4B10A

Plasmodium vivax n-myristoyltransferase with a non-hydrolysable co- factor
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Design and Synthesis of Inhibitors of Plasmodium Falciparum N-Myristoyltransferase, a Promising Target for Anti-Malarial Drug Discovery.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 119
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4b10A00
4UFWA 4CGOA 4B10A 5G22A 3JTKA 4UCNA 4B14A 4CGMA 4CAFA 4B12A 4C2ZA 4B13A 4CGPA 3H5ZA 5G20A 4BBHA 4A33A 4A95A 4CAEA 4C2XA 4A31A 2WUUA 2YNCA 4UCPA 4B11A 5G21A 4C7IA 2YNEA 4CGLA 4UFXA 4CYNA 3IWEA 4CGNA 4A30A 3IU1A 5G1ZA 5AG4A 4C2YA 4C68A 2YNCC 4C7HA 2YNDA 3IU2A 5AG5A 4CYOA 5AG6A 5A27A 5AGEA 4CYQA 5A28A 2WSAA 4UFVA 4UCMA 5AG7A 4CYPA 4A32A 4A2ZA
chains in the Genus database with same CATH superfamily
1ZG9A 2QYVA 4JWPA 2ZEGA 4FAIA 3JTKA 1RO5A 1YGHA 4BMHA 3WABA 2PJ9A 2JBKA 4PV6A 4JJXA 1S7LA 1VIXA 3R95A 3PBBA 1ZG7A 4LUAA 2QJ8A 1FY7A 4MY3A 3JVNA 2EK9A 2ZEMA 1XF8A 3EO4A 3FEDA 1IY7A 2F8HA 3FECA 3SJGA 1VHSA 2CNMA 4IHMA 4M3SA 2REEA 3ZZIA 3DSBA 4OIDA 2CTBA 3CPXA 4P45A 4KVME 1AUGA 1FNOA 4MFPA 1GYTA 2Q4VA 4DUKA 3FRMA 1DE4C 4NGMA 5J8FA 3B3TA 2R1IA 4R76A 4B10A 1LAMA 4NGTA 2AFSA 3FB3A 4IUSA 4A37A 1IIDA 3JRUA 4JXRA 4CGPA 2BUEA 4OC0A 3FBUA 3R1KA 3PGPA 2J9AA 3FF3A 4B5PB 2PR1A 3H8EA 2EUIA 2Q04A 4UF4A 1Z5RA 3DGVA 1KWMA 1JWQA 2X7BA 1YVKA 3NA6A 4F9VA 4CGNA 2HUZA 4Q7AA 1KZFA 2C6PA 5AG4A 3ZJ0A 5AG5A 3S9LA 4F8ZA 4KVOE 1QQ9A 2ARHA 2K5TA 2PJBA 5IV0A 5A27A 5AGEA 4NXYA 5D29A 4MY0A 3D7DA 5AG7A 2PE3A 5JGFA 1KUYA 4JLYA 4H2KA 1ZO0A 3B7IA 1IICA 1XMTA 2FIAA 5GCNA 2CY2A 1CG2A 2DF5A 4B14A 2ZEHA 2REFA 5K8PA 2JEVA 1RTQA 1LFWA 4KOWA 1QSOA 2HQYA 2PJ6A 3CZXA 4MJ8A 3T9YA 3B8GA 5JPHA 1CP6A 4K30A 2QECA 2PJ8A 1DTDA 3T90A 1YW6A 3I1UA 2V77A 5EMIA 3GUXA 4Y49B 4FBEA 4UEFA 2ATRA 4ZBGA 1KUVA 3IIBA 1CJWA 4KSAA 4MHPA 2AE6A 2B5GB 2WSAA 4A38A 4ZYQA 3H4QA 4PXCA 4R7MA 1RXTA 2FIWA 2NSMA 2DPTA 2P6EA 2ZOGA 2B3UA 4OP4A 1BPMA 2BCOA 2EVNA 3FX6A 4KOTA 3PFOA 4ORFA 2CXAA 1MJAA 2OB0A 3K2KA 3ISXA 4A39A 4B13A 3BXMA 1S3ZA 3P2FA 1LANA 4JXQA 6CPAA 2DEAA 2RB7A 2OU2A 4AVBA 2PJ0A 3PB9X 1H8LA 2POKA 2OZGA 2HV2A 1YMEA 4JYWA 3V38A 4DNCA 3SI1A 3BJ8A 4CS0B 4MBUA 3TTHA 1CBXA 3LD2A 3S6KA 2V8VA 5FVJA 2FVGA 2G0BA 4A32A 1N71A 1LOKA 1J4JA 2CTCA 3I3GA 4OKOA 3CPAA 2EO8A 2B4DA 4OC1A 3TE4A 2FXFA 2A4NA 3KGQA 4G1PA 3D2PA 4KOVA 2ZW5A 4U9ZA 2C1CA 3CT9A 5H84A 4MCPA 3EXNA 4OC5A 1ZLIA 3RYOA 4OIWA 2Z3KA 2JDCA 4CRYB 1Z8WA 3W6SA 2PSWA 5K8OA 3KHXA 2Q51A 3LACA 3WT4A 4AG7A 5JH9A 3PZJA 1Z4EA 5J8CA 1ON0A 2VEZA 2P6GA 5HMNA 2V8GA 2QIRA 3FIXA 2PCUA 2ZEDA 4CYQA 5A28A 3D67A 1S7KA 3T8WA 2Q4YA 1X12A 1WK4A 3TOBA 4KUBA 3FYNA 1IB1E 3FVLA 4UFWA 1CM0A 4KOYA 2Z10A 1IYLA 1VHOA 4U9YA 5J1QA 4B6ZA 5IB9A 2DPSA 4GS4A 2G3AA 3R9FA 4Z65A 1Y9WA 4HNWB 5JQ4A 4KLWA 1ELMP 2OZUA 2Q0YA 2Y0MA 4UBRA 5F48A 3NFZA 4CGLA 3QAHA 1B6BA 3BJ7A 1HDQA 2VL1A 1VKCA 3CXPA 3CXSA 4E8OA 5THWA 4RUHA 1F2PA 5C88A 2ZEEA 3D66A 4NEXA 1YX0A 3FH4A 3D3SA 2FSRA 1QSRA 1OZPA 2FCKA 3WC5A 4C68A 5K8MA 5F09A 1BOBA 2Z11A 4HNXB 4GXHA 4NGNA 2D4PA 4Q36A 4AVCA 1NSAA 3KZWA 4B5PA 1V0CA 4OMEA 2J8RA 3TOAA 4KOSA 1IU8A 2ZPAA 4P4EA 3RZAA 4CRZB 2OOTA 1TKHA 4MFKA 2XEGA 4H6ZA 5G22A 4L89A 2AFMA 4RI1A 5F49A 4FWUA 4PK3A 2AFWA 4NGSA 2ZEOA 1CX8A 3S6GA 