4B10A

Plasmodium vivax n-myristoyltransferase with a non-hydrolysable co- factor
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Design and Synthesis of Inhibitors of Plasmodium Falciparum N-Myristoyltransferase, a Promising Target for Anti-Malarial Drug Discovery.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 119
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4b10A00
4B11A 4C7HA 4CYPA 4BBHA 4B12A 4UFWA 2WUUA 3H5ZA 2YNCC 5AG5A 4A32A 4A31A 2WSAA 4B13A 4UFVA 4C2ZA 4CYOA 5G21A 4B14A 4CGOA 5G22A 3IWEA 4A2ZA 5AG6A 4C2XA 4A95A 3IU1A 4UCPA 5G1ZA 4CAEA 4CAFA 4A30A 5G20A 2YNDA 4UCMA 5AG7A 2YNCA 3JTKA 4CYQA 4UCNA 5A27A 4CGMA 4CYNA 4C2YA 4C7IA 4C68A 4A33A 4B10A 4UFXA 3IU2A 5A28A 4CGPA 4CGLA 4CGNA 5AG4A 2YNEA 5AGEA
chains in the Genus database with same CATH superfamily
2Z0ZA 1A2ZA 2PJBA 3B2YA 1ZG7A 3S6FA 4BMHA 2PJ0A 3SJEA 1FY7A 2EWBA 4UFWA 2Q4VA 3RAMA 4DJLA 4JLYA 3ISZA 1MJ9A 4EVYA 4H2KA 5LRKA 2PVVA 2FIWA 4UIBA 2AFXA 5J8FA 4OAEA 4FD5A 2ZEHA 1YX0A 4UWIA 3GIUA 1MJAA 4Q7AA 1B6BA 2DXQA 4H6UA 3MRUA 5AG7A 2FSRA 1YVKA 5D8NA 1IYKA 3CPXA 3DSBA 4ONWA 1Z2LA 2ABZA 2ZEFA 3EXNA 4C7IA 2B3UA 4MFKA 4QVTA 2PSWA 3S9LA 1PCAA 4P4IA 2FL4A 5F47A 3VWEA 4LQGA 2Q7BA 3SJGA 4RI1A 1CPXA 4MCQA 2PQ8A 7CPAA 3SI1A 4XNHB 4F0YA 5FVJA 2AFUA 1QMUA 5EBVA 2G9DA 5F46A 3OWCA 2HQYA 4B6ZA 4GXHA 5HVHA 3RBUA 1LCPA 4Z65A 1UWYA 4PSXA 4IAVA 1Y7RA 8CPAA 3FJUA 4FAIA 4YFJA 1S3ZA 5G22A 3FEEA 2Z11A 3FB3A 4A95A 4CPAA 3UY5A 3EY5A 3F0AA 3ZJ0A 4JYWA 4EMEA 2FS5A 4OIDA 2Q0YA 4OIWA 4X3RA 4R87A 5ELYA 5H84A 2FE7A 4OC3A 3NH8A 5THWA 4H6ZA 5DWNA 4P10A 2PIZA 3T8WA 1YR0A 3TCVA 4B5PB 2DEAA 3FYNA 2G3AA 4OADA 4KOYA 2B4DA 2OZGA 4UWJA 4M6GA 2JDDA 1Y9WA 2FIAA 4MCSA 4UBRA 3SHPA 2ZW6A 1PYTB 1QSRA 1ARLA 4UEEA 4NXYA 4IK2A 4A39A 1XEBA 1XOVA 1TKJA 1NMTA 2EK8A 2IJZA 2P6GA 4CYOA 3R9EA 3FF3A 4KSAA 2OU2A 3KGQA 2Z10A 2VEZA 4MMOA 2PJ5A 2DF5A 3K2KA 4MCRA 4CYQA 1S7LA 1XMBA 4MFQA 2ZENA 2ZEOA 4B5OA 2ZW5A 4CYNA 1TF9A 4PXBA 5IV0A 2EO8A 5I0CA 4KZTA 1Z8WA 1LAPA 4MHPA 2JEVA 1VKCA 1YREA 3I3GA 2Z3OA 4F8ZA 6CPAA 3TFYA 1VIXA 4NF1A 5CNPA 2O53A 1CBXA 2C6CA 1F57A 2PCUA 5F49A 2GLFA 2X7BA 2ZELA 3IEHA 4MY3A 1IOFA 1K4JA 2AJ6A 4MHZA 3P2FA 3H4QA 3D7DA 4UIAA 1TIQA 1TKFA 1I1DA 3VATA 4BINA 2OZUA 3CXQA 4HNYB 1BO4A 5GCNA 4F9UA 3B35A 2O28A 5K8NA 2VBQA 4QBJA 3ZZIA 3FIXA 3NE7A 4ZGYB 3F5BA 2ZOFA 5K8MA 2C27A 1QQ9A 3QAHA 2DPTA 2QIRA 3LODA 4PXEA 4C2XA 2PJ9A 2K5TA 4KOSA 2ZW4A 1CM0A 3BI0A 4F6AA 4CAXA 3TE4A 3FECA 3D66A 4OC1A 2IMOA 2Z3KA 1ZLIA 1I21A 3T9YA 2Z3MA 2BSWA 5JQ4A 2YNEA 4TWEA 4B11A 4P4JA 2CNMA 4XPLA 3G3SA 4BBHA 2H5MA 4JJXA 2XEIA 2OOTA 2AE6A 4WWVA 4A32A 1YLEA 3V8IA 4UA3A 1YQEA 1XIXA 4XNHC 3V7ZA 4II9A 1QSNA 2V8VA 2PJ4A 3DR8A 1AMPA 2P6EA 1UFHA 1CG2A 4NGPA 4AG9A 4A38A 3TX8A 4OKOA 3NH5A 4KOVA 1LFWA 1I12A 2CTBA 4F0XA 4AXVA 4HPSA 4RUHA 1LAMA 3IU2A 4MI4A 4WJBA 4ZX9A 4CGPA 3R1KA 1Q2CA 1RXTA 3DNSA 1XBUA 4P4DA 1B87A 3PB4X 3SI2A 4CRYB 5HMNA 4M6HA 4EFDA 5IB9A 1AYEA 1WK4A 2POKA 2PJCA 1VHOA 3SI0A 3GKRA 3KQXA 4UFVA 2XEJA 3P2HA 2FVGA 3D67A 4BD9A 4NSQA 1GHEA 1IIDA 3KL9A 2QJ8A 1PUAA 1Q2YA 2NMTA 3S6GA 2YNDA 2RFHA 4OC5A 2CIJA 2PJ3A 4UEZA 3SXNA 3S9NA 3GY9A 3TT2A 2J8RA 2PJ1A 3QAYA 2C6GA 3VARA 2VZZA 4KS9A 4CAVA 1DE4C 4QUSA 1IYLA 2GLJA 2Y0MA 1P0HA 2BCOA 3B3SA 2G0BA 4DUKA 