4B10A

Plasmodium vivax n-myristoyltransferase with a non-hydrolysable co- factor
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
385
structure length
385
Chain Sequence
b'MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Design and Synthesis of Inhibitors of Plasmodium Falciparum N-Myristoyltransferase, a Promising Target for Anti-Malarial Drug Discovery.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 119
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4b10A00
4CAFA 2YNDA 4A2ZA 4A95A 4UFWA 4BBHA 4CYOA 4CGPA 4UFVA 4B14A 4C2YA 4CYNA 4CGLA 5G20A 4UCNA 4B10A 4C2ZA 4UCPA 2WUUA 5A27A 3H5ZA 5G21A 5AG6A 5G22A 5G1ZA 4C7HA 4C68A 5AG5A 4UFXA 4CAEA 2YNCC 4C2XA 4UCMA 4A33A 4CGMA 4A31A 5AG7A 4B12A 4CGNA 4CGOA 4A30A 4A32A 3JTKA 5AGEA 4CYQA 3IU1A 4B11A 2YNCA 3IWEA 5AG4A 3IU2A 2WSAA 4B13A 5A28A 2YNEA 4C7IA 4CYPA
chains in the Genus database with same CATH superfamily
2KCWA 2R7HA 5LRGA 4LQGA 3VWDA 2ZEPA 1HDUA 2C6PA 2NSMA 1I21A 4DJLA 5G20A 2HQYA 2PJ3A 1XOVA 1ARLA 2WUUA 3G8WA 5K8OA 5G22A 5K8MA 3PB6X 4NGMA 4PK2A 3D3SA 4F9VA 1B6BA 2G3TA 4UFXA 2F7VA 3SI0A 3RAMA 2OU2A 1MJ9A 1IICA 2QIRA 3D7HA 1XF8A 1VHOA 2Z3OA 2IQ6A 2CTBA 2YNCA 3BJ8A 4LX9A 1Z4EA 4KOSA 4TWEA 3SI2A 4C7IA 2D4OA 4NSQA 4YRHA 4CAFA 3TC8A 3ISXA 4JZ0A 4CYOA 4EWTA 4ZI6A 1XJOA 2CXAA 3PRTA 4H6UA 5LYLA 3A9LA 3JUWA 2V77A 2PJ5A 4ZY1A 2WZNA 4DUKA 2ZEFA 4UCNA 3H8FA 4UWJA 3B3WA 1KUXA 2C6CA 2ZENA 2V8DA 4NXYA 2ZW6A 4P4DA 3S9MA 2QJ8A 2Z0ZA 3W6SA 1VIXA 3DGVA 2IMOA 3D4UA 4JD6A 3B2YA 4PV6A 2PIZA 4P4EA 3V7ZA 3LODA 1XIXA 2PCUA 4A39A 1XE4A 5AG7A 4F0XA 4KSIA 1BPMA 2AFMA 4ZGYB 3D8PA 2VI7A 5ISVA 3CXPA 4FUUA 4OIWA 3WABA 3KQZA 4IF5A 3CZXA 2AFWA 5LYFA 3FNCA 4R6TA 1LFWA 2YNDA 4CS0B 2Q43A 3IIBA 2ATRA 3B35A 3B3SA 3FEEA 4DYOA 4XPLA 5HXDA 5HMNA 1CJWA 4P44A 1CP6A 2XEGA 5F47A 5J8FA 3S9LA 1Z8TA 4Q7AA 1XFOA 3BI1A 2PJ8A 1XRYA 2CNTA 2F5IA 4G1PA 4UEZA 1GHEA 5AG6A 4XPDC 3PEIA 2GFQA 4YGOA 4ZY2A 2GLFA 4RN7A 2C27A 3FYNA 4KLVA 4AG9A 2EO8A 2YNCC 4KOTA 4PSWA 2OB0A 3B3VA 4MJ8A 5DWNA 2P6EA 4B5PB 1IY7A 5HVGA 4A32A 1YK3A 2V8HA 5AGEA 1TIQA 2HV2A 1X10A 4JWPA 4F6AA 4Z65A 2PSWA 3TTHA 1FT7A 4B6ZA 4AVBA 2P0WA 2HB6A 1ZG7A 3NE8A 3R1KA 2Q4VA 1S60A 1XMTA 5GCNA 2ZEOA 2QVPA 4CYPA 2J8RA 2GLJA 2DPSA 1JWQA 2XEIA 1M44A 2ZEHA 1WK4A 1UWYA 4JJXA 1DTDA 1YW6A 4A37A 5EC4A 1JQGA 5HH1A 2Z3NA 2PDOA 5G1ZA 4C7HA 3W6XA 2PC1A 3D2MA 3LACA 3PP9A 4MFKA 2Z3MA 1BLLE 2Q51A 2PVVA 4E8OA 1CM0A 4P45A 8CPAA 1PUAA 1RXTA 4FD5A 3TOAA 4MHNA 3GYAA 3S6HA 4OLLA 3GUXA 2PJ0A 2X7BA 1L0CA 5A28A 5F49A 4GM5A 4OADA 1XBUA 2VEZA 3PFEA 4MHDA 2FE7A 2IJZA 3SHPA 1TKFA 3GB0A 2VBQA 3FECA 1V0CA 1OBRA 3NFZA 2Q7BA 4ZYQA 4NEXA 2I00A 3K2KA 2Q7SA 3SXOA 1HDQA 4MHZA 4UWIA 4NGNA 1YW4A 4R57A 3CPXA 3D2PA 1KZFA 1NSLA 3RYOA 3TFYA 4YWYA 1VGYA 1Y7EA 1ELMP 1M1DA 2DXQA 1PYTB 4GS4A 4JLYA 1TKJA 2B5GA 2JEWA 3FIXA 5CNPA 1YQEA 2ZXVA 3EO4A 2QMLA 5DWMA 3IWWA 4A31A 4L8AA 3NH5A 4MCRA 3HLPA 2Q4YA 4UF4A 2VL1A 2EK8A 3BI0A 5C82A 2WPXA 1DE4C 1SQHA 1ZG8A 4NGSA 3KR5A 4KOUA 4KLWA 4BBHA 3VWEA 3G3SA 3T90A 1N71A 1EE3P 1U6MA 3MGDA 4IAVA 2JDCA 4RI1A 1NMTA 4KSAA 1LCPA 1Y0RA 1F2OA 4MFQA 4PXDA 1H8LA 1YVKA 2PIYA 3K9UA 3NE7A 3P2HA 4M6HA 4UIAA 5AG5A 1XEBA 5K8NA 2PJ6A 3LD2A 2PJAA 1BAVA 3FF3A 2ZEDA 4PK3A 3KZWA 4CGNA 5LRJA 3TCVA 1M4IA 2DF5A 4E2AA 4FAIA 