2AFUA

Crystal structure of human glutaminyl cyclase in complex with glutamine t-butyl ester
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
329
structure length
321
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLDLSLQLIFFDGQEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutaminyl-peptide cyclotransferase
publication title Crystal structures of human glutaminyl cyclase, an enzyme responsible for protein N-terminal pyroglutamate formation
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 321
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2afuA00
3LWUA 4JYWA 4NGPA 1Z2LA 2ZEOA 1BLLE 4W9YA 8CPAA 3KASA 1XMBA 2GLFA 4A37A 2ZEFA 3RAMA 4OC1A 3VH9A 2PJ4A 1TXRA 2PVWA 3SI1A 2C6CA 2VL1A 1PCAA 4ZX8A 5I4MA 1XJOA 1ARMA 2AFOA 3MN8A 3V7ZA 3H8FA 2PJ5A 2ZEDA 4MCPA 3TX8A 1Q7LA 4EMEA 2ZEHA 4MCSA 4NGQA 4P4JA 3B3SA 4R7MA 2Q4ZA 3KHZA 1F57A 1VGYA 2IJZA 2V8GA 6CPAA 3D7HA 4MHYA 5LYDA 5THWA 2PJ3A 4R8FA 3KZWA 5HVGA 2C6GA 3IEHA 3D4UA 4DYOA 1LOKA 2PJCA 2XEIA 4OC5A 4MXUA 3PBBA 4GM5A 4UIAA 4PQAA 3CPXA 3B3VA 4OP4A 3B2YA 3HLPA 1R3NA 4EFDA 4UEFA 4OC2A 4WWVA 3FMCA 4Z65A 3I1UA 1YW4A 1F2OA 2ZEEA 5IB9A 1XBUA 3BI1A 3FH4A 3FECA 3NH4A 4OC0A 3CT9A 3D7FA 2ZOFA 3S9MA 3IO1A 1TKJA 2IQ6A 3WC6A 3IFEA 2AFWA 3VARA 4P4EA 5LYLA 1DE4C 2QJ8A 4NGSA 4WJBA 4NJQA 3DLJA 4IAVA 1JQGA 1TKHA 5JH9A 4H2KA 1CX8A 3IC1A 4P6YA 1ARLA 2PVVA 2PJ2A 4O23A 4IK2A 2C6PA 2G9DA 4NJRA 4FBEA 1VHEA 2EK9A 4PPZA 3PFOA 1TF9A 5ELYA 1CBXA 5K8PA 3CPAA 3WT4A 2V8VA 2EWBA 2O4HA 1CG2A 3KHXA 2CIJA 2PIZA 2CF4A 3D7GA 1ZG8A 1CP7A 2AFZA 1QMUA 4ZY0A 2PRQA 1R43A 3GUXA 2CTBA 4PXEA 3SJFA 5LYIA 1BAVA 3S9LA 2JBKA 7CPAA 1UWYA 2BO9A 2J9AA 3ISZA 4NGTA 3FJUA 5HXDA 4X8IA 4NFRA 3DGVA 1LANA 2C1CA 2AFSA 3FVLA 3K2KA 2V8DA 1YMEA 4OC4A 3PB4X 1RTQA 4MCRA 4Q7AA 3D7DA 5LRKA 4YWYA 2PCUA 1ELMP 5D29A 4DJLA 3D66A 5LRGA 1Z5RA 1TF8A 2WZNA 3IIBA 3SJXA 1AYEA 3H8EA 2PJ7A 2Q51A 3PRTA 2GREA 2ZEPA 4MHZA 4X2TA 1YW6A 2JEWA 4PXDA 4MRIA 4F9UA 2PE3A 3D68A 4OC3A 3PBEA 1YSJA 1IY7A 2AFUA 3K9TA 1Y0YA 3PEIA 5LYFA 2ZELA 5JGFA 1BPNA 3FX6A 4NGNA 4P4DA 4ZI6A 4UIBA 5J1QA 3WC5A 5D8NA 1GYTA 2BOAA 4P45A 2AFMA 3NA6A 2O53A 4TWEA 3JRUA 1TKFA 4UEEA 3PFEA 3KQZA 1Y0RA 5F09A 4F9VA 1ZG9A 1Y7EA 2OR4A 1FNOA 3KQXA 3RBUA 4FUUA 3L2NA 1BPMA 4JZ0A 4FWUA 3QNVA 3FF3A 1CP6A 5LRJA 1HDQA 2XEFA 3KR5A 4NGMA 3GB0A 3GLJA 4X3RA 5DS0A 4A39A 4P4BA 4PXBA 4AXVA 1NSAA 5K8NA 2F7VA 2Q43A 1XRYA 4G1PA 2PIYA 4A94A 4UEZA 4ZX9A 4MHPA 3WABA 1QQ9A 2QVPA 2NSMA 3B7IA 3PB9X 1XFOA 2PJ6A 3PB8X 3KR4A 2HB6A 3FEDA 1OBRA 1EE3P 1CPXA 1PYTB 4OKOA 3ISXA 4P10A 2V77A 1DTDA 4IHMA 2PJ8A 1AMPA 2QYVA 2FVGA 1LAMA 3CDXA 3NH5A 2XEGA 3TC8A 1ZLHA 4RUHA 5HVHA 2CTCA 3RZAA 4K3NA 3N5FA 2RB7A 3B35A 3SJEA 4TNUA 3HUVA 1VHOA 3KI9A 2JBJA 2BCOA 4P44A 2ZEGA 2PJAA 4CPAA 2ZOGA 3MRUA 3V38A 3KGQA 2POKA 5K8MA 4DUKA 2ZEMA 5K8OA 1HDUA 4A38A 3B3CA 1Z8LA 3KL9A 1ELLP 2IMOA 1FT7A 3S9NA 3T8WA 2PJ9A 2RFHA 2WYRA 1CPSA 3NFZA 4YU9A 2OOTA 4EWTA 2EK8A 4ZY2A 4OIWA 1LCPA 4BD9A 3BXMA 3B3WA 4MMOA 2DEAA 1VIXA 2F8HA 3NH8A 3B3TA 4PXCA 2ANPA 2ZENA 3PB6X 4LQGA 2I3CA 3PB7X 5HVFA 2GU2A 3SI0A 4KSIA 4UF4A 2XEJA 1IGBA 5CPAA 4ZYQA 4R76A 4FAIA 1KWMA 5CBMA 3BHXA 1HEEA 2NYQA 3IJ3A 4ONWA 4P4FA 3WC7A 3H8GA 2V8HA 4NGRA 4F8ZA 3D67A 1F2PA 1YLOA 4OMEA 1LFWA 3LMSA 4MCQA 2AFXA 2PJ0A 4ZY1A 2HC9A 3FEEA 5JM6A 3BI0A 4MHNA 1M4LA 3VATA 2GLJA 1LAPA 2PJ1A 1ZLIA 1ZG7A 4OIDA 3IWWA 4P4IA 2PJBA 1H8LA 3SJGA 3SI2A 2ABZA 4B6ZA 4R6TA
chains in the Genus database with same CATH superfamily
