4B10A

Plasmodium vivax n-myristoyltransferase with a non-hydrolysable co- factor
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Design and Synthesis of Inhibitors of Plasmodium Falciparum N-Myristoyltransferase, a Promising Target for Anti-Malarial Drug Discovery.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 119
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2012-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4b10A00
5AG7A 5G22A 4C7IA 4CGMA 5A27A 4A95A 4UFWA 4UFXA 5AGEA 4CGOA 4CGLA 4CGPA 5G21A 4C2XA 5G1ZA 4A2ZA 3JTKA 4UCPA 5AG4A 2WUUA 4B11A 2YNDA 2WSAA 4UCNA 5AG6A 4A33A 4A31A 4CYPA 5G20A 3IWEA 3H5ZA 4C68A 2YNCA 3IU1A 5AG5A 4C7HA 4CGNA 4B12A 4C2ZA 4C2YA 4CYNA 4CAFA 2YNCC 5A28A 3IU2A 2YNEA 4UFVA 4A30A 4B13A 4CYOA 4B10A 4UCMA 4A32A 4B14A 4CYQA 4BBHA 4CAEA
chains in the Genus database with same CATH superfamily
4YRHA 1GYTA 3KL9A 2GANA 3D67A 2B58A 2PJ8A 5BWAB 1ZLIA 2JDCA 4X3RA 5J8CA 4P4JA 2ZEFA 5FVJA 4Q7AA 4R6TA 2G9DA 5G21A 4C2XA 3N5FA 2JEWA 3R9GA 3QNVA 1NE9A 4FBEA 2PJ3A 4BD9A 2V8HA 2V8VA 3JUWA 4H89A 5CBMA 4PK2A 2PDOA 1DE4C 3DR6A 1MJBA 1M4GA 1S7LA 3S9MA 4JXQA 2Q44A 1LOKA 4ZGYB 4I49A 2EK8A 2ODFA 2BO9A 1ZG7A 2PC1A 1YGHA 2WPXA 1XJOA 3VATA 4A38A 2C6GA 3EXNA 2PRBA 1M4DA 2AFUA 1BAVA 1IY7A 2G0BA 4UWJA 4CYQA 2ZEPA 2PJ0A 3RYOA 1IU8A 1PU9A 2B3VA 4CRZB 1QSMA 3KGQA 3H8EA 5G22A 4A94A 1B6BA 3FF3A 5F46A 1XF8A 2OZHA 4JZ0A 5DWMA 2BL1A 2REEA 4CGLA 2I3CA 3CXQA 1VHSA 2QIRA 3IFEA 4MFJA 4OC3A 4FD5A 4UEEA 1Q2YA 3SI0A 3FYNA 1V0CA 3T9YA 4ZYQA 4ZY2A 1R43A 1MJ9A 4IK2A 3VH9A 1CX8A 1CM0A 3BJ8A 3EY5A 3D3SA 4MHNA 4B12A 4C2YA 4KOUA 4R87A 3DSBA 3IGRA 4AVCA 5JPHA 4KLVA 4MXUA 4A30A 4OMEA 5THWA 3UY5A 1ELMP 3LWUA 4A37A 4IAVA 3TO7A 1Q2DA 4A39A 3K9TA 4CAEA 4NGRA 1BPNA 2PQ8A 4EWTA 3R96A 1IB1E 4R3LA 5AG7A 3SJFA 4M85A 5LRJA 2EBJA 5F47A 1YW6A 2JDDA 4H6ZA 1Z9UA 4CS0B 1QQ9A 4OLLA 4KSFA 3S6GA 5I4MA 2ZEHA 2WZNA 5HVHA 2FL4A 4DJLA 4MHPA 3NH5A 1WK4A 4EMEA 2ARHA 4MJ8A 4XPDB 1M4LA 4R3KA 4KUBA 2GLFA 3D7FA 4O23A 4E2AA 1KUYA 1Q2CA 3RO0A 1TKFA 3B8GA 5J8FA 2H5MA 1S7NA 2VEZA 2Z3MA 4IF5A 4ORFA 4M6IA 4UF4A 2GLJA 5HVFA 3SXOA 3W6XA 3RNZA 2Z3NA 1B87A 4CYOA 4OADA 3K9UA 2Q04A 3NA6A 2OZUA 4ONWA 2V8DA 4L89A 1IOIA 2RFHA 4OKOA 2PJ1A 3WC6A 4AVAA 4R57A 2OH1A 1Z2LA 3DR8A 2IQ6A 1MK4A 2ABZA 2BEIA 2PJ7A 4GM5A 2B4DA 1M1DA 1M44A 1XOVA 1L0CA 1S60A 1VHEA 3R95A 2PJ4A 1VGYA 4A33A 4AG9A 1I1DA 5KTDA 2PJCA 3DDDA 2PJAA 2Z3OA 2F5IA 3IU1A 3FECA 4JYWA 4MI4A 2AFXA 1VHOA 2HQYA 2B5GA 1X12A 2B3UA 4Y49B 3V7ZA 4CAWA 4HKFA 2YNEA 3F0AA 3FEEA 4OIDA 1FNOA 1YQEA 4GXHA 3GKRA 4MHDA 4B6ZA 5LYDA 2PJBA 4XPLA 3HLPA 4H2KA 4J3GA 4NXYA 2Q4VA 4QC6A 4Q38A 2BOAA 5A27A 4NEXA 5AGEA 4F9VA 4KLWA 7CPAA 2AFZA 2VZZA 4E0AA 3TTHA 1TKHA 2Z3KA 3JRUA 2EWBA 3B2YA 1BLLE 3JVNA 5EC4A 3TOAA 2D4OA 2HV2A 4KS9A 2JBJA 3IWEA 1YX0A 2R7HA 3KHXA 3B35A 4MY0A 1RTQA 3RAMA 1YSJA 1Z5RA 3D2PA 3CPXA 2GU2A 3GY9A 4JD6A 4DUKA 2VXKA 1K4JA 3FX6A 2Q4YA 1LFWA 2P0WA 1I12A 5LRKA 2DEAA 2R8VA 3C26A 4ZX9A 2OOTA 2C27A 2PJ5A 1AMPA 2ANPA 1FT7A 3R9EA 3RZAA 5HVGA 1XMTA 2FIAA 2GFQA 3D4UA 4JJXA 4UFXA 2OU2A 2P6EA 4CGPA 5G1ZA 1LRZA 3G8WA 3H8FA 3SXNA 1XMBA 4U9YA 3IO1A 3B3SA 2CF4A 4P4FA 5G20A 2XEJA 1ZO0A 4LUAA 2POKA 2BSWA 4KOSA 2PVVA 1P4NA 2DXQA 