2AFUA

Crystal structure of human glutaminyl cyclase in complex with glutamine t-butyl ester
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
329
structure length
321
Chain Sequence
b'ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLDLSLQLIFFDGQEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title Crystal structures of human glutaminyl cyclase, an enzyme responsible for protein N-terminal pyroglutamate formation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 107
structure length 321
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2005-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2afuA00
2IQ6A 4P4EA 4DYOA 3FH4A 2GLFA 2O53A 2C1CA 1Z5RA 2XEIA 3B3WA 3VARA 4DJLA 4PPZA 3MRUA 4MCSA 3RAMA 5CBMA 4MHZA 1TF8A 4NGPA 3L2NA 1IY7A 3FMCA 4YWYA 3TC8A 3SJEA 4FBEA 4FWUA 1HEEA 4PXDA 5JM6A 4DUKA 1HDUA 2QJ8A 4ZY0A 2OR4A 4OC3A 1ELMP 2J9AA 3WC5A 4WJBA 4ZY2A 3FJUA 3I1UA 1PCAA 1NSAA 3QNVA 2PJ1A 2C6GA 1BPMA 1LAPA 3WC6A 1YW6A 1CPSA 3KQXA 4TWEA 1H8LA 2CIJA 1PYTB 1KWMA 2ZEEA 3MN8A 5ELYA 4OC2A 4F9VA 2HC9A 3IIBA 3NH5A 4FUUA 4NJQA 2V8HA 4NGTA 3PBBA 1LFWA 3H8FA 1QQ9A 3FECA 4OC4A 3D67A 4NJRA 2F7VA 4OC1A 4MCQA 1ZG8A 5D8NA 3WT4A 2AFZA 3VATA 4H2KA 1TKHA 3FEDA 4MHNA 2ZEPA 3BHXA 3KQZA 4X3RA 1F57A 4FAIA 1VIXA 4UF4A 4ZX9A 2AFSA 3V7ZA 4NGSA 3KL9A 4OC5A 2CF4A 5K8PA 2PIZA 2RB7A 3GB0A 2I3CA 1DE4C 4R8FA 3PB7X 1FT7A 3BXMA 2XEJA 3D4UA 1JQGA 4P4IA 1RTQA 5HXDA 1ZG7A 2PVWA 3DGVA 2CTBA 2PJAA 2WYRA 2JEWA 3KASA 3NA6A 1XBUA 2ZEFA 1VHEA 3IC1A 3PFOA 1OBRA 4P4JA 1CX8A 2ZENA 5K8MA 4JYWA 4NGRA 2V77A 4BD9A 2OOTA 3D66A 3D7FA 3WC7A 1BAVA 3NH4A 5THWA 2PJ0A 4F9UA 4P4BA 5HVFA 2GREA 2BCOA 1YLOA 4KSIA 2PJ4A 1ZLHA 3H8GA 3JRUA 5IB9A 4OMEA 2PVVA 3PEIA 4LQGA 4UEEA 3CDXA 3GLJA 2ZOFA 5LYLA 2Q51A 1LANA 1Q7LA 2V8GA 3TX8A 1EE3P 3FVLA 1LAMA 3S9LA 4ZI6A 2ZEMA 4IK2A 4PXBA 3WABA 1YSJA 4OP4A 3FX6A 3KHXA 1VHOA 3CPAA 3D7GA 3IO1A 2JBJA 4ZX8A 5JH9A 3HLPA 4P4FA 1YW4A 5LYFA 3GUXA 4B6ZA 4P10A 1ELLP 2PJ3A 4G1PA 3LMSA 2EK9A 3BI1A 2DEAA 4ONWA 3BI0A 1Y0RA 3SJGA 3B3VA 4JZ0A 1Y7EA 3SI0A 3PB8X 4NGQA 5HVHA 5D29A 3B3TA 4TNUA 1Z8LA 2ZEDA 4AXVA 2HB6A 1ZLIA 5I4MA 2PCUA 4K3NA 4X2TA 2C6CA 5DS0A 4F8ZA 2IMOA 2PJ5A 2JBKA 2AFXA 5LYIA 8CPAA 1DTDA 1XFOA 4P4DA 2XEGA 4YU9A 1M4LA 4CPAA 2ZEHA 2EWBA 1FNOA 5LRJA 3KI9A 4P44A 3SI2A 2G9DA 5LRKA 5JGFA 4IHMA 2BOAA 3B2YA 1HDQA 3ISZA 4O23A 3CPXA 2IJZA 2NSMA 1CP7A 5F09A 3LWUA 3IWWA 3KR4A 2XEFA 1CP6A 2NYQA 4R7MA 4ZY1A 4OKOA 2PJ6A 4EFDA 3DLJA 3HUVA 1R43A 3N5FA 4MHYA 3V38A 4EMEA 3PB9X 2AFMA 1YMEA 1TF9A 1CG2A 2FVGA 3NFZA 4Z65A 4NGNA 2PJ7A 3SJFA 4MCPA 2VL1A 1CBXA 3KHZA 2PJ2A 4MHPA 2O4HA 3IEHA 3KGQA 1GYTA 3S9MA 2WZNA 2ZOGA 4ZYQA 4A37A 4MMOA 3K2KA 4MCRA 3IFEA 2CTCA 7CPAA 1BLLE 2EK8A 1XMBA 3FEEA 4OIWA 3RZAA 1AYEA 4WWVA 3D7DA 3VH9A 1F2PA 4OIDA 1UWYA 1ARLA 4NFRA 4IAVA 3PB4X 2ZEGA 4UEFA 3FF3A 2PE3A 4W9YA 1LOKA 4OC0A 5J1QA 2RFHA 3PRTA 3KZWA 1Y0YA 1BPNA 3PBEA 3NH8A 4PXEA 2V8VA 4P45A 3B3CA 2PRQA 3D68A 1ZG9A 4UIBA 6CPAA 2V8DA 2ABZA 4X8IA 4Q7AA 3B3SA 2ZELA 3RBUA 1TKJA 4A39A 5K8OA 3SI1A 4P6YA 3B35A 2AFWA 4R76A 3KR5A 4RUHA 3H8EA 2QYVA 2QVPA 2PJBA 3D7HA 2GLJA 1XRYA 1ARMA 4MRIA 3K9TA 4GM5A 1R3NA 5LYDA 1LCPA 4UIAA 1F2OA 2PJCA 3S9NA 3ISXA 4PXCA 1CPXA 4PQAA 1VGYA 2GU2A 1TKFA 2PJ9A 2PJ8A 2ZEOA 4UEZA 3B7IA 4EWTA 2Q4ZA 5CPAA 1TXRA 2AFUA 2ANPA 5LRGA 5K8NA 4A94A 4MXUA 1QMUA 3PB6X 3CT9A 5HVGA 2F8HA 2POKA 1Z2LA 2AFOA 1AMPA 2BO9A 2C6PA 3T8WA 1IGBA 2PIYA 4A38A 1XJOA 2Q43A 3SJXA 4R6TA 3IJ3A 4NGMA 3PFEA
chains in the Genus database with same CATH superfamily
