4B10A

Plasmodium vivax n-myristoyltransferase with a non-hydrolysable co- factor
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design and Synthesis of Inhibitors of Plasmodium Falciparum N-Myristoyltransferase, a Promising Target for Anti-Malarial Drug Discovery.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 119
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4b10A00
2WUUA 4CYPA 4CYNA 4CGLA 5G22A 2YNEA 5G1ZA 3IU2A 5G20A 4B13A 2YNCA 2YNDA 5AG4A 4UCMA 4A95A 2WSAA 5AG6A 4B10A 3H5ZA 5A27A 2YNCC 4C7HA 4A33A 5AG7A 4UFXA 4A32A 4CGNA 3JTKA 4C7IA 4A2ZA 4CAEA 4A31A 4C2YA 3IU1A 4CAFA 4CYOA 5AG5A 4CGOA 4CYQA 4UFVA 4CGMA 4CGPA 4A30A 4C2ZA 4B14A 4C68A 5G21A 4B11A 4B12A 4C2XA 5AGEA 4UCPA 4BBHA 4UCNA 3IWEA 4UFWA 5A28A
chains in the Genus database with same CATH superfamily
2DF5A 4IAVA 1Z8TA 2FXFA 2Q4ZA 3GYAA 4NGQA 5CPAA 2ANPA 3TO7A 2YNCA 3FX6A 2R1IA 3R96A 1Z9UA 4PXEA 5IX3A 3TE4A 4MHDA 2EBJA 1ELMP 2P0WA 1KWMA 2PJ5A 4MY0A 4A32A 2G9DA 3R1KA 2ABZA 3E0KA 1ELLP 1VHOA 3FNCA 3NH4A 8CPAA 1YVOA 2FIAA 3TX8A 4CRYB 1OZPA 5FVJA 3D7HA 3B3CA 3SI2A 1I21A 1Q2CA 3SJEA 4EFDA 5F09A 1YLOA 2ZXVA 1NMTA 4E8OA 1BOBA 1ZLIA 3BI0A 2NYQA 4CRZB 1XF8A 2ZW7A 2DXQA 5JQ4A 2P6EA 1R43A 2ZEOA 4FD5A 4MJ8A 4KVOE 3JRUA 1XBUA 1Y7EA 2GIVA 1XMBA 2D4OA 2ZELA 4MHYA 4QVTA 4B5PB 3K9TA 4AXVA 5A27A 5HXDA 1IGBA 2YNCC 5HVHA 1MJAA 1CBXA 1Z2LA 2PJ4A 2PJ3A 3ZJ0A 2WZNA 3NH8A 5AG7A 4PSWA 2FIWA 2O4HA 2PJ1A 5K8MA 3WR7A 1RO5A 4A2ZA 4WWVA 3F5BA 3L2NA 7CPAA 3SI1A 1ZG8A 4UEZA 1ARLA 3B3SA 3RNZA 2IMOA 3GKRA 4PK2A 3TO9A 2FSRA 2DPTA 3D66A 1IU8A 5DS0A 4B12A 2QYVA 2IQ6A 1TKJA 2BL1A 2O28A 4FWUA 4PPZA 5IV0A 4JJXA 5LRKA 4BINA 5K8OA 5A28A 2K5TA 3B2YA 5I4MA 5J8FA 4OAEA 1IB1E 3VH9A 1CP7A 1HDQA 3TOAA 2WPXA 1M1DA 3R9EA 3IU2A 1IOIA 4E2AA 4LUAA 1ZLHA 4C7HA 1NSLA 4OC2A 2AFMA 2V8DA 4DNCA 4KOTA 4C2YA 2CTCA 3EY5A 3KGQA 1TF8A 2F7VA 4HNWB 4ONWA 4XNHB 5LYDA 1S7FA 1ZG9A 2G3AA 1PUAA 4B14A 2BUEA 3H8FA 4ZGYB 4C68A 4NJQA 1YR0A 2Z3NA 2J8MA 4HNXB 3FIXA 4AB7A 3NE7A 3V8IA 1A2ZA 2Q43A 5BWAB 2C1CA 3CDXA 2YNEA 4H89A 3TCVA 3FECA 2AFOA 2F8HA 3KKWA 2Z10A 3V38A 1Z8LA 2B58A 4F0XA 1BPNA 3WT4A 4AVCA 3IJ3A 3FB3A 4ZY2A 4M6GA 2C27A 2REEA 3SXNA 3QAHA 3OWCA 1KUVA 4FD4A 2B4DA 1TKHA 2PE3A 3D3SA 4UFVA 3S9MA 4MMOA 4JXRA 5F48A 5HMNA 4MCSA 4AVBA 1ON0A 3CT9A 4KOWA 2FS5A 2DEAA 3EFAA 2HQYA 1F2OA 4NGTA 4OLLA 4R8FA 4F9UA 4LQGA 1HDUA 5KTDA 4LX9A 3N7ZA 3RAMA 3SI0A 2BOAA 4RI1A 3D67A 2PJ8A 1ZO0A 4FUUA 2QMLA 5AG4A 2VXKA 4KUBA 2GLJA 5JH9A 5KTCA 2CTBA 5K8PA 3B7IA 1KUXA 4R7MA 4AG7A 2B3VA 4Q7AA 2I3CA 1VIXA 2Q04A 1PCAA 4MI4A 2OB0A 4ZI6A 1JWQA 2C6PA 3DDDA 4OP4A 1H8LA 2Q4VA 4P4DA 4MHPA 1BAVA 4CAFA 5D8NA 4RUHA 1XE4A 2ZW5A 2BCOA 5E96A 3PFOA 2PSWA 4UWIA 3VWDA 4CAVA 4C2XA 2ZEGA 4NJRA 3H4QA 4MCRA 1Z5RA 5AGEA 4UCNA 1L0CA 1DE4C 3IWWA 4UF4A 3P2FA 1ZG7A 2WUUA 2AE6A 2ZEPA 1VGYA 3SJGA 4DJLA 1CPSA 5G22A 2WPWA 3KZWA 4R9MA 4XPDB 5G20A 4JLYA 2AFUA 4MFJA 2X7BA 2EK8A 1YMEA 4MFZA 4UEEA 1PU9A 4ZX9A 2Q51A 3LWUA 3R9GA 1Q2DA 4GM5A 4RN7A 4TWEA 3ZZIA 5EBVA 3S9NA 1K4JA 1XRYA 4A94A 2BSWA 3WC5A 2PIZA 2PJBA 2PJAA 3TO6A 1S5KA 2VBQA 3IFEA 4P4FA 4UA3A 4C2ZA 2JDCA 3HLPA 4PXDA 4H6ZA 2VEZA 2VQYA 3FVLA 4A38A 3FEDA 3D2MA 1Y0YA 1LCPA 3KR5A 4M6HA 4OMEA 2B5GA 4OC4A 1S7LA 3GUXA 2XEJA 3S6FA 2PCUA 4R6TA 4U9YA 