5HXDA 1S5KA 3WR7A 4QB9A 5KTAA 3FNCA 2D4OA 3S9MA 3PP9A 4OC2A 2PQ8A 1YVOA 1K4JA 2YNCA 4F0XA 2Q7SA 5LRKA 2JBJA 1Q7LA 1S7NA 5DWNA 3D4UA 4P4DA 2BSWA 4NGRA 1LAPA 2NYQA 2EBJA 2B58A 1XIXA 3VWEA 3FXTA 3ISZA 1ARLA 3WC7A 4CYOA 4MMOA 4P44A 4R8FA 5HVHA 2ODFA 2AFOA 4YGOA 1MJBA 2EWBA 4IK2A 1Z9UA 1XJOA 2AFZA 1Q2DA 3PFEA 4F0YA 4I49A 4HKFA 4A2ZA 1WWZA 4PSWA 3VATA 1LCPA 3SJEA 2NMTA 3QAYA 1YREA 1AMPA 3MGDA 2PIZA 1TKFA 2PJ3A 4JD6A 4MHYA 4YU9A 2PRBA 5LYDA 3GB0A 2C6GA 3DLJA 1CP7A 2ZOFA 3TO6A 2B5GA 5G21A 2VQYA 4MRIA 4P6YA 2GU2A 4PK2A 2ZEFA 3BLNA 2I00A 5BWAB 4QC6A 2YNCC 3GYAA 3KI9A 4MHDA 5EC4A 4P10A 2ZW4A 5AG6A 5CPAA 4XPLA 4KSIA 1Y0YA 5IB0A 4KSFA 2JLMA 2HB6A 2Z3MA 1XBUA 1PCAA 4P4FA 4CGOA 1CPXA 4EVYA 2Z3OA 3H8GA 4R6TA 2GREA 4M6GA 4XPKA 1MK4A 4ZX8A 2PJAA 4QVTA 2I3CA 4KLVA 4IF5A 5H86A 5LRGA 2QVPA 4B11A 4W9YA 3B3SA 4IAVA 4UFXA 3R9GA 4Y49C 4LQGA 1ELLP 1KUXA 2B3VA 2CIJA 2XEIA 2YGWA 4MFZA 1Z8XA 2GLJA 3G3SA 2VZYA 2PRQA 3EFAA 4NFRA 3SI2A 2YNDA 2PJCA 2ZENA 3KHZA 1JQGA 4MCSA 3TO7A 4AVAA 4UWIA 2PR8A 3PB8X 3SXOA 3GIUA 4PXBA 2RFHA 1HDUA 1PYTB 3P2HA 1LRZA 1UFHA 4GM5A 4NSQA 4X5KA 2VZZA 4PSXA 2ANPA 2B4BA 2ZXVA 4BD9A 4FD7A 4UEEA 1S60A 2BEIA 3OWCA 4CAFA 5C82A 1XMBA 4B12A 4OADA 4DYOA 1P4NA 3W91A 4MCQA 2P6FA 4ZX9A 4MFLA 4B5OA 4PXDA 1XRYA 1EE3P 5E96A 5HVFA 8CPAA 5I4MA 3S9NA 2OH1A 1M1DA 2Z3LA 3NH5A 4E2AA 3TFYA 4XPDB 4NJQA 4X3RA 4P4IA 2FS5A 4WWVA 3FMCA 3R9EA 3D8PA 3TT2A 3IWGA 2Q4ZA 4C7HA 4YRHA 3KR5A 1I1DA 3V8IA 3N7ZA 3RNZA 5LYIA 1NMTA 1SQHA 4RS2A 2GLFA 1YLEA 1Z4RA 2PJ2A 3F0AA 3R96A 1Q2YA 1QSNA 7CPAA 3LMSA 4KOUA 2PJ5A 5F47A 3D2MA 4JZ0A 2P0WA 2CNSA 2H5MA 2KCWA 2Z0ZA 3B3VA 4HPSA 4OC4A 2AFXA 2DXQA 4F6AA 4R87A 4EWTA 3GKRA 3B2YA 1BPNA 4MHZA 2R98A 1ZG8A 4FUUA 4XPDC 3F8KA 3KL9A 4O23A 2EK8A 1ARMA 1QSMA 2O53A 2PJ7A 2WUUA 2ABZA 2V8HA 2AFUA 4NGQA 3EY5A 1Z8LA 1AYEA 4KZTA 1CPSA 2RC4A 1I12A 4KVXA 1IOFA 1XEBA 4X8IA 2IL4A 3S6HA 2Q7BA 3SHPA 3LODA 2BL1A 2F7VA 2OR4A 4MI4A 2WYRA 4U5YA 3TCVA 4OC3A 3TC8A 5KTCA 3PEIA 2PVWA 4MXUA 3WC6A 2F5IA 4H6UA 4KORA 4M85A 1BAVA 3QB8A 1VGYA 4K3NA 4R3KA 4PXEA 5CNPA 5G20A 4A95A 3FEEA 4QBJA 3DR6A 3NH8A 1Y9KA 1Y0RA 3D68A 1M4IA 1QSTA 1U6MA 5KTDA 4C7IA 2PJ1A 2YNEA 3IFEA 2PVVA 4A30A 3BHXA 3H8FA 1S7FA 2Z3PA 3DDDA 3PB7X 4II9A 3K9UA 1YLOA 4C2YA 4NJRA 4BINA 2ZW7A 1R43A 3KQZA 3D7GA 4QUSA 4CPAA 1NE9A 4F9UA 4P4BA 1X10A 3L2NA 2R8VA 4AG9A 3C26A 4OAEA 4RN7A 1TXRA 2O4HA 1HEEA 1YW4A 3NH4A 3MN8A 4J3GA 2JDDA 3FJUA 5HVGA 4DJLA 2G3TA 4UA3A 1IGBA 1M44A 2I79A 1P0HA 3BI1A 4A33A 3LWUA 4R9MA 4MHNA 3A9LA 4A31A 3GY9A 2IMOA 2G9DA 1XFOA 3IGRA 3I9SA 3IWEA 3EC4A 1VHEA 4M6HA 1FT7A 4CAVA 3IWWA 2GANA 5G1ZA 3GLJA 1YSJA 4R3LA 2ZEPA 4TNUA 5HH1A 1OBRA 2J8MA 1Z8TA 1IOIA 4MFJA 4KS9A 5LYLA 1M4DA 5ISVA 4UCMA 3DR8A 3KKWA 1QMUA 5CBMA 4MCRA 2OZHA 4L8AA 3TX8A 5IX3A 1ZLHA 3IC1A 3BI0A 2J8NA 2WPWA 2JEWA 2Q43A 4EMEA 3VWDA 4ZGYB 2FE7A 2C6CA 3IO1A 2Z3NA 3PBEA 2BO9A 3K9TA 3MRUA 3W6XA 1XE4A 3B3WA 2CF4A 2VBQA 4FD6A 2PC1A 5I0CA 3HUVA 4UIAA 2VXKA 3SXNA 4A94A 4AB7A 1GHEA 1YQEA 1R3NA 2WPXA 3IEHA 5JM6A 3SJFA 1Y7RA 1BO4A 3VH9A 5LRJA 1M4GA 4E0AA 1Q2CA 2IQ6A 4UFVA 4CYPA 2GIVA 4LX9A 4YFJA 3UY5A 4ZY1A 2V8DA 4UCNA 3DNSA 2GE3A 3B3CA 4H89A 2AJ6A 1XOVA 3D7FA 1TF9A 2PIYA 1F2OA 2O28A 2QMLA 4C2ZA 2ZW6A 4CAWA 4UIBA 3CDXA 1TKJA 2PJ4A 1R57A 4XNHB 4WJBA 