1QSNA 4CYOA 2IL4A 2IQ6A 4P4EA 4H6UA 4DYOA 1Q2CA 4PV6A 4KOUA 3EFAA 4E2AA 3S6FA 3FH4A 2GLFA 2O53A 4KSFA 1Y7RA 4C2XA 3F0AA 2C1CA 2Z11A 1Z5RA 2Z3MA 4B5PA 2XEIA 4KOTA 3B3WA 1S5KA 3CXSA 3VARA 4DJLA 4PPZA 3T9YA 3LACA 3MRUA 3EC4A 1VHSA 4MCSA 3RAMA 2Q44A 3TO6A 2WUUA 5CBMA 1XOVA 4MHZA 3IU2A 1TF8A 5E96A 4NGPA 4KUAA 1IB1E 4LUAA 3L2NA 4NSQA 1IY7A 3FMCA 2QIRA 4U5YA 2DPTA 4MFPA 4YWYA 3W6XA 3TC8A 3SJEA 4FBEA 4FWUA 1HEEA 4PXDA 1BO4A 2Z0ZA 2CNTA 1HDUA 4QUSA 3S6KA 3GY9A 2QJ8A 4Y49C 1Q2YA 4DUKA 4ZY0A 3OWCA 3P2HA 2OR4A 2REFA 4C7HA 4OC3A 1ELMP 2J9AA 5F47A 3CXPA 4UWJA 4WJBA 3WC5A 4ZY2A 3FJUA 1M4DA 3I1UA 1OZPA 1PCAA 1Y9WA 3C26A 5A27A 2PC1A 1NSAA 2FE7A 2PJ1A 3QNVA 2B5GB 1I12A 2C6GA 1BPMA 4FD6A 4CGOA 1LAPA 1Z4RA 5CNPA 3WC6A 1YW6A 3F8KA 1CPSA 3KQXA 4IUSA 4TWEA 4A33A 1H8LA 2CIJA 4Q36A 2PR8A 1PYTB 3S6GA 4CAVA 1KWMA 2ZEEA 3MN8A 5ELYA 2R8VA 4OC2A 4UBRA 4F9VA 2HC9A 3IIBA 3NH5A 4FUUA 4K30A 4ZGYB 1Z8XA 3DDDA 2GIVA 4NJQA 1B6BA 2V8HA 3UY5A 1YLEA 2B4DB 4NGTA 4KZTA 4NEXA 5A28A 3PBBA 2FL4A 1LFWA 2B3VA 3H8FA 2J8NA 2Q4VA 3FRMA 1QQ9A 3FECA 3JTKA 1S3ZA 3D67A 2PRBA 4NJRA 1QSRA 2F7VA 4OC4A 4OC1A 4MCQA 1IU8A 1YVKA 1ZG8A 5D8NA 3WT4A 2AFZA 2B5GA 3VATA 4MY0A 4H2KA 4R3KA 1TKHA 3FEDA 2D4PA 5HH1A 1A2ZA 2P6FA 2ZEPA 4MHNA 4A31A 2B4BA 4YRHA 3BHXA 3KQZA 4U9YA 1CJWA 4X3RA 4JLYA 4M6GA 1F57A 3I3GA 1VIXA 4FAIA 4HNXB 4UF4A 4ZX9A 5I0CA 2EO8A 4MY3A 3R95A 4M6HA 2AFSA 3V7ZA 3W91A 3H5ZA 4NGSA 4FD5A 3KL9A 4OC5A 2PR1A 2CF4A 5K8PA 2PIZA 2RB7A 2WPWA 1YGHA 2B4DA 4B14A 1CM0A 3FYNA 3GB0A 2I3CA 1DE4C 4Q38A 1MJAA 3PB7X 4QC6A 4R8FA 1FT7A 3BXMA 3LD2A 2C27A 2XEJA 4B12A 5JPHA 3D4UA 5ISVA 2FIWA 1JQGA 2FT0A 4P4IA 1RTQA 5HXDA 1ZG7A 1FY7A 2PVWA 2YNCA 3DGVA 2OZGA 4EVYA 2CTBA 2PJAA 3SHPA 2WYRA 2O28A 2NMTA 2JEWA 1JWQA 1P4NA 3KASA 4OADA 4XNHB 4XPDC 3NA6A 3D3SA 1QSOA 1XBUA 2ZEFA 4AB7A 1VHEA 2I00A 3IC1A 3PFOA 4QVTA 1OBRA 5IX3A 5IB0A 4UFVA 4ONUA 2WSAA 4UCNA 4KORA 5HMNA 4P4JA 1CX8A 2CXAA 4L8AA 5G20A 2ZENA 2CNSA 5K8MA 1IICA 4JYWA 4NGRA 2V77A 4BD9A 1Z9UA 2OOTA 2B58A 4F0XA 2K5TA 4R9MA 4KOVA 5EBVA 3GIUA 2KCWA 3D66A 1UFHA 3F5BA 1MJBA 3D7FA 3H4QA 4OLLA 4XPDB 1NSLA 3WC7A 2R1IA 1BAVA 4A32A 3QAHA 4B13A 5F46A 3EY5A 2R98A 3I9SA 3NH4A 4C2YA 4KOYA 5THWA 4KOSA 4NF1A 2PJ0A 2VI7A 5JM6A 4F9UA 2P6GA 4P4BA 2FCKA 4JXQA 5AG5A 5HVFA 3W6SA 2GREA 2BCOA 4YGOA 1YLOA 3P2FA 3EXNA 2VZZA 3GKRA 2Q4YA 4KSIA 2PJ4A 1IYLA 1I1DA 2BSWA 1ZLHA 3R9FA 3H8GA 3JRUA 5IB9A 2Z3LA 4RS2A 4FD4A 1M1DA 1BOBA 2PVVA 3PEIA 4OMEA 1WK4A 4LQGA 4UEEA 4MFQA 3CDXA 3KKWA 4E0AA 4CYQA 3GLJA 2ZOFA 5LYLA 3FB3A 1RO5A 1P0HA 2Q51A 1LANA 2QMLA 1KUVA 2ATRA 4QB9A 1Q7LA 3FXTA 1S7NA 2R7HA 5G22A 3ZZIA 2V8GA 4HPSA 1XE4A 3TX8A 1EE3P 3G8WA 3ZJ0A 3FVLA 4CS0B 2HQYA 1LAMA 3S9LA 1S7KA 1XEBA 3RNZA 4ZI6A 4CGNA 2ZEMA 4IK2A 4PXBA 3G3SA 3WABA 1S60A 1YSJA 4OP4A 4PK2A 4C7IA 4GS4A 3FX6A 2PSWA 3KHXA 1VHOA 3JVNA 3CPAA 5C82A 3D7GA 3TOAA 3JUWA 2Z3OA 3IO1A 2JBJA 4F0YA 4ZX8A 2F5IA 3TE4A 5JH9A 3HLPA 2YNCC 4X5KA 4P4FA 1YW4A 5LYFA 3GUXA 4B6ZA 4MFJA 4GXHA 4P10A 1IOFA 1ELLP 2PJ3A 4CGLA 4G1PA 4M85A 5GCNA 4C2ZA 3LMSA 4R87A 2EK9A 4LQ6A 1I21A 2DEAA 3BI1A 1MK4A 4MFZA 2VBQA 1B87A 4ONWA 2D4OA 2Z3NA 2J8RA 1MJ9A 3R9EA 1TIQA 3BI0A 2OB0A 1Y0RA 1KUYA 3LODA 3SJGA 3PP9A 1L0CA 3CXQA 3FNCA 4R57A 3B3VA 3VWDA 1Y7EA 4JZ0A 2DPSA 4IF5A 4MJ8A 3D8PA 3SI0A 3PB8X 3EO4A 2G3TA 4NGQA 2Z3PA 5HVHA 3TCVA 1WWZA 4MFLA 4KVME 5D29A 3B3TA 4TNUA 4RI1A 3S6HA 1Z8LA 2ZEDA 4CAWA 4AXVA 2HB6A 4UWIA 1ZLIA 3PZJA 5I4MA 2PCUA 5AG4A 4HNYB 4JWPA 4K3NA 4X2TA 4XNHC 4KVXA 2C6CA 2Y0MA 4AG9A 4CGPA 5DS0A 4F8ZA 2IMOA 3VWEA 4XPKA 1KUXA 2Q04A 2PJ5A 3QAYA 4B10A 4XPLA 3QB8A 1AUGA 2JBKA 4U9ZA 2GE3A 5KTDA 2AFXA 4JJXA 1YQEA 5LYIA 2EBJA 4CAFA 2FXFA 8CPAA 5AG7A 1DTDA 1XFOA 3E0KA 2HV2A 2XEGA 4P4DA 2A4NA 3IU1A 4YU9A 1M4LA 4PK3A 1S7LA 4CPAA 2ZEHA 2J8MA 4E8OA 4CAEA 2EWBA 2H5MA 5J8FA 1FNOA 4BINA 1IOIA 5LRJA 2EUIA 4ORFA 3KI9A 4P44A 4A2ZA 4BMHA 3BJ8A 3SI2A 2G9DA 3MGDA 5JGFA 4IHMA 3D2MA 5LRKA 4NXYA 3SXNA 2BOAA 4H6ZA 3B2YA 1HDQA 3N7ZA 3ISZA 3CPXA 4O23A 2IJZA 2PQ8A 2NSMA 3TO9A 2Q7SA 1CP7A 2AJ6A 5AG6A 5F09A 3LWUA 3IWWA 2FIAA 3KR4A 2XEFA 5H84A 1CP6A 1K4JA 2NYQA 4R7MA 4ZY1A 1ON0A 2OH1A 4OAEA 4OKOA 2FS5A 2PJ6A 1NE9A 4UCMA 4EFDA 3DLJA 3HUVA 1R43A 1Y9KA 2DXQA 4MHDA 3N5FA 1X10A 3A9LA 4RN7A 4MHYA 3V38A 2B3UA 