3KI9A 4X2TA 3F0AA 4B10A 2EO8A 3EO4A 3RO0A 2IJZA 1XOVA 2CIJA 1FT7A 3A9LA 3CPAA 3FXTA 5F47A 5GCNA 1VHEA 3I3GA 4NEXA 4YU9A 2VL1A 3TC8A 1IOFA 3KHZA 4II9A 2WYRA 4ZBGA 4CGMA 3HUVA 4ZY0A 2F5IA 4JZ0A 4KSIA 4P44A 2I00A 1P4NA 1LRZA 4P10A 5IB0A 2VZYA 1IYKA 2Z3OA 3QB8A 2ZEEA 4CYPA 4UIBA 5I0CA 4CGLA 4X5KA 3BLNA 2IL4A 2AFXA 2OZUA 3H8EA 3MN8A 3NH5A 4PXBA 4B6ZA 4AG9A 2AFWA 5F46A 4A95A 1CM0A 4KS9A 4UBRA 3F8KA 4G1PA 3KHXA 5ISVA 3FJUA 4X3RA 1JQGA 4UWJA 5HVFA 2PRQA 4PK3A 1XIXA 4A33A 1YLEA 1B87A 4H6UA 2ZEFA 3IC1A 4XPKA 1CX8A 5KTAA 3IWGA 3D2PA 1M4DA 1CPXA 1CP6A 1SQHA 4A39A 2FVGA 3FRMA 2Z3PA 3G3SA 1UFHA 3KASA 5AG5A 1GYTA 1YREA 2AJ6A 3FEEA 2R7HA 3TFYA 3DGVA 4KZTA 5DWMA 2JLMA 1XJOA 3PBEA 4BBHA 4IK2A 4C7IA 2PJ7A 3PB4X 4A37A 3PB8X 4Q36A 2Z11A 4CAXA 4B5OA 2ARHA 1X12A 3QAYA 4NCZA 1PYTB 4F8ZA 3BJ8A 1U6MA 4FD7A 2ZOGA 4PSXA 4B13A 5K8NA 1J4JA 5THWA 1UWYA 2WSAA 5AG6A 5LYLA 4MFQA 4DUKA 1BLLE 1S7KA 1AMPA 1S60A 1LFWA 3SJFA 2CF4A 2ZEDA 3CXQA 5HVGA 3ISZA 1M4IA 3PBBA 4A31A 2QIRA 2G0BA 1YK3A 4IUSA 4UIAA 4O23A 4CYOA 4CYQA 1MK4A 1DTDA 4U9ZA 1F2PA 4P4JA 4ZY1A 1IIDA 3T9YA 1IYLA 2BO9A 2CXAA 2YGWA 1QSRA 2PVVA 3I9SA 3KL9A 2B3UA 2ZW4A 4UFWA 4UCPA 2C6GA 3H8GA 2PRBA 3K9UA 3GIUA 1QSOA 3PZJA 2R98A 3B3VA 2Z3KA 1Z8XA 3BXMA 2PR8A 3R9FA 2V77A 2B4BA 3RBUA 1OBRA 2FCKA 3IGRA 4P4IA 4BD9A 4KLWA 2QVPA 1QSMA 1KUYA 1NE9A 1FNOA 2PJ0A 2RC4A 2J8NA 4TNUA 3IO1A 2EK9A 3WABA 1LOKA 1WWZA 3UY5A 1GHEA 1CJWA 4NGPA 3RYOA 1TIQA 4CGPA 4OIWA 4YRHA 2D4PA 3R95A 2G3TA 4EMEA 4EVYA 1I12A 4IF5A 1TXRA 4K30A 4P4BA 2PJ2A 4MRIA 2CNSA 4QBJA 1V0CA 3CZXA 2CNMA 2Z3LA 3NE8A 5H84A 3RZAA 2JBJA 4R3KA 1YW6A 4QB9A 2YNDA 2FL4A 2JEWA 2P6FA 4DYOA 4E0AA 2HV2A 1XFOA 2I79A 5LRGA 5J1QA 3S6GA 4CGNA 5IB9A 3VWEA 2Q7BA 1AYEA 2JEVA 2CY2A 1YVKA 3BI1A 5C82A 4OADA 1M4GA 2ATRA 3LMSA 1X10A 2POKA 4PV6A 4JXQA 2Q7SA 3NFZA 5G21A 4JD6A 4B11A 1Y9WA 3EC4A 3G8WA 4KSAA 3S6KA 3B3TA 3NA6A 4KVME 3BJ7A 3W91A 2ZOFA 3D4UA 5JGFA 3GB0A 3D8PA 1R3NA 3W6XA 2PJ9A 1QMUA 4ORFA 4KSFA 4OC3A 3QNVA 5G1ZA 4YWYA 3PFEA 4U5YA 2PVWA 3CXPA 6CPAA 5D29A 2QECA 1XMTA 4Y49B 3BHXA 4K3NA 4JWPA 2J9AA 3W6SA 4KVXA 4RS2A 2PR1A 4ONUA 4YGOA 2HB6A 3C26A 1Y9KA 2XEFA 2KCWA 4UFXA 3MRUA 1P0HA 3FF3A 3IEHA 4CS0B 2RFHA 4HPSA 4QC6A 4CAEA 4NGRA 4F0YA 1QSTA 4MY3A 3S6HA 2FE7A 2ODFA 4KORA 4CGOA 2H5MA 4M85A 1VKCA 3KR4A 4P45A 1MJ9A 2Q0YA 2Q4YA 3JUWA 2REFA 5J8CA 4KUAA 4F9VA 4CYNA 4WJBA 3IIBA 4M6IA 4F6AA 1QSNA 1WK4A 2R8VA 4NXYA 3S9LA 4QUSA 2GU2A 2Z0ZA 2NMTA 2OH1A 2GANA 1Q7LA 5CNPA 1YGHA 2V8VA 2V8HA 2DPSA 3LD2A 2XEIA 4MFPA 2NSMA 4LQ6A 4KOXA 4NGNA 4Q38A 1RXTA 1EE3P 2B5GB 4XNHC 3FH4A 1M44A 2RB7A 3SXOA 1BPMA 1Y7RA 5LYIA 1ARMA 2BEIA 1YSJA 4PXCA 2PDOA 3B8GA 4KOUA 2PJCA 1QQ9A 4L89A 3ISXA 4GS4A 1I1DA 2OZGA 2PIYA 1Z4RA 3DR8A 3K2KA 3PP9A 5JPHA 4MHNA 4BMHA 2C6CA 1TKFA 2ZPAA 3TT2A 1F57A 4OKOA 3FMCA 3KQXA 3PB9X 2VI7A 2Q44A 3PRTA 1TF9A 3DLJA 4IHMA 3GLJA 4MFKA 5ELYA 1N71A 4B5PA 3MGDA 5LRJA 3EXNA 3DNSA 4KOSA 3VARA 4CAWA 2QJ8A 3D7DA 1LAPA 3SJXA 3N5FA 1HEEA 3B3WA 1BO4A 4GXHA 2HC9A 5HH1A 2GREA 4J3GA 3V7ZA 1NSAA 2EWBA 2V8GA 2EVNA 2ZEMA 4M3SA 3T90A 1VHSA 2O53A 3WC6A 3B35A 3I1UA 2PQ8A 3VATA 3TOBA 4ZYQA 3FYNA 1RTQA 4AVAA 3PEIA 4P6YA 2JBKA 1LANA 4Z65A 2P6GA 4HNYB 2JDDA 2GLFA 2XEGA 4KLVA 3JVNA 4OC1A 2OR4A 1B6BA 4CPAA 4NGSA 4UCMA 3PB7X 4R3LA 