4KOXA 3NE7A 1TIQA 3G8WA 2CNTA 1MJ9A 3CXQA 4CYNA 4NCZA 3PB4X 4UEZA 3IU1A 4MFQA 3D7HA 2C27A 4LQ6A 3F5BA 5D8NA 5DS0A 3RAMA 4FD4A 3IU2A 3RO0A 2GFQA 1A2ZA 1YK3A 3TO9A 3N5FA 1YR0A 3RBUA 3S6FA 5LYFA 1BLLE 1Z2LA 4NGPA 2XEFA 5EBVA 3KQXA 2HC9A 3VARA 2BOAA 4OLLA 3KASA 4TWEA 4P4JA 1PU9A 3PRTA 5F46A 4XNHC 1I21A 5DWMA 4M6IA 4CGMA 3QNVA 2FT0A 1M4LA 3H5ZA 2WZNA 3JUWA 3SI0A 1TF8A 4ZY2A 4ONWA 4BBHA 1UWYA 5ELYA 3KR4A 2VI7A 4C2XA 4CAEA 4YWYA 4UCPA 1L0CA 4ONUA 4AXVA 2B4DB 2FL4A 4ZI6A 4UWJA 2PDOA 4PQAA 4EFDA 2R7HA 4HNYB 4X2TA 2IJZA 2ZELA 3IJ3A 2XEJA 4NF1A 4PPZA 4CAXA 3SJXA 1F57A 3NE8A 3PB6X 1Y7EA 1IYKA 5K8NA 4R57A 3E0KA 3V7ZA 4FD5A 4ZY0A 4KUAA 3B35A 4Q38A 3HLPA 1NSLA 1PUAA 2Q44A 1B87A
chains in the Genus database with same CATH topology
4JWPA 3JTKA 1RO5A 1YGHA 4BMHA 4PV6A 4JJXA 1S7LA 3R95A 4LUAA 1FY7A 4MY3A 3JVNA 3EO4A 1XF8A 1VHSA 2CNMA 4M3SA 2REEA 3ZZIA 3DSBA 4KVME 4MFPA 2Q4VA 3FRMA 5J8FA 2R1IA 4B10A 3FB3A 4IUSA 1IIDA 4JXRA 4CGPA 2BUEA 4B5PB 3FBUA 3R1KA 3PGPA 2PR1A 2EUIA 2Q04A 2X7BA 1YVKA 4CGNA 2HUZA 1KZFA 5AG4A 3ZJ0A 5AG5A 4KVOE 2ARHA 2K5TA 5IV0A 5A27A 5AGEA 4NXYA 4MY0A 5AG7A 1KUYA 4JLYA 1ZO0A 1IICA 1XMTA 2FIAA 5GCNA 2CY2A 4B14A 2REFA 2JEVA 4KOWA 1QSOA 2HQYA 3T9YA 4MJ8A 3B8GA 5JPHA 4K30A 2QECA 3T90A 4Y49B 2ATRA 4ZBGA 1KUVA 1CJWA 4KSAA 2AE6A 2B5GB 2WSAA 3H4QA 1RXTA 2FIWA 2P6EA 2DPTA 2B3UA 2EVNA 4KOTA 4ORFA 2CXAA 1MJAA 2OB0A 4B13A 3P2FA 1S3ZA 4JXQA 2OU2A 4AVBA 2OZGA 2HV2A 4DNCA 3BJ8A 4CS0B 4MBUA 3TTHA 3LD2A 3S6KA 5FVJA 2G0BA 4A32A 1N71A 3I3GA 1J4JA 2B4DA 3TE4A 2FXFA 2A4NA 3D2PA 4KOVA 2ZW5A 4U9ZA 5H84A 3EXNA 3RYOA 2Z3KA 2JDCA 4CRYB 3W6SA 2PSWA 4AG7A 3PZJA 1Z4EA 5J8CA 1ON0A 2VEZA 2P6GA 5HMNA 2QIRA 3FIXA 4CYQA 5A28A 1S7KA 2Q4YA 1WK4A 3TOBA 4KUBA 3FYNA 1IB1E 4UFWA 1CM0A 4KOYA 2Z10A 1IYLA 4U9YA 2DPSA 4GS4A 2G3AA 3R9FA 1Y9WA 4HNWB 5JQ4A 4KLWA 2OZUA 2Q0YA 2Y0MA 4UBRA 5F48A 4CGLA 3QAHA 1B6BA 3BJ7A 3CXPA 3CXSA 1VKCA 4E8OA 5C88A 4NEXA 1YX0A 4C68A 3D3SA 2FSRA 1QSRA 1OZPA 2FCKA 1BOBA 2Z11A 4HNXB 2D4PA 4Q36A 4AVCA 4B5PA 1V0CA 2J8RA 3TOAA 4KOSA 2ZPAA 4CRZB 4MFKA 4H6ZA 5G22A 4L89A 4RI1A 5F49A 4PK3A 3S6GA 1S5KA 3WR7A 4QB9A 5KTAA 3FNCA 2D4OA 3PP9A 2PQ8A 1YVOA 1K4JA 2YNCA 4F0XA 5DWNA 1S7NA 2BSWA 2B58A 1XIXA 3VWEA 3FXTA 4CYOA 4YGOA 1MJBA 1Z9UA 4F0YA 1Q2DA 4I49A 4HKFA 4A2ZA 1WWZA 4PSWA 2NMTA 1YREA 3MGDA 4JD6A 2PRBA 3TO6A 2B5GA 5G21A 2VQYA 4PK2A 3BLNA 2I00A 5BWAB 4QC6A 2YNCC 3GYAA 4MHDA 5EC4A 2ZW4A 5AG6A 4XPLA 5IB0A 4KSFA 2JLMA 2Z3MA 4CGOA 4EVYA 2Z3OA 4XPKA 1MK4A 4QVTA 4KLVA 4IF5A 5H86A 4B11A 4UFXA 3R9GA 4Y49C 1KUXA 2B3VA 4MFZA 2YGWA 3G3SA 2VZYA 3EFAA 2YNDA 3TO7A 4AVAA 4UWIA 2PR8A 3SXOA 3P2HA 1LRZA 1UFHA 4NSQA 4X5KA 2VZZA 4PSXA 2B4BA 2ZXVA 4FD7A 1S60A 2BEIA 3OWCA 4CAFA 5C82A 4B12A 4OADA 1P4NA 3W91A 2P6FA 4MFLA 4B5OA 5E96A 2OH1A 1M1DA 2Z3LA 4E2AA 3TFYA 4XPDB 2FS5A 3R9EA 3D8PA 3TT2A 3IWGA 4C7HA 4YRHA 1I1DA 3V8IA 3N7ZA 1NMTA 1SQHA 4RS2A 1YLEA 1Z4RA 3F0AA 3R96A 1Q2YA 1QSNA 4KOUA 5F47A 3D2MA 2CNSA 2H5MA 2KCWA 2P0WA 2Z0ZA 2DXQA 4F6AA 4R87A 3GKRA 2R98A 4XPDC 3F8KA 1QSMA 2WUUA 3EY5A 4KZTA 2RC4A 1I12A 4KVXA 3S6HA 1XEBA 3SHPA 2IL4A 2Q7BA 3LODA 2BL1A 4MI4A 4U5YA 3TCVA 5KTCA 2F5IA 4H6UA 4KORA 4M85A 3QB8A 4R3KA 5CNPA 5G20A 4A95A 4QBJA 3DR6A 1Y9KA 1M4IA 1QSTA 1U6MA 5KTDA 4C7IA 2YNEA 4A30A 1S7FA 