1XJOA

Structure of aminopeptidase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
277
structure length
270
Chain Sequence
APDIPLANVKAHLTQLSTIAANNGGNRAHGRPGYKASVDYVKAKLDAAGYTTTLQQFTSGGATGYNLIANWPGGDPNKVLMAGAHLDSVSSGAGINDNGSGSAAVLETALAVSRAGYQPDKHLRFAWWGAEELGLIGSKFYVNNLPSADRSKLAGYLNFDIGSPNPGYFVYDDDPVIEKTFKNYFAGLNVPTEIRSDHAPFKNVGVPVGGLFTGAGYTKSAAQAQKWGGTAGQAFDRCYHSSCDSLSNINDTALDRNSDAAAHAIWTLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE
publication title Streptomyces griseus aminopeptidase: X-ray crystallographic structure at 1.75 A resolution.
pubmed doi rcsb
total genus 101
structure length 270
sequence length 277
ec nomenclature ec 3.4.11.24: Aminopeptidase S.
pdb deposition date 1996-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1xjoA00
2PE3A 1XFOA 5DS0A 2CTBA 1DTDA 4R7MA 1JQGA 2G9DA 2BOAA 3PFOA 6CPAA 3GB0A 3S9LA 2J9AA 1PYTB 4PXEA 5D29A 2HC9A 4EMEA 5HVGA 3BI0A 1VGYA 4R8FA 1TKFA 1CX8A 1XRYA 1XMBA 3FF3A 3B2YA 3KHXA 2Q43A 4F8ZA 2CTCA 1YSJA 3D7HA 1TF8A 4OC0A 4ZX9A 1QMUA 2ZEHA 2XEGA 4GM5A 1LOKA 1Y0RA 1ZG8A 3KL9A 3B7IA 1CPSA 2VL1A 3D7FA 4DJLA 2IMOA 2PJ3A 1ELLP 5THWA 2GREA 2ZENA 5LYLA 2DEAA 3CDXA 3IWWA 4NGRA 4LQGA 2PRQA 2AFUA 3VH9A 3HLPA 3KHZA 4OC4A 1AMPA 5LRJA 4JYWA 2OR4A 1TKJA 2C6CA 1CPXA 5LYFA 2ZOFA 1M4LA 3S9MA 4FAIA 4MHYA 1FT7A 2PVVA 3JRUA 3FEEA 5K8OA 2V8HA 2PJ2A 5K8NA 3IEHA 3MN8A 3D67A 2FVGA 4G1PA 3SJFA 4CPAA 2C1CA 3BHXA 2PVWA 2ZEEA 3SI2A 5ELYA 4MCPA 4TWEA 1GYTA 2Q4ZA 3PB8X 3CPAA 3IIBA 3RAMA 3SJGA 1F2OA 3NA6A 1BAVA 4NGTA 2AFSA 5HVHA 2RFHA 1NSAA 3ISXA 3H8GA 2V8GA 1H8LA 4BD9A 5JM6A 5I4MA 3N5FA 4OC2A 2C6PA 2AFZA 4JZ0A 3B3VA 4WJBA 2CF4A 3KASA 1HEEA 4Z65A 2JEWA 2F7VA 1VHOA 1EE3P 1LCPA 2HB6A 4A38A 2PJ8A 1DE4C 2BO9A 1CG2A 3DLJA 3IFEA 3RBUA 3L2NA 5IB9A 3RZAA 2PIYA 4NGNA 5LRKA 4YWYA 4MCRA 4DYOA 3FJUA 4YU9A 3D7DA 1TF9A 4UIBA 4EWTA 4K3NA 4OP4A 4MHPA 3B3WA 5LYDA 1LFWA 3KQZA 3V38A 1KWMA 4RUHA 1ZG7A 4IHMA 4P44A 3KI9A 4MHZA 1YW6A 1XJOA 2ZEPA 2PJ4A 3KR4A 2ZOGA 3HUVA 1ARLA 3PRTA 4OKOA 3D7GA 1UWYA 1Y0YA 2PJ7A 4ZI6A 2ZEGA 4ZY2A 3FH4A 5JH9A 2NSMA 4WWVA 3SJXA 2ZEMA 3TC8A 2XEFA 4R6TA 2O4HA 3KGQA 2ANPA 2GU2A 1LAPA 3KR5A 2WYRA 4MCQA 1YMEA 1HDUA 4UEEA 3FMCA 4NJRA 1CBXA 4OC5A 3I1UA 2QJ8A 1Y7EA 1LAMA 4MRIA 4PXDA 1VIXA 2PJCA 1RTQA 4PQAA 1IGBA 2Q51A 1TXRA 3MRUA 4NGSA 4P4IA 4FWUA 2I3CA 3TX8A 1BPNA 1ZLHA 3B35A 5CBMA 3ISZA 4P10A 3WT4A 1Z2LA 1ELMP 1YW4A 3BI1A 4F9UA 3PFEA 3CT9A 4ONWA 3D66A 4P45A 3T8WA 4IAVA 2PJ5A 2OOTA 5HXDA 3BXMA 2XEIA 2JBKA 3PB6X 3NH5A 1PCAA 3CPXA 2PJ6A 3LWUA 3PB9X 2PJBA 4OMEA 1F2PA 4A37A 1ARMA 2JBJA 4X3RA 3D68A 3FX6A 4UF4A 3FEDA 4B6ZA 2GLFA 2PJAA 4KSIA 2EK9A 3K2KA 5F09A 3NH8A 5LRGA 5JGFA 4ZY1A 2AFMA 4P6YA 1F57A 2V8VA 4Q7AA 1TKHA 4NGQA 2WZNA 4ZX8A 4MMOA 4P4FA 3PEIA 2PIZA 4NFRA 4TNUA 5HVFA 2IQ6A 2AFOA 4NJQA 3QNVA 4DUKA 3B3SA 5K8MA 3GUXA 4UEZA 4MCSA 2POKA 4P4EA 4EFDA 4P4BA 5D8NA 1VHEA 2PJ9A 4PPZA 2V8DA 4ZY0A 3H8EA 2QYVA 4FUUA 2ABZA 2PJ0A 2C6GA 1IY7A 3DGVA 3KQXA 4P4DA 1HDQA 7CPAA 1FNOA 4MXUA 1Z8LA 1R3NA 3WABA 1CP7A 1AYEA 2ZEDA 2O53A 4O23A 4OIWA 2NYQA 3FVLA 4ZYQA 4W9YA 2QVPA 4UIAA 2EWBA 4A94A 3IJ3A 2ZEFA 2XEJA 4NGMA 3B3CA 5K8PA 3PBEA 3SI1A 1Q7LA 1LANA 4OC3A 1OBRA 4UEFA 4NGPA 2AFWA 3V7ZA 2V77A 3PBBA 4PXBA 3LMSA 1BPMA 3PB4X 4F9VA 3VATA 4FBEA 2PJ1A 3GLJA 3WC5A 8CPAA 3H8FA 2AFXA 2CIJA 4MHNA 3PB7X 1BLLE 3S9NA 1CP6A 3IC1A 3B3TA 5LYIA 3D4UA 2BCOA 4H2KA 1Z5RA 5CPAA 4OIDA 2GLJA 2ZELA 1ZG9A 2ZEOA 3WC7A 3NH4A 5J1QA 3FECA 3KZWA 3SI0A 2EK8A 2PCUA 4PXCA 4A39A 1QQ9A 3WC6A 2F8HA 4X8IA 4AXVA 3VARA 2RB7A 4IK2A 3IO1A 3K9TA 1YLOA 3NFZA 4OC1A 1ZLIA 2IJZA 4P4JA 1XBUA 4R76A 3SJEA 4X2TA 1R43A
chains in the Genus database with same CATH superfamily
