1XJOA

Structure of aminopeptidase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
277
structure length
270
Chain Sequence
b'APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE
publication title Streptomyces griseus aminopeptidase: X-ray crystallographic structure at 1.75 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 101
structure length 270
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 1996-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1xjoA00
1JQGA 2F8HA 1ZG9A 3VARA 4MMOA 5LYLA 3IC1A 1CG2A 1AMPA 3JRUA 1LANA 2PJ5A 2PJ9A 1TF8A 3DGVA 1EE3P 2PJ1A 4OC3A 3TC8A 2XEJA 3CDXA 4MHZA 3H8GA 4NGMA 7CPAA 4NFRA 5F09A 3PFEA 3V7ZA 2GU2A 4IHMA 3S9LA 3K2KA 5I4MA 3KR4A 4IAVA 3RAMA 4NGPA 4A39A 3PBBA 3PB9X 3HUVA 1Y7EA 2AFWA 2JBKA 3D7DA 3WC6A 1NSAA 8CPAA 1VIXA 4MCRA 3GB0A 4FUUA 3ISXA 5LYFA 3IFEA 3WABA 1XJOA 4FWUA 4P10A 4MRIA 3I1UA 4F9UA 4FAIA 6CPAA 3B3WA 3KL9A 1PYTB 4ZY0A 4PQAA 3SI1A 1R3NA 2PJ6A 4ZI6A 1Y0YA 3ISZA 2PE3A 2EK9A 3MN8A 4OC4A 1XBUA 4MHPA 3NH4A 5D8NA 3NH8A 3IO1A 1Q7LA 5K8NA 4ZY2A 4X2TA 1YW4A 3H8EA 2CF4A 4RUHA 3FVLA 2F7VA 3KQXA 2V8GA 5K8PA 2PJBA 3BHXA 4R76A 3KI9A 3B3SA 4ZYQA 5ELYA 2HB6A 4PXEA 3BI0A 2PJ2A 5J1QA 3RZAA 1XFOA 4P4IA 4NGRA 3WC5A 1KWMA 2XEFA 1HDUA 3FH4A 2IQ6A 3FMCA 4OP4A 5LRJA 1CP7A 4ZY1A 4IK2A 4KSIA 1ELLP 3FEDA 3CPAA 1F2PA 4B6ZA 2Q51A 2C6CA 2Q4ZA 4OIDA 4GM5A 1Z8LA 1F2OA 4MCSA 3SI0A 3PRTA 2J9AA 2ZEDA 2AFZA 4CPAA 4OC2A 2I3CA 2EWBA 2ZENA 3D67A 2G9DA 4PPZA 1LAPA 1QMUA 2GLJA 4NJRA 4UIAA 2ZEGA 1TF9A 2C1CA 1LCPA 2VL1A 5K8OA 1LFWA 2CTBA 2O53A 2C6PA 1IY7A 1CP6A 2FVGA 3V38A 5HVHA 3PBEA 4A38A 4TWEA 3PB6X 5DS0A 3LWUA 5LYIA 1VHEA 2ABZA 2PJ3A 5JGFA 3GUXA 4P4DA 3KR5A 2GREA 1CX8A 2QVPA 3IWWA 3T8WA 4NGSA 2GLFA 4TNUA 2PCUA 5LRKA 4R8FA 2PRQA 2AFXA 2EK8A 4OC0A 4EFDA 4MCQA 3B2YA 4LQGA 4PXDA 3KGQA 1LOKA 1ZG8A 2PJ8A 4X3RA 3BI1A 4UIBA 3IIBA 3SI2A 4A37A 1LAMA 4UEEA 4AXVA 1FNOA 4JYWA 2DEAA 2NYQA 2JEWA 1DE4C 2ZEHA 4NGNA 3D4UA 3PB7X 1ELMP 3IJ3A 1ARMA 4P4FA 1XRYA 4ZX8A 1CPXA 4WWVA 2WYRA 2PVVA 1QQ9A 4F8ZA 1R43A 3DLJA 3B7IA 3N5FA 3KHZA 1DTDA 3KZWA 4YU9A 2PJ4A 3D7GA 2JBJA 4WJBA 2V8VA 4P4EA 5CBMA 2PVWA 2QJ8A 3VATA 5CPAA 4ZX9A 2ZELA 1ZLHA 3PB4X 5IB9A 1IGBA 1RTQA 1BLLE 2HC9A 2OOTA 2XEIA 1YMEA 4YWYA 1TKFA 3TX8A 2PJAA 5HVFA 2CTCA 4MHNA 3B35A 3KASA 3FX6A 4EMEA 2AFOA 3B3TA 1BAVA 2Q43A 4UEZA 2AFUA 4OKOA 2QYVA 2ZEFA 3SJFA 1H8LA 2V8DA 2PIYA 3HLPA 4OC1A 4R6TA 2V77A 4OIWA 4UEFA 1XMBA 3NA6A 4R7MA 1VGYA 3KQZA 2IMOA 4DJLA 3SJEA 4MXUA 2WZNA 3BXMA 2O4HA 2XEGA 3IEHA 1TXRA 2PJ0A 4DYOA 1BPMA 4NGQA 2OR4A 2ZEOA 1ARLA 2AFMA 5LYDA 1AYEA 2RB7A 5JM6A 2C6GA 3LMSA 5D29A 2V8HA 3NFZA 4P45A 1ZG7A 1Z5RA 3K9TA 1YLOA 2ZOFA 3PB8X 1UWYA 5JH9A 3B3VA 1BPNA 4NJQA 3L2NA 2NSMA 2RFHA 3CPXA 4EWTA 3WT4A 3S9MA 2ZEMA 1Z2LA 5HXDA 1YSJA 2ZOGA 4JZ0A 3SJGA 3FECA 4ONWA 4NGTA 5K8MA 1CPSA 1PCAA 3S9NA 4P4BA 1TKJA 3FEEA 2PIZA 2BOAA 3D7HA 5LRGA 2ANPA 4PXBA 2BCOA 5THWA 2ZEEA 2BO9A 4P6YA 3D66A 4P44A 3SJXA 4BD9A 4K3NA 1F57A 2ZEPA 2IJZA 1FT7A 4O23A 4OMEA 4MHYA 3GLJA 1M4LA 1Y0RA 3CT9A 3FF3A 4DUKA 2AFSA 3H8FA 4PXCA 1HDQA 4F9VA 3KHXA 5HVGA 1TKHA 2CIJA 3D7FA 2PJCA 3MRUA 1HEEA 3QNVA 3NH5A 4G1PA 1YW6A 3VH9A 3FJUA 3PEIA 4W9YA 1GYTA 4Z65A 4UF4A 4MCPA 4A94A 4P4JA 3RBUA 3WC7A 2PJ7A 3PFOA 4Q7AA 4FBEA 2POKA 3D68A 4X8IA 1CBXA 1ZLIA 4OC5A 1VHOA 4H2KA 3B3CA 1OBRA
chains in the Genus database with same CATH superfamily