2Z3PA 3DDDA 4II9A 3K9UA 4C2YA 2ZW7A 4QUSA 1NE9A 2R8VA 4AG9A 3C26A 4OAEA 4J3GA 2JDDA 2G3TA 4UA3A 1M44A 2I79A 1P0HA 4A33A 4R9MA 3A9LA 4A31A 3GY9A 3IGRA 3I9SA 3IWEA 3EC4A 4CAVA 2GANA 5G1ZA 4R3LA 5HH1A 2J8MA 4MFJA 4KS9A 1M4DA 5ISVA 4UCMA 3DR8A 3KKWA 2OZHA 4L8AA 5IX3A 2J8NA 2WPWA 3VWDA 4ZGYB 2FE7A 2Z3NA 3W6XA 1XE4A 2VBQA 4FD6A 2PC1A 5I0CA 3SXNA 2VXKA 4AB7A 1GHEA 2WPXA 1Y7RA 1BO4A 4E0AA 1M4GA 1Q2CA 4UFVA 4CYPA 2GIVA 4LX9A 4YFJA 3UY5A 4UCNA 3DNSA 2GE3A 4H89A 2AJ6A 4C2ZA 2O28A 2QMLA 2ZW6A 4CAWA 4XNHB 1R57A 4KOXA 3NE7A 1TIQA 3G8WA 2CNTA 1MJ9A 3CXQA 4CYNA 4NCZA 3IU1A 4MFQA 2C27A 3F5BA 4FD4A 3IU2A 1YK3A 3TO9A 1YR0A 3S6FA 5EBVA 4OLLA 1PU9A 5F46A 4XNHC 1I21A 5DWMA 4CGMA 2FT0A 3H5ZA 3JUWA 4BBHA 2VI7A 4C2XA 4CAEA 4UCPA 1L0CA 4ONUA 2B4DB 2FL4A 4UWJA 2PDOA 2R7HA 4HNYB 4CAXA 4NF1A 1IYKA 4R57A 3E0KA 4FD5A 4KUAA 4Q38A 1NSLA 1PUAA 2Q44A 1B87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UFW A;  4CGO A;  4B10 A;  5G22 A;  3JTK A;  4UCN A;  4B14 A;  4CGM A;  4CAF A;  4B12 A;  4C2Z A;  4B13 A;  4CGP A;  3H5Z A;  5G20 A;  4BBH A;  4A33 A;  4A95 A;  4CAE A;  4C2X A;  4A31 A;  2WUU A;  2YNC A;  4UCP A;  4B11 A;  5G21 A;  4C7I A;  2YNE A;  4CGL A;  4UFX A;  4CYN A;  3IWE A;  4CGN A;  4A30 A;  3IU1 A;  5G1Z A;  5AG4 A;  4C2Y A;  4C68 A;  2YNC C;  4C7H A;  2YND A;  3IU2 A;  5AG5 A;  4CYO A;  5AG6 A;  5A27 A;  5AGE A;  4CYQ A;  5A28 A;  2WSA A;  4UFV A;  4UCM A;  5AG7 A;  4CYP A;  4A32 A;  4A2Z A; 
#chains in the Genus database with same CATH topology
 1ZG9 A;  2QYV A;  4JWP A;  2ZEG A;  4FAI A;  3JTK A;  1RO5 A;  1YGH A;  4BMH A;  3WAB A;  2PJ9 A;  2JBK A;  4PV6 A;  4JJX A;  1S7L A;  1VIX A;  3R95 A;  3PBB A;  1ZG7 A;  4LUA A;  2QJ8 A;  1FY7 A;  4MY3 A;  3JVN A;  2EK9 A;  2ZEM A;  1XF8 A;  3EO4 A;  3FED A;  1IY7 A;  2F8H A;  3FEC A;  3SJG A;  1VHS A;  2CNM A;  4IHM A;  4M3S A;  2REE A;  3ZZI A;  3DSB A;  4OID A;  2CTB A;  3CPX A;  4P45 A;  4KVM E;  1AUG A;  1FNO A;  4MFP A;  1GYT A;  2Q4V A;  4DUK A;  3FRM A;  1DE4 C;  4NGM A;  5J8F A;  3B3T A;  2R1I A;  4R76 A;  4B10 A;  1LAM A;  4NGT A;  2AFS A;  3FB3 A;  4IUS A;  4A37 A;  1IID A;  3JRU A;  4JXR A;  4CGP A;  2BUE A;  4OC0 A;  3FBU A;  3R1K A;  3PGP A;  2J9A A;  3FF3 A;  4B5P B;  2PR1 A;  3H8E A;  2EUI A;  2Q04 A;  4UF4 A;  1Z5R A;  3DGV A;  1KWM A;  1JWQ A;  2X7B A;  1YVK A;  3NA6 A;  4F9V A;  4CGN A;  2HUZ A;  4Q7A A;  1KZF A;  2C6P A;  5AG4 A;  3ZJ0 A;  5AG5 A;  3S9L A;  4F8Z A;  4KVO E;  1QQ9 A;  2ARH A;  2K5T A;  2PJB A;  5IV0 A;  5A27 A;  5AGE A;  4NXY A;  5D29 A;  4MY0 A;  3D7D A;  5AG7 A;  2PE3 A;  5JGF A;  1KUY A;  4JLY A;  4H2K A;  1ZO0 A;  3B7I A;  1IIC A;  1XMT A;  2FIA A;  5GCN A;  2CY2 A;  1CG2 A;  2DF5 A;  4B14 A;  2ZEH A;  2REF A;  5K8P A;  2JEV A;  1RTQ A;  1LFW A;  4KOW A;  1QSO A;  2HQY A;  2PJ6 A;  3CZX A;  4MJ8 A;  3T9Y A;  3B8G A;  5JPH A;  1CP6 A;  4K30 A;  2QEC A;  2PJ8 A;  1DTD A;  3T90 A;  1YW6 A;  3I1U A;  2V77 A;  5EMI A;  3GUX A;  4Y49 B;  4FBE A;  4UEF A;  2ATR A;  4ZBG A;  1KUV A;  3IIB A;  1CJW A;  4KSA A;  4MHP A;  2AE6 A;  2B5G B;  2WSA A;  4A38 A;  4ZYQ A;  3H4Q A;  4PXC A;  4R7M A;  1RXT A;  2FIW A;  2NSM A;  2DPT A;  2P6E A;  2ZOG A;  2B3U A;  4OP4 A;  1BPM A;  2BCO A;  2EVN