1XJOA

Structure of aminopeptidase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
277
structure length
270
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE
publication title Streptomyces griseus aminopeptidase: X-ray crystallographic structure at 1.75 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 101
structure length 270
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 1996-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1xjoA00
4R8FA 3WABA 3VARA 2PJCA 2QJ8A 1ZLHA 5K8OA 3KHXA 4FAIA 5LRKA 4A37A 2NYQA 1NSAA 3KHZA 1Z5RA 2BO9A 1H8LA 1XRYA 4MHZA 4PQAA 1HEEA 3H8EA 2DEAA 2Q43A 2ZEMA 1CBXA 1ARMA 3NH4A 3SI2A 4NGQA 2PJ3A 3DGVA 5K8MA 3FVLA 3PEIA 2F8HA 2ZEDA 1PCAA 2F7VA 3GB0A 5THWA 3I1UA 2PJ5A 3KR5A 2PE3A 1HDQA 4NGSA 3FJUA 1QQ9A 2ZEGA 3D7HA 3PB6X 2GREA 1IGBA 1ZG8A 5JH9A 3V38A 2IMOA 5J1QA 3WC7A 1YMEA 3NH5A 2PVVA 3QNVA 2CF4A 1XBUA 2CIJA 3N5FA 2JBJA 1GYTA 1XFOA 3GLJA 1TF9A 2ZEHA 4YU9A 1PYTB 3BI0A 3IIBA 1VGYA 5HXDA 1TKJA 3VH9A 3ISXA 5D8NA 7CPAA 1FNOA 2JBKA 1Y0YA 3PB4X 5JGFA 4P4JA 1CX8A 3PFEA 2BOAA 3FF3A 3CPXA 5DS0A 2AFXA 4Z65A 4MMOA 1Y7EA 4WWVA 2HB6A 3PBEA 1Z8LA 1VHOA 4UF4A 3KZWA 4F9VA 4P10A 1FT7A 3VATA 3FH4A 3S9MA 2GU2A 2ZEFA 2C6CA 4ZX9A 3SJGA 2IJZA 4ZY1A 2PIYA 2G9DA 3PRTA 1YW6A 1ZG9A 4NFRA 4MCSA 3FMCA 4P4EA 2EK9A 6CPAA 2Q51A 1Y0RA 2BCOA 1UWYA 1Q7LA 1TXRA 1JQGA 3IFEA 1HDUA 2ZEOA 4EFDA 3D7DA 2AFOA 3D4UA 4Q7AA 2AFWA 3KL9A 3CDXA 3JRUA 4PXDA 4GM5A 4NGTA 1ELMP 4P45A 4OKOA 4OC4A 5K8PA 1AMPA 5LYIA 4KSIA 3PBBA 1F57A 4NJQA 2RFHA 2ZEEA 1BPMA 3B7IA 1CP7A 4WJBA 3K2KA 4ZI6A 1R43A 3WT4A 5LYDA 3NH8A 4ZX8A 2GLFA 4OC2A 3PB9X 3TC8A 3IWWA 2ABZA 2PJ1A 2WYRA 5LRGA 4P6YA 4A94A 3SJEA 3K9TA 4P4IA 3KI9A 4MHNA 4R76A 3RAMA 3IJ3A 1CP6A 4NGPA 2OOTA 3HUVA 4P4FA 2VL1A 3MN8A 1KWMA 2PJAA 3FECA 4PPZA 4PXCA 2GLJA 4DUKA 3FEEA 4MCRA 1F2PA 3D67A 2PJ7A 1LCPA 2EWBA 3SJFA 4TNUA 4F8ZA 1XJOA 3PB7X 2ZOFA 2V8DA 2EK8A 4UEFA 2O4HA 3T8WA 4ZY0A 4UEZA 3S9LA 3PB8X 4JZ0A 5LYLA 2NSMA 4NGRA 4MXUA 4ZYQA 5F09A 2PCUA 4P4DA 3B35A 3KGQA 3LMSA 3HLPA 1AYEA 4MHPA 2XEJA 3D7GA 4CPAA 3KR4A 5D29A 1VIXA 3ISZA 4MRIA 4MCQA 2ZELA 3B3WA 5CBMA 4UEEA 4R6TA 2Q4ZA 4OC3A 4MHYA 4YWYA 4W9YA 3B3VA 3NFZA 3BXMA 2V8VA 4JYWA 3BI1A 4DYOA 4IHMA 4OMEA 1ZG7A 2AFZA 2CTCA 3V7ZA 1CG2A 4TWEA 4X3RA 1IY7A 4IK2A 2ANPA 3RZAA 3H8GA 2CTBA 4H2KA 4OC0A 4F9UA 3D7FA 2JEWA 1YSJA 4OC5A 3IC1A 3SI0A 3D66A 2ZEPA 4O23A 2PJ0A 2J9AA 3CPAA 1LOKA 8CPAA 1EE3P 3D68A 2AFMA 3IEHA 2HC9A 2XEGA 4OIWA 5JM6A 5K8NA 4BD9A 3LWUA 5LYFA 2QYVA 4K3NA 4PXEA 1TKHA 2ZOGA 3S9NA 4EMEA 1QMUA 3TX8A 2PJ9A 4A38A 4UIBA 2POKA 2PVWA 3H8FA 1XMBA 4OIDA 2OR4A 1BLLE 4MCPA 1YW4A 2V77A 5HVFA 3MRUA 2PJ6A 3B3CA 3BHXA 4A39A 4PXBA 1DE4C 2WZNA 3KQZA 3KQXA 1VHEA 4UIAA 2I3CA 2V8HA 1F2OA 3CT9A 4DJLA 4X2TA 4IAVA 1BAVA 1RTQA 3SI1A 1R3NA 4P4BA 4EWTA 3FEDA 1DTDA 4R7MA 3WC5A 3B3TA 1M4LA 4P44A 1TKFA 1Z2LA 2PJBA 4RUHA 3GUXA 2RB7A 4ZY2A 4LQGA 3WC6A 4FUUA 5CPAA 1CPXA 4OC1A 2O53A 5LRJA 5HVGA 5ELYA 4FWUA 1CPSA 1LAPA 3KASA 2PJ2A 4AXVA 1LAMA 1OBRA 3PFOA 2AFSA 4G1PA 2C1CA 4NGNA 2XEIA 1YLOA 2PIZA 4B6ZA 3L2NA 1LANA 2FVGA 1BPNA 1ZLIA 2PJ4A 2QVPA 4OP4A 3NA6A 3RBUA 1ELLP 4ONWA 4NGMA 1LFWA 1ARLA 2PJ8A 2IQ6A 4X8IA 3IO1A 3DLJA 4NJRA 2V8GA 2C6GA 2PRQA 3SJXA 2C6PA 2AFUA 5I4MA 5IB9A 3FX6A 4FBEA 5HVHA 1TF8A 2XEFA 2ZENA 3B2YA 3B3SA
chains in the Genus database with same CATH superfamily