4Y49C 2PJ7A 4HKFA 2BO9A 3IU2A 2B4DB 1B87A 4P4JA 4LUAA 1IOIA 3R9FA 4U5YA 3V38A 2ARHA 3CDXA 5I4MA 1Y7RA 2Q44A 4Q36A 1S5KA 2ZOFA 2ZW4A 3DSBA 4IK2A 4IHMA 3SXNA 3K9TA 2I3CA 4W9YA 2EWBA 1TXRA 5FVJA 5A27A 1LRZA 5G21A 4PPZA 3BJ7A 4MRIA 4U9ZA 1VHEA 2BOAA 4TNUA 5HVHA 1IB1E 3BHXA 1QSRA 1ARMA 2CF4A 3D67A 2XEFA 2NYQA 2BUEA 1S7LA 2BL1A 2C1CA 3I1UA 4ONWA 2PJ9A 2WPWA 4ORFA 1Z2LA 4OC0A 3IWGA 3TX8A 3R95A 2IL4A 3QNVA 2Z10A 5LYDA 4BD9A 1QSTA 3IC1A 2REFA 2JBKA 4A2ZA 2J8MA 4AB7A 5E96A 2PJ4A 4LQ6A 4B14A 4C2YA 4JYWA 6CPAA 4A94A 2FS5A 1CP7A 2OZHA 3TE4A 1R3NA 2Y0MA 4P4BA 2AFZA 4MBUA 4F8ZA 2V8GA 3FB3A 3S9NA 5IB0A 1HEEA 2OR4A 3GLJA 1Q2YA 5JPHA 1BPNA 4A38A 1ZLHA 3NH8A 4XPDB 2PRQA 4X3RA 3DLJA 4I49A 1ZG9A 4HNWB 4NGQA 3QB8A 2POKA 4O23A 3MRUA 2O4HA 4C2XA 4CAEA 2GANA 2AFOA 4RUHA 4OC3A 4R76A 4MCSA 1YVOA 4KZTA 5AG4A 2WSAA 1Z4RA 1LANA 1R57A 4J3GA 2D4PA 3LWUA 3SJEA 3TT2A 4WJBA 3EXNA 4MHPA 3NH4A 3JVNA 4YFJA 2BSWA 4CPAA 2FSRA 1Z9UA 1CPSA 1IU8A 3WC7A 4CGLA 4ZBGA 2P6FA 4YU9A 1PU9A 4UA3A 2F8HA 4X8IA 1Q7LA 1CG2A 3KR4A 4UEFA 2Z3LA 4M3SA 4OMEA 4QC6A 2PJCA 2EUIA 3DNSA 4P6YA 1AUGA 1MJBA 2QYVA 4FD7A 2B3VA 4CGOA 2I79A 3BXMA 1ZLIA 4AG7A 4M6IA 4NJQA 3PB8X 2Z11A 4IUSA 4NCZA 3KHZA 1S7NA 4R7MA 4FD4A 5LYIA 3B8GA 1YREA 4CAWA 3DDDA 4R87A 1P4NA 3FX6A 4KUBA 2AFSA 3KGQA 1J4JA 4E0AA 5CBMA 2GIVA 5D8NA 2FXFA 2G0BA 3F8KA 2FIAA 1A2ZA 3CT9A 4C2ZA 4H89A 2Q0YA 1S7KA 4M85A 3R9EA 4QB9A 2CNSA 3F0AA 3L2NA 1R43A 4PXEA 3BLNA 4X2TA 4XPKA 5HVFA 3ZJ0A 3C26A 5BWAB 3VARA 3HUVA 1YX0A 1LAMA 3WR7A 4A33A 4FBEA 2HUZA 2Z3PA 2ZEEA 4ONUA 5I0CA 1RO5A 3WC5A 5IB9A 2FL4A 5JH9A 2VZZA 4XNHC 4MFLA 2ZEGA 3EY5A 2RC4A 2PJ1A 3EFAA 3SJXA 4H6ZA 5KTDA 2REEA 3GKRA 1YMEA 3PGPA 4MFZA 3NA6A 4AXVA 4QUSA 3RBUA 2A4NA 2PRBA 5F09A 1FNOA 4OC2A 1AMPA 2H5MA 1NSAA 2WYRA 3QAYA 4NGPA 4B5OA 2CTCA 4JXQA 1Z8XA 2B4BA 3KL9A 1ELLP 4UBRA 3I9SA 3I3GA 5J1QA 4KVXA 4NGRA 3H4QA 4QVTA 2C6GA 2OH1A 4K30A 1LAPA 1Y9KA 4PXCA 2R1IA 4PQAA 1F57A 2V8VA 4NF1A 4B12A 3KQXA 3N7ZA 3N5FA 3OWCA 4MXUA 4OC5A 3D68A 4B11A 3T8WA 3SI1A 1IIDA 1VHSA 3FJUA 3IWEA 4P4IA 4H2KA 4KOXA 3VATA 3PFOA 4HNXB 5KTCA 4HNYB 5CPAA 1M4DA 1IYKA 4KORA 4Y49B 5C88A 1QMUA 4EMEA 3WT4A 3CXSA 2NMTA 3B7IA 2ABZA 4BMHA 4EVYA 3TO9A 4FWUA 3GY9A 4P10A 5K8PA 4B10A 3FEDA 1CBXA 5H86A 4GXHA 3T9YA 2HC9A 4II9A 3KI9A 2PE3A 3P2FA 4X5KA 3H5ZA 1GYTA 4PXBA 2B5GB 1QSMA 1RTQA 2PJ2A 2CNMA 3KKWA 2ZEMA 3IJ3A 2CY2A 4UCMA 4CGMA 4KOYA 4MY0A 3WC6A 4AVAA 2JEVA 3IU1A 4FD6A 4CRZB 2ODFA 4B5PA 3H8GA 1Q2DA 1Z8WA 3FMCA 3IGRA 4K3NA 4MCQA 2QECA 3DR8A 4PSXA 5EBVA 3FRMA 5THWA 3SJFA 3SJGA 4MY3A 2JLMA 2YGWA 2G3AA 3TOBA 4NFRA 1BO4A 3PBBA 4BINA 4KVOE 1S3ZA 4KS9A 1Y0YA 2RFHA 4CRYB 3RO0A 4KVME 2OOTA 1TF9A 2EBJA 4ZX9A 1WWZA 4MFPA 3S6KA 1M4GA 4MMOA 4OAEA 3RNZA 2PQ8A 1BOBA 2AE6A 4C68A 5J8CA 4CAVA 1S7FA 2JDDA 3D7FA 2FIWA 3E0KA 4Q38A 5JQ4A 1AYEA 1CPXA 2O53A 3D7GA 1IOFA 2ZPAA 4HPSA 4KOWA 4DNCA 5KTAA 3JRUA 3KHXA 4QBJA 2YNEA 2AFXA 4CYNA 2R98A 4KSFA 4R3LA 1YGHA 4F0YA 4OP4A 4OC1A 4UFWA 2PJBA 2VXKA 3D7DA 4UIBA 4WWVA 4AVCA 2PVWA 4KUAA 2GU2A 1CX8A 2Q04A 1Z5RA 2ZW7A 1M4LA 2O28A 3ISZA 3TO7A 3CXQA 3W91A 3B3CA 2DPTA 2VQYA 2GE3A 3FVLA 4U9YA 3V8IA 1KUYA 1ON0A 2CIJA 3PB7X 3VH9A 1LOKA 2EK9A 2OZGA 4P4FA 3KASA 3TO6A 4EFDA 1XMBA 3ZZIA 5F46A 1OZPA 1YSJA 3F5BA 2FT0A 2FVGA 3IFEA 4B13A 3PZJA 3DR6A 