2EVNA 2FSRA 3WC5A 4CAXA 1ELLP 1UFHA 2FIWA 4X8IA 4IHMA 1YVKA 5IX3A 3FEDA 2WYRA 1F57A 5J1QA 3LD2A 4B10A 1U6MA 4EFDA 1HDQA 5IV0A 1IYLA 3GIUA 2HUZA 3KQXA 3NE7A 4YU9A 4NGQA 4R9MA 2Q51A 1PCAA 3IJ3A 3FB3A 2V77A 4U9ZA 4MCSA 1VKCA 4P4DA 2PSWA 2ZPAA 2EO8A 1LAMA 1Y9KA 3TFYA 2ZOGA 1GHEA 4CYPA 5JQ4A 4C68A 4F0XA 5JH9A 3GUXA 2IL4A 1QSOA 3BI1A 4P44A 2A4NA 4HNWB 8CPAA 2ZW6A 5K8OA 3A9LA 3RBUA 4NGTA 3B3WA 3FBUA 4P6YA 3CXSA 4AB7A 2CNTA 2DF5A 1TKJA 3G3SA 4WWVA 3IWGA 5E96A 2Q0YA 4DNCA 1EE3P 1Y7EA 2ZW4A 4ZY0A 4X2TA 1S7FA 2VBQA 3JTKA 3IWWA 4NJQA 1J4JA 3H4QA 4K30A 4NGPA 2I79A 2P6GA 4UCNA 4UBRA 2PE3A 3W91A 3FRMA 4RUHA 3D66A 1AYEA 5LYIA 3TE4A 1CBXA 1LCPA 5A28A 3TX8A 2IMOA 3N7ZA 1IIDA 4MHZA 3MRUA 4KVME 4XPDC 5LYLA 3W6SA 4LQ6A 2ZW7A 3CDXA 1IICA 1ARLA 2BUEA 2NSMA 2B4BA 1Z8LA 4QBJA 4RS2A 1P0HA 2ZENA 4P4EA 1TF8A 4KOWA 3SJXA 3NH4A 3PZJA 4HPSA 1XE4A 4NJRA 5HMNA 4CGMA 3B7IA 4MCQA 2HC9A 2PIYA 4NF1A 1XEBA 3FNCA 4JXRA 2C6PA 3WR7A 4H6UA 3D68A 4ONUA 1JWQA 2YNDA 2QVPA 1TF9A 3SJGA 4QUSA 2NYQA 4CGNA 3PFOA 1RO5A 4MMOA 5H86A 4C7HA 2G3AA 2QECA 2ZEDA 4MFPA 4MCPA 4TNUA 4YFJA 4CYNA 1DTDA 4YWYA 5HXDA 3IU2A 3PBBA 4OC1A 3S6HA 2RC4A 2Q7SA 4LQGA 2J8MA 4NGNA 3P2HA 4QB9A 2J9AA 1IOFA 2GE3A 2CNSA 1VIXA 1FY7A 2GREA 4UA3A 3QAYA 4B5OA 2FXFA 5F48A 3CT9A 1NSLA 3PFEA 2Z11A 1JQGA 4KORA 4OIWA 4A95A 4UFWA 4CGOA 4F8ZA 2GIVA 3TC8A 1ARMA 2VI7A 2HB6A 4P10A 1NSAA 1QSTA 4KSIA 1Y9WA 3H8GA 3SI2A 1TXRA 2OB0A 4IUSA 4OC0A 4M3SA 5ELYA 2EK9A 4NGSA 2PJ9A 5IB0A 3FIXA 3WABA 1RXTA 2Y0MA 2DPTA 1Z8TA 4GS4A 5DS0A 2K5TA 3P2FA 4FAIA 4UEFA 1BOBA 2F7VA 3E0KA 4NSQA 3PRTA 2QJ8A 4BBHA 2OZGA 4XNHC 4LX9A 3PB4X 2AFMA 2PR8A 3KR4A 3NE8A 4K3NA 2PIZA 3V8IA 4OC4A 4UIBA 2XEGA 2C6CA 4M6GA 2PR1A 4UWIA 1LAPA 3D8PA 4P4BA 2FCKA 2I00A 4MFKA 3KR5A 4MBUA 4UCPA 3DLJA 4W9YA 1Y0RA 3PB8X 4B11A 5K8MA 4HNXB 4X5KA 3B3CA 3WT4A 3H5ZA 3I9SA 3TOBA 2PRQA 4OAEA 5K8NA 1YLOA 3FMCA 4CPAA 3TO9A 3ZJ0A 1F2OA 2ATRA 3DGVA 4Z65A 4B13A 5C82A 1S5KA 3T8WA 1YK3A 4PSWA 4II9A 2JLMA 3PEIA 1Z4RA 4R8FA 4MFZA 4OC2A 2Z0ZA 4TWEA 1YMEA 3B3VA 1Z8XA 3KHZA 2ZEGA 1IGBA 3EO4A 2Q43A 1S7KA 2VL1A 3WC7A 4G1PA 3ZZIA 5KTAA 5EBVA 4F0YA 3NH8A 2FT0A 3IIBA 2ZEMA 3KZWA 4FWUA 5I0CA 3FJUA 4PXBA 3EC4A 2R98A 3PB9X 4Q36A 4ZI6A 2X7BA 1CPXA 2XEFA 1CP7A 2D4PA 2FVGA 3LMSA 5D29A 2VZYA 3I1UA 4UIAA 4EVYA 2CXAA 3KKWA 4MFLA 4MY3A 2FE7A 2AFWA 1XRYA 3GLJA 4MHYA 3S9LA 4OP4A 5LYFA 4KVOE 3CXPA 2EUIA 2F8HA 5IB9A 2AFSA 3PP9A 1QSRA 2AE6A 1A2ZA 2CIJA 5ISVA 1SQHA 3QB8A 2PJ2A 3PB7X 2Z3PA 3TT2A 4CAVA 1YREA 5DWNA 2B4DB 4NFRA 3R9FA 5D8NA 1M4IA 3CPAA 4RN7A 5JM6A 2ZELA 4XPKA 1MJAA 3F5BA 4P45A 1OBRA 4A31A 4AXVA 1LANA 2YNCA 2B5GB 1KZFA 4KVXA 4KOTA 3HUVA 2P6FA 1XIXA 2NMTA 1YR0A 1Z4EA 3IEHA 5F09A 3L2NA 2ZOFA 5K8PA 3T90A 4JLYA 3MN8A 3S6KA 2PVWA 3D7HA 2OR4A 1PYTB 1ZG8A 3K2KA 3LODA 3D7GA 4KSAA 1CPSA 1YLEA 3KI9A 2PCUA 1AUGA 1N71A 3PGPA 5CPAA 1ZG9A 2O28A 2BCOA 3FVLA 5JGFA 1XBUA 1R57A 2O53A 3BLNA 1KUXA 2R1IA 3CZXA 4C7IA 1PUAA 5C88A 2PJ6A 1X10A 3BI0A 4F9UA 1BO4A 2IJZA 2ZEOA 3MGDA 5AG4A 4B5PB 6CPAA 1TIQA 3BJ7A 3R1KA 5F49A 1Y0YA 2G3TA 4UEZA 4PV6A 4ZX8A 4ZY1A 4KUAA 5GCNA 4C2ZA 2XEIA 2J8RA 2ZW5A 4FD4A 3KASA 4CAFA 3B3TA 3FXTA 4AVBA 3D7DA 3GB0A 3BXMA 4OC5A 4QVTA 3V38A 3ISXA 4UCMA 4CRYB 2J8NA 4Y49C 3PBEA 2FS5A 