4R8FA 4B12A 1BOBA 3WABA 3VARA 1YK3A 4H6ZA 2PJCA 2O28A 4UCNA 2QJ8A 1ZLHA 1VHSA 4UWJA 1MJBA 3TO7A 4E0AA 5K8OA 4M6IA 4U9YA 3KHXA 4FAIA 1QSTA 3GIUA 4AB7A 5EBVA 2B4DB 5LRKA 2JEVA 2PDOA 4A37A 3TO9A 2NYQA 1NSAA 3MGDA 4HNXB 3KHZA 5C88A 1Z5RA 2BO9A 2HUZA 3QAHA 5E96A 4UWIA 5G20A 5H84A 1H8LA 4CGPA 1S3ZA 1XRYA 4MHZA 2PR1A 1YR0A 4PQAA 1HEEA 2X7BA 3H8EA 1NE9A 4FD7A 1Z4RA 2DEAA 2Q43A 2G3TA 1CBXA 1ARMA 2R1IA 2ZEMA 3NH4A 4KUAA 3SI2A 2R98A 4NGQA 4KOVA 1KZFA 2PJ3A 1S7FA 3DGVA 4QC6A 5K8MA 4BBHA 4A33A 4B5OA 2ZW7A 3FVLA 1NSLA 3PEIA 1IYKA 4AVBA 1Z8WA 2VZZA 4I49A 2F8HA 3EFAA 2Z3PA 2ZEDA 3JTKA 1PCAA 2F7VA 4MJ8A 1Y9KA 2PQ8A 3GB0A 2Q44A 1XMTA 2Q4YA 5THWA 3I1UA 1S5KA 1ZO0A 2PJ5A 4R3KA 4R87A 3KR5A 4CYQA 2D4PA 5AG4A 2OU2A 2PE3A 1HDQA 4C2YA 3H4QA 4NGSA 2CNTA 2D4OA 2FT0A 3FJUA 2J8RA 3F0AA 5F46A 1QQ9A 3D2MA 3B2YA 2ZEGA 3D7HA 4C7HA 3QB8A 3PB6X 4CGOA 2GREA 1IGBA 1ZG8A 5JH9A 1X10A 3V38A 4HNYB 5AG6A 4MBUA 2REFA 1UFHA 2IMOA 3S6HA 5J1QA 3JVNA 2FIWA 3D2PA 3SHPA 1Z9UA 3WC7A 3A9LA 2ZW5A 3F5BA 1YMEA 4CRZB 3NH5A 2PVVA 3QNVA 3TOAA 2CF4A 1XBUA 2CIJA 3N5FA 4KVME 3S6KA 4YGOA 4GXHA 4E8OA 5JQ4A 4XNHC 2JBJA 1GYTA 1XFOA 3N7ZA 4H6UA 4RS2A 3GLJA 3LD2A 4XPKA 1M44A 1TF9A 3RNZA 1IOFA 3TCVA 4JLYA 2ZEHA 4XPLA 4YU9A 5JPHA 5AG5A 4B11A 4OADA 2WSAA 1PYTB 2Q4VA 1PU9A 3PGPA 4U5YA 3BI0A 3IIBA 4UCPA 1VGYA 2Q7BA 5HXDA 1TKJA 4JJXA 3ISXA 5D8NA 3VH9A 7CPAA 1FNOA 2JBKA 4A2ZA 2Z10A 1Y0YA 3WR7A 5A27A 3PB4X 4ZGYB 4L8AA 3D3SA 2OZGA 5JGFA 4P4JA 1CX8A 3PFEA 4BMHA 2BOAA 3FF3A 3CPXA 2ZPAA 3SXNA 5DS0A 4QB9A 1QSNA 2AFXA 1YVOA 3B3SA 4Z65A 3NE7A 4C2ZA 4MMOA 1Y7EA 4WWVA 2HB6A 3PBEA 1Z8LA 3BJ8A 1VHOA 4UF4A 3KZWA 3W6XA 4F9VA 4KOWA 1YX0A 2BSWA 4P10A 4RI1A 1FT7A 1Z8TA 4KOSA 4KVXA 3VATA 3FB3A 4FD4A 3FH4A 4H89A 3S9MA 3TTHA 4BINA 2P6EA 2GU2A 2ZEFA 2C6CA 2BL1A 2K5TA 2IJZA 2G0BA 3CXSA 3FNCA 4ZX9A 2PIYA 3SJGA 4C68A 4ZY1A 2G9DA 4NF1A 4ONUA 1M4IA 3PRTA 2Q0YA 3FYNA 4F0XA 2FXFA 1YW6A 1ZG9A 4ZBGA 4NFRA 2AE6A 2FS5A 4MCSA 3FMCA 4P4EA 2B5GB 2EK9A 4CAFA 6CPAA 2Q51A 1Y0RA 4NSQA 1PUAA 4IUSA 2BCOA 1UWYA 1Q7LA 1TXRA 1JQGA 1RXTA 3IFEA 1HDUA 2ZEOA 4CAWA 4EFDA 4DNCA 3D7DA 4UFXA 2AFOA 3W91A 3D4UA 4F6AA 2P6GA 3R1KA 2YNCC 4Q7AA 2GFQA 2AFWA 2VEZA 2KCWA 3KL9A 2B4DA 1L0CA 2G3AA 4B14A 3CDXA 4R9MA 3JRUA 3TOBA 4UBRA 4CYNA 5KTCA 4PXDA 1S60A 4EVYA 5G22A 4GM5A 4YFJA 3IWEA 3PZJA 4NGTA 1ELMP 4HPSA 4P45A 4OKOA 4OC4A 5F47A 1S7NA 5K8PA 4XPDC 1AMPA 4UA3A 3DR6A 3B8GA 5LYIA 4KOUA 1IICA 4KSIA 5EMIA 3R9GA 5BWAB 5IV0A 3PBBA 2VXKA 5H86A 2Z3MA 1F57A 1I21A 4NJQA 2PR8A 2RFHA 2ZEEA 4E2AA 1OZPA 1BPMA 4NCZA 3B7IA 1CP7A 4U9ZA 5AGEA 4A31A 4WJBA 3K2KA 5F48A 2QIRA 1MJ9A 4ZI6A 1R43A 1Q2YA 1P4NA 2DPSA 3WT4A 4C7IA 3EO4A 5LYDA 4CYOA 4M3SA 3NH8A 4ZX8A 2GLFA 2PRBA 3SXOA 4OC2A 3PB9X 2BUEA 3TC8A 2RC4A 2Z3LA 3IWWA 4KLWA 1B87A 4MFLA 1IOIA 4FD6A 1A2ZA 2ABZA 2PJ1A 3RO0A 2WYRA 3QAYA 5LRGA 2DXQA 1GHEA 4P6YA 4A94A 3UY5A 3SJEA 3S6GA 4CAEA 2CNMA 3EC4A 2FIAA 3K9TA 4M6HA 3H5ZA 2B3UA 3KI9A 4P4IA 4YRHA 3IU2A 4MHNA 4KS9A 4MFQA 4R3LA 3F8KA 4R76A 3RAMA 2NMTA 3TO6A 2FE7A 1CP6A 3IJ3A 4NGPA 2IL4A 2OOTA 3HUVA 4P4FA 4NEXA 1R57A 2VL1A 2DPTA 2JLMA 4KUBA 2ZXVA 5FVJA 3MN8A 1Q2CA 2FCKA 4XNHB 1KWMA 2PJAA 3FECA 2ODFA 1Z4EA 4AVAA 4PPZA 4PXCA 2GLJA 3IU1A 4DUKA 3FEEA 4MCRA 3S6FA 3V8IA 1F2PA 2ATRA 3D67A 2PJ7A 4JXRA 2YGWA 1XE4A 1IIDA 2ZW6A 1XEBA 1LCPA 4GS4A 5AG7A 2EWBA 3SJFA 4TNUA 4F8ZA 4MFJA 2OH1A 1XJOA 3PB7X 2ZOFA 4X5KA 4CYPA 4F0YA 3R95A 2V8DA 4Y49C 2EK8A 3FXTA 4UEFA 2O4HA 1Q2DA 1M4DA 1WK4A 2GIVA 1NMTA 3LACA 5G21A 5CNPA 3T8WA 4ZY0A 4UEZA 3S9LA 3PB8X 3P2HA 1RO5A 4JZ0A 1YGHA 4KVOE 3ZZIA 3T9YA 5LYLA 2NSMA 4Q36A 2VQYA 3I9SA 4NGRA 4MXUA 4ZYQA 5F09A 2PCUA 1KUVA 2OZHA 4P4DA 3FBUA 2REEA 3B35A 3KGQA 3LMSA 1QSRA 1AYEA 3HLPA 4KLVA 4MHPA 5ISVA 2I00A 2XEJA 3C26A 1V0CA 3D7GA 4CPAA 3KR4A 2Z3NA 3DDDA 5D29A 1VIXA 3EY5A 1VKCA 3ISZA 3LODA 4MRIA 4MCQA 4UFVA 4J3GA 2ZELA 1U6MA 3B3WA 5CBMA 2JDCA 2WUUA 1Y7RA 4CGLA 4MFZA 4UEEA 4R6TA 2Q4ZA 4OC3A 1BO4A 4B5PB 4MHDA 4MHYA 3R96A 5I0CA 1CJWA 5KTDA 2PSWA 1S7KA 1WWZA 2YNEA 5EC4A 4YWYA 2EO8A 4W9YA 3B3VA 4MY0A 2HQYA 3NFZA 3BXMA 2V8VA 2J8NA 4M85A 4JYWA 3BI1A 2PC1A 4DYOA 5G1ZA 4IHMA 4OMEA 1ZG7A 2AFZA 2CTCA 4KSAA 3V7ZA 3GYAA 4B13A 1CG2A 4TWEA 4X3RA 3CZXA 5DWMA 1IY7A 4IK2A 2ANPA 2B58A 2Z3KA 3H8GA 4LUAA 3RZAA 1MJAA 2CTBA 4H2KA 4UFWA 4OC0A 4F9UA 3TT2A 3D7FA 3RYOA 1SQHA 4JWPA 2B5GA 1YSJA 2JEWA 4OC5A 3IC1A 3SI0A 3D66A 1YREA 4KSFA 5A28A 