4KOWA 2Z3KA 4EMEA 1U6MA 4AVBA 2JEVA 4UA3A 3PB9X 4C68A 4CGMA 2AFMA 3DNSA 1YMEA 1TF9A 1CG2A 2FVGA 3NFZA 3TFYA 4Z65A 2HUZA 4NGNA 2PJ7A 1M4IA 3SJFA 4H89A 4MCPA 2VL1A 4KUBA 1CBXA 4QBJA 1XF8A 2ARHA 3KHZA 3R9GA 4KS9A 3D2PA 5G1ZA 1S7FA 2PJ2A 2ZW5A 2ZW7A 4MHPA 2O4HA 3IEHA 2QECA 3KGQA 1GYTA 5EMIA 3S9MA 2WZNA 2YNEA 2ZOGA 4L89A 4ZYQA 3BLNA 1RXTA 4A37A 4MMOA 4CRZB 3K2KA 4MFKA 4MCRA 3IFEA 2CTCA 7CPAA 4A30A 5J8CA 1BLLE 2ZPAA 2EK8A 1ZO0A 1NMTA 1XMBA 3FEEA 4OIWA 3RZAA 1Z8WA 2ODFA 1AYEA 4WWVA 2I79A 3D7DA 3VH9A 1VKCA 1F2PA 3K9UA 1UWYA 4OIDA 2ZXVA 1ARLA 2WPXA 1M4GA 2G3AA 4NFRA 4IAVA 4PSWA 5KTAA 1Z8TA 2ZEGA 3PB4X 4UEFA 3FF3A 2PE3A 3BJ7A 4W9YA 1LOKA 4OC0A 1XMTA 4MI4A 2ZW6A 4KVOE 5J1QA 5C88A 2P0WA 1XIXA 1YK3A 2CNMA 2RFHA 4UCPA 5H86A 4AVCA 2Z10A 5FVJA 4R3LA 4F6AA 3PRTA 3KZWA 1YX0A 4J3GA 4UFWA 4B5OA 3R1KA 1Y0YA 1BPNA 3PBEA 3NH8A 1QSMA 1PU9A 2CY2A 4PXEA 2OU2A 2YNDA 1GHEA 2V8VA 3IWEA 4P45A 3B3CA 2PRQA 3D68A 1ZG9A 1QSTA 2BEIA 3DR8A 4UIBA 1KZFA 6CPAA 3CZXA 1M44A 2V8DA 2ABZA 2G0BA 1J4JA 3FBUA 4KLVA 4Q7AA 4X8IA 3B3SA 3WR7A 4CRYB 2ZELA 2YGWA 5KTCA 3RBUA 4Y49B 3TOBA 1TKJA 4FD7A 4A39A 5K8OA 3IWGA 4JD6A 4M6IA 3SI1A 5EC4A 5F49A 2PDOA 4P6YA 1N71A 2EVNA 1PUAA 3B35A 1YREA 2AFWA 4R76A 4A95A 3V8IA 1YVOA 4PSXA 4MBUA 3GYAA 4B11A 3KR5A 1LRZA 3R96A 1Q2DA 2VXKA 2BUEA 4ZBGA 4RUHA 5DWNA 3H8EA 1R57A 2QYVA 2RC4A 2QVPA 2GANA 2PJBA 3D7HA 5F48A 2FSRA 2GLJA 1XRYA 4AG7A 4KLWA 1ARMA 4MRIA 4AVAA 3K9TA 4GM5A 1YR0A 1R3NA 2OZHA 5LYDA 2VQYA 1LCPA 5DWMA 4BBHA 4UIAA 4UFXA 4JXRA 4NCZA 3B8GA 1F2OA 2PJCA 3TTHA 4CYPA 3DSBA 3T90A 3S9NA 3ISXA 5BWAB 4PXCA 1CPXA 4PQAA 1VGYA 2GU2A 2Q0YA 1TKFA 2PJ9A 3RYOA 2PJ8A 2ZEOA 4UEZA 3B7IA 5G21A 3RO0A 4EWTA 2Q4ZA 5CPAA 1TXRA 4DNCA 4I49A 2AFUA 2ANPA 4CYNA 1Z4EA 2Q7BA 2OZUA 2ZW4A 3SXOA 5LRGA 1X12A 4A94A 5K8NA 2REEA 4KSAA 4LX9A 4MXUA 3IGRA 1QMUA 2BL1A 3TO7A 2JLMA 1IIDA 2VZYA 1SQHA 1V0CA 3DR6A 2AE6A 3PB6X 4B5PB 4YFJA 3CT9A 4KOXA 4M3SA 3FIXA 4HNWB 5HVGA 2F8HA 2POKA 3NE8A 1Z2LA 4HKFA 2AFOA 1AMPA 2BO9A 2C6PA 2JDDA 2X7BA 3T8WA 2DF5A 1IGBA 2JDCA 3NE7A 2PIYA 4A38A 5IV0A 5AGEA 1XJOA 2Q43A 4CAXA 3SJXA 4II9A 3PGPA 2GFQA 4R6TA 3TT2A 2VEZA 2P6EA 3IJ3A 5JQ4A 1IYKA 4NGMA 3PFEA
chains in the Genus database with same CATH topology
2IQ6A 4P4EA 4DYOA 3FH4A 2GLFA 2O53A 2C1CA 1Z5RA 2XEIA 3B3WA 3VARA 4DJLA 4PPZA 3MRUA 4MCSA 3RAMA 5CBMA 4MHZA 1TF8A 4NGPA 3L2NA 1IY7A 3FMCA 4YWYA 3TC8A 3SJEA 4FBEA 4FWUA 1HEEA 4PXDA 5JM6A 4DUKA 1HDUA 2QJ8A 4ZY0A 2OR4A 4OC3A 1ELMP 2J9AA 3WC5A 4WJBA 4ZY2A 3FJUA 3I1UA 1PCAA 1NSAA 3QNVA 2PJ1A 2C6GA 1BPMA 1LAPA 3WC6A 1YW6A 1CPSA 3KQXA 4TWEA 1H8LA 2CIJA 1PYTB 1KWMA 2ZEEA 3MN8A 5ELYA 4OC2A 4F9VA 2HC9A 3IIBA 3NH5A 4FUUA 4NJQA 2V8HA 4NGTA 3PBBA 1LFWA 3H8FA 1QQ9A 3FECA 4OC4A 3D67A 4NJRA 2F7VA 4OC1A 4MCQA 1ZG8A 5D8NA 3WT4A 2AFZA 3VATA 4H2KA 1TKHA 3FEDA 4MHNA 2ZEPA 3BHXA 3KQZA 4X3RA 1F57A 4FAIA 1VIXA 4UF4A 4ZX9A 2AFSA 3V7ZA 4NGSA 3KL9A 4OC5A 2CF4A 5K8PA 2PIZA 2RB7A 3GB0A 2I3CA 1DE4C 4R8FA 3PB7X 1FT7A 3BXMA 2XEJA 3D4UA 1JQGA 4P4IA 1RTQA 5HXDA 1ZG7A 2PVWA 3DGVA 2CTBA 2PJAA 2WYRA 2JEWA 3KASA 3NA6A 1XBUA 2ZEFA 1VHEA 3IC1A 3PFOA 1OBRA 4P4JA 1CX8A 2ZENA 5K8MA 4JYWA 4NGRA 2V77A 4BD9A 2OOTA 3D66A 3D7FA 3WC7A 1BAVA 3NH4A 5THWA 2PJ0A 4F9UA 4P4BA 5HVFA 2GREA 2BCOA 1YLOA 4KSIA 2PJ4A 1ZLHA 3H8GA 3JRUA 5IB9A 4OMEA 2PVVA 3PEIA 4LQGA 4UEEA 3CDXA 3GLJA 2ZOFA 5LYLA 2Q51A 1LANA 1Q7LA 2V8GA 3TX8A 1EE3P 3FVLA 1LAMA 3S9LA 4ZI6A 2ZEMA 4IK2A 4PXBA 3WABA 1YSJA 4OP4A 3FX6A 3KHXA 1VHOA 3CPAA 3D7GA 3IO1A 2JBJA 4ZX8A 5JH9A 3HLPA 4P4FA 1YW4A 5LYFA 3GUXA 4B6ZA 4P10A 1ELLP 2PJ3A 4G1PA 3LMSA 2EK9A 3BI1A 2DEAA 4ONWA 3BI0A 1Y0RA 3SJGA 3B3VA 4JZ0A 1Y7EA 3SI0A 3PB8X 4NGQA 5HVHA 5D29A 3B3TA 4TNUA 1Z8LA 2ZEDA 4AXVA 2HB6A 1ZLIA 5I4MA 2PCUA 4K3NA 4X2TA 2C6CA 5DS0A 4F8ZA 2IMOA 2PJ5A 2JBKA 2AFXA 5LYIA 8CPAA 1DTDA 1XFOA 4P4DA 2XEGA 4YU9A 1M4LA 4CPAA 2ZEHA 2EWBA 1FNOA 5LRJA 3KI9A 4P44A 3SI2A 2G9DA 