1IY7A 3DR6A 2PJ6A 5H86A 4PQAA 4FD6A 4OIDA 1KZFA 4UEFA 1M4LA 5EMIA 3PGPA 2Z3MA 4OC5A 4W9YA 1R57A 4I49A 3LODA 4EWTA 2EUIA 3JTKA 4XPLA 1Q2YA 3LACA 2OOTA 4KOYA 3SHPA 4YFJA 1CG2A 3IU1A 1AUGA 2ZW6A 3TTHA 5JM6A 2OU2A 3D7FA 2GE3A 1LAMA 5DWNA 4A30A 3D7GA 2ZEHA 3KQZA 4R76A 5LYFA 2HUZA 2FT0A 5CBMA 1IICA 2AFZA 5F49A 3IWEA 4R87A 3P2HA 3DSBA 2B4DB 4MHZA 4NGMA 4P4EA 3T8WA 3CXSA 3CPXA 3D68A 4NFRA 4X8IA 4XPDC 4FAIA 4H2KA 1S7NA 3GY9A 3PB6X 2PC1A 4ZX8A 4L8AA 2AFSA 1S3ZA 4KOVA 4MBUA 3H5ZA 4NSQA 5EC4A 4MXUA 4HKFA 4MCPA 4JYWA 4MFLA 1YX0A 1Z4EA 1Z8WA 1YW4A 3WC7A 4MCQA 1XEBA 2VZZA 1Y0RA 2ZENA 2J8RA 4Y49C 2OZHA 4NF1A 4R57A 2Y0MA 2CNTA 5C88A 3FBUA 4OC0A 1YQEA 2GFQA 1MJBA 4FBEA 2A4NA 1FY7A
chains in the Genus database with same CATH topology
2FXFA 3GYAA 3TO7A 2YNCA 2R1IA 3R96A 1Z9UA 3TE4A 5IX3A 4MHDA 2P0WA 4MY0A 4A32A 3R1KA 3E0KA 3FNCA 1YVOA 2FIAA 4CRYB 1OZPA 5FVJA 1I21A 1Q2CA 2ZXVA 1NMTA 4E8OA 1BOBA 4CRZB 1XF8A 2ZW7A 2DXQA 5JQ4A 2P6EA 4FD5A 4MJ8A 4KVOE 2GIVA 2D4OA 4QVTA 4B5PB 5A27A 2YNCC 1MJAA 3ZJ0A 5AG7A 4PSWA 2FIWA 3WR7A 1RO5A 4A2ZA 3F5BA 3TO9A 3GKRA 4PK2A 2FSRA 2DPTA 4B12A 2O28A 2BL1A 5IV0A 4JJXA 5A28A 2K5TA 5J8FA 4OAEA 1IB1E 3TOAA 2WPXA 1M1DA 3R9EA 3IU2A 4E2AA 4LUAA 4C7HA 1NSLA 4DNCA 4KOTA 4C2YA 3EY5A 4HNWB 4XNHB 1S7FA 2G3AA 1PUAA 4B14A 2BUEA 4ZGYB 4C68A 1YR0A 2Z3NA 2J8MA 4HNXB 3FIXA 4AB7A 3NE7A 3V8IA 5BWAB 2YNEA 4H89A 3TCVA 3KKWA 2Z10A 2B58A 4F0XA 4AVCA 3FB3A 3SXNA 2C27A 2REEA 3QAHA 3OWCA 1KUVA 4FD4A 2B4DA 3D3SA 4UFVA 5HMNA 4JXRA 5F48A 4AVBA 1ON0A 4KOWA 2FS5A 3EFAA 4OLLA 2HQYA 5KTDA 4LX9A 3N7ZA 4RI1A 1ZO0A 2QMLA 5AG4A 2VXKA 4KUBA 5KTCA 4AG7A 1KUXA 2B3VA 2Q04A 4MI4A 2OB0A 3DDDA 2Q4VA 4CAFA 1XE4A 2ZW5A 5E96A 4CAVA 2PSWA 4UWIA 3VWDA 4C2XA 3H4QA 5AGEA 4UCNA 1L0CA 3P2FA 2WUUA 2AE6A 5G22A 2WPWA 4R9MA 4XPDB 5G20A 4JLYA 4MFJA 2X7BA 4MFZA 1PU9A 3R9GA 1Q2DA 3ZZIA 5EBVA 1K4JA 2BSWA 3TO6A 1S5KA 2VBQA 4UA3A 4C2ZA 2JDCA 4H6ZA 2VEZA 2VQYA 3D2MA 2B5GA 1S7LA 3S6FA 4U9YA 3F0AA 4B10A 3EO4A 3A9LA 3FXTA 5F47A 5GCNA 3I3GA 4NEXA 4II9A 4ZBGA 4CGMA 2F5IA 2I00A 1P4NA 1LRZA 5IB0A 2VZYA 1IYKA 2Z3OA 3QB8A 4CYPA 5I0CA 4CGLA 4X5KA 3BLNA 2IL4A 2OZUA 5F46A 4AG9A 4A95A 1CM0A 4KS9A 4UBRA 3F8KA 5ISVA 4UWJA 4PK3A 1XIXA 4A33A 1YLEA 1B87A 4H6UA 4XPKA 5KTAA 3IWGA 3D2PA 1M4DA 1SQHA 3FRMA 2Z3PA 3G3SA 1UFHA 5AG5A 1YREA 2AJ6A 2R7HA 3TFYA 4KZTA 5DWMA 2JLMA 4BBHA 4C7IA 4Q36A 2Z11A 4CAXA 4B5OA 2ARHA 4NCZA 3BJ8A 1U6MA 4FD7A 4PSXA 4B13A 1J4JA 2WSAA 5AG6A 4MFQA 1S7KA 1S60A 3CXQA 1M4IA 4A31A 2QIRA 2G0BA 1YK3A 4IUSA 4CYOA 4CYQA 1MK4A 4U9ZA 1IIDA 3T9YA 1IYLA 2CXAA 2YGWA 4UCPA 1QSRA 3I9SA 2B3UA 2ZW4A 4UFWA 2PRBA 3K9UA 3PZJA 1QSOA 2R98A 2Z3KA 2PR8A 3R9FA 2B4BA 2FCKA 3IGRA 4KLWA 1QSMA 1KUYA 1NE9A 2RC4A 2J8NA 1WWZA 3UY5A 1GHEA 1CJWA 3RYOA 1TIQA 4CGPA 4YRHA 2D4PA 3R95A 2G3TA 4EVYA 1I12A 4IF5A 4K30A 2CNSA 4QBJA 1V0CA 2CNMA 2Z3LA 5H84A 4R3KA 4QB9A 2YNDA 2FL4A 2P6FA 4E0AA 2HV2A 2I79A 3S6GA 4CGNA 3VWEA 2Q7BA 2JEVA 2CY2A 1YVKA 5C82A 4OADA 1M4GA 2ATRA 4PV6A 4JXQA 5G21A 4JD6A 4B11A 1Y9WA 3EC4A 3G8WA 4KSAA 3S6KA 4KVME 3BJ7A 3W91A 3D8PA 3W6XA 4ORFA 4KSFA 5G1ZA 4U5YA 3CXPA 2QECA 1XMTA 4Y49B 4JWPA 3W6SA 4KVXA 4RS2A 2PR1A 4ONUA 4YGOA 3C26A 1Y9KA 2KCWA 4UFXA 1P0HA 4CS0B 4QC6A 4CAEA 4F0YA 1QSTA 4MY3A 3S6HA 2FE7A 4KORA 4CGOA 2H5MA 