4ZY2A 4QB9A 2QYVA 1M44A 4MBUA 2WUUA 5JGFA 1JWQA 1S5KA 3G8WA 1CP7A 4M85A 2WSAA 1KUVA 3MN8A 4C2ZA 1CX8A 4CS0B 3N5FA 5IB0A 3SJFA 4OC2A 4K3NA 3B3WA 2ZEMA 2ZOGA 4FD4A 4P4FA 3JRUA 1IOIA 1X10A 2PR1A 5LYFA 4KVME 4UCPA 3EO4A 4CAWA 3GB0A 5G20A 3WT4A 3TTHA 5A27A 3QB8A 2Q43A 3KASA 3RZAA 4MFZA 4A33A 3LMSA 1YMEA 4MFLA 4B10A 4W9YA 4ONUA 1XFOA 2J8MA 2OR4A 1XMTA 2B4BA 3D3SA 4P4BA 5K8PA 2R1IA 5H86A 3WC5A 4AVCA 2ZW7A 4KOXA 1M4DA 1BAVA 4JD6A 2KCWA 4GS4A 2JDCA 2CTCA 4B12A 4CYPA 2PIYA 2YNCC 4L89A 5E96A 2A4NA 4NEXA 4KOUA 3IIBA 1IB1E 4NGRA 5F48A 4R3LA 4JZ0A 2WZNA 2XEFA 3TOAA 4RS2A 3PEIA 3IWGA 2Q7SA 2B5GA 3IGRA 3K9UA 4CAEA 2EVNA 4Q38A 2V8GA 1R3NA 1TF8A 2EUIA 4Y49B 3WC7A 1OBRA 1MK4A 1Y0RA 1GYTA 2V77A 1YW4A 1Y9KA 5C88A 3T90A 3B3CA 1M4LA 2AFMA 3PP9A 4KLVA 1PU9A 1CPSA 4JXQA 3R96A 3PFOA 4E8OA 1S7FA 2OH1A 1P4NA 4AB7A 2BL1A 2HB6A 2ZEPA 4DYOA 2PE3A 4FD6A 4L8AA 2CF4A 4B13A 3SJXA 3N7ZA 3FX6A 3W6SA 3R9GA 4X2TA 5HH1A 3PGPA 3K9TA 4KLWA 1ELMP 3BHXA 5BWAB 1Z5RA 2PJ2A 3D68A 4J3GA 3IU1A 5HVFA 3CT9A 3D2MA 5K8OA 2Z3NA 4E2AA 4A37A 3FEDA 2EBJA 3H8FA 1YLOA 2HUZA 2R7HA 4UFXA 1F2OA 1Q7LA 4P4EA 1OZPA 3DR6A 2GFQA 1HDUA 2BEIA 2GIVA 2RB7A 3RNZA 3WABA 2F7VA 4OMEA 5F09A 4OP4A 2FCKA 3RO0A 4YWYA 5LRGA 2WPWA 2CY2A 1YGHA 5LRJA 4G1PA 5KTCA 4R76A 5KTDA 4FBEA 2G3TA 1KUYA 2GE3A 4MHNA 4MFJA 1QSMA 3FVLA 4FWUA 2PJ8A 2PC1A 4ORFA 1R43A 4NGMA 3VWDA 2PR8A 4P45A 1S60A 3FRMA 3PFEA 3I1UA 5HXDA 3B7IA 3IC1A 1YVOA 4MJ8A 4RN7A 4A30A 4B5PA 2CNTA 5KTAA 3A9LA 1H8LA 2D4OA 5EC4A 4LX9A 2ZEGA 4AVBA 4P6YA 3PB8X 1TXRA 2P6FA 3GYAA 4QC6A 2NYQA 1IGBA 1Z9UA 3C26A 3HUVA 4LUAA 4CGNA 1ON0A 2B3VA 3D8PA 4PK3A 5AGEA 3BLNA 2F5IA 4IHMA 4AG7A 2B58A 3F8KA 4OC0A 4TNUA 1CP6A 3CZXA 3KHZA 5ISVA 3H5ZA 2I00A 4K30A 5EMIA 4MCPA 4NJQA 2AFOA 1M4GA 2B4DB 3PB9X 2BOAA 1V0CA 3NFZA 1M4IA 4Q36A 3KR4A 3WR7A 3IWEA 4KVXA 4R3KA 3NE8A 5JH9A 4PPZA 5CPAA 2WPXA 1BLLE 1Z8TA 5J1QA 4H89A 4CGMA 3JVNA 2QECA 4I49A 3CXSA 3KQZA 2AFZA 4KUBA 4PXCA 3S9MA 3TO7A 2GREA 1CJWA 1HDQA 4Y49C 5A28A 2ZXVA 3EC4A 2ANPA 2YGWA 4MXUA 4MHDA 2AFSA 4C7HA 3BXMA 2ATRA 2CNSA 3KKWA 3KZWA 4NGTA 5AG5A 2EK9A 3EFAA 2XEGA 3DDDA 4U9ZA 2ZEEA 1KUXA 3KR5A 3LWUA 4U9YA 1JQGA 2ZEDA 5C82A 2ARHA 5G21A 4CRZB 2QMLA 1FNOA 2HC9A 2Q51A 3PRTA 2Z3PA 4NJRA 2D4PA 3B3VA 5G1ZA 2GANA 1MJBA 2PDOA 3D7HA 2YNCA 2JLMA 3H8EA 3CPAA 5CBMA 4O23A 1Z4EA 3KI9A 1WWZA 4MHYA 3HLPA 2C1CA 3PB7X 2PJ7A 1YK3A 3FNCA 4OLLA 2RC4A 1IU8A 3BJ7A 2GU2A 1F2PA 4KSIA 3W91A 3DGVA 4R6TA 4A94A 2BUEA 2Z3LA 1J4JA 1YSJA 2Q4ZA 1SQHA 2PJAA 2BO9A 2Q4YA 3D2PA 1Z8XA 2IQ6A 1ZG9A 4NCZA 2J9AA 1S7KA 4LQ6A 4YU9A 4GM5A 3V38A 3B8GA 4OC4A 1XE4A 1Y7EA 2JBJA 2F8HA 1KZFA 3FXTA 3WC6A 5HVGA 1VHSA 1KWMA 3CXPA 4HNWB 4X8IA 4YGOA 1X12A 4PV6A 2QVPA 4EWTA 4KORA 2O4HA 3JUWA 3GLJA 1R57A 2R8VA 3E0KA 2PRBA 3PB6X 4PXDA 3BI1A 5I4MA 4JWPA 3VH9A 2WYRA 1N71A 1M1DA 4HKFA 5J8CA 3IFEA 2DPSA 3MGDA 1BPMA 1NE9A 4NGQA 3R95A 3FH4A 3SXOA 3S6KA 1L0CA 1AUGA 1ARMA 1Y0YA 2NSMA 4KOWA 2VI7A 1QSOA 2HV2A 4XPDC 2PJ6A 4R8FA 4R7MA 2I79A 2PRQA 2V8DA 4E0AA 1NSAA 2VL1A 3KHXA 2P0WA 4XPKA 3QNVA 3JTKA 4M6IA 4UCNA 1LANA 2PVWA 3TOBA 3GUXA 4F9VA 3NA6A 4P44A 5JPHA 4IF5A 3ISXA 4CGLA 4ZBGA 3LACA 5AG4A 4FUUA 1VGYA 1XRYA 1FT7A 2ODFA 4MRIA 4AVAA 1LOKA 1BPNA 3L2NA 1ZO0A 4A31A 1NSLA 4R57A 1ZLHA 4HNXB 4PSWA 1BOBA 4KSFA 3TO9A 2FXFA 3D7FA 3FBUA 4MY0A 4KVOE 3W6XA 4B14A 4NFRA 1QSTA 2OB0A 1IICA 4CGOA 4MFPA 4A2ZA 3LD2A 3IO1A 5DS0A 1TKHA 4ZY1A 4ZX8A 4U5YA 2CXAA 2REEA 2R98A 3D4UA 2Q04A 1Q2DA 4IUSA 4NGSA 4ZYQA 3S6HA 4C68A 1Z4RA 2VXKA 3I9SA 3PZJA 2C6PA 3CDXA 1RO5A 2Q44A 2V8HA 4ZI6A 5LYDA 1RTQA 3B3TA 3RYOA 3TC8A 4PQAA 4UEFA 1Z8LA 2J8NA 3FMCA 4R9MA 2OZHA 3DLJA 5LYIA 4KUAA 1EE3P 4DNCA 5LYLA 2REFA 1ELLP 1IY7A 5D29A 4XPDB 4JXRA 4NGNA 5DWMA 3TO6A 4PK2A 3PBEA 2VZYA 2JEWA 3H8GA 3IJ3A 5AG6A 3IWWA 1DTDA 2IL4A 3BJ8A 3D7GA 4CAFA 1LRZA 2VQYA 1S7NA 2AFWA 2I3CA 2ZPAA 4UCMA 4X5KA 4YRHA 4FD7A 1U6MA 5IX3A 2FT0A 1XJOA 2JBKA 1YW6A 5JM6A 1ZG8A 4C2YA 3NH4A 3R9FA 4ZY0A 4KOTA 2B5GB 4UF4A 1VHEA 3PBBA 1HEEA 1XF8A 4M3SA
chains in the Genus database with same CATH topology
2Z0ZA 3S6FA 4BMHA 1FY7A 4UFWA 2Q4VA 4JLYA 1MJ9A 4EVYA 2FIWA 5J8FA 4OAEA 4FD5A 1YX0A 4UWIA 1MJAA 1B6BA 2DXQA 4H6UA 5AG7A 2FSRA 1YVKA 1IYKA 3DSBA 3EXNA 4C7IA 2B3UA 4MFKA 4QVTA 2PSWA 2FL4A 5F47A 3VWEA 2Q7BA 4RI1A 2PQ8A 4XNHB 4F0YA 5FVJA 5EBVA 5F46A 3OWCA 2HQYA 4PSXA 1Y7RA 4YFJA 1S3ZA 5G22A 2Z11A 3FB3A 4A95A 3UY5A 3EY5A 3F0AA 3ZJ0A 2FS5A 2Q0YA 4R87A 5H84A 2FE7A 4H6ZA 5DWNA 3TCVA 1YR0A 4B5PB 3FYNA 2G3AA 4OADA 4KOYA 2B4DA 2OZGA 4UWJA 3SHPA 1Y9WA 2FIAA 2JDDA 4UBRA 2ZW6A 1QSRA 4NXYA 1XEBA 1NMTA 2P6GA 4CYOA 3R9EA 4KSAA 2OU2A 2Z10A 2VEZA 4CYQA 1S7LA 4MFQA 4B5OA 2ZW5A 4CYNA 5IV0A 5I0CA 4KZTA 2JEVA 1VKCA 1YREA 3I3GA 2Z3OA 3TFYA 4NF1A 5CNPA 5F49A 2X7BA 4MY3A 1K4JA 2AJ6A 3P2FA 3H4QA 1TIQA 1I1DA 2OZUA 3CXQA 4HNYB 1BO4A 5GCNA 2O28A 2VBQA 4QBJA 3ZZIA 3FIXA 3NE7A 4ZGYB 3F5BA 2C27A 3QAHA 4C2XA 2DPTA 2QIRA 3LODA 2K5TA 4KOSA 2ZW4A 1CM0A 4F6AA 4CAXA 3TE4A 2Z3KA 3T9YA 1I21A 2Z3MA 2BSWA 5JQ4A 2YNEA 4B11A 2CNMA 4XPLA 3G3SA 4BBHA 2H5MA 4JJXA 2AE6A 4A32A 1YLEA 3V8IA 4UA3A 1XIXA 4XNHC 4II9A 1QSNA 3DR8A 2P6EA 1UFHA 4AG9A 4KOVA 1I12A 4F0XA 3IU2A 4MI4A 4CGPA 3R1KA 1Q2CA 1RXTA 3DNSA 1B87A 4CRYB 5HMNA 1WK4A 3GKRA 4UFVA 3P2HA 4NSQA 1GHEA 1IIDA 1PUAA 1Q2YA 2NMTA 3S6GA 2YNDA 3SXNA 3GY9A 3TT2A 2J8RA 2VZZA 4KS9A 4CAVA 4QUSA 1IYLA 2Y0MA 1P0HA 2G0BA 4QB9A 4MBUA 1M44A 2WUUA 1S5KA 4M85A 3G8WA 2WSAA 1KUVA 4C2ZA 4CS0B 5IB0A 4FD4A 2PR1A 4KVME 4UCPA 3EO4A 4CAWA 5G20A 3TTHA 5A27A 3QB8A 4MFZA 4A33A 4B10A 4MFLA 4ONUA 2J8MA 1XMTA 2B4BA 3D3SA 2R1IA 5H86A 4AVCA 2ZW7A 4KOXA 1M4DA 4JD6A 4CYPA 2KCWA 4GS4A 2JDCA 4B12A 2YNCC 4L89A 5E96A 2A4NA 4NEXA 4KOUA 1IB1E 5F48A 4R3LA 3TOAA 4RS2A 3IWGA 2B5GA 3IGRA 3K9UA 4CAEA 2EVNA 4Q38A 2EUIA 4Y49B 1MK4A 1Y9KA 5C88A 3T90A 3PP9A 4KLVA 1PU9A 4JXQA 3R96A 4E8OA 1S7FA 2OH1A 1P4NA 4AB7A 2BL1A 4FD6A 4L8AA 4B13A 3N7ZA 3W6SA 3R9GA 5HH1A 3PGPA 4KLWA 5BWAB 4J3GA 3IU1A 3D2MA 2Z3NA 4E2AA 2HUZA 2R7HA 4UFXA 1OZPA 3DR6A 2BEIA 2GIVA 2FCKA 2WPWA 2CY2A 1YGHA 5KTCA 5KTDA 2G3TA 1KUYA 2GE3A 4MFJA 1QSMA 2PC1A 4ORFA 3VWDA 2PR8A 1S60A 3FRMA 1YVOA 4MJ8A 4B5PA 4A30A 2CNTA 5KTAA 3A9LA 2D4OA 5EC4A 4LX9A 4AVBA 3GYAA 2P6FA 4QC6A 1Z9UA 3C26A 4LUAA 4CGNA 1ON0A 2B3VA 3D8PA 4PK3A 5AGEA 3BLNA 2F5IA 4AG7A 2B58A 3F8KA 5ISVA 3H5ZA 2I00A 4K30A 1M4GA 2B4DB 1V0CA 1M4IA 4Q36A 3WR7A 3IWEA 4KVXA 4R3KA 2WPXA 4H89A 4CGMA 3JVNA 2QECA 4I49A 3CXSA 3TO7A 4KUBA 1CJWA 4Y49C 5A28A 2ZXVA 3EC4A 2YGWA 4MHDA 4C7HA 2ATRA 2CNSA 3KKWA 5AG5A 3EFAA 3DDDA 4U9ZA 1KUXA 4U9YA 5C82A 2ARHA 5G21A 4CRZB 2QMLA 2Z3PA 