A;  3FX6 A;  4KOT A;  3PFO A;  4ORF A;  2CXA A;  1MJA A;  2OB0 A;  3K2K A;  3ISX A;  4A39 A;  4B13 A;  3BXM A;  1S3Z A;  3P2F A;  1LAN A;  4JXQ A;  6CPA A;  2DEA A;  2RB7 A;  2OU2 A;  4AVB A;  2PJ0 A;  3PB9 X;  1H8L A;  2POK A;  2OZG A;  2HV2 A;  1YME A;  4JYW A;  3V38 A;  4DNC A;  3SI1 A;  3BJ8 A;  4CS0 B;  4MBU A;  3TTH A;  1CBX A;  3LD2 A;  3S6K A;  2V8V A;  5FVJ A;  2FVG A;  2G0B A;  4A32 A;  1N71 A;  1LOK A;  1J4J A;  2CTC A;  3I3G A;  4OKO A;  3CPA A;  2EO8 A;  2B4D A;  4OC1 A;  3TE4 A;  2FXF A;  2A4N A;  3KGQ A;  4G1P A;  3D2P A;  4KOV A;  2ZW5 A;  4U9Z A;  2C1C A;  3CT9 A;  5H84 A;  4MCP A;  3EXN A;  4OC5 A;  1ZLI A;  3RYO A;  4OIW A;  2Z3K A;  2JDC A;  4CRY B;  1Z8W A;  3W6S A;  2PSW A;  5K8O A;  3KHX A;  2Q51 A;  3LAC A;  3WT4 A;  4AG7 A;  5JH9 A;  3PZJ A;  1Z4E A;  5J8C A;  1ON0 A;  2VEZ A;  2P6G A;  5HMN A;  2V8G A;  2QIR A;  3FIX A;  2PCU A;  2ZED A;  4CYQ A;  5A28 A;  3D67 A;  1S7K A;  3T8W A;  2Q4Y A;  1X12 A;  1WK4 A;  3TOB A;  4KUB A;  3FYN A;  1IB1 E;  3FVL A;  4UFW A;  1CM0 A;  4KOY A;  2Z10 A;  1IYL A;  1VHO A;  4U9Y A;  5J1Q A;  4B6Z A;  5IB9 A;  2DPS A;  4GS4 A;  2G3A A;  3R9F A;  4Z65 A;  1Y9W A;  4HNW B;  5JQ4 A;  4KLW A;  1ELM P;  2OZU A;  2Q0Y A;  2Y0M A;  4UBR A;  5F48 A;  3NFZ A;  4CGL A;  3QAH A;  1B6B A;  3BJ7 A;  1HDQ A;  2VL1 A;  1VKC A;  3CXP A;  3CXS A;  4E8O A;  5THW A;  4RUH A;  1F2P A;  5C88 A;  2ZEE A;  3D66 A;  4NEX A;  1YX0 A;  3FH4 A;  3D3S A;  2FSR A;  1QSR A;  1OZP A;  2FCK A;  3WC5 A;  4C68 A;  5K8M A;  5F09 A;  1BOB A;  2Z11 A;  4HNX B;  4GXH A;  4NGN A;  2D4P A;  4Q36 A;  4AVC A;  1NSA A;  3KZW A;  4B5P A;  1V0C A;  4OME A;  2J8R A;  3TOA A;  4KOS A;  1IU8 A;  2ZPA A;  4P4E A;  3RZA A;  4CRZ B;  2OOT A;  1TKH A;  4MFK A;  2XEG A;  4H6Z A;  5G22 A;  4L89 A;  2AFM A;  4RI1 A;  5F49 A;  4FWU A;  4PK3 A;  2AFW A;  4NGS A;  2ZEO A;  1CX8 A;  3S6G A;  5HXD A;  1S5K A;  3WR7 A;  4QB9 A;  5KTA A;  3FNC A;  2D4O A;  3S9M A;  3PP9 A;  4OC2 A;  2PQ8 A;  1YVO A;  1K4J A;  2YNC A;  4F0X A;  2Q7S A;  5LRK A;  2JBJ A;  1Q7L A;  1S7N A;  5DWN A;  3D4U A;  4P4D A;  2BSW A;  4NGR A;  1LAP A;  2NYQ A;  2EBJ A;  2B58 A;  1XIX A;  3VWE A;  3FXT A;  3ISZ A;  1ARL A;  3WC7 A;  4CYO A;  4MMO A;  4P44 A;  4R8F A;  5HVH A;  2ODF A;  2AFO A;  4YGO A;  1MJB A;  2EWB A;  4IK2 A;  1Z9U A;  1XJO A;  2AFZ A;  1Q2D A;  3PFE A;  4F0Y A;  4I49 A;  4HKF A;  4A2Z A;  1WWZ A;  4PSW A;  3VAT A;  1LCP A;  3SJE A;  2NMT A;  3QAY A;  1YRE A;  1AMP A;  3MGD A;  2PIZ A;  1TKF A;  2PJ3 A;  4JD6 A;  4MHY A;  4YU9 A;  2PRB A;  5LYD A;  3GB0 A;  2C6G A;  3DLJ A;  1CP7 A;  2ZOF A;  3TO6 A;  2B5G A;  5G21 A;  2VQY A;  4MRI A;  4P6Y A;  2GU2 A;  4PK2 A;  2ZEF A;  3BLN A;  2I00 A;  5BWA B;  4QC6 A;  2YNC C;  3GYA A;  3KI9 A;  4MHD A;  5EC4 A;  4P10 A;  2ZW4 A;  5AG6 A;  5CPA A;  4XPL A;  4KSI A;  1Y0Y A;  5IB0 A;  4KSF A;  2JLM A;  2HB6 A;  2Z3M A;  1XBU A;  1PCA A;  4P4F A;  4CGO A;  1CPX A;  4EVY A;  2Z3O A;  3H8G A;  4R6T A;  2GRE A;  4M6G A;  4XPK A;  1MK4 A;  4ZX8 A;  2PJA A;  4QVT A;  2I3C A;  4KLV A;  4IF5 A;  5H86 A;  5LRG A;  2QVP A;  4B11 A;  4W9Y A;  3B3S A;  4IAV A;  4UFX A;  3R9G A;  4Y49 C;  4LQG A;  1ELL P;  1KUX A;  2B3V A;  2CIJ A;  2XEI A;  2YGW A;  4MFZ A;  1Z8X A;  2GLJ A;  3G3S A;  2VZY A;  2PRQ A;  3EFA A;  4NFR A;  3SI2 A;  2YND A;  2PJC A;  2ZEN A;  3KHZ A;  1JQG A;  4MCS A;  3TO7 A;  4AVA A;  4UWI A;  2PR8 A;  3PB8 X;  3SXO A;  3GIU A;  4PXB A;  2RFH A;  1HDU A;  1PYT B;  3P2H A;  1LRZ A;  1UFH A;  4GM5 A;  4NSQ A;  4X5K A;  2VZZ A;  4PSX A;  2ANP A;  2B4B A;  2ZXV A;  4BD9 A;  4FD7 A;  4UEE A;  1S60 A;  2BEI A;  3OWC A;  4CAF A;  5C82 A;  1XMB A;  4B12 A;  4OAD A;  4DYO A;  1P4N A;  3W91 A;  4MCQ A;  2P6F A;  4ZX9 A;  4MFL A;  4B5O A;  4PXD A;  1XRY A;  1EE3 P;  5E96 A;  5HVF A;  8CPA A;  5I4M A;  3S9N A;  2OH1 A;  1M1D A;  2Z3L A;  3NH5 A;  4E2A A;  3TFY A;  4XPD B;  4NJQ A;  4X3R A;  4P4I A;  2FS5 A;  4WWV A;  3FMC A;  3R9E A;  3D8P A;  3TT2 A;  3IWG A;  2Q4Z A;  4C7H A;  4YRH A;  3KR5 A;  1I1D A;  3V8I A;  3N7Z A;  3RNZ A;  5LYI A;  1NMT A;  1SQH A;  4RS2 A;  2GLF A;  1YLE A;  1Z4R A;  2PJ2 A;  3F0A A;  3R96 A;  1Q2Y A;  1QSN A;  7CPA A;  3LMS A;  4KOU A;  2PJ5 A;  5F47 A;  3D2M A;  4JZ0 A;  2P0W A;  2CNS A;  2H5M A;  2KCW A;  2Z0Z A;  3B3V A;  4HPS A;  4OC4 A;  2AFX A;  2DXQ A;  4F6A A;  4R87 A;  4EWT A;  3GKR A;  3B2Y A;  1BPN A;  4MHZ A;  2R98 A;  1ZG8 A;  4FUU A;  4XPD C;  3F8K A;  3KL9 A;  4O23 A;  2EK8 A;  1ARM A;  1QSM A;  2O53 A;  2PJ7 A;  2WUU A;  2ABZ A;  2V8H A;  2AFU A;  4NGQ A;  3EY5 A;  1Z8L A;  1AYE A;  4KZT A;  1CPS A;  2RC4 A;  1I12 A;  4KVX A;  1IOF A;  1XEB A;  4X8I A;  2IL4 A;  3S6H A;  2Q7B A;  3SHP A;  3LOD A;  2BL1 A;  2F7V A;  2OR4 A;  4MI4 A;  2WYR A;  4U5Y A;  3TCV A;  4OC3 A;  3TC8 A;  5KTC A;  3PEI A;  2PVW A;  4MXU A;  3WC6 A;  2F5I A;  4H6U A;  4KOR A;  4M85 A;  1BAV A;  3QB8 A;  1VGY A;  4K3N A;  4R3K A;  4PXE A;  5CNP A;  5G20 A;  4A95 A;  3FEE A;  4QBJ A;  3DR6 A;  3NH8 A;  1Y9K A;  1Y0R A;  3D68 A;  1M4I A;  1QST A;  1U6M A;  5KTD A;  4C7I A;  2PJ1 A;  2YNE A;  3IFE A;  2PVV A;  4A30 A;  3BHX A;  3H8F A;  1S7F A;  2Z3P A;  3DDD A;  3PB7 X;  4II9 A;  3K9U A;  1YLO A;  4C2Y A;  4NJR A;  4BIN A;  2ZW7 A;  1R43 A;  3KQZ A;  3D7G A;  4QUS A;  4CPA A;  1NE9 A;  4F9U A;  4P4B A;  1X10 A;  3L2N A;  2R8V A;  4AG9 A;  3C26 A;  4OAE A;  4RN7 A;  1TXR A;  2O4H A;  1HEE A;  1YW4 A;  3NH4 A;  3MN8 A;  4J3G A;  2JDD A;  3FJU A;  5HVG A;  4DJL A;  2G3T A;  4UA3 A;  1IGB A;  1M44 A;  2I79 A;  1P0H A;  3BI1 A;  4A33 A;  3LWU A;  4R9M A;  4MHN A;  3A9L A;  4A31 A;  3GY9 A;  2IMO A;  2G9D A;  1XFO A;  3IGR A;  3I9S A;  3IWE A;  3EC4 A;  1VHE A;  4M6H A;  1FT7 A;  4CAV A;  3IWW A;  2GAN A;  5G1Z A;  3GLJ A;  1YSJ A;  4R3L A;  2ZEP A;  4TNU A;  5HH1 A;  1OBR A;  2J8M A;  1Z8T A;  1IOI A;  4MFJ A;  4KS9 A;  5LYL A;  1M4D A;  5ISV A;  4UCM A;  3DR8 A;  3KKW A;  1QMU A;  5CBM A;  4MCR A;  2OZH A;  4L8A A;  3TX8 A;  5IX3 A;  1ZLH A;  3IC1 A;  3BI0 A;  2J8N A;  2WPW A;  2JEW A;  2Q43 A;  4EME A;  3VWD A;  4ZGY B;  2FE7 A;  2C6C A;  3IO1 A;  2Z3N A;  3PBE A;  2BO9 A;  3K9T A;  3MRU A;  3W6X A;  1XE4 A;  3B3W A;  2CF4 A;  2VBQ A;  4FD6 A;  2PC1 A;  5I0C A;  3HUV A;  4UIA A;  2VXK A;  3SXN A;  4A94 A;  4AB7 A;  1GHE A;  1YQE A;  1R3N A;  2WPX A;  3IEH A;  5JM6 A;  3SJF A;  1Y7R A;  1BO4 A;  3VH9 A;  5LRJ A;  1M4G A;  4E0A A;  1Q2C A;  2IQ6 A;  4UFV