4M85A 1VKCA 1MJ9A 2Q0YA 2Q4YA 3JUWA 2REFA 5J8CA 4KUAA 4CYNA 4F6AA 1QSNA 1WK4A 2R8VA 4NXYA 4QUSA 2Z0ZA 2NMTA 2OH1A 2GANA 5CNPA 1YGHA 2DPSA 3LD2A 4MFPA 4KOXA 4Q38A 1RXTA 2B5GB 4XNHC 1M44A 3SXOA 1Y7RA 2BEIA 2PDOA 3B8GA 4KOUA 4L89A 4GS4A 1I1DA 2OZGA 1Z4RA 3DR8A 3PP9A 5JPHA 4BMHA 2ZPAA 3TT2A 2VI7A 2Q44A 4MFKA 4B5PA 1N71A 3MGDA 3EXNA 3DNSA 4KOSA 4CAWA 1BO4A 5HH1A 4J3GA 2EVNA 4M3SA 3T90A 1VHSA 2PQ8A 3TOBA 3FYNA 4AVAA 2P6GA 4HNYB 2JDDA 4KLVA 3JVNA 1B6BA 4UCMA 4R3LA 3DR6A 5H86A 4FD6A 1KZFA 3PGPA 2Z3MA 1R57A 4I49A 3LODA 2EUIA 3JTKA 4XPLA 1Q2YA 4KOYA 3SHPA 4YFJA 3IU1A 2ZW6A 3TTHA 2OU2A 2GE3A 4A30A 5DWNA 2HUZA 2FT0A 1IICA 5F49A 3IWEA 4R87A 3P2HA 3DSBA 2B4DB 3CXSA 4XPDC 1S7NA 3GY9A 2PC1A 4L8AA 1S3ZA 4KOVA 4MBUA 3H5ZA 4NSQA 5EC4A 4HKFA 4MFLA 1YX0A 1Z4EA 1XEBA 2VZZA 4Y49C 2J8RA 2OZHA 4NF1A 4R57A 2Y0MA 2CNTA 5C88A 3FBUA 1MJBA 2A4NA 1FY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WUU A;  4CYP A;  4CYN A;  4CGL A;  5G22 A;  2YNE A;  5G1Z A;  3IU2 A;  5G20 A;  4B13 A;  2YNC A;  2YND A;  5AG4 A;  4UCM A;  4A95 A;  2WSA A;  5AG6 A;  4B10 A;  3H5Z A;  5A27 A;  2YNC C;  4C7H A;  4A33 A;  5AG7 A;  4UFX A;  4A32 A;  4CGN A;  3JTK A;  4C7I A;  4A2Z A;  4CAE A;  4A31 A;  4C2Y A;  3IU1 A;  4CAF A;  4CYO A;  5AG5 A;  4CGO A;  4CYQ A;  4UFV A;  4CGM A;  4CGP A;  4A30 A;  4C2Z A;  4B14 A;  4C68 A;  5G21 A;  4B11 A;  4B12 A;  4C2X A;  5AGE A;  4UCP A;  4BBH A;  4UCN A;  3IWE A;  4UFW A;  5A28 A; 
#chains in the Genus database with same CATH topology
 2DF5 A;  4IAV A;  1Z8T A;  2FXF A;  2Q4Z A;  3GYA A;  4NGQ A;  5CPA A;  2ANP A;  3TO7 A;  2YNC A;  3FX6 A;  2R1I A;  3R96 A;  1Z9U A;  4PXE A;  5IX3 A;  3TE4 A;  4MHD A;  2EBJ A;  1ELM P;  2P0W A;  1KWM A;  2PJ5 A;  4MY0 A;  4A32 A;  2G9D A;  3R1K A;  2ABZ A;  3E0K A;  1ELL P;  1VHO A;  3FNC A;  3NH4 A;  8CPA A;  1YVO A;  2FIA A;  3TX8 A;  4CRY B;  1OZP A;  5FVJ A;  3D7H A;  3B3C A;  3SI2 A;  1I21 A;  1Q2C A;  3SJE A;  4EFD A;  5F09 A;  1YLO A;  2ZXV A;  1NMT A;  4E8O A;  1BOB A;  1ZLI A;  3BI0 A;  2NYQ A;  4CRZ B;  1XF8 A;  2ZW7 A;  2DXQ A;  5JQ4 A;  2P6E A;  1R43 A;  2ZEO A;  4FD5 A;  4MJ8 A;  4KVO E;  3JRU A;  1XBU A;  1Y7E A;  2GIV A;  1XMB A;  2D4O A;  2ZEL A;  4MHY A;  4QVT A;  4B5P B;  3K9T A;  4AXV A;  5A27 A;  5HXD A;  1IGB A;  2YNC C;  5HVH A;  1MJA A;  1CBX A;  1Z2L A;  2PJ4 A;  2PJ3 A;  3ZJ0 A;  2WZN A;  3NH8 A;  5AG7 A;  4PSW A;  2FIW A;  2O4H A;  2PJ1 A;  5K8M A;  3WR7 A;  1RO5 A;  4A2Z A;  4WWV A;  3F5B A;  3L2N A;  7CPA A;  3SI1 A;  1ZG8 A;  4UEZ A;  1ARL A;  3B3S A;  3RNZ A;  2IMO A;  3GKR A;  4PK2 A;  3TO9 A;  2FSR A;  2DPT A;  3D66 A;  1IU8 A;  5DS0 A;  4B12 A;  2QYV A;  2IQ6 A;  1TKJ A;  2BL1 A;  2O28 A;  4FWU A;  4PPZ A;  5IV0 A;  4JJX A;  5LRK A;  4BIN A;  5K8O A;  5A28 A;  2K5T A;  3B2Y A;  5I4M A;  5J8F A;  4OAE A;  1IB1 E;  3VH9 A;  1CP7 A;  1HDQ A;  3TOA A;  2WPX A;  1M1D A;  3R9E A;  3IU2 A;  1IOI A;  4E2A A;  4LUA A;  1ZLH A;  4C7H A;  1NSL A;  4OC2 A;  2AFM A;  2V8D A;  4DNC A;  4KOT A;  4C2Y A;  2CTC A;  3EY5 A;  3KGQ A;  1TF8 A;  2F7V A;  4HNW B;  4ONW A;  4XNH B;  5LYD A;  1S7F A;  1ZG9 A;  2G3A A;  1PUA A;  4B14 A;  2BUE A;  3H8F A;  4ZGY B;  4C68 A;  4NJQ A;  1YR0 A;  2Z3N A;  2J8M