4YGOA 2DPSA 2Z3LA 4KOVA 1HDUA 4NCZA 3S6FA 1KWMA 1CJWA 1ON0A 1Y7RA 2CTCA 2CTBA 1IYKA 4PXCA 1CG2A 1KUVA 3ISZA 4FD6A 4JWPA 1CP6A 1I21A 2JBKA 2RB7A 4KZTA 4RI1A 1QMUA 4MFQA 4BINA 4DYOA 2ZXVA 1YVOA 4PQAA 2WSAA 4BMHA 3F8KA 4L8AA 5AG5A 5H84A 3QAHA 4FD7A 1NMTA 1R3NA 4FUUA 4E8OA 4PK3A 3EFAA 3S9NA 4AG7A 3IC1A 4UFVA 3TO6A 1S3ZA 4PXEA 1OZPA 3D2MA 5HH1A 3NFZA 2VQYA 2QYVA 2JEVA 2V8GA 3DNSA 3LACA 4P4IA 3VARA 4A32A 2CNMA 1Z8WA 5EMIA 1ZLHA 2AJ6A 3BHXA 4KOYA 2QMLA 1WWZA 4R76A 5LRGA 3TCVA 1HEEA 4HNYB 4PSXA 1XFOA 2C1CA 3SI1A 3PB6X 2YGWA 3FH4A 3SHPA 5CNPA 4ZBGA 4A2ZA 3KQZA 2WUUA 4KOXA 2Q7BA 1Q7LA 4NGMA 5AG6A 4B5PA 3VWDA 2O4HA 2Z10A 1UWYA 2WPWA 4MRIA 3GYAA 2REFA 4M6HA 3VWEA 1H8LA 2KCWA 2YNCC 4U5YA 3I3GA 5KTCA 2AFOA 2Q4ZA 1F2PA 3OWCA 1QSNA 2CY2A 4MCRA 4R7MA 4WJBA 4XNHB 4PPZA 1BPMA 2ZEEA 3SJEA 4PXDA 4B14A 1YW4A 4F6AA
chains in the Genus database with same CATH topology
4YRHA 2GANA 5BWAB 2B58A 5J8CA 2JDCA 5FVJA 5G21A 4C2XA 3R9GA 1NE9A 3JUWA 4H89A 4PK2A 2PDOA 3DR6A 1MJBA 1M4GA 1S7LA 4JXQA 2Q44A 4ZGYB 4I49A 2PC1A 1YGHA 2WPXA 3EXNA 2PRBA 1M4DA 2G0BA 4UWJA 4CYQA 3RYOA 1PU9A 2B3VA 4CRZB 1QSMA 5G22A 1B6BA 5F46A 2OZHA 5DWMA 4CGLA 2BL1A 2REEA 3CXQA 1VHSA 2QIRA 4MFJA 4FD5A 1Q2YA 3FYNA 1V0CA 3T9YA 1MJ9A 1CM0A 3BJ8A 3EY5A 3D3SA 4B12A 4C2YA 4KOUA 4R87A 3DSBA 3IGRA 4AVCA 5JPHA 4KLVA 4A30A 3UY5A 3TO7A 1Q2DA 4CAEA 2PQ8A 3R96A 1IB1E 4R3LA 5AG7A 4M85A 5F47A 2JDDA 4H6ZA 1Z9UA 4CS0B 4OLLA 4KSFA 3S6GA 2FL4A 1WK4A 2ARHA 4MJ8A 4XPDB 4R3KA 4KUBA 4E2AA 1KUYA 1Q2CA 5J8FA 3B8GA 2H5MA 1S7NA 2VEZA 2Z3MA 4IF5A 4ORFA 3SXOA 3W6XA 4CYOA 2Z3NA 1B87A 4OADA 3K9UA 2Q04A 2OZUA 4L89A 4AVAA 4R57A 2OH1A 3DR8A 1MK4A 2BEIA 2B4DA 1M1DA 1M44A 3R95A 1L0CA 1S60A 4A33A 4AG9A 1I1DA 5KTDA 3DDDA 2Z3OA 2F5IA 3IU1A 4MI4A 2HQYA 2B5GA 2B3UA 4Y49B 4CAWA 4HKFA 2YNEA 3F0AA 4MHDA 3GKRA 4XPLA 4J3GA 4NXYA 2Q4VA 4QC6A 4Q38A 5A27A 4NEXA 5AGEA 4KLWA 2VZZA 4E0AA 3TTHA 2Z3KA 3TOAA 3JVNA 5EC4A 2D4OA 2HV2A 4KS9A 3IWEA 1YX0A 2R7HA 4MY0A 3D2PA 4JD6A 3GY9A 2VXKA 1K4JA 2Q4YA 2P0WA 1I12A 2R8VA 3C26A 2C27A 3R9EA 1XMTA 2FIAA 4JJXA 4UFXA 2OU2A 2P6EA 4CGPA 5G1ZA 1LRZA 3G8WA 3SXNA 4U9YA 5G20A 1ZO0A 4LUAA 2BSWA 4KOSA 1P4NA 2DXQA 2EVNA 2FSRA 4CAXA 1UFHA 2FIWA 1YVKA 5IX3A 3LD2A 4B10A 1U6MA 5IV0A 1IYLA 2HUZA 3NE7A 4R9MA 3FB3A 4U9ZA 1VKCA 2PSWA 2ZPAA 1Y9KA 3TFYA 1GHEA 4CYPA 5JQ4A 4C68A 4F0XA 2IL4A 1QSOA 2A4NA 4HNWB 2ZW6A 3A9LA 3FBUA 4AB7A 3CXSA 2CNTA 3G3SA 3IWGA 5E96A 2Q0YA 4DNCA 2ZW4A 1S7FA 2VBQA 3JTKA 1J4JA 3H4QA 4K30A 4UCNA 2I79A 2P6GA 4UBRA 3W91A 3FRMA 3TE4A 5A28A 3N7ZA 1IIDA 4KVME 4XPDC 3W6SA 2ZW7A 1IICA 2BUEA 2B4BA 4QBJA 4RS2A 1P0HA 4KOWA 3PZJA 5HMNA 1XE4A 4CGMA 4NF1A 1XEBA 3FNCA 4JXRA 3WR7A 4H6UA 4ONUA 2YNDA 4QUSA 4CGNA 4C7HA 1RO5A 5H86A 2G3AA 2QECA 4MFPA 4YFJA 4CYNA 3IU2A 3S6HA 2RC4A 2J8MA 3P2HA 4QB9A 2GE3A 2CNSA 4UA3A 1FY7A 4B5OA 2FXFA 5F48A 1NSLA 2Z11A 4KORA 4A95A 4UFWA 4CGOA 2GIVA 2VI7A 1QSTA 1Y9WA 2OB0A 4IUSA 4M3SA 5IB0A 3FIXA 1RXTA 2Y0MA 2DPTA 4GS4A 2K5TA 3P2FA 1BOBA 3E0KA 4NSQA 4BBHA 2OZGA 4XNHC 4LX9A 2PR8A 3V8IA 2PR1A 4UWIA 3D8PA 2FCKA 2I00A 4MFKA 4MBUA 4UCPA 4B11A 4HNXB 4X5KA 3H5ZA 3I9SA 3TOBA 4OAEA 3TO9A 3ZJ0A 2ATRA 5C82A 4B13A 1S5KA 1YK3A 4PSWA 4II9A 2JLMA 1Z4RA 4MFZA 2Z0ZA 3EO4A 1S7KA 3ZZIA 5KTAA 