1XJOA

Structure of aminopeptidase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
277
structure length
270
Chain Sequence
b'APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE
molecule tags Hydrolase
publication title Streptomyces griseus aminopeptidase: X-ray crystallographic structure at 1.75 A resolution.
pubmed doi rcsb
total genus 101
structure length 270
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 1996-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1xjoA00
4O23A 4BD9A 4NGTA 1TKJA 3FMCA 4ZI6A 3RZAA 4TNUA 2XEIA 2AFUA 4OKOA 3FEEA 4P10A 4LQGA 4YU9A 5F09A 3KQXA 2C6CA 5D8NA 4PXEA 4UEEA 2WZNA 4B6ZA 3IWWA 2GLFA 2C6PA 4EFDA 3NH5A 2OR4A 2PJ4A 2AFMA 3SI2A 3CPAA 4DUKA 1YMEA 3PBBA 1QQ9A 1LOKA 1TXRA 4OIWA 3TX8A 1IY7A 3GLJA 3KL9A 4ZY2A 1VHEA 3V7ZA 2VL1A 1DTDA 1OBRA 4WWVA 4P45A 4K3NA 4X2TA 3BI0A 2PVWA 5K8NA 3B3VA 3NA6A 4NGRA 1F2OA 1CG2A 4NFRA 4FAIA 4MHNA 4GM5A 3L2NA 3RBUA 4P4JA 2AFWA 2XEGA 1CBXA 3HLPA 1HDUA 2PJAA 4P4IA 1JQGA 4OC2A 5ELYA 3WT4A 5D29A 1CX8A 1QMUA 2PIYA 4P4DA 4FWUA 2PJ8A 1CP6A 5LRKA 1ZG9A 3S9LA 4PXCA 2CIJA 2PCUA 1KWMA 1CP7A 3NH8A 3KGQA 2DEAA 2XEJA 1Z2LA 2NYQA 1Q7LA 3H8GA 4NJRA 1VIXA 5THWA 3B3SA 2C6GA 4OC3A 4P4EA 4MCPA 1IGBA 4YWYA 3IFEA 4H2KA 1ZLHA 3SI1A 4Q7AA 4ZX8A 4NGPA 4FBEA 2ZEFA 4OIDA 5JM6A 1HDQA 2F7VA 3SJXA 7CPAA 4OMEA 4RUHA 4ZYQA 1EE3P 4A94A 1ZG8A 4A38A 4CPAA 4UIAA 4R7MA 1LAPA 4OC5A 2BOAA 1R43A 2PJ7A 3PB6X 4OC4A 5JH9A 2F8HA 2XEFA 8CPAA 1Y7EA 3PFOA 3D67A 3KI9A 3KR4A 2PVVA 4NGSA 3VH9A 3T8WA 1VGYA 5HVGA 5K8MA 4OC1A 4MHZA 1YW6A 2EWBA 2V8VA 3PB7X 4F9UA 4P4BA 1ARMA 4P6YA 1TKFA 3DGVA 1NSAA 2BO9A 4ZX9A 2GU2A 2PJ1A 1RTQA 1BPNA 1CPSA 3GUXA 3NFZA 5CPAA 4G1PA 5CBMA 4NGNA 2PJBA 3H8EA 2FVGA 3TC8A 3B35A 1XMBA 3GB0A 1TKHA 5K8OA 3IIBA 3S9NA 5LYDA 5LRJA 3SJFA 1YSJA 3LMSA 5K8PA 4UF4A 1Z5RA 3BHXA 3SJEA 3MN8A 3RAMA 4EMEA 2ZEHA 2C1CA 1ZLIA 2JBKA 4TWEA 1ARLA 3IC1A 1XBUA 1AYEA 3B3WA 3IEHA 2JEWA 1ELMP 2PIZA 1H8LA 1BLLE 2QVPA 2AFZA 1GYTA 3ISZA 3PBEA 3WC5A 3PB8X 2G9DA 3FH4A 3PRTA 3PB4X 1LANA 3CDXA 2ZENA 4JYWA 3MRUA 3KASA 1XJOA 4F9VA 3D66A 2ZEGA 1XRYA 2ANPA 2WYRA 3K2KA 1M4LA 4JZ0A 4ZY0A 4MHYA 1CPXA 3DLJA 3QNVA 4NGQA 2V8DA 4IK2A 4UEFA 1BAVA 1R3NA 2I3CA 4PQAA 3V38A 4IAVA 2PJ0A 1ZG7A 4P4FA 3WABA 1XFOA 5J1QA 3D7GA 1HEEA 2O4HA 2QJ8A 3JRUA 2PJCA 3KHXA 5DS0A 4Z65A 2AFSA 4ONWA 3IO1A 3FECA 5JGFA 2ZOGA 1YW4A 3FVLA 2RFHA 1F2PA 2EK8A 4MCQA 3NH4A 2ABZA 3SJGA 2IJZA 2IQ6A 3FX6A 3KR5A 3PB9X 1FT7A 1LAMA 2AFXA 2V8GA 3D7DA 1VHOA 4UIBA 2V8HA 5LYLA 3KZWA 1BPMA 1TF8A 1Y0YA 1Z8LA 2HC9A 2ZEEA 1YLOA 3D7FA 3CT9A 5HXDA 4MXUA 3BI1A 3H8FA 2OOTA 2PJ2A 2POKA 3WC6A 3FEDA 2CTCA 4MCRA 2EK9A 1PYTB 3VATA 2Q43A 3N5FA 4KSIA 3HUVA 2Q51A 2V77A 5IB9A 4OC0A 4A37A 3WC7A 2GLJA 2IMOA 4A39A 4X3RA 4IHMA 1ELLP 2JBJA 1TF9A 5I4MA 4OP4A 4R6TA 2ZELA 3B7IA 3VARA 6CPAA 2BCOA 5LYFA 4MRIA 3PFEA 4MHPA 4PXBA 3LWUA 2J9AA 2Q4ZA 5HVHA 3B2YA 5LRGA 3S9MA 2ZOFA 2PJ9A 4MCSA 5HVFA 2RB7A 1DE4C 4X8IA 4DYOA 1UWYA 3FJUA 4WJBA 3D4UA 4PPZA 5LYIA 3K9TA 3I1UA 2ZEPA 4DJLA 2O53A 3IJ3A 2HB6A 2PRQA 3B3CA 2PJ6A 1F57A 4NGMA 4UEZA 2CF4A 4AXVA 2ZEMA 2QYVA 4EWTA 2AFOA 2PJ3A 2ZEOA 3CPXA 4P44A 2ZEDA 3FF3A 1AMPA 4W9YA 3PEIA 1Y0RA 2CTBA 3BXMA 4PXDA 4F8ZA 4ZY1A 4R76A 2PE3A 2PJ5A 3D7HA 4MMOA 1FNOA 2GREA 3B3TA 3KHZA 3SI0A 4NJQA 1LFWA 4R8FA 1LCPA 2NSMA 3D68A 3ISXA 1PCAA 3KQZA 4FUUA
chains in the Genus database with same CATH superfamily