A;  4HNX B;  3FIX A;  4AB7 A;  3NE7 A;  3V8I A;  1A2Z A;  2Q43 A;  5BWA B;  2C1C A;  3CDX A;  2YNE A;  4H89 A;  3TCV A;  3FEC A;  2AFO A;  2F8H A;  3KKW A;  2Z10 A;  3V38 A;  1Z8L A;  2B58 A;  4F0X A;  1BPN A;  3WT4 A;  4AVC A;  3IJ3 A;  3FB3 A;  4ZY2 A;  4M6G A;  2C27 A;  2REE A;  3SXN A;  3QAH A;  3OWC A;  1KUV A;  4FD4 A;  2B4D A;  1TKH A;  2PE3 A;  3D3S A;  4UFV A;  3S9M A;  4MMO A;  4JXR A;  5F48 A;  5HMN A;  4MCS A;  4AVB A;  1ON0 A;  3CT9 A;  4KOW A;  2FS5 A;  2DEA A;  3EFA A;  2HQY A;  1F2O A;  4NGT A;  4OLL A;  4R8F A;  4F9U A;  4LQG A;  1HDU A;  5KTD A;  4LX9 A;  3N7Z A;  3RAM A;  3SI0 A;  2BOA A;  4RI1 A;  3D67 A;  2PJ8 A;  1ZO0 A;  4FUU A;  2QML A;  5AG4 A;  2VXK A;  4KUB A;  2GLJ A;  5JH9 A;  5KTC A;  2CTB A;  5K8P A;  3B7I A;  1KUX A;  4R7M A;  4AG7 A;  2B3V A;  4Q7A A;  2I3C A;  1VIX A;  2Q04 A;  1PCA A;  4MI4 A;  2OB0 A;  4ZI6 A;  1JWQ A;  2C6P A;  3DDD A;  4OP4 A;  1H8L A;  2Q4V A;  4P4D A;  4MHP A;  1BAV A;  4CAF A;  5D8N A;  4RUH A;  1XE4 A;  2ZW5 A;  2BCO A;  5E96 A;  3PFO A;  2PSW A;  4UWI A;  3VWD A;  4CAV A;  4C2X A;  2ZEG A;  4NJR A;  3H4Q A;  4MCR A;  1Z5R A;  5AGE A;  4UCN A;  1L0C A;  1DE4 C;  3IWW A;  4UF4 A;  3P2F A;  1ZG7 A;  2WUU A;  2AE6 A;  2ZEP A;  1VGY A;  3SJG A;  4DJL A;  1CPS A;  5G22 A;  2WPW A;  3KZW A;  4R9M A;  4XPD B;  5G20 A;  4JLY A;  2AFU A;  4MFJ A;  2X7B A;  2EK8 A;  1YME A;  4MFZ A;  4UEE A;  1PU9 A;  4ZX9 A;  2Q51 A;  3LWU A;  3R9G A;  1Q2D A;  4GM5 A;  4RN7 A;  4TWE A;  3ZZI A;  5EBV A;  3S9N A;  1K4J A;  1XRY A;  4A94 A;  2BSW A;  3WC5 A;  2PIZ A;  2PJB A;  2PJA A;  3TO6 A;  1S5K A;  2VBQ A;  3IFE A;  4P4F A;  4UA3 A;  4C2Z A;  2JDC A;  3HLP A;  4PXD A;  4H6Z A;  2VEZ A;  2VQY A;  3FVL A;  4A38 A;  3FED A;  3D2M A;  1Y0Y A;  1LCP A;  3KR5 A;  4M6H A;  4OME A;  2B5G A;  4OC4 A;  1S7L A;  3GUX A;  2XEJ A;  3S6F A;  2PCU A;  4R6T A;  4U9Y A;  3KI9 A;  4X2T A;  3F0A A;  4B10 A;  2EO8 A;  3EO4 A;  3RO0 A;  2IJZ A;  1XOV A;  2CIJ A;  1FT7 A;  3A9L A;  3CPA A;  3FXT A;  5F47 A;  5GCN A;  1VHE A;  3I3G A;  4NEX A;  4YU9 A;  2VL1 A;  3TC8 A;  1IOF A;  3KHZ A;  4II9 A;  2WYR A;  4ZBG A;  4CGM A;  3HUV A;  4ZY0 A;  2F5I A;  4JZ0 A;  4KSI A;  4P44 A;  2I00 A;  1P4N A;  1LRZ A;  4P10 A;  5IB0 A;  2VZY A;  1IYK A;  2Z3O A;  3QB8 A;  2ZEE A;  4CYP A;  4UIB A;  5I0C A;  4CGL A;  4X5K A;  3BLN A;  2IL4 A;  2AFX A;  2OZU A;  3H8E A;  3MN8 A;  3NH5 A;  4PXB A;  4B6Z A;  4AG9 A;  2AFW A;  5F46 A;  4A95 A;  1CM0 A;  4KS9 A;  4UBR A;  3F8K A;  4G1P A;  3KHX A;  5ISV A;  3FJU A;  4X3R A;  1JQG A;  4UWJ A;  5HVF A;  2PRQ A;  4PK3 A;  1XIX A;  4A33 A;  1YLE A;  1B87 A;  4H6U A;  2ZEF A;  3IC1 A;  4XPK A;  1CX8 A;  5KTA A;  3IWG A;  3D2P A;  1M4D A;  1CPX A;  1CP6 A;  1SQH A;  4A39 A;  2FVG A;  3FRM A;  2Z3P A;  3G3S A;  1UFH A;  3KAS A;  5AG5 A;  1GYT A;  1YRE A;  2AJ6 A;  3FEE A;  2R7H A;  3TFY A;  3DGV A;  4KZT A;  5DWM A;  2JLM A;  1XJO A;  3PBE A;  4BBH A;  4IK2 A;  4C7I A;  2PJ7 A;  3PB4 X;  4A37 A;  3PB8 X;  4Q36 A;  2Z11 A;  4CAX A;  4B5O A;  2ARH A;  1X12 A;  3QAY A;  4NCZ A;  1PYT B;  4F8Z A;  3BJ8 A;  1U6M A;  4FD7 A;  2ZOG A;  4PSX A;  4B13 A;  5K8N A;  1J4J A;  5THW A;  1UWY A;  2WSA A;  5AG6 A;  5LYL