5LRKA 5JGFA 4IHMA 2BOAA 3B2YA 1HDQA 3ISZA 4O23A 3CPXA 2IJZA 2NSMA 1CP7A 5F09A 3LWUA 3IWWA 3KR4A 2XEFA 1CP6A 2NYQA 4R7MA 4ZY1A 4OKOA 2PJ6A 4EFDA 3DLJA 3HUVA 1R43A 3N5FA 4MHYA 3V38A 4EMEA 3PB9X 2AFMA 1YMEA 1TF9A 1CG2A 2FVGA 3NFZA 4Z65A 4NGNA 2PJ7A 3SJFA 4MCPA 2VL1A 1CBXA 3KHZA 2PJ2A 4MHPA 2O4HA 3IEHA 3KGQA 1GYTA 3S9MA 2WZNA 2ZOGA 4ZYQA 4A37A 4MMOA 3K2KA 4MCRA 3IFEA 2CTCA 7CPAA 1BLLE 2EK8A 1XMBA 3FEEA 4OIWA 3RZAA 1AYEA 4WWVA 3D7DA 3VH9A 1F2PA 4OIDA 1UWYA 1ARLA 4NFRA 4IAVA 3PB4X 2ZEGA 4UEFA 3FF3A 2PE3A 4W9YA 1LOKA 4OC0A 5J1QA 2RFHA 3PRTA 3KZWA 1Y0YA 1BPNA 3PBEA 3NH8A 4PXEA 2V8VA 4P45A 3B3CA 2PRQA 3D68A 1ZG9A 4UIBA 6CPAA 2V8DA 2ABZA 4X8IA 4Q7AA 3B3SA 2ZELA 3RBUA 1TKJA 4A39A 5K8OA 3SI1A 4P6YA 3B35A 2AFWA 4R76A 3KR5A 4RUHA 3H8EA 2QYVA 2QVPA 2PJBA 3D7HA 2GLJA 1XRYA 1ARMA 4MRIA 3K9TA 4GM5A 1R3NA 5LYDA 1LCPA 4UIAA 1F2OA 2PJCA 3S9NA 3ISXA 4PXCA 1CPXA 4PQAA 1VGYA 2GU2A 1TKFA 2PJ9A 2PJ8A 2ZEOA 4UEZA 3B7IA 4EWTA 2Q4ZA 5CPAA 1TXRA 2AFUA 2ANPA 5LRGA 5K8NA 4A94A 4MXUA 1QMUA 3PB6X 3CT9A 5HVGA 2F8HA 2POKA 1Z2LA 2AFOA 1AMPA 2BO9A 2C6PA 3T8WA 1IGBA 2PIYA 4A38A 1XJOA 2Q43A 3SJXA 4R6TA 3IJ3A 4NGMA 3PFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IQ6 A;  4P4E A;  4DYO A;  3FH4 A;  2GLF A;  2O53 A;  2C1C A;  1Z5R A;  2XEI A;  3B3W A;  3VAR A;  4DJL A;  4PPZ A;  3MRU A;  4MCS A;  3RAM A;  5CBM A;  4MHZ A;  1TF8 A;  4NGP A;  3L2N A;  1IY7 A;  3FMC A;  4YWY A;  3TC8 A;  3SJE A;  4FBE A;  4FWU A;  1HEE A;  4PXD A;  5JM6 A;  4DUK A;  1HDU A;  2QJ8 A;  4ZY0 A;  2OR4 A;  4OC3 A;  1ELM P;  2J9A A;  3WC5 A;  4WJB A;  4ZY2 A;  3FJU A;  3I1U A;  1PCA A;  1NSA A;  3QNV A;  2PJ1 A;  2C6G A;  1BPM A;  1LAP A;  3WC6 A;  1YW6 A;  1CPS A;  3KQX A;  4TWE A;  1H8L A;  2CIJ A;  1PYT B;  1KWM A;  2ZEE A;  3MN8 A;  5ELY A;  4OC2 A;  4F9V A;  2HC9 A;  3IIB A;  3NH5 A;  4FUU A;  4NJQ A;  2V8H A;  4NGT A;  3PBB A;  1LFW A;  3H8F A;  1QQ9 A;  3FEC A;  4OC4 A;  3D67 A;  4NJR A;  2F7V A;  4OC1 A;  4MCQ A;  1ZG8 A;  5D8N A;  3WT4 A;  2AFZ A;  3VAT A;  4H2K A;  1TKH A;  3FED A;  4MHN A;  2ZEP A;  3BHX A;  3KQZ A;  4X3R A;  1F57 A;  4FAI A;  1VIX A;  4UF4 A;  4ZX9 A;  2AFS A;  3V7Z A;  4NGS A;  3KL9 A;  4OC5 A;  2CF4 A;  5K8P A;  2PIZ A;  2RB7 A;  3GB0 A;  2I3C A;  1DE4 C;  4R8F A;  3PB7 X;  1FT7 A;  3BXM A;  2XEJ A;  3D4U A;  1JQG A;  4P4I A;  1RTQ A;  5HXD A;  1ZG7 A;  2PVW A;  3DGV A;  2CTB A;  2PJA A;  2WYR A;  2JEW A;  3KAS A;  3NA6 A;  1XBU A;  2ZEF A;  1VHE A;  3IC1 A;  3PFO A;  1OBR A;  4P4J A;  1CX8 A;  2ZEN A;  5K8M A;  4JYW A;  4NGR A;  2V77 A;  4BD9 A;  2OOT A;  3D66 A;  3D7F A;  3WC7 A;  1BAV A;  3NH4 A;  5THW A;  2PJ0 A;  4F9U A;  4P4B A;  5HVF A;  2GRE A;  2BCO A;  1YLO A;  4KSI A;  2PJ4 A;  1ZLH A;  3H8G A;  3JRU A;  5IB9 A;  4OME A;  2PVV A;  3PEI A;  4LQG A;  4UEE A;  3CDX A;  3GLJ A;  2ZOF A;  5LYL A;  2Q51 A;  1LAN A;  1Q7L A;  2V8G A;  3TX8 A;  1EE3 P;  3FVL A;  1LAM A;  3S9L A;  4ZI6 A;  2ZEM A;  4IK2 A;  4PXB A;  3WAB A;  1YSJ A;  4OP4 A;  3FX6 A;  3KHX A;  1VHO A;  3CPA A;  3D7G A;  3IO1 A;  2JBJ A;  4ZX8 A;  5JH9 A;  3HLP A;  4P4F A;  1YW4 A;  5LYF A;  3GUX A;  4B6Z A;  4P10 A;  1ELL P;  2PJ3 A;  4G1P A;  3LMS A;  2EK9 A;  3BI1 A;  2DEA A;  4ONW A;  3BI0 A;  1Y0R A;  3SJG A;  3B3V A;  4JZ0 A;  1Y7E A;  3SI0 A;  3PB8 X;  4NGQ A;  5HVH A;  5D29 A;  3B3T A;  4TNU A;  1Z8L A;  2ZED A;  4AXV A;  2HB6 A;  1ZLI A;  5I4M A;  2PCU A;  4K3N A;  4X2T A;  2C6C A;  5DS0 A;  4F8Z A;  2IMO A;  2PJ5 A;  2JBK A;  2AFX A;  5LYI A;  8CPA A;  1DTD A;  1XFO A;  4P4D A;  2XEG A;  4YU9 A;  1M4L A;  4CPA A;  2ZEH A;  2EWB A;  1FNO A;  5LRJ A;  3KI9 A;  4P44 A;  3SI2 A;  2G9D A;  5LRK A;  5JGF A;  4IHM A;  2BOA A;  3B2Y A;  1HDQ A;  3ISZ A;  4O23 A;  3CPX A;  2IJZ A;  2NSM A;  1CP7 A;  5F09 A;  3LWU A;  3IWW A;  3KR4 A;  2XEF A;  1CP6 A;  2NYQ A;  4R7M A;  4ZY1 A;  