3C26A 4O23A 4BD9A 4B5OA 4NGTA 4C2YA 1TKJA 1KUVA 3FMCA 4ZI6A 2Z3MA 2K5TA 3RZAA 4MY0A 3SXNA 4TNUA 1LRZA 1KUXA 2AFUA 1B87A 2VEZA 2XEIA 3FEEA 4OKOA 2JDCA 2H5MA 4P10A 4LQGA 4YU9A 1X10A 2WUUA 5F09A 3KQXA 2C6CA 5D8NA 4PXEA 4UEEA 2WZNA 4AVBA 2Q0YA 4KLVA 4B6ZA 4M6HA 3IWWA 4Y49C 2GLFA 2ATRA 1VHSA 2C6PA 4EFDA 3TOBA 3PP9A 3NH5A 4C2ZA 1TIQA 2OR4A 4B12A 2PJ4A 2AFMA 4A33A 3SI2A 3W6SA 3CPAA 1VKCA 2YNCC 4DUKA 1YMEA 1XOVA 2RC4A 3PBBA 1QQ9A 2WPXA 4MFZA 1LOKA 1M44A 3GYAA 1TXRA 4MI4A 4OIWA 5F46A 1IOFA 3FNCA 1PU9A 1IY7A 2OU2A 3GLJA 3KL9A 5DWNA 3TX8A 4ZY2A 1Y9WA 1YX0A 4QVTA 1VHEA 5G22A 4M6GA 3R1KA 3V7ZA 2VL1A 1DTDA 1OBRA 2YNDA 3FRMA 4WWVA 4KOYA 4UWIA 4R3KA 2R1IA 4NXYA 4P45A 4K3NA 4CGPA 4X2TA 3BI0A 2G3AA 2Q7BA 2PVWA 4J3GA 2R8VA 3T90A 4FD7A 4DNCA 3FB3A 4KUAA 5K8NA 3WR7A 5JQ4A 3B3VA 1XMTA 3NA6A 1JWQA 2Z0ZA 4H6UA 4NGRA 1F2OA 1CG2A 3G8WA 4KOTA 4NFRA 4X5KA 4CGOA 4FAIA 4MHNA 1CM0A 4GM5A 3L2NA 3RBUA 4P4JA 2AFWA 2XEGA 1CBXA 3HLPA 1HDUA 2PJAA 4P4IA 2I79A 1JQGA 2R98A 3K9UA 1V0CA 4M3SA 4LUAA 4OC2A 5ELYA 3WT4A 5D29A 1CX8A 2Q4VA 5FVJA 2JLMA 4YGOA 4CS0B 1QMUA 4FWUA 4P4DA 1P4NA 2PJ8A 2CNMA 3QAYA 5CNPA 4B13A 5J8CA 1CP6A 5LRKA 1ZG9A 1KUYA 3S9LA 1QSMA 4KS9A 2BEIA 2R7HA 5HMNA 4E8OA 4PXCA 2CIJA 2PCUA 3QAHA 1KWMA 2WSAA 1CP7A 2CY2A 4KOSA 4NSQA 2B58A 3NH8A 1RO5A 3KGQA 4QBJA 2DEAA 4YFJA 2XEJA 2J8MA 1Z2LA 2NYQA 1Q7LA 4RS2A 4AB7A 3H8GA 3R9FA 4C68A 1XE4A 4NJRA 1VIXA 5THWA 3B3SA 2C6GA 4OC3A 4HNXB 4MHDA 4P4EA 4F0YA 4MCPA 1IGBA 4YWYA 4PK2A 1BOBA 4GS4A 3CXQA 2PR8A 3IFEA 4H2KA 4IUSA 1ZLHA 4RI1A 3SI1A 4Q7AA 4ZX8A 3JUWA 4C7HA 1S7KA 2HV2A 3H4QA 4NGPA 4FBEA 3LACA 4B5PB 2GIVA 4CGNA 4NCZA 2ZEFA 4OIDA 4MFLA 3P2FA 5JM6A 1MJAA 5F48A 1HDQA 1K4JA 2F7VA 3SJXA 7CPAA 1J4JA 4OMEA 4A30A 4RUHA 4XPKA 4ZYQA 5I0CA 1AUGA 3ZZIA 1EE3P 4A94A 4QB9A 1XEBA 1ZG8A 4EVYA 1YREA 4A38A 4AVAA 4CPAA 2D4PA 4UIAA 4R7MA 3JTKA 1LAPA 5AG5A 3RNZA 3F5BA 4OC5A 3R9EA 2BOAA 1R43A 2CXAA 1XIXA 4B11A 4PK3A 2PJ7A 3PB6X 4OC4A 3T9YA 5JH9A 1Z4EA 2F8HA 1IB1E 2XEFA 3TO7A 3TFYA 2Z3OA 4U5YA 1Y7EA 8CPAA 3NE7A 5G20A 3PFOA 2CNTA 3D67A 5E96A 3KI9A 3ZJ0A 5AG7A 4KOWA 5KTCA 4CYOA 1MK4A 3KR4A 4HNYB 2PVVA 3TO9A 4NGSA 4C2XA 5EC4A 3VH9A 1Z8XA 4QUSA 1OZPA 3S6FA 1VGYA 3T8WA 2JDDA 1YR0A 1I12A 1N71A 4OC1A 4B5PA 5HVGA 4MHZA 2OB0A 5K8MA 1YW6A 2PR1A 2EWBA 2V8VA 3PB7X 4YRHA 4CGLA 4F9UA 5A28A 2VXKA 4P4BA 1ARMA 2GANA 2HQYA 3IWEA 4M6IA 2ZW7A 4MFQA 4M85A 4P6YA 1TKFA 3DGVA 3I9SA 4KORA 3S6GA 3SXOA 4NF1A 1NSAA 3DSBA 2BO9A 4FUUA 4ZX9A 4A32A 2EUIA 2GU2A 1YVKA 2Z10A 4I49A 1M1DA 5AG4A 2PJ1A 3PZJA 1RTQA 1BPNA 4MJ8A 1CPSA 3GUXA 2J8RA 3NFZA 2BSWA 5CPAA 2FT0A 3LD2A 4G1PA 4RN7A 5CBMA 4NGNA 4NEXA 4C7IA 2PJBA 2Y0MA 3H8EA 3EXNA 1Q2DA 3I3GA 3UY5A 1P0HA 2FVGA 4CRZB 3TC8A 1Y7RA 1I1DA 3BJ7A 3B35A 3S6KA 2B3UA 3TOAA 1XMBA 4A31A 2C27A 2Z3NA 3GB0A 4XNHC 1TKHA 5K8OA 3IIBA 4XPLA 3S9NA 1IU8A 2YNCA 4AG9A 5LYDA 5LRJA 4UFVA 1R57A 2VBQA 4E2AA 4BBHA 3SJFA 1YSJA 3LMSA 4R87A 5IB0A 4KLWA 4CRYB 5K8PA 5HH1A 1Q2YA 1Z5RA 2B4DA 4UF4A 5G21A 3BHXA 2F5IA 4CAWA 5C88A 3FXTA 3SJEA 3MN8A 1M4GA 3IGRA 4FD6A 1YK3A 3GIUA 1S7FA 3RAMA 4EMEA 2ZEHA 2ZW4A 2C1CA 1ZLIA 4JD6A 4JLYA 5IV0A 4OLLA 4E0AA 3MGDA 2JBKA 4QC6A 4TWEA 1ARLA 3IC1A 2PDOA 1S7NA 3DR6A 4MBUA 1XBUA 1AYEA 3B3WA 3IEHA 4F6AA 2JEWA 1ELMP 2PIZA 1H8LA 3S6HA 3FYNA 2Q04A 3D3SA 1BLLE 2QVPA 2AFZA 1FY7A 2QECA 3BLNA 1GYTA 3ISZA 3PBEA 3WC5A 2I00A 2QIRA 3PB8X 2G9DA 3FH4A 3PRTA 3PB4X 1XF8A 1LANA 3H5ZA 4ZBGA 2FIWA 3CDXA 2ZENA 4JYWA 4MFPA 3MRUA 3KASA 1U6MA 1XJOA 2OZUA 4F9VA 2B4DB 3D66A 2ZEGA 2EVNA 1XRYA 2ANPA 2Z3LA 4A2ZA 5C82A 1UFHA 2GE3A 4CAVA 2IL4A 2WYRA 2Q7SA 2A4NA 3K2KA 1M4LA 4JZ0A 1SQHA 3EC4A 4PSXA 4ZY0A 4MHYA 2Z3PA 1CPXA 3DLJA 3QNVA 4NGQA 2Z3KA 1MJBA 2V8DA 3P2HA 2B3VA 4IK2A 5KTDA 3RYOA 4UEFA 4H6ZA 1BAVA 1R3NA 3TT2A 1YQEA 5J8FA 2I3CA 4PQAA 1A2ZA 3V38A 1Z8WA 4IAVA 4JJXA 2PJ0A 4UFXA 3KKWA 1ZG7A 3W6XA 4U9YA 2ZPAA 4P4FA 2OH1A 3WABA 1XFOA 1S5KA 2Q44A 5J1QA 3D7GA 1B6BA 1HEEA 1L0CA 1WWZA 2O4HA 2QJ8A 3D2PA 2PJCA 3JRUA 2REFA 2YNEA 3KHXA 3D2MA 3V8IA 3PGPA 2OZGA 5DS0A 2NMTA 1MJ9A 4Z65A 1M4IA 4K30A 1GHEA 1PUAA 2AFSA 5H84A 4ONWA 2AJ6A 2FXFA 5DWMA 3IO1A 1BO4A 5BWAB 3FECA 1S3ZA 1S60A 2O28A 2VZYA 5JGFA 2ZOGA 3VWEA 2B5GA 2Q4YA 1I21A 1YW4A 3F0AA 3FVLA 2RFHA 1F2PA 2EK8A 4B14A 1Z4RA 4ONUA 3B8GA 4MCQA 2P0WA 2ABZA 2FIAA 1Z9UA 2IJZA 2IQ6A 3NH4A 2PC1A 3SJGA 2ARHA 3CXPA 3FX6A 4CGMA 3KR5A 3PB9X 1FT7A 