4KSFA 2PE3A 2FIWA 1CM0A 1XFOA 2GFQA 5DS0A 3B8GA 2CTBA 3G8WA 1DTDA 4R7MA 4KVOE 4B14A 4M6IA 1IB1E 3FB3A 1JQGA 4X5KA 2G9DA 2BOAA 4A32A 3PFOA 3R1KA 4LX9A 4PK2A 3F0AA 2Z3KA 3EFAA 4JJXA 3GB0A 1ZO0A 3N7ZA 3ZZIA 4AB7A 4B12A 2J9AA 5DWNA 3S9LA 1PYTB 4PXEA 3QB8A 1IOFA 1I21A 2HC9A 2PQ8A 2PR8A 5D29A 4CRYB 4EMEA 5F46A 5HVGA 3BI0A 1VGYA 5G20A 3D2PA 5IV0A 4R8FA 3F5BA 1TKFA 5IB0A 1M4GA 1CX8A 4A2ZA 1XRYA 1XMBA 3FF3A 5KTDA 3B2YA 5JQ4A 4MI4A 4MHDA 2R98A 3KHXA 2Q43A 4F8ZA 5EMIA 2CTCA 1YSJA 3D7HA 1TF8A 3TOAA 1IYKA 4OC0A 4Y49B 4ZX9A 1QMUA 2ZEHA 3LD2A 4AG9A 2XEGA 4GM5A 4B6ZA 1LOKA 1Y0RA 1ZG8A 4JXRA 4NSQA 3KL9A 3B7IA 2B5GB 4OLLA 3RYOA 4YFJA 1S7LA 4H6UA 1WK4A 4NEXA 3I3GA 5ISVA 1CPSA 4C7HA 2FS5A 4AVBA 2VL1A 1YR0A 3S6FA 3D7FA 4DJLA 2IMOA 1BO4A 2PJ3A 3BJ7A 3EY5A 4UWJA 4KOVA 1ELLP 4LQ6A 5THWA 4CGPA 2GREA 3I9SA 2ZENA 4B5PB 4H6ZA 5LYLA 2DEAA 3ZJ0A 5DWMA 1XIXA 3CDXA 1FY7A 3H5ZA 3IWWA 4CAEA 4KOTA 4NGRA 4LQGA 1TIQA 3FXTA 1WWZA 1OZPA 2G0BA 4J3GA 4KVXA 2OZHA 2PRQA 2AFUA 2Z0ZA 3CXPA 3VH9A 2JEVA 2DPTA 4A95A 3HLPA 4UCMA 3V8IA 3KHZA 4OC4A 1AMPA 2O28A 2G3AA 3T9YA 4GXHA 5LRJA 4JYWA 5C82A 4RN7A 4KS9A 2OR4A 1TKJA 2C6CA 1CPXA 4MFKA 5LYFA 5BWAB 2ZOFA 1M4LA 3S9MA 4CAVA 4FAIA 4UWIA 2GANA 4MHYA 1FT7A 2PVVA 3JRUA 3FEEA 5K8OA 2REFA 2V8HA 1Z8TA 2PJ2A 5K8NA 3IEHA 4M6GA 3MN8A 3D67A 2REEA 3H4QA 4ONUA 5C88A 2FVGA 4G1PA 4A33A 4KSAA 3SJFA 1X10A 2C1CA 3BHXA 4CAXA 2D4OA 4CPAA 2PVWA 2ZEEA 3SI2A 5ELYA 4MCPA 4TWEA 1GYTA 2HUZA 4CGMA 2Q4ZA 1M4IA 3PB8X 3CPAA 3IIBA 2P6EA 2ZPAA 3RAMA 3SJGA 1QSNA 1F2OA 2FIAA 4LUAA 4OADA 3NA6A 1BAVA 1V0CA 3GYAA 1IOIA 4NGTA 2AFSA 1GHEA 4KOXA 1Z8WA 5HVHA 2FL4A 2RFHA 1NSAA 3DR8A 3ISXA 3H8GA 2ZW7A 3VWEA 4MFLA 5HH1A 4BINA 4XPKA 5J8CA 1KUVA 2V8GA 1H8LA 4BD9A 3T90A 5JM6A 2Z3LA 2IL4A 5I4MA 1M1DA 3TO9A 2OU2A 2R1IA 2J8NA 3N5FA 2R7HA 4OC2A 2C6PA 2AFZA 2PRBA 3TO6A 4JZ0A 3B3VA 4WJBA 3G3SA 4I49A 3R95A 2CF4A 3KASA 1HEEA 1YGHA 1UFHA 3JUWA 4Z65A 3JVNA 2CNSA 2JEWA 3IWGA 5I0CA 2F7VA 2VI7A 2JDCA 2Z3NA 1VHOA 1EE3P 2P6FA 5AG5A 1LCPA 4KOSA 3FYNA 2HB6A 2Q04A 3BLNA 4CGOA 2YNEA 4A38A 3UY5A 3TTHA 1I1DA 2DPSA 2PJ8A 5J8FA 1DE4C 1U6MA 2BO9A 2DF5A 4FD6A 1PUAA 3SXOA 1CG2A 3LODA 4DNCA 1S7NA 3DLJA 1S3ZA 3D3SA 3IFEA 3S6KA 4C2ZA 3RBUA 2VEZA 3L2NA 4MY0A 2C27A 3PP9A 3JTKA 5IB9A 3RZAA 2PIYA 4NGNA 2ZXVA 5LRKA 4YWYA 2PSWA 4MCRA 3FJUA 4FD7A 4UFVA 4MY3A 4YU9A 5E96A 4DYOA 3D7DA 4B10A 1TF9A 2WPXA 4UIBA 4HKFA 3CXQA 4UBRA 1QSTA 2A4NA 4PK3A 1S7KA 3NE8A 4EWTA 4K3NA 4OP4A 4U9YA 4MHPA 3B3WA 5F48A 5LYDA 4B11A 1LFWA 4MFJA 3KQZA 1MK4A 1KZFA 3V38A 4KOYA 3DR6A 1KWMA 1Q2CA 1ZG7A 2FXFA 4IHMA 4KOUA 4R87A 4P44A 4RUHA 3KI9A 3QAHA 4MHZA 1YW6A 1XJOA 2ZEPA 2AJ6A 5A28A 2FT0A 2PJ4A 3KR4A 5H84A 4IUSA 2ZOGA 2G3TA 4F6AA 4KLVA 3FBUA 1N71A 3HUVA 1ARLA 4MFPA 3PRTA 4OKOA 1IU8A 4CRZB 3DNSA 4E2AA 5KTCA 3D7GA 4II9A 4CYOA 1UWYA 2EVNA 1Y0YA 4HNYB 2PJ7A 4UFWA 4ZI6A 2ZEGA 3R9GA 4XPDC 2B4BA 4ZY2A 3FH4A 4HNXB 3BJ8A 5GCNA 5JH9A 2NSMA 5EBVA 4WWVA 2CXAA 3SJXA 2ZEMA 3TC8A 1RO5A 2OB0A 3QAYA 4CGLA 1YK3A 2XEFA 4E0AA 4R6TA 2O4HA 3KGQA 2Q7SA 2CY2A 3A9LA 2ANPA 1K4JA 2GU2A 1LAPA 1Z4RA 1XMTA 1P4NA 3P2FA 3KR5A 2RC4A 4KLWA 2WYRA 2Z10A 4MCQA 1YMEA 1HDUA 4FD4A 4UEEA 4AVCA 3FMCA 4NJRA 1Y9WA 1CBXA 2VZZA 1J4JA 3TCVA 4OC5A 3I1UA 2QJ8A 1Y7EA 4QC6A 1BOBA 1LAMA 2Q7BA 2Y0MA 1M4DA 4MRIA 4R9MA 3R9FA 4PXDA 1MJAA 1VIXA 2ZW5A 1IYLA 2PJCA 1RTQA 1L0CA 2HQYA 2Q4VA 4L89A 5JPHA 2WUUA 1YQEA 4PQAA 4K30A 1IGBA 2Q51A 2Q0YA 1TXRA 3MRUA 4NGSA 4P4IA 4QUSA 1M44A 4FWUA 1R57A 2NMTA 5AGEA 4R3LA 2I3CA 1Y7RA 3TX8A 4CGNA 1BPNA 1ZLHA 3B35A 5CBMA 4KUAA 3ISZA 4P10A 4NXYA 3PGPA 2PR1A 4CYPA 4PV6A 3WT4A 1VKCA 1Z2LA 1ELMP 3EO4A 1YW4A 4QVTA 3IWEA 4U5YA 2I00A 3BI1A 4JLYA 2YNDA 2VZYA 4F9UA 4ZGYB 3PFEA 2OZGA 3CT9A 4NCZA 4ONWA 3D66A 1NE9A 2QECA 4RI1A 2X7BA 4P45A 4XPDB 3T8WA 4IAVA 4AVAA 4KORA 2GIVA 4B5OA 2PJ5A 2OOTA 2KCWA 5HXDA 1QSRA 3PZJA 2BSWA 3DSBA 4CAWA 3BXMA 2XEIA 3CXSA 2QIRA 3IU1A 2JBKA 4ZBGA 3PB6X 1YVKA 4F0XA 3FRMA 3VWDA 2YGWA 1PCAA 3CPXA 2PJ6A 3LWUA 3NH5A 3PB9X 3W6XA 4QBJA 1B87A 1YX0A 2PJBA 2VBQA 4OMEA 1F2PA 4A37A 3R9EA 1ARMA 2JBJA 4X3RA 2QMLA 1QSOA 3D68A 3FX6A 4A30A 2AE6A 4UF4A 3FEDA 5EC4A 3NE7A 2GLFA 2PJAA 