2ZEPA 3FRMA 4O23A 2PJ0A 2J9AA 2VBQA 3CPAA 3IGRA 4MI4A 1KUYA 1LOKA 3G8WA 3KKWA 1B6BA 4PSWA 2QMLA 4XPDB 8CPAA 1P0HA 1EE3P 2EUIA 3D68A 4HKFA 2Z3OA 5J8CA 2R8VA 4MY3A 2AFMA 2Z11A 4QBJA 3IEHA 1X12A 2HC9A 2XEGA 4K30A 4OIWA 5JM6A 5K8NA 4BD9A 2OB0A 5IB0A 1KUXA 3LWUA 2OZUA 2ZW4A 5LYFA 1YQEA 2QYVA 3P2FA 4II9A 3JUWA 1TIQA 4K3NA 3G3SA 4PXEA 2Q7SA 1M4GA 4M6GA 3DSBA 3TFYA 2Q04A 1TKHA 2ZOGA 3S9NA 2CXAA 4EMEA 1XF8A 1I1DA 1QMUA 4CS0B 3TX8A 2PJ9A 2CNSA 4AVCA 4A38A 4UIBA 1IB1E 2POKA 2PVWA 3H8FA 1XMBA 3T90A 2JDDA 4OIDA 4A95A 2OR4A 1N71A 4KOYA 3R9EA 2GANA 3CXPA 1BLLE 4CAVA 4LQ6A 2AJ6A 4MCPA 4RN7A 1YW4A 2V77A 4AG9A 2VZYA 5HVFA 2QECA 3MRUA 2PJ6A 3B3CA 4KZTA 3BHXA 3ZJ0A 2YNDA 2R7HA 3TE4A 2H5MA 1FY7A 4QVTA 5HMNA 3EXNA 4A39A 3E0KA 4PXBA 1IU8A 1DE4C 3FIXA 4CGMA 2WZNA 2F5IA 3KQZA 2B3VA 1VHEA 3KQXA 4UIAA 4KORA 2I3CA 3W6SA 2V8HA 4CRYB 1F2OA 3CT9A 4DJLA 4PK2A 3VWDA 4X2TA 4IAVA 1BAVA 4ORFA 3R9FA 1RTQA 3CXQA 3SI1A 1R3NA 4OAEA 4P4BA 1XIXA 4EWTA 5C82A 5GCNA 3FEDA 2BEIA 4Y49B 4OLLA 4QUSA 1DTDA 4R7MA 3K9UA 3B3TA 2C27A 4PK3A 3WC5A 1M1DA 4MFPA 2J8MA 1M4LA 4FD5A 4P44A 5HH1A 1J4JA 4UCMA 2WPXA 1TKFA 4Q38A 1XOVA 1QSOA 1Z2LA 2I79A 4NXYA 1Z8XA 2FSRA 2PJBA 4RUHA 3GUXA 1YVKA 2B4BA 2RB7A 5DWNA 4LQGA 4ZY2A 3WC6A 4FUUA 1S7LA 5CPAA 4JXQA 1CPXA 1MK4A 4OC1A 4PSXA 2O53A 1I12A 2DF5A 2EBJA 2FL4A 2P0WA 4MFKA 4R57A 5LRJA 1IYLA 1LRZA 5HVGA 5ELYA 4FWUA 2GE3A 1CPSA 1ON0A 1LAPA 3D8PA 2PJ2A 3KASA 4AXVA 1LAMA 4CAXA 1OBRA 3PFOA 1JWQA 1CM0A 3NE8A 5IX3A 2AFSA 4C2XA 4LX9A 4G1PA 2C1CA 4NGNA 2XEIA 5J8FA 1YLOA 2PIZA 2Z0ZA 3OWCA 1YLEA 5KTAA 4B6ZA 3GY9A 3L2NA 4KOTA 1LANA 2FVGA 1BPNA 4L89A 1ZLIA 2PJ4A 5F49A 3BLNA 4B5PA 2QVPA 4OP4A 3NA6A 3GKRA 3RBUA 4A32A 2CY2A 1ELLP 4ONWA 4NGMA 1LFWA 1ARLA 4AG7A 2PJ8A 2IQ6A 4PV6A 4X8IA 2ARHA 1QSMA 2WPWA 3DNSA 3IO1A 2A4NA 3DLJA 4NJRA 2V8GA 3PP9A 3I3GA 4KOXA 2C6GA 3VWEA 2P6FA 4HNWB 3BJ7A 2EVNA 3DR8A 2PRQA 3SJXA 4CGNA 2C6PA 2AFUA 2YNCA 5I4MA 1K4JA 5IB9A 3IWGA 3FX6A 4FBEA 4IF5A 1AUGA 4JD6A 4B10A 2VI7A 5HVHA 1TF8A 4A30A 2XEFA 2ZENA 2Y0MA 2HV2A 1Y9WA
chains in the Genus database with same CATH topology
4R8FA 3WABA 3VARA 2PJCA 2QJ8A 1ZLHA 5K8OA 3KHXA 4FAIA 5LRKA 4A37A 2NYQA 1NSAA 3KHZA 1Z5RA 2BO9A 1H8LA 1XRYA 4MHZA 4PQAA 1HEEA 3H8EA 2DEAA 2Q43A 2ZEMA 1CBXA 1ARMA 3NH4A 3SI2A 4NGQA 2PJ3A 3DGVA 5K8MA 3FVLA 3PEIA 2F8HA 2ZEDA 1PCAA 2F7VA 3GB0A 5THWA 3I1UA 2PJ5A 3KR5A 2PE3A 1HDQA 4NGSA 3FJUA 1QQ9A 2ZEGA 3D7HA 3PB6X 2GREA 1IGBA 1ZG8A 5JH9A 3V38A 2IMOA 5J1QA 3WC7A 1YMEA 3NH5A 2PVVA 3QNVA 2CF4A 1XBUA 2CIJA 3N5FA 2JBJA 1GYTA 1XFOA 3GLJA 1TF9A 2ZEHA 4YU9A 1PYTB 3BI0A 3IIBA 1VGYA 5HXDA 1TKJA 3VH9A 3ISXA 5D8NA 7CPAA 1FNOA 2JBKA 1Y0YA 3PB4X 5JGFA 4P4JA 1CX8A 3PFEA 2BOAA 3FF3A 3CPXA 5DS0A 2AFXA 4Z65A 4MMOA 1Y7EA 4WWVA 2HB6A 3PBEA 1Z8LA 1VHOA 4UF4A 3KZWA 4F9VA 4P10A 1FT7A 3VATA 3FH4A 3S9MA 2GU2A 2ZEFA 2C6CA 4ZX9A 3SJGA 2IJZA 4ZY1A 2PIYA 2G9DA 3PRTA 1YW6A 1ZG9A 4NFRA 4MCSA 3FMCA 4P4EA 2EK9A 6CPAA 2Q51A 1Y0RA 2BCOA 1UWYA 1Q7LA 1TXRA 1JQGA 3IFEA 1HDUA 2ZEOA 4EFDA 3D7DA 2AFOA 3D4UA 4Q7AA 2AFWA 3KL9A 3CDXA 3JRUA 4PXDA 4GM5A 4NGTA 1ELMP 4P45A 4OKOA 4OC4A 5K8PA 1AMPA 5LYIA 4KSIA 3PBBA 1F57A 4NJQA 2RFHA 2ZEEA 1BPMA 3B7IA 1CP7A 4WJBA 3K2KA 4ZI6A 1R43A 3WT4A 5LYDA 3NH8A 4ZX8A 2GLFA 4OC2A 3PB9X 3TC8A 3IWWA 2ABZA 2PJ1A 2WYRA 5LRGA 4P6YA 4A94A 3SJEA 3K9TA 4P4IA 3KI9A 4MHNA 4R76A 3RAMA 3IJ3A 1CP6A 4NGPA 2OOTA 3HUVA 4P4FA 2VL1A 3MN8A 1KWMA 2PJAA 3FECA 4PPZA 4PXCA 2GLJA 4DUKA 3FEEA 4MCRA 1F2PA 3D67A 2PJ7A 1LCPA 2EWBA 3SJFA 4TNUA 4F8ZA 1XJOA 3PB7X 2ZOFA 2V8DA 2EK8A 4UEFA 2O4HA 3T8WA 4ZY0A 4UEZA 3S9LA 3PB8X 4JZ0A 5LYLA 2NSMA 4NGRA 4MXUA 4ZYQA 5F09A 2PCUA 4P4DA 3B35A 3KGQA 3LMSA 3HLPA 1AYEA 4MHPA 2XEJA 3D7GA 4CPAA 3KR4A 5D29A 1VIXA 3ISZA 4MRIA 4MCQA 2ZELA 3B3WA 5CBMA 4UEEA 4R6TA 2Q4ZA 4OC3A 4MHYA 4YWYA 4W9YA 3B3VA 3NFZA 3BXMA 2V8VA 4JYWA 3BI1A 4DYOA 4IHMA 4OMEA 1ZG7A 2AFZA 2CTCA 