1LAMA 4KZTA 4Q38A 4A95A 4XNHB 4KOVA 1IYKA 2AFXA 2DXQA 5GCNA 2V8GA 3D7DA 4CAFA 4R57A 3LODA 3W91A 1VHOA 4UIBA 2V8HA 4PV6A 2B5GB 5LYLA 3KZWA 2P6FA 3GKRA 3A9LA 4KVOE 1BPMA 1TF8A 1Y0YA 1Z8LA 2EO8A 4CAEA 4PSWA 4B10A 1X12A 2HC9A 2ZEEA 1YLOA 2YGWA 4UA3A 2FE7A 5F49A 3D7FA 3CT9A 5G1ZA 5HXDA 5AGEA 3TCVA 4MXUA 3BI1A 3H8FA 2OOTA 4GXHA 1NSLA 4XPDC 2PJ2A 1QSNA 2POKA 4KSFA 3FEDA 3WC6A 2CTCA 5AG6A 4MCRA 2EK9A 4UCMA 3JVNA 4R3LA 4U9ZA 4UCNA 3TTHA 1ON0A 3OWCA 1S7LA 4UWJA 1PYTB 4MFKA 3VATA 2ODFA 2J8NA 2X7BA 2Q43A 3N5FA 3F8KA 4KSIA 3HUVA 2Q51A 1YVOA 2QMLA 2DPSA 2V77A 4OC0A 4BMHA 5IB9A 3FIXA 4LQ6A 4KUBA 4A37A 4F0XA 4UFWA 3WC7A 3IU2A 4KVME 2GLJA 2DPTA 2IMOA 2CNSA 4IF5A 4A39A 1IOIA 4X3RA 3FBUA 2VZZA 4IHMA 2DF5A 2PQ8A 1ELLP 2JBJA 4JXRA 2GFQA 1KZFA 2Z11A 1TF9A 5I4MA 4OP4A 1NMTA 4FD4A 4L89A 4KVXA 3VWDA 4R6TA 2P6GA 4II9A 1IYLA 1IIDA 1YLEA 2ZELA 4R9MA 5H86A 3B7IA 4LX9A 3VARA 6CPAA 3R95A 2BCOA 1QSRA 5LYFA 4MRIA 4FD5A 4AVCA 4KOUA 2KCWA 3PFEA 2P6EA 2FCKA 5F47A 3TE4A 1CJWA 1IICA 3TO6A 3G3SA 4MHPA 2FSRA 4PXBA 3LWUA 4CAXA 2J9AA 2Q4ZA 5HVHA 3B2YA 3EFAA 4MY3A 5LRGA 1RXTA 1ZO0A 2ZXVA 4OADA 4Y49B 3S9MA 4CYNA 3QB8A 2BUEA 2ZOFA 3EY5A 4MFJA 1Z8TA 2PJ9A 3DNSA 4AG7A 1Y9KA 5A27A 5JPHA 3R96A 2ZW5A 3RO0A 2FS5A 4MCSA 5ISVA 5HVFA 2VQYA 2RB7A 1WK4A 2PRBA 4L8AA 1DE4C 4HKFA 4X8IA 4DYOA 4BINA 2PSWA 1UWYA 3FJUA 4WJBA 3D4UA 4PPZA 5LYIA 3K9TA 1QSTA 4HNWB 2REEA 3I1UA 2ZEPA 1M4DA 3R9GA 2ZW6A 4DJLA 2B4BA 3BJ8A 2O53A 4HPSA 1NE9A 4CYPA 3IJ3A 2OZHA 3E0KA 4H89A 2AE6A 2PRQA 2HB6A 3B3CA 2PJ6A 1F57A 3NE8A 4NGMA 1Q2CA 1YGHA 2HUZA 4UEZA 2CF4A 2G3TA 3IU1A 4AXVA 4CYQA 3CZXA 2JEVA 4ZGYB 5IX3A 2ZEMA 2G0BA 2QYVA 4EWTA 3DDDA 2AFOA 5EMIA 2PJ3A 2ZEOA 3CPXA 3IWGA 2ZEDA 3D8PA 1AMPA 1QSOA 3EO4A 3FF3A 3PEIA 4ORFA 4P44A 4W9YA 4OAEA 1Y0RA 2CTBA 3BXMA 4PXDA 4F8ZA 4UBRA 3DR8A 4JWPA 3SHPA 5EBVA 4KOXA 4ZY1A 4Q36A 4R76A 4XPDB 3GY9A 4UCPA 2PE3A 2PJ5A 2D4OA 3D7HA 1FNOA 4MMOA 2GREA 4JXQA 2EBJA 3B3TA 3KHZA 3SI0A 4NJQA 3N7ZA 1LFWA 3CXSA 1LCPA 2NSMA 4R8FA 5KTAA 2FL4A 4KSAA 2VI7A 3D68A 3ISXA 2BL1A 1PCAA 3KQZA 2PIYA 2WPWA
chains in the Genus database with same CATH topology
4O23A 4BD9A 4NGTA 1TKJA 3FMCA 4ZI6A 3RZAA 4TNUA 2XEIA 2AFUA 4OKOA 3FEEA 4P10A 4LQGA 4YU9A 5F09A 3KQXA 2C6CA 5D8NA 4PXEA 4UEEA 2WZNA 4B6ZA 3IWWA 2GLFA 2C6PA 4EFDA 3NH5A 2OR4A 2PJ4A 2AFMA 3SI2A 3CPAA 4DUKA 1YMEA 3PBBA 1QQ9A 1LOKA 1TXRA 4OIWA 3TX8A 1IY7A 3GLJA 3KL9A 4ZY2A 1VHEA 3V7ZA 2VL1A 1DTDA 1OBRA 4WWVA 4P45A 4K3NA 4X2TA 3BI0A 2PVWA 5K8NA 3B3VA 3NA6A 4NGRA 1F2OA 1CG2A 4NFRA 4FAIA 4MHNA 4GM5A 3L2NA 3RBUA 4P4JA 2AFWA 2XEGA 1CBXA 3HLPA 1HDUA 2PJAA 4P4IA 1JQGA 4OC2A 5ELYA 3WT4A 5D29A 1CX8A 1QMUA 2PIYA 4P4DA 4FWUA 2PJ8A 1CP6A 5LRKA 1ZG9A 3S9LA 4PXCA 2CIJA 2PCUA 1KWMA 1CP7A 3NH8A 3KGQA 2DEAA 2XEJA 1Z2LA 2NYQA 1Q7LA 3H8GA 4NJRA 1VIXA 5THWA 3B3SA 2C6GA 4OC3A 4P4EA 4MCPA 1IGBA 4YWYA 3IFEA 4H2KA 1ZLHA 3SI1A 4Q7AA 4ZX8A 4NGPA 4FBEA 2ZEFA 4OIDA 5JM6A 1HDQA 2F7VA 3SJXA 7CPAA 4OMEA 4RUHA 4ZYQA 1EE3P 4A94A 1ZG8A 4A38A 4CPAA 4UIAA 4R7MA 1LAPA 4OC5A 2BOAA 1R43A 2PJ7A 3PB6X 4OC4A 5JH9A 2F8HA 2XEFA 8CPAA 1Y7EA 3PFOA 3D67A 3KI9A 3KR4A 2PVVA 4NGSA 3VH9A 3T8WA 1VGYA 5HVGA 5K8MA 4OC1A 4MHZA 1YW6A 2EWBA 2V8VA 3PB7X 4F9UA 4P4BA 1ARMA 4P6YA 1TKFA 3DGVA 1NSAA 2BO9A 4ZX9A 2GU2A 2PJ1A 1RTQA 1BPNA 1CPSA 3GUXA 3NFZA 5CPAA 4G1PA 5CBMA 4NGNA 2PJBA 3H8EA 2FVGA 3TC8A 3B35A 1XMBA 3GB0A 1TKHA 5K8OA 3IIBA 3S9NA 5LYDA 5LRJA 3SJFA 1YSJA 3LMSA 5K8PA 4UF4A 1Z5RA 3BHXA 3SJEA 3MN8A 3RAMA 4EMEA 2ZEHA 2C1CA 1ZLIA 2JBKA 4TWEA 1ARLA 3IC1A 1XBUA 1AYEA 3B3WA 3IEHA 2JEWA 1ELMP 2PIZA 1H8LA 1BLLE 2QVPA 2AFZA 1GYTA 3ISZA 3PBEA 3WC5A 3PB8X 2G9DA 3FH4A 3PRTA 3PB4X 1LANA 3CDXA 2ZENA 4JYWA 3MRUA 3KASA 1XJOA 4F9VA 3D66A 2ZEGA 1XRYA 2ANPA 2WYRA 3K2KA 1M4LA 4JZ0A 4ZY0A 4MHYA 1CPXA 3DLJA 3QNVA 4NGQA 2V8DA 4IK2A 4UEFA 1BAVA 1R3NA 2I3CA 4PQAA 3V38A 4IAVA 2PJ0A 1ZG7A 4P4FA 3WABA 1XFOA 