4KSIA 2EK9A 1LRZA 3GKRA 3K2KA 4XNHB 5AG6A 3TOBA 5F09A 3NH8A 2YNCA 5LRGA 1S5KA 5JGFA 1CJWA 4ZY1A 2AFMA 4P6YA 4R3KA 1YVOA 1F57A 1IIDA 2V8VA 3D2MA 2Z11A 4Q7AA 1TKHA 3IU2A 4FD5A 2ODFA 1X12A 2WZNA 4NGQA 4ZX8A 5G1ZA 4MMOA 4KUBA 4M3SA 4P4FA 2GE3A 4R57A 3PEIA 2PIZA 4NFRA 2B4DA 4PSXA 4TNUA 5CNPA 1MJ9A 5HVFA 1ON0A 1Q2YA 3CZXA 5IX3A 2IQ6A 2Z3MA 2AFOA 4NJQA 4UCPA 1Q2DA 3QNVA 4DUKA 1B6BA 3B3SA 5F49A 1SQHA 3LACA 5K8MA 3GUXA 4JWPA 1Z4EA 4UEZA 4KOWA 2POKA 2K5TA 4MCSA 4JD6A 4P4EA 4BBHA 4EFDA 3KKWA 4P4BA 5D8NA 1VHEA 2PJ9A 1S60A 2WSAA 4EVYA 2ZW6A 4Q38A 4PPZA 2Z3OA 2OH1A 1PU9A 2J8MA 2V8DA 1MJBA 4ZY0A 3TO7A 4C2YA 1YREA 2QYVA 3H8EA 4FUUA 2Q4YA 4HPSA 1KUXA 4MFQA 2ABZA 4Q36A 3WR7A 4C2XA 2PJ0A 5AG7A 2C6GA 4L8AA 4OAEA 1IY7A 3DGVA 3KQXA 4P4DA 1HDQA 7CPAA 1FNOA 4MXUA 1Z8LA 1R3NA 4H89A 3WABA 2JDDA 4CYNA 4E8OA 1XOVA 2CNTA 1CP7A 1AYEA 5F47A 4AG7A 2JLMA 2O53A 2ZEDA 4O23A 4OIWA 3SHPA 2VQYA 3E0KA 2NYQA 3FVLA 4ZYQA 4W9YA 3P2HA 2QVPA 4GS4A 2EWBA 4UIAA 1VHSA 3IJ3A 4HNWB 2ZEFA 4A94A 2XEJA 4IF5A 2PDOA 2OZUA 3EXNA 5HMNA 4QB9A 1IICA 3S6HA 4NGMA 3B3CA 3FNCA 4CYQA 5K8PA 2Q44A 4UFXA 3PBEA 2FSRA 4UCNA 3SI1A 2HV2A 3SXNA 1Q7LA 2B4DB 2B3UA 1XEBA 1LANA 3EC4A 4OC3A 1OBRA 4UEFA 4XNHC 4B13A 2B3VA 2P6GA 3F8KA 3RNZA 4NGPA 3IGRA 4YRHA 3C26A 3TE4A 2AFWA 1AUGA 3R96A 3V7ZA 1S7FA 4CS0B 2FE7A 2V77A 3PBBA 4JXQA 2ZW4A 4F0YA 3W91A 1Z8XA 1A2ZA 1YLEA 4PXBA 3LMSA 3TT2A 2H5MA 1NSLA 1BPMA 3PB4X 4F9VA 4NF1A 1NMTA 3VATA 2F5IA 3OWCA 4FBEA 4PSWA 1P0HA 1Z9UA 2PJ1A 3GLJA 3WC5A 3K9UA 3H8FA 8CPAA 2I79A 2D4PA 2AFXA 2CIJA 4MHNA 1I12A 5G22A 3PB7X 4KZTA 2DXQA 1BLLE 2CNMA 3S9NA 1CP6A 1KUYA 3IC1A 4M6HA 5FVJA 3D8PA 5KTAA 4C68A 2BL1A 3B3TA 2P0WA 5LYIA 2VXKA 3D4UA 5A27A 4XPLA 4MFZA 2BCOA 2EBJA 4H2KA 6CPAA 5AG4A 3DDDA 4UA3A 1Z5RA 5CPAA 3S6GA 4A31A 3TFYA 3GY9A 4OIDA 2GLJA 2ZELA 2BEIA 3RO0A 1ZG9A 2ZEOA 1XE4A 3WC7A 3NH4A 5J1QA 2FCKA 3FECA 3KZWA 4Y49C 3W6SA 3SI0A 2EK8A 2PC1A 2PCUA 4PXCA 2WPWA 4A39A 2J8RA 4M85A 1QQ9A 3WC6A 2R8VA 2YNCC 4C7IA 2F8HA 2ATRA 2EUIA 5H86A 1JWQA 1RXTA 4X8IA 1Y9KA 4AXVA 3VARA 1QSMA 4RS2A 2B5GA 2RB7A 4IK2A 2EO8A 3IO1A 4U9ZA 3K9TA 1YLOA 3NFZA 4OC1A 2ARHA 5G21A 4MBUA 1ZLIA 1XF8A 3GIUA 3MGDA 2IJZA 4KVME 3FIXA 4P4JA 4CAFA 2B58A 4BMHA 4MJ8A 4YGOA 2Z3PA 1XBUA 4R76A 3SJEA 4B5PA 4ORFA 2BUEA 4X2TA 1R43A
chains in the Genus database with same CATH topology
2PE3A 1XFOA 5DS0A 2CTBA 1DTDA 4R7MA 1JQGA 2G9DA 2BOAA 3PFOA 6CPAA 3GB0A 3S9LA 2J9AA 1PYTB 4PXEA 5D29A 2HC9A 4EMEA 5HVGA 3BI0A 1VGYA 4R8FA 1TKFA 1CX8A 1XRYA 1XMBA 3FF3A 3B2YA 3KHXA 2Q43A 4F8ZA 2CTCA 1YSJA 3D7HA 1TF8A 4OC0A 4ZX9A 1QMUA 2ZEHA 2XEGA 4GM5A 1LOKA 1Y0RA 1ZG8A 3KL9A 3B7IA 1CPSA 2VL1A 3D7FA 4DJLA 2IMOA 2PJ3A 1ELLP 5THWA 2GREA 2ZENA 5LYLA 2DEAA 3CDXA 3IWWA 4NGRA 4LQGA 2PRQA 2AFUA 3VH9A 3HLPA 3KHZA 4OC4A 1AMPA 5LRJA 4JYWA 2OR4A 1TKJA 2C6CA 1CPXA 5LYFA 2ZOFA 1M4LA 3S9MA 4FAIA 4MHYA 1FT7A 2PVVA 3JRUA 3FEEA 5K8OA 2V8HA 2PJ2A 5K8NA 3IEHA 3MN8A 3D67A 2FVGA 4G1PA 3SJFA 4CPAA 2C1CA 3BHXA 2PVWA 2ZEEA 3SI2A 5ELYA 4MCPA 4TWEA 1GYTA 2Q4ZA 3PB8X 3CPAA 3IIBA 3RAMA 3SJGA 1F2OA 3NA6A 1BAVA 4NGTA 2AFSA 5HVHA 2RFHA 1NSAA 3ISXA 3H8GA 2V8GA 1H8LA 4BD9A 5JM6A 5I4MA 3N5FA 4OC2A 2C6PA 2AFZA 4JZ0A 3B3VA 4WJBA 2CF4A 3KASA 1HEEA 4Z65A 2JEWA 2F7VA 1VHOA 1EE3P 1LCPA 2HB6A 4A38A 2PJ8A 1DE4C 2BO9A 1CG2A 3DLJA 3IFEA 3RBUA 3L2NA 5IB9A 3RZAA 2PIYA 4NGNA 5LRKA 4YWYA 4MCRA 4DYOA 3FJUA 4YU9A 3D7DA 1TF9A 4UIBA 4EWTA 4K3NA 4OP4A 4MHPA 3B3WA 5LYDA 1LFWA 3KQZA 3V38A 1KWMA 4RUHA 1ZG7A 4IHMA 4P44A 3KI9A 4MHZA 1YW6A 1XJOA 2ZEPA 2PJ4A 3KR4A 2ZOGA 3HUVA 1ARLA 3PRTA 4OKOA 3D7GA 1UWYA 1Y0YA 2PJ7A 4ZI6A 2ZEGA 4ZY2A 3FH4A 5JH9A 2NSMA 4WWVA 3SJXA 2ZEMA 3TC8A 2XEFA 4R6TA 2O4HA 3KGQA 2ANPA 2GU2A 1LAPA 3KR5A 2WYRA 4MCQA 1YMEA 1HDUA 4UEEA 3FMCA 4NJRA 1CBXA 4OC5A 3I1UA 2QJ8A 1Y7EA 1LAMA 4MRIA 4PXDA 1VIXA 2PJCA 1RTQA 4PQAA 1IGBA 2Q51A 1TXRA 3MRUA 4NGSA 4P4IA 4FWUA 2I3CA 3TX8A 1BPNA 1ZLHA 3B35A 5CBMA 3ISZA 