3V7ZA 1CG2A 4TWEA 4X3RA 1IY7A 4IK2A 2ANPA 3RZAA 3H8GA 2CTBA 4H2KA 4OC0A 4F9UA 3D7FA 2JEWA 1YSJA 4OC5A 3IC1A 3SI0A 3D66A 2ZEPA 4O23A 2PJ0A 2J9AA 3CPAA 1LOKA 8CPAA 1EE3P 3D68A 2AFMA 3IEHA 2HC9A 2XEGA 4OIWA 5JM6A 5K8NA 4BD9A 3LWUA 5LYFA 2QYVA 4K3NA 4PXEA 1TKHA 2ZOGA 3S9NA 4EMEA 1QMUA 3TX8A 2PJ9A 4A38A 4UIBA 2POKA 2PVWA 3H8FA 1XMBA 4OIDA 2OR4A 1BLLE 4MCPA 1YW4A 2V77A 5HVFA 3MRUA 2PJ6A 3B3CA 3BHXA 4A39A 4PXBA 1DE4C 2WZNA 3KQZA 3KQXA 1VHEA 4UIAA 2I3CA 2V8HA 1F2OA 3CT9A 4DJLA 4X2TA 4IAVA 1BAVA 1RTQA 3SI1A 1R3NA 4P4BA 4EWTA 3FEDA 1DTDA 4R7MA 3WC5A 3B3TA 1M4LA 4P44A 1TKFA 1Z2LA 2PJBA 4RUHA 3GUXA 2RB7A 4ZY2A 4LQGA 3WC6A 4FUUA 5CPAA 1CPXA 4OC1A 2O53A 5LRJA 5HVGA 5ELYA 4FWUA 1CPSA 1LAPA 3KASA 2PJ2A 4AXVA 1LAMA 1OBRA 3PFOA 2AFSA 4G1PA 2C1CA 4NGNA 2XEIA 1YLOA 2PIZA 4B6ZA 3L2NA 1LANA 2FVGA 1BPNA 1ZLIA 2PJ4A 2QVPA 4OP4A 3NA6A 3RBUA 1ELLP 4ONWA 4NGMA 1LFWA 1ARLA 2PJ8A 2IQ6A 4X8IA 3IO1A 3DLJA 4NJRA 2V8GA 2C6GA 2PRQA 3SJXA 2C6PA 2AFUA 5I4MA 5IB9A 3FX6A 4FBEA 5HVHA 1TF8A 2XEFA 2ZENA 3B2YA 3B3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R8F A;  3WAB A;  3VAR A;  2PJC A;  2QJ8 A;  1ZLH A;  5K8O A;  3KHX A;  4FAI A;  5LRK A;  4A37 A;  2NYQ A;  1NSA A;  3KHZ A;  1Z5R A;  2BO9 A;  1H8L A;  1XRY A;  4MHZ A;  4PQA A;  1HEE A;  3H8E A;  2DEA A;  2Q43 A;  2ZEM A;  1CBX A;  1ARM A;  3NH4 A;  3SI2 A;  4NGQ A;  2PJ3 A;  3DGV A;  5K8M A;  3FVL A;  3PEI A;  2F8H A;  2ZED A;  1PCA A;  2F7V A;  3GB0 A;  5THW A;  3I1U A;  2PJ5 A;  3KR5 A;  2PE3 A;  1HDQ A;  4NGS A;  3FJU A;  1QQ9 A;  2ZEG A;  3D7H A;  3PB6 X;  2GRE A;  1IGB A;  1ZG8 A;  5JH9 A;  3V38 A;  2IMO A;  5J1Q A;  3WC7 A;  1YME A;  3NH5 A;  2PVV A;  3QNV A;  2CF4 A;  1XBU A;  2CIJ A;  3N5F A;  2JBJ A;  1GYT A;  1XFO A;  3GLJ A;  1TF9 A;  2ZEH A;  4YU9 A;  1PYT B;  3BI0 A;  3IIB A;  1VGY A;  5HXD A;  1TKJ A;  3VH9 A;  3ISX A;  5D8N A;  7CPA A;  1FNO A;  2JBK A;  1Y0Y A;  3PB4 X;  5JGF A;  4P4J A;  1CX8 A;  3PFE A;  2BOA A;  3FF3 A;  3CPX A;  5DS0 A;  2AFX A;  4Z65 A;  4MMO A;  1Y7E A;  4WWV A;  2HB6 A;  3PBE A;  1Z8L A;  1VHO A;  4UF4 A;  3KZW A;  4F9V A;  4P10 A;  1FT7 A;  3VAT A;  3FH4 A;  3S9M A;  2GU2 A;  2ZEF A;  2C6C A;  4ZX9 A;  3SJG A;  2IJZ A;  4ZY1 A;  2PIY A;  2G9D A;  3PRT A;  1YW6 A;  1ZG9 A;  4NFR A;  4MCS A;  3FMC A;  4P4E A;  2EK9 A;  6CPA A;  2Q51 A;  1Y0R A;  2BCO A;  1UWY A;  1Q7L A;  1TXR A;  1JQG A;  3IFE A;  1HDU A;  2ZEO A;  4EFD A;  3D7D A;  2AFO A;  3D4U A;  4Q7A A;  2AFW A;  3KL9 A;  3CDX A;  3JRU A;  4PXD A;  4GM5 A;  4NGT A;  1ELM P;  4P45 A;  4OKO A;  4OC4 A;  5K8P A;  1AMP A;  5LYI A;  4KSI A;  3PBB A;  1F57 A;  4NJQ A;  2RFH A;  2ZEE A;  1BPM A;  3B7I A;  1CP7 A;  4WJB A;  3K2K A;  4ZI6 A;  1R43 A;  3WT4 A;  5LYD A;  3NH8 A;  4ZX8 A;  2GLF A;  4OC2 A;  3PB9 X;  3TC8 A;  3IWW A;  2ABZ A;  2PJ1 A;  2WYR A;  5LRG A;  4P6Y A;  4A94 A;  3SJE A;  3K9T A;  4P4I A;  3KI9 A;  4MHN A;  4R76 A;  3RAM A;  3IJ3 A;  1CP6 A;  4NGP A;  2OOT A;  3HUV A;  4P4F A;  2VL1 A;  3MN8 A;  1KWM A;  2PJA A;  3FEC A;  4PPZ A;  4PXC A;  2GLJ A;  4DUK A;  3FEE A;  4MCR A;  1F2P A;  3D67 A;  2PJ7 A;  1LCP A;  2EWB A;  3SJF A;  4TNU A;  4F8Z A;  1XJO A;  3PB7 X;  2ZOF A;  2V8D A;  2EK8 A;  4UEF A;  2O4H A;  3T8W A;  4ZY0 A;  4UEZ A;  3S9L A;  3PB8 X;  4JZ0 A;  5LYL A;  2NSM A;  4NGR A;  4MXU A;  4ZYQ A;  5F09 A;  2PCU A;  4P4D A;  3B35 A;  3KGQ A;  3LMS A;  3HLP A;  1AYE A;  4MHP A;  2XEJ A;  3D7G A;  4CPA A;  3KR4 A;  5D29 A;  1VIX A;  3ISZ A;  4MRI A;  4MCQ A;  2ZEL A;  3B3W A;  5CBM A;  4UEE A;  4R6T A;  2Q4Z A;  4OC3 A;  4MHY A;  4YWY A;  4W9Y A;  3B3V A;  3NFZ A;  3BXM A;  2V8V A;  4JYW A;  3BI1 A;  4DYO A;  4IHM A;  4OME A;  1ZG7 A;  2AFZ A;  2CTC A;  3V7Z A;  1CG2 A;  4TWE A;  4X3R A;  1IY7 A;  4IK2 A;  2ANP A;  3RZA A;  3H8G A;  2CTB A;  4H2K A;  4OC0 A;  