5J1QA 3D7GA 1HEEA 2O4HA 2QJ8A 3JRUA 2PJCA 3KHXA 5DS0A 4Z65A 2AFSA 4ONWA 3IO1A 3FECA 5JGFA 2ZOGA 1YW4A 3FVLA 2RFHA 1F2PA 2EK8A 4MCQA 3NH4A 2ABZA 3SJGA 2IJZA 2IQ6A 3FX6A 3KR5A 3PB9X 1FT7A 1LAMA 2AFXA 2V8GA 3D7DA 1VHOA 4UIBA 2V8HA 5LYLA 3KZWA 1BPMA 1TF8A 1Y0YA 1Z8LA 2HC9A 2ZEEA 1YLOA 3D7FA 3CT9A 5HXDA 4MXUA 3BI1A 3H8FA 2OOTA 2PJ2A 2POKA 3WC6A 3FEDA 2CTCA 4MCRA 2EK9A 1PYTB 3VATA 2Q43A 3N5FA 4KSIA 3HUVA 2Q51A 2V77A 5IB9A 4OC0A 4A37A 3WC7A 2GLJA 2IMOA 4A39A 4X3RA 4IHMA 1ELLP 2JBJA 1TF9A 5I4MA 4OP4A 4R6TA 2ZELA 3B7IA 3VARA 6CPAA 2BCOA 5LYFA 4MRIA 3PFEA 4MHPA 4PXBA 3LWUA 2J9AA 2Q4ZA 5HVHA 3B2YA 5LRGA 3S9MA 2ZOFA 2PJ9A 4MCSA 5HVFA 2RB7A 1DE4C 4X8IA 4DYOA 1UWYA 3FJUA 4WJBA 3D4UA 4PPZA 5LYIA 3K9TA 3I1UA 2ZEPA 4DJLA 2O53A 3IJ3A 2HB6A 2PRQA 3B3CA 2PJ6A 1F57A 4NGMA 4UEZA 2CF4A 4AXVA 2ZEMA 2QYVA 4EWTA 2AFOA 2PJ3A 2ZEOA 3CPXA 4P44A 2ZEDA 3FF3A 1AMPA 4W9YA 3PEIA 1Y0RA 2CTBA 3BXMA 4PXDA 4F8ZA 4ZY1A 4R76A 2PE3A 2PJ5A 3D7HA 4MMOA 1FNOA 2GREA 3B3TA 3KHZA 3SI0A 4NJQA 1LFWA 4R8FA 1LCPA 2NSMA 3D68A 3ISXA 1PCAA 3KQZA 4FUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O23 A;  4BD9 A;  4NGT A;  1TKJ A;  3FMC A;  4ZI6 A;  3RZA A;  4TNU A;  2XEI A;  2AFU A;  4OKO A;  3FEE A;  4P10 A;  4LQG A;  4YU9 A;  5F09 A;  3KQX A;  2C6C A;  5D8N A;  4PXE A;  4UEE A;  2WZN A;  4B6Z A;  3IWW A;  2GLF A;  2C6P A;  4EFD A;  3NH5 A;  2OR4 A;  2PJ4 A;  2AFM A;  3SI2 A;  3CPA A;  4DUK A;  1YME A;  3PBB A;  1QQ9 A;  1LOK A;  1TXR A;  4OIW A;  3TX8 A;  1IY7 A;  3GLJ A;  3KL9 A;  4ZY2 A;  1VHE A;  3V7Z A;  2VL1 A;  1DTD A;  1OBR A;  4WWV A;  4P45 A;  4K3N A;  4X2T A;  3BI0 A;  2PVW A;  5K8N A;  3B3V A;  3NA6 A;  4NGR A;  1F2O A;  1CG2 A;  4NFR A;  4FAI A;  4MHN A;  4GM5 A;  3L2N A;  3RBU A;  4P4J A;  2AFW A;  2XEG A;  1CBX A;  3HLP A;  1HDU A;  2PJA A;  4P4I A;  1JQG A;  4OC2 A;  5ELY A;  3WT4 A;  5D29 A;  1CX8 A;  1QMU A;  2PIY A;  4P4D A;  4FWU A;  2PJ8 A;  1CP6 A;  5LRK A;  1ZG9 A;  3S9L A;  4PXC A;  2CIJ A;  2PCU A;  1KWM A;  1CP7 A;  3NH8 A;  3KGQ A;  2DEA A;  2XEJ A;  1Z2L A;  2NYQ A;  1Q7L A;  3H8G A;  4NJR A;  1VIX A;  5THW A;  3B3S A;  2C6G A;  4OC3 A;  4P4E A;  4MCP A;  1IGB A;  4YWY A;  3IFE A;  4H2K A;  1ZLH A;  3SI1 A;  4Q7A A;  4ZX8 A;  4NGP A;  4FBE A;  2ZEF A;  4OID A;  5JM6 A;  1HDQ A;  2F7V A;  3SJX A;  7CPA A;  4OME A;  4RUH A;  4ZYQ A;  1EE3 P;  4A94 A;  1ZG8 A;  4A38 A;  4CPA A;  4UIA A;  4R7M A;  1LAP A;  4OC5 A;  2BOA A;  1R43 A;  2PJ7 A;  3PB6 X;  4OC4 A;  5JH9 A;  2F8H A;  2XEF A;  8CPA A;  1Y7E A;  3PFO A;  3D67 A;  3KI9 A;  3KR4 A;  2PVV A;  4NGS A;  3VH9 A;  3T8W A;  1VGY A;  5HVG A;  5K8M A;  4OC1 A;  4MHZ A;  1YW6 A;  2EWB A;  2V8V A;  3PB7 X;  4F9U A;  4P4B A;  1ARM A;  4P6Y A;  1TKF A;  3DGV A;  1NSA A;  2BO9 A;  4ZX9 A;  2GU2 A;  2PJ1 A;  1RTQ A;  1BPN A;  1CPS A;  3GUX A;  3NFZ A;  5CPA A;  4G1P A;  5CBM A;  4NGN A;  2PJB A;  3H8E A;  2FVG A;  3TC8 A;  3B35 A;  1XMB A;  3GB0 A;  1TKH A;  5K8O A;  3IIB A;  3S9N A;  5LYD A;  5LRJ A;  3SJF A;  1YSJ A;  3LMS A;  5K8P A;  4UF4 A;  1Z5R A;  3BHX A;  3SJE A;  3MN8 A;  3RAM A;  4EME A;  2ZEH A;  2C1C A;  1ZLI A;  2JBK A;  4TWE A;  1ARL A;  3IC1 A;  1XBU A;  1AYE A;  3B3W A;  3IEH A;  2JEW A;  1ELM P;  2PIZ A;  1H8L A;  1BLL E;  2QVP A;  2AFZ A;  1GYT A;  3ISZ A;  3PBE A;  3WC5 A;  3PB8 X;  2G9D A;  3FH4 A;  3PRT A;  3PB4 X;  1LAN A;  3CDX A;  2ZEN A;  4JYW A;  3MRU A;  3KAS A;  1XJO A;  4F9V A;  3D66 A;  2ZEG A;  1XRY A;  2ANP A;  2WYR A;  3K2K A;  1M4L A;  4JZ0 A;  4ZY0 A;  4MHY A;  1CPX A;  3DLJ A;  3QNV A;  4NGQ A;  2V8D A;  4IK2 A;  4UEF A;  1BAV A;  1R3N A;  2I3C A;  4PQA A;  3V38 A;  4IAV A;  2PJ0 A;  1ZG7 A;  4P4F A;  3WAB A;  1XFO A;  5J1Q A;  3D7G A;  1HEE A;  2O4H A;  2QJ8 A;  3JRU A;  2PJC A;  3KHX A;  5DS0 A;  4Z65 A;  2AFS A;  4ONW A;  3IO1 A;  3FEC A;  5JGF