5EBVA 4F0YA 2FT0A 5I0CA 3EC4A 2R98A 4Q36A 2X7BA 2D4PA 2VZYA 4EVYA 2CXAA 3KKWA 4MFLA 4MY3A 2FE7A 4KVOE 3CXPA 2EUIA 3PP9A 1QSRA 2AE6A 5ISVA 1SQHA 3QB8A 3TT2A 2Z3PA 4CAVA 1YREA 5DWNA 2B4DB 3R9FA 1M4IA 4XPKA 1MJAA 3F5BA 4A31A 2YNCA 2B5GB 1KZFA 4KVXA 4KOTA 2P6FA 1XIXA 2NMTA 1YR0A 1Z4EA 3T90A 4JLYA 3S6KA 3LODA 4KSAA 1YLEA 1N71A 3PGPA 2O28A 4C7IA 1R57A 3BLNA 1KUXA 2R1IA 5C88A 1PUAA 1BO4A 3MGDA 5AG4A 4B5PB 1TIQA 3BJ7A 3R1KA 5F49A 2G3TA 4PV6A 4KUAA 5GCNA 4C2ZA 2J8RA 2ZW5A 4FD4A 4CAFA 3FXTA 4AVBA 4QVTA 4UCMA 4CRYB 2J8NA 4Y49C 2FS5A 4YGOA 2DPSA 2Z3LA 4KOVA 4NCZA 3S6FA 1CJWA 1ON0A 1Y7RA 1IYKA 1KUVA 4FD6A 4JWPA 1I21A 4RI1A 4KZTA 4MFQA 2ZXVA 1YVOA 2WSAA 4BMHA 3F8KA 4L8AA 5AG5A 5H84A 3QAHA 4FD7A 1NMTA 4E8OA 4PK3A 3EFAA 4AG7A 4UFVA 3TO6A 1S3ZA 1OZPA 3D2MA 5HH1A 2VQYA 2JEVA 3DNSA 4A32A 2CNMA 2AJ6A 4KOYA 2QMLA 1WWZA 3TCVA 4HNYB 4PSXA 2YGWA 3SHPA 5CNPA 4ZBGA 4A2ZA 2WUUA 4KOXA 2Q7BA 5AG6A 4B5PA 3VWDA 2Z10A 2WPWA 3VWEA 3GYAA 2REFA 2KCWA 2YNCC 4U5YA 3I3GA 5KTCA 3OWCA 1QSNA 2CY2A 4XNHB 4B14A 1XF8A 4F6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AG7 A;  5G22 A;  4C7I A;  4CGM A;  5A27 A;  4A95 A;  4UFW A;  4UFX A;  5AGE A;  4CGO A;  4CGL A;  4CGP A;  5G21 A;  4C2X A;  5G1Z A;  4A2Z A;  3JTK A;  4UCP A;  5AG4 A;  2WUU A;  4B11 A;  2YND A;  2WSA A;  4UCN A;  5AG6 A;  4A33 A;  4A31 A;  4CYP A;  5G20 A;  3IWE A;  3H5Z A;  4C68 A;  2YNC A;  3IU1 A;  5AG5 A;  4C7H A;  4CGN A;  4B12 A;  4C2Z A;  4C2Y A;  4CYN A;  4CAF A;  2YNC C;  5A28 A;  3IU2 A;  2YNE A;  4UFV A;  4A30 A;  4B13 A;  4CYO A;  4B10 A;  4UCM A;  4A32 A;  4B14 A;  4CYQ A;  4BBH A;  4CAE A; 
#chains in the Genus database with same CATH topology
 4YRH A;  1GYT A;  3KL9 A;  2GAN A;  3D67 A;  2B58 A;  2PJ8 A;  5BWA B;  1ZLI A;  2JDC A;  4X3R A;  5J8C A;  4P4J A;  2ZEF A;  5FVJ A;  4Q7A A;  4R6T A;  2G9D A;  5G21 A;  4C2X A;  3N5F A;  2JEW A;  3R9G A;  3QNV A;  1NE9 A;  4FBE A;  2PJ3 A;  4BD9 A;  2V8H A;  2V8V A;  3JUW A;  4H89 A;  5CBM A;  4PK2 A;  2PDO A;  1DE4 C;  3DR6 A;  1MJB A;  1M4G A;  1S7L A;  3S9M A;  4JXQ A;  2Q44 A;  1LOK A;  4ZGY B;  4I49 A;  2EK8 A;  2ODF A;  2BO9 A;  1ZG7 A;  2PC1 A;  1YGH A;  2WPX A;  1XJO A;  3VAT A;  4A38 A;  2C6G A;  3EXN A;  2PRB A;  1M4D A;  2AFU A;  1BAV A;  1IY7 A;  2G0B A;  4UWJ A;  4CYQ A;  2ZEP A;  2PJ0 A;  3RYO A;  1IU8 A;  1PU9 A;  2B3V A;  4CRZ B;  1QSM A;  3KGQ A;  3H8E A;  5G22 A;  4A94 A;  1B6B A;  3FF3 A;  5F46 A;  1XF8 A;  2OZH A;  4JZ0 A;  5DWM A;  2BL1 A;  2REE A;  4CGL A;  2I3C A;  3CXQ A;  1VHS A;  2QIR A;  3IFE A;  4MFJ A;  4OC3 A;  4FD5 A;  4UEE A;  1Q2Y A;  3SI0 A;  3FYN A;  1V0C A;  3T9Y A;  4ZYQ A;  4ZY2 A;  1R43 A;  1MJ9 A;  4IK2 A;  3VH9 A;  1CX8 A;  1CM0 A;  3BJ8 A;  3EY5 A;  3D3S A;  4MHN A;  4B12 A;  4C2Y A;  4KOU A;  4R87 A;  3DSB A;  3IGR A;  4AVC A;  5JPH A;  4KLV A;  4MXU A;  4A30 A;  4OME A;  5THW A;  3UY5 A;  1ELM P;  3LWU A;  4A37 A;  4IAV A;  3TO7 A;  1Q2D A;  4A39 A;  3K9T A;  4CAE A;  4NGR A;  1BPN A;  2PQ8 A;  4EWT A;  3R96 A;  1IB1 E;  4R3L A;  5AG7 A;  3SJF A;  4M85 A;  5LRJ A;  2EBJ A;  5F47 A;  1YW6 A;  2JDD A;  4H6Z A;  1Z9U A;  4CS0 B;  1QQ9 A;  4OLL A;  4KSF A;  3S6G A;  5I4M A;  2ZEH