4F9U A;  3D7F A;  2JEW A;  1YSJ A;  4OC5 A;  3IC1 A;  3SI0 A;  3D66 A;  2ZEP A;  4O23 A;  2PJ0 A;  2J9A A;  3CPA A;  1LOK A;  8CPA A;  1EE3 P;  3D68 A;  2AFM A;  3IEH A;  2HC9 A;  2XEG A;  4OIW A;  5JM6 A;  5K8N A;  4BD9 A;  3LWU A;  5LYF A;  2QYV A;  4K3N A;  4PXE A;  1TKH A;  2ZOG A;  3S9N A;  4EME A;  1QMU A;  3TX8 A;  2PJ9 A;  4A38 A;  4UIB A;  2POK A;  2PVW A;  3H8F A;  1XMB A;  4OID A;  2OR4 A;  1BLL E;  4MCP A;  1YW4 A;  2V77 A;  5HVF A;  3MRU A;  2PJ6 A;  3B3C A;  3BHX A;  4A39 A;  4PXB A;  1DE4 C;  2WZN A;  3KQZ A;  3KQX A;  1VHE A;  4UIA A;  2I3C A;  2V8H A;  1F2O A;  3CT9 A;  4DJL A;  4X2T A;  4IAV A;  1BAV A;  1RTQ A;  3SI1 A;  1R3N A;  4P4B A;  4EWT A;  3FED A;  1DTD A;  4R7M A;  3WC5 A;  3B3T A;  1M4L A;  4P44 A;  1TKF A;  1Z2L A;  2PJB A;  4RUH A;  3GUX A;  2RB7 A;  4ZY2 A;  4LQG A;  3WC6 A;  4FUU A;  5CPA A;  1CPX A;  4OC1 A;  2O53 A;  5LRJ A;  5HVG A;  5ELY A;  4FWU A;  1CPS A;  1LAP A;  3KAS A;  2PJ2 A;  4AXV A;  1LAM A;  1OBR A;  3PFO A;  2AFS A;  4G1P A;  2C1C A;  4NGN A;  2XEI A;  1YLO A;  2PIZ A;  4B6Z A;  3L2N A;  1LAN A;  2FVG A;  1BPN A;  1ZLI A;  2PJ4 A;  2QVP A;  4OP4 A;  3NA6 A;  3RBU A;  1ELL P;  4ONW A;  4NGM A;  1LFW A;  1ARL A;  2PJ8 A;  2IQ6 A;  4X8I A;  3IO1 A;  3DLJ A;  4NJR A;  2V8G A;  2C6G A;  2PRQ A;  3SJX A;  2C6P A;  2AFU A;  5I4M A;  5IB9 A;  3FX6 A;  4FBE A;  5HVH A;  1TF8 A;  2XEF A;  2ZEN A;  3B2Y A;  3B3S A; 
#chains in the Genus database with same CATH topology
 4R8F A;  4B12 A;  1BOB A;  3WAB A;  3VAR A;  1YK3 A;  4H6Z A;  2PJC A;  2O28 A;  4UCN A;  2QJ8 A;  1ZLH A;  1VHS A;  4UWJ A;  1MJB A;  3TO7 A;  4E0A A;  5K8O A;  4M6I A;  4U9Y A;  3KHX A;  4FAI A;  1QST A;  3GIU A;  4AB7 A;  5EBV A;  2B4D B;  5LRK A;  2JEV A;  2PDO A;  4A37 A;  3TO9 A;  2NYQ A;  1NSA A;  3MGD A;  4HNX B;  3KHZ A;  5C88 A;  1Z5R A;  2BO9 A;  2HUZ A;  3QAH A;  5E96 A;  4UWI A;  5G20 A;  5H84 A;  1H8L A;  4CGP A;  1S3Z A;  1XRY A;  4MHZ A;  2PR1 A;  1YR0 A;  4PQA A;  1HEE A;  2X7B A;  3H8E A;  1NE9 A;  4FD7 A;  1Z4R A;  2DEA A;  2Q43 A;  2G3T A;  1CBX A;  1ARM A;  2R1I A;  2ZEM A;  3NH4 A;  4KUA A;  3SI2 A;  2R98 A;  4NGQ A;  4KOV A;  1KZF A;  2PJ3 A;  1S7F A;  3DGV A;  4QC6 A;  5K8M A;  4BBH A;  4A33 A;  4B5O A;  2ZW7 A;  3FVL A;  1NSL A;  3PEI A;  1IYK A;  4AVB A;  1Z8W A;  2VZZ A;  4I49 A;  2F8H A;  3EFA A;  2Z3P A;  2ZED A;  3JTK A;  1PCA A;  2F7V A;  4MJ8 A;  1Y9K A;  2PQ8 A;  3GB0 A;  2Q44 A;  1XMT A;  2Q4Y A;  5THW A;  3I1U A;  1S5K A;  1ZO0 A;  2PJ5 A;  4R3K A;  4R87 A;  3KR5 A;  4CYQ A;  2D4P A;  5AG4 A;  2OU2 A;  2PE3 A;  1HDQ A;  4C2Y A;  3H4Q A;  4NGS A;  2CNT A;  2D4O A;  2FT0 A;  3FJU A;  2J8R A;  3F0A A;  5F46 A;  1QQ9 A;  3D2M A;  3B2Y A;  2ZEG A;  3D7H A;  4C7H A;  3QB8 A;  3PB6 X;  4CGO A;  2GRE A;  1IGB A;  1ZG8 A;  5JH9 A;  1X10 A;  3V38 A;  4HNY B;  5AG6 A;  4MBU A;  2REF A;  1UFH A;  2IMO A;  3S6H A;  5J1Q A;  3JVN A;  2FIW A;  3D2P A;  3SHP A;  1Z9U A;  3WC7 A;  3A9L A;  2ZW5 A;  3F5B A;  1YME A;  4CRZ B;  3NH5 A;  2PVV A;  3QNV A;  3TOA A;  2CF4 A;  1XBU A;  2CIJ A;  3N5F A;  4KVM E;  3S6K A;  4YGO A;  4GXH A;  4E8O A;  5JQ4 A;  4XNH C;  2JBJ A;  1GYT A;  1XFO A;  3N7Z A;  4H6U A;  4RS2 A;  3GLJ A;  3LD2 A;  4XPK A;  1M44 A;  1TF9 A;  3RNZ A;  1IOF A;  3TCV A;  4JLY A;  2ZEH A;  4XPL A;  4YU9 A;  5JPH A;  5AG5 A;  4B11 A;  4OAD A;  2WSA A;  1PYT B;  2Q4V A;  1PU9 A;  3PGP A;  4U5Y A;  3BI0 A;  3IIB A;  4UCP A;  1VGY A;  2Q7B A;  5HXD A;  1TKJ A;  4JJX A;  3ISX A;  5D8N A;  3VH9 A;  7CPA A;  1FNO A;  2JBK A;  4A2Z A;  2Z10 A;  1Y0Y A;  3WR7 A;  5A27 A;  3PB4 X;  4ZGY B;  4L8A A;  3D3S A;  2OZG A;  5JGF A;  4P4J A;  1CX8 A;  3PFE A;  4BMH A;  2BOA A;  3FF3 A;  3CPX A;  2ZPA A;  3SXN A;  5DS0 A;  4QB9 A;  1QSN A;  2AFX A;  1YVO A;  3B3S A;  4Z65 A;  3NE7 A;  