1JQGA 2F8HA 2GANA 3TO7A 1ZG9A 1VKCA 3VARA 4CYNA 4MMOA 4F0XA 5LYLA 3IC1A 1AMPA 1CG2A 3JRUA 1LANA 2PJ5A 2PJ9A 1TF8A 5IX3A 3DGVA 3A9LA 4R3LA 1EE3P 4R3KA 4ZGYB 5C88A 1IYKA 1YK3A 2PR1A 2Z3OA 2ODFA 2PJ1A 1YR0A 4KLVA 4ZBGA 1M4DA 1QSMA 5IB0A 4NEXA 4OC3A 3TC8A 2XEJA 2B58A 3CDXA 3ZJ0A 1Y9WA 3DSBA 4MHZA 2FL4A 3H8GA 3I9SA 4NGMA 2JEVA 7CPAA 2ZW7A 4NFRA 5F09A 1L0CA 3DR8A 2P6FA 3PZJA 2OZUA 4U5YA 2JDCA 2Q7SA 5EC4A 4QBJA 3PFEA 4MHDA 3V7ZA 2GU2A 1MJ9A 4IHMA 4C7IA 3S9LA 4XPKA 1NSLA 3K2KA 4CYPA 2K5TA 5HMNA 3EXNA 4Y49B 2B4BA 4JD6A 5I4MA 3KR4A 4IAVA 1X10A 2YNCA 3D8PA 4UCPA 3RAMA 4NGPA 5KTCA 3I3GA 3PBBA 4Q36A 3S6GA 4A39A 3PB9X 3HUVA 4GS4A 2Q0YA 3VWEA 4JXQA 1Y7EA 2AFWA 2B4DA 2YNDA 3RYOA 2JBKA 3D7DA 4NXYA 3WR7A 5J8FA 1XE4A 5F46A 3WC6A 1NSAA 3JUWA 1VIXA 2FT0A 4MCRA 3GB0A 4FUUA 3ISXA 5EMIA 8CPAA 5LYFA 4Q38A 3IFEA 3WABA 1XJOA 4FWUA 4P10A 4MRIA 3W6XA 4QVTA 3I1UA 2WSAA 2DF5A 4F9UA 4FAIA 1UFHA 4HNXB 4M6HA 3B3WA 4R9MA 3KL9A 1PYTB 4ZY0A 4PQAA 3GKRA 6CPAA 4QC6A 3SI1A 1R3NA 2FIWA 2PJ6A 2BL1A 1Y0YA 3N7ZA 4ONUA 4ZI6A 3ISZA 2PE3A 3R96A 2EK9A 4AG9A 3MN8A 2Z10A 4OC4A 4E8OA 1XBUA 4MHPA 3NH4A 5D8NA 3NH8A 4JWPA 2GE3A 3IO1A 1Q7LA 5K8NA 4ZY2A 4X2TA 1YW4A 4M3SA 4C2ZA 2WPWA 1XOVA 4UFWA 3H8EA 4KORA 3D2MA 2CF4A 4RUHA 3FVLA 1V0CA 4KVME 3FNCA 2F7VA 1PU9A 3KQXA 4KVOE 4AVCA 3TO6A 4XNHC 2V8GA 5K8PA 3CXQA 5H86A 3G3SA 2Z3PA 2PJBA 3BHXA 1N71A 3GIUA 4R76A 4BBHA 3KI9A 3B3SA 1IU8A 4QB9A 4ZYQA 2Q7BA 4B5OA 2VBQA 1A2ZA 1I21A 5ELYA 2HB6A 4UFVA 5C82A 1KZFA 2OZGA 3KKWA 1Y7RA 3BI0A 4PXEA 2PJ2A 5J1QA 1WWZA 3BLNA 1IIDA 5AG4A 2FXFA 5A27A 3RZAA 1Y9KA 1M1DA 4B14A 4MFZA 3MGDA 3DR6A 2J8RA 3H5ZA 3JTKA 4XPDB 1S60A 1XEBA 2FSRA 4M85A 2Z3KA 1XFOA 4P4IA 1I12A 4R57A 1LRZA 3IU2A 4NGRA 3WC5A 4UCNA 1KWMA 2XEFA 3IWEA 1HDUA 1ON0A 3FH4A 2IQ6A 2GIVA 4CGPA 3FMCA 4OP4A 4UWJA 5LRJA 2VZYA 1CP7A 2P6GA 4H6ZA 4ZY1A 1Z4RA 4IK2A 4KSIA 1ELLP 3FEDA 3CPAA 1F2PA 3QB8A 4B6ZA 2Q51A 2C6CA 4NF1A 2Q4ZA 1FY7A 4JLYA 4H6UA 4OIDA 1S7FA 2B5GB 2Q4VA 1Z8LA 1F2OA 4GM5A 4MCSA 5F48A 2Q4YA 2WUUA 3SI0A 2OH1A 4KSFA 3PRTA 2J9AA 2ZEDA 3NE8A 3PP9A 3EFAA 2AFZA 3B8GA 4OC2A 4CPAA 1M44A 3LODA 2I3CA 2DPSA 3H4QA 1TIQA 3F8KA 4Y49C 2EWBA 2ZENA 3D67A 3EC4A 2G9DA 4OLLA 3FYNA 1LAPA 4PPZA 1QMUA 1YQEA 2GLJA 4NJRA 2Z3LA 4UIAA 4CAXA 2ZEGA 2Z11A 3IWGA 1TF9A 2C1CA 2Z3NA 1LCPA 2PRBA 2VL1A 2JLMA 4HNYB 5K8OA 1LFWA 2CTBA 2ATRA 3C26A 2O53A 2C6PA 2I00A 1IY7A 1QSNA 1CP6A 2D4PA 1IYLA 2FVGA 4MBUA 4MI4A 3V38A 2VI7A 5HVHA 4UFXA 3PBEA 3RO0A 3S6HA 4FD6A 4A38A 2CNTA 4TWEA 3PB6X 4AVAA 4PV6A 5DS0A 1RXTA 3CXSA 5DWMA 4B5PA 3LWUA 4AG7A 5LYIA 3TOBA 4CAWA 1VHEA 2ABZA 4M6IA 2CY2A 1KUYA 2PJ3A 5JGFA 3F5BA 3E0KA 3GUXA 3EY5A 3NE7A 4P4DA 5AGEA 3TOAA 3KR5A 4A32A 2GREA 1QSTA 2R1IA 1ZO0A 1CX8A 2QVPA 4FD4A 1BOBA 3IWWA 4CYQA 4C2XA 3T8WA 4NGSA 2WPXA 2GLFA 4NCZA 4TNUA 2DXQA 2R98A 3K9UA 2PCUA 1IOFA 2R8VA 2YNCC 3CXPA 4HNWB 3JVNA 5LRKA 2J8NA 1Q2YA 1WK4A 4KS9A 4R8FA 2PRQA 5AG6A 2F5IA 2AFXA 3TE4A 4BINA 4KOUA 2EK8A 1YVKA 2ZW5A 2CNMA 1S7NA 5A28A 2EO8A 4OC0A 4EVYA 1IICA 5J8CA 4ORFA 3D2PA 4EFDA 4C68A 4MCQA 3B2YA 4LQGA 4PXDA 2G3TA 4YFJA 5I0CA 3KGQA 4QUSA 2GFQA 1LOKA 1ZG8A 2PJ8A 4X3RA 3BI1A 4U9YA 4L89A 4UIBA 3ZZIA 3IIBA 4IUSA 3SI2A 4A37A 1LAMA 4UEEA 4B5PB 4AXVA 1FNOA 1OZPA 4JYWA 2RC4A 2DEAA 1AUGA 2NYQA 2JEWA 3R1KA 1DE4C 2ZEHA 3CZXA 4KSAA 4MFJA 4NGNA 2DPTA 2B5GA 4XPDC 3D4UA 3PB7X 1ELMP 3IJ3A 1ARMA 4L8AA 1XRYA 2CXAA 4P4FA 4ZX8A 1CPXA 4FD7A 1U6MA 4PSXA 2YNEA 4WWVA 2PSWA 2WYRA 3S6FA 2PVVA 1QQ9A 4F8ZA 1R43A 3DLJA 3IU1A 2G3AA 3B7IA 5G22A 4II9A 2X7BA 3N5FA 3KHZA 4F6AA 3QAHA 1DTDA 1S5KA 3KZWA 4J3GA 4A30A 1MK4A 2A4NA 4YU9A 2PJ4A 3D7GA 4A95A 2JBJA 2YGWA 3FXTA 2V8VA 4WJBA 2HV2A 2Z0ZA 4P4EA 3D3SA 1KUVA 4PK2A 5E96A 1BO4A 5CBMA 4MY3A 3TT2A 2PVWA 2QJ8A 2VXKA 3LACA 3VATA 1PUAA 5CPAA 4ZX9A 5CNPA 2ZELA 2ZW4A 1ZLHA 3PB4X 2FIAA 5IB9A 2Y0MA 1IGBA 1RTQA 1BLLE 1MJBA 2HC9A 2OB0A 2BEIA 2XEIA 4KOSA 5AG7A 2OOTA 1XMTA 1YMEA 4KLWA 5G20A 4FD5A 1TKFA 2VZZA 4JJXA 2PJAA 4YWYA 5HVFA 3S6KA 3TX8A 4CRYB 4BMHA 1CM0A 4CGNA 2J8MA 2CTCA 1Z8WA 3OWCA 5KTAA 3QAYA 1M4GA 4MHNA 3B35A 3FB3A 4F0YA 2R7HA 1CJWA 3FX6A 3KASA 4U9ZA 1QSOA 4EMEA 4XNHB 4CGOA 2AFOA 4KOVA 3B3TA 1BAVA 2Q43A 4UEZA 2EUIA 4X5KA 3SXNA 2AFUA 4OKOA 4LQ6A 4CAVA 2QYVA 2ZEFA 2BSWA 1X12A 3SJFA 1H8LA 2V8DA 2PIYA 3HLPA 4OC1A 4R6TA 1K4JA 1Z4EA 2V77A 3FIXA 4MFLA 3RNZA 4OIWA 4UEFA 3R9GA 1XMBA 1YX0A 3NA6A 4R7MA 1VGYA 1P4NA 