4OKO A;  2PJ6 A;  4EFD A;  3DLJ A;  3HUV A;  1R43 A;  3N5F A;  4MHY A;  3V38 A;  4EME A;  3PB9 X;  2AFM A;  1YME A;  1TF9 A;  1CG2 A;  2FVG A;  3NFZ A;  4Z65 A;  4NGN A;  2PJ7 A;  3SJF A;  4MCP A;  2VL1 A;  1CBX A;  3KHZ A;  2PJ2 A;  4MHP A;  2O4H A;  3IEH A;  3KGQ A;  1GYT A;  3S9M A;  2WZN A;  2ZOG A;  4ZYQ A;  4A37 A;  4MMO A;  3K2K A;  4MCR A;  3IFE A;  2CTC A;  7CPA A;  1BLL E;  2EK8 A;  1XMB A;  3FEE A;  4OIW A;  3RZA A;  1AYE A;  4WWV A;  3D7D A;  3VH9 A;  1F2P A;  4OID A;  1UWY A;  1ARL A;  4NFR A;  4IAV A;  3PB4 X;  2ZEG A;  4UEF A;  3FF3 A;  2PE3 A;  4W9Y A;  1LOK A;  4OC0 A;  5J1Q A;  2RFH A;  3PRT A;  3KZW A;  1Y0Y A;  1BPN A;  3PBE A;  3NH8 A;  4PXE A;  2V8V A;  4P45 A;  3B3C A;  2PRQ A;  3D68 A;  1ZG9 A;  4UIB A;  6CPA A;  2V8D A;  2ABZ A;  4X8I A;  4Q7A A;  3B3S A;  2ZEL A;  3RBU A;  1TKJ A;  4A39 A;  5K8O A;  3SI1 A;  4P6Y A;  3B35 A;  2AFW A;  4R76 A;  3KR5 A;  4RUH A;  3H8E A;  2QYV A;  2QVP A;  2PJB A;  3D7H A;  2GLJ A;  1XRY A;  1ARM A;  4MRI A;  3K9T A;  4GM5 A;  1R3N A;  5LYD A;  1LCP A;  4UIA A;  1F2O A;  2PJC A;  3S9N A;  3ISX A;  4PXC A;  1CPX A;  4PQA A;  1VGY A;  2GU2 A;  1TKF A;  2PJ9 A;  2PJ8 A;  2ZEO A;  4UEZ A;  3B7I A;  4EWT A;  2Q4Z A;  5CPA A;  1TXR A;  2AFU A;  2ANP A;  5LRG A;  5K8N A;  4A94 A;  4MXU A;  1QMU A;  3PB6 X;  3CT9 A;  5HVG A;  2F8H A;  2POK A;  1Z2L A;  2AFO A;  1AMP A;  2BO9 A;  2C6P A;  3T8W A;  1IGB A;  2PIY A;  4A38 A;  1XJO A;  2Q43 A;  3SJX A;  4R6T A;  3IJ3 A;  4NGM A;  3PFE A; 
#chains in the Genus database with same CATH topology
 1QSN A;  4CYO A;  2IL4 A;  2IQ6 A;  4P4E A;  4H6U A;  4DYO A;  1Q2C A;  4PV6 A;  4KOU A;  3EFA A;  4E2A A;  3S6F A;  3FH4 A;  2GLF A;  2O53 A;  4KSF A;  1Y7R A;  4C2X A;  3F0A A;  2C1C A;  2Z11 A;  1Z5R A;  2Z3M A;  4B5P A;  2XEI A;  4KOT A;  3B3W A;  1S5K A;  3CXS A;  3VAR A;  4DJL A;  4PPZ A;  3T9Y A;  3LAC A;  3MRU A;  3EC4 A;  1VHS A;  4MCS A;  3RAM A;  2Q44 A;  3TO6 A;  2WUU A;  5CBM A;  1XOV A;  4MHZ A;  3IU2 A;  1TF8 A;  5E96 A;  4NGP A;  4KUA A;  1IB1 E;  4LUA A;  3L2N A;  4NSQ A;  1IY7 A;  3FMC A;  2QIR A;  4U5Y A;  2DPT A;  4MFP A;  4YWY A;  3W6X A;  3TC8 A;  3SJE A;  4FBE A;  4FWU A;  1HEE A;  4PXD A;  1BO4 A;  2Z0Z A;  2CNT A;  1HDU A;  4QUS A;  3S6K A;  3GY9 A;  2QJ8 A;  4Y49 C;  1Q2Y A;  4DUK A;  4ZY0 A;  3OWC A;  3P2H A;  2OR4 A;  2REF A;  4C7H A;  4OC3 A;  1ELM P;  2J9A A;  5F47 A;  3CXP A;  4UWJ A;  4WJB A;  3WC5 A;  4ZY2 A;  3FJU A;  1M4D A;  3I1U A;  1OZP A;  1PCA A;  1Y9W A;  3C26 A;  5A27 A;  2PC1 A;  1NSA A;  2FE7 A;  2PJ1 A;  3QNV A;  2B5G B;  1I12 A;  2C6G A;  1BPM A;  4FD6 A;  4CGO A;  1LAP A;  1Z4R A;  5CNP A;  3WC6 A;  1YW6 A;  3F8K A;  1CPS A;  3KQX A;  4IUS A;  4TWE A;  4A33 A;  1H8L A;  2CIJ A;  4Q36 A;  2PR8 A;  1PYT B;  3S6G A;  4CAV A;  1KWM A;  2ZEE A;  3MN8 A;  5ELY A;  2R8V A;  4OC2 A;  4UBR A;  4F9V A;  2HC9 A;  3IIB A;  3NH5 A;  4FUU A;  4K30 A;  4ZGY B;  1Z8X A;  3DDD A;  2GIV A;  4NJQ A;  1B6B A;  2V8H A;  3UY5 A;  1YLE A;  2B4D B;  4NGT A;  4KZT A;  4NEX A;  5A28 A;  3PBB A;  2FL4 A;  1LFW A;  2B3V A;  3H8F A;  2J8N A;  2Q4V A;  3FRM A;  1QQ9 A;  3FEC A;  3JTK A;  1S3Z A;  3D67 A;  2PRB A;  4NJR A;  1QSR A;  2F7V A;  4OC4 A;  4OC1 A;  4MCQ A;  1IU8 A;  1YVK A;  1ZG8 A;  5D8N A;  3WT4 A;  2AFZ A;  2B5G A;  3VAT A;  4MY0 A;  4H2K A;  4R3K A;  1TKH A;  3FED A;  2D4P A;  5HH1 A;  1A2Z A;  2P6F A;  2ZEP A;  4MHN A;  4A31 A;  2B4B A;  4YRH A;  3BHX A;  3KQZ A;  4U9Y A;  1CJW A;  4X3R A;  4JLY A;  4M6G A;  1F57 A;  3I3G A;  1VIX A;  4FAI A;  4HNX B;  4UF4 A;  4ZX9 A;  5I0C A;  2EO8 A;  4MY3 A;  3R95 A;  4M6H A;  2AFS A;  3V7Z A;  3W91 A;  3H5Z A;  4NGS A;  4FD5 A;  3KL9 A;  4OC5 A;  2PR1 A;  2CF4 A;  5K8P A;  2PIZ A;  2RB7 A;  2WPW A;  1YGH A;  2B4D A;  4B14 A;  1CM0 A;  3FYN A;  3GB0 A;  2I3C A;  