A;  2ZOG A;  1YW4 A;  3FVL A;  2RFH A;  1F2P A;  2EK8 A;  4MCQ A;  3NH4 A;  2ABZ A;  3SJG A;  2IJZ A;  2IQ6 A;  3FX6 A;  3KR5 A;  3PB9 X;  1FT7 A;  1LAM A;  2AFX A;  2V8G A;  3D7D A;  1VHO A;  4UIB A;  2V8H A;  5LYL A;  3KZW A;  1BPM A;  1TF8 A;  1Y0Y A;  1Z8L A;  2HC9 A;  2ZEE A;  1YLO A;  3D7F A;  3CT9 A;  5HXD A;  4MXU A;  3BI1 A;  3H8F A;  2OOT A;  2PJ2 A;  2POK A;  3WC6 A;  3FED A;  2CTC A;  4MCR A;  2EK9 A;  1PYT B;  3VAT A;  2Q43 A;  3N5F A;  4KSI A;  3HUV A;  2Q51 A;  2V77 A;  5IB9 A;  4OC0 A;  4A37 A;  3WC7 A;  2GLJ A;  2IMO A;  4A39 A;  4X3R A;  4IHM A;  1ELL P;  2JBJ A;  1TF9 A;  5I4M A;  4OP4 A;  4R6T A;  2ZEL A;  3B7I A;  3VAR A;  6CPA A;  2BCO A;  5LYF A;  4MRI A;  3PFE A;  4MHP A;  4PXB A;  3LWU A;  2J9A A;  2Q4Z A;  5HVH A;  3B2Y A;  5LRG A;  3S9M A;  2ZOF A;  2PJ9 A;  4MCS A;  5HVF A;  2RB7 A;  1DE4 C;  4X8I A;  4DYO A;  1UWY A;  3FJU A;  4WJB A;  3D4U A;  4PPZ A;  5LYI A;  3K9T A;  3I1U A;  2ZEP A;  4DJL A;  2O53 A;  3IJ3 A;  2HB6 A;  2PRQ A;  3B3C A;  2PJ6 A;  1F57 A;  4NGM A;  4UEZ A;  2CF4 A;  4AXV A;  2ZEM A;  2QYV A;  4EWT A;  2AFO A;  2PJ3 A;  2ZEO A;  3CPX A;  4P44 A;  2ZED A;  3FF3 A;  1AMP A;  4W9Y A;  3PEI A;  1Y0R A;  2CTB A;  3BXM A;  4PXD A;  4F8Z A;  4ZY1 A;  4R76 A;  2PE3 A;  2PJ5 A;  3D7H A;  4MMO A;  1FNO A;  2GRE A;  3B3T A;  3KHZ A;  3SI0 A;  4NJQ A;  1LFW A;  4R8F A;  1LCP A;  2NSM A;  3D68 A;  3ISX A;  1PCA A;  3KQZ A;  4FUU A; 
#chains in the Genus database with same CATH topology
 3C26 A;  4O23 A;  4BD9 A;  4B5O A;  4NGT A;  4C2Y A;  1TKJ A;  1KUV A;  3FMC A;  4ZI6 A;  2Z3M A;  2K5T A;  3RZA A;  4MY0 A;  3SXN A;  4TNU A;  1LRZ A;  1KUX A;  2AFU A;  1B87 A;  2VEZ A;  2XEI A;  3FEE A;  4OKO A;  2JDC A;  2H5M A;  4P10 A;  4LQG A;  4YU9 A;  1X10 A;  2WUU A;  5F09 A;  3KQX A;  2C6C A;  5D8N A;  4PXE A;  4UEE A;  2WZN A;  4AVB A;  2Q0Y A;  4KLV A;  4B6Z A;  4M6H A;  3IWW A;  4Y49 C;  2GLF A;  2ATR A;  1VHS A;  2C6P A;  4EFD A;  3TOB A;  3PP9 A;  3NH5 A;  4C2Z A;  1TIQ A;  2OR4 A;  4B12 A;  2PJ4 A;  2AFM A;  4A33 A;  3SI2 A;  3W6S A;  3CPA A;  1VKC A;  2YNC C;  4DUK A;  1YME A;  1XOV A;  2RC4 A;  3PBB A;  1QQ9 A;  2WPX A;  4MFZ A;  1LOK A;  1M44 A;  3GYA A;  1TXR A;  4MI4 A;  4OIW A;  5F46 A;  1IOF A;  3FNC A;  1PU9 A;  1IY7 A;  2OU2 A;  3GLJ A;  3KL9 A;  5DWN A;  3TX8 A;  4ZY2 A;  1Y9W A;  1YX0 A;  4QVT A;  1VHE A;  5G22 A;  4M6G A;  3R1K A;  3V7Z A;  2VL1 A;  1DTD A;  1OBR A;  2YND A;  3FRM A;  4WWV A;  4KOY A;  4UWI A;  4R3K A;  2R1I A;  4NXY A;  4P45 A;  4K3N A;  4CGP A;  4X2T A;  3BI0 A;  2G3A A;  2Q7B A;  2PVW A;  4J3G A;  2R8V A;  3T90 A;  4FD7 A;  4DNC A;  3FB3 A;  4KUA A;  5K8N A;  3WR7 A;  5JQ4 A;  3B3V A;  1XMT A;  3NA6 A;  1JWQ A;  2Z0Z A;  4H6U A;  4NGR A;  1F2O A;  1CG2 A;  3G8W A;  4KOT A;  4NFR A;  4X5K A;  4CGO A;  4FAI A;  4MHN A;  1CM0 A;  4GM5 A;  3L2N A;  3RBU A;  4P4J A;  2AFW A;  2XEG A;  1CBX A;  3HLP A;  1HDU A;  2PJA A;  4P4I A;  2I79 A;  1JQG A;  2R98 A;  3K9U A;  1V0C A;  4M3S A;  4LUA A;  4OC2 A;  5ELY A;  3WT4 A;  5D29 A;  1CX8 A;  2Q4V A;  5FVJ A;  2JLM A;  4YGO A;  4CS0 B;  1QMU A;  4FWU A;  4P4D A;  1P4N A;  2PJ8 A;  2CNM A;  3QAY A;  5CNP A;  4B13 A;  5J8C A;  1CP6 A;  5LRK A;  1ZG9 A;  1KUY A;  3S9L A;  1QSM A;  4KS9 A;  2BEI A;  2R7H A;  5HMN A;  4E8O A;  4PXC A;  2CIJ A;  2PCU A;  3QAH A;  1KWM A;  2WSA A;  1CP7 A;  2CY2 A;  4KOS A;  4NSQ A;  2B58 A;  3NH8 A;  1RO5 A;  3KGQ A;  4QBJ A;  2DEA A;  4YFJ A;  2XEJ A;  2J8M A;  1Z2L A;  2NYQ A;  1Q7L A;  4RS2 A;  4AB7 A;  3H8G A;  3R9F A;  4C68 A;  1XE4 A;  4NJR A;  1VIX A;  5THW A;  3B3S A;  2C6G A;  4OC3 A;  4HNX B;  4MHD A;  4P4E A;  4F0Y A;  4MCP A;  1IGB A;  4YWY A;  4PK2 A;  1BOB A;  4GS4 A;  3CXQ A;  2PR8 A;  3IFE A;  4H2K A;  4IUS A;  1ZLH A;  4RI1 A;  3SI1 A;  4Q7A A;  4ZX8 