A;  4CYP A;  2GIV A;  4LX9 A;  4YFJ A;  3UY5 A;  4ZY1 A;  2V8D A;  4UCN A;  3DNS A;  2GE3 A;  3B3C A;  4H89 A;  2AJ6 A;  1XOV A;  3D7F A;  1TF9 A;  2PIY A;  1F2O A;  2O28 A;  2QML A;  4C2Z A;  2ZW6 A;  4CAW A;  4UIB A;  3CDX A;  1TKJ A;  2PJ4 A;  1R57 A;  4XNH B;  4WJB A;  4KOX A;  3NE7 A;  1TIQ A;  3G8W A;  2CNT A;  1MJ9 A;  3CXQ A;  4CYN A;  4NCZ A;  3PB4 X;  4UEZ A;  3IU1 A;  4MFQ A;  3D7H A;  2C27 A;  4LQ6 A;  3F5B A;  5D8N A;  5DS0 A;  3RAM A;  4FD4 A;  3IU2 A;  3RO0 A;  2GFQ A;  1A2Z A;  1YK3 A;  3TO9 A;  3N5F A;  1YR0 A;  3RBU A;  3S6F A;  5LYF A;  1BLL E;  1Z2L A;  4NGP A;  2XEF A;  5EBV A;  3KQX A;  2HC9 A;  3VAR A;  2BOA A;  4OLL A;  3KAS A;  4TWE A;  4P4J A;  1PU9 A;  3PRT A;  5F46 A;  4XNH C;  1I21 A;  5DWM A;  4M6I A;  4CGM A;  3QNV A;  2FT0 A;  1M4L A;  3H5Z A;  2WZN A;  3JUW A;  3SI0 A;  1TF8 A;  4ZY2 A;  4ONW A;  4BBH A;  1UWY A;  5ELY A;  3KR4 A;  2VI7 A;  4C2X A;  4CAE A;  4YWY A;  4UCP A;  1L0C A;  4ONU A;  4AXV A;  2B4D B;  2FL4 A;  4ZI6 A;  4UWJ A;  2PDO A;  4PQA A;  4EFD A;  2R7H A;  4HNY B;  4X2T A;  2IJZ A;  2ZEL A;  3IJ3 A;  2XEJ A;  4NF1 A;  4PPZ A;  4CAX A;  3SJX A;  1F57 A;  3NE8 A;  3PB6 X;  1Y7E A;  1IYK A;  5K8N A;  4R57 A;  3E0K A;  3V7Z A;  4FD5 A;  4ZY0 A;  4KUA A;  3B35 A;  4Q38 A;  3HLP A;  1NSL A;  1PUA A;  2Q44 A;  1B87 A; 
#chains in the Genus database with same CATH homology
 4JWP A;  3JTK A;  1RO5 A;  1YGH A;  4BMH A;  4PV6 A;  4JJX A;  1S7L A;  3R95 A;  4LUA A;  1FY7 A;  4MY3 A;  3JVN A;  3EO4 A;  1XF8 A;  1VHS A;  2CNM A;  4M3S A;  2REE A;  3ZZI A;  3DSB A;  4KVM E;  4MFP A;  2Q4V A;  3FRM A;  5J8F A;  2R1I A;  4B10 A;  3FB3 A;  4IUS A;  1IID A;  4JXR A;  4CGP A;  2BUE A;  4B5P B;  3FBU A;  3R1K A;  3PGP A;  2PR1 A;  2EUI A;  2Q04 A;  2X7B A;  1YVK A;  4CGN A;  2HUZ A;  1KZF A;  5AG4 A;  3ZJ0 A;  5AG5 A;  4KVO E;  2ARH A;  2K5T A;  5IV0 A;  5A27 A;  5AGE A;  4NXY A;  4MY0 A;  5AG7 A;  1KUY A;  4JLY A;  1ZO0 A;  1IIC A;  1XMT A;  2FIA A;  5GCN A;  2CY2 A;  4B14 A;  2REF A;  2JEV A;  4KOW A;  1QSO A;  2HQY A;  3T9Y A;  4MJ8 A;  3B8G A;  5JPH A;  4K30 A;  2QEC A;  3T90 A;  4Y49 B;  2ATR A;  4ZBG A;  1KUV A;  1CJW A;  4KSA A;  2AE6 A;  2B5G B;  2WSA A;  3H4Q A;  1RXT A;  2FIW A;  2P6E A;  2DPT A;  2B3U A;  2EVN A;  4KOT A;  4ORF A;  2CXA A;  1MJA A;  2OB0 A;  4B13 A;  3P2F A;  1S3Z A;  4JXQ A;  2OU2 A;  4AVB A;  2OZG A;  2HV2 A;  4DNC A;  3BJ8 A;  4CS0 B;  4MBU A;  3TTH A;  3LD2 A;  3S6K A;  5FVJ A;  2G0B A;  4A32 A;  1N71 A;  3I3G A;  1J4J A;  2B4D A;  3TE4 A;  2FXF A;  2A4N A;  3D2P A;  4KOV A;  2ZW5 A;  4U9Z A;  5H84 A;  3EXN A;  3RYO A;  2Z3K A;  2JDC A;  4CRY B;  3W6S A;  2PSW A;  4AG7 A;  3PZJ A;  1Z4E A;  5J8C A;  1ON0 A;  2VEZ A;  2P6G A;  5HMN A;  2QIR A;  3FIX A;  4CYQ A;  5A28 A;  1S7K A;  2Q4Y A;  1WK4 A;  3TOB A;  4KUB A;  3FYN A;  1IB1 E;  4UFW A;  1CM0 A;  4KOY A;  2Z10 A;  1IYL A;  4U9Y A;  2DPS A;  4GS4 A;  2G3A A;  3R9F A;  1Y9W A;  4HNW B;  5JQ4 A;  4KLW A;  2OZU A;  2Q0Y A;  2Y0M A;  4UBR A;  5F48 A;  4CGL A;  3QAH A;  1B6B A;  3BJ7 A;  3CXP A;  3CXS A;  1VKC A;  4E8O A;  5C88 A;  4NEX A;  1YX0 A;  4C68 A;  3D3S A;  2FSR A;  1QSR A;  1OZP A;  2FCK A;  1BOB A;  2Z11 A;  4HNX B;  2D4P