3S6GA 2BEIA 3LMSA 1PCAA 1KUVA 4JXRA 1QSNA 1MJAA 2GREA 2VZYA 3PB4X 5H84A 2J8NA 1Q2CA 2ZW5A 3FBUA 3FH4A 3GIUA 3QAHA 4M6GA 4NJRA 5ELYA 4CGPA 4ZY0A 7CPAA 2XEJA 3EC4A 2Q4ZA 3IEHA 4UEEA 2JBJA 1IYLA 1I12A 1TF8A 2PR8A 3FXTA 1P0HA 3D66A 4ZX8A 3UY5A 1VKCA 4RS2A 2EVNA 1Z8LA 4CAXA 5JGFA 4A30A 2ZELA 1ZO0A 2OZUA 4CYQA 2FCKA 2ANPA 2G9DA 2K5TA 3PB9X 3MN8A 2DEAA 3CPAA 3R9GA 1MK4A 4NGTA 1TKHA 4MCPA 3S6FA 2PR1A 2B3UA 2AJ6A 5F48A 1IGBA 1QSOA 4XNHB 1F2PA 2B4DA 4A95A 4UFVA 1I1DA 5JM6A 1FY7A 1YLEA 5IX3A 4L89A 1QQ9A 4UCPA 1YLOA 3PBEA 1UFHA 3H8EA 2ZOGA 4R9MA 4MHYA 2AFUA 2J9AA 4OIDA 2BCOA 4MFJA 4R3KA 2P6GA 1NE9A 4OC4A 1KWMA 4R8FA 3R96A 3RZAA 2Z3KA 1Y9WA 1K4JA 1X12A 3JTKA 3B3TA 5LRKA 3IO1A 4KOVA 5EMIA 1YR0A 2R8VA 5DS0A 2B58A 4OKOA 4F9UA 4MI4A 2RB7A 5IV0A 5D29A
chains in the Genus database with same CATH topology
2KCWA 2R7HA 3VWDA 1I21A 5G20A 2HQYA 2WUUA 3G8WA 5G22A 4PK2A 3D3SA 1B6BA 2G3TA 4UFXA 2OU2A 1MJ9A 1IICA 2QIRA 1XF8A 2Z3OA 2YNCA 3BJ8A 4LX9A 1Z4EA 4KOSA 4C7IA 2D4OA 4NSQA 4YRHA 4CAFA 4CYOA 2CXAA 4H6UA 3A9LA 3JUWA 4UCNA 4UWJA 1KUXA 4NXYA 2ZW6A 2Z0ZA 3W6SA 4JD6A 4PV6A 3LODA 1XIXA 1XE4A 5AG7A 4F0XA 4ZGYB 3D8PA 2VI7A 5ISVA 3CXPA 4IF5A 3FNCA 2YNDA 4CS0B 2ATRA 4XPLA 5HMNA 1CJWA 5J8FA 5F47A 2F5IA 2CNTA 1GHEA 5AG6A 4XPDC 4YGOA 2C27A 3FYNA 4KLVA 4AG9A 2YNCC 4KOTA 4PSWA 2OB0A 4MJ8A 5DWNA 2P6EA 4B5PB 4A32A 1YK3A 5AGEA 1TIQA 2HV2A 4JWPA 4F6AA 2PSWA 3TTHA 4AVBA 2P0WA 3R1KA 5GCNA 4CYPA 2Q4VA 1S60A 1XMTA 2J8RA 2DPSA 1M44A 1WK4A 4JJXA 5EC4A 5HH1A 2Z3NA 2PDOA 5G1ZA 4C7HA 3W6XA 2PC1A 3D2MA 3PP9A 4MFKA 2Z3MA 4E8OA 1CM0A 1PUAA 1RXTA 4FD5A 3TOAA 3GYAA 3S6HA 4OLLA 2X7BA 1L0CA 5A28A 5F49A 4OADA 2VEZA 4MHDA 2FE7A 3SHPA 2VBQA 1V0CA 2Q7BA 4NEXA 2I00A 3SXOA 5C88A 4UWIA 4R57A 1NSLA 3D2PA 3RYOA 1KZFA 3TFYA 4JLYA 1M1DA 2DXQA 4GS4A 2B5GA 3FIXA 5CNPA 2ZXVA 3EO4A 2QMLA 5DWMA 4A31A 4L8AA 2Q4YA 5C82A 2WPXA 1SQHA 4KOUA 4KLWA 4BBHA 3VWEA 3G3SA 3T90A 1N71A 1U6MA 3MGDA 2JDCA 4RI1A 1NMTA 4KSAA 4MFQA 1YVKA 3K9UA 3NE7A 3P2HA 5AG5A 1XEBA 3LD2A 4PK3A 4CGNA 3TCVA 1M4IA 4E2AA 4Y49C 4HKFA 3IU2A 2B4DB 1B87A 4LUAA 3R9FA 4U5YA 2ARHA 1Y7RA 2Q44A 4Q36A 1S5KA 2ZW4A 3DSBA 3SXNA 5FVJA 5A27A 1LRZA 5G21A 3BJ7A 4U9ZA 1IB1E 1QSRA 2BUEA 1S7LA 2BL1A 2WPWA 4ORFA 3IWGA 3R95A 2IL4A 2Z10A 1QSTA 2REFA 4A2ZA 2J8MA 4AB7A 5E96A 4B14A 4C2YA 2FS5A 2OZHA 3TE4A 2Y0MA 4MBUA 3FB3A 5IB0A 1Q2YA 5JPHA 4XPDB 4I49A 4CAEA 4HNWB 3QB8A 4C2XA 2GANA 1YVOA 4KZTA 5AG4A 2WSAA 1Z4RA 1R57A 4J3GA 2D4PA 3TT2A 3EXNA 3JVNA 4YFJA 2BSWA 2FSRA 1Z9UA 4CGLA 4ZBGA 2P6FA 1PU9A 4UA3A 2Z3LA 4M3SA 4QC6A 2EUIA 3DNSA 1MJBA 4FD7A 2B3VA 4CGOA 2I79A 4AG7A 2Z11A 4IUSA 4NCZA 1S7NA 4FD4A 3B8GA 1YREA 4CAWA 3DDDA 4R87A 1P4NA 4KUBA 1J4JA 4E0AA 2GIVA 2FXFA 2G0BA 3F8KA 2FIAA 4C2ZA 4H89A 2Q0YA 1S7KA 4M85A 3R9EA 4QB9A 2CNSA 3F0AA 3BLNA 4XPKA 5BWAB 3ZJ0A 3C26A 3WR7A 1YX0A 4A33A 2HUZA 2Z3PA 4ONUA 5I0CA 1RO5A 2FL4A 2VZZA 4XNHC 4MFLA 3EY5A 2RC4A 3EFAA 4H6ZA 5KTDA 2REEA 3GKRA 3PGPA 4MFZA 4QUSA 2A4NA 2PRBA 2H5MA 4B5OA 4JXQA 2B4BA 4UBRA 3I9SA 3I3GA 4KVXA 3H4QA 4QVTA 2OH1A 4K30A 1Y9KA 2R1IA 4NF1A 4B12A 3N7ZA 3OWCA 4B11A 1IIDA 1VHSA 3IWEA 4KOXA 4HNXB 5KTCA 4HNYB 1M4DA 1IYKA 4KORA 4Y49B 3CXSA 2NMTA 4BMHA 4EVYA 3TO9A 3GY9A 4B10A 5H86A 3T9YA 4II9A 3P2FA 4X5KA 3H5ZA 2B5GB 1QSMA 2CNMA 3KKWA 2CY2A 4UCMA 