2D4PA 5G1ZA 2GANA 1MJBA 2PDOA 2YNCA 2JLMA 1Z4EA 1WWZA 1YK3A 3FNCA 4OLLA 2RC4A 3BJ7A 3W91A 2BUEA 2Z3LA 1J4JA 1SQHA 2Q4YA 3D2PA 4NCZA 1S7KA 3B8GA 1XE4A 3FXTA 1KZFA 1VHSA 3CXPA 4HNWB 4YGOA 4PV6A 4KORA 3JUWA 1R57A 2R8VA 3E0KA 2PRBA 4JWPA 1N71A 1M1DA 4HKFA 5J8CA 2DPSA 3MGDA 1NE9A 3R95A 3SXOA 3S6KA 1L0CA 4KOWA 2VI7A 1QSOA 2HV2A 4XPDC 2I79A 4E0AA 4XPKA 2P0WA 3JTKA 4UCNA 3TOBA 5JPHA 4IF5A 4CGLA 4ZBGA 5AG4A 4AVAA 4A31A 1ZO0A 1NSLA 4R57A 4HNXB 4PSWA 3TO9A 1BOBA 4KSFA 2FXFA 3FBUA 4MY0A 4KVOE 3W6XA 4B14A 1QSTA 2OB0A 1IICA 4CGOA 4MFPA 4A2ZA 3LD2A 4U5YA 2CXAA 2REEA 2R98A 4IUSA 2Q04A 1Q2DA 3S6HA 4C68A 1Z4RA 2VXKA 3I9SA 3PZJA 1RO5A 2Q44A 3RYOA 2J8NA 4R9MA 2OZHA 4KUAA 4DNCA 2REFA 4XPDB 4JXRA 5DWMA 3TO6A 4PK2A 2VZYA 5AG6A 3BJ8A 2IL4A 4CAFA 1LRZA 2VQYA 1S7NA 4X5KA 2ZPAA 4UCMA 4YRHA 4FD7A 1U6MA 5IX3A 2FT0A 4C2YA 3R9FA 4KOTA 2B5GB 1XF8A 4M3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B11 A;  4C7H A;  4CYP A;  4BBH A;  4B12 A;  4UFW A;  2WUU A;  3H5Z A;  2YNC C;  5AG5 A;  4A32 A;  4A31 A;  2WSA A;  4B13 A;  4UFV A;  4C2Z A;  4CYO A;  5G21 A;  4B14 A;  4CGO A;  5G22 A;  3IWE A;  4A2Z A;  5AG6 A;  4C2X A;  4A95 A;  3IU1 A;  4UCP A;  5G1Z A;  4CAE A;  4CAF A;  4A30 A;  5G20 A;  2YND A;  4UCM A;  5AG7 A;  2YNC A;  3JTK A;  4CYQ A;  4UCN A;  5A27 A;  4CGM A;  4CYN A;  4C2Y A;  4C7I A;  4C68 A;  4A33 A;  4B10 A;  4UFX A;  3IU2 A;  5A28 A;  4CGP A;  4CGL A;  4CGN A;  5AG4 A;  2YNE A;  5AGE A; 
#chains in the Genus database with same CATH topology
 2Z0Z A;  1A2Z A;  2PJB A;  3B2Y A;  1ZG7 A;  3S6F A;  4BMH A;  2PJ0 A;  3SJE A;  1FY7 A;  2EWB A;  4UFW A;  2Q4V A;  3RAM A;  4DJL A;  4JLY A;  3ISZ A;  1MJ9 A;  4EVY A;  4H2K A;  5LRK A;  2PVV A;  2FIW A;  4UIB A;  2AFX A;  5J8F A;  4OAE A;  4FD5 A;  2ZEH A;  1YX0 A;  4UWI A;  3GIU A;  1MJA A;  4Q7A A;  1B6B A;  2DXQ A;  4H6U A;  3MRU A;  5AG7 A;  2FSR A;  1YVK A;  5D8N A;  1IYK A;  3CPX A;  3DSB A;  4ONW A;  1Z2L A;  2ABZ A;  2ZEF A;  3EXN A;  4C7I A;  2B3U A;  4MFK A;  4QVT A;  2PSW A;  3S9L A;  1PCA A;  4P4I A;  2FL4 A;  5F47 A;  3VWE A;  4LQG A;  2Q7B A;  3SJG A;  4RI1 A;  1CPX A;  4MCQ A;  2PQ8 A;  7CPA A;  3SI1 A;  4XNH B;  4F0Y A;  5FVJ A;  2AFU A;  1QMU A;  5EBV A;  2G9D A;  5F46 A;  3OWC A;  2HQY A;  4B6Z A;  4GXH A;  5HVH A;  3RBU A;  1LCP A;  4Z65 A;  1UWY A;  4PSX A;  4IAV A;  1Y7R A;  8CPA A;  3FJU A;  4FAI A;  4YFJ A;  1S3Z A;  5G22 A;  3FEE A;  2Z11 A;  3FB3 A;  4A95 A;  4CPA A;  3UY5 A;  3EY5 A;  3F0A A;  3ZJ0 A;  4JYW A;  4EME A;  2FS5 A;  4OID A;  2Q0Y A;  4OIW A;  4X3R A;  4R87 A;  5ELY A;  5H84 A;  2FE7 A;  4OC3 A;  3NH8 A;  5THW A;  4H6Z A;  5DWN A;  4P10 A;  2PIZ A;  3T8W A;  1YR0 A;  3TCV A;  4B5P B;  2DEA A;  3FYN A;  2G3A A;  4OAD A;  4KOY A;  2B4D A;  2OZG A;  4UWJ A;  4M6G A;  2JDD A;  1Y9W A;  2FIA A;  4MCS A;  4UBR A;  3SHP A;  2ZW6 A;  1PYT B;  1QSR A;  1ARL A;  4UEE A;  4NXY A;  4IK2 A;  4A39 A;  1XEB A;  1XOV A;  1TKJ A;  1NMT A;  2EK8 A;  2IJZ A;  2P6G A;  4CYO A;  3R9E A;  3FF3 A;  4KSA A;  2OU2 A;  3KGQ A;  2Z10 A;  2VEZ A;  4MMO A;  2PJ5 A;  2DF5 A;  3K2K A;  4MCR A;  4CYQ A;  1S7L A;  1XMB A;  4MFQ A;  2ZEN A;  2ZEO A;  4B5O A;  2ZW5 A;  4CYN A;  1TF9 A;  4PXB A;  5IV0 A;  2EO8 