3LWUA 4JYWA 4NGPA 1Z2LA 2ZEOA 1BLLE 1PUAA 1S5KA 1S7FA 2F5IA 3H4QA 2I00A 4L89A 4W9YA 8CPAA 3KASA 4KOWA 4CYNA 1XMBA 3S6HA 2GLFA 4A37A 2ZEFA 2PC1A 3RAMA 5AG7A 2WPXA 4RI1A 4OC1A 3VH9A 3H5ZA 1XMTA 2FT0A 2PJ4A 4UCNA 3VWEA 1TXRA 2PVWA 4UWJA 3SI1A 2EO8A 2C6CA 4CAXA 2VL1A 1PCAA 4X5KA 4ZX8A 3V8IA 5I4MA 1XJOA 4KOTA 2VZYA 1VHSA 2BL1A 1ARMA 2Q0YA 3K9UA 4UWIA 2AFOA 2JDDA 3MN8A 3S6FA 3V7ZA 5IB0A 3H8FA 2PJ5A 1Q2DA 3LACA 2B5GA 4NF1A 5AG4A 2ZEDA 2VI7A 2R98A 4MCPA 3EFAA 3TX8A 1Q7LA 4MJ8A 4B5OA 5EBVA 4EMEA 2J8RA 2ZEHA 4MCSA 4NGQA 3DNSA 4P4JA 5HMNA 3B3SA 4K30A 4R7MA 2Q4ZA 3KHZA 1WK4A 4II9A 1F57A 3R95A 4MY0A 5E96A 3S6KA 1VGYA 2IJZA 2Q44A 1R57A 2V8GA 6CPAA 1YVKA 3D7HA 4MHYA 4KLWA 5LYDA 5THWA 4H6ZA 2PJ3A 4R8FA 4EVYA 3KZWA 3PZJA 4GS4A 2Z11A 2ZW5A 2C6GA 3IEHA 3DR6A 5HVGA 3D4UA 4DYOA 2BSWA 3I3GA 5F48A 3F5BA 1XIXA 2YNCA 1LOKA 1QSOA 2PJCA 4XPDB 2XEIA 2YNCC 4OC5A 4MXUA 2J8NA 3PBBA 5C82A 1Y9WA 2DPTA 2YNDA 1RXTA 4GM5A 2P6EA 4UIAA 4PQAA 3CPXA 3B3VA 3IU1A 2G0BA 1Q2CA 1MJAA 4U9YA 2OH1A 4OP4A 3B2YA 3HLPA 2PR1A 1R3NA 1N71A 1V0CA 4EFDA 4UEFA 3IWGA 4MFKA 4B5PA 4OC2A 5J8CA 4WWVA 4KORA 4KVOE 1Y9KA 2AJ6A 2ZXVA 3FMCA 3T9YA 5KTDA 2VZZA 4PSXA 4Z65A 3I1UA 1YW4A 1Y7RA 1F2OA 2R8VA 2ZEEA 4M85A 5IB9A 5JPHA 3RNZA 4KUAA 1XBUA 3BI1A 3FH4A 3FECA 1XEBA 2DF5A 1MJ9A 3CXPA 4OADA 3NH4A 4OC0A 4JXQA 3CT9A 3D7FA 3P2HA 1TIQA 2ZOFA 2FCKA 3QB8A 3S9MA 1S7NA 3IO1A 4UA3A 1TKJA 2IQ6A 4CYQA 3D8PA 1KUVA 3WC6A 3IFEA 1QSRA 2GFQA 2FL4A 2AFWA 3VARA 4P4EA 5LYLA 4AVBA 1DE4C 2CNTA 2QJ8A 1FY7A 4NGSA 4WJBA 4NJQA 3DLJA 4IAVA 4MY3A 1M1DA 1JQGA 1NMTA 2PR8A 4A32A 4A95A 1M4GA 1TKHA 4YFJA 5JH9A 4H2KA 3E0KA 1CX8A 5GCNA 3IC1A 4P6YA 1ARLA 2EBJA 2PVVA 1KUYA 2PJ2A 3ZJ0A 2VXKA 4R9MA 5J8FA 4MHDA 4NEXA 4B10A 4O23A 4IK2A 3EY5A 3TOAA 4MFPA 4LX9A 4XNHB 2OB0A 3NE7A 4MFJA 4MI4A 2G3AA 4IUSA 2C6PA 2G9DA 4NJRA 4A31A 4FBEA 1VHEA 2EK9A 4PPZA 3PFOA 1TF9A 4H89A 4QC6A 4E8OA 5DWNA 5ELYA 1CBXA 4NXYA 5K8PA 4UCMA 4R57A 3CPAA 3WT4A 2V8VA 2EWBA 2O4HA 4NSQA 4PSWA 1CG2A 3KHXA 4A2ZA 2CIJA 1QSNA 2JEVA 1S60A 3QAYA 2PIZA 4ORFA 5CNPA 2CF4A 4BINA 4AVCA 3D7GA 2CXAA 4CAVA 1ZG8A 4UFVA 1CP7A 2R1IA 1GHEA 4A30A 1A2ZA 4E2AA 4PK2A 2G3TA 2AFZA 3DSBA 2JDCA 1QMUA 2Z3LA 1X10A 4ZY0A 2PRQA 1R43A 4M3SA 3GUXA 2P0WA 2C27A 2CTBA 2REEA 1AUGA 4PXEA 3SJFA 4BMHA 1X12A 2RC4A 4KOYA 4KSAA 4PV6A 1UFHA 1BAVA 1IIDA 5LYIA 3FIXA 3VWDA 3S9LA 2JBKA 1WWZA 1UWYA 2BO9A 3LD2A 2J9AA 2B58A 2WSAA 4KSFA 1QSTA 4AG9A 3GY9A 3ISZA 2HV2A 4NGTA 3FJUA 4ONUA 4H6UA 5HXDA 2K5TA 2ARHA 4OLLA 4NFRA 4R3LA 4X8IA 1YVOA 3DGVA 1LANA 3R96A 2C1CA 2CY2A 2AFSA 2GIVA 5AGEA 2EUIA 4L8AA 2HQYA 2ATRA 3FVLA 3K2KA 4QUSA 2ZW6A 2V8DA 5F47A 2JLMA 1YMEA 2PQ8A 3A9LA 4B13A 4OC4A 3PB4X 1RTQA 4MCRA 4UFWA 3SXNA 3W91A 4Q7AA 3OWCA 3D7DA 3EXNA 2YGWA 4Y49B 5LRKA 3N7ZA 4UCPA 3UY5A 4MBUA 4YWYA 2PCUA 2WPWA 1ELMP 4A33A 2QIRA 2B4BA 4CAWA 1KUXA 3C26A 2B4DA 1PU9A 5D29A 3FNCA 4DJLA 2KCWA 2AE6A 3CXSA 3D66A 4CYPA 2REFA 4C2YA 5H84A 1BO4A 5LRGA 1Z5RA 3CZXA 1B6BA 1TF8A 2WZNA 2Q4VA 4KOXA 3IIBA 3SJXA 4FD4A 1AYEA 4ZGYB 4J3GA 3H8EA 2PJ7A 2Q51A 2Z3NA 2GREA 2Z10A 2ZEPA 3FRMA 3P2FA 3PRTA 4MHZA 2FIAA 4X2TA 4KOSA 1YW6A 5ISVA 2JEWA 5G21A 2BEIA 3RYOA 1XOVA 1YQEA 4FD5A 4KZTA 4PXDA 4MRIA 4RN7A 4BBHA 1CJWA 3TOBA 4F9UA 2PE3A 1YGHA 3CXQA 4GXHA 4E0AA 3D68A 4IF5A 4AVAA 4YGOA 4OC3A 3PBEA 2Z3OA 3RO0A 1YR0A 1YSJA 1IY7A 2AFUA 1Z9UA 3PP9A 4I49A 3TCVA 2B5GB 3K9TA 1Z4EA 1Y0YA 3PEIA 5LYFA 3BJ7A 2ZELA 5JGFA 1IICA 1BPNA 1Q2YA 3IWEA 5BWAB 2ZW4A 3FX6A 1QSMA 4NGNA 2Z0ZA 4P4DA 3FBUA 4AG7A 4PK3A 2QECA 4C7HA 1Z8WA 4ZI6A 4KLVA 4UIBA 5J1QA 3WC5A 5D8NA 1LRZA 5G22A 2OZUA 1GYTA 2BOAA 4P45A 2GE3A 1J4JA 1Z8XA 2AFMA 3NA6A 2O53A 4TWEA 5EMIA 3JRUA 4CGPA 2IL4A 1TKFA 1VKCA 3FXTA 3FYNA 4CGOA 2OU2A 4JLYA 4UEEA 2PDOA 2P6FA 3KQZA 3PFEA 1Y0RA 1XE4A 5F09A 4HNXB 3WR7A 4F9VA 1ZG9A 1Y7EA 2R7HA 4HPSA 3PGPA 2OR4A 1FNOA 3TO7A 1XF8A 3KQXA 3RBUA 5AG6A 4FUUA 3G8WA 4DNCA 3L2NA 2J8MA 1BPMA 4JZ0A 1NSLA 4LQ6A 4NCZA 4FWUA 1S7KA 1M4DA 2B3VA 3QNVA 3FF3A 4KUBA 3EO4A 1CP6A 5LRJA 4CYOA 4Q38A 1U6MA 4CAFA 1IOIA 2FE7A 1HDQA 2XEFA 3KR5A 4NGMA 4QVTA 3GB0A 3GLJA 3TTHA 1Z8TA 4HKFA 4CGLA 4CS0B 4QBJA 2O28A 4X3RA 5DS0A 4CRYB 4B5PB 4F6AA 4A39A 4P4BA 3DDDA 4PXBA 4AXVA 1SQHA 1Z4RA 3T90A 1NE9A 1NSAA 1L0CA 2F7VA 5K8NA 2Q43A 1IB1E 1XRYA 4B14A 5A27A 1MJBA 2DXQA 4G1PA 4OAEA 