A;  3JUW A;  4C7H A;  1S7K A;  2HV2 A;  3H4Q A;  4NGP A;  4FBE A;  3LAC A;  4B5P B;  2GIV A;  4CGN A;  4NCZ A;  2ZEF A;  4OID A;  4MFL A;  3P2F A;  5JM6 A;  1MJA A;  5F48 A;  1HDQ A;  1K4J A;  2F7V A;  3SJX A;  7CPA A;  1J4J A;  4OME A;  4A30 A;  4RUH A;  4XPK A;  4ZYQ A;  5I0C A;  1AUG A;  3ZZI A;  1EE3 P;  4A94 A;  4QB9 A;  1XEB A;  1ZG8 A;  4EVY A;  1YRE A;  4A38 A;  4AVA A;  4CPA A;  2D4P A;  4UIA A;  4R7M A;  3JTK A;  1LAP A;  5AG5 A;  3RNZ A;  3F5B A;  4OC5 A;  3R9E A;  2BOA A;  1R43 A;  2CXA A;  1XIX A;  4B11 A;  4PK3 A;  2PJ7 A;  3PB6 X;  4OC4 A;  3T9Y A;  5JH9 A;  1Z4E A;  2F8H A;  1IB1 E;  2XEF A;  3TO7 A;  3TFY A;  2Z3O A;  4U5Y A;  1Y7E A;  8CPA A;  3NE7 A;  5G20 A;  3PFO A;  2CNT A;  3D67 A;  5E96 A;  3KI9 A;  3ZJ0 A;  5AG7 A;  4KOW A;  5KTC A;  4CYO A;  1MK4 A;  3KR4 A;  4HNY B;  2PVV A;  3TO9 A;  4NGS A;  4C2X A;  5EC4 A;  3VH9 A;  1Z8X A;  4QUS A;  1OZP A;  3S6F A;  1VGY A;  3T8W A;  2JDD A;  1YR0 A;  1I12 A;  1N71 A;  4OC1 A;  4B5P A;  5HVG A;  4MHZ A;  2OB0 A;  5K8M A;  1YW6 A;  2PR1 A;  2EWB A;  2V8V A;  3PB7 X;  4YRH A;  4CGL A;  4F9U A;  5A28 A;  2VXK A;  4P4B A;  1ARM A;  2GAN A;  2HQY A;  3IWE A;  4M6I A;  2ZW7 A;  4MFQ A;  4M85 A;  4P6Y A;  1TKF A;  3DGV A;  3I9S A;  4KOR A;  3S6G A;  3SXO A;  4NF1 A;  1NSA A;  3DSB A;  2BO9 A;  4FUU A;  4ZX9 A;  4A32 A;  2EUI A;  2GU2 A;  1YVK A;  2Z10 A;  4I49 A;  1M1D A;  5AG4 A;  2PJ1 A;  3PZJ A;  1RTQ A;  1BPN A;  4MJ8 A;  1CPS A;  3GUX A;  2J8R A;  3NFZ A;  2BSW A;  5CPA A;  2FT0 A;  3LD2 A;  4G1P A;  4RN7 A;  5CBM A;  4NGN A;  4NEX A;  4C7I A;  2PJB A;  2Y0M A;  3H8E A;  3EXN A;  1Q2D A;  3I3G A;  3UY5 A;  1P0H A;  2FVG A;  4CRZ B;  3TC8 A;  1Y7R A;  1I1D A;  3BJ7 A;  3B35 A;  3S6K A;  2B3U A;  3TOA A;  1XMB A;  4A31 A;  2C27 A;  2Z3N A;  3GB0 A;  4XNH C;  1TKH A;  5K8O A;  3IIB A;  4XPL A;  3S9N A;  1IU8 A;  2YNC A;  4AG9 A;  5LYD A;  5LRJ A;  4UFV A;  1R57 A;  2VBQ A;  4E2A A;  4BBH A;  3SJF A;  1YSJ A;  3LMS A;  4R87 A;  5IB0 A;  4KLW A;  4CRY B;  5K8P A;  5HH1 A;  1Q2Y A;  1Z5R A;  2B4D A;  4UF4 A;  5G21 A;  3BHX A;  2F5I A;  4CAW A;  5C88 A;  3FXT A;  3SJE A;  3MN8 A;  1M4G A;  3IGR A;  4FD6 A;  1YK3 A;  3GIU A;  1S7F A;  3RAM A;  4EME A;  2ZEH A;  2ZW4 A;  2C1C A;  1ZLI A;  4JD6 A;  4JLY A;  5IV0 A;  4OLL A;  4E0A A;  3MGD A;  2JBK A;  4QC6 A;  4TWE A;  1ARL A;  3IC1 A;  2PDO A;  1S7N A;  3DR6 A;  4MBU A;  1XBU A;  1AYE A;  3B3W A;  3IEH A;  4F6A A;  2JEW A;  1ELM P;  2PIZ A;  1H8L A;  3S6H A;  3FYN A;  2Q04 A;  3D3S A;  1BLL E;  2QVP A;  2AFZ A;  1FY7 A;  2QEC A;  3BLN A;  1GYT A;  3ISZ A;  3PBE A;  3WC5 A;  2I00 A;  2QIR A;  3PB8 X;  2G9D A;  3FH4 A;  3PRT A;  3PB4 X;  1XF8 A;  1LAN A;  3H5Z A;  4ZBG A;  2FIW A;  3CDX A;  2ZEN A;  4JYW A;  4MFP A;  3MRU A;  3KAS A;  1U6M A;  1XJO A;  2OZU A;  4F9V A;  2B4D B;  3D66 A;  2ZEG A;  2EVN A;  1XRY A;  2ANP A;  2Z3L A;  4A2Z A;  5C82 A;  1UFH A;  2GE3 A;  4CAV A;  2IL4 A;  2WYR A;  2Q7S A;  2A4N A;  3K2K A;  1M4L A;  4JZ0 A;  1SQH A;  3EC4 A;  4PSX A;  4ZY0 A;  4MHY A;  2Z3P A;  1CPX A;  3DLJ A;  3QNV A;  4NGQ A;  2Z3K A;  1MJB A;  2V8D A;  3P2H A;  2B3V A;  4IK2 A;  5KTD A;  3RYO A;  4UEF A;  4H6Z A;  1BAV A;  1R3N A;  3TT2 A;  1YQE A;  5J8F A;  2I3C A;  4PQA A;  1A2Z A;  3V38 A;  1Z8W A;  4IAV A;  4JJX A;  2PJ0 A;  4UFX A;  3KKW A;  1ZG7 A;  3W6X A;  4U9Y A;  2ZPA A;  4P4F A;  2OH1 A;  3WAB A;  1XFO A;  1S5K A;  2Q44 A;  5J1Q A;  3D7G A;  1B6B A;  1HEE A;  1L0C A;  1WWZ A;  2O4H A;  2QJ8 A;  3D2P A;  2PJC A;  3JRU A;  2REF A;  2YNE A;  3KHX A;  3D2M A;  3V8I A;  3PGP A;  2OZG A;  5DS0 A;  2NMT A;  1MJ9 A;  4Z65 A;  1M4I A;  4K30 A;  1GHE A;  1PUA A;  2AFS A;  5H84 A;  4ONW A;  2AJ6 A;  2FXF A;  5DWM A;  3IO1 A;  1BO4 A;  5BWA B;  3FEC A;  1S3Z A;  1S60 A;  2O28 A;  2VZY A;  5JGF A;  