4C2Z A;  4MMO A;  1Y7E A;  4WWV A;  2HB6 A;  3PBE A;  1Z8L A;  3BJ8 A;  1VHO A;  4UF4 A;  3KZW A;  3W6X A;  4F9V A;  4KOW A;  1YX0 A;  2BSW A;  4P10 A;  4RI1 A;  1FT7 A;  1Z8T A;  4KOS A;  4KVX A;  3VAT A;  3FB3 A;  4FD4 A;  3FH4 A;  4H89 A;  3S9M A;  3TTH A;  4BIN A;  2P6E A;  2GU2 A;  2ZEF A;  2C6C A;  2BL1 A;  2K5T A;  2IJZ A;  2G0B A;  3CXS A;  3FNC A;  4ZX9 A;  2PIY A;  3SJG A;  4C68 A;  4ZY1 A;  2G9D A;  4NF1 A;  4ONU A;  1M4I A;  3PRT A;  2Q0Y A;  3FYN A;  4F0X A;  2FXF A;  1YW6 A;  1ZG9 A;  4ZBG A;  4NFR A;  2AE6 A;  2FS5 A;  4MCS A;  3FMC A;  4P4E A;  2B5G B;  2EK9 A;  4CAF A;  6CPA A;  2Q51 A;  1Y0R A;  4NSQ A;  1PUA A;  4IUS A;  2BCO A;  1UWY A;  1Q7L A;  1TXR A;  1JQG A;  1RXT A;  3IFE A;  1HDU A;  2ZEO A;  4CAW A;  4EFD A;  4DNC A;  3D7D A;  4UFX A;  2AFO A;  3W91 A;  3D4U A;  4F6A A;  2P6G A;  3R1K A;  2YNC C;  4Q7A A;  2GFQ A;  2AFW A;  2VEZ A;  2KCW A;  3KL9 A;  2B4D A;  1L0C A;  2G3A A;  4B14 A;  3CDX A;  4R9M A;  3JRU A;  3TOB A;  4UBR A;  4CYN A;  5KTC A;  4PXD A;  1S60 A;  4EVY A;  5G22 A;  4GM5 A;  4YFJ A;  3IWE A;  3PZJ A;  4NGT A;  1ELM P;  4HPS A;  4P45 A;  4OKO A;  4OC4 A;  5F47 A;  1S7N A;  5K8P A;  4XPD C;  1AMP A;  4UA3 A;  3DR6 A;  3B8G A;  5LYI A;  4KOU A;  1IIC A;  4KSI A;  5EMI A;  3R9G A;  5BWA B;  5IV0 A;  3PBB A;  2VXK A;  5H86 A;  2Z3M A;  1F57 A;  1I21 A;  4NJQ A;  2PR8 A;  2RFH A;  2ZEE A;  4E2A A;  1OZP A;  1BPM A;  4NCZ A;  3B7I A;  1CP7 A;  4U9Z A;  5AGE A;  4A31 A;  4WJB A;  3K2K A;  5F48 A;  2QIR A;  1MJ9 A;  4ZI6 A;  1R43 A;  1Q2Y A;  1P4N A;  2DPS A;  3WT4 A;  4C7I A;  3EO4 A;  5LYD A;  4CYO A;  4M3S A;  3NH8 A;  4ZX8 A;  2GLF A;  2PRB A;  3SXO A;  4OC2 A;  3PB9 X;  2BUE A;  3TC8 A;  2RC4 A;  2Z3L A;  3IWW A;  4KLW A;  1B87 A;  4MFL A;  1IOI A;  4FD6 A;  1A2Z A;  2ABZ A;  2PJ1 A;  3RO0 A;  2WYR A;  3QAY A;  5LRG A;  2DXQ A;  1GHE A;  4P6Y A;  4A94 A;  3UY5 A;  3SJE A;  3S6G A;  4CAE A;  2CNM A;  3EC4 A;  2FIA A;  3K9T A;  4M6H A;  3H5Z A;  2B3U A;  3KI9 A;  4P4I A;  4YRH A;  3IU2 A;  4MHN A;  4KS9 A;  4MFQ A;  4R3L A;  3F8K A;  4R76 A;  3RAM A;  2NMT A;  3TO6 A;  2FE7 A;  1CP6 A;  3IJ3 A;  4NGP A;  2IL4 A;  2OOT A;  3HUV A;  4P4F A;  4NEX A;  1R57 A;  2VL1 A;  2DPT A;  2JLM A;  4KUB A;  2ZXV A;  5FVJ A;  3MN8 A;  1Q2C A;  2FCK A;  4XNH B;  1KWM A;  2PJA A;  3FEC A;  2ODF A;  1Z4E A;  4AVA A;  4PPZ A;  4PXC A;  2GLJ A;  3IU1 A;  4DUK A;  3FEE A;  4MCR A;  3S6F A;  3V8I A;  1F2P A;  2ATR A;  3D67 A;  2PJ7 A;  4JXR A;  2YGW A;  1XE4 A;  1IID A;  2ZW6 A;  1XEB A;  1LCP A;  4GS4 A;  5AG7 A;  2EWB A;  3SJF A;  4TNU A;  4F8Z A;  4MFJ A;  2OH1 A;  1XJO A;  3PB7 X;  2ZOF A;  4X5K A;  4CYP A;  4F0Y A;  3R95 A;  2V8D A;  4Y49 C;  2EK8 A;  3FXT A;  4UEF A;  2O4H A;  1Q2D A;  1M4D A;  1WK4 A;  2GIV A;  1NMT A;  3LAC A;  5G21 A;  5CNP A;  3T8W A;  4ZY0 A;  4UEZ A;  3S9L A;  3PB8 X;  3P2H A;  1RO5 A;  4JZ0 A;  1YGH A;  4KVO E;  3ZZI A;  3T9Y A;  5LYL A;  2NSM A;  4Q36 A;  2VQY A;  3I9S A;  4NGR A;  4MXU A;  4ZYQ A;  5F09 A;  2PCU A;  1KUV A;  2OZH A;  4P4D A;  3FBU A;  2REE A;  3B35 A;  3KGQ A;  3LMS A;  1QSR A;  1AYE A;  3HLP A;  4KLV A;  4MHP A;  5ISV A;  2I00 A;  2XEJ A;  3C26 A;  1V0C A;  3D7G A;  4CPA A;  3KR4 A;  2Z3N A;  3DDD A;  5D29 A;  1VIX A;  3EY5 A;  1VKC A;  3ISZ A;  3LOD A;  4MRI A;  4MCQ A;  4UFV A;  4J3G A;  2ZEL A;  1U6M A;  3B3W A;  5CBM A;  2JDC A;  2WUU A;  1Y7R A;  4CGL A;  4MFZ A;  4UEE A;  4R6T A;  2Q4Z A;  4OC3 A;  1BO4 A;  4B5P B;  4MHD A;  4MHY A;  3R96 A;  5I0C A;  1CJW A;  5KTD A;  2PSW A;  1S7K A;  1WWZ A;  2YNE A;  5EC4 A;  4YWY A;  2EO8 A;  4W9Y A;  3B3V A;  4MY0 A;  2HQY A;  3NFZ A;  3BXM A;  2V8V A;  2J8N A;  4M85 A;  4JYW A;  3BI1 A;  2PC1 A;  4DYO A;  5G1Z A;  4IHM A;  4OME A;  1ZG7 A;  2AFZ A;  2CTC A;  4KSA A;  3V7Z A;  3GYA A;  