A;  2WZN A;  5HVH A;  2FL4 A;  4DJL A;  4MHP A;  3NH5 A;  1WK4 A;  4EME A;  2ARH A;  4MJ8 A;  4XPD B;  1M4L A;  4R3K A;  4KUB A;  2GLF A;  3D7F A;  4O23 A;  4E2A A;  1KUY A;  1Q2C A;  3RO0 A;  1TKF A;  3B8G A;  5J8F A;  2H5M A;  1S7N A;  2VEZ A;  2Z3M A;  4IF5 A;  4ORF A;  4M6I A;  4UF4 A;  2GLJ A;  5HVF A;  3SXO A;  3W6X A;  3RNZ A;  2Z3N A;  1B87 A;  4CYO A;  4OAD A;  3K9U A;  2Q04 A;  3NA6 A;  2OZU A;  4ONW A;  2V8D A;  4L89 A;  1IOI A;  2RFH A;  4OKO A;  2PJ1 A;  3WC6 A;  4AVA A;  4R57 A;  2OH1 A;  1Z2L A;  3DR8 A;  2IQ6 A;  1MK4 A;  2ABZ A;  2BEI A;  2PJ7 A;  4GM5 A;  2B4D A;  1M1D A;  1M44 A;  1XOV A;  1L0C A;  1S60 A;  1VHE A;  3R95 A;  2PJ4 A;  1VGY A;  4A33 A;  4AG9 A;  1I1D A;  5KTD A;  2PJC A;  3DDD A;  2PJA A;  2Z3O A;  2F5I A;  3IU1 A;  3FEC A;  4JYW A;  4MI4 A;  2AFX A;  1VHO A;  2HQY A;  2B5G A;  1X12 A;  2B3U A;  4Y49 B;  3V7Z A;  4CAW A;  4HKF A;  2YNE A;  3F0A A;  3FEE A;  4OID A;  1FNO A;  1YQE A;  4GXH A;  3GKR A;  4MHD A;  4B6Z A;  5LYD A;  2PJB A;  4XPL A;  3HLP A;  4H2K A;  4J3G A;  4NXY A;  2Q4V A;  4QC6 A;  4Q38 A;  2BOA A;  5A27 A;  4NEX A;  5AGE A;  4F9V A;  4KLW A;  7CPA A;  2AFZ A;  2VZZ A;  4E0A A;  3TTH A;  1TKH A;  2Z3K A;  3JRU A;  2EWB A;  3B2Y A;  1BLL E;  3JVN A;  5EC4 A;  3TOA A;  2D4O A;  2HV2 A;  4KS9 A;  2JBJ A;  3IWE A;  1YX0 A;  2R7H A;  3KHX A;  3B35 A;  4MY0 A;  1RTQ A;  3RAM A;  1YSJ A;  1Z5R A;  3D2P A;  3CPX A;  2GU2 A;  3GY9 A;  4JD6 A;  4DUK A;  2VXK A;  1K4J A;  3FX6 A;  2Q4Y A;  1LFW A;  2P0W A;  1I12 A;  5LRK A;  2DEA A;  2R8V A;  3C26 A;  4ZX9 A;  2OOT A;  2C27 A;  2PJ5 A;  1AMP A;  2ANP A;  1FT7 A;  3R9E A;  3RZA A;  5HVG A;  1XMT A;  2FIA A;  2GFQ A;  3D4U A;  4JJX A;  4UFX A;  2OU2 A;  2P6E A;  4CGP A;  5G1Z A;  1LRZ A;  3G8W A;  3H8F A;  3SXN A;  1XMB A;  4U9Y A;  3IO1 A;  3B3S A;  2CF4 A;  4P4F A;  5G20 A;  2XEJ A;  1ZO0 A;  4LUA A;  2POK A;  2BSW A;  4KOS A;  2PVV A;  1P4N A;  2DXQ A;  2EVN A;  2FSR A;  3WC5 A;  4CAX A;  1ELL P;  1UFH A;  2FIW A;  4X8I A;  4IHM A;  1YVK A;  5IX3 A;  3FED A;  2WYR A;  1F57 A;  5J1Q A;  3LD2 A;  4B10 A;  1U6M A;  4EFD A;  1HDQ A;  5IV0 A;  1IYL A;  3GIU A;  2HUZ A;  3KQX A;  3NE7 A;  4YU9 A;  4NGQ A;  4R9M A;  2Q51 A;  1PCA A;  3IJ3 A;  3FB3 A;  2V77 A;  4U9Z A;  4MCS A;  1VKC A;  4P4D A;  2PSW A;  2ZPA A;  2EO8 A;  1LAM A;  1Y9K A;  3TFY A;  2ZOG A;  1GHE A;  4CYP A;  5JQ4 A;  4C68 A;  4F0X A;  5JH9 A;  3GUX A;  2IL4 A;  1QSO A;  3BI1 A;  4P44 A;  2A4N A;  4HNW B;  8CPA A;  2ZW6 A;  5K8O A;  3A9L A;  3RBU A;  4NGT A;  3B3W A;  3FBU A;  4P6Y A;  3CXS A;  4AB7 A;  2CNT A;  2DF5 A;  1TKJ A;  3G3S A;  4WWV A;  3IWG A;  5E96 A;  2Q0Y A;  4DNC A;  1EE3 P;  1Y7E A;  2ZW4 A;  4ZY0 A;  4X2T A;  1S7F A;  2VBQ A;  3JTK A;  3IWW A;  4NJQ A;  1J4J A;  3H4Q A;  4K30 A;  4NGP A;  2I79 A;  2P6G A;  4UCN A;  4UBR A;  2PE3 A;  3W91 A;  3FRM A;  4RUH A;  3D66 A;  1AYE A;  5LYI A;  3TE4 A;  1CBX A;  1LCP A;  5A28 A;  3TX8 A;  2IMO A;  3N7Z A;  1IID A;  4MHZ A;  3MRU A;  4KVM E;  4XPD C;  5LYL A;  3W6S A;  4LQ6 A;  2ZW7 A;  3CDX A;  1IIC A;  1ARL A;  2BUE A;  2NSM A;  2B4B A;  1Z8L A;  4QBJ A;  4RS2 A;  1P0H A;  2ZEN A;  4P4E A;  1TF8 A;  