4P10A 3WT4A 1Z2LA 1ELMP 1YW4A 3BI1A 4F9UA 3PFEA 3CT9A 4ONWA 3D66A 4P45A 3T8WA 4IAVA 2PJ5A 2OOTA 5HXDA 3BXMA 2XEIA 2JBKA 3PB6X 3NH5A 1PCAA 3CPXA 2PJ6A 3LWUA 3PB9X 2PJBA 4OMEA 1F2PA 4A37A 1ARMA 2JBJA 4X3RA 3D68A 3FX6A 4UF4A 3FEDA 4B6ZA 2GLFA 2PJAA 4KSIA 2EK9A 3K2KA 5F09A 3NH8A 5LRGA 5JGFA 4ZY1A 2AFMA 4P6YA 1F57A 2V8VA 4Q7AA 1TKHA 4NGQA 2WZNA 4ZX8A 4MMOA 4P4FA 3PEIA 2PIZA 4NFRA 4TNUA 5HVFA 2IQ6A 2AFOA 4NJQA 3QNVA 4DUKA 3B3SA 5K8MA 3GUXA 4UEZA 4MCSA 2POKA 4P4EA 4EFDA 4P4BA 5D8NA 1VHEA 2PJ9A 4PPZA 2V8DA 4ZY0A 3H8EA 2QYVA 4FUUA 2ABZA 2PJ0A 2C6GA 1IY7A 3DGVA 3KQXA 4P4DA 1HDQA 7CPAA 1FNOA 4MXUA 1Z8LA 1R3NA 3WABA 1CP7A 1AYEA 2ZEDA 2O53A 4O23A 4OIWA 2NYQA 3FVLA 4ZYQA 4W9YA 2QVPA 4UIAA 2EWBA 4A94A 3IJ3A 2ZEFA 2XEJA 4NGMA 3B3CA 5K8PA 3PBEA 3SI1A 1Q7LA 1LANA 4OC3A 1OBRA 4UEFA 4NGPA 2AFWA 3V7ZA 2V77A 3PBBA 4PXBA 3LMSA 1BPMA 3PB4X 4F9VA 3VATA 4FBEA 2PJ1A 3GLJA 3WC5A 8CPAA 3H8FA 2AFXA 2CIJA 4MHNA 3PB7X 1BLLE 3S9NA 1CP6A 3IC1A 3B3TA 5LYIA 3D4UA 2BCOA 4H2KA 1Z5RA 5CPAA 4OIDA 2GLJA 2ZELA 1ZG9A 2ZEOA 3WC7A 3NH4A 5J1QA 3FECA 3KZWA 3SI0A 2EK8A 2PCUA 4PXCA 4A39A 1QQ9A 3WC6A 2F8HA 4X8IA 4AXVA 3VARA 2RB7A 4IK2A 3IO1A 3K9TA 1YLOA 3NFZA 4OC1A 1ZLIA 2IJZA 4P4JA 1XBUA 4R76A 3SJEA 4X2TA 1R43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PE3 A;  1XFO A;  5DS0 A;  2CTB A;  1DTD A;  4R7M A;  1JQG A;  2G9D A;  2BOA A;  3PFO A;  6CPA A;  3GB0 A;  3S9L A;  2J9A A;  1PYT B;  4PXE A;  5D29 A;  2HC9 A;  4EME A;  5HVG A;  3BI0 A;  1VGY A;  4R8F A;  1TKF A;  1CX8 A;  1XRY A;  1XMB A;  3FF3 A;  3B2Y A;  3KHX A;  2Q43 A;  4F8Z A;  2CTC A;  1YSJ A;  3D7H A;  1TF8 A;  4OC0 A;  4ZX9 A;  1QMU A;  2ZEH A;  2XEG A;  4GM5 A;  1LOK A;  1Y0R A;  1ZG8 A;  3KL9 A;  3B7I A;  1CPS A;  2VL1 A;  3D7F A;  4DJL A;  2IMO A;  2PJ3 A;  1ELL P;  5THW A;  2GRE A;  2ZEN A;  5LYL A;  2DEA A;  3CDX A;  3IWW A;  4NGR A;  4LQG A;  2PRQ A;  2AFU A;  3VH9 A;  3HLP A;  3KHZ A;  4OC4 A;  1AMP A;  5LRJ A;  4JYW A;  2OR4 A;  1TKJ A;  2C6C A;  1CPX A;  5LYF A;  2ZOF A;  1M4L A;  3S9M A;  4FAI A;  4MHY A;  1FT7 A;  2PVV A;  3JRU A;  3FEE A;  5K8O A;  2V8H A;  2PJ2 A;  5K8N A;  3IEH A;  3MN8 A;  3D67 A;  2FVG A;  4G1P A;  3SJF A;  4CPA A;  2C1C A;  3BHX A;  2PVW A;  2ZEE A;  3SI2 A;  5ELY A;  4MCP A;  4TWE A;  1GYT A;  2Q4Z A;  3PB8 X;  3CPA A;  3IIB A;  3RAM A;  3SJG A;  1F2O A;  3NA6 A;  1BAV A;  4NGT A;  2AFS A;  5HVH A;  2RFH A;  1NSA A;  3ISX A;  3H8G A;  2V8G A;  1H8L A;  4BD9 A;  5JM6 A;  5I4M A;  3N5F A;  4OC2 A;  2C6P A;  2AFZ A;  4JZ0 A;  3B3V A;  4WJB A;  2CF4 A;  3KAS A;  1HEE A;  4Z65 A;  2JEW A;  2F7V A;  1VHO A;  1EE3 P;  1LCP A;  2HB6 A;  4A38 A;  2PJ8 A;  1DE4 C;  2BO9 A;  1CG2 A;  3DLJ A;  3IFE A;  3RBU A;  3L2N A;  5IB9 A;  3RZA A;  2PIY A;  4NGN A;  5LRK A;  4YWY A;  4MCR A;  4DYO A;  3FJU A;  4YU9 A;  3D7D A;  1TF9 A;  4UIB A;  4EWT A;  4K3N A;  4OP4 A;  4MHP A;  3B3W A;  5LYD A;  1LFW A;  3KQZ A;  3V38 A;  1KWM A;  4RUH A;  1ZG7 A;  4IHM A;  4P44 A;  3KI9 A;  4MHZ A;  1YW6 A;  1XJO A;  2ZEP A;  2PJ4 A;  3KR4 A;  2ZOG A;  3HUV A;  1ARL A;  3PRT A;  4OKO A;  3D7G A;  1UWY A;  1Y0Y A;  2PJ7 A;  4ZI6 A;  2ZEG A;  4ZY2 A;  3FH4 A;  5JH9 A;  2NSM A;  4WWV A;  3SJX A;  2ZEM A;  3TC8 A;  2XEF A;  4R6T A;  2O4H A;  3KGQ A;  2ANP A;  2GU2 A;  1LAP A;  3KR5 A;  2WYR A;  4MCQ A;  1YME A;  1HDU A;  4UEE A;  3FMC A;  4NJR A;  1CBX A;  4OC5 A;  3I1U A;  2QJ8 A;  1Y7E A;  1LAM A;  4MRI A;  4PXD A;  1VIX A;  2PJC A;  1RTQ A;  4PQA A;  1IGB A;  2Q51 A;  1TXR A;  3MRU A;  4NGS A;  4P4I A;  4FWU A;  2I3C A;  3TX8 A;  1BPN A;  1ZLH A;  3B35 A;  5CBM A;  3ISZ A;  4P10 A;  3WT4 A;  1Z2L A;  1ELM P;  1YW4 A;  3BI1 A;  4F9U A;  3PFE A;  3CT9 A;  4ONW A;  3D66 A;  4P45 A;  3T8W A;  4IAV A;  2PJ5 A;  2OOT A;  5HXD A;  3BXM A;  2XEI A;  2JBK A;  3PB6 X;  3NH5 A;  1PCA A;  3CPX A;  2PJ6 A;  3LWU A;  3PB9 X;  