4XPDC 2PIYA 4A94A 4UEZA 4ZX9A 4MHPA 3WABA 1QQ9A 2Z3PA 2QVPA 2NSMA 3B7IA 3PB9X 5F49A 4C2ZA 1XFOA 2PJ6A 1M4IA 5I0CA 3PB8X 5AG5A 1YK3A 3KR4A 2Q7BA 2HB6A 4XPLA 1IYKA 3FEDA 3TFYA 1OBRA 3I9SA 1EE3P 4CRZB 1CPXA 1PYTB 4M6HA 4R3KA 4OKOA 5IX3A 3TO6A 2FSRA 5FVJA 3ISXA 1I21A 3R9EA 3S6GA 3TE4A 3D3SA 5KTAA 4P10A 2V77A 2Q7SA 2YNEA 1DTDA 4IHMA 4C68A 2PJ8A 1AMPA 2PSWA 2Z3MA 3R9GA 2QYVA 5A28A 2FVGA 1LAMA 2VBQA 3CDXA 4YRHA 3NH5A 3SHPA 3G3SA 1ON0A 4MFZA 4CGMA 3D2PA 2XEGA 3F0AA 3TC8A 1ZLHA 4RUHA 5HVHA 1I1DA 2CTCA 3RZAA 5C88A 2OZGA 4K3NA 3N5FA 2RB7A 1P4NA 1IYLA 2B3UA 3B35A 3NE8A 4FD7A 4TNUA 2D4PA 2WUUA 4XPKA 3SJEA 3TT2A 3HUVA 1VHOA 3KI9A 2JBJA 2ZPAA 3W6XA 2BCOA 4KVME 3B8GA 4P44A 4UFXA 1S7LA 4B11A 2ZEGA 2PJAA 4MFQA 2FS5A 3EC4A 2ZOGA 3MRUA 4R87A 2ODFA 4ZBGA 3KGQA 3V38A 4CPAA 2POKA 5K8MA 1MK4A 1KZFA 3BLNA 5DWMA 3ZZIA 4DUKA 1P0HA 2NMTA 2ZEMA 5K8OA 1HDUA 3JTKA 3B3CA 4A38A 1Z8LA 1I12A 4HNYB 3KL9A 2A4NA 4KOVA 1ELLP 4Q36A 1K4JA 2IMOA 1OZPA 1FT7A 4XNHC 5F46A 3S9NA 2P6GA 3DR8A 3T8WA 2PJ9A 2RFHA 5JQ4A 1YX0A 2WYRA 5IV0A 1CPSA 1RO5A 3JVNA 3NFZA 3QAHA 4YU9A 2OOTA 2EK8A 4EWTA 4LUAA 4M6GA 4M6IA 7CPAA 3R1KA 2FXFA 4ZY2A 4OIWA 4F0YA 1LCPA 2PRBA 4U9ZA 3BXMA 4BD9A 3B3WA 4MMOA 3R9FA 2DEAA 1VIXA 2F8HA 2GANA 3NH8A 3LODA 3B3TA 4PXCA 2ANPA 2CNSA 5HH1A 4HNWB 2Q4YA 2ZENA 2FIWA 3PB6X 4LQGA 5G1ZA 2I3CA 3PB7X 4KOUA 2GU2A 2EVNA 2I79A 5HVFA 3SI0A 4C2XA 2D4OA 4KSIA 2ZW7A 4F0XA 4UF4A 2H5MA 2XEJA 3JUWA 1IGBA 2VEZA 3MGDA 4JJXA 4CGNA 5CPAA 4ZYQA 3IGRA 3F8KA 2VQYA 4QB9A 4R76A 4FAIA 3D2MA 1KWMA 4MFLA 5CBMA 3BHXA 1HEEA 2NYQA 3IJ3A 4ONWA 1ZO0A 4P4FA 3WC7A 3H8GA 2V8HA 4NGRA 2CNMA 3D67A 1F2PA 1YLOA 4F8ZA 2BUEA 5KTCA 1S3ZA 1JWQA 4OMEA 3TO9A 1LFWA 3LMSA 1M44A 4MCQA 3IU2A 2B4DB 3KKWA 4C7IA 2AFXA 1BOBA 2PJ0A 3GKRA 4FD6A 2OZHA 2HC9A 2Q04A 4ZY1A 3FEEA 4JWPA 5JM6A 1B87A 4JXRA 2Y0MA 3BI0A 3SXOA 4MHNA 1M4LA 3VATA 3GIUA 2GLJA 1LAPA 2QMLA 3FB3A 2HUZA 2PJ1A 1ZLIA 1CM0A 1ZG7A 1YREA 4OIDA 2X7BA 1YLEA 2Z3KA 4RS2A 4Y49C 5G20A 2DPSA 3BJ8A 4CAEA 1IOFA 4JD6A 3GYAA 3IWWA 4P4IA 2PJBA 1H8LA 5H86A 1IU8A 4U5YA 3SJGA 3W6SA 3SI2A 4B12A 4KS9A 4UBRA 2ABZA 4B6ZA 4R6TA 4AB7A 5EC4A 4KVXA
chains in the Genus database with same CATH topology
3LWUA 4JYWA 4NGPA 1Z2LA 2ZEOA 1BLLE 4W9YA 8CPAA 3KASA 1XMBA 2GLFA 4A37A 2ZEFA 3RAMA 4OC1A 3VH9A 2PJ4A 1TXRA 2PVWA 3SI1A 2C6CA 2VL1A 1PCAA 4ZX8A 5I4MA 1XJOA 1ARMA 2AFOA 3MN8A 3V7ZA 3H8FA 2PJ5A 2ZEDA 4MCPA 3TX8A 1Q7LA 4EMEA 2ZEHA 4MCSA 4NGQA 4P4JA 3B3SA 4R7MA 2Q4ZA 3KHZA 1F57A 1VGYA 2IJZA 2V8GA 6CPAA 3D7HA 4MHYA 5LYDA 5THWA 2PJ3A 4R8FA 3KZWA 5HVGA 2C6GA 3IEHA 3D4UA 4DYOA 1LOKA 2PJCA 2XEIA 4OC5A 4MXUA 3PBBA 4GM5A 4UIAA 4PQAA 3CPXA 3B3VA 4OP4A 3B2YA 3HLPA 1R3NA 4EFDA 4UEFA 4OC2A 4WWVA 3FMCA 4Z65A 3I1UA 1YW4A 1F2OA 2ZEEA 5IB9A 1XBUA 3BI1A 3FH4A 3FECA 3NH4A 4OC0A 3CT9A 3D7FA 2ZOFA 3S9MA 3IO1A 1TKJA 2IQ6A 3WC6A 3IFEA 2AFWA 3VARA 4P4EA 5LYLA 1DE4C 2QJ8A 4NGSA 4WJBA 4NJQA 3DLJA 4IAVA 1JQGA 1TKHA 5JH9A 4H2KA 1CX8A 3IC1A 4P6YA 1ARLA 2PVVA 2PJ2A 4O23A 4IK2A 2C6PA 2G9DA 4NJRA 4FBEA 1VHEA 2EK9A 4PPZA 3PFOA 1TF9A 5ELYA 1CBXA 5K8PA 3CPAA 3WT4A 2V8VA 2EWBA 2O4HA 1CG2A 3KHXA 2CIJA 2PIZA 2CF4A 3D7GA 1ZG8A 1CP7A 2AFZA 1QMUA 4ZY0A 2PRQA 1R43A 3GUXA 2CTBA 4PXEA 3SJFA 5LYIA 1BAVA 3S9LA 2JBKA 7CPAA 1UWYA 2BO9A 2J9AA 3ISZA 4NGTA 3FJUA 5HXDA 4X8IA 4NFRA 3DGVA 1LANA 2C1CA 2AFSA 3FVLA 3K2KA 2V8DA 1YMEA 4OC4A 3PB4X 1RTQA 4MCRA 4Q7AA 3D7DA 5LRKA 4YWYA 2PCUA 1ELMP 5D29A 4DJLA 3D66A 5LRGA 1Z5RA 1TF8A 2WZNA 3IIBA 3SJXA 1AYEA 3H8EA 2PJ7A 2Q51A 3PRTA 2GREA 2ZEPA 4MHZA 4X2TA 1YW6A 2JEWA 4PXDA 4MRIA 4F9UA 2PE3A 3D68A 4OC3A 3PBEA 1YSJA 1IY7A 2AFUA 3K9TA 1Y0YA 3PEIA 5LYFA 2ZELA 5JGFA 1BPNA 3FX6A 4NGNA 4P4DA 4ZI6A 4UIBA 5J1QA 3WC5A 5D8NA 1GYTA 2BOAA 4P45A 2AFMA 3NA6A 2O53A 4TWEA 3JRUA 1TKFA 4UEEA 3PFEA 3KQZA 1Y0RA 5F09A 4F9VA 1ZG9A 1Y7EA 2OR4A 1FNOA 3KQXA 3RBUA 4FUUA 3L2NA 1BPMA 4JZ0A 4FWUA 3QNVA 3FF3A 1CP6A 