A;  4MFQ A;  4DUK A;  1BLL E;  1S7K A;  1AMP A;  1S60 A;  1LFW A;  3SJF A;  2CF4 A;  2ZED A;  3CXQ A;  5HVG A;  3ISZ A;  1M4I A;  3PBB A;  4A31 A;  2QIR A;  2G0B A;  1YK3 A;  4IUS A;  4UIA A;  4O23 A;  4CYO A;  4CYQ A;  1MK4 A;  1DTD A;  4U9Z A;  1F2P A;  4P4J A;  4ZY1 A;  1IID A;  3T9Y A;  1IYL A;  2BO9 A;  2CXA A;  2YGW A;  1QSR A;  2PVV A;  3I9S A;  3KL9 A;  2B3U A;  2ZW4 A;  4UFW A;  4UCP A;  2C6G A;  3H8G A;  2PRB A;  3K9U A;  3GIU A;  1QSO A;  3PZJ A;  2R98 A;  3B3V A;  2Z3K A;  1Z8X A;  3BXM A;  2PR8 A;  3R9F A;  2V77 A;  2B4B A;  3RBU A;  1OBR A;  2FCK A;  3IGR A;  4P4I A;  4BD9 A;  4KLW A;  2QVP A;  1QSM A;  1KUY A;  1NE9 A;  1FNO A;  2PJ0 A;  2RC4 A;  2J8N A;  4TNU A;  3IO1 A;  2EK9 A;  3WAB A;  1LOK A;  1WWZ A;  3UY5 A;  1GHE A;  1CJW A;  4NGP A;  3RYO A;  1TIQ A;  4CGP A;  4OIW A;  4YRH A;  2D4P A;  3R95 A;  2G3T A;  4EME A;  4EVY A;  1I12 A;  4IF5 A;  1TXR A;  4K30 A;  4P4B A;  2PJ2 A;  4MRI A;  2CNS A;  4QBJ A;  1V0C A;  3CZX A;  2CNM A;  2Z3L A;  3NE8 A;  5H84 A;  3RZA A;  2JBJ A;  4R3K A;  1YW6 A;  4QB9 A;  2YND A;  2FL4 A;  2JEW A;  2P6F A;  4DYO A;  4E0A A;  2HV2 A;  1XFO A;  2I79 A;  5LRG A;  5J1Q A;  3S6G A;  4CGN A;  5IB9 A;  3VWE A;  2Q7B A;  1AYE A;  2JEV A;  2CY2 A;  1YVK A;  3BI1 A;  5C82 A;  4OAD A;  1M4G A;  2ATR A;  3LMS A;  1X10 A;  2POK A;  4PV6 A;  4JXQ A;  2Q7S A;  3NFZ A;  5G21 A;  4JD6 A;  4B11 A;  1Y9W A;  3EC4 A;  3G8W A;  4KSA A;  3S6K A;  3B3T A;  3NA6 A;  4KVM E;  3BJ7 A;  3W91 A;  2ZOF A;  3D4U A;  5JGF A;  3GB0 A;  3D8P A;  1R3N A;  3W6X A;  2PJ9 A;  1QMU A;  4ORF A;  4KSF A;  4OC3 A;  3QNV A;  5G1Z A;  4YWY A;  3PFE A;  4U5Y A;  2PVW A;  3CXP A;  6CPA A;  5D29 A;  2QEC A;  1XMT A;  4Y49 B;  3BHX A;  4K3N A;  4JWP A;  2J9A A;  3W6S A;  4KVX A;  4RS2 A;  2PR1 A;  4ONU A;  4YGO A;  2HB6 A;  3C26 A;  1Y9K A;  2XEF A;  2KCW A;  4UFX A;  3MRU A;  1P0H A;  3FF3 A;  3IEH A;  4CS0 B;  2RFH A;  4HPS A;  4QC6 A;  4CAE A;  4NGR A;  4F0Y A;  1QST A;  4MY3 A;  3S6H A;  2FE7 A;  2ODF A;  4KOR A;  4CGO A;  2H5M A;  4M85 A;  1VKC A;  3KR4 A;  4P45 A;  1MJ9 A;  2Q0Y A;  2Q4Y A;  3JUW A;  2REF A;  5J8C A;  4KUA A;  4F9V A;  4CYN A;  4WJB A;  3IIB A;  4M6I A;  4F6A A;  1QSN A;  1WK4 A;  2R8V A;  4NXY A;  3S9L A;  4QUS A;  2GU2 A;  2Z0Z A;  2NMT A;  2OH1 A;  2GAN A;  1Q7L A;  5CNP A;  1YGH A;  2V8V A;  2V8H A;  2DPS A;  3LD2 A;  2XEI A;  4MFP A;  2NSM A;  4LQ6 A;  4KOX A;  4NGN A;  4Q38 A;  1RXT A;  1EE3 P;  2B5G B;  4XNH C;  3FH4 A;  1M44 A;  2RB7 A;  3SXO A;  1BPM A;  1Y7R A;  5LYI A;  1ARM A;  2BEI A;  1YSJ A;  4PXC A;  2PDO A;  3B8G A;  4KOU A;  2PJC A;  1QQ9 A;  4L89 A;  3ISX A;  4GS4 A;  1I1D A;  2OZG A;  2PIY A;  1Z4R A;  3DR8 A;  3K2K A;  3PP9 A;  5JPH A;  4MHN A;  4BMH A;  2C6C A;  1TKF A;  2ZPA A;  3TT2 A;  1F57 A;  4OKO A;  3FMC A;  3KQX A;  3PB9 X;  2VI7 A;  2Q44 A;  3PRT A;  1TF9 A;  3DLJ A;  4IHM A;  3GLJ A;  4MFK A;  5ELY A;  1N71 A;  4B5P A;  3MGD A;  5LRJ A;  3EXN A;  3DNS A;  4KOS A;  3VAR A;  4CAW A;  2QJ8 A;  3D7D A;  1LAP A;  3SJX A;  3N5F A;  1HEE A;  3B3W A;  1BO4 A;  4GXH A;  2HC9 A;  5HH1 A;  2GRE A;  4J3G A;  3V7Z A;  1NSA A;  2EWB A;  2V8G A;  2EVN A;  2ZEM A;  4M3S A;  3T90 A;  1VHS A;  2O53 