4CGMA 4KOYA 4MY0A 4AVAA 2JEVA 3IU1A 4FD6A 4CRZB 4B5PA 1Q2DA 3IGRA 2QECA 3DR8A 4PSXA 5EBVA 3FRMA 4MY3A 2JLMA 2YGWA 2G3AA 3TOBA 1BO4A 4KVOE 1S3ZA 4KS9A 4CRYB 4KVME 1WWZA 4MFPA 3S6KA 1M4GA 4OAEA 2PQ8A 1BOBA 2AE6A 4C68A 5J8CA 4CAVA 1S7FA 2JDDA 2FIWA 3E0KA 4Q38A 5JQ4A 2ZPAA 4KOWA 4DNCA 5KTAA 4QBJA 2YNEA 4CYNA 2R98A 4KSFA 4R3LA 1YGHA 4F0YA 4UFWA 2VXKA 4AVCA 4KUAA 2Q04A 2ZW7A 3W91A 2O28A 3TO7A 3CXQA 2DPTA 2VQYA 2GE3A 4U9YA 3V8IA 1KUYA 1ON0A 2OZGA 3TO6A 3ZZIA 5F46A 1OZPA 3F5BA 2FT0A 4B13A 3PZJA 3DR6A 3S6GA 2BEIA 1KUVA 4JXRA 1QSNA 1MJAA 2VZYA 5H84A 2J8NA 1Q2CA 2ZW5A 3FBUA 3QAHA 4CGPA 3EC4A 1IYLA 1I12A 2PR8A 3FXTA 1P0HA 3UY5A 1VKCA 4RS2A 2EVNA 4CAXA 4A30A 1ZO0A 2OZUA 4CYQA 2FCKA 2K5TA 3R9GA 1MK4A 3S6FA 2PR1A 2B3UA 2AJ6A 5F48A 4XNHB 1QSOA 4A95A 2B4DA 4UFVA 1I1DA 1FY7A 1YLEA 5IX3A 4L89A 4UCPA 1UFHA 4R9MA 4MFJA 4R3KA 2P6GA 1NE9A 3R96A 2Z3KA 1Y9WA 1K4JA 3JTKA 4KOVA 1YR0A 2R8VA 2B58A 4MI4A 5IV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CAF A;  2YND A;  4A2Z A;  4A95 A;  4UFW A;  4BBH A;  4CYO A;  4CGP A;  4UFV A;  4B14 A;  4C2Y A;  4CYN A;  4CGL A;  5G20 A;  4UCN A;  4B10 A;  4C2Z A;  4UCP A;  2WUU A;  5A27 A;  3H5Z A;  5G21 A;  5AG6 A;  5G22 A;  5G1Z A;  4C7H A;  4C68 A;  5AG5 A;  4UFX A;  4CAE A;  2YNC C;  4C2X A;  4UCM A;  4A33 A;  4CGM A;  4A31 A;  5AG7 A;  4B12 A;  4CGN A;  4CGO A;  4A30 A;  4A32 A;  3JTK A;  5AGE A;  4CYQ A;  3IU1 A;  4B11 A;  2YNC A;  3IWE A;  5AG4 A;  3IU2 A;  2WSA A;  4B13 A;  5A28 A;  2YNE A;  4C7I A;  4CYP A; 
#chains in the Genus database with same CATH topology
 2KCW A;  2R7H A;  5LRG A;  4LQG A;  3VWD A;  2ZEP A;  1HDU A;  2C6P A;  2NSM A;  1I21 A;  4DJL A;  5G20 A;  2HQY A;  2PJ3 A;  1XOV A;  1ARL A;  2WUU A;  3G8W A;  5K8O A;  5G22 A;  5K8M A;  3PB6 X;  4NGM A;  4PK2 A;  3D3S A;  4F9V A;  1B6B A;  2G3T A;  4UFX A;  2F7V A;  3SI0 A;  3RAM A;  2OU2 A;  1MJ9 A;  1IIC A;  2QIR A;  3D7H A;  1XF8 A;  1VHO A;  2Z3O A;  2IQ6 A;  2CTB A;  2YNC A;  3BJ8 A;  4LX9 A;  1Z4E A;  4KOS A;  4TWE A;  3SI2 A;  4C7I A;  2D4O A;  4NSQ A;  4YRH A;  4CAF A;  3TC8 A;  3ISX A;  4JZ0 A;  4CYO A;  4EWT A;  4ZI6 A;  1XJO A;  2CXA A;  3PRT A;  4H6U A;  5LYL A;  3A9L A;  3JUW A;  2V77 A;  2PJ5 A;  4ZY1 A;  2WZN A;  4DUK A;  2ZEF A;  4UCN A;  3H8F A;  4UWJ A;  3B3W A;  1KUX A;  2C6C A;  2ZEN A;  2V8D A;  4NXY A;  2ZW6 A;  4P4D A;  3S9M A;  2QJ8 A;  2Z0Z A;  3W6S A;  1VIX A;  3DGV A;  2IMO A;  3D4U A;  4JD6 A;  3B2Y A;  4PV6 A;  2PIZ A;  4P4E A;  3V7Z A;  3LOD A;  1XIX A;  2PCU A;  4A39 A;  1XE4 A;  5AG7 A;  4F0X A;  4KSI A;  1BPM A;  2AFM A;  4ZGY B;  3D8P A;  2VI7 A;  5ISV A;  3CXP A;  4FUU A;  4OIW A;  3WAB A;  3KQZ A;  4IF5 A;  3CZX A;  2AFW A;  5LYF A;  3FNC A;  4R6T A;  1LFW A;  2YND A;  4CS0 B;  2Q43 A;  3IIB A;  2ATR A;  3B35 A;  3B3S A;  3FEE A;  4DYO A;  4XPL A;  5HXD A;  5HMN A;  1CJW A;  4P44 A;  1CP6 A;  2XEG A;  5F47 A;  5J8F A;  3S9L A;  1Z8T A;  4Q7A A;  1XFO A;  3BI1 A;  2PJ8 A;  1XRY A;  2CNT A;  2F5I A;  4G1P A;  4UEZ A;  1GHE A;  5AG6 A;  4XPD C;  3PEI A;  2GFQ A;  4YGO A;  4ZY2 A;  2GLF A;  4RN7 A;  2C27 A;  3FYN A;  4KLV A;  4AG9 A;  2EO8 A;  2YNC C;  4KOT A;  4PSW A;  2OB0 A;  3B3V A;  4MJ8 A;  5DWN A;  2P6E A;  4B5P B;  1IY7 A;  