5LRJA 1HDQA 2XEFA 3KR5A 4NGMA 3GB0A 3GLJA 4X3RA 5DS0A 4A39A 4P4BA 4PXBA 4AXVA 1NSAA 5K8NA 2F7VA 2Q43A 1XRYA 4G1PA 2PIYA 4A94A 4UEZA 4ZX9A 4MHPA 3WABA 1QQ9A 2QVPA 2NSMA 3B7IA 3PB9X 1XFOA 2PJ6A 3PB8X 3KR4A 2HB6A 3FEDA 1OBRA 1EE3P 1CPXA 1PYTB 4OKOA 3ISXA 4P10A 2V77A 1DTDA 4IHMA 2PJ8A 1AMPA 2QYVA 2FVGA 1LAMA 3CDXA 3NH5A 2XEGA 3TC8A 1ZLHA 4RUHA 5HVHA 2CTCA 3RZAA 4K3NA 3N5FA 2RB7A 3B35A 3SJEA 4TNUA 3HUVA 1VHOA 3KI9A 2JBJA 2BCOA 4P44A 2ZEGA 2PJAA 4CPAA 2ZOGA 3MRUA 3V38A 3KGQA 2POKA 5K8MA 4DUKA 2ZEMA 5K8OA 1HDUA 4A38A 3B3CA 1Z8LA 3KL9A 1ELLP 2IMOA 1FT7A 3S9NA 3T8WA 2PJ9A 2RFHA 2WYRA 1CPSA 3NFZA 4YU9A 2OOTA 4EWTA 2EK8A 4ZY2A 4OIWA 1LCPA 4BD9A 3BXMA 3B3WA 4MMOA 2DEAA 1VIXA 2F8HA 3NH8A 3B3TA 4PXCA 2ANPA 2ZENA 3PB6X 4LQGA 2I3CA 3PB7X 5HVFA 2GU2A 3SI0A 4KSIA 4UF4A 2XEJA 1IGBA 5CPAA 4ZYQA 4R76A 4FAIA 1KWMA 5CBMA 3BHXA 1HEEA 2NYQA 3IJ3A 4ONWA 4P4FA 3WC7A 3H8GA 2V8HA 4NGRA 4F8ZA 3D67A 1F2PA 1YLOA 4OMEA 1LFWA 3LMSA 4MCQA 2AFXA 2PJ0A 4ZY1A 2HC9A 3FEEA 5JM6A 3BI0A 4MHNA 1M4LA 3VATA 2GLJA 1LAPA 2PJ1A 1ZLIA 1ZG7A 4OIDA 3IWWA 4P4IA 2PJBA 1H8LA 3SJGA 3SI2A 2ABZA 4B6ZA 4R6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWU A;  4JYW A;  4NGP A;  1Z2L A;  2ZEO A;  1BLL E;  4W9Y A;  8CPA A;  3KAS A;  1XMB A;  2GLF A;  4A37 A;  2ZEF A;  3RAM A;  4OC1 A;  3VH9 A;  2PJ4 A;  1TXR A;  2PVW A;  3SI1 A;  2C6C A;  2VL1 A;  1PCA A;  4ZX8 A;  5I4M A;  1XJO A;  1ARM A;  2AFO A;  3MN8 A;  3V7Z A;  3H8F A;  2PJ5 A;  2ZED A;  4MCP A;  3TX8 A;  1Q7L A;  4EME A;  2ZEH A;  4MCS A;  4NGQ A;  4P4J A;  3B3S A;  4R7M A;  2Q4Z A;  3KHZ A;  1F57 A;  1VGY A;  2IJZ A;  2V8G A;  6CPA A;  3D7H A;  4MHY A;  5LYD A;  5THW A;  2PJ3 A;  4R8F A;  3KZW A;  5HVG A;  2C6G A;  3IEH A;  3D4U A;  4DYO A;  1LOK A;  2PJC A;  2XEI A;  4OC5 A;  4MXU A;  3PBB A;  4GM5 A;  4UIA A;  4PQA A;  3CPX A;  3B3V A;  4OP4 A;  3B2Y A;  3HLP A;  1R3N A;  4EFD A;  4UEF A;  4OC2 A;  4WWV A;  3FMC A;  4Z65 A;  3I1U A;  1YW4 A;  1F2O A;  2ZEE A;  5IB9 A;  1XBU A;  3BI1 A;  3FH4 A;  3FEC A;  3NH4 A;  4OC0 A;  3CT9 A;  3D7F A;  2ZOF A;  3S9M A;  3IO1 A;  1TKJ A;  2IQ6 A;  3WC6 A;  3IFE A;  2AFW A;  3VAR A;  4P4E A;  5LYL A;  1DE4 C;  2QJ8 A;  4NGS A;  4WJB A;  4NJQ A;  3DLJ A;  4IAV A;  1JQG A;  1TKH A;  5JH9 A;  4H2K A;  1CX8 A;  3IC1 A;  4P6Y A;  1ARL A;  2PVV A;  2PJ2 A;  4O23 A;  4IK2 A;  2C6P A;  2G9D A;  4NJR A;  4FBE A;  1VHE A;  2EK9 A;  4PPZ A;  3PFO A;  1TF9 A;  5ELY A;  1CBX A;  5K8P A;  3CPA A;  3WT4 A;  2V8V A;  2EWB A;  2O4H A;  1CG2 A;  3KHX A;  2CIJ A;  2PIZ A;  2CF4 A;  3D7G A;  1ZG8 A;  1CP7 A;  2AFZ A;  1QMU A;  4ZY0 A;  2PRQ A;  1R43 A;  3GUX A;  2CTB A;  4PXE A;  3SJF A;  5LYI A;  1BAV A;  3S9L A;  2JBK A;  7CPA A;  1UWY A;  2BO9 A;  2J9A A;  3ISZ A;  4NGT A;  3FJU A;  5HXD A;  4X8I A;  4NFR A;  3DGV A;  1LAN A;  2C1C A;  2AFS A;  3FVL A;  3K2K A;  2V8D A;  1YME A;  4OC4 A;  3PB4 X;  1RTQ A;  4MCR A;  4Q7A A;  3D7D A;  5LRK A;  4YWY A;  2PCU A;  1ELM P;  5D29 A;  4DJL A;  3D66 A;  5LRG A;  1Z5R A;  1TF8 A;  2WZN A;  3IIB A;  3SJX A;  1AYE A;  3H8E A;  2PJ7 A;  2Q51 A;  3PRT A;  2GRE A;  2ZEP A;  4MHZ A;  4X2T A;  1YW6 A;  2JEW A;  4PXD A;  4MRI A;  4F9U A;  2PE3 A;  3D68 A;  4OC3 A;  3PBE A;  1YSJ A;  1IY7 A;  2AFU A;  3K9T A;  1Y0Y A;  3PEI A;  5LYF A;  2ZEL A;  5JGF A;  1BPN A;  3FX6 A;  4NGN A;  4P4D A;  4ZI6 A;  4UIB A;  5J1Q A;  3WC5 A;  5D8N A;  1GYT A;  2BOA A;  4P45 A;  2AFM A;  3NA6 A;  2O53 A;  4TWE A;  3JRU A;  1TKF A;  4UEE A;  3PFE A;  3KQZ A;  1Y0R A;  5F09 A;  4F9V A;  1ZG9 A;  1Y7E A;  2OR4 A;  1FNO A;  3KQX A;  3RBU A;  4FUU A;  3L2N A;  1BPM A;  4JZ0 A;  4FWU A;  3QNV A;  3FF3 A;  1CP6 A;  5LRJ A;  1HDQ A;  2XEF A;  3KR5 A;  4NGM A;  3GB0 A;  3GLJ A;  4X3R A;  5DS0 A;  4A39 A;  4P4B A;  4PXB A;  4AXV A;  1NSA A;  5K8N A;  2F7V A;  2Q43 A;  1XRY A;  4G1P