A;  3WC6 A;  3B35 A;  3I1U A;  2PQ8 A;  3VAT A;  3TOB A;  4ZYQ A;  3FYN A;  1RTQ A;  4AVA A;  3PEI A;  4P6Y A;  2JBK A;  1LAN A;  4Z65 A;  2P6G A;  4HNY B;  2JDD A;  2GLF A;  2XEG A;  4KLV A;  3JVN A;  4OC1 A;  2OR4 A;  1B6B A;  4CPA A;  4NGS A;  4UCM A;  3PB7 X;  4R3L A;  1IY7 A;  3DR6 A;  2PJ6 A;  5H86 A;  4PQA A;  4FD6 A;  4OID A;  1KZF A;  4UEF A;  1M4L A;  5EMI A;  3PGP A;  2Z3M A;  4OC5 A;  4W9Y A;  1R57 A;  4I49 A;  3LOD A;  4EWT A;  2EUI A;  3JTK A;  4XPL A;  1Q2Y A;  3LAC A;  2OOT A;  4KOY A;  3SHP A;  4YFJ A;  1CG2 A;  3IU1 A;  1AUG A;  2ZW6 A;  3TTH A;  5JM6 A;  2OU2 A;  3D7F A;  2GE3 A;  1LAM A;  5DWN A;  4A30 A;  3D7G A;  2ZEH A;  3KQZ A;  4R76 A;  5LYF A;  2HUZ A;  2FT0 A;  5CBM A;  1IIC A;  2AFZ A;  5F49 A;  3IWE A;  4R87 A;  3P2H A;  3DSB A;  2B4D B;  4MHZ A;  4NGM A;  4P4E A;  3T8W A;  3CXS A;  3CPX A;  3D68 A;  4NFR A;  4X8I A;  4XPD C;  4FAI A;  4H2K A;  1S7N A;  3GY9 A;  3PB6 X;  2PC1 A;  4ZX8 A;  4L8A A;  2AFS A;  1S3Z A;  4KOV A;  4MBU A;  3H5Z A;  4NSQ A;  5EC4 A;  4MXU A;  4HKF A;  4MCP A;  4JYW A;  4MFL A;  1YX0 A;  1Z4E A;  1Z8W A;  1YW4 A;  3WC7 A;  4MCQ A;  1XEB A;  2VZZ A;  1Y0R A;  2ZEN A;  2J8R A;  4Y49 C;  2OZH A;  4NF1 A;  4R57 A;  2Y0M A;  2CNT A;  5C88 A;  3FBU A;  4OC0 A;  1YQE A;  2GFQ A;  1MJB A;  4FBE A;  2A4N A;  1FY7 A; 
#chains in the Genus database with same CATH homology
 2FXF A;  3GYA A;  3TO7 A;  2YNC A;  2R1I A;  3R96 A;  1Z9U A;  3TE4 A;  5IX3 A;  4MHD A;  2P0W A;  4MY0 A;  4A32 A;  3R1K A;  3E0K A;  3FNC A;  1YVO A;  2FIA A;  4CRY B;  1OZP A;  5FVJ A;  1I21 A;  1Q2C A;  2ZXV A;  1NMT A;  4E8O A;  1BOB A;  4CRZ B;  1XF8 A;  2ZW7 A;  2DXQ A;  5JQ4 A;  2P6E A;  4FD5 A;  4MJ8 A;  4KVO E;  2GIV A;  2D4O A;  4QVT A;  4B5P B;  5A27 A;  2YNC C;  1MJA A;  3ZJ0 A;  5AG7 A;  4PSW A;  2FIW A;  3WR7 A;  1RO5 A;  4A2Z A;  3F5B A;  3TO9 A;  3GKR A;  4PK2 A;  2FSR A;  2DPT A;  4B12 A;  2O28 A;  2BL1 A;  5IV0 A;  4JJX A;  5A28 A;  2K5T A;  5J8F A;  4OAE A;  1IB1 E;  3TOA A;  2WPX A;  1M1D A;  3R9E A;  3IU2 A;  4E2A A;  4LUA A;  4C7H A;  1NSL A;  4DNC A;  4KOT A;  4C2Y A;  3EY5 A;  4HNW B;  4XNH B;  1S7F A;  2G3A A;  1PUA A;  4B14 A;  2BUE A;  4ZGY B;  4C68 A;  1YR0 A;  2Z3N A;  2J8M A;  4HNX B;  3FIX A;  4AB7 A;  3NE7 A;  3V8I A;  5BWA B;  2YNE A;  4H89 A;  3TCV A;  3KKW A;  2Z10 A;  2B58 A;  4F0X A;  4AVC A;  3FB3 A;  3SXN A;  2C27 A;  2REE A;  3QAH A;  3OWC A;  1KUV A;  4FD4 A;  2B4D A;  3D3S A;  4UFV A;  5HMN A;  4JXR A;  5F48 A;  4AVB A;  1ON0 A;  4KOW A;  2FS5 A;  3EFA A;  4OLL A;  2HQY A;  5KTD A;  4LX9 A;  3N7Z A;  4RI1 A;  1ZO0 A;  2QML A;  5AG4 A;  2VXK A;  4KUB A;  5KTC A;  4AG7 A;  1KUX A;  2B3V A;  2Q04 A;  4MI4 A;  2OB0 A;  3DDD A;  2Q4V A;  4CAF A;  1XE4 A;  2ZW5 A;  5E96 A;  4CAV A;  2PSW A;  4UWI A;  3VWD A;  4C2X A;  3H4Q A;  5AGE A;  4UCN A;  1L0C A;  3P2F A;  2WUU A;  2AE6 A;  5G22 A;  2WPW A;  4R9M A;  4XPD B;  5G20 A;  4JLY A;  4MFJ A;  2X7B A;  4MFZ A;  1PU9 A;  3R9G A;  1Q2D A;  3ZZI A;  5EBV A;  1K4J A;  2BSW A;  3TO6 A;  1S5K A;  2VBQ A;  4UA3 A;  4C2Z A;  2JDC A;  4H6Z A;  2VEZ A;  2VQY A;  3D2M A;  2B5G A;  1S7L A;  3S6F A;  4U9Y A;  3F0A A;  4B10 A;  3EO4 A;  3A9L A;  3FXT A;  5F47 