4B13 A;  1CG2 A;  4TWE A;  4X3R A;  3CZX A;  5DWM A;  1IY7 A;  4IK2 A;  2ANP A;  2B58 A;  2Z3K A;  3H8G A;  4LUA A;  3RZA A;  1MJA A;  2CTB A;  4H2K A;  4UFW A;  4OC0 A;  4F9U A;  3TT2 A;  3D7F A;  3RYO A;  1SQH A;  4JWP A;  2B5G A;  1YSJ A;  2JEW A;  4OC5 A;  3IC1 A;  3SI0 A;  3D66 A;  1YRE A;  4KSF A;  5A28 A;  2ZEP A;  3FRM A;  4O23 A;  2PJ0 A;  2J9A A;  2VBQ A;  3CPA A;  3IGR A;  4MI4 A;  1KUY A;  1LOK A;  3G8W A;  3KKW A;  1B6B A;  4PSW A;  2QML A;  4XPD B;  8CPA A;  1P0H A;  1EE3 P;  2EUI A;  3D68 A;  4HKF A;  2Z3O A;  5J8C A;  2R8V A;  4MY3 A;  2AFM A;  2Z11 A;  4QBJ A;  3IEH A;  1X12 A;  2HC9 A;  2XEG A;  4K30 A;  4OIW A;  5JM6 A;  5K8N A;  4BD9 A;  2OB0 A;  5IB0 A;  1KUX A;  3LWU A;  2OZU A;  2ZW4 A;  5LYF A;  1YQE A;  2QYV A;  3P2F A;  4II9 A;  3JUW A;  1TIQ A;  4K3N A;  3G3S A;  4PXE A;  2Q7S A;  1M4G A;  4M6G A;  3DSB A;  3TFY A;  2Q04 A;  1TKH A;  2ZOG A;  3S9N A;  2CXA A;  4EME A;  1XF8 A;  1I1D A;  1QMU A;  4CS0 B;  3TX8 A;  2PJ9 A;  2CNS A;  4AVC A;  4A38 A;  4UIB A;  1IB1 E;  2POK A;  2PVW A;  3H8F A;  1XMB A;  3T90 A;  2JDD A;  4OID A;  4A95 A;  2OR4 A;  1N71 A;  4KOY A;  3R9E A;  2GAN A;  3CXP A;  1BLL E;  4CAV A;  4LQ6 A;  2AJ6 A;  4MCP A;  4RN7 A;  1YW4 A;  2V77 A;  4AG9 A;  2VZY A;  5HVF A;  2QEC A;  3MRU A;  2PJ6 A;  3B3C A;  4KZT A;  3BHX A;  3ZJ0 A;  2YND A;  2R7H A;  3TE4 A;  2H5M A;  1FY7 A;  4QVT A;  5HMN A;  3EXN A;  4A39 A;  3E0K A;  4PXB A;  1IU8 A;  1DE4 C;  3FIX A;  4CGM A;  2WZN A;  2F5I A;  3KQZ A;  2B3V A;  1VHE A;  3KQX A;  4UIA A;  4KOR A;  2I3C A;  3W6S A;  2V8H A;  4CRY B;  1F2O A;  3CT9 A;  4DJL A;  4PK2 A;  3VWD A;  4X2T A;  4IAV A;  1BAV A;  4ORF A;  3R9F A;  1RTQ A;  3CXQ A;  3SI1 A;  1R3N A;  4OAE A;  4P4B A;  1XIX A;  4EWT A;  5C82 A;  5GCN A;  3FED A;  2BEI A;  4Y49 B;  4OLL A;  4QUS A;  1DTD A;  4R7M A;  3K9U A;  3B3T A;  2C27 A;  4PK3 A;  3WC5 A;  1M1D A;  4MFP A;  2J8M A;  1M4L A;  4FD5 A;  4P44 A;  5HH1 A;  1J4J A;  4UCM A;  2WPX A;  1TKF A;  4Q38 A;  1XOV A;  1QSO A;  1Z2L A;  2I79 A;  4NXY A;  1Z8X A;  2FSR A;  2PJB A;  4RUH A;  3GUX A;  1YVK A;  2B4B A;  2RB7 A;  5DWN A;  4LQG A;  4ZY2 A;  3WC6 A;  4FUU A;  1S7L A;  5CPA A;  4JXQ A;  1CPX A;  1MK4 A;  4OC1 A;  4PSX A;  2O53 A;  1I12 A;  2DF5 A;  2EBJ A;  2FL4 A;  2P0W A;  4MFK A;  4R57 A;  5LRJ A;  1IYL A;  1LRZ A;  5HVG A;  5ELY A;  4FWU A;  2GE3 A;  1CPS A;  1ON0 A;  1LAP A;  3D8P A;  2PJ2 A;  3KAS A;  4AXV A;  1LAM A;  4CAX A;  1OBR A;  3PFO A;  1JWQ A;  1CM0 A;  3NE8 A;  5IX3 A;  2AFS A;  4C2X A;  4LX9 A;  4G1P A;  2C1C A;  4NGN A;  2XEI A;  5J8F A;  1YLO A;  2PIZ A;  2Z0Z A;  3OWC A;  1YLE A;  5KTA A;  4B6Z A;  3GY9 A;  3L2N A;  4KOT A;  1LAN A;  2FVG A;  1BPN A;  4L89 A;  1ZLI A;  2PJ4 A;  5F49 A;  3BLN A;  4B5P A;  2QVP A;  4OP4 A;  3NA6 A;  3GKR A;  3RBU A;  4A32 A;  2CY2 A;  1ELL P;  4ONW A;  4NGM A;  1LFW A;  1ARL A;  4AG7 A;  2PJ8 A;  2IQ6 A;  4PV6 A;  4X8I A;  2ARH A;  1QSM A;  2WPW A;  3DNS A;  3IO1 A;  2A4N A;  3DLJ A;  4NJR A;  2V8G A;  3PP9 A;  3I3G A;  4KOX A;  2C6G A;  3VWE A;  2P6F A;  4HNW B;  3BJ7 A;  2EVN A;  3DR8 A;  2PRQ A;  3SJX A;  4CGN A;  2C6P A;  2AFU A;  2YNC A;  5I4M A;  1K4J A;  5IB9 A;  3IWG A;  3FX6 A;  4FBE A;  4IF5 A;  1AUG A;  4JD6 A;  4B10 A;  2VI7 A;  5HVH A;  1TF8 A;  4A30 A;  2XEF A;  2ZEN A;  2Y0M A;  2HV2 A;  1Y9W A; 
#chains in the Genus database with same CATH homology