5HVG A;  4A32 A;  1YK3 A;  2V8H A;  5AGE A;  1TIQ A;  2HV2 A;  1X10 A;  4JWP A;  4F6A A;  4Z65 A;  2PSW A;  3TTH A;  1FT7 A;  4B6Z A;  4AVB A;  2P0W A;  2HB6 A;  1ZG7 A;  3NE8 A;  3R1K A;  2Q4V A;  1S60 A;  1XMT A;  5GCN A;  2ZEO A;  2QVP A;  4CYP A;  2J8R A;  2GLJ A;  2DPS A;  1JWQ A;  2XEI A;  1M44 A;  2ZEH A;  1WK4 A;  1UWY A;  4JJX A;  1DTD A;  1YW6 A;  4A37 A;  5EC4 A;  1JQG A;  5HH1 A;  2Z3N A;  2PDO A;  5G1Z A;  4C7H A;  3W6X A;  2PC1 A;  3D2M A;  3LAC A;  3PP9 A;  4MFK A;  2Z3M A;  1BLL E;  2Q51 A;  2PVV A;  4E8O A;  1CM0 A;  4P45 A;  8CPA A;  1PUA A;  1RXT A;  4FD5 A;  3TOA A;  4MHN A;  3GYA A;  3S6H A;  4OLL A;  3GUX A;  2PJ0 A;  2X7B A;  1L0C A;  5A28 A;  5F49 A;  4GM5 A;  4OAD A;  1XBU A;  2VEZ A;  3PFE A;  4MHD A;  2FE7 A;  2IJZ A;  3SHP A;  1TKF A;  3GB0 A;  2VBQ A;  3FEC A;  1V0C A;  1OBR A;  3NFZ A;  2Q7B A;  4ZYQ A;  4NEX A;  2I00 A;  3K2K A;  2Q7S A;  3SXO A;  1HDQ A;  4MHZ A;  4UWI A;  4NGN A;  1YW4 A;  4R57 A;  3CPX A;  3D2P A;  1KZF A;  1NSL A;  3RYO A;  3TFY A;  4YWY A;  1VGY A;  1Y7E A;  1ELM P;  1M1D A;  2DXQ A;  1PYT B;  4GS4 A;  4JLY A;  1TKJ A;  2B5G A;  2JEW A;  3FIX A;  5CNP A;  1YQE A;  2ZXV A;  3EO4 A;  2QML A;  5DWM A;  3IWW A;  4A31 A;  4L8A A;  3NH5 A;  4MCR A;  3HLP A;  2Q4Y A;  4UF4 A;  2VL1 A;  2EK8 A;  3BI0 A;  5C82 A;  2WPX A;  1DE4 C;  1SQH A;  1ZG8 A;  4NGS A;  3KR5 A;  4KOU A;  4KLW A;  4BBH A;  3VWE A;  3G3S A;  3T90 A;  1N71 A;  1EE3 P;  1U6M A;  3MGD A;  4IAV A;  2JDC A;  4RI1 A;  1NMT A;  4KSA A;  1LCP A;  1Y0R A;  1F2O A;  4MFQ A;  4PXD A;  1H8L A;  1YVK A;  2PIY A;  3K9U A;  3NE7 A;  3P2H A;  4M6H A;  4UIA A;  5AG5 A;  1XEB A;  5K8N A;  2PJ6 A;  3LD2 A;  2PJA A;  1BAV A;  3FF3 A;  2ZED A;  4PK3 A;  3KZW A;  4CGN A;  5LRJ A;  3TCV A;  1M4I A;  2DF5 A;  4E2A A;  4FAI A;  4Y49 C;  2PJ7 A;  4HKF A;  2BO9 A;  3IU2 A;  2B4D B;  1B87 A;  4P4J A;  4LUA A;  1IOI A;  3R9F A;  4U5Y A;  3V38 A;  2ARH A;  3CDX A;  5I4M A;  1Y7R A;  2Q44 A;  4Q36 A;  1S5K A;  2ZOF A;  2ZW4 A;  3DSB A;  4IK2 A;  4IHM A;  3SXN A;  3K9T A;  2I3C A;  4W9Y A;  2EWB A;  1TXR A;  5FVJ A;  5A27 A;  1LRZ A;  5G21 A;  4PPZ A;  3BJ7 A;  4MRI A;  4U9Z A;  1VHE A;  2BOA A;  4TNU A;  5HVH A;  1IB1 E;  3BHX A;  1QSR A;  1ARM A;  2CF4 A;  3D67 A;  2XEF A;  2NYQ A;  2BUE A;  1S7L A;  2BL1 A;  2C1C A;  3I1U A;  4ONW A;  2PJ9 A;  2WPW A;  4ORF A;  1Z2L A;  4OC0 A;  3IWG A;  3TX8 A;  3R95 A;  2IL4 A;  3QNV A;  2Z10 A;  5LYD A;  4BD9 A;  1QST A;  3IC1 A;  2REF A;  2JBK A;  4A2Z A;  2J8M A;  4AB7 A;  5E96 A;  2PJ4 A;  4LQ6 A;  4B14 A;  4C2Y A;  4JYW A;  6CPA A;  4A94 A;  2FS5 A;  1CP7 A;  2OZH A;  3TE4 A;  1R3N A;  2Y0M A;  4P4B A;  2AFZ A;  4MBU A;  4F8Z A;  2V8G A;  3FB3 A;  3S9N A;  5IB0 A;  1HEE A;  2OR4 A;  3GLJ A;  1Q2Y A;  5JPH A;  1BPN A;  4A38 A;  1ZLH A;  3NH8 A;  4XPD B;  2PRQ A;  4X3R A;  3DLJ A;  4I49 A;  1ZG9 A;  4HNW B;  4NGQ A;  3QB8 A;  2POK A;  4O23 A;  3MRU A;  2O4H A;  4C2X A;  4CAE A;  2GAN A;  2AFO A;  4RUH A;  4OC3 A;  4R76 A;  4MCS A;  1YVO A;  4KZT A;  5AG4 A;  2WSA A;  1Z4R A;  1LAN A;  1R57 A;  4J3G A;  2D4P A;  3LWU A;  3SJE A;  3TT2 A;  4WJB A;  3EXN A;  4MHP A;  3NH4 A;  3JVN A;  4YFJ A;  2BSW A;  4CPA A;  2FSR A;  1Z9U A;  1CPS