3KQZA 2IMOA 3PGPA 4DJLA 3SJEA 2AE6A 4LX9A 4E2AA 1NMTA 4MXUA 2WZNA 3BXMA 3R9FA 3R95A 2FE7A 5EBVA 2O4HA 2ARHA 2ZW6A 2XEGA 3IEHA 4KOTA 1TXRA 2PJ0A 4LUAA 1M4IA 2D4OA 2PQ8A 1MJAA 4DYOA 4AB7A 1B6BA 4KOXA 1BPMA 3R9EA 4NGQA 1KUXA 2OR4A 2ZEOA 1ARLA 2AFMA 5LYDA 1AYEA 4CGMA 2RB7A 5JM6A 2VEZA 1Q2DA 2ZPAA 4UWIA 1YGHA 3F0AA 2C6GA 3W6SA 2P0WA 3LMSA 3V8IA 2PR8A 4UA3A 3BJ7A 5D29A 4JXRA 2JDDA 2V8HA 3NFZA 2HQYA 2Z3MA 4P45A 4NSQA 5AG5A 5G21A 1ZG7A 1Z5RA 3K9TA 5FVJA 3UY5A 5IV0A 1J4JA 1YLOA 4CAFA 5GCNA 1S7LA 2QMLA 2ZOFA 3TTHA 3PB8X 2I79A 4RI1A 1UWYA 1Z9UA 4HKFA 5JH9A 3B3VA 4KUBA 2OU2A 1QSRA 4MFPA 5ISVA 2QIRA 1S3ZA 1BPNA 2B3VA 4CRZB 4NJQA 2C27A 2G0BA 2ZXVA 3L2NA 2NSMA 1S7KA 2RFHA 4XPLA 3CPXA 4KZTA 3SHPA 4EWTA 4DNCA 3T90A 3EO4A 3WT4A 1IB1E 3S9MA 1R57A 5JPHA 1P0HA 2QECA 4H89A 5BWAB 2ZEMA 1Z2LA 3VWDA 5HXDA 1YSJA 2ZOGA 4JZ0A 3SJGA 2AJ6A 3TO9A 3TFYA 3FECA 3P2HA 4KOWA 4C2YA 3FBUA 5KTDA 4ONWA 2REFA 3FRMA 4NGTA 5HH1A 4B12A 5K8MA 2Q44A 1CPSA 1PCAA 4YGOA 4AVBA 3S9NA 4P4BA 2B3UA 5F47A 1TKJA 4UCMA 3FEEA 2PIZA 2H5MA 2BOAA 3DDDA 1NE9A 3D7HA 4K30A 3G8WA 2PDOA 1GHEA 3SXOA 2REEA 4MFQA 4RN7A 3P2FA 2ANPA 4HPSA 4PXBA 4PSWA 5LRGA 4I49A 4KOYA 2BCOA 4RS2A 4MFKA 5THWA 4A31A 2ZEEA 2BO9A 3DNSA 4P6YA 2EBJA 4B11A 3D66A 4C7HA 2OZHA 4P44A 4KVXA 4B10A 2Q04A 3GYAA 1I1DA 3SJXA 4BD9A 4PK3A 1SQHA 4K3NA 1F57A 2FCKA 2PC1A 4YRHA 4CGLA 1Q2CA 2ZEPA 4CS0B 1VHSA 2IJZA 5F49A 1FT7A 1B87A 1Z8TA 4IF5A 4O23A 4OMEA 4MHYA 3W91A 4UBRA 3GLJA 2B4DB 4CAEA 1M4LA 1Y0RA 3CT9A 4OADA 3FF3A 4OAEA 4M6GA 4DUKA 2AFSA 3H8FA 2P6EA 1Z8XA 4PXCA 1HDQA 4F9VA 2BUEA 3KHXA 1TKHA 5DWNA 5HVGA 2EVNA 2HUZA 4E0AA 1YVOA 2KCWA 1JWQA 1YLEA 2CIJA 3D7FA 2PJCA 3MRUA 3T9YA 3LD2A 1HEEA 4A2ZA 2FS5A 3QNVA 3NH5A 2IL4A 5H84A 4B13A 4CYOA 4R87A 3GY9A 1RO5A 1YW6A 2CNSA 3FJUA 4G1PA 2VQYA 3PEIA 3TCVA 3VH9A 3BJ8A 4W9YA 1GYTA 4A33A 4Z65A 4UF4A 4MCPA 4A94A 4P4JA 5G1ZA 3RBUA 3WC7A 2PJ7A 4MY0A 3PFOA 4Q7AA 1XF8A 2NMTA 5JQ4A 3IGRA 4FBEA 2POKA 3D68A 4X8IA 1CBXA 1ZLIA 1IOIA 1VHOA 2O28A 4GXHA 4OC5A 4H2KA 4KUAA 4MJ8A 1YREA 3B3CA 1XIXA 1OBRA
chains in the Genus database with same CATH topology
1JQGA 2F8HA 1ZG9A 3VARA 4MMOA 5LYLA 3IC1A 1CG2A 1AMPA 3JRUA 1LANA 2PJ5A 2PJ9A 1TF8A 3DGVA 1EE3P 2PJ1A 4OC3A 3TC8A 2XEJA 3CDXA 4MHZA 3H8GA 4NGMA 7CPAA 4NFRA 5F09A 3PFEA 3V7ZA 2GU2A 4IHMA 3S9LA 3K2KA 5I4MA 3KR4A 4IAVA 3RAMA 4NGPA 4A39A 3PBBA 3PB9X 3HUVA 1Y7EA 2AFWA 2JBKA 3D7DA 3WC6A 1NSAA 8CPAA 1VIXA 4MCRA 3GB0A 4FUUA 3ISXA 5LYFA 3IFEA 3WABA 1XJOA 4FWUA 4P10A 4MRIA 3I1UA 4F9UA 4FAIA 6CPAA 3B3WA 3KL9A 1PYTB 4ZY0A 4PQAA 3SI1A 1R3NA 2PJ6A 4ZI6A 1Y0YA 3ISZA 2PE3A 2EK9A 3MN8A 4OC4A 1XBUA 4MHPA 3NH4A 5D8NA 3NH8A 3IO1A 1Q7LA 5K8NA 4ZY2A 4X2TA 1YW4A 3H8EA 2CF4A 4RUHA 3FVLA 2F7VA 3KQXA 2V8GA 5K8PA 2PJBA 3BHXA 4R76A 3KI9A 3B3SA 4ZYQA 5ELYA 2HB6A 4PXEA 3BI0A 2PJ2A 5J1QA 3RZAA 1XFOA 4P4IA 4NGRA 3WC5A 1KWMA 2XEFA 1HDUA 3FH4A 2IQ6A 3FMCA 4OP4A 5LRJA 1CP7A 4ZY1A 4IK2A 4KSIA 1ELLP 3FEDA 3CPAA 1F2PA 4B6ZA 2Q51A 2C6CA 2Q4ZA 4OIDA 4GM5A 1Z8LA 1F2OA 4MCSA 3SI0A 3PRTA 2J9AA 2ZEDA 2AFZA 4CPAA 4OC2A 2I3CA 2EWBA 2ZENA 3D67A 2G9DA 4PPZA 1LAPA 1QMUA 2GLJA 4NJRA 4UIAA 2ZEGA 1TF9A 2C1CA 1LCPA 2VL1A 5K8OA 1LFWA 2CTBA 2O53A 2C6PA 1IY7A 1CP6A 2FVGA 3V38A 5HVHA 3PBEA 4A38A 4TWEA 3PB6X 5DS0A 3LWUA 5LYIA 1VHEA 2ABZA 2PJ3A 5JGFA 3GUXA 4P4DA 3KR5A 2GREA 1CX8A 2QVPA 3IWWA 3T8WA 4NGSA 2GLFA 4TNUA 2PCUA 5LRKA 4R8FA 2PRQA 2AFXA 2EK8A 4OC0A 4EFDA 4MCQA 3B2YA 4LQGA 4PXDA 3KGQA 1LOKA 1ZG8A 2PJ8A 4X3RA 3BI1A 4UIBA 3IIBA 3SI2A 4A37A 1LAMA 4UEEA 4AXVA 1FNOA 4JYWA 2DEAA 2NYQA 2JEWA 1DE4C 2ZEHA 4NGNA 3D4UA 3PB7X 1ELMP 3IJ3A 1ARMA 4P4FA 1XRYA 4ZX8A 1CPXA 4WWVA 2WYRA 2PVVA 1QQ9A 4F8ZA 1R43A 3DLJA 3B7IA 3N5FA 3KHZA 1DTDA 3KZWA 4YU9A 2PJ4A 3D7GA 2JBJA 4WJBA 2V8VA 4P4EA 5CBMA 2PVWA 2QJ8A 3VATA 5CPAA 4ZX9A 2ZELA 1ZLHA 3PB4X 5IB9A 1IGBA 1RTQA 1BLLE 2HC9A 2OOTA 2XEIA 1YMEA 4YWYA 1TKFA 3TX8A 