A;  5I0C A;  4KZT A;  1Z8W A;  1LAP A;  4MHP A;  2JEV A;  1VKC A;  1YRE A;  3I3G A;  2Z3O A;  4F8Z A;  6CPA A;  3TFY A;  1VIX A;  4NF1 A;  5CNP A;  2O53 A;  1CBX A;  2C6C A;  1F57 A;  2PCU A;  5F49 A;  2GLF A;  2X7B A;  2ZEL A;  3IEH A;  4MY3 A;  1IOF A;  1K4J A;  2AJ6 A;  4MHZ A;  3P2F A;  3H4Q A;  3D7D A;  4UIA A;  1TIQ A;  1TKF A;  1I1D A;  3VAT A;  4BIN A;  2OZU A;  3CXQ A;  4HNY B;  1BO4 A;  5GCN A;  4F9U A;  3B35 A;  2O28 A;  5K8N A;  2VBQ A;  4QBJ A;  3ZZI A;  3FIX A;  3NE7 A;  4ZGY B;  3F5B A;  2ZOF A;  5K8M A;  2C27 A;  1QQ9 A;  3QAH A;  2DPT A;  2QIR A;  3LOD A;  4PXE A;  4C2X A;  2PJ9 A;  2K5T A;  4KOS A;  2ZW4 A;  1CM0 A;  3BI0 A;  4F6A A;  4CAX A;  3TE4 A;  3FEC A;  3D66 A;  4OC1 A;  2IMO A;  2Z3K A;  1ZLI A;  1I21 A;  3T9Y A;  2Z3M A;  2BSW A;  5JQ4 A;  2YNE A;  4TWE A;  4B11 A;  4P4J A;  2CNM A;  4XPL A;  3G3S A;  4BBH A;  2H5M A;  4JJX A;  2XEI A;  2OOT A;  2AE6 A;  4WWV A;  4A32 A;  1YLE A;  3V8I A;  4UA3 A;  1YQE A;  1XIX A;  4XNH C;  3V7Z A;  4II9 A;  1QSN A;  2V8V A;  2PJ4 A;  3DR8 A;  1AMP A;  2P6E A;  1UFH A;  1CG2 A;  4NGP A;  4AG9 A;  4A38 A;  3TX8 A;  4OKO A;  3NH5 A;  4KOV A;  1LFW A;  1I12 A;  2CTB A;  4F0X A;  4AXV A;  4HPS A;  4RUH A;  1LAM A;  3IU2 A;  4MI4 A;  4WJB A;  4ZX9 A;  4CGP A;  3R1K A;  1Q2C A;  1RXT A;  3DNS A;  1XBU A;  4P4D A;  1B87 A;  3PB4 X;  3SI2 A;  4CRY B;  5HMN A;  4M6H A;  4EFD A;  5IB9 A;  1AYE A;  1WK4 A;  2POK A;  2PJC A;  1VHO A;  3SI0 A;  3GKR A;  3KQX A;  4UFV A;  2XEJ A;  3P2H A;  2FVG A;  3D67 A;  4BD9 A;  4NSQ A;  1GHE A;  1IID A;  3KL9 A;  2QJ8 A;  1PUA A;  1Q2Y A;  2NMT A;  3S6G A;  2YND A;  2RFH A;  4OC5 A;  2CIJ A;  2PJ3 A;  4UEZ A;  3SXN A;  3S9N A;  3GY9 A;  3TT2 A;  2J8R A;  2PJ1 A;  3QAY A;  2C6G A;  3VAR A;  2VZZ A;  4KS9 A;  4CAV A;  1DE4 C;  4QUS A;  1IYL A;  2GLJ A;  2Y0M A;  1P0H A;  2BCO A;  3B3S A;  2G0B A;  4DUK A;  4ZY2 A;  4QB9 A;  2QYV A;  1M44 A;  4MBU A;  2WUU A;  5JGF A;  1JWQ A;  1S5K A;  3G8W A;  1CP7 A;  4M85 A;  2WSA A;  1KUV A;  3MN8 A;  4C2Z A;  1CX8 A;  4CS0 B;  3N5F A;  5IB0 A;  3SJF A;  4OC2 A;  4K3N A;  3B3W A;  2ZEM A;  2ZOG A;  4FD4 A;  4P4F A;  3JRU A;  1IOI A;  1X10 A;  2PR1 A;  5LYF A;  4KVM E;  4UCP A;  3EO4 A;  4CAW A;  3GB0 A;  5G20 A;  3WT4 A;  3TTH A;  5A27 A;  3QB8 A;  2Q43 A;  3KAS A;  3RZA A;  4MFZ A;  4A33 A;  3LMS A;  1YME A;  4MFL A;  4B10 A;  4W9Y A;  4ONU A;  1XFO A;  2J8M A;  2OR4 A;  1XMT A;  2B4B A;  3D3S A;  4P4B A;  5K8P A;  2R1I A;  5H86 A;  3WC5 A;  4AVC A;  2ZW7 A;  4KOX A;  1M4D A;  1BAV A;  4JD6 A;  2KCW A;  4GS4 A;  2JDC A;  2CTC A;  4B12 A;  4CYP A;  2PIY A;  2YNC C;  4L89 A;  5E96 A;  2A4N A;  4NEX A;  4KOU A;  3IIB A;  1IB1 E;  4NGR A;  5F48 A;  4R3L A;  4JZ0 A;  2WZN A;  2XEF A;  3TOA A;  4RS2 A;  3PEI A;  3IWG A;  2Q7S A;  2B5G A;  3IGR A;  3K9U A;  4CAE A;  2EVN A;  4Q38 A;  2V8G A;  1R3N A;  1TF8 A;  2EUI A;  4Y49 B;  3WC7 A;  1OBR A;  1MK4 A;  1Y0R A;  1GYT A;  2V77 A;  1YW4 A;  1Y9K A;  5C88 A;  3T90 A;  3B3C A;  1M4L A;  2AFM A;  3PP9 A;  4KLV A;  1PU9 A;  1CPS A;  4JXQ A;  3R96 A;  3PFO A;  4E8O A;  1S7F A;  2OH1 A;  1P4N A;  4AB7 A;  2BL1 A;  2HB6 A;  2ZEP A;  4DYO A;  2PE3 A;  4FD6 A;  4L8A A;  2CF4 A;  4B13 