4KOW A;  3SJX A;  3NH4 A;  3PZJ A;  4HPS A;  1XE4 A;  4NJR A;  5HMN A;  4CGM A;  3B7I A;  4MCQ A;  2HC9 A;  2PIY A;  4NF1 A;  1XEB A;  3FNC A;  4JXR A;  2C6P A;  3WR7 A;  4H6U A;  3D68 A;  4ONU A;  1JWQ A;  2YND A;  2QVP A;  1TF9 A;  3SJG A;  4QUS A;  2NYQ A;  4CGN A;  3PFO A;  1RO5 A;  4MMO A;  5H86 A;  4C7H A;  2G3A A;  2QEC A;  2ZED A;  4MFP A;  4MCP A;  4TNU A;  4YFJ A;  4CYN A;  1DTD A;  4YWY A;  5HXD A;  3IU2 A;  3PBB A;  4OC1 A;  3S6H A;  2RC4 A;  2Q7S A;  4LQG A;  2J8M A;  4NGN A;  3P2H A;  4QB9 A;  2J9A A;  1IOF A;  2GE3 A;  2CNS A;  1VIX A;  1FY7 A;  2GRE A;  4UA3 A;  3QAY A;  4B5O A;  2FXF A;  5F48 A;  3CT9 A;  1NSL A;  3PFE A;  2Z11 A;  1JQG A;  4KOR A;  4OIW A;  4A95 A;  4UFW A;  4CGO A;  4F8Z A;  2GIV A;  3TC8 A;  1ARM A;  2VI7 A;  2HB6 A;  4P10 A;  1NSA A;  1QST A;  4KSI A;  1Y9W A;  3H8G A;  3SI2 A;  1TXR A;  2OB0 A;  4IUS A;  4OC0 A;  4M3S A;  5ELY A;  2EK9 A;  4NGS A;  2PJ9 A;  5IB0 A;  3FIX A;  3WAB A;  1RXT A;  2Y0M A;  2DPT A;  1Z8T A;  4GS4 A;  5DS0 A;  2K5T A;  3P2F A;  4FAI A;  4UEF A;  1BOB A;  2F7V A;  3E0K A;  4NSQ A;  3PRT A;  2QJ8 A;  4BBH A;  2OZG A;  4XNH C;  4LX9 A;  3PB4 X;  2AFM A;  2PR8 A;  3KR4 A;  3NE8 A;  4K3N A;  2PIZ A;  3V8I A;  4OC4 A;  4UIB A;  2XEG A;  2C6C A;  4M6G A;  2PR1 A;  4UWI A;  1LAP A;  3D8P A;  4P4B A;  2FCK A;  2I00 A;  4MFK A;  3KR5 A;  4MBU A;  4UCP A;  3DLJ A;  4W9Y A;  1Y0R A;  3PB8 X;  4B11 A;  5K8M A;  4HNX B;  4X5K A;  3B3C A;  3WT4 A;  3H5Z A;  3I9S A;  3TOB A;  2PRQ A;  4OAE A;  5K8N A;  1YLO A;  3FMC A;  4CPA A;  3TO9 A;  3ZJ0 A;  1F2O A;  2ATR A;  3DGV A;  4Z65 A;  4B13 A;  5C82 A;  1S5K A;  3T8W A;  1YK3 A;  4PSW A;  4II9 A;  2JLM A;  3PEI A;  1Z4R A;  4R8F A;  4MFZ A;  4OC2 A;  2Z0Z A;  4TWE A;  1YME A;  3B3V A;  1Z8X A;  3KHZ A;  2ZEG A;  1IGB A;  3EO4 A;  2Q43 A;  1S7K A;  2VL1 A;  3WC7 A;  4G1P A;  3ZZI A;  5KTA A;  5EBV A;  4F0Y A;  3NH8 A;  2FT0 A;  3IIB A;  2ZEM A;  3KZW A;  4FWU A;  5I0C A;  3FJU A;  4PXB A;  3EC4 A;  2R98 A;  3PB9 X;  4Q36 A;  4ZI6 A;  2X7B A;  1CPX A;  2XEF A;  1CP7 A;  2D4P A;  2FVG A;  3LMS A;  5D29 A;  2VZY A;  3I1U A;  4UIA A;  4EVY A;  2CXA A;  3KKW A;  4MFL A;  4MY3 A;  2FE7 A;  2AFW A;  1XRY A;  3GLJ A;  4MHY A;  3S9L A;  4OP4 A;  5LYF A;  4KVO E;  3CXP A;  2EUI A;  2F8H A;  5IB9 A;  2AFS A;  3PP9 A;  1QSR A;  2AE6 A;  1A2Z A;  2CIJ A;  5ISV A;  1SQH A;  3QB8 A;  2PJ2 A;  3PB7 X;  2Z3P A;  3TT2 A;  4CAV A;  1YRE A;  5DWN A;  2B4D B;  4NFR A;  3R9F A;  5D8N A;  1M4I A;  3CPA A;  4RN7 A;  5JM6 A;  2ZEL A;  4XPK A;  1MJA A;  3F5B A;  4P45 A;  1OBR A;  4A31 A;  4AXV A;  1LAN A;  2YNC A;  2B5G B;  1KZF A;  4KVX A;  4KOT A;  3HUV A;  2P6F A;  1XIX A;  2NMT A;  1YR0 A;  1Z4E A;  3IEH A;  5F09 A;  3L2N A;  2ZOF A;  5K8P A;  3T90 A;  4JLY A;  3MN8 A;  3S6K A;  2PVW A;  3D7H A;  2OR4 A;  1PYT B;  1ZG8 A;  3K2K A;  3LOD A;  3D7G A;  4KSA A;  1CPS A;  1YLE A;  3KI9 A;  2PCU A;  1AUG A;  1N71 A;  3PGP A;  5CPA A;  1ZG9 A;  2O28 A;  2BCO A;  3FVL A;  5JGF A;  1XBU A;  1R57 A;  2O53 A;  3BLN A;  1KUX A;  2R1I A;  3CZX A;  4C7I A;  1PUA A;  5C88 A;  2PJ6 A;  1X10 A;  3BI0 A;  4F9U A;  1BO4 A;  2IJZ A;  2ZEO A;  3MGD A;  