1DE4 C;  4Q38 A;  1MJA A;  3PB7 X;  4QC6 A;  4R8F A;  1FT7 A;  3BXM A;  3LD2 A;  2C27 A;  2XEJ A;  4B12 A;  5JPH A;  3D4U A;  5ISV A;  2FIW A;  1JQG A;  2FT0 A;  4P4I A;  1RTQ A;  5HXD A;  1ZG7 A;  1FY7 A;  2PVW A;  2YNC A;  3DGV A;  2OZG A;  4EVY A;  2CTB A;  2PJA A;  3SHP A;  2WYR A;  2O28 A;  2NMT A;  2JEW A;  1JWQ A;  1P4N A;  3KAS A;  4OAD A;  4XNH B;  4XPD C;  3NA6 A;  3D3S A;  1QSO A;  1XBU A;  2ZEF A;  4AB7 A;  1VHE A;  2I00 A;  3IC1 A;  3PFO A;  4QVT A;  1OBR A;  5IX3 A;  5IB0 A;  4UFV A;  4ONU A;  2WSA A;  4UCN A;  4KOR A;  5HMN A;  4P4J A;  1CX8 A;  2CXA A;  4L8A A;  5G20 A;  2ZEN A;  2CNS A;  5K8M A;  1IIC A;  4JYW A;  4NGR A;  2V77 A;  4BD9 A;  1Z9U A;  2OOT A;  2B58 A;  4F0X A;  2K5T A;  4R9M A;  4KOV A;  5EBV A;  3GIU A;  2KCW A;  3D66 A;  1UFH A;  3F5B A;  1MJB A;  3D7F A;  3H4Q A;  4OLL A;  4XPD B;  1NSL A;  3WC7 A;  2R1I A;  1BAV A;  4A32 A;  3QAH A;  4B13 A;  5F46 A;  3EY5 A;  2R98 A;  3I9S A;  3NH4 A;  4C2Y A;  4KOY A;  5THW A;  4KOS A;  4NF1 A;  2PJ0 A;  2VI7 A;  5JM6 A;  4F9U A;  2P6G A;  4P4B A;  2FCK A;  4JXQ A;  5AG5 A;  5HVF A;  3W6S A;  2GRE A;  2BCO A;  4YGO A;  1YLO A;  3P2F A;  3EXN A;  2VZZ A;  3GKR A;  2Q4Y A;  4KSI A;  2PJ4 A;  1IYL A;  1I1D A;  2BSW A;  1ZLH A;  3R9F A;  3H8G A;  3JRU A;  5IB9 A;  2Z3L A;  4RS2 A;  4FD4 A;  1M1D A;  1BOB A;  2PVV A;  3PEI A;  4OME A;  1WK4 A;  4LQG A;  4UEE A;  4MFQ A;  3CDX A;  3KKW A;  4E0A A;  4CYQ A;  3GLJ A;  2ZOF A;  5LYL A;  3FB3 A;  1RO5 A;  1P0H A;  2Q51 A;  1LAN A;  2QML A;  1KUV A;  2ATR A;  4QB9 A;  1Q7L A;  3FXT A;  1S7N A;  2R7H A;  5G22 A;  3ZZI A;  2V8G A;  4HPS A;  1XE4 A;  3TX8 A;  1EE3 P;  3G8W A;  3ZJ0 A;  3FVL A;  4CS0 B;  2HQY A;  1LAM A;  3S9L A;  1S7K A;  1XEB A;  3RNZ A;  4ZI6 A;  4CGN A;  2ZEM A;  4IK2 A;  4PXB A;  3G3S A;  3WAB A;  1S60 A;  1YSJ A;  4OP4 A;  4PK2 A;  4C7I A;  4GS4 A;  3FX6 A;  2PSW A;  3KHX A;  1VHO A;  3JVN A;  3CPA A;  5C82 A;  3D7G A;  3TOA A;  3JUW A;  2Z3O A;  3IO1 A;  2JBJ A;  4F0Y A;  4ZX8 A;  2F5I A;  3TE4 A;  5JH9 A;  3HLP A;  2YNC C;  4X5K A;  4P4F A;  1YW4 A;  5LYF A;  3GUX A;  4B6Z A;  4MFJ A;  4GXH A;  4P10 A;  1IOF A;  1ELL P;  2PJ3 A;  4CGL A;  4G1P A;  4M85 A;  5GCN A;  4C2Z A;  3LMS A;  4R87 A;  2EK9 A;  4LQ6 A;  1I21 A;  2DEA A;  3BI1 A;  1MK4 A;  4MFZ A;  2VBQ A;  1B87 A;  4ONW A;  2D4O A;  2Z3N A;  2J8R A;  1MJ9 A;  3R9E A;  1TIQ A;  3BI0 A;  2OB0 A;  1Y0R A;  1KUY A;  3LOD A;  3SJG A;  3PP9 A;  1L0C A;  3CXQ A;  3FNC A;  4R57 A;  3B3V A;  3VWD A;  1Y7E A;  4JZ0 A;  2DPS A;  4IF5 A;  4MJ8 A;  3D8P A;  3SI0 A;  3PB8 X;  3EO4 A;  2G3T A;  4NGQ A;  2Z3P A;  5HVH A;  3TCV A;  1WWZ A;  4MFL A;  4KVM E;  5D29 A;  3B3T A;  4TNU A;  4RI1 A;  3S6H A;  1Z8L A;  2ZED A;  4CAW A;  4AXV A;  2HB6 A;  4UWI A;  1ZLI A;  3PZJ A;  5I4M A;  2PCU A;  5AG4 A;  4HNY B;  4JWP A;  4K3N A;  4X2T A;  4XNH C;  4KVX A;  2C6C A;  2Y0M A;  4AG9 A;  4CGP A;  5DS0 A;  4F8Z A;  2IMO A;  3VWE A;  4XPK A;  1KUX A;  2Q04 A;  2PJ5 A;  3QAY A;  4B10 A;  4XPL A;  3QB8 A;  1AUG A;  2JBK A;  4U9Z A;  2GE3 A;  5KTD A;  2AFX A;  4JJX A;  1YQE A;  5LYI A;  2EBJ A;  4CAF A;  2FXF A;  8CPA A;  5AG7 A;  1DTD A;  1XFO A;  3E0K A;  2HV2 A;  2XEG A;  4P4D A;  2A4N A;  3IU1 A;  4YU9 A;  1M4L A;  4PK3 A;  1S7L A;  4CPA A;  2ZEH A;  2J8M A;  4E8O A;  4CAE A;  2EWB A;  2H5M A;  5J8F A;  1FNO A;  4BIN A;  1IOI A;  5LRJ A;  2EUI A;  4ORF A;  3KI9 A;  4P44 A;  4A2Z A;  4BMH A;  3BJ8 A;  3SI2 A;  2G9D A;  3MGD A;  5JGF A;  4IHM A;  3D2M A;  5LRK A;  4NXY A;  3SXN A;  2BOA A;  4H6Z A;  3B2Y A;  1HDQ A;  3N7Z A;  3ISZ A;  3CPX A;  4O23 A;  2IJZ A;  2PQ8 A;  2NSM A;  3TO9 A;  2Q7S A;  1CP7 A;  2AJ6 A;  5AG6 A;  5F09 A;  3LWU A;  3IWW A;  2FIA A;  3KR4 A;  2XEF A;  5H84 A;  1CP6 A;  1K4J A;  2NYQ A;  4R7M A;  4ZY1 A;  1ON0 A;  2OH1 A;  4OAE A;  