A;  3SJX A;  3N7Z A;  3FX6 A;  3W6S A;  3R9G A;  4X2T A;  5HH1 A;  3PGP A;  3K9T A;  4KLW A;  1ELM P;  3BHX A;  5BWA B;  1Z5R A;  2PJ2 A;  3D68 A;  4J3G A;  3IU1 A;  5HVF A;  3CT9 A;  3D2M A;  5K8O A;  2Z3N A;  4E2A A;  4A37 A;  3FED A;  2EBJ A;  3H8F A;  1YLO A;  2HUZ A;  2R7H A;  4UFX A;  1F2O A;  1Q7L A;  4P4E A;  1OZP A;  3DR6 A;  2GFQ A;  1HDU A;  2BEI A;  2GIV A;  2RB7 A;  3RNZ A;  3WAB A;  2F7V A;  4OME A;  5F09 A;  4OP4 A;  2FCK A;  3RO0 A;  4YWY A;  5LRG A;  2WPW A;  2CY2 A;  1YGH A;  5LRJ A;  4G1P A;  5KTC A;  4R76 A;  5KTD A;  4FBE A;  2G3T A;  1KUY A;  2GE3 A;  4MHN A;  4MFJ A;  1QSM A;  3FVL A;  4FWU A;  2PJ8 A;  2PC1 A;  4ORF A;  1R43 A;  4NGM A;  3VWD A;  2PR8 A;  4P45 A;  1S60 A;  3FRM A;  3PFE A;  3I1U A;  5HXD A;  3B7I A;  3IC1 A;  1YVO A;  4MJ8 A;  4RN7 A;  4A30 A;  4B5P A;  2CNT A;  5KTA A;  3A9L A;  1H8L A;  2D4O A;  5EC4 A;  4LX9 A;  2ZEG A;  4AVB A;  4P6Y A;  3PB8 X;  1TXR A;  2P6F A;  3GYA A;  4QC6 A;  2NYQ A;  1IGB A;  1Z9U A;  3C26 A;  3HUV A;  4LUA A;  4CGN A;  1ON0 A;  2B3V A;  3D8P A;  4PK3 A;  5AGE A;  3BLN A;  2F5I A;  4IHM A;  4AG7 A;  2B58 A;  3F8K A;  4OC0 A;  4TNU A;  1CP6 A;  3CZX A;  3KHZ A;  5ISV A;  3H5Z A;  2I00 A;  4K30 A;  5EMI A;  4MCP A;  4NJQ A;  2AFO A;  1M4G A;  2B4D B;  3PB9 X;  2BOA A;  1V0C A;  3NFZ A;  1M4I A;  4Q36 A;  3KR4 A;  3WR7 A;  3IWE A;  4KVX A;  4R3K A;  3NE8 A;  5JH9 A;  4PPZ A;  5CPA A;  2WPX A;  1BLL E;  1Z8T A;  5J1Q A;  4H89 A;  4CGM A;  3JVN A;  2QEC A;  4I49 A;  3CXS A;  3KQZ A;  2AFZ A;  4KUB A;  4PXC A;  3S9M A;  3TO7 A;  2GRE A;  1CJW A;  1HDQ A;  4Y49 C;  5A28 A;  2ZXV A;  3EC4 A;  2ANP A;  2YGW A;  4MXU A;  4MHD A;  2AFS A;  4C7H A;  3BXM A;  2ATR A;  2CNS A;  3KKW A;  3KZW A;  4NGT A;  5AG5 A;  2EK9 A;  3EFA A;  2XEG A;  3DDD A;  4U9Z A;  2ZEE A;  1KUX A;  3KR5 A;  3LWU A;  4U9Y A;  1JQG A;  2ZED A;  5C82 A;  2ARH A;  5G21 A;  4CRZ B;  2QML A;  1FNO A;  2HC9 A;  2Q51 A;  3PRT A;  2Z3P A;  4NJR A;  2D4P A;  3B3V A;  5G1Z A;  2GAN A;  1MJB A;  2PDO A;  3D7H A;  2YNC A;  2JLM A;  3H8E A;  3CPA A;  5CBM A;  4O23 A;  1Z4E A;  3KI9 A;  1WWZ A;  4MHY A;  3HLP A;  2C1C A;  3PB7 X;  2PJ7 A;  1YK3 A;  3FNC A;  4OLL A;  2RC4 A;  1IU8 A;  3BJ7 A;  2GU2 A;  1F2P A;  4KSI A;  3W91 A;  3DGV A;  4R6T A;  4A94 A;  2BUE A;  2Z3L A;  1J4J A;  1YSJ A;  2Q4Z A;  1SQH A;  2PJA A;  2BO9 A;  2Q4Y A;  3D2P A;  1Z8X A;  2IQ6 A;  1ZG9 A;  4NCZ A;  2J9A A;  1S7K A;  4LQ6 A;  4YU9 A;  4GM5 A;  3V38 A;  3B8G A;  4OC4 A;  1XE4 A;  1Y7E A;  2JBJ A;  2F8H A;  1KZF A;  3FXT A;  3WC6 A;  5HVG A;  1VHS A;  1KWM A;  3CXP A;  4HNW B;  4X8I A;  4YGO A;  1X12 A;  4PV6 A;  2QVP A;  4EWT A;  4KOR A;  2O4H A;  3JUW A;  3GLJ A;  1R57 A;  2R8V A;  3E0K A;  2PRB A;  3PB6 X;  4PXD A;  3BI1 A;  5I4M A;  4JWP A;  3VH9 A;  2WYR A;  1N71 A;  1M1D A;  4HKF A;  5J8C A;  3IFE A;  2DPS A;  3MGD A;  1BPM A;  1NE9 A;  4NGQ A;  3R95 A;  3FH4 A;  3SXO A;  3S6K A;  1L0C A;  1AUG A;  1ARM A;  1Y0Y A;  2NSM A;  4KOW A;  2VI7 A;  1QSO A;  2HV2 A;  4XPD C;  2PJ6 A;  4R8F A;  4R7M A;  2I79 A;  2PRQ A;  2V8D A;  4E0A A;  1NSA A;  2VL1 A;  3KHX A;  2P0W A;  4XPK A;  3QNV A;  3JTK A;  4M6I A;  4UCN A;  1LAN A;  2PVW A;  3TOB A;  3GUX