2PJB A;  4OME A;  1F2P A;  4A37 A;  1ARM A;  2JBJ A;  4X3R A;  3D68 A;  3FX6 A;  4UF4 A;  3FED A;  4B6Z A;  2GLF A;  2PJA A;  4KSI A;  2EK9 A;  3K2K A;  5F09 A;  3NH8 A;  5LRG A;  5JGF A;  4ZY1 A;  2AFM A;  4P6Y A;  1F57 A;  2V8V A;  4Q7A A;  1TKH A;  4NGQ A;  2WZN A;  4ZX8 A;  4MMO A;  4P4F A;  3PEI A;  2PIZ A;  4NFR A;  4TNU A;  5HVF A;  2IQ6 A;  2AFO A;  4NJQ A;  3QNV A;  4DUK A;  3B3S A;  5K8M A;  3GUX A;  4UEZ A;  4MCS A;  2POK A;  4P4E A;  4EFD A;  4P4B A;  5D8N A;  1VHE A;  2PJ9 A;  4PPZ A;  2V8D A;  4ZY0 A;  3H8E A;  2QYV A;  4FUU A;  2ABZ A;  2PJ0 A;  2C6G A;  1IY7 A;  3DGV A;  3KQX A;  4P4D A;  1HDQ A;  7CPA A;  1FNO A;  4MXU A;  1Z8L A;  1R3N A;  3WAB A;  1CP7 A;  1AYE A;  2ZED A;  2O53 A;  4O23 A;  4OIW A;  2NYQ A;  3FVL A;  4ZYQ A;  4W9Y A;  2QVP A;  4UIA A;  2EWB A;  4A94 A;  3IJ3 A;  2ZEF A;  2XEJ A;  4NGM A;  3B3C A;  5K8P A;  3PBE A;  3SI1 A;  1Q7L A;  1LAN A;  4OC3 A;  1OBR A;  4UEF A;  4NGP A;  2AFW A;  3V7Z A;  2V77 A;  3PBB A;  4PXB A;  3LMS A;  1BPM A;  3PB4 X;  4F9V A;  3VAT A;  4FBE A;  2PJ1 A;  3GLJ A;  3WC5 A;  8CPA A;  3H8F A;  2AFX A;  2CIJ A;  4MHN A;  3PB7 X;  1BLL E;  3S9N A;  1CP6 A;  3IC1 A;  3B3T A;  5LYI A;  3D4U A;  2BCO A;  4H2K A;  1Z5R A;  5CPA A;  4OID A;  2GLJ A;  2ZEL A;  1ZG9 A;  2ZEO A;  3WC7 A;  3NH4 A;  5J1Q A;  3FEC A;  3KZW A;  3SI0 A;  2EK8 A;  2PCU A;  4PXC A;  4A39 A;  1QQ9 A;  3WC6 A;  2F8H A;  4X8I A;  4AXV A;  3VAR A;  2RB7 A;  4IK2 A;  3IO1 A;  3K9T A;  1YLO A;  3NFZ A;  4OC1 A;  1ZLI A;  2IJZ A;  4P4J A;  1XBU A;  4R76 A;  3SJE A;  4X2T A;  1R43 A; 
#chains in the Genus database with same CATH topology
 4KSF A;  2PE3 A;  2FIW A;  1CM0 A;  1XFO A;  2GFQ A;  5DS0 A;  3B8G A;  2CTB A;  3G8W A;  1DTD A;  4R7M A;  4KVO E;  4B14 A;  4M6I A;  1IB1 E;  3FB3 A;  1JQG A;  4X5K A;  2G9D A;  2BOA A;  4A32 A;  3PFO A;  3R1K A;  4LX9 A;  4PK2 A;  3F0A A;  2Z3K A;  3EFA A;  4JJX A;  3GB0 A;  1ZO0 A;  3N7Z A;  3ZZI A;  4AB7 A;  4B12 A;  2J9A A;  5DWN A;  3S9L A;  1PYT B;  4PXE A;  3QB8 A;  1IOF A;  1I21 A;  2HC9 A;  2PQ8 A;  2PR8 A;  5D29 A;  4CRY B;  4EME A;  5F46 A;  5HVG A;  3BI0 A;  1VGY A;  5G20 A;  3D2P A;  5IV0 A;  4R8F A;  3F5B A;  1TKF A;  5IB0 A;  1M4G A;  1CX8 A;  4A2Z A;  1XRY A;  1XMB A;  3FF3 A;  5KTD A;  3B2Y A;  5JQ4 A;  4MI4 A;  4MHD A;  2R98 A;  3KHX A;  2Q43 A;  4F8Z A;  5EMI A;  2CTC A;  1YSJ A;  3D7H A;  1TF8 A;  3TOA A;  1IYK A;  4OC0 A;  4Y49 B;  4ZX9 A;  1QMU A;  2ZEH A;  3LD2 A;  4AG9 A;  2XEG A;  4GM5 A;  4B6Z A;  1LOK A;  1Y0R A;  1ZG8 A;  4JXR A;  4NSQ A;  3KL9 A;  3B7I A;  2B5G B;  4OLL A;  3RYO A;  4YFJ A;  1S7L A;  4H6U A;  1WK4 A;  4NEX A;  3I3G A;  5ISV A;  1CPS A;  4C7H A;  2FS5 A;  4AVB A;  2VL1 A;  1YR0 A;  3S6F A;  3D7F A;  4DJL A;  2IMO A;  1BO4 A;  2PJ3 A;  3BJ7 A;  3EY5 A;  4UWJ A;  4KOV A;  1ELL P;  4LQ6 A;  5THW A;  4CGP A;  2GRE A;  3I9S A;  2ZEN A;  4B5P B;  4H6Z A;  5LYL A;  2DEA A;  3ZJ0 A;  5DWM A;  1XIX A;  3CDX A;  1FY7 A;  3H5Z A;  3IWW A;  4CAE A;  4KOT A;  4NGR A;  4LQG A;  1TIQ A;  3FXT A;  1WWZ A;  1OZP A;  2G0B A;  4J3G A;  4KVX A;  2OZH A;  2PRQ A;  2AFU A;  2Z0Z A;  3CXP A;  3VH9 A;  2JEV A;  2DPT A;  4A95 A;  3HLP A;  4UCM A;  3V8I A;  3KHZ A;  4OC4 A;  1AMP A;  2O28 A;  2G3A A;  3T9Y A;  4GXH A;  5LRJ A;  4JYW A;  5C82 A;  4RN7 A;  4KS9 A;  2OR4 A;  1TKJ A;  2C6C A;  1CPX A;  4MFK A;  5LYF A;  5BWA B;  2ZOF A;  1M4L A;  3S9M A;  4CAV A;  4FAI A;  4UWI A;  2GAN A;  4MHY A;  1FT7 A;  2PVV A;  3JRU A;  3FEE A;  5K8O A;  2REF A;  2V8H A;  1Z8T A;  2PJ2 A;  5K8N A;  3IEH A;  4M6G A;  3MN8 A;  3D67 A;  2REE A;  3H4Q A;  4ONU A;  5C88 A;  2FVG A;  4G1P A;  4A33 A;  4KSA A;  3SJF A;  1X10 A;  2C1C A;  3BHX A;  4CAX A;  2D4O A;  4CPA A;  2PVW A;  2ZEE A;  3SI2 A;  5ELY A;  4MCP A;  4TWE A;  1GYT A;  2HUZ A;  4CGM A;  2Q4Z A;  1M4I A;  3PB8 X;  3CPA