4OKO A;  2FS5 A;  2PJ6 A;  1NE9 A;  4UCM A;  4EFD A;  3DLJ A;  3HUV A;  1R43 A;  1Y9K A;  2DXQ A;  4MHD A;  3N5F A;  1X10 A;  3A9L A;  4RN7 A;  4MHY A;  3V38 A;  2B3U A;  4KOW A;  2Z3K A;  4EME A;  1U6M A;  4AVB A;  2JEV A;  4UA3 A;  3PB9 X;  4C68 A;  4CGM A;  2AFM A;  3DNS A;  1YME A;  1TF9 A;  1CG2 A;  2FVG A;  3NFZ A;  3TFY A;  4Z65 A;  2HUZ A;  4NGN A;  2PJ7 A;  1M4I A;  3SJF A;  4H89 A;  4MCP A;  2VL1 A;  4KUB A;  1CBX A;  4QBJ A;  1XF8 A;  2ARH A;  3KHZ A;  3R9G A;  4KS9 A;  3D2P A;  5G1Z A;  1S7F A;  2PJ2 A;  2ZW5 A;  2ZW7 A;  4MHP A;  2O4H A;  3IEH A;  2QEC A;  3KGQ A;  1GYT A;  5EMI A;  3S9M A;  2WZN A;  2YNE A;  2ZOG A;  4L89 A;  4ZYQ A;  3BLN A;  1RXT A;  4A37 A;  4MMO A;  4CRZ B;  3K2K A;  4MFK A;  4MCR A;  3IFE A;  2CTC A;  7CPA A;  4A30 A;  5J8C A;  1BLL E;  2ZPA A;  2EK8 A;  1ZO0 A;  1NMT A;  1XMB A;  3FEE A;  4OIW A;  3RZA A;  1Z8W A;  2ODF A;  1AYE A;  4WWV A;  2I79 A;  3D7D A;  3VH9 A;  1VKC A;  1F2P A;  3K9U A;  1UWY A;  4OID A;  2ZXV A;  1ARL A;  2WPX A;  1M4G A;  2G3A A;  4NFR A;  4IAV A;  4PSW A;  5KTA A;  1Z8T A;  2ZEG A;  3PB4 X;  4UEF A;  3FF3 A;  2PE3 A;  3BJ7 A;  4W9Y A;  1LOK A;  4OC0 A;  1XMT A;  4MI4 A;  2ZW6 A;  4KVO E;  5J1Q A;  5C88 A;  2P0W A;  1XIX A;  1YK3 A;  2CNM A;  2RFH A;  4UCP A;  5H86 A;  4AVC A;  2Z10 A;  5FVJ A;  4R3L A;  4F6A A;  3PRT A;  3KZW A;  1YX0 A;  4J3G A;  4UFW A;  4B5O A;  3R1K A;  1Y0Y A;  1BPN A;  3PBE A;  3NH8 A;  1QSM A;  1PU9 A;  2CY2 A;  4PXE A;  2OU2 A;  2YND A;  1GHE A;  2V8V A;  3IWE A;  4P45 A;  3B3C A;  2PRQ A;  3D68 A;  1ZG9 A;  1QST A;  2BEI A;  3DR8 A;  4UIB A;  1KZF A;  6CPA A;  3CZX A;  1M44 A;  2V8D A;  2ABZ A;  2G0B A;  1J4J A;  3FBU A;  4KLV A;  4Q7A A;  4X8I A;  3B3S A;  3WR7 A;  4CRY B;  2ZEL A;  2YGW A;  5KTC A;  3RBU A;  4Y49 B;  3TOB A;  1TKJ A;  4FD7 A;  4A39 A;  5K8O A;  3IWG A;  4JD6 A;  4M6I A;  3SI1 A;  5EC4 A;  5F49 A;  2PDO A;  4P6Y A;  1N71 A;  2EVN A;  1PUA A;  3B35 A;  1YRE A;  2AFW A;  4R76 A;  4A95 A;  3V8I A;  1YVO A;  4PSX A;  4MBU A;  3GYA A;  4B11 A;  3KR5 A;  1LRZ A;  3R96 A;  1Q2D A;  2VXK A;  2BUE A;  4ZBG A;  4RUH A;  5DWN A;  3H8E A;  1R57 A;  2QYV A;  2RC4 A;  2QVP A;  2GAN A;  2PJB A;  3D7H A;  5F48 A;  2FSR A;  2GLJ A;  1XRY A;  4AG7 A;  4KLW A;  1ARM A;  4MRI A;  4AVA A;  3K9T A;  4GM5 A;  1YR0 A;  1R3N A;  2OZH A;  5LYD A;  2VQY A;  1LCP A;  5DWM A;  4BBH A;  4UIA A;  4UFX A;  4JXR A;  4NCZ A;  3B8G A;  1F2O A;  2PJC A;  3TTH A;  4CYP A;  3DSB A;  3T90 A;  3S9N A;  3ISX A;  5BWA B;  4PXC A;  1CPX A;  4PQA A;  1VGY A;  2GU2 A;  2Q0Y A;  1TKF A;  2PJ9 A;  3RYO A;  2PJ8 A;  2ZEO A;  4UEZ A;  3B7I A;  5G21 A;  3RO0 A;  4EWT A;  2Q4Z A;  5CPA A;  1TXR A;  4DNC A;  4I49 A;  2AFU A;  2ANP A;  4CYN A;  1Z4E A;  2Q7B A;  2OZU A;  2ZW4 A;  3SXO A;  5LRG A;  1X12 A;  4A94 A;  5K8N A;  2REE A;  4KSA A;  4LX9 A;  4MXU A;  3IGR A;  1QMU A;  2BL1 A;  3TO7 A;  2JLM A;  1IID A;  2VZY A;  1SQH A;  1V0C A;  3DR6 A;  2AE6 A;  3PB6 X;  4B5P B;  4YFJ A;  3CT9 A;  4KOX A;  4M3S A;  3FIX A;  4HNW B;  5HVG A;  2F8H A;  2POK A;  3NE8 A;  1Z2L A;  4HKF A;  2AFO A;  1AMP A;  2BO9 A;  2C6P A;  2JDD A;  2X7B A;  3T8W A;  2DF5 A;  1IGB A;  2JDC A;  3NE7 A;  2PIY A;  4A38 A;  5IV0 A;  5AGE A;  1XJO A;  2Q43 A;  4CAX A;  3SJX A;  4II9 A;  3PGP A;  2GFQ A;  4R6T A;  3TT2 A;  2VEZ A;  2P6E A;  3IJ3 A;  5JQ4 A;  1IYK A;  4NGM A;  3PFE A; 
#chains in the Genus database with same CATH homology