 4R8F A;  3WAB A;  3VAR A;  2PJC A;  2QJ8 A;  1ZLH A;  5K8O A;  3KHX A;  4FAI A;  5LRK A;  4A37 A;  2NYQ A;  1NSA A;  3KHZ A;  1Z5R A;  2BO9 A;  1H8L A;  1XRY A;  4MHZ A;  4PQA A;  1HEE A;  3H8E A;  2DEA A;  2Q43 A;  2ZEM A;  1CBX A;  1ARM A;  3NH4 A;  3SI2 A;  4NGQ A;  2PJ3 A;  3DGV A;  5K8M A;  3FVL A;  3PEI A;  2F8H A;  2ZED A;  1PCA A;  2F7V A;  3GB0 A;  5THW A;  3I1U A;  2PJ5 A;  3KR5 A;  2PE3 A;  1HDQ A;  4NGS A;  3FJU A;  1QQ9 A;  2ZEG A;  3D7H A;  3PB6 X;  2GRE A;  1IGB A;  1ZG8 A;  5JH9 A;  3V38 A;  2IMO A;  5J1Q A;  3WC7 A;  1YME A;  3NH5 A;  2PVV A;  3QNV A;  2CF4 A;  1XBU A;  2CIJ A;  3N5F A;  2JBJ A;  1GYT A;  1XFO A;  3GLJ A;  1TF9 A;  2ZEH A;  4YU9 A;  1PYT B;  3BI0 A;  3IIB A;  1VGY A;  5HXD A;  1TKJ A;  3VH9 A;  3ISX A;  5D8N A;  7CPA A;  1FNO A;  2JBK A;  1Y0Y A;  3PB4 X;  5JGF A;  4P4J A;  1CX8 A;  3PFE A;  2BOA A;  3FF3 A;  3CPX A;  5DS0 A;  2AFX A;  4Z65 A;  4MMO A;  1Y7E A;  4WWV A;  2HB6 A;  3PBE A;  1Z8L A;  1VHO A;  4UF4 A;  3KZW A;  4F9V A;  4P10 A;  1FT7 A;  3VAT A;  3FH4 A;  3S9M A;  2GU2 A;  2ZEF A;  2C6C A;  4ZX9 A;  3SJG A;  2IJZ A;  4ZY1 A;  2PIY A;  2G9D A;  3PRT A;  1YW6 A;  1ZG9 A;  4NFR A;  4MCS A;  3FMC A;  4P4E A;  2EK9 A;  6CPA A;  2Q51 A;  1Y0R A;  2BCO A;  1UWY A;  1Q7L A;  1TXR A;  1JQG A;  3IFE A;  1HDU A;  2ZEO A;  4EFD A;  3D7D A;  2AFO A;  3D4U A;  4Q7A A;  2AFW A;  3KL9 A;  3CDX A;  3JRU A;  4PXD A;  4GM5 A;  4NGT A;  1ELM P;  4P45 A;  4OKO A;  4OC4 A;  5K8P A;  1AMP A;  5LYI A;  4KSI A;  3PBB A;  1F57 A;  4NJQ A;  2RFH A;  2ZEE A;  1BPM A;  3B7I A;  1CP7 A;  4WJB A;  3K2K A;  4ZI6 A;  1R43 A;  3WT4 A;  5LYD A;  3NH8 A;  4ZX8 A;  2GLF A;  4OC2 A;  3PB9 X;  3TC8 A;  3IWW A;  2ABZ A;  2PJ1 A;  2WYR A;  5LRG A;  4P6Y A;  4A94 A;  3SJE A;  3K9T A;  4P4I A;  3KI9 A;  4MHN A;  4R76 A;  3RAM A;  3IJ3 A;  1CP6 A;  4NGP A;  2OOT A;  3HUV A;  4P4F A;  2VL1 A;  3MN8 A;  1KWM A;  2PJA A;  3FEC A;  4PPZ A;  4PXC A;  2GLJ A;  4DUK A;  3FEE A;  4MCR A;  1F2P A;  3D67 A;  2PJ7 A;  1LCP A;  2EWB A;  3SJF A;  4TNU A;  4F8Z A;  1XJO A;  3PB7 X;  2ZOF A;  2V8D A;  2EK8 A;  4UEF A;  2O4H A;  3T8W A;  4ZY0 A;  4UEZ A;  3S9L A;  3PB8 X;  4JZ0 A;  5LYL A;  2NSM A;  4NGR A;  4MXU A;  4ZYQ A;  5F09 A;  2PCU A;  4P4D A;  3B35 A;  3KGQ A;  3LMS A;  3HLP A;  1AYE A;  4MHP A;  2XEJ A;  3D7G A;  4CPA A;  3KR4 A;  5D29 A;  1VIX A;  3ISZ A;  4MRI A;  4MCQ A;  2ZEL A;  3B3W A;  5CBM A;  4UEE A;  4R6T A;  2Q4Z A;  4OC3 A;  4MHY A;  4YWY A;  4W9Y A;  3B3V A;  3NFZ A;  3BXM A;  2V8V A;  4JYW A;  3BI1 A;  4DYO A;  4IHM A;  4OME A;  1ZG7 A;  2AFZ A;  2CTC A;  3V7Z A;  1CG2 A;  4TWE A;  4X3R A;  1IY7 A;  4IK2 A;  2ANP A;  3RZA A;  3H8G A;  2CTB A;  4H2K A;  4OC0 A;  4F9U A;  3D7F A;  2JEW A;  1YSJ A;  4OC5 A;  3IC1 A;  3SI0 A;  3D66 A;  2ZEP A;  4O23 A;  2PJ0 A;  2J9A A;  3CPA A;  1LOK A;  8CPA A;  1EE3 P;  3D68 A;  2AFM A;  3IEH A;  2HC9 A;  2XEG A;  4OIW A;  5JM6 A;  5K8N A;  4BD9 A;  3LWU A;  5LYF A;  2QYV A;  4K3N A;  4PXE A;  1TKH A;  2ZOG A;  3S9N A;  4EME A;  1QMU A;  3TX8 A;  2PJ9 A;  4A38 A;  4UIB A;  2POK A;  2PVW A;  3H8F A;  1XMB A;  4OID A;  2OR4 A;  1BLL E;  4MCP A;  1YW4 A;  2V77 A;  5HVF A;  3MRU A;  2PJ6 A;  3B3C A;  3BHX A;  4A39 A;  4PXB A;  1DE4 C;  2WZN A;  3KQZ A;  3KQX A;  1VHE A;  4UIA A;  2I3C A;  2V8H A;  1F2O A;  3CT9 A;  4DJL A;  4X2T A;  4IAV A;  1BAV A;  1RTQ A;  3SI1 A;  1R3N A;  4P4B A;  4EWT A;  3FED A;  1DTD A;  4R7M A;  3WC5 A;  3B3T A;  1M4L A;  4P44 A;  1TKF A;  1Z2L A;  2PJB A;  4RUH A;  3GUX A;  2RB7 A;  4ZY2 A;  4LQG A;  3WC6 A;  4FUU A;  5CPA A;  1CPX A;  4OC1 A;  2O53 A;  5LRJ A;  5HVG A;  5ELY A;  4FWU A;  1CPS A;  1LAP A;  3KAS A;  2PJ2 A;  4AXV A;  1LAM A;  1OBR A;  3PFO A;  2AFS A;  4G1P A;  2C1C A;  4NGN A;  2XEI A;  1YLO A;  2PIZ A;  4B6Z A;  3L2N A;  1LAN A;  2FVG A;  1BPN A;  1ZLI A;  2PJ4 A;  2QVP A;  4OP4 A;  3NA6 A;  3RBU A;  1ELL P;  4ONW A;  4NGM A;  1LFW A;  1ARL A;  2PJ8 A;  2IQ6 A;  4X8I A;  3IO1 A;  3DLJ A;  4NJR A;  2V8G A;  2C6G A;  2PRQ A;  3SJX A;  2C6P A;  2AFU A;  5I4M A;  5IB9 A;  3FX6 A;  4FBE A;  5HVH A;  1TF8 A;  2XEF A;  2ZEN A;  3B2Y A;  3B3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...