2ZOG A;  3VWE A;  2B5G A;  2Q4Y A;  1I21 A;  1YW4 A;  3F0A A;  3FVL A;  2RFH A;  1F2P A;  2EK8 A;  4B14 A;  1Z4R A;  4ONU A;  3B8G A;  4MCQ A;  2P0W A;  2ABZ A;  2FIA A;  1Z9U A;  2IJZ A;  2IQ6 A;  3NH4 A;  2PC1 A;  3SJG A;  2ARH A;  3CXP A;  3FX6 A;  4CGM A;  3KR5 A;  3PB9 X;  1FT7 A;  1LAM A;  4KZT A;  4Q38 A;  4A95 A;  4XNH B;  4KOV A;  1IYK A;  2AFX A;  2DXQ A;  5GCN A;  2V8G A;  3D7D A;  4CAF A;  4R57 A;  3LOD A;  3W91 A;  1VHO A;  4UIB A;  2V8H A;  4PV6 A;  2B5G B;  5LYL A;  3KZW A;  2P6F A;  3GKR A;  3A9L A;  4KVO E;  1BPM A;  1TF8 A;  1Y0Y A;  1Z8L A;  2EO8 A;  4CAE A;  4PSW A;  4B10 A;  1X12 A;  2HC9 A;  2ZEE A;  1YLO A;  2YGW A;  4UA3 A;  2FE7 A;  5F49 A;  3D7F A;  3CT9 A;  5G1Z A;  5HXD A;  5AGE A;  3TCV A;  4MXU A;  3BI1 A;  3H8F A;  2OOT A;  4GXH A;  1NSL A;  4XPD C;  2PJ2 A;  1QSN A;  2POK A;  4KSF A;  3FED A;  3WC6 A;  2CTC A;  5AG6 A;  4MCR A;  2EK9 A;  4UCM A;  3JVN A;  4R3L A;  4U9Z A;  4UCN A;  3TTH A;  1ON0 A;  3OWC A;  1S7L A;  4UWJ A;  1PYT B;  4MFK A;  3VAT A;  2ODF A;  2J8N A;  2X7B A;  2Q43 A;  3N5F A;  3F8K A;  4KSI A;  3HUV A;  2Q51 A;  1YVO A;  2QML A;  2DPS A;  2V77 A;  4OC0 A;  4BMH A;  5IB9 A;  3FIX A;  4LQ6 A;  4KUB A;  4A37 A;  4F0X A;  4UFW A;  3WC7 A;  3IU2 A;  4KVM E;  2GLJ A;  2DPT A;  2IMO A;  2CNS A;  4IF5 A;  4A39 A;  1IOI A;  4X3R A;  3FBU A;  2VZZ A;  4IHM A;  2DF5 A;  2PQ8 A;  1ELL P;  2JBJ A;  4JXR A;  2GFQ A;  1KZF A;  2Z11 A;  1TF9 A;  5I4M A;  4OP4 A;  1NMT A;  4FD4 A;  4L89 A;  4KVX A;  3VWD A;  4R6T A;  2P6G A;  4II9 A;  1IYL A;  1IID A;  1YLE A;  2ZEL A;  4R9M A;  5H86 A;  3B7I A;  4LX9 A;  3VAR A;  6CPA A;  3R95 A;  2BCO A;  1QSR A;  5LYF A;  4MRI A;  4FD5 A;  4AVC A;  4KOU A;  2KCW A;  3PFE A;  2P6E A;  2FCK A;  5F47 A;  3TE4 A;  1CJW A;  1IIC A;  3TO6 A;  3G3S A;  4MHP A;  2FSR A;  4PXB A;  3LWU A;  4CAX A;  2J9A A;  2Q4Z A;  5HVH A;  3B2Y A;  3EFA A;  4MY3 A;  5LRG A;  1RXT A;  1ZO0 A;  2ZXV A;  4OAD A;  4Y49 B;  3S9M A;  4CYN A;  3QB8 A;  2BUE A;  2ZOF A;  3EY5 A;  4MFJ A;  1Z8T A;  2PJ9 A;  3DNS A;  4AG7 A;  1Y9K A;  5A27 A;  5JPH A;  3R96 A;  2ZW5 A;  3RO0 A;  2FS5 A;  4MCS A;  5ISV A;  5HVF A;  2VQY A;  2RB7 A;  1WK4 A;  2PRB A;  4L8A A;  1DE4 C;  4HKF A;  4X8I A;  4DYO A;  4BIN A;  2PSW A;  1UWY A;  3FJU A;  4WJB A;  3D4U A;  4PPZ A;  5LYI A;  3K9T A;  1QST A;  4HNW B;  2REE A;  3I1U A;  2ZEP A;  1M4D A;  3R9G A;  2ZW6 A;  4DJL A;  2B4B A;  3BJ8 A;  2O53 A;  4HPS A;  1NE9 A;  4CYP A;  3IJ3 A;  2OZH A;  3E0K A;  4H89 A;  2AE6 A;  2PRQ A;  2HB6 A;  3B3C A;  2PJ6 A;  1F57 A;  3NE8 A;  4NGM A;  1Q2C A;  1YGH A;  2HUZ A;  4UEZ A;  2CF4 A;  2G3T A;  3IU1 A;  4AXV A;  4CYQ A;  3CZX A;  2JEV A;  4ZGY B;  5IX3 A;  2ZEM A;  2G0B A;  2QYV A;  4EWT A;  3DDD A;  2AFO A;  5EMI A;  2PJ3 A;  2ZEO A;  3CPX A;  3IWG A;  2ZED A;  3D8P A;  1AMP A;  1QSO A;  3EO4 A;  3FF3 A;  3PEI A;  4ORF A;  4P44 A;  4W9Y A;  4OAE A;  1Y0R A;  2CTB A;  3BXM A;  4PXD A;  4F8Z A;  4UBR A;  3DR8 A;  4JWP A;  3SHP A;  5EBV A;  4KOX A;  4ZY1 A;  4Q36 A;  4R76 A;  4XPD B;  3GY9 A;  4UCP A;  2PE3 A;  2PJ5 A;  2D4O A;  3D7H A;  1FNO A;  4MMO A;  2GRE A;  4JXQ A;  2EBJ A;  3B3T A;  3KHZ A;  3SI0 A;  4NJQ A;  3N7Z A;  1LFW A;  3CXS A;  1LCP A;  2NSM A;  4R8F A;  5KTA A;  2FL4 A;  4KSA A;  2VI7 A;  3D68 A;  3ISX A;  2BL1 A;  1PCA A;  3KQZ A;  2PIY A;  2WPW A; 
#chains in the Genus database with same CATH homology