A;  4F9V A;  3NA6 A;  4P44 A;  5JPH A;  4IF5 A;  3ISX A;  4CGL A;  4ZBG A;  3LAC A;  5AG4 A;  4FUU A;  1VGY A;  1XRY A;  1FT7 A;  2ODF A;  4MRI A;  4AVA A;  1LOK A;  1BPN A;  3L2N A;  1ZO0 A;  4A31 A;  1NSL A;  4R57 A;  1ZLH A;  4HNX B;  4PSW A;  1BOB A;  4KSF A;  3TO9 A;  2FXF A;  3D7F A;  3FBU A;  4MY0 A;  4KVO E;  3W6X A;  4B14 A;  4NFR A;  1QST A;  2OB0 A;  1IIC A;  4CGO A;  4MFP A;  4A2Z A;  3LD2 A;  3IO1 A;  5DS0 A;  1TKH A;  4ZY1 A;  4ZX8 A;  4U5Y A;  2CXA A;  2REE A;  2R98 A;  3D4U A;  2Q04 A;  1Q2D A;  4IUS A;  4NGS A;  4ZYQ A;  3S6H A;  4C68 A;  1Z4R A;  2VXK A;  3I9S A;  3PZJ A;  2C6P A;  3CDX A;  1RO5 A;  2Q44 A;  2V8H A;  4ZI6 A;  5LYD A;  1RTQ A;  3B3T A;  3RYO A;  3TC8 A;  4PQA A;  4UEF A;  1Z8L A;  2J8N A;  3FMC A;  4R9M A;  2OZH A;  3DLJ A;  5LYI A;  4KUA A;  1EE3 P;  4DNC A;  5LYL A;  2REF A;  1ELL P;  1IY7 A;  5D29 A;  4XPD B;  4JXR A;  4NGN A;  5DWM A;  3TO6 A;  4PK2 A;  3PBE A;  2VZY A;  2JEW A;  3H8G A;  3IJ3 A;  5AG6 A;  3IWW A;  1DTD A;  2IL4 A;  3BJ8 A;  3D7G A;  4CAF A;  1LRZ A;  2VQY A;  1S7N A;  2AFW A;  2I3C A;  2ZPA A;  4UCM A;  4X5K A;  4YRH A;  4FD7 A;  1U6M A;  5IX3 A;  2FT0 A;  1XJO A;  2JBK A;  1YW6 A;  5JM6 A;  1ZG8 A;  4C2Y A;  3NH4 A;  3R9F A;  4ZY0 A;  4KOT A;  2B5G B;  4UF4 A;  1VHE A;  3PBB A;  1HEE A;  1XF8 A;  4M3S A; 
#chains in the Genus database with same CATH homology
 2Z0Z A;  3S6F A;  4BMH A;  1FY7 A;  4UFW A;  2Q4V A;  4JLY A;  1MJ9 A;  4EVY A;  2FIW A;  5J8F A;  4OAE A;  4FD5 A;  1YX0 A;  4UWI A;  1MJA A;  1B6B A;  2DXQ A;  4H6U A;  5AG7 A;  2FSR A;  1YVK A;  1IYK A;  3DSB A;  3EXN A;  4C7I A;  2B3U A;  4MFK A;  4QVT A;  2PSW A;  2FL4 A;  5F47 A;  3VWE A;  2Q7B A;  4RI1 A;  2PQ8 A;  4XNH B;  4F0Y A;  5FVJ A;  5EBV A;  5F46 A;  3OWC A;  2HQY A;  4PSX A;  1Y7R A;  4YFJ A;  1S3Z A;  5G22 A;  2Z11 A;  3FB3 A;  4A95 A;  3UY5 A;  3EY5 A;  3F0A A;  3ZJ0 A;  2FS5 A;  2Q0Y A;  4R87 A;  5H84 A;  2FE7 A;  4H6Z A;  5DWN A;  3TCV A;  1YR0 A;  4B5P B;  3FYN A;  2G3A A;  4OAD A;  4KOY A;  2B4D A;  2OZG A;  4UWJ A;  3SHP A;  1Y9W A;  2FIA A;  2JDD A;  4UBR A;  2ZW6 A;  1QSR A;  4NXY A;  1XEB A;  1NMT A;  2P6G A;  4CYO A;  3R9E A;  4KSA A;  2OU2 A;  2Z10 A;  2VEZ A;  4CYQ A;  1S7L A;  4MFQ A;  4B5O A;  2ZW5 A;  4CYN A;  5IV0 A;  5I0C A;  4KZT A;  2JEV A;  1VKC A;  1YRE A;  3I3G A;  2Z3O A;  3TFY A;  4NF1 A;  5CNP A;  5F49 A;  2X7B A;  4MY3 A;  1K4J A;  2AJ6 A;  3P2F A;  3H4Q A;  1TIQ A;  1I1D A;  2OZU A;  3CXQ A;  4HNY B;  1BO4 A;  5GCN A;  2O28 A;  2VBQ A;  4QBJ A;  3ZZI A;  3FIX A;  3NE7 A;  4ZGY B;  3F5B A;  2C27 A;  3QAH A;  4C2X A;  2DPT A;  2QIR A;  3LOD A;  2K5T A;  4KOS A;  2ZW4 A;  1CM0 A;  4F6A A;  4CAX A;  3TE4 A;  2Z3K A;  3T9Y A;  1I21 A;  2Z3M A;  2BSW A;  5JQ4 A;  2YNE A;  4B11 A;  2CNM A;  4XPL A;  3G3S A;  4BBH A;  2H5M A;  4JJX A;  2AE6 A;  4A32 A;  1YLE A;  3V8I A;  4UA3 A;  1XIX A;  4XNH C;  4II9 A;  1QSN A;  3DR8 A;  2P6E A;  1UFH A;  4AG9 A;  4KOV A;  1I12 A;  4F0X A;  3IU2 A;  4MI4 A;  4CGP A;  3R1K A;  1Q2C A;  1RXT A;  3DNS A;  1B87 A;  4CRY B;  5HMN A;  1WK4 A;  3GKR A;  4UFV A;  3P2H A;  4NSQ A;  1GHE A;  1IID A;  1PUA A;  1Q2Y A;  2NMT A;  3S6G A;  2YND A;  3SXN A;  3GY9 A;  3TT2 