 2IQ6 A;  4P4E A;  4DYO A;  3FH4 A;  2GLF A;  2O53 A;  2C1C A;  1Z5R A;  2XEI A;  3B3W A;  3VAR A;  4DJL A;  4PPZ A;  3MRU A;  4MCS A;  3RAM A;  5CBM A;  4MHZ A;  1TF8 A;  4NGP A;  3L2N A;  1IY7 A;  3FMC A;  4YWY A;  3TC8 A;  3SJE A;  4FBE A;  4FWU A;  1HEE A;  4PXD A;  5JM6 A;  4DUK A;  1HDU A;  2QJ8 A;  4ZY0 A;  2OR4 A;  4OC3 A;  1ELM P;  2J9A A;  3WC5 A;  4WJB A;  4ZY2 A;  3FJU A;  3I1U A;  1PCA A;  1NSA A;  3QNV A;  2PJ1 A;  2C6G A;  1BPM A;  1LAP A;  3WC6 A;  1YW6 A;  1CPS A;  3KQX A;  4TWE A;  1H8L A;  2CIJ A;  1PYT B;  1KWM A;  2ZEE A;  3MN8 A;  5ELY A;  4OC2 A;  4F9V A;  2HC9 A;  3IIB A;  3NH5 A;  4FUU A;  4NJQ A;  2V8H A;  4NGT A;  3PBB A;  1LFW A;  3H8F A;  1QQ9 A;  3FEC A;  4OC4 A;  3D67 A;  4NJR A;  2F7V A;  4OC1 A;  4MCQ A;  1ZG8 A;  5D8N A;  3WT4 A;  2AFZ A;  3VAT A;  4H2K A;  1TKH A;  3FED A;  4MHN A;  2ZEP A;  3BHX A;  3KQZ A;  4X3R A;  1F57 A;  4FAI A;  1VIX A;  4UF4 A;  4ZX9 A;  2AFS A;  3V7Z A;  4NGS A;  3KL9 A;  4OC5 A;  2CF4 A;  5K8P A;  2PIZ A;  2RB7 A;  3GB0 A;  2I3C A;  1DE4 C;  4R8F A;  3PB7 X;  1FT7 A;  3BXM A;  2XEJ A;  3D4U A;  1JQG A;  4P4I A;  1RTQ A;  5HXD A;  1ZG7 A;  2PVW A;  3DGV A;  2CTB A;  2PJA A;  2WYR A;  2JEW A;  3KAS A;  3NA6 A;  1XBU A;  2ZEF A;  1VHE A;  3IC1 A;  3PFO A;  1OBR A;  4P4J A;  1CX8 A;  2ZEN A;  5K8M A;  4JYW A;  4NGR A;  2V77 A;  4BD9 A;  2OOT A;  3D66 A;  3D7F A;  3WC7 A;  1BAV A;  3NH4 A;  5THW A;  2PJ0 A;  4F9U A;  4P4B A;  5HVF A;  2GRE A;  2BCO A;  1YLO A;  4KSI A;  2PJ4 A;  1ZLH A;  3H8G A;  3JRU A;  5IB9 A;  4OME A;  2PVV A;  3PEI A;  4LQG A;  4UEE A;  3CDX A;  3GLJ A;  2ZOF A;  5LYL A;  2Q51 A;  1LAN A;  1Q7L A;  2V8G A;  3TX8 A;  1EE3 P;  3FVL A;  1LAM A;  3S9L A;  4ZI6 A;  2ZEM A;  4IK2 A;  4PXB A;  3WAB A;  1YSJ A;  4OP4 A;  3FX6 A;  3KHX A;  1VHO A;  3CPA A;  3D7G A;  3IO1 A;  2JBJ A;  4ZX8 A;  5JH9 A;  3HLP A;  4P4F A;  1YW4 A;  5LYF A;  3GUX A;  4B6Z A;  4P10 A;  1ELL P;  2PJ3 A;  4G1P A;  3LMS A;  2EK9 A;  3BI1 A;  2DEA A;  4ONW A;  3BI0 A;  1Y0R A;  3SJG A;  3B3V A;  4JZ0 A;  1Y7E A;  3SI0 A;  3PB8 X;  4NGQ A;  5HVH A;  5D29 A;  3B3T A;  4TNU A;  1Z8L A;  2ZED A;  4AXV A;  2HB6 A;  1ZLI A;  5I4M A;  2PCU A;  4K3N A;  4X2T A;  2C6C A;  5DS0 A;  4F8Z A;  2IMO A;  2PJ5 A;  2JBK A;  2AFX A;  5LYI A;  8CPA A;  1DTD A;  1XFO A;  4P4D A;  2XEG A;  4YU9 A;  1M4L A;  4CPA A;  2ZEH A;  2EWB A;  1FNO A;  5LRJ A;  3KI9 A;  4P44 A;  3SI2 A;  2G9D A;  5LRK A;  5JGF A;  4IHM A;  2BOA A;  3B2Y A;  1HDQ A;  3ISZ A;  4O23 A;  3CPX A;  2IJZ A;  2NSM A;  1CP7 A;  5F09 A;  3LWU A;  3IWW A;  3KR4 A;  2XEF A;  1CP6 A;  2NYQ A;  4R7M A;  4ZY1 A;  4OKO A;  2PJ6 A;  4EFD A;  3DLJ A;  3HUV A;  1R43 A;  3N5F A;  4MHY A;  3V38 A;  4EME A;  3PB9 X;  2AFM A;  1YME A;  1TF9 A;  1CG2 A;  2FVG A;  3NFZ A;  4Z65 A;  4NGN A;  2PJ7 A;  3SJF A;  4MCP A;  2VL1 A;  1CBX A;  3KHZ A;  2PJ2 A;  4MHP A;  2O4H A;  3IEH A;  3KGQ A;  1GYT A;  3S9M A;  2WZN A;  2ZOG A;  4ZYQ A;  4A37 A;  4MMO A;  3K2K A;  4MCR A;  3IFE A;  2CTC A;  7CPA A;  1BLL E;  2EK8 A;  1XMB A;  3FEE A;  4OIW A;  3RZA A;  1AYE A;  4WWV A;  3D7D A;  3VH9 A;  1F2P A;  4OID A;  1UWY A;  1ARL A;  4NFR A;  4IAV A;  3PB4 X;  2ZEG A;  4UEF A;  3FF3 A;  2PE3 A;  4W9Y A;  1LOK A;  4OC0 A;  5J1Q A;  2RFH A;  3PRT A;  3KZW A;  1Y0Y A;  1BPN A;  3PBE A;  3NH8 A;  4PXE A;  2V8V A;  4P45 A;  3B3C A;  2PRQ A;  3D68 A;  1ZG9 A;  4UIB A;  6CPA A;  2V8D A;  2ABZ A;  4X8I A;  4Q7A A;  3B3S A;  2ZEL A;  3RBU A;  1TKJ A;  4A39 A;  5K8O A;  3SI1 A;  4P6Y A;  3B35 A;  2AFW A;  4R76 A;  3KR5 A;  4RUH A;  3H8E A;  2QYV A;  2QVP A;  2PJB A;  3D7H A;  2GLJ A;  1XRY A;  1ARM A;  4MRI A;  3K9T A;  4GM5 A;  1R3N A;  5LYD A;  1LCP A;  4UIA A;  1F2O A;  2PJC A;  3S9N A;  3ISX A;  4PXC A;  1CPX A;  4PQA A;  1VGY A;  2GU2 A;  1TKF A;  2PJ9 A;  2PJ8 A;  2ZEO A;  4UEZ A;  3B7I A;  4EWT A;  2Q4Z A;  5CPA A;  1TXR A;  2AFU A;  2ANP A;  5LRG A;  5K8N A;  4A94 A;  4MXU A;  1QMU A;  3PB6 X;  3CT9 A;  5HVG A;  2F8H A;  2POK A;  1Z2L A;  2AFO A;  1AMP A;  2BO9 A;  2C6P A;  3T8W A;  1IGB A;  2PIY A;  4A38 A;  1XJO A;  2Q43 A;  3SJX A;  4R6T A;  3IJ3 A;  4NGM A;  3PFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...