A;  3IIB A;  2P6E A;  2ZPA A;  3RAM A;  3SJG A;  1QSN A;  1F2O A;  2FIA A;  4LUA A;  4OAD A;  3NA6 A;  1BAV A;  1V0C A;  3GYA A;  1IOI A;  4NGT A;  2AFS A;  1GHE A;  4KOX A;  1Z8W A;  5HVH A;  2FL4 A;  2RFH A;  1NSA A;  3DR8 A;  3ISX A;  3H8G A;  2ZW7 A;  3VWE A;  4MFL A;  5HH1 A;  4BIN A;  4XPK A;  5J8C A;  1KUV A;  2V8G A;  1H8L A;  4BD9 A;  3T90 A;  5JM6 A;  2Z3L A;  2IL4 A;  5I4M A;  1M1D A;  3TO9 A;  2OU2 A;  2R1I A;  2J8N A;  3N5F A;  2R7H A;  4OC2 A;  2C6P A;  2AFZ A;  2PRB A;  3TO6 A;  4JZ0 A;  3B3V A;  4WJB A;  3G3S A;  4I49 A;  3R95 A;  2CF4 A;  3KAS A;  1HEE A;  1YGH A;  1UFH A;  3JUW A;  4Z65 A;  3JVN A;  2CNS A;  2JEW A;  3IWG A;  5I0C A;  2F7V A;  2VI7 A;  2JDC A;  2Z3N A;  1VHO A;  1EE3 P;  2P6F A;  5AG5 A;  1LCP A;  4KOS A;  3FYN A;  2HB6 A;  2Q04 A;  3BLN A;  4CGO A;  2YNE A;  4A38 A;  3UY5 A;  3TTH A;  1I1D A;  2DPS A;  2PJ8 A;  5J8F A;  1DE4 C;  1U6M A;  2BO9 A;  2DF5 A;  4FD6 A;  1PUA A;  3SXO A;  1CG2 A;  3LOD A;  4DNC A;  1S7N A;  3DLJ A;  1S3Z A;  3D3S A;  3IFE A;  3S6K A;  4C2Z A;  3RBU A;  2VEZ A;  3L2N A;  4MY0 A;  2C27 A;  3PP9 A;  3JTK A;  5IB9 A;  3RZA A;  2PIY A;  4NGN A;  2ZXV A;  5LRK A;  4YWY A;  2PSW A;  4MCR A;  3FJU A;  4FD7 A;  4UFV A;  4MY3 A;  4YU9 A;  5E96 A;  4DYO A;  3D7D A;  4B10 A;  1TF9 A;  2WPX A;  4UIB A;  4HKF A;  3CXQ A;  4UBR A;  1QST A;  2A4N A;  4PK3 A;  1S7K A;  3NE8 A;  4EWT A;  4K3N A;  4OP4 A;  4U9Y A;  4MHP A;  3B3W A;  5F48 A;  5LYD A;  4B11 A;  1LFW A;  4MFJ A;  3KQZ A;  1MK4 A;  1KZF A;  3V38 A;  4KOY A;  3DR6 A;  1KWM A;  1Q2C A;  1ZG7 A;  2FXF A;  4IHM A;  4KOU A;  4R87 A;  4P44 A;  4RUH A;  3KI9 A;  3QAH A;  4MHZ A;  1YW6 A;  1XJO A;  2ZEP A;  2AJ6 A;  5A28 A;  2FT0 A;  2PJ4 A;  3KR4 A;  5H84 A;  4IUS A;  2ZOG A;  2G3T A;  4F6A A;  4KLV A;  3FBU A;  1N71 A;  3HUV A;  1ARL A;  4MFP A;  3PRT A;  4OKO A;  1IU8 A;  4CRZ B;  3DNS A;  4E2A A;  5KTC A;  3D7G A;  4II9 A;  4CYO A;  1UWY A;  2EVN A;  1Y0Y A;  4HNY B;  2PJ7 A;  4UFW A;  4ZI6 A;  2ZEG A;  3R9G A;  4XPD C;  2B4B A;  4ZY2 A;  3FH4 A;  4HNX B;  3BJ8 A;  5GCN A;  5JH9 A;  2NSM A;  5EBV A;  4WWV A;  2CXA A;  3SJX A;  2ZEM A;  3TC8 A;  1RO5 A;  2OB0 A;  3QAY A;  4CGL A;  1YK3 A;  2XEF A;  4E0A A;  4R6T A;  2O4H A;  3KGQ A;  2Q7S A;  2CY2 A;  3A9L A;  2ANP A;  1K4J A;  2GU2 A;  1LAP A;  1Z4R A;  1XMT A;  1P4N A;  3P2F A;  3KR5 A;  2RC4 A;  4KLW A;  2WYR A;  2Z10 A;  4MCQ A;  1YME A;  1HDU A;  4FD4 A;  4UEE A;  4AVC A;  3FMC A;  4NJR A;  1Y9W A;  1CBX A;  2VZZ A;  1J4J A;  3TCV A;  4OC5 A;  3I1U A;  2QJ8 A;  1Y7E A;  4QC6 A;  1BOB A;  1LAM A;  2Q7B A;  2Y0M A;  1M4D A;  4MRI A;  4R9M A;  3R9F A;  4PXD A;  1MJA A;  1VIX A;  2ZW5 A;  1IYL A;  2PJC A;  1RTQ A;  1L0C A;  2HQY A;  2Q4V A;  4L89 A;  5JPH A;  2WUU A;  1YQE A;  4PQA A;  4K30 A;  1IGB A;  2Q51 A;  2Q0Y A;  1TXR A;  3MRU A;  4NGS A;  4P4I A;  4QUS A;  1M44 A;  4FWU A;  1R57 A;  2NMT A;  5AGE A;  4R3L A;  2I3C A;  1Y7R A;  3TX8 A;  4CGN A;  1BPN A;  1ZLH A;  3B35 A;  5CBM A;  4KUA A;  3ISZ A;  4P10 A;  4NXY A;  3PGP A;  2PR1 A;  4CYP A;  4PV6 A;  3WT4 A;  1VKC A;  1Z2L A;  1ELM P;  3EO4 A;  1YW4 A;  4QVT A;  3IWE A;  4U5Y A;  2I00 A;  3BI1 A;  4JLY A;  2YND A;  2VZY A;  4F9U A;  4ZGY B;  3PFE A;  2OZG A;  3CT9 A;  4NCZ A;  4ONW A;  3D66 A;  1NE9 A;  2QEC A;  4RI1 A;  2X7B A;  4P45 A;  4XPD B;  3T8W A;  4IAV A;  4AVA A;  4KOR A;  2GIV A;  4B5O A;  2PJ5 A;  2OOT A;  2KCW A;  5HXD A;  1QSR A;  3PZJ A;  2BSW A;  3DSB A;  4CAW A;  3BXM A;  2XEI A;  3CXS A;  2QIR A;  3IU1 A;  2JBK A;  4ZBG A;  3PB6 X;  1YVK A;  4F0X A;  3FRM A;  3VWD A;  2YGW A;  1PCA A;  3CPX A;  2PJ6 A;  3LWU A;  3NH5 A;  3PB9 X;  3W6X A;  4QBJ A;  1B87 A;  1YX0 A;  2PJB A;  2VBQ A;  4OME A;  1F2P A;  4A37 A;  3R9E A;  1ARM A;  2JBJ A;  4X3R A;  2QML A;  1QSO A;  3D68 A;  3FX6 A;  4A30 A;  2AE6 A;  4UF4 