 4O23 A;  4BD9 A;  4NGT A;  1TKJ A;  3FMC A;  4ZI6 A;  3RZA A;  4TNU A;  2XEI A;  2AFU A;  4OKO A;  3FEE A;  4P10 A;  4LQG A;  4YU9 A;  5F09 A;  3KQX A;  2C6C A;  5D8N A;  4PXE A;  4UEE A;  2WZN A;  4B6Z A;  3IWW A;  2GLF A;  2C6P A;  4EFD A;  3NH5 A;  2OR4 A;  2PJ4 A;  2AFM A;  3SI2 A;  3CPA A;  4DUK A;  1YME A;  3PBB A;  1QQ9 A;  1LOK A;  1TXR A;  4OIW A;  3TX8 A;  1IY7 A;  3GLJ A;  3KL9 A;  4ZY2 A;  1VHE A;  3V7Z A;  2VL1 A;  1DTD A;  1OBR A;  4WWV A;  4P45 A;  4K3N A;  4X2T A;  3BI0 A;  2PVW A;  5K8N A;  3B3V A;  3NA6 A;  4NGR A;  1F2O A;  1CG2 A;  4NFR A;  4FAI A;  4MHN A;  4GM5 A;  3L2N A;  3RBU A;  4P4J A;  2AFW A;  2XEG A;  1CBX A;  3HLP A;  1HDU A;  2PJA A;  4P4I A;  1JQG A;  4OC2 A;  5ELY A;  3WT4 A;  5D29 A;  1CX8 A;  1QMU A;  2PIY A;  4P4D A;  4FWU A;  2PJ8 A;  1CP6 A;  5LRK A;  1ZG9 A;  3S9L A;  4PXC A;  2CIJ A;  2PCU A;  1KWM A;  1CP7 A;  3NH8 A;  3KGQ A;  2DEA A;  2XEJ A;  1Z2L A;  2NYQ A;  1Q7L A;  3H8G A;  4NJR A;  1VIX A;  5THW A;  3B3S A;  2C6G A;  4OC3 A;  4P4E A;  4MCP A;  1IGB A;  4YWY A;  3IFE A;  4H2K A;  1ZLH A;  3SI1 A;  4Q7A A;  4ZX8 A;  4NGP A;  4FBE A;  2ZEF A;  4OID A;  5JM6 A;  1HDQ A;  2F7V A;  3SJX A;  7CPA A;  4OME A;  4RUH A;  4ZYQ A;  1EE3 P;  4A94 A;  1ZG8 A;  4A38 A;  4CPA A;  4UIA A;  4R7M A;  1LAP A;  4OC5 A;  2BOA A;  1R43 A;  2PJ7 A;  3PB6 X;  4OC4 A;  5JH9 A;  2F8H A;  2XEF A;  8CPA A;  1Y7E A;  3PFO A;  3D67 A;  3KI9 A;  3KR4 A;  2PVV A;  4NGS A;  3VH9 A;  3T8W A;  1VGY A;  5HVG A;  5K8M A;  4OC1 A;  4MHZ A;  1YW6 A;  2EWB A;  2V8V A;  3PB7 X;  4F9U A;  4P4B A;  1ARM A;  4P6Y A;  1TKF A;  3DGV A;  1NSA A;  2BO9 A;  4ZX9 A;  2GU2 A;  2PJ1 A;  1RTQ A;  1BPN A;  1CPS A;  3GUX A;  3NFZ A;  5CPA A;  4G1P A;  5CBM A;  4NGN A;  2PJB A;  3H8E A;  2FVG A;  3TC8 A;  3B35 A;  1XMB A;  3GB0 A;  1TKH A;  5K8O A;  3IIB A;  3S9N A;  5LYD A;  5LRJ A;  3SJF A;  1YSJ A;  3LMS A;  5K8P A;  4UF4 A;  1Z5R A;  3BHX A;  3SJE A;  3MN8 A;  3RAM A;  4EME A;  2ZEH A;  2C1C A;  1ZLI A;  2JBK A;  4TWE A;  1ARL A;  3IC1 A;  1XBU A;  1AYE A;  3B3W A;  3IEH A;  2JEW A;  1ELM P;  2PIZ A;  1H8L A;  1BLL E;  2QVP A;  2AFZ A;  1GYT A;  3ISZ A;  3PBE A;  3WC5 A;  3PB8 X;  2G9D A;  3FH4 A;  3PRT A;  3PB4 X;  1LAN A;  3CDX A;  2ZEN A;  4JYW A;  3MRU A;  3KAS A;  1XJO A;  4F9V A;  3D66 A;  2ZEG A;  1XRY A;  2ANP A;  2WYR A;  3K2K A;  1M4L A;  4JZ0 A;  4ZY0 A;  4MHY A;  1CPX A;  3DLJ A;  3QNV A;  4NGQ A;  2V8D A;  4IK2 A;  4UEF A;  1BAV A;  1R3N A;  2I3C A;  4PQA A;  3V38 A;  4IAV A;  2PJ0 A;  1ZG7 A;  4P4F A;  3WAB A;  1XFO A;  5J1Q A;  3D7G A;  1HEE A;  2O4H A;  2QJ8 A;  3JRU A;  2PJC A;  3KHX A;  5DS0 A;  4Z65 A;  2AFS A;  4ONW A;  3IO1 A;  3FEC A;  5JGF A;  2ZOG A;  1YW4 A;  3FVL A;  2RFH A;  1F2P A;  2EK8 A;  4MCQ A;  3NH4 A;  2ABZ A;  3SJG A;  2IJZ A;  2IQ6 A;  3FX6 A;  3KR5 A;  3PB9 X;  1FT7 A;  1LAM A;  2AFX A;  2V8G A;  3D7D A;  1VHO A;  4UIB A;  2V8H A;  5LYL A;  3KZW A;  1BPM A;  1TF8 A;  1Y0Y A;  1Z8L A;  2HC9 A;  2ZEE A;  1YLO A;  3D7F A;  3CT9 A;  5HXD A;  4MXU A;  3BI1 A;  3H8F A;  2OOT A;  2PJ2 A;  2POK A;  3WC6 A;  3FED A;  2CTC A;  4MCR A;  2EK9 A;  1PYT B;  3VAT A;  2Q43 A;  3N5F A;  4KSI A;  3HUV A;  2Q51 A;  2V77 A;  5IB9 A;  4OC0 A;  4A37 A;  3WC7 A;  2GLJ A;  2IMO A;  4A39 A;  4X3R A;  4IHM A;  1ELL P;  2JBJ A;  1TF9 A;  5I4M A;  4OP4 A;  4R6T A;  2ZEL A;  3B7I A;  3VAR A;  6CPA A;  2BCO A;  5LYF A;  4MRI A;  3PFE A;  4MHP A;  4PXB A;  3LWU A;  2J9A A;  2Q4Z A;  5HVH A;  3B2Y A;  5LRG A;  3S9M A;  2ZOF A;  2PJ9 A;  4MCS A;  5HVF A;  2RB7 A;  1DE4 C;  4X8I A;  4DYO A;  1UWY A;  3FJU A;  4WJB A;  3D4U A;  4PPZ A;  5LYI A;  3K9T A;  3I1U A;  2ZEP A;  4DJL A;  2O53 A;  3IJ3 A;  2HB6 A;  2PRQ A;  3B3C A;  2PJ6 A;  1F57 A;  4NGM A;  4UEZ A;  2CF4 A;  4AXV A;  2ZEM A;  2QYV A;  4EWT A;  2AFO A;  2PJ3 A;  2ZEO A;  3CPX A;  4P44 A;  2ZED A;  3FF3 A;  1AMP A;  4W9Y A;  3PEI A;  1Y0R A;  2CTB A;  3BXM A;  4PXD A;  4F8Z A;  4ZY1 A;  4R76 A;  2PE3 A;  2PJ5 A;  3D7H A;  4MMO A;  1FNO A;  2GRE A;  3B3T A;  3KHZ A;  3SI0 A;  4NJQ A;  1LFW A;  4R8F A;  1LCP A;  2NSM A;  3D68 A;  3ISX A;  1PCA A;  3KQZ A;  4FUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...