5AG4 A;  4B5P B;  6CPA A;  1TIQ A;  3BJ7 A;  3R1K A;  5F49 A;  1Y0Y A;  2G3T A;  4UEZ A;  4PV6 A;  4ZX8 A;  4ZY1 A;  4KUA A;  5GCN A;  4C2Z A;  2XEI A;  2J8R A;  2ZW5 A;  4FD4 A;  3KAS A;  4CAF A;  3B3T A;  3FXT A;  4AVB A;  3D7D A;  3GB0 A;  3BXM A;  4OC5 A;  4QVT A;  3V38 A;  3ISX A;  4UCM A;  4CRY B;  2J8N A;  4Y49 C;  3PBE A;  2FS5 A;  4YGO A;  2DPS A;  2Z3L A;  4KOV A;  1HDU A;  4NCZ A;  3S6F A;  1KWM A;  1CJW A;  1ON0 A;  1Y7R A;  2CTC A;  2CTB A;  1IYK A;  4PXC A;  1CG2 A;  1KUV A;  3ISZ A;  4FD6 A;  4JWP A;  1CP6 A;  1I21 A;  2JBK A;  2RB7 A;  4KZT A;  4RI1 A;  1QMU A;  4MFQ A;  4BIN A;  4DYO A;  2ZXV A;  1YVO A;  4PQA A;  2WSA A;  4BMH A;  3F8K A;  4L8A A;  5AG5 A;  5H84 A;  3QAH A;  4FD7 A;  1NMT A;  1R3N A;  4FUU A;  4E8O A;  4PK3 A;  3EFA A;  3S9N A;  4AG7 A;  3IC1 A;  4UFV A;  3TO6 A;  1S3Z A;  4PXE A;  1OZP A;  3D2M A;  5HH1 A;  3NFZ A;  2VQY A;  2QYV A;  2JEV A;  2V8G A;  3DNS A;  3LAC A;  4P4I A;  3VAR A;  4A32 A;  2CNM A;  1Z8W A;  5EMI A;  1ZLH A;  2AJ6 A;  3BHX A;  4KOY A;  2QML A;  1WWZ A;  4R76 A;  5LRG A;  3TCV A;  1HEE A;  4HNY B;  4PSX A;  1XFO A;  2C1C A;  3SI1 A;  3PB6 X;  2YGW A;  3FH4 A;  3SHP A;  5CNP A;  4ZBG A;  4A2Z A;  3KQZ A;  2WUU A;  4KOX A;  2Q7B A;  1Q7L A;  4NGM A;  5AG6 A;  4B5P A;  3VWD A;  2O4H A;  2Z10 A;  1UWY A;  2WPW A;  4MRI A;  3GYA A;  2REF A;  4M6H A;  3VWE A;  1H8L A;  2KCW A;  2YNC C;  4U5Y A;  3I3G A;  5KTC A;  2AFO A;  2Q4Z A;  1F2P A;  3OWC A;  1QSN A;  2CY2 A;  4MCR A;  4R7M A;  4WJB A;  4XNH B;  4PPZ A;  1BPM A;  2ZEE A;  3SJE A;  4PXD A;  4B14 A;  1YW4 A;  4F6A A; 
#chains in the Genus database with same CATH homology
 4YRH A;  2GAN A;  5BWA B;  2B58 A;  5J8C A;  2JDC A;  5FVJ A;  5G21 A;  4C2X A;  3R9G A;  1NE9 A;  3JUW A;  4H89 A;  4PK2 A;  2PDO A;  3DR6 A;  1MJB A;  1M4G A;  1S7L A;  4JXQ A;  2Q44 A;  4ZGY B;  4I49 A;  2PC1 A;  1YGH A;  2WPX A;  3EXN A;  2PRB A;  1M4D A;  2G0B A;  4UWJ A;  4CYQ A;  3RYO A;  1PU9 A;  2B3V A;  4CRZ B;  1QSM A;  5G22 A;  1B6B A;  5F46 A;  2OZH A;  5DWM A;  4CGL A;  2BL1 A;  2REE A;  3CXQ A;  1VHS A;  2QIR A;  4MFJ A;  4FD5 A;  1Q2Y A;  3FYN A;  1V0C A;  3T9Y A;  1MJ9 A;  1CM0 A;  3BJ8 A;  3EY5 A;  3D3S A;  4B12 A;  4C2Y A;  4KOU A;  4R87 A;  3DSB A;  3IGR A;  4AVC A;  5JPH A;  4KLV A;  4A30 A;  3UY5 A;  3TO7 A;  1Q2D A;  4CAE A;  2PQ8 A;  3R96 A;  1IB1 E;  4R3L A;  5AG7 A;  4M85 A;  5F47 A;  2JDD A;  4H6Z A;  1Z9U A;  4CS0 B;  4OLL A;  4KSF A;  3S6G A;  2FL4 A;  1WK4 A;  2ARH A;  4MJ8 A;  4XPD B;  4R3K A;  4KUB A;  4E2A A;  1KUY A;  1Q2C A;  5J8F A;  3B8G A;  2H5M A;  1S7N A;  2VEZ A;  2Z3M A;  4IF5 A;  4ORF A;  3SXO A;  3W6X A;  4CYO A;  2Z3N A;  1B87 A;  4OAD A;  3K9U A;  2Q04 A;  2OZU A;  4L89 A;  4AVA A;  4R57 A;  2OH1 A;  3DR8 A;  1MK4 A;  2BEI A;  2B4D A;  1M1D A;  1M44 A;  3R95 A;  1L0C A;  1S60 A;  4A33 A;  4AG9 A;  1I1D A;  5KTD A;  3DDD A;  2Z3O A;  2F5I A;  3IU1 A;  4MI4 A;  2HQY A;  2B5G A;  2B3U A;  4Y49 B;  4CAW A;  4HKF A;  2YNE A;  3F0A A;  4MHD A;  3GKR A;  4XPL A;  4J3G A;  4NXY A;  2Q4V A;  4QC6 A;  4Q38 A;  5A27 A;  4NEX A;  5AGE A;  4KLW A;  2VZZ A;  4E0A A;  3TTH A;  2Z3K A;  3TOA A;  3JVN A;  