2PJAA 5HVFA 2CTCA 4MHNA 3B35A 3KASA 3FX6A 4EMEA 2AFOA 3B3TA 1BAVA 2Q43A 4UEZA 2AFUA 4OKOA 2QYVA 2ZEFA 3SJFA 1H8LA 2V8DA 2PIYA 3HLPA 4OC1A 4R6TA 2V77A 4OIWA 4UEFA 1XMBA 3NA6A 4R7MA 1VGYA 3KQZA 2IMOA 4DJLA 3SJEA 4MXUA 2WZNA 3BXMA 2O4HA 2XEGA 3IEHA 1TXRA 2PJ0A 4DYOA 1BPMA 4NGQA 2OR4A 2ZEOA 1ARLA 2AFMA 5LYDA 1AYEA 2RB7A 5JM6A 2C6GA 3LMSA 5D29A 2V8HA 3NFZA 4P45A 1ZG7A 1Z5RA 3K9TA 1YLOA 2ZOFA 3PB8X 1UWYA 5JH9A 3B3VA 1BPNA 4NJQA 3L2NA 2NSMA 2RFHA 3CPXA 4EWTA 3WT4A 3S9MA 2ZEMA 1Z2LA 5HXDA 1YSJA 2ZOGA 4JZ0A 3SJGA 3FECA 4ONWA 4NGTA 5K8MA 1CPSA 1PCAA 3S9NA 4P4BA 1TKJA 3FEEA 2PIZA 2BOAA 3D7HA 5LRGA 2ANPA 4PXBA 2BCOA 5THWA 2ZEEA 2BO9A 4P6YA 3D66A 4P44A 3SJXA 4BD9A 4K3NA 1F57A 2ZEPA 2IJZA 1FT7A 4O23A 4OMEA 4MHYA 3GLJA 1M4LA 1Y0RA 3CT9A 3FF3A 4DUKA 2AFSA 3H8FA 4PXCA 1HDQA 4F9VA 3KHXA 5HVGA 1TKHA 2CIJA 3D7FA 2PJCA 3MRUA 1HEEA 3QNVA 3NH5A 4G1PA 1YW6A 3VH9A 3FJUA 3PEIA 4W9YA 1GYTA 4Z65A 4UF4A 4MCPA 4A94A 4P4JA 3RBUA 3WC7A 2PJ7A 3PFOA 4Q7AA 4FBEA 2POKA 3D68A 4X8IA 1CBXA 1ZLIA 4OC5A 1VHOA 4H2KA 3B3CA 1OBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JQG A;  2F8H A;  1ZG9 A;  3VAR A;  4MMO A;  5LYL A;  3IC1 A;  1CG2 A;  1AMP A;  3JRU A;  1LAN A;  2PJ5 A;  2PJ9 A;  1TF8 A;  3DGV A;  1EE3 P;  2PJ1 A;  4OC3 A;  3TC8 A;  2XEJ A;  3CDX A;  4MHZ A;  3H8G A;  4NGM A;  7CPA A;  4NFR A;  5F09 A;  3PFE A;  3V7Z A;  2GU2 A;  4IHM A;  3S9L A;  3K2K A;  5I4M A;  3KR4 A;  4IAV A;  3RAM A;  4NGP A;  4A39 A;  3PBB A;  3PB9 X;  3HUV A;  1Y7E A;  2AFW A;  2JBK A;  3D7D A;  3WC6 A;  1NSA A;  8CPA A;  1VIX A;  4MCR A;  3GB0 A;  4FUU A;  3ISX A;  5LYF A;  3IFE A;  3WAB A;  1XJO A;  4FWU A;  4P10 A;  4MRI A;  3I1U A;  4F9U A;  4FAI A;  6CPA A;  3B3W A;  3KL9 A;  1PYT B;  4ZY0 A;  4PQA A;  3SI1 A;  1R3N A;  2PJ6 A;  4ZI6 A;  1Y0Y A;  3ISZ A;  2PE3 A;  2EK9 A;  3MN8 A;  4OC4 A;  1XBU A;  4MHP A;  3NH4 A;  5D8N A;  3NH8 A;  3IO1 A;  1Q7L A;  5K8N A;  4ZY2 A;  4X2T A;  1YW4 A;  3H8E A;  2CF4 A;  4RUH A;  3FVL A;  2F7V A;  3KQX A;  2V8G A;  5K8P A;  2PJB A;  3BHX A;  4R76 A;  3KI9 A;  3B3S A;  4ZYQ A;  5ELY A;  2HB6 A;  4PXE A;  3BI0 A;  2PJ2 A;  5J1Q A;  3RZA A;  1XFO A;  4P4I A;  4NGR A;  3WC5 A;  1KWM A;  2XEF A;  1HDU A;  3FH4 A;  2IQ6 A;  3FMC A;  4OP4 A;  5LRJ A;  1CP7 A;  4ZY1 A;  4IK2 A;  4KSI A;  1ELL P;  3FED A;  3CPA A;  1F2P A;  4B6Z A;  2Q51 A;  2C6C A;  2Q4Z A;  4OID A;  4GM5 A;  1Z8L A;  1F2O A;  4MCS A;  3SI0 A;  3PRT A;  2J9A A;  2ZED A;  2AFZ A;  4CPA A;  4OC2 A;  2I3C A;  2EWB A;  2ZEN A;  3D67 A;  2G9D A;  4PPZ A;  1LAP A;  1QMU A;  2GLJ A;  4NJR A;  4UIA A;  2ZEG A;  1TF9 A;  2C1C A;  1LCP A;  2VL1 A;  5K8O A;  1LFW A;  2CTB A;  2O53 A;  2C6P A;  1IY7 A;  1CP6 A;  2FVG A;  3V38 A;  5HVH A;  3PBE A;  4A38 A;  4TWE A;  3PB6 X;  5DS0 A;  3LWU A;  5LYI A;  1VHE A;  2ABZ A;  2PJ3 A;  5JGF A;  3GUX A;  4P4D A;  3KR5 A;  2GRE A;  1CX8 A;  2QVP A;  3IWW A;  3T8W A;  4NGS A;  2GLF A;  4TNU A;  2PCU A;  5LRK A;  4R8F A;  2PRQ A;  2AFX A;  2EK8 A;  4OC0 A;  4EFD A;  4MCQ A;  3B2Y A;  4LQG A;  4PXD A;  3KGQ A;  1LOK A;  1ZG8 A;  2PJ8 A;  4X3R A;  3BI1 A;  4UIB A;  3IIB A;  3SI2 A;  4A37 A;  1LAM A;  4UEE A;  4AXV A;  1FNO A;  4JYW A;  2DEA A;  2NYQ A;  2JEW A;  1DE4 C;  2ZEH A;  4NGN A;  3D4U A;  3PB7 X;  1ELM P;  3IJ3 A;  1ARM A;  4P4F A;  1XRY A;  4ZX8 A;  1CPX A;  4WWV A;  2WYR A;  2PVV A;  1QQ9 A;  4F8Z A;  1R43 A;  3DLJ A;  3B7I A;  3N5F A;  3KHZ A;  1DTD A;  3KZW A;  4YU9 A;  2PJ4 A;  3D7G A;  2JBJ A;  4WJB A;  2V8V A;  4P4E A;  5CBM A;  2PVW A;  2QJ8 A;  3VAT A;  5CPA A;  4ZX9 A;  2ZEL A;  1ZLH A;  3PB4 X;  5IB9 A;  1IGB A;  1RTQ A;  1BLL E;  2HC9 A;  2OOT A;  2XEI A;  1YME A;  4YWY A;  1TKF A;  3TX8 A;  2PJA A;  5HVF A;  2CTC A;  4MHN A;  3B35 A;  3KAS A;  3FX6 A;  4EME A;  2AFO A;  3B3T A;  1BAV A;  2Q43 A;  4UEZ A;  