A;  2J8R A;  2VZZ A;  4KS9 A;  4CAV A;  4QUS A;  1IYL A;  2Y0M A;  1P0H A;  2G0B A;  4QB9 A;  4MBU A;  1M44 A;  2WUU A;  1S5K A;  4M85 A;  3G8W A;  2WSA A;  1KUV A;  4C2Z A;  4CS0 B;  5IB0 A;  4FD4 A;  2PR1 A;  4KVM E;  4UCP A;  3EO4 A;  4CAW A;  5G20 A;  3TTH A;  5A27 A;  3QB8 A;  4MFZ A;  4A33 A;  4B10 A;  4MFL A;  4ONU A;  2J8M A;  1XMT A;  2B4B A;  3D3S A;  2R1I A;  5H86 A;  4AVC A;  2ZW7 A;  4KOX A;  1M4D A;  4JD6 A;  4CYP A;  2KCW A;  4GS4 A;  2JDC A;  4B12 A;  2YNC C;  4L89 A;  5E96 A;  2A4N A;  4NEX A;  4KOU A;  1IB1 E;  5F48 A;  4R3L A;  3TOA A;  4RS2 A;  3IWG A;  2B5G A;  3IGR A;  3K9U A;  4CAE A;  2EVN A;  4Q38 A;  2EUI A;  4Y49 B;  1MK4 A;  1Y9K A;  5C88 A;  3T90 A;  3PP9 A;  4KLV A;  1PU9 A;  4JXQ A;  3R96 A;  4E8O A;  1S7F A;  2OH1 A;  1P4N A;  4AB7 A;  2BL1 A;  4FD6 A;  4L8A A;  4B13 A;  3N7Z A;  3W6S A;  3R9G A;  5HH1 A;  3PGP A;  4KLW A;  5BWA B;  4J3G A;  3IU1 A;  3D2M A;  2Z3N A;  4E2A A;  2HUZ A;  2R7H A;  4UFX A;  1OZP A;  3DR6 A;  2BEI A;  2GIV A;  2FCK A;  2WPW A;  2CY2 A;  1YGH A;  5KTC A;  5KTD A;  2G3T A;  1KUY A;  2GE3 A;  4MFJ A;  1QSM A;  2PC1 A;  4ORF A;  3VWD A;  2PR8 A;  1S60 A;  3FRM A;  1YVO A;  4MJ8 A;  4B5P A;  4A30 A;  2CNT A;  5KTA A;  3A9L A;  2D4O A;  5EC4 A;  4LX9 A;  4AVB A;  3GYA A;  2P6F A;  4QC6 A;  1Z9U A;  3C26 A;  4LUA A;  4CGN A;  1ON0 A;  2B3V A;  3D8P A;  4PK3 A;  5AGE A;  3BLN A;  2F5I A;  4AG7 A;  2B58 A;  3F8K A;  5ISV A;  3H5Z A;  2I00 A;  4K30 A;  1M4G A;  2B4D B;  1V0C A;  1M4I A;  4Q36 A;  3WR7 A;  3IWE A;  4KVX A;  4R3K A;  2WPX A;  4H89 A;  4CGM A;  3JVN A;  2QEC A;  4I49 A;  3CXS A;  3TO7 A;  4KUB A;  1CJW A;  4Y49 C;  5A28 A;  2ZXV A;  3EC4 A;  2YGW A;  4MHD A;  4C7H A;  2ATR A;  2CNS A;  3KKW A;  5AG5 A;  3EFA A;  3DDD A;  4U9Z A;  1KUX A;  4U9Y A;  5C82 A;  2ARH A;  5G21 A;  4CRZ B;  2QML A;  2Z3P A;  2D4P A;  5G1Z A;  2GAN A;  1MJB A;  2PDO A;  2YNC A;  2JLM A;  1Z4E A;  1WWZ A;  1YK3 A;  3FNC A;  4OLL A;  2RC4 A;  3BJ7 A;  3W91 A;  2BUE A;  2Z3L A;  1J4J A;  1SQH A;  2Q4Y A;  3D2P A;  4NCZ A;  1S7K A;  3B8G A;  1XE4 A;  3FXT A;  1KZF A;  1VHS A;  3CXP A;  4HNW B;  4YGO A;  4PV6 A;  4KOR A;  3JUW A;  1R57 A;  2R8V A;  3E0K A;  2PRB A;  4JWP A;  1N71 A;  1M1D A;  4HKF A;  5J8C A;  2DPS A;  3MGD A;  1NE9 A;  3R95 A;  3SXO A;  3S6K A;  1L0C A;  4KOW A;  2VI7 A;  1QSO A;  2HV2 A;  4XPD C;  2I79 A;  4E0A A;  4XPK A;  2P0W A;  3JTK A;  4UCN A;  3TOB A;  5JPH A;  4IF5 A;  4CGL A;  4ZBG A;  5AG4 A;  4AVA A;  4A31 A;  1ZO0 A;  1NSL A;  4R57 A;  4HNX B;  4PSW A;  3TO9 A;  1BOB A;  4KSF A;  2FXF A;  3FBU A;  4MY0 A;  4KVO E;  3W6X A;  4B14 A;  1QST A;  2OB0 A;  1IIC A;  4CGO A;  4MFP A;  4A2Z A;  3LD2 A;  4U5Y A;  2CXA A;  2REE A;  2R98 A;  4IUS A;  2Q04 A;  1Q2D A;  3S6H A;  4C68 A;  1Z4R A;  2VXK A;  3I9S A;  3PZJ A;  1RO5 A;  2Q44 A;  3RYO A;  2J8N A;  4R9M A;  2OZH A;  4KUA A;  4DNC A;  2REF A;  4XPD B;  4JXR A;  5DWM A;  3TO6 A;  4PK2 A;  2VZY A;  5AG6 A;  3BJ8 A;  2IL4 A;  4CAF A;  1LRZ A;  2VQY A;  1S7N A;  4X5K A;  2ZPA A;  4UCM A;  4YRH A;  4FD7 A;  1U6M A;  5IX3 A;  2FT0 A;  4C2Y A;  3R9F A;  4KOT A;  2B5G B;  1XF8 A;  4M3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...