5EC4 A;  2D4O A;  2HV2 A;  4KS9 A;  3IWE A;  1YX0 A;  2R7H A;  4MY0 A;  3D2P A;  4JD6 A;  3GY9 A;  2VXK A;  1K4J A;  2Q4Y A;  2P0W A;  1I12 A;  2R8V A;  3C26 A;  2C27 A;  3R9E A;  1XMT A;  2FIA A;  4JJX A;  4UFX A;  2OU2 A;  2P6E A;  4CGP A;  5G1Z A;  1LRZ A;  3G8W A;  3SXN A;  4U9Y A;  5G20 A;  1ZO0 A;  4LUA A;  2BSW A;  4KOS A;  1P4N A;  2DXQ A;  2EVN A;  2FSR A;  4CAX A;  1UFH A;  2FIW A;  1YVK A;  5IX3 A;  3LD2 A;  4B10 A;  1U6M A;  5IV0 A;  1IYL A;  2HUZ A;  3NE7 A;  4R9M A;  3FB3 A;  4U9Z A;  1VKC A;  2PSW A;  2ZPA A;  1Y9K A;  3TFY A;  1GHE A;  4CYP A;  5JQ4 A;  4C68 A;  4F0X A;  2IL4 A;  1QSO A;  2A4N A;  4HNW B;  2ZW6 A;  3A9L A;  3FBU A;  4AB7 A;  3CXS A;  2CNT A;  3G3S A;  3IWG A;  5E96 A;  2Q0Y A;  4DNC A;  2ZW4 A;  1S7F A;  2VBQ A;  3JTK A;  1J4J A;  3H4Q A;  4K30 A;  4UCN A;  2I79 A;  2P6G A;  4UBR A;  3W91 A;  3FRM A;  3TE4 A;  5A28 A;  3N7Z A;  1IID A;  4KVM E;  4XPD C;  3W6S A;  2ZW7 A;  1IIC A;  2BUE A;  2B4B A;  4QBJ A;  4RS2 A;  1P0H A;  4KOW A;  3PZJ A;  5HMN A;  1XE4 A;  4CGM A;  4NF1 A;  1XEB A;  3FNC A;  4JXR A;  3WR7 A;  4H6U A;  4ONU A;  2YND A;  4QUS A;  4CGN A;  4C7H A;  1RO5 A;  5H86 A;  2G3A A;  2QEC A;  4MFP A;  4YFJ A;  4CYN A;  3IU2 A;  3S6H A;  2RC4 A;  2J8M A;  3P2H A;  4QB9 A;  2GE3 A;  2CNS A;  4UA3 A;  1FY7 A;  4B5O A;  2FXF A;  5F48 A;  1NSL A;  2Z11 A;  4KOR A;  4A95 A;  4UFW A;  4CGO A;  2GIV A;  2VI7 A;  1QST A;  1Y9W A;  2OB0 A;  4IUS A;  4M3S A;  5IB0 A;  3FIX A;  1RXT A;  2Y0M A;  2DPT A;  4GS4 A;  2K5T A;  3P2F A;  1BOB A;  3E0K A;  4NSQ A;  4BBH A;  2OZG A;  4XNH C;  4LX9 A;  2PR8 A;  3V8I A;  2PR1 A;  4UWI A;  3D8P A;  2FCK A;  2I00 A;  4MFK A;  4MBU A;  4UCP A;  4B11 A;  4HNX B;  4X5K A;  3H5Z A;  3I9S A;  3TOB A;  4OAE A;  3TO9 A;  3ZJ0 A;  2ATR A;  5C82 A;  4B13 A;  1S5K A;  1YK3 A;  4PSW A;  4II9 A;  2JLM A;  1Z4R A;  4MFZ A;  2Z0Z A;  3EO4 A;  1S7K A;  3ZZI A;  5KTA A;  5EBV A;  4F0Y A;  2FT0 A;  5I0C A;  3EC4 A;  2R98 A;  4Q36 A;  2X7B A;  2D4P A;  2VZY A;  4EVY A;  2CXA A;  3KKW A;  4MFL A;  4MY3 A;  2FE7 A;  4KVO E;  3CXP A;  2EUI A;  3PP9 A;  1QSR A;  2AE6 A;  5ISV A;  1SQH A;  3QB8 A;  3TT2 A;  2Z3P A;  4CAV A;  1YRE A;  5DWN A;  2B4D B;  3R9F A;  1M4I A;  4XPK A;  1MJA A;  3F5B A;  4A31 A;  2YNC A;  2B5G B;  1KZF A;  4KVX A;  4KOT A;  2P6F A;  1XIX A;  2NMT A;  1YR0 A;  1Z4E A;  3T90 A;  4JLY A;  3S6K A;  3LOD A;  4KSA A;  1YLE A;  1N71 A;  3PGP A;  2O28 A;  4C7I A;  1R57 A;  3BLN A;  1KUX A;  2R1I A;  5C88 A;  1PUA A;  1BO4 A;  3MGD A;  5AG4 A;  4B5P B;  1TIQ A;  3BJ7 A;  3R1K A;  5F49 A;  2G3T A;  4PV6 A;  4KUA A;  5GCN A;  4C2Z A;  2J8R A;  2ZW5 A;  4FD4 A;  4CAF A;  3FXT A;  4AVB A;  4QVT A;  4UCM A;  4CRY B;  2J8N A;  4Y49 C;  2FS5 A;  4YGO A;  2DPS A;  2Z3L A;  4KOV A;  4NCZ A;  3S6F A;  1CJW A;  1ON0 A;  1Y7R A;  1IYK A;  1KUV A;  4FD6 A;  4JWP A;  1I21 A;  4RI1 A;  4KZT A;  4MFQ A;  2ZXV A;  1YVO A;  2WSA A;  4BMH A;  3F8K A;  4L8A A;  5AG5 A;  5H84 A;  3QAH A;  4FD7 A;  1NMT A;  4E8O A;  4PK3 A;  3EFA A;  4AG7 A;  4UFV A;  3TO6 A;  1S3Z A;  1OZP A;  3D2M A;  5HH1 A;  2VQY A;  2JEV A;  3DNS A;  4A32 A;  2CNM A;  2AJ6 A;  4KOY A;  2QML A;  1