A;  2PIY A;  4A94 A;  4UEZ A;  4ZX9 A;  4MHP A;  3WAB A;  1QQ9 A;  2QVP A;  2NSM A;  3B7I A;  3PB9 X;  1XFO A;  2PJ6 A;  3PB8 X;  3KR4 A;  2HB6 A;  3FED A;  1OBR A;  1EE3 P;  1CPX A;  1PYT B;  4OKO A;  3ISX A;  4P10 A;  2V77 A;  1DTD A;  4IHM A;  2PJ8 A;  1AMP A;  2QYV A;  2FVG A;  1LAM A;  3CDX A;  3NH5 A;  2XEG A;  3TC8 A;  1ZLH A;  4RUH A;  5HVH A;  2CTC A;  3RZA A;  4K3N A;  3N5F A;  2RB7 A;  3B35 A;  3SJE A;  4TNU A;  3HUV A;  1VHO A;  3KI9 A;  2JBJ A;  2BCO A;  4P44 A;  2ZEG A;  2PJA A;  4CPA A;  2ZOG A;  3MRU A;  3V38 A;  3KGQ A;  2POK A;  5K8M A;  4DUK A;  2ZEM A;  5K8O A;  1HDU A;  4A38 A;  3B3C A;  1Z8L A;  3KL9 A;  1ELL P;  2IMO A;  1FT7 A;  3S9N A;  3T8W A;  2PJ9 A;  2RFH A;  2WYR A;  1CPS A;  3NFZ A;  4YU9 A;  2OOT A;  4EWT A;  2EK8 A;  4ZY2 A;  4OIW A;  1LCP A;  4BD9 A;  3BXM A;  3B3W A;  4MMO A;  2DEA A;  1VIX A;  2F8H A;  3NH8 A;  3B3T A;  4PXC A;  2ANP A;  2ZEN A;  3PB6 X;  4LQG A;  2I3C A;  3PB7 X;  5HVF A;  2GU2 A;  3SI0 A;  4KSI A;  4UF4 A;  2XEJ A;  1IGB A;  5CPA A;  4ZYQ A;  4R76 A;  4FAI A;  1KWM A;  5CBM A;  3BHX A;  1HEE A;  2NYQ A;  3IJ3 A;  4ONW A;  4P4F A;  3WC7 A;  3H8G A;  2V8H A;  4NGR A;  4F8Z A;  3D67 A;  1F2P A;  1YLO A;  4OME A;  1LFW A;  3LMS A;  4MCQ A;  2AFX A;  2PJ0 A;  4ZY1 A;  2HC9 A;  3FEE A;  5JM6 A;  3BI0 A;  4MHN A;  1M4L A;  3VAT A;  2GLJ A;  1LAP A;  2PJ1 A;  1ZLI A;  1ZG7 A;  4OID A;  3IWW A;  4P4I A;  2PJB A;  1H8L A;  3SJG A;  3SI2 A;  2ABZ A;  4B6Z A;  4R6T A; 
#chains in the Genus database with same CATH topology
 3LWU A;  4JYW A;  4NGP A;  1Z2L A;  2ZEO A;  1BLL E;  1PUA A;  1S5K A;  1S7F A;  2F5I A;  3H4Q A;  2I00 A;  4L89 A;  4W9Y A;  8CPA A;  3KAS A;  4KOW A;  4CYN A;  1XMB A;  3S6H A;  2GLF A;  4A37 A;  2ZEF A;  2PC1 A;  3RAM A;  5AG7 A;  2WPX A;  4RI1 A;  4OC1 A;  3VH9 A;  3H5Z A;  1XMT A;  2FT0 A;  2PJ4 A;  4UCN A;  3VWE A;  1TXR A;  2PVW A;  4UWJ A;  3SI1 A;  2EO8 A;  2C6C A;  4CAX A;  2VL1 A;  1PCA A;  4X5K A;  4ZX8 A;  3V8I A;  5I4M A;  1XJO A;  4KOT A;  2VZY A;  1VHS A;  2BL1 A;  1ARM A;  2Q0Y A;  3K9U A;  4UWI A;  2AFO A;  2JDD A;  3MN8 A;  3S6F A;  3V7Z A;  5IB0 A;  3H8F A;  2PJ5 A;  1Q2D A;  3LAC A;  2B5G A;  4NF1 A;  5AG4 A;  2ZED A;  2VI7 A;  2R98 A;  4MCP A;  3EFA A;  3TX8 A;  1Q7L A;  4MJ8 A;  4B5O A;  5EBV A;  4EME A;  2J8R A;  2ZEH A;  4MCS A;  4NGQ A;  3DNS A;  4P4J A;  5HMN A;  3B3S A;  4K30 A;  4R7M A;  2Q4Z A;  3KHZ A;  1WK4 A;  4II9 A;  1F57 A;  3R95 A;  4MY0 A;  5E96 A;  3S6K A;  1VGY A;  2IJZ A;  2Q44 A;  1R57 A;  2V8G A;  6CPA A;  1YVK A;  3D7H A;  4MHY A;  4KLW A;  5LYD A;  5THW A;  4H6Z A;  2PJ3 A;  4R8F A;  4EVY A;  3KZW A;  3PZJ A;  4GS4 A;  2Z11 A;  2ZW5 A;  2C6G A;  3IEH A;  3DR6 A;  5HVG A;  3D4U A;  4DYO A;  2BSW A;  3I3G A;  5F48 A;  3F5B A;  1XIX A;  2YNC A;  1LOK A;  1QSO A;  2PJC A;  4XPD B;  2XEI A;  2YNC C;  4OC5 A;  4MXU A;  2J8N A;  3PBB A;  5C82 A;  1Y9W A;  2DPT A;  2YND A;  1RXT A;  4GM5 A;  2P6E A;  4UIA A;  4PQA A;  3CPX A;  3B3V A;  3IU1 A;  2G0B A;  1Q2C A;  1MJA A;  4U9Y A;  2OH1 A;  4OP4 A;  3B2Y A;  3HLP A;  2PR1 A;  1R3N A;  1N71 A;  1V0C A;  4EFD A;  4UEF A;  3IWG A;  4MFK A;  4B5P A;  4OC2 A;  5J8C A;  4WWV A;  4KOR A;  4KVO E;  1Y9K A;  2AJ6 A;  2ZXV A;  3FMC A;  3T9Y A;  5KTD A;  2VZZ A;  4PSX A;  4Z65 A;  3I1U A;  1YW4 A;  1Y7R A;  1F2O A;  2R8V A;  2ZEE A;  4M85 A;  5IB9 A;  5JPH A;  3RNZ A;  4KUA A;  1XBU A;  3BI1 A;  3FH4 A;  3FEC A;  1XEB A;  2DF5 A;  1MJ9 A;  3CXP A;  4OAD A;  3NH4 A;  4OC0 A;  4JXQ A;  3CT9 A;  3D7F A;  3P2H A;  1TIQ A;  2ZOF A;  2FCK A;  3QB8 A;  3S9M A;  1S7N A;  3IO1 A;  4UA3 A;  1TKJ A;  2IQ6 A;  4CYQ A;  3D8P A;  1KUV A;  3WC6 A;  3IFE A;  1QSR A;  2GFQ A;  2FL4 A;  2AFW A;  3VAR A;  4P4E A;  5LYL A;  4AVB A;  1DE4 C;  2CNT A;  2QJ8 A;  1FY7 A;  4NGS A;  4WJB A;  4NJQ A;  