2AFU A;  4OKO A;  2QYV A;  2ZEF A;  3SJF A;  1H8L A;  2V8D A;  2PIY A;  3HLP A;  4OC1 A;  4R6T A;  2V77 A;  4OIW A;  4UEF A;  1XMB A;  3NA6 A;  4R7M A;  1VGY A;  3KQZ A;  2IMO A;  4DJL A;  3SJE A;  4MXU A;  2WZN A;  3BXM A;  2O4H A;  2XEG A;  3IEH A;  1TXR A;  2PJ0 A;  4DYO A;  1BPM A;  4NGQ A;  2OR4 A;  2ZEO A;  1ARL A;  2AFM A;  5LYD A;  1AYE A;  2RB7 A;  5JM6 A;  2C6G A;  3LMS A;  5D29 A;  2V8H A;  3NFZ A;  4P45 A;  1ZG7 A;  1Z5R A;  3K9T A;  1YLO A;  2ZOF A;  3PB8 X;  1UWY A;  5JH9 A;  3B3V A;  1BPN A;  4NJQ A;  3L2N A;  2NSM A;  2RFH A;  3CPX A;  4EWT A;  3WT4 A;  3S9M A;  2ZEM A;  1Z2L A;  5HXD A;  1YSJ A;  2ZOG A;  4JZ0 A;  3SJG A;  3FEC A;  4ONW A;  4NGT A;  5K8M A;  1CPS A;  1PCA A;  3S9N A;  4P4B A;  1TKJ A;  3FEE A;  2PIZ A;  2BOA A;  3D7H A;  5LRG A;  2ANP A;  4PXB A;  2BCO A;  5THW A;  2ZEE A;  2BO9 A;  4P6Y A;  3D66 A;  4P44 A;  3SJX A;  4BD9 A;  4K3N A;  1F57 A;  2ZEP A;  2IJZ A;  1FT7 A;  4O23 A;  4OME A;  4MHY A;  3GLJ A;  1M4L A;  1Y0R A;  3CT9 A;  3FF3 A;  4DUK A;  2AFS A;  3H8F A;  4PXC A;  1HDQ A;  4F9V A;  3KHX A;  5HVG A;  1TKH A;  2CIJ A;  3D7F A;  2PJC A;  3MRU A;  1HEE A;  3QNV A;  3NH5 A;  4G1P A;  1YW6 A;  3VH9 A;  3FJU A;  3PEI A;  4W9Y A;  1GYT A;  4Z65 A;  4UF4 A;  4MCP A;  4A94 A;  4P4J A;  3RBU A;  3WC7 A;  2PJ7 A;  3PFO A;  4Q7A A;  4FBE A;  2POK A;  3D68 A;  4X8I A;  1CBX A;  1ZLI A;  4OC5 A;  1VHO A;  4H2K A;  3B3C A;  1OBR A; 
#chains in the Genus database with same CATH topology
 1JQG A;  2F8H A;  2GAN A;  3TO7 A;  1ZG9 A;  1VKC A;  3VAR A;  4CYN A;  4MMO A;  4F0X A;  5LYL A;  3IC1 A;  1AMP A;  1CG2 A;  3JRU A;  1LAN A;  2PJ5 A;  2PJ9 A;  1TF8 A;  5IX3 A;  3DGV A;  3A9L A;  4R3L A;  1EE3 P;  4R3K A;  4ZGY B;  5C88 A;  1IYK A;  1YK3 A;  2PR1 A;  2Z3O A;  2ODF A;  2PJ1 A;  1YR0 A;  4KLV A;  4ZBG A;  1M4D A;  1QSM A;  5IB0 A;  4NEX A;  4OC3 A;  3TC8 A;  2XEJ A;  2B58 A;  3CDX A;  3ZJ0 A;  1Y9W A;  3DSB A;  4MHZ A;  2FL4 A;  3H8G A;  3I9S A;  4NGM A;  2JEV A;  7CPA A;  2ZW7 A;  4NFR A;  5F09 A;  1L0C A;  3DR8 A;  2P6F A;  3PZJ A;  2OZU A;  4U5Y A;  2JDC A;  2Q7S A;  5EC4 A;  4QBJ A;  3PFE A;  4MHD A;  3V7Z A;  2GU2 A;  1MJ9 A;  4IHM A;  4C7I A;  3S9L A;  4XPK A;  1NSL A;  3K2K A;  4CYP A;  2K5T A;  5HMN A;  3EXN A;  4Y49 B;  2B4B A;  4JD6 A;  5I4M A;  3KR4 A;  4IAV A;  1X10 A;  2YNC A;  3D8P A;  4UCP A;  3RAM A;  4NGP A;  5KTC A;  3I3G A;  3PBB A;  4Q36 A;  3S6G A;  4A39 A;  3PB9 X;  3HUV A;  4GS4 A;  2Q0Y A;  3VWE A;  4JXQ A;  1Y7E A;  2AFW A;  2B4D A;  2YND A;  3RYO A;  2JBK A;  3D7D A;  4NXY A;  3WR7 A;  5J8F A;  1XE4 A;  5F46 A;  3WC6 A;  1NSA A;  3JUW A;  1VIX A;  2FT0 A;  4MCR A;  3GB0 A;  4FUU A;  3ISX A;  5EMI A;  8CPA A;  5LYF A;  4Q38 A;  3IFE A;  3WAB A;  1XJO A;  4FWU A;  4P10 A;  4MRI A;  3W6X A;  4QVT A;  3I1U A;  2WSA A;  2DF5 A;  4F9U A;  4FAI A;  1UFH A;  4HNX B;  4M6H A;  3B3W A;  4R9M A;  3KL9 A;  1PYT B;  4ZY0 A;  4PQA A;  3GKR A;  6CPA A;  4QC6 A;  3SI1 A;  1R3N A;  2FIW A;  2PJ6 A;  2BL1 A;  1Y0Y A;  3N7Z A;  4ONU A;  4ZI6 A;  3ISZ A;  2PE3 A;  3R96 A;  2EK9 A;  4AG9 A;  3MN8 A;  2Z10 A;  4OC4 A;  4E8O A;  1XBU A;  4MHP A;  3NH4 A;  5D8N A;  3NH8 A;  4JWP A;  2GE3 A;  3IO1 A;  1Q7L A;  5K8N A;  4ZY2 A;  4X2T A;  1YW4 A;  4M3S A;  4C2Z A;  2WPW A;  1XOV A;  4UFW A;  3H8E A;  4KOR A;  3D2M A;  2CF4 A;  4RUH A;  3FVL A;  1V0C A;  4KVM E;  3FNC A;  2F7V A;  1PU9 A;  3KQX A;  4KVO E;  4AVC A;  3TO6 A;  4XNH C;  2V8G A;  5K8P A;  3CXQ A;  5H86 A;  3G3S A;  2Z3P A;  2PJB A;  3BHX A;  1N71 A;  3GIU A;  4R76 A;  4BBH A;  3KI9 A;  3B3S A;  1IU8 A;  4QB9 A;  4ZYQ A;  2Q7B A;  4B5O A;  2VBQ A;  1A2Z A;  1I21 A;  5ELY A;  2HB6 A;  4UFV A;  5C82 A;  1KZF A;  2OZG A;  3KKW A;  1Y7R A;  3BI0 A;  4PXE A;  2PJ2 A;  5J1Q A;  1WWZ A;  3BLN A;  1IID A;  5AG4 A;  