A;  1IU8 A;  3WC7 A;  4CGL A;  4ZBG A;  2P6F A;  4YU9 A;  1PU9 A;  4UA3 A;  2F8H A;  4X8I A;  1Q7L A;  1CG2 A;  3KR4 A;  4UEF A;  2Z3L A;  4M3S A;  4OME A;  4QC6 A;  2PJC A;  2EUI A;  3DNS A;  4P6Y A;  1AUG A;  1MJB A;  2QYV A;  4FD7 A;  2B3V A;  4CGO A;  2I79 A;  3BXM A;  1ZLI A;  4AG7 A;  4M6I A;  4NJQ A;  3PB8 X;  2Z11 A;  4IUS A;  4NCZ A;  3KHZ A;  1S7N A;  4R7M A;  4FD4 A;  5LYI A;  3B8G A;  1YRE A;  4CAW A;  3DDD A;  4R87 A;  1P4N A;  3FX6 A;  4KUB A;  2AFS A;  3KGQ A;  1J4J A;  4E0A A;  5CBM A;  2GIV A;  5D8N A;  2FXF A;  2G0B A;  3F8K A;  2FIA A;  1A2Z A;  3CT9 A;  4C2Z A;  4H89 A;  2Q0Y A;  1S7K A;  4M85 A;  3R9E A;  4QB9 A;  2CNS A;  3F0A A;  3L2N A;  1R43 A;  4PXE A;  3BLN A;  4X2T A;  4XPK A;  5HVF A;  3ZJ0 A;  3C26 A;  5BWA B;  3VAR A;  3HUV A;  1YX0 A;  1LAM A;  3WR7 A;  4A33 A;  4FBE A;  2HUZ A;  2Z3P A;  2ZEE A;  4ONU A;  5I0C A;  1RO5 A;  3WC5 A;  5IB9 A;  2FL4 A;  5JH9 A;  2VZZ A;  4XNH C;  4MFL A;  2ZEG A;  3EY5 A;  2RC4 A;  2PJ1 A;  3EFA A;  3SJX A;  4H6Z A;  5KTD A;  2REE A;  3GKR A;  1YME A;  3PGP A;  4MFZ A;  3NA6 A;  4AXV A;  4QUS A;  3RBU A;  2A4N A;  2PRB A;  5F09 A;  1FNO A;  4OC2 A;  1AMP A;  2H5M A;  1NSA A;  2WYR A;  3QAY A;  4NGP A;  4B5O A;  2CTC A;  4JXQ A;  1Z8X A;  2B4B A;  3KL9 A;  1ELL P;  4UBR A;  3I9S A;  3I3G A;  5J1Q A;  4KVX A;  4NGR A;  3H4Q A;  4QVT A;  2C6G A;  2OH1 A;  4K30 A;  1LAP A;  1Y9K A;  4PXC A;  2R1I A;  4PQA A;  1F57 A;  2V8V A;  4NF1 A;  4B12 A;  3KQX A;  3N7Z A;  3N5F A;  3OWC A;  4MXU A;  4OC5 A;  3D68 A;  4B11 A;  3T8W A;  3SI1 A;  1IID A;  1VHS A;  3FJU A;  3IWE A;  4P4I A;  4H2K A;  4KOX A;  3VAT A;  3PFO A;  4HNX B;  5KTC A;  4HNY B;  5CPA A;  1M4D A;  1IYK A;  4KOR A;  4Y49 B;  5C88 A;  1QMU A;  4EME A;  3WT4 A;  3CXS A;  2NMT A;  3B7I A;  2ABZ A;  4BMH A;  4EVY A;  3TO9 A;  4FWU A;  3GY9 A;  4P10 A;  5K8P A;  4B10 A;  3FED A;  1CBX A;  5H86 A;  4GXH A;  3T9Y A;  2HC9 A;  4II9 A;  3KI9 A;  2PE3 A;  3P2F A;  4X5K A;  3H5Z A;  1GYT A;  4PXB A;  2B5G B;  1QSM A;  1RTQ A;  2PJ2 A;  2CNM A;  3KKW A;  2ZEM A;  3IJ3 A;  2CY2 A;  4UCM A;  4CGM A;  4KOY A;  4MY0 A;  3WC6 A;  4AVA A;  2JEV A;  3IU1 A;  4FD6 A;  4CRZ B;  2ODF A;  4B5P A;  3H8G A;  1Q2D A;  1Z8W A;  3FMC A;  3IGR A;  4K3N A;  4MCQ A;  2QEC A;  3DR8 A;  4PSX A;  5EBV A;  3FRM A;  5THW A;  3SJF A;  3SJG A;  4MY3 A;  2JLM A;  2YGW A;  2G3A A;  3TOB A;  4NFR A;  1BO4 A;  3PBB A;  4BIN A;  4KVO E;  1S3Z A;  4KS9 A;  1Y0Y A;  2RFH A;  4CRY B;  3RO0 A;  4KVM E;  2OOT A;  1TF9 A;  2EBJ A;  4ZX9 A;  1WWZ A;  4MFP A;  3S6K A;  1M4G A;  4MMO A;  4OAE A;  3RNZ A;  2PQ8 A;  1BOB A;  2AE6 A;  4C68 A;  5J8C A;  4CAV A;  1S7F A;  2JDD A;  3D7F A;  2FIW A;  3E0K A;  4Q38 A;  5JQ4 A;  1AYE A;  1CPX A;  2O53 A;  3D7G A;  1IOF A;  2ZPA A;  4HPS A;  4KOW A;  4DNC A;  5KTA A;  3JRU A;  3KHX A;  4QBJ A;  2YNE A;  2AFX A;  4CYN A;  2R98 A;  4KSF A;  4R3L A;  1YGH A;  4F0Y A;  4OP4 A;  4OC1 A;  4UFW A;  2PJB A;  2VXK A;  3D7D A;  4UIB A;  4WWV A;  4AVC A;  2PVW A;  4KUA A;  2GU2 A;  1CX8 A;  2Q04 A;  1Z5R A;  2ZW7 A;  1M4L A;  2O28 A;  3ISZ A;  3TO7 A;  3CXQ A;  3W91 A;  3B3C A;  2DPT A;  2VQY A;  2GE3 A;  3FVL A;  4U9Y A;  3V8I A;  1KUY A;  1ON0 A;  2CIJ A;  