A;  3FED A;  5EC4 A;  3NE7 A;  2GLF A;  2PJA A;  4KSI A;  2EK9 A;  1LRZ A;  3GKR A;  3K2K A;  4XNH B;  5AG6 A;  3TOB A;  5F09 A;  3NH8 A;  2YNC A;  5LRG A;  1S5K A;  5JGF A;  1CJW A;  4ZY1 A;  2AFM A;  4P6Y A;  4R3K A;  1YVO A;  1F57 A;  1IID A;  2V8V A;  3D2M A;  2Z11 A;  4Q7A A;  1TKH A;  3IU2 A;  4FD5 A;  2ODF A;  1X12 A;  2WZN A;  4NGQ A;  4ZX8 A;  5G1Z A;  4MMO A;  4KUB A;  4M3S A;  4P4F A;  2GE3 A;  4R57 A;  3PEI A;  2PIZ A;  4NFR A;  2B4D A;  4PSX A;  4TNU A;  5CNP A;  1MJ9 A;  5HVF A;  1ON0 A;  1Q2Y A;  3CZX A;  5IX3 A;  2IQ6 A;  2Z3M A;  2AFO A;  4NJQ A;  4UCP A;  1Q2D A;  3QNV A;  4DUK A;  1B6B A;  3B3S A;  5F49 A;  1SQH A;  3LAC A;  5K8M A;  3GUX A;  4JWP A;  1Z4E A;  4UEZ A;  4KOW A;  2POK A;  2K5T A;  4MCS A;  4JD6 A;  4P4E A;  4BBH A;  4EFD A;  3KKW A;  4P4B A;  5D8N A;  1VHE A;  2PJ9 A;  1S60 A;  2WSA A;  4EVY A;  2ZW6 A;  4Q38 A;  4PPZ A;  2Z3O A;  2OH1 A;  1PU9 A;  2J8M A;  2V8D A;  1MJB A;  4ZY0 A;  3TO7 A;  4C2Y A;  1YRE A;  2QYV A;  3H8E A;  4FUU A;  2Q4Y A;  4HPS A;  1KUX A;  4MFQ A;  2ABZ A;  4Q36 A;  3WR7 A;  4C2X A;  2PJ0 A;  5AG7 A;  2C6G A;  4L8A A;  4OAE A;  1IY7 A;  3DGV A;  3KQX A;  4P4D A;  1HDQ A;  7CPA A;  1FNO A;  4MXU A;  1Z8L A;  1R3N A;  4H89 A;  3WAB A;  2JDD A;  4CYN A;  4E8O A;  1XOV A;  2CNT A;  1CP7 A;  1AYE A;  5F47 A;  4AG7 A;  2JLM A;  2O53 A;  2ZED A;  4O23 A;  4OIW A;  3SHP A;  2VQY A;  3E0K A;  2NYQ A;  3FVL A;  4ZYQ A;  4W9Y A;  3P2H A;  2QVP A;  4GS4 A;  2EWB A;  4UIA A;  1VHS A;  3IJ3 A;  4HNW B;  2ZEF A;  4A94 A;  2XEJ A;  4IF5 A;  2PDO A;  2OZU A;  3EXN A;  5HMN A;  4QB9 A;  1IIC A;  3S6H A;  4NGM A;  3B3C A;  3FNC A;  4CYQ A;  5K8P A;  2Q44 A;  4UFX A;  3PBE A;  2FSR A;  4UCN A;  3SI1 A;  2HV2 A;  3SXN A;  1Q7L A;  2B4D B;  2B3U A;  1XEB A;  1LAN A;  3EC4 A;  4OC3 A;  1OBR A;  4UEF A;  4XNH C;  4B13 A;  2B3V A;  2P6G A;  3F8K A;  3RNZ A;  4NGP A;  3IGR A;  4YRH A;  3C26 A;  3TE4 A;  2AFW A;  1AUG A;  3R96 A;  3V7Z A;  1S7F A;  4CS0 B;  2FE7 A;  2V77 A;  3PBB A;  4JXQ A;  2ZW4 A;  4F0Y A;  3W91 A;  1Z8X A;  1A2Z A;  1YLE A;  4PXB A;  3LMS A;  3TT2 A;  2H5M A;  1NSL A;  1BPM A;  3PB4 X;  4F9V A;  4NF1 A;  1NMT A;  3VAT A;  2F5I A;  3OWC A;  4FBE A;  4PSW A;  1P0H A;  1Z9U A;  2PJ1 A;  3GLJ A;  3WC5 A;  3K9U A;  3H8F A;  8CPA A;  2I79 A;  2D4P A;  2AFX A;  2CIJ A;  4MHN A;  1I12 A;  5G22 A;  3PB7 X;  4KZT A;  2DXQ A;  1BLL E;  2CNM A;  3S9N A;  1CP6 A;  1KUY A;  3IC1 A;  4M6H A;  5FVJ A;  3D8P A;  5KTA A;  4C68 A;  2BL1 A;  3B3T A;  2P0W A;  5LYI A;  2VXK A;  3D4U A;  5A27 A;  4XPL A;  4MFZ A;  2BCO A;  2EBJ A;  4H2K A;  6CPA A;  5AG4 A;  3DDD A;  4UA3 A;  1Z5R A;  5CPA A;  3S6G A;  4A31 A;  3TFY A;  3GY9 A;  4OID A;  2GLJ A;  2ZEL A;  2BEI A;  3RO0 A;  1ZG9 A;  2ZEO A;  1XE4 A;  3WC7 A;  3NH4 A;  5J1Q A;  2FCK A;  3FEC A;  3KZW A;  4Y49 C;  3W6S A;  3SI0 A;  2EK8 A;  2PC1 A;  2PCU A;  4PXC A;  2WPW A;  4A39 A;  2J8R A;  4M85 A;  1QQ9 A;  3WC6 A;  2R8V A;  2YNC C;  4C7I A;  2F8H A;  2ATR A;  2EUI A;  5H86 A;  1JWQ A;  1RXT A;  4X8I A;  1Y9K A;  4AXV A;  3VAR A;  1QSM A;  4RS2 A;  2B5G A;  2RB7 A;  4IK2 A;  2EO8 A;  3IO1 A;  4U9Z A;  3K9T A;  1YLO A;  3NFZ A;  4OC1 A;  2ARH A;  5G21 A;  4MBU A;  1ZLI A;  1XF8 A;  3GIU A;  3MGD A;  2IJZ A;  4KVM E;  3FIX A;  4P4J A;  4CAF A;  2B58 A;  4BMH A;  4MJ8 A;  4YGO A;  2Z3P A;  1XBU A;  4R76 A;  3SJE A;  4B5P A;  4ORF A;  2BUE A;  4X2T A;  1R43 A; 
#chains in the Genus database with same CATH homology