3DLJ A;  4IAV A;  4MY3 A;  1M1D A;  1JQG A;  1NMT A;  2PR8 A;  4A32 A;  4A95 A;  1M4G A;  1TKH A;  4YFJ A;  5JH9 A;  4H2K A;  3E0K A;  1CX8 A;  5GCN A;  3IC1 A;  4P6Y A;  1ARL A;  2EBJ A;  2PVV A;  1KUY A;  2PJ2 A;  3ZJ0 A;  2VXK A;  4R9M A;  5J8F A;  4MHD A;  4NEX A;  4B10 A;  4O23 A;  4IK2 A;  3EY5 A;  3TOA A;  4MFP A;  4LX9 A;  4XNH B;  2OB0 A;  3NE7 A;  4MFJ A;  4MI4 A;  2G3A A;  4IUS A;  2C6P A;  2G9D A;  4NJR A;  4A31 A;  4FBE A;  1VHE A;  2EK9 A;  4PPZ A;  3PFO A;  1TF9 A;  4H89 A;  4QC6 A;  4E8O A;  5DWN A;  5ELY A;  1CBX A;  4NXY A;  5K8P A;  4UCM A;  4R57 A;  3CPA A;  3WT4 A;  2V8V A;  2EWB A;  2O4H A;  4NSQ A;  4PSW A;  1CG2 A;  3KHX A;  4A2Z A;  2CIJ A;  1QSN A;  2JEV A;  1S60 A;  3QAY A;  2PIZ A;  4ORF A;  5CNP A;  2CF4 A;  4BIN A;  4AVC A;  3D7G A;  2CXA A;  4CAV A;  1ZG8 A;  4UFV A;  1CP7 A;  2R1I A;  1GHE A;  4A30 A;  1A2Z A;  4E2A A;  4PK2 A;  2G3T A;  2AFZ A;  3DSB A;  2JDC A;  1QMU A;  2Z3L A;  1X10 A;  4ZY0 A;  2PRQ A;  1R43 A;  4M3S A;  3GUX A;  2P0W A;  2C27 A;  2CTB A;  2REE A;  1AUG A;  4PXE A;  3SJF A;  4BMH A;  1X12 A;  2RC4 A;  4KOY A;  4KSA A;  4PV6 A;  1UFH A;  1BAV A;  1IID A;  5LYI A;  3FIX A;  3VWD A;  3S9L A;  2JBK A;  1WWZ A;  1UWY A;  2BO9 A;  3LD2 A;  2J9A A;  2B58 A;  2WSA A;  4KSF A;  1QST A;  4AG9 A;  3GY9 A;  3ISZ A;  2HV2 A;  4NGT A;  3FJU A;  4ONU A;  4H6U A;  5HXD A;  2K5T A;  2ARH A;  4OLL A;  4NFR A;  4R3L A;  4X8I A;  1YVO A;  3DGV A;  1LAN A;  3R96 A;  2C1C A;  2CY2 A;  2AFS A;  2GIV A;  5AGE A;  2EUI A;  4L8A A;  2HQY A;  2ATR A;  3FVL A;  3K2K A;  4QUS A;  2ZW6 A;  2V8D A;  5F47 A;  2JLM A;  1YME A;  2PQ8 A;  3A9L A;  4B13 A;  4OC4 A;  3PB4 X;  1RTQ A;  4MCR A;  4UFW A;  3SXN A;  3W91 A;  4Q7A A;  3OWC A;  3D7D A;  3EXN A;  2YGW A;  4Y49 B;  5LRK A;  3N7Z A;  4UCP A;  3UY5 A;  4MBU A;  4YWY A;  2PCU A;  2WPW A;  1ELM P;  4A33 A;  2QIR A;  2B4B A;  4CAW A;  1KUX A;  3C26 A;  2B4D A;  1PU9 A;  5D29 A;  3FNC A;  4DJL A;  2KCW A;  2AE6 A;  3CXS A;  3D66 A;  4CYP A;  2REF A;  4C2Y A;  5H84 A;  1BO4 A;  5LRG A;  1Z5R A;  3CZX A;  1B6B A;  1TF8 A;  2WZN A;  2Q4V A;  4KOX A;  3IIB A;  3SJX A;  4FD4 A;  1AYE A;  4ZGY B;  4J3G A;  3H8E A;  2PJ7 A;  2Q51 A;  2Z3N A;  2GRE A;  2Z10 A;  2ZEP A;  3FRM A;  3P2F A;  3PRT A;  4MHZ A;  2FIA A;  4X2T A;  4KOS A;  1YW6 A;  5ISV A;  2JEW A;  5G21 A;  2BEI A;  3RYO A;  1XOV A;  1YQE A;  4FD5 A;  4KZT A;  4PXD A;  4MRI A;  4RN7 A;  4BBH A;  1CJW A;  3TOB A;  4F9U A;  2PE3 A;  1YGH A;  3CXQ A;  4GXH A;  4E0A A;  3D68 A;  4IF5 A;  4AVA A;  4YGO A;  4OC3 A;  3PBE A;  2Z3O A;  3RO0 A;  1YR0 A;  1YSJ A;  1IY7 A;  2AFU A;  1Z9U A;  3PP9 A;  4I49 A;  3TCV A;  2B5G B;  3K9T A;  1Z4E A;  1Y0Y A;  3PEI A;  5LYF A;  3BJ7 A;  2ZEL A;  5JGF A;  1IIC A;  1BPN A;  1Q2Y A;  3IWE A;  5BWA B;  2ZW4 A;  3FX6 A;  1QSM A;  4NGN A;  2Z0Z A;  4P4D A;  3FBU A;  4AG7 A;  4PK3 A;  2QEC A;  4C7H A;  1Z8W A;  4ZI6 A;  4KLV A;  4UIB A;  5J1Q A;  3WC5 A;  5D8N A;  1LRZ A;  5G22 A;  2OZU A;  1GYT A;  2BOA A;  4P45 A;  2GE3 A;  1J4J A;  1Z8X A;  2AFM A;  3NA6 A;  2O53 A;  4TWE A;  5EMI A;  3JRU A;  4CGP A;  2IL4 A;  1TKF A;  1VKC A;  3FXT A;  3FYN A;  4CGO A;  2OU2 A;  4JLY A;  4UEE A;  2PDO A;  2P6F A;  3KQZ A;  3PFE A;  1Y0R A;  1XE4 A;  5F09 A;  4HNX B;  3WR7 A;  4F9V A;  1ZG9 A;  1Y7E A;  2R7H A;  4HPS A;  3PGP A;  2OR4 A;  1FNO A;  3TO7 A;  1XF8 A;  3KQX A;  3RBU A;  5AG6 A;  4FUU A;  3G8W A;  4DNC A;  3L2N A;  2J8M A;  1BPM A;  4JZ0 A;  1NSL A;  4LQ6 A;  4NCZ A;  4FWU A;  1S7K A;  1M4D A;  2B3V A;  3QNV A;  3FF3 A;  4KUB A;  3EO4 A;  1CP6 A;  5LRJ A;  4CYO A;  4Q38 A;  1U6M A;  4CAF A;  1IOI A;  2FE7 A;  1HDQ A;  2XEF A;  3KR5 A;  4NGM A;  4QVT A;  3GB0 A;  3GLJ A;  3TTH A;  1Z8T A;  4HKF A;  4CGL A;  4CS0 B;  4QBJ A;  2O28 A;  4X3R A;  5DS0 A;  4CRY B;  4B5P