3PB7 X;  3VH9 A;  1LOK A;  2EK9 A;  2OZG A;  4P4F A;  3KAS A;  3TO6 A;  4EFD A;  1XMB A;  3ZZI A;  5F46 A;  1OZP A;  1YSJ A;  3F5B A;  2FT0 A;  2FVG A;  3IFE A;  4B13 A;  3PZJ A;  3DR6 A;  3S6G A;  2BEI A;  3LMS A;  1PCA A;  1KUV A;  4JXR A;  1QSN A;  1MJA A;  2GRE A;  2VZY A;  3PB4 X;  5H84 A;  2J8N A;  1Q2C A;  2ZW5 A;  3FBU A;  3FH4 A;  3GIU A;  3QAH A;  4M6G A;  4NJR A;  5ELY A;  4CGP A;  4ZY0 A;  7CPA A;  2XEJ A;  3EC4 A;  2Q4Z A;  3IEH A;  4UEE A;  2JBJ A;  1IYL A;  1I12 A;  1TF8 A;  2PR8 A;  3FXT A;  1P0H A;  3D66 A;  4ZX8 A;  3UY5 A;  1VKC A;  4RS2 A;  2EVN A;  1Z8L A;  4CAX A;  5JGF A;  4A30 A;  2ZEL A;  1ZO0 A;  2OZU A;  4CYQ A;  2FCK A;  2ANP A;  2G9D A;  2K5T A;  3PB9 X;  3MN8 A;  2DEA A;  3CPA A;  3R9G A;  1MK4 A;  4NGT A;  1TKH A;  4MCP A;  3S6F A;  2PR1 A;  2B3U A;  2AJ6 A;  5F48 A;  1IGB A;  1QSO A;  4XNH B;  1F2P A;  2B4D A;  4A95 A;  4UFV A;  1I1D A;  5JM6 A;  1FY7 A;  1YLE A;  5IX3 A;  4L89 A;  1QQ9 A;  4UCP A;  1YLO A;  3PBE A;  1UFH A;  3H8E A;  2ZOG A;  4R9M A;  4MHY A;  2AFU A;  2J9A A;  4OID A;  2BCO A;  4MFJ A;  4R3K A;  2P6G A;  1NE9 A;  4OC4 A;  1KWM A;  4R8F A;  3R96 A;  3RZA A;  2Z3K A;  1Y9W A;  1K4J A;  1X12 A;  3JTK A;  3B3T A;  5LRK A;  3IO1 A;  4KOV A;  5EMI A;  1YR0 A;  2R8V A;  5DS0 A;  2B58 A;  4OKO A;  4F9U A;  4MI4 A;  2RB7 A;  5IV0 A;  5D29 A; 
#chains in the Genus database with same CATH homology
 2KCW A;  2R7H A;  3VWD A;  1I21 A;  5G20 A;  2HQY A;  2WUU A;  3G8W A;  5G22 A;  4PK2 A;  3D3S A;  1B6B A;  2G3T A;  4UFX A;  2OU2 A;  1MJ9 A;  1IIC A;  2QIR A;  1XF8 A;  2Z3O A;  2YNC A;  3BJ8 A;  4LX9 A;  1Z4E A;  4KOS A;  4C7I A;  2D4O A;  4NSQ A;  4YRH A;  4CAF A;  4CYO A;  2CXA A;  4H6U A;  3A9L A;  3JUW A;  4UCN A;  4UWJ A;  1KUX A;  4NXY A;  2ZW6 A;  2Z0Z A;  3W6S A;  4JD6 A;  4PV6 A;  3LOD A;  1XIX A;  1XE4 A;  5AG7 A;  4F0X A;  4ZGY B;  3D8P A;  2VI7 A;  5ISV A;  3CXP A;  4IF5 A;  3FNC A;  2YND A;  4CS0 B;  2ATR A;  4XPL A;  5HMN A;  1CJW A;  5J8F A;  5F47 A;  2F5I A;  2CNT A;  1GHE A;  5AG6 A;  4XPD C;  4YGO A;  2C27 A;  3FYN A;  4KLV A;  4AG9 A;  2YNC C;  4KOT A;  4PSW A;  2OB0 A;  4MJ8 A;  5DWN A;  2P6E A;  4B5P B;  4A32 A;  1YK3 A;  5AGE A;  1TIQ A;  2HV2 A;  4JWP A;  4F6A A;  2PSW A;  3TTH A;  4AVB A;  2P0W A;  3R1K A;  5GCN A;  4CYP A;  2Q4V A;  1S60 A;  1XMT A;  2J8R A;  2DPS A;  1M44 A;  1WK4 A;  4JJX A;  5EC4 A;  5HH1 A;  2Z3N A;  2PDO A;  5G1Z A;  4C7H A;  3W6X A;  2PC1 A;  3D2M A;  3PP9 A;  4MFK A;  2Z3M A;  4E8O A;  1CM0 A;  1PUA A;  1RXT A;  4FD5 A;  3TOA A;  3GYA A;  3S6H A;  4OLL A;  2X7B A;  1L0C A;  5A28 A;  5F49 A;  4OAD A;  2VEZ A;  4MHD A;  2FE7 A;  3SHP A;  2VBQ A;  1V0C A;  2Q7B A;  4NEX A;  2I00 A;  3SXO A;  5C88 A;  4UWI A;  4R57 A;  1NSL A;  3D2P A;  3RYO A;  1KZF A;  3TFY A;  4JLY A;  1M1D A;  2DXQ A;  4GS4 A;  2B5G A;  3FIX A;  5CNP A;  2ZXV A;  3EO4 A;  2QML A;  5DWM A;  4A31 A;  4L8A A;  2Q4Y A;  5C82 A;  2WPX A;  1SQH A;  4KOU A;  4KLW A;  4BBH A;  3VWE A;  3G3S A;  3T90 A;  1N71 A;  1U6M A;  3MGD A;  2JDC A;  4RI1 A;  1NMT A;  4KSA A;  4MFQ A;  1YVK A;  3K9U A;  3NE7 A;  3P2H A;  5AG5 A;  1XEB A;  3LD2 A;  4PK3 A;  4CGN A;  3TCV A;  1M4I A;  4E2A A;  4Y49 C;  4HKF A;  3IU2 A;  2B4D B;  1B87 A;  4LUA A;  3R9F A;  4U5Y A;  2ARH A;  1Y7R A;  2Q44 A;  4Q36 A;  1S5K A;  2ZW4 A;  3DSB A;  3SXN A;  5FVJ A;  5A27 A;  1LRZ A;  5G21 A;  3BJ7 A;  4U9Z A;  1IB1 E;  1QSR A;  2BUE A;  1S7L A;  2BL1 A;  2WPW A;  4ORF A;  3IWG A;  3R95 A;  2IL4 A;  2Z10 A;  1QST A;  2REF A;  4A2Z A;  2J8M A;  4AB7 A;  5E96 A;  4B14 A;  4C2Y A;  2FS5 A;  2OZH A;  3TE4 A;  2Y0M A;  4MBU A;  3FB3 A;  5IB0 A;  1Q2Y A;  5JPH A;  4XPD B;  4I49 A;  4CAE A;  4HNW B;  3QB8 A;  4C2X A;  2GAN A;  1YVO A;  4KZT A;  5AG4 A;  2WSA A;  1Z4R A;  1R57 A;  4J3G A;  2D4P A;  3TT2 A;  3EXN A;  3JVN A;  4YFJ A;  2BSW A;  2FSR A;  1Z9U A;  4CGL A;  4ZBG A;  2P6F A;  1PU9 A;  4UA3 A;  2Z3L A;  4M3S A;  4QC6 A;  2EUI A;  3DNS A;  1MJB A;  4FD7 A;  2B3V A;  4CGO A;  2I79 A;  4AG7 A;  2Z11 A;  4IUS A;  4NCZ A;  1S7N A;  4FD4 A;  3B8G A;  1YRE A;  4CAW A;  3DDD A;  4R87 A;  1P4N A;  4KUB A;  1J4J A;  4E0A A;  2GIV A;  2FXF A;  2G0B A;  3F8K A;  2FIA A;  4C2Z A;  4H89 A;  2Q0Y A;  1S7K A;  4M85 A;  3R9E A;  4QB9 A;  2CNS A;  3F0A A;  3BLN A;  4XPK A;  5BWA B;  3ZJ0 A;  3C26 A;  3WR7 A;  1YX0 A;  4A33 A;  2HUZ A;  2Z3P A;  4ONU A;  5I0C A;  1RO5 A;  2FL4 A;  2VZZ A;  4XNH C;  4MFL A;  3EY5 A;  2RC4 A;  3EFA A;  4H6Z A;  5KTD A;  2REE A;  3GKR A;  3PGP A;  4MFZ A;  4QUS A;  2A4N A;  2PRB A;  2H5M A;  4B5O A;  4JXQ A;  2B4B A;  4UBR A;  3I9S A;  3I3G A;  4KVX A;  3H4Q A;  4QVT A;  2OH1 A;  4K30 A;  1Y9K A;  2R1I A;  4NF1 A;  4B12 A;  3N7Z A;  3OWC A;  4B11 A;  1IID A;  1VHS A;  3IWE A;  4KOX A;  4HNX B;  5KTC A;  4HNY B;  1M4D A;  1IYK A;  4KOR A;  4Y49 B;  3CXS A;  2NMT A;  4BMH A;  4EVY A;  3TO9 A;  3GY9 A;  4B10 A;  5H86 A;  3T9Y A;  4II9 A;  3P2F A;  4X5K A;  3H5Z A;  2B5G B;  1QSM A;  2CNM A;  3KKW A;  2CY2 A;  4UCM A;  4CGM A;  4KOY A;  4MY0 A;  4AVA A;  2JEV A;  3IU1 A;  4FD6 A;  4CRZ B;  4B5P A;  1Q2D A;  3IGR A;  2QEC A;  3DR8 A;  4PSX A;  5EBV A;  3FRM A;  4MY3 A;  2JLM A;  2YGW A;  2G3A A;  3TOB A;  1BO4 A;  4KVO E;  1S3Z A;  4KS9 A;  4CRY B;  4KVM E;  1WWZ A;  4MFP A;  3S6K A;  1M4G A;  4OAE A;  2PQ8 A;  1BOB A;  2AE6 A;  4C68 A;  5J8C A;  4CAV A;  1S7F A;  2JDD A;  2FIW A;  3E0K A;  4Q38 A;  5JQ4 A;  2ZPA A;  4KOW A;  4DNC A;  5KTA A;  4QBJ A;  2YNE A;  4CYN A;  2R98 A;  4KSF A;  4R3L A;  1YGH A;  4F0Y A;  4UFW A;  2VXK A;  4AVC A;  4KUA A;  2Q04 A;  2ZW7 A;  3W91 A;  2O28 A;  3TO7 A;  3CXQ A;  2DPT A;  2VQY A;  2GE3 A;  4U9Y A;  3V8I A;  1KUY A;  1ON0 A;  2OZG A;  3TO6 A;  3ZZI A;  5F46 A;  1OZP A;  3F5B A;  2FT0 A;  4B13 A;  3PZJ A;  3DR6 A;  3S6G A;  2BEI A;  1KUV A;  4JXR A;  1QSN A;  1MJA A;  2VZY A;  5H84 A;  2J8N A;  1Q2C A;  2ZW5 A;  3FBU A;  3QAH A;  4CGP A;  3EC4 A;  1IYL A;  1I12 A;  2PR8 A;  3FXT A;  1P0H A;  3UY5 A;  1VKC A;  4RS2 A;  2EVN A;  4CAX A;  4A30 A;  1ZO0 A;  2OZU A;  4CYQ A;  2FCK A;  2K5T A;  3R9G A;  1MK4 A;  3S6F A;  2PR1 A;  2B3U A;  2AJ6 A;  5F48 A;  4XNH B;  1QSO A;  4A95 A;  2B4D A;  4UFV A;  1I1D A;  1FY7 A;  1YLE A;  5IX3 A;  4L89 A;  4UCP A;  1UFH A;  4R9M A;  4MFJ A;  4R3K A;  2P6G A;  1NE9 A;  3R96 A;  2Z3K A;  1Y9W A;  1K4J A;  3JTK A;  4KOV A;  1YR0 A;  2R8V A;  2B58 A;  4MI4 A;  5IV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...