2FXF A;  5A27 A;  3RZA A;  1Y9K A;  1M1D A;  4B14 A;  4MFZ A;  3MGD A;  3DR6 A;  2J8R A;  3H5Z A;  3JTK A;  4XPD B;  1S60 A;  1XEB A;  2FSR A;  4M85 A;  2Z3K A;  1XFO A;  4P4I A;  1I12 A;  4R57 A;  1LRZ A;  3IU2 A;  4NGR A;  3WC5 A;  4UCN A;  1KWM A;  2XEF A;  3IWE A;  1HDU A;  1ON0 A;  3FH4 A;  2IQ6 A;  2GIV A;  4CGP A;  3FMC A;  4OP4 A;  4UWJ A;  5LRJ A;  2VZY A;  1CP7 A;  2P6G A;  4H6Z A;  4ZY1 A;  1Z4R A;  4IK2 A;  4KSI A;  1ELL P;  3FED A;  3CPA A;  1F2P A;  3QB8 A;  4B6Z A;  2Q51 A;  2C6C A;  4NF1 A;  2Q4Z A;  1FY7 A;  4JLY A;  4H6U A;  4OID A;  1S7F A;  2B5G B;  2Q4V A;  1Z8L A;  1F2O A;  4GM5 A;  4MCS A;  5F48 A;  2Q4Y A;  2WUU A;  3SI0 A;  2OH1 A;  4KSF A;  3PRT A;  2J9A A;  2ZED A;  3NE8 A;  3PP9 A;  3EFA A;  2AFZ A;  3B8G A;  4OC2 A;  4CPA A;  1M44 A;  3LOD A;  2I3C A;  2DPS A;  3H4Q A;  1TIQ A;  3F8K A;  4Y49 C;  2EWB A;  2ZEN A;  3D67 A;  3EC4 A;  2G9D A;  4OLL A;  3FYN A;  1LAP A;  4PPZ A;  1QMU A;  1YQE A;  2GLJ A;  4NJR A;  2Z3L A;  4UIA A;  4CAX A;  2ZEG A;  2Z11 A;  3IWG A;  1TF9 A;  2C1C A;  2Z3N A;  1LCP A;  2PRB A;  2VL1 A;  2JLM A;  4HNY B;  5K8O A;  1LFW A;  2CTB A;  2ATR A;  3C26 A;  2O53 A;  2C6P A;  2I00 A;  1IY7 A;  1QSN A;  1CP6 A;  2D4P A;  1IYL A;  2FVG A;  4MBU A;  4MI4 A;  3V38 A;  2VI7 A;  5HVH A;  4UFX A;  3PBE A;  3RO0 A;  3S6H A;  4FD6 A;  4A38 A;  2CNT A;  4TWE A;  3PB6 X;  4AVA A;  4PV6 A;  5DS0 A;  1RXT A;  3CXS A;  5DWM A;  4B5P A;  3LWU A;  4AG7 A;  5LYI A;  3TOB A;  4CAW A;  1VHE A;  2ABZ A;  4M6I A;  2CY2 A;  1KUY A;  2PJ3 A;  5JGF A;  3F5B A;  3E0K A;  3GUX A;  3EY5 A;  3NE7 A;  4P4D A;  5AGE A;  3TOA A;  3KR5 A;  4A32 A;  2GRE A;  1QST A;  2R1I A;  1ZO0 A;  1CX8 A;  2QVP A;  4FD4 A;  1BOB A;  3IWW A;  4CYQ A;  4C2X A;  3T8W A;  4NGS A;  2WPX A;  2GLF A;  4NCZ A;  4TNU A;  2DXQ A;  2R98 A;  3K9U A;  2PCU A;  1IOF A;  2R8V A;  2YNC C;  3CXP A;  4HNW B;  3JVN A;  5LRK A;  2J8N A;  1Q2Y A;  1WK4 A;  4KS9 A;  4R8F A;  2PRQ A;  5AG6 A;  2F5I A;  2AFX A;  3TE4 A;  4BIN A;  4KOU A;  2EK8 A;  1YVK A;  2ZW5 A;  2CNM A;  1S7N A;  5A28 A;  2EO8 A;  4OC0 A;  4EVY A;  1IIC A;  5J8C A;  4ORF A;  3D2P A;  4EFD A;  4C68 A;  4MCQ A;  3B2Y A;  4LQG A;  4PXD A;  2G3T A;  4YFJ A;  5I0C A;  3KGQ A;  4QUS A;  2GFQ A;  1LOK A;  1ZG8 A;  2PJ8 A;  4X3R A;  3BI1 A;  4U9Y A;  4L89 A;  4UIB A;  3ZZI A;  3IIB A;  4IUS A;  3SI2 A;  4A37 A;  1LAM A;  4UEE A;  4B5P B;  4AXV A;  1FNO A;  1OZP A;  4JYW A;  2RC4 A;  2DEA A;  1AUG A;  2NYQ A;  2JEW A;  3R1K A;  1DE4 C;  2ZEH A;  3CZX A;  4KSA A;  4MFJ A;  4NGN A;  2DPT A;  2B5G A;  4XPD C;  3D4U A;  3PB7 X;  1ELM P;  3IJ3 A;  1ARM A;  4L8A A;  1XRY A;  2CXA A;  4P4F A;  4ZX8 A;  1CPX A;  4FD7 A;  1U6M A;  4PSX A;  2YNE A;  4WWV A;  2PSW A;  2WYR A;  3S6F A;  2PVV A;  1QQ9 A;  4F8Z A;  1R43 A;  3DLJ A;  3IU1 A;  2G3A A;  3B7I A;  5G22 A;  4II9 A;  2X7B A;  3N5F A;  3KHZ A;  4F6A A;  3QAH A;  1DTD A;  1S5K A;  3KZW A;  4J3G A;  4A30 A;  1MK4 A;  2A4N A;  4YU9 A;  2PJ4 A;  3D7G A;  4A95 A;  2JBJ A;  2YGW A;  3FXT A;  2V8V A;  4WJB A;  2HV2 A;  2Z0Z A;  4P4E A;  3D3S A;  1KUV A;  4PK2 A;  5E96 A;  1BO4 A;  5CBM A;  4MY3 A;  3TT2 A;  2PVW A;  2QJ8 A;  2VXK A;  3LAC A;  3VAT A;  1PUA A;  5CPA A;  4ZX9 A;  5CNP A;  2ZEL A;  2ZW4 A;  1ZLH A;  3PB4 X;  2FIA A;  5IB9 A;  2Y0M A;  1IGB A;  1RTQ A;  1BLL E;  1MJB A;  2HC9 A;  2OB0 A;  2BEI A;  2XEI A;  4KOS A;  5AG7 A;  2OOT A;  1XMT A;  1YME A;  4KLW A;  5G20 A;  4FD5 A;  1TKF A;  2VZZ A;  4JJX A;  2PJA A;  4YWY A;  5HVF A;  3S6K A;  3TX8 A;  4CRY B;  4BMH A;  1CM0 A;  4CGN A;  2J8M A;  2CTC A;  1Z8W A;  3OWC A;  5KTA A;  3QAY A;  1M4G A;  4MHN A;  3B35 A;  3FB3 A;  4F0Y A;  2R7H A;  1CJW A;  3FX6 A;  3KAS A;  4U9Z A;  1QSO A;  4EME A;  4XNH B;  4CGO A;  2AFO A;  4KOV A;  3B3T A;  1BAV A;  2Q43 A;  4UEZ A;  2EUI A;  4X5K A;  3SXN A;  2AFU A;  4OKO A;  4LQ6 A;  4CAV A;  2QYV A;  2ZEF A;  2BSW A;  1X12 A;  3SJF A;  1H8L A;  2V8D A;  2PIY A;  3HLP A;  4OC1 A;  4R6T A;  1K4J A;  1Z4E A;  2V77 A;  3FIX A;  4MFL A;  3RNZ A;  4OIW A;  4UEF A;  3R9G A;  1XMB A;  1YX0 A;  3NA6 A;  4R7M A;  1VGY A;  1P4N A;  3KQZ A;  2IMO A;  3PGP A;  4DJL A;  3SJE A;  2AE6 A;  4LX9 A;  4E2A A;  1NMT A;  4MXU A;  2WZN A;  3BXM A;  3R9F A;  3R95 A;  2FE7 A;  5EBV A;  2O4H A;  2ARH A;  2ZW6 A;  2XEG A;  3IEH A;  4KOT A;  1TXR A;  2PJ0 A;  4LUA A;  1M4I A;  2D4O A;  2PQ8 A;  1MJA A;  4DYO A;  4AB7 A;  1B6B A;  4KOX A;  1BPM A;  3R9E A;  4NGQ A;  1KUX A;  2OR4 A;  2ZEO A;  1ARL A;  2AFM A;  5LYD A;  1AYE A;  4CGM A;  2RB7 A;  5JM6 A;  2VEZ A;  1Q2D A;  2ZPA A;  4UWI A;  1YGH A;  3F0A A;  2C6G A;  3W6S A;  2P0W A;  3LMS A;  3V8I A;  2PR8 A;  4UA3 A;  3BJ7 A;  5D29 A;  4JXR A;  2JDD A;  2V8H A;  3NFZ A;  2HQY A;  2Z3M A;  4P45 A;  4NSQ A;  5AG5 A;  5G21 A;  1ZG7 A;  1Z5R A;  3K9T A;  5FVJ A;  3UY5 A;  5IV0 A;  1J4J A;  1YLO A;  4CAF A;  5GCN A;  1S7L A;  2QML A;  2ZOF A;  3TTH A;  3PB8 X;  2I79 A;  4RI1 A;  1UWY A;  1Z9U A;  4HKF A;  5JH9 A;  3B3V A;  4KUB A;  2OU2 A;  1QSR A;  4MFP A;  5ISV A;  2QIR A;  1S3Z A;  1BPN A;  2B3V A;  4CRZ B;  4NJQ A;  2C27 A;  2G0B A;  2ZXV A;  3L2N A;  2NSM A;  1S7K A;  2RFH A;  4XPL A;  3CPX A;  4KZT A;  3SHP A;  4EWT A;  4DNC A;  3T90 A;  3EO4 A;  3WT4 A;  1IB1 E;  3S9M A;  1R57 A;  5JPH A;  1P0H A;  2QEC A;  4H89 A;  5BWA B;  2ZEM A;  1Z2L A;  3VWD A;  5HXD A;  1YSJ A;  2ZOG A;  4JZ0 A;  3SJG A;  2AJ6 A;  3TO9 A;  3TFY A;  3FEC A;  3P2H A;  4KOW A;  4C2Y A;  3FBU A;  5KTD A;  4ONW A;  2REF A;  3FRM A;  4NGT A;  5HH1 A;  4B12 A;  5K8M A;  2Q44 A;  1CPS A;  1PCA A;  4YGO A;  4AVB A;  3S9N A;  4P4B A;  2B3U A;  5F47 A;  1TKJ A;  4UCM A;  3FEE A;  2PIZ A;  2H5M A;  2BOA A;  3DDD A;  1NE9 A;  3D7H A;  4K30 A;  3G8W A;  2PDO A;  1GHE A;  3SXO A;  2REE A;  4MFQ A;  4RN7 A;  3P2F A;  2ANP A;  4HPS A;  4PXB A;  4PSW A;  5LRG A;  4I49 A;  4KOY A;  2BCO A;  4RS2 A;  4MFK A;  5THW A;  4A31 A;  2ZEE A;  2BO9 A;  3DNS A;  4P6Y A;  2EBJ A;  4B11 A;  3D66 A;  4C7H A;  2OZH A;  4P44 A;  4KVX A;  4B10 A;  2Q04 A;  3GYA A;  1I1D A;  3SJX A;  4BD9 A;  4PK3 A;  1SQH A;  4K3N A;  1F57 A;  2FCK A;  2PC1 A;  4YRH A;  4CGL A;  1Q2C A;  2ZEP A;  4CS0 B;  1VHS A;  2IJZ A;  5F49 A;  1FT7 A;  1B87 A;  1Z8T A;  4IF5 A;  4O23 A;  4OME A;  4MHY A;  3W91 A;  4UBR A;  3GLJ A;  2B4D B;  4CAE A;  1M4L A;  1Y0R A;  3CT9 A;  4OAD A;  3FF3 A;  4OAE A;  4M6G A;  4DUK A;  2AFS A;  3H8F A;  2P6E A;  1Z8X A;  4PXC A;  1HDQ A;  4F9V A;  2BUE A;  3KHX A;  1TKH A;  5DWN A;  5HVG A;  2EVN A;  2HUZ A;  4E0A A;  1YVO A;  2KCW A;  1JWQ A;  1YLE A;  2CIJ A;  3D7F A;  2PJC A;  3MRU A;  3T9Y A;  3LD2 A;  1HEE A;  4A2Z A;  2FS5 A;  3QNV A;  3NH5 A;  2IL4 A;  5H84 A;  4B13 A;  4CYO A;  4R87 A;  3GY9 A;  1RO5 A;  1YW6 A;  2CNS A;  3FJU A;  4G1P A;  2VQY A;  3PEI A;  3TCV A;  3VH9 A;  3BJ8 A;  4W9Y A;  1GYT A;  4A33 A;  4Z65 A;  4UF4 A;  4MCP A;  4A94 A;  4P4J A;  5G1Z A;  3RBU A;  3WC7 A;  2PJ7 A;  4MY0 A;  3PFO A;  4Q7A A;  1XF8 A;  2NMT A;  5JQ4 A;  3IGR A;  4FBE A;  2POK A;  3D68 A;  4X8I A;  1CBX A;  1ZLI A;  1IOI A;  1VHO A;  2O28 A;  4GXH A;  4OC5 A;  4H2K A;  4KUA A;  4MJ8 A;  1YRE A;  3B3C A;  1XIX A;  1OBR A; 
#chains in the Genus database with same CATH homology