B;  4F6A A;  4A39 A;  4P4B A;  3DDD A;  4PXB A;  4AXV A;  1SQH A;  1Z4R A;  3T90 A;  1NE9 A;  1NSA A;  1L0C A;  2F7V A;  5K8N A;  2Q43 A;  1IB1 E;  1XRY A;  4B14 A;  5A27 A;  1MJB A;  2DXQ A;  4G1P A;  4OAE A;  4XPD C;  2PIY A;  4A94 A;  4UEZ A;  4ZX9 A;  4MHP A;  3WAB A;  1QQ9 A;  2Z3P A;  2QVP A;  2NSM A;  3B7I A;  3PB9 X;  5F49 A;  4C2Z A;  1XFO A;  2PJ6 A;  1M4I A;  5I0C A;  3PB8 X;  5AG5 A;  1YK3 A;  3KR4 A;  2Q7B A;  2HB6 A;  4XPL A;  1IYK A;  3FED A;  3TFY A;  1OBR A;  3I9S A;  1EE3 P;  4CRZ B;  1CPX A;  1PYT B;  4M6H A;  4R3K A;  4OKO A;  5IX3 A;  3TO6 A;  2FSR A;  5FVJ A;  3ISX A;  1I21 A;  3R9E A;  3S6G A;  3TE4 A;  3D3S A;  5KTA A;  4P10 A;  2V77 A;  2Q7S A;  2YNE A;  1DTD A;  4IHM A;  4C68 A;  2PJ8 A;  1AMP A;  2PSW A;  2Z3M A;  3R9G A;  2QYV A;  5A28 A;  2FVG A;  1LAM A;  2VBQ A;  3CDX A;  4YRH A;  3NH5 A;  3SHP A;  3G3S A;  1ON0 A;  4MFZ A;  4CGM A;  3D2P A;  2XEG A;  3F0A A;  3TC8 A;  1ZLH A;  4RUH A;  5HVH A;  1I1D A;  2CTC A;  3RZA A;  5C88 A;  2OZG A;  4K3N A;  3N5F A;  2RB7 A;  1P4N A;  1IYL A;  2B3U A;  3B35 A;  3NE8 A;  4FD7 A;  4TNU A;  2D4P A;  2WUU A;  4XPK A;  3SJE A;  3TT2 A;  3HUV A;  1VHO A;  3KI9 A;  2JBJ A;  2ZPA A;  3W6X A;  2BCO A;  4KVM E;  3B8G A;  4P44 A;  4UFX A;  1S7L A;  4B11 A;  2ZEG A;  2PJA A;  4MFQ A;  2FS5 A;  3EC4 A;  2ZOG A;  3MRU A;  4R87 A;  2ODF A;  4ZBG A;  3KGQ A;  3V38 A;  4CPA A;  2POK A;  5K8M A;  1MK4 A;  1KZF A;  3BLN A;  5DWM A;  3ZZI A;  4DUK A;  1P0H A;  2NMT A;  2ZEM A;  5K8O A;  1HDU A;  3JTK A;  3B3C A;  4A38 A;  1Z8L A;  1I12 A;  4HNY B;  3KL9 A;  2A4N A;  4KOV A;  1ELL P;  4Q36 A;  1K4J A;  2IMO A;  1OZP A;  1FT7 A;  4XNH C;  5F46 A;  3S9N A;  2P6G A;  3DR8 A;  3T8W A;  2PJ9 A;  2RFH A;  5JQ4 A;  1YX0 A;  2WYR A;  5IV0 A;  1CPS A;  1RO5 A;  3JVN A;  3NFZ A;  3QAH A;  4YU9 A;  2OOT A;  2EK8 A;  4EWT A;  4LUA A;  4M6G A;  4M6I A;  7CPA A;  3R1K A;  2FXF A;  4ZY2 A;  4OIW A;  4F0Y A;  1LCP A;  2PRB A;  4U9Z A;  3BXM A;  4BD9 A;  3B3W A;  4MMO A;  3R9F A;  2DEA A;  1VIX A;  2F8H A;  2GAN A;  3NH8 A;  3LOD A;  3B3T A;  4PXC A;  2ANP A;  2CNS A;  5HH1 A;  4HNW B;  2Q4Y A;  2ZEN A;  2FIW A;  3PB6 X;  4LQG A;  5G1Z A;  2I3C A;  3PB7 X;  4KOU A;  2GU2 A;  2EVN A;  2I79 A;  5HVF A;  3SI0 A;  4C2X A;  2D4O A;  4KSI A;  2ZW7 A;  4F0X A;  4UF4 A;  2H5M A;  2XEJ A;  3JUW A;  1IGB A;  2VEZ A;  3MGD A;  4JJX A;  4CGN A;  5CPA A;  4ZYQ A;  3IGR A;  3F8K A;  2VQY A;  4QB9 A;  4R76 A;  4FAI A;  3D2M A;  1KWM A;  4MFL A;  5CBM A;  3BHX A;  1HEE A;  2NYQ A;  3IJ3 A;  4ONW A;  1ZO0 A;  4P4F A;  3WC7 A;  3H8G A;  2V8H A;  4NGR A;  2CNM A;  3D67 A;  1F2P A;  1YLO A;  4F8Z A;  2BUE A;  5KTC A;  1S3Z A;  1JWQ A;  4OME A;  3TO9 A;  1LFW A;  3LMS A;  1M44 A;  4MCQ A;  3IU2 A;  2B4D B;  3KKW A;  4C7I A;  2AFX A;  1BOB A;  2PJ0 A;  3GKR A;  4FD6 A;  2OZH A;  2HC9 A;  2Q04 A;  4ZY1 A;  3FEE A;  4JWP A;  5JM6 A;  1B87 A;  4JXR A;  2Y0M A;  3BI0 A;  3SXO A;  4MHN A;  1M4L A;  3VAT A;  3GIU A;  2GLJ A;  1LAP A;  2QML A;  3FB3 A;  2HUZ A;  2PJ1 A;  1ZLI A;  1CM0 A;  1ZG7 A;  1YRE A;  4OID A;  2X7B A;  1YLE A;  2Z3K A;  4RS2 A;  4Y49 C;  5G20 A;  2DPS A;  3BJ8 A;  4CAE A;  1IOF A;  4JD6 A;  3GYA A;  3IWW A;  4P4I A;  2PJB A;  1H8L A;  5H86 A;  1IU8 A;  4U5Y A;  3SJG A;  3W6S A;  3SI2 A;  4B12 A;  4KS9 A;  4UBR A;  2ABZ A;  4B6Z A;  4R6T A;  4AB7 A;  5EC4 A;  4KVX A; 
#chains in the Genus database with same CATH homology