A;  5GCN A;  3I3G A;  4NEX A;  4II9 A;  4ZBG A;  4CGM A;  2F5I A;  2I00 A;  1P4N A;  1LRZ A;  5IB0 A;  2VZY A;  1IYK A;  2Z3O A;  3QB8 A;  4CYP A;  5I0C A;  4CGL A;  4X5K A;  3BLN A;  2IL4 A;  2OZU A;  5F46 A;  4AG9 A;  4A95 A;  1CM0 A;  4KS9 A;  4UBR A;  3F8K A;  5ISV A;  4UWJ A;  4PK3 A;  1XIX A;  4A33 A;  1YLE A;  1B87 A;  4H6U A;  4XPK A;  5KTA A;  3IWG A;  3D2P A;  1M4D A;  1SQH A;  3FRM A;  2Z3P A;  3G3S A;  1UFH A;  5AG5 A;  1YRE A;  2AJ6 A;  2R7H A;  3TFY A;  4KZT A;  5DWM A;  2JLM A;  4BBH A;  4C7I A;  4Q36 A;  2Z11 A;  4CAX A;  4B5O A;  2ARH A;  4NCZ A;  3BJ8 A;  1U6M A;  4FD7 A;  4PSX A;  4B13 A;  1J4J A;  2WSA A;  5AG6 A;  4MFQ A;  1S7K A;  1S60 A;  3CXQ A;  1M4I A;  4A31 A;  2QIR A;  2G0B A;  1YK3 A;  4IUS A;  4CYO A;  4CYQ A;  1MK4 A;  4U9Z A;  1IID A;  3T9Y A;  1IYL A;  2CXA A;  2YGW A;  4UCP A;  1QSR A;  3I9S A;  2B3U A;  2ZW4 A;  4UFW A;  2PRB A;  3K9U A;  3PZJ A;  1QSO A;  2R98 A;  2Z3K A;  2PR8 A;  3R9F A;  2B4B A;  2FCK A;  3IGR A;  4KLW A;  1QSM A;  1KUY A;  1NE9 A;  2RC4 A;  2J8N A;  1WWZ A;  3UY5 A;  1GHE A;  1CJW A;  3RYO A;  1TIQ A;  4CGP A;  4YRH A;  2D4P A;  3R95 A;  2G3T A;  4EVY A;  1I12 A;  4IF5 A;  4K30 A;  2CNS A;  4QBJ A;  1V0C A;  2CNM A;  2Z3L A;  5H84 A;  4R3K A;  4QB9 A;  2YND A;  2FL4 A;  2P6F A;  4E0A A;  2HV2 A;  2I79 A;  3S6G A;  4CGN A;  3VWE A;  2Q7B A;  2JEV A;  2CY2 A;  1YVK A;  5C82 A;  4OAD A;  1M4G A;  2ATR A;  4PV6 A;  4JXQ A;  5G21 A;  4JD6 A;  4B11 A;  1Y9W A;  3EC4 A;  3G8W A;  4KSA A;  3S6K A;  4KVM E;  3BJ7 A;  3W91 A;  3D8P A;  3W6X A;  4ORF A;  4KSF A;  5G1Z A;  4U5Y A;  3CXP A;  2QEC A;  1XMT A;  4Y49 B;  4JWP A;  3W6S A;  4KVX A;  4RS2 A;  2PR1 A;  4ONU A;  4YGO A;  3C26 A;  1Y9K A;  2KCW A;  4UFX A;  1P0H A;  4CS0 B;  4QC6 A;  4CAE A;  4F0Y A;  1QST A;  4MY3 A;  3S6H A;  2FE7 A;  4KOR A;  4CGO A;  2H5M A;  4M85 A;  1VKC A;  1MJ9 A;  2Q0Y A;  2Q4Y A;  3JUW A;  2REF A;  5J8C A;  4KUA A;  4CYN A;  4F6A A;  1QSN A;  1WK4 A;  2R8V A;  4NXY A;  4QUS A;  2Z0Z A;  2NMT A;  2OH1 A;  2GAN A;  5CNP A;  1YGH A;  2DPS A;  3LD2 A;  4MFP A;  4KOX A;  4Q38 A;  1RXT A;  2B5G B;  4XNH C;  1M44 A;  3SXO A;  1Y7R A;  2BEI A;  2PDO A;  3B8G A;  4KOU A;  4L89 A;  4GS4 A;  1I1D A;  2OZG A;  1Z4R A;  3DR8 A;  3PP9 A;  5JPH A;  4BMH A;  2ZPA A;  3TT2 A;  2VI7 A;  2Q44 A;  4MFK A;  4B5P A;  1N71 A;  3MGD A;  3EXN A;  3DNS A;  4KOS A;  4CAW A;  1BO4 A;  5HH1 A;  4J3G A;  2EVN A;  4M3S A;  3T90 A;  1VHS A;  2PQ8 A;  3TOB A;  3FYN A;  4AVA A;  2P6G A;  4HNY B;  2JDD A;  4KLV A;  3JVN A;  1B6B A;  4UCM A;  4R3L A;  3DR6 A;  5H86 A;  4FD6 A;  1KZF A;  3PGP A;  2Z3M A;  1R57 A;  4I49 A;  3LOD A;  2EUI A;  3JTK A;  4XPL A;  1Q2Y A;  4KOY A;  3SHP A;  4YFJ A;  3IU1 A;  2ZW6 A;  3TTH A;  2OU2 A;  2GE3 A;  4A30 A;  5DWN A;  2HUZ A;  2FT0 A;  1IIC A;  5F49 A;  3IWE A;  4R87 A;  3P2H A;  3DSB A;  2B4D B;  3CXS A;  4XPD C;  1S7N A;  3GY9 A;  2PC1 A;  4L8A A;  1S3Z A;  4KOV A;  4MBU A;  3H5Z A;  4NSQ A;  5EC4 A;  4HKF A;  4MFL A;  1YX0 A;  1Z4E A;  1XEB A;  2VZZ A;  4Y49 C;  2J8R A;  2OZH A;  4NF1 A;  4R57 A;  2Y0M A;  2CNT A;  5C88 A;  3FBU A;  1MJB A;  2A4N A;  1FY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...