 1JQG A;  2F8H A;  1ZG9 A;  3VAR A;  4MMO A;  5LYL A;  3IC1 A;  1CG2 A;  1AMP A;  3JRU A;  1LAN A;  2PJ5 A;  2PJ9 A;  1TF8 A;  3DGV A;  1EE3 P;  2PJ1 A;  4OC3 A;  3TC8 A;  2XEJ A;  3CDX A;  4MHZ A;  3H8G A;  4NGM A;  7CPA A;  4NFR A;  5F09 A;  3PFE A;  3V7Z A;  2GU2 A;  4IHM A;  3S9L A;  3K2K A;  5I4M A;  3KR4 A;  4IAV A;  3RAM A;  4NGP A;  4A39 A;  3PBB A;  3PB9 X;  3HUV A;  1Y7E A;  2AFW A;  2JBK A;  3D7D A;  3WC6 A;  1NSA A;  8CPA A;  1VIX A;  4MCR A;  3GB0 A;  4FUU A;  3ISX A;  5LYF A;  3IFE A;  3WAB A;  1XJO A;  4FWU A;  4P10 A;  4MRI A;  3I1U A;  4F9U A;  4FAI A;  6CPA A;  3B3W A;  3KL9 A;  1PYT B;  4ZY0 A;  4PQA A;  3SI1 A;  1R3N A;  2PJ6 A;  4ZI6 A;  1Y0Y A;  3ISZ A;  2PE3 A;  2EK9 A;  3MN8 A;  4OC4 A;  1XBU A;  4MHP A;  3NH4 A;  5D8N A;  3NH8 A;  3IO1 A;  1Q7L A;  5K8N A;  4ZY2 A;  4X2T A;  1YW4 A;  3H8E A;  2CF4 A;  4RUH A;  3FVL A;  2F7V A;  3KQX A;  2V8G A;  5K8P A;  2PJB A;  3BHX A;  4R76 A;  3KI9 A;  3B3S A;  4ZYQ A;  5ELY A;  2HB6 A;  4PXE A;  3BI0 A;  2PJ2 A;  5J1Q A;  3RZA A;  1XFO A;  4P4I A;  4NGR A;  3WC5 A;  1KWM A;  2XEF A;  1HDU A;  3FH4 A;  2IQ6 A;  3FMC A;  4OP4 A;  5LRJ A;  1CP7 A;  4ZY1 A;  4IK2 A;  4KSI A;  1ELL P;  3FED A;  3CPA A;  1F2P A;  4B6Z A;  2Q51 A;  2C6C A;  2Q4Z A;  4OID A;  4GM5 A;  1Z8L A;  1F2O A;  4MCS A;  3SI0 A;  3PRT A;  2J9A A;  2ZED A;  2AFZ A;  4CPA A;  4OC2 A;  2I3C A;  2EWB A;  2ZEN A;  3D67 A;  2G9D A;  4PPZ A;  1LAP A;  1QMU A;  2GLJ A;  4NJR A;  4UIA A;  2ZEG A;  1TF9 A;  2C1C A;  1LCP A;  2VL1 A;  5K8O A;  1LFW A;  2CTB A;  2O53 A;  2C6P A;  1IY7 A;  1CP6 A;  2FVG A;  3V38 A;  5HVH A;  3PBE A;  4A38 A;  4TWE A;  3PB6 X;  5DS0 A;  3LWU A;  5LYI A;  1VHE A;  2ABZ A;  2PJ3 A;  5JGF A;  3GUX A;  4P4D A;  3KR5 A;  2GRE A;  1CX8 A;  2QVP A;  3IWW A;  3T8W A;  4NGS A;  2GLF A;  4TNU A;  2PCU A;  5LRK A;  4R8F A;  2PRQ A;  2AFX A;  2EK8 A;  4OC0 A;  4EFD A;  4MCQ A;  3B2Y A;  4LQG A;  4PXD A;  3KGQ A;  1LOK A;  1ZG8 A;  2PJ8 A;  4X3R A;  3BI1 A;  4UIB A;  3IIB A;  3SI2 A;  4A37 A;  1LAM A;  4UEE A;  4AXV A;  1FNO A;  4JYW A;  2DEA A;  2NYQ A;  2JEW A;  1DE4 C;  2ZEH A;  4NGN A;  3D4U A;  3PB7 X;  1ELM P;  3IJ3 A;  1ARM A;  4P4F A;  1XRY A;  4ZX8 A;  1CPX A;  4WWV A;  2WYR A;  2PVV A;  1QQ9 A;  4F8Z A;  1R43 A;  3DLJ A;  3B7I A;  3N5F A;  3KHZ A;  1DTD A;  3KZW A;  4YU9 A;  2PJ4 A;  3D7G A;  2JBJ A;  4WJB A;  2V8V A;  4P4E A;  5CBM A;  2PVW A;  2QJ8 A;  3VAT A;  5CPA A;  4ZX9 A;  2ZEL A;  1ZLH A;  3PB4 X;  5IB9 A;  1IGB A;  1RTQ A;  1BLL E;  2HC9 A;  2OOT A;  2XEI A;  1YME A;  4YWY A;  1TKF A;  3TX8 A;  2PJA A;  5HVF A;  2CTC A;  4MHN A;  3B35 A;  3KAS A;  3FX6 A;  4EME A;  2AFO A;  3B3T A;  1BAV A;  2Q43 A;  4UEZ A;  2AFU A;  4OKO A;  2QYV A;  2ZEF A;  3SJF A;  1H8L A;  2V8D A;  2PIY A;  3HLP A;  4OC1 A;  4R6T A;  2V77 A;  4OIW A;  4UEF A;  1XMB A;  3NA6 A;  4R7M A;  1VGY A;  3KQZ A;  2IMO A;  4DJL A;  3SJE A;  4MXU A;  2WZN A;  3BXM A;  2O4H A;  2XEG A;  3IEH A;  1TXR A;  2PJ0 A;  4DYO A;  1BPM A;  4NGQ A;  2OR4 A;  2ZEO A;  1ARL A;  2AFM A;  5LYD A;  1AYE A;  2RB7 A;  5JM6 A;  2C6G A;  3LMS A;  5D29 A;  2V8H A;  3NFZ A;  4P45 A;  1ZG7 A;  1Z5R A;  3K9T A;  1YLO A;  2ZOF A;  3PB8 X;  1UWY A;  5JH9 A;  3B3V A;  1BPN A;  4NJQ A;  3L2N A;  2NSM A;  2RFH A;  3CPX A;  4EWT A;  3WT4 A;  3S9M A;  2ZEM A;  1Z2L A;  5HXD A;  1YSJ A;  2ZOG A;  4JZ0 A;  3SJG A;  3FEC A;  4ONW A;  4NGT A;  5K8M A;  1CPS A;  1PCA A;  3S9N A;  4P4B A;  1TKJ A;  3FEE A;  2PIZ A;  2BOA A;  3D7H A;  5LRG A;  2ANP A;  4PXB A;  2BCO A;  5THW A;  2ZEE A;  2BO9 A;  4P6Y A;  3D66 A;  4P44 A;  3SJX A;  4BD9 A;  4K3N A;  1F57 A;  2ZEP A;  2IJZ A;  1FT7 A;  4O23 A;  4OME A;  4MHY A;  3GLJ A;  1M4L A;  1Y0R A;  3CT9 A;  3FF3 A;  4DUK A;  2AFS A;  3H8F A;  4PXC A;  1HDQ A;  4F9V A;  3KHX A;  5HVG A;  1TKH A;  2CIJ A;  3D7F A;  2PJC A;  3MRU A;  1HEE A;  3QNV A;  3NH5 A;  4G1P A;  1YW6 A;  3VH9 A;  3FJU A;  3PEI A;  4W9Y A;  1GYT A;  4Z65 A;  4UF4 A;  4MCP A;  4A94 A;  4P4J A;  3RBU A;  3WC7 A;  2PJ7 A;  3PFO A;  4Q7A A;  4FBE A;  2POK A;  3D68 A;  4X8I A;  1CBX A;  1ZLI A;  4OC5 A;  1VHO A;  4H2K A;  3B3C A;  1OBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...