 2PE3 A;  1XFO A;  5DS0 A;  2CTB A;  1DTD A;  4R7M A;  1JQG A;  2G9D A;  2BOA A;  3PFO A;  6CPA A;  3GB0 A;  3S9L A;  2J9A A;  1PYT B;  4PXE A;  5D29 A;  2HC9 A;  4EME A;  5HVG A;  3BI0 A;  1VGY A;  4R8F A;  1TKF A;  1CX8 A;  1XRY A;  1XMB A;  3FF3 A;  3B2Y A;  3KHX A;  2Q43 A;  4F8Z A;  2CTC A;  1YSJ A;  3D7H A;  1TF8 A;  4OC0 A;  4ZX9 A;  1QMU A;  2ZEH A;  2XEG A;  4GM5 A;  1LOK A;  1Y0R A;  1ZG8 A;  3KL9 A;  3B7I A;  1CPS A;  2VL1 A;  3D7F A;  4DJL A;  2IMO A;  2PJ3 A;  1ELL P;  5THW A;  2GRE A;  2ZEN A;  5LYL A;  2DEA A;  3CDX A;  3IWW A;  4NGR A;  4LQG A;  2PRQ A;  2AFU A;  3VH9 A;  3HLP A;  3KHZ A;  4OC4 A;  1AMP A;  5LRJ A;  4JYW A;  2OR4 A;  1TKJ A;  2C6C A;  1CPX A;  5LYF A;  2ZOF A;  1M4L A;  3S9M A;  4FAI A;  4MHY A;  1FT7 A;  2PVV A;  3JRU A;  3FEE A;  5K8O A;  2V8H A;  2PJ2 A;  5K8N A;  3IEH A;  3MN8 A;  3D67 A;  2FVG A;  4G1P A;  3SJF A;  4CPA A;  2C1C A;  3BHX A;  2PVW A;  2ZEE A;  3SI2 A;  5ELY A;  4MCP A;  4TWE A;  1GYT A;  2Q4Z A;  3PB8 X;  3CPA A;  3IIB A;  3RAM A;  3SJG A;  1F2O A;  3NA6 A;  1BAV A;  4NGT A;  2AFS A;  5HVH A;  2RFH A;  1NSA A;  3ISX A;  3H8G A;  2V8G A;  1H8L A;  4BD9 A;  5JM6 A;  5I4M A;  3N5F A;  4OC2 A;  2C6P A;  2AFZ A;  4JZ0 A;  3B3V A;  4WJB A;  2CF4 A;  3KAS A;  1HEE A;  4Z65 A;  2JEW A;  2F7V A;  1VHO A;  1EE3 P;  1LCP A;  2HB6 A;  4A38 A;  2PJ8 A;  1DE4 C;  2BO9 A;  1CG2 A;  3DLJ A;  3IFE A;  3RBU A;  3L2N A;  5IB9 A;  3RZA A;  2PIY A;  4NGN A;  5LRK A;  4YWY A;  4MCR A;  4DYO A;  3FJU A;  4YU9 A;  3D7D A;  1TF9 A;  4UIB A;  4EWT A;  4K3N A;  4OP4 A;  4MHP A;  3B3W A;  5LYD A;  1LFW A;  3KQZ A;  3V38 A;  1KWM A;  4RUH A;  1ZG7 A;  4IHM A;  4P44 A;  3KI9 A;  4MHZ A;  1YW6 A;  1XJO A;  2ZEP A;  2PJ4 A;  3KR4 A;  2ZOG A;  3HUV A;  1ARL A;  3PRT A;  4OKO A;  3D7G A;  1UWY A;  1Y0Y A;  2PJ7 A;  4ZI6 A;  2ZEG A;  4ZY2 A;  3FH4 A;  5JH9 A;  2NSM A;  4WWV A;  3SJX A;  2ZEM A;  3TC8 A;  2XEF A;  4R6T A;  2O4H A;  3KGQ A;  2ANP A;  2GU2 A;  1LAP A;  3KR5 A;  2WYR A;  4MCQ A;  1YME A;  1HDU A;  4UEE A;  3FMC A;  4NJR A;  1CBX A;  4OC5 A;  3I1U A;  2QJ8 A;  1Y7E A;  1LAM A;  4MRI A;  4PXD A;  1VIX A;  2PJC A;  1RTQ A;  4PQA A;  1IGB A;  2Q51 A;  1TXR A;  3MRU A;  4NGS A;  4P4I A;  4FWU A;  2I3C A;  3TX8 A;  1BPN A;  1ZLH A;  3B35 A;  5CBM A;  3ISZ A;  4P10 A;  3WT4 A;  1Z2L A;  1ELM P;  1YW4 A;  3BI1 A;  4F9U A;  3PFE A;  3CT9 A;  4ONW A;  3D66 A;  4P45 A;  3T8W A;  4IAV A;  2PJ5 A;  2OOT A;  5HXD A;  3BXM A;  2XEI A;  2JBK A;  3PB6 X;  3NH5 A;  1PCA A;  3CPX A;  2PJ6 A;  3LWU A;  3PB9 X;  2PJB A;  4OME A;  1F2P A;  4A37 A;  1ARM A;  2JBJ A;  4X3R A;  3D68 A;  3FX6 A;  4UF4 A;  3FED A;  4B6Z A;  2GLF A;  2PJA A;  4KSI A;  2EK9 A;  3K2K A;  5F09 A;  3NH8 A;  5LRG A;  5JGF A;  4ZY1 A;  2AFM A;  4P6Y A;  1F57 A;  2V8V A;  4Q7A A;  1TKH A;  4NGQ A;  2WZN A;  4ZX8 A;  4MMO A;  4P4F A;  3PEI A;  2PIZ A;  4NFR A;  4TNU A;  5HVF A;  2IQ6 A;  2AFO A;  4NJQ A;  3QNV A;  4DUK A;  3B3S A;  5K8M A;  3GUX A;  4UEZ A;  4MCS A;  2POK A;  4P4E A;  4EFD A;  4P4B A;  5D8N A;  1VHE A;  2PJ9 A;  4PPZ A;  2V8D A;  4ZY0 A;  3H8E A;  2QYV A;  4FUU A;  2ABZ A;  2PJ0 A;  2C6G A;  1IY7 A;  3DGV A;  3KQX A;  4P4D A;  1HDQ A;  7CPA A;  1FNO A;  4MXU A;  1Z8L A;  1R3N A;  3WAB A;  1CP7 A;  1AYE A;  2ZED A;  2O53 A;  4O23 A;  4OIW A;  2NYQ A;  3FVL A;  4ZYQ A;  4W9Y A;  2QVP A;  4UIA A;  2EWB A;  4A94 A;  3IJ3 A;  2ZEF A;  2XEJ A;  4NGM A;  3B3C A;  5K8P A;  3PBE A;  3SI1 A;  1Q7L A;  1LAN A;  4OC3 A;  1OBR A;  4UEF A;  4NGP A;  2AFW A;  3V7Z A;  2V77 A;  3PBB A;  4PXB A;  3LMS A;  1BPM A;  3PB4 X;  4F9V A;  3VAT A;  4FBE A;  2PJ1 A;  3GLJ A;  3WC5 A;  8CPA A;  3H8F A;  2AFX A;  2CIJ A;  4MHN A;  3PB7 X;  1BLL E;  3S9N A;  1CP6 A;  3IC1 A;  3B3T A;  5LYI A;  3D4U A;  2BCO A;  4H2K A;  1Z5R A;  5CPA A;  4OID A;  2GLJ A;  2ZEL A;  1ZG9 A;  2ZEO A;  3WC7 A;  3NH4 A;  5J1Q A;  3FEC A;  3KZW A;  3SI0 A;  2EK8 A;  2PCU A;  4PXC A;  4A39 A;  1QQ9 A;  3WC6 A;  2F8H A;  4X8I A;  4AXV A;  3VAR A;  2RB7 A;  4IK2 A;  3IO1 A;  3K9T A;  1YLO A;  3NFZ A;  4OC1 A;  1ZLI A;  2IJZ A;  4P4J A;  1XBU A;  4R76 A;  3SJE A;  4X2T A;  1R43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...