 3LWU A;  4JYW A;  4NGP A;  1Z2L A;  2ZEO A;  1BLL E;  4W9Y A;  8CPA A;  3KAS A;  1XMB A;  2GLF A;  4A37 A;  2ZEF A;  3RAM A;  4OC1 A;  3VH9 A;  2PJ4 A;  1TXR A;  2PVW A;  3SI1 A;  2C6C A;  2VL1 A;  1PCA A;  4ZX8 A;  5I4M A;  1XJO A;  1ARM A;  2AFO A;  3MN8 A;  3V7Z A;  3H8F A;  2PJ5 A;  2ZED A;  4MCP A;  3TX8 A;  1Q7L A;  4EME A;  2ZEH A;  4MCS A;  4NGQ A;  4P4J A;  3B3S A;  4R7M A;  2Q4Z A;  3KHZ A;  1F57 A;  1VGY A;  2IJZ A;  2V8G A;  6CPA A;  3D7H A;  4MHY A;  5LYD A;  5THW A;  2PJ3 A;  4R8F A;  3KZW A;  5HVG A;  2C6G A;  3IEH A;  3D4U A;  4DYO A;  1LOK A;  2PJC A;  2XEI A;  4OC5 A;  4MXU A;  3PBB A;  4GM5 A;  4UIA A;  4PQA A;  3CPX A;  3B3V A;  4OP4 A;  3B2Y A;  3HLP A;  1R3N A;  4EFD A;  4UEF A;  4OC2 A;  4WWV A;  3FMC A;  4Z65 A;  3I1U A;  1YW4 A;  1F2O A;  2ZEE A;  5IB9 A;  1XBU A;  3BI1 A;  3FH4 A;  3FEC A;  3NH4 A;  4OC0 A;  3CT9 A;  3D7F A;  2ZOF A;  3S9M A;  3IO1 A;  1TKJ A;  2IQ6 A;  3WC6 A;  3IFE A;  2AFW A;  3VAR A;  4P4E A;  5LYL A;  1DE4 C;  2QJ8 A;  4NGS A;  4WJB A;  4NJQ A;  3DLJ A;  4IAV A;  1JQG A;  1TKH A;  5JH9 A;  4H2K A;  1CX8 A;  3IC1 A;  4P6Y A;  1ARL A;  2PVV A;  2PJ2 A;  4O23 A;  4IK2 A;  2C6P A;  2G9D A;  4NJR A;  4FBE A;  1VHE A;  2EK9 A;  4PPZ A;  3PFO A;  1TF9 A;  5ELY A;  1CBX A;  5K8P A;  3CPA A;  3WT4 A;  2V8V A;  2EWB A;  2O4H A;  1CG2 A;  3KHX A;  2CIJ A;  2PIZ A;  2CF4 A;  3D7G A;  1ZG8 A;  1CP7 A;  2AFZ A;  1QMU A;  4ZY0 A;  2PRQ A;  1R43 A;  3GUX A;  2CTB A;  4PXE A;  3SJF A;  5LYI A;  1BAV A;  3S9L A;  2JBK A;  7CPA A;  1UWY A;  2BO9 A;  2J9A A;  3ISZ A;  4NGT A;  3FJU A;  5HXD A;  4X8I A;  4NFR A;  3DGV A;  1LAN A;  2C1C A;  2AFS A;  3FVL A;  3K2K A;  2V8D A;  1YME A;  4OC4 A;  3PB4 X;  1RTQ A;  4MCR A;  4Q7A A;  3D7D A;  5LRK A;  4YWY A;  2PCU A;  1ELM P;  5D29 A;  4DJL A;  3D66 A;  5LRG A;  1Z5R A;  1TF8 A;  2WZN A;  3IIB A;  3SJX A;  1AYE A;  3H8E A;  2PJ7 A;  2Q51 A;  3PRT A;  2GRE A;  2ZEP A;  4MHZ A;  4X2T A;  1YW6 A;  2JEW A;  4PXD A;  4MRI A;  4F9U A;  2PE3 A;  3D68 A;  4OC3 A;  3PBE A;  1YSJ A;  1IY7 A;  2AFU A;  3K9T A;  1Y0Y A;  3PEI A;  5LYF A;  2ZEL A;  5JGF A;  1BPN A;  3FX6 A;  4NGN A;  4P4D A;  4ZI6 A;  4UIB A;  5J1Q A;  3WC5 A;  5D8N A;  1GYT A;  2BOA A;  4P45 A;  2AFM A;  3NA6 A;  2O53 A;  4TWE A;  3JRU A;  1TKF A;  4UEE A;  3PFE A;  3KQZ A;  1Y0R A;  5F09 A;  4F9V A;  1ZG9 A;  1Y7E A;  2OR4 A;  1FNO A;  3KQX A;  3RBU A;  4FUU A;  3L2N A;  1BPM A;  4JZ0 A;  4FWU A;  3QNV A;  3FF3 A;  1CP6 A;  5LRJ A;  1HDQ A;  2XEF A;  3KR5 A;  4NGM A;  3GB0 A;  3GLJ A;  4X3R A;  5DS0 A;  4A39 A;  4P4B A;  4PXB A;  4AXV A;  1NSA A;  5K8N A;  2F7V A;  2Q43 A;  1XRY A;  4G1P A;  2PIY A;  4A94 A;  4UEZ A;  4ZX9 A;  4MHP A;  3WAB A;  1QQ9 A;  2QVP A;  2NSM A;  3B7I A;  3PB9 X;  1XFO A;  2PJ6 A;  3PB8 X;  3KR4 A;  2HB6 A;  3FED A;  1OBR A;  1EE3 P;  1CPX A;  1PYT B;  4OKO A;  3ISX A;  4P10 A;  2V77 A;  1DTD A;  4IHM A;  2PJ8 A;  1AMP A;  2QYV A;  2FVG A;  1LAM A;  3CDX A;  3NH5 A;  2XEG A;  3TC8 A;  1ZLH A;  4RUH A;  5HVH A;  2CTC A;  3RZA A;  4K3N A;  3N5F A;  2RB7 A;  3B35 A;  3SJE A;  4TNU A;  3HUV A;  1VHO A;  3KI9 A;  2JBJ A;  2BCO A;  4P44 A;  2ZEG A;  2PJA A;  4CPA A;  2ZOG A;  3MRU A;  3V38 A;  3KGQ A;  2POK A;  5K8M A;  4DUK A;  2ZEM A;  5K8O A;  1HDU A;  4A38 A;  3B3C A;  1Z8L A;  3KL9 A;  1ELL P;  2IMO A;  1FT7 A;  3S9N A;  3T8W A;  2PJ9 A;  2RFH A;  2WYR A;  1CPS A;  3NFZ A;  4YU9 A;  2OOT A;  4EWT A;  2EK8 A;  4ZY2 A;  4OIW A;  1LCP A;  4BD9 A;  3BXM A;  3B3W A;  4MMO A;  2DEA A;  1VIX A;  2F8H A;  3NH8 A;  3B3T A;  4PXC A;  2ANP A;  2ZEN A;  3PB6 X;  4LQG A;  2I3C A;  3PB7 X;  5HVF A;  2GU2 A;  3SI0 A;  4KSI A;  4UF4 A;  2XEJ A;  1IGB A;  5CPA A;  4ZYQ A;  4R76 A;  4FAI A;  1KWM A;  5CBM A;  3BHX A;  1HEE A;  2NYQ A;  3IJ3 A;  4ONW A;  4P4F A;  3WC7 A;  3H8G A;  2V8H A;  4NGR A;  4F8Z A;  3D67 A;  1F2P A;  1YLO A;  4OME A;  1LFW A;  3LMS A;  4MCQ A;  2AFX A;  2PJ0 A;  4ZY1 A;  2HC9 A;  3FEE A;  5JM6 A;  3BI0 A;  4MHN A;  1M4L A;  3VAT A;  2GLJ A;  1LAP A;  2PJ1 A;  1ZLI A;  1ZG7 A;  4OID A;  3IWW A;  4P4I A;  2PJB A;  1H8L A;  3SJG A;  3SI2 A;  2ABZ A;  4B6Z A;  4R6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...