A;  4Q36 A;  4AVC A;  4B5P A;  1V0C A;  2J8R A;  3TOA A;  4KOS A;  2ZPA A;  4CRZ B;  4MFK A;  4H6Z A;  5G22 A;  4L89 A;  4RI1 A;  5F49 A;  4PK3 A;  3S6G A;  1S5K A;  3WR7 A;  4QB9 A;  5KTA A;  3FNC A;  2D4O A;  3PP9 A;  2PQ8 A;  1YVO A;  1K4J A;  2YNC A;  4F0X A;  5DWN A;  1S7N A;  2BSW A;  2B58 A;  1XIX A;  3VWE A;  3FXT A;  4CYO A;  4YGO A;  1MJB A;  1Z9U A;  4F0Y A;  1Q2D A;  4I49 A;  4HKF A;  4A2Z A;  1WWZ A;  4PSW A;  2NMT A;  1YRE A;  3MGD A;  4JD6 A;  2PRB A;  3TO6 A;  2B5G A;  5G21 A;  2VQY A;  4PK2 A;  3BLN A;  2I00 A;  5BWA B;  4QC6 A;  2YNC C;  3GYA A;  4MHD A;  5EC4 A;  2ZW4 A;  5AG6 A;  4XPL A;  5IB0 A;  4KSF A;  2JLM A;  2Z3M A;  4CGO A;  4EVY A;  2Z3O A;  4XPK A;  1MK4 A;  4QVT A;  4KLV A;  4IF5 A;  5H86 A;  4B11 A;  4UFX A;  3R9G A;  4Y49 C;  1KUX A;  2B3V A;  4MFZ A;  2YGW A;  3G3S A;  2VZY A;  3EFA A;  2YND A;  3TO7 A;  4AVA A;  4UWI A;  2PR8 A;  3SXO A;  3P2H A;  1LRZ A;  1UFH A;  4NSQ A;  4X5K A;  2VZZ A;  4PSX A;  2B4B A;  2ZXV A;  4FD7 A;  1S60 A;  2BEI A;  3OWC A;  4CAF A;  5C82 A;  4B12 A;  4OAD A;  1P4N A;  3W91 A;  2P6F A;  4MFL A;  4B5O A;  5E96 A;  2OH1 A;  1M1D A;  2Z3L A;  4E2A A;  3TFY A;  4XPD B;  2FS5 A;  3R9E A;  3D8P A;  3TT2 A;  3IWG A;  4C7H A;  4YRH A;  1I1D A;  3V8I A;  3N7Z A;  1NMT A;  1SQH A;  4RS2 A;  1YLE A;  1Z4R A;  3F0A A;  3R96 A;  1Q2Y A;  1QSN A;  4KOU A;  5F47 A;  3D2M A;  2CNS A;  2H5M A;  2KCW A;  2P0W A;  2Z0Z A;  2DXQ A;  4F6A A;  4R87 A;  3GKR A;  2R98 A;  4XPD C;  3F8K A;  1QSM A;  2WUU A;  3EY5 A;  4KZT A;  2RC4 A;  1I12 A;  4KVX A;  3S6H A;  1XEB A;  3SHP A;  2IL4 A;  2Q7B A;  3LOD A;  2BL1 A;  4MI4 A;  4U5Y A;  3TCV A;  5KTC A;  2F5I A;  4H6U A;  4KOR A;  4M85 A;  3QB8 A;  4R3K A;  5CNP A;  5G20 A;  4A95 A;  4QBJ A;  3DR6 A;  1Y9K A;  1M4I A;  1QST A;  1U6M A;  5KTD A;  4C7I A;  2YNE A;  4A30 A;  1S7F A;  2Z3P A;  3DDD A;  4II9 A;  3K9U A;  4C2Y A;  2ZW7 A;  4QUS A;  1NE9 A;  2R8V A;  4AG9 A;  3C26 A;  4OAE A;  4J3G A;  2JDD A;  2G3T A;  4UA3 A;  1M44 A;  2I79 A;  1P0H A;  4A33 A;  4R9M A;  3A9L A;  4A31 A;  3GY9 A;  3IGR A;  3I9S A;  3IWE A;  3EC4 A;  4CAV A;  2GAN A;  5G1Z A;  4R3L A;  5HH1 A;  2J8M A;  4MFJ A;  4KS9 A;  1M4D A;  5ISV A;  4UCM A;  3DR8 A;  3KKW A;  2OZH A;  4L8A A;  5IX3 A;  2J8N A;  2WPW A;  3VWD A;  4ZGY B;  2FE7 A;  2Z3N A;  3W6X A;  1XE4 A;  2VBQ A;  4FD6 A;  2PC1 A;  5I0C A;  3SXN A;  2VXK A;  4AB7 A;  1GHE A;  2WPX A;  1Y7R A;  1BO4 A;  4E0A A;  1M4G A;  1Q2C A;  4UFV A;  4CYP A;  2GIV A;  4LX9 A;  4YFJ A;  3UY5 A;  4UCN A;  3DNS A;  2GE3 A;  4H89 A;  2AJ6 A;  4C2Z A;  2O28 A;  2QML A;  2ZW6 A;  4CAW A;  4XNH B;  1R57 A;  4KOX A;  3NE7 A;  1TIQ A;  3G8W A;  2CNT A;  1MJ9 A;  3CXQ A;  4CYN A;  4NCZ A;  3IU1 A;  4MFQ A;  2C27 A;  3F5B A;  4FD4 A;  3IU2 A;  1YK3 A;  3TO9 A;  1YR0 A;  3S6F A;  5EBV A;  4OLL A;  1PU9 A;  5F46 A;  4XNH C;  1I21 A;  5DWM A;  4CGM A;  2FT0 A;  3H5Z A;  3JUW A;  4BBH A;  2VI7 A;  4C2X A;  4CAE A;  4UCP A;  1L0C A;  4ONU A;  2B4D B;  2FL4 A;  4UWJ A;  2PDO A;  2R7H A;  4HNY B;  4CAX A;  4NF1 A;  1IYK A;  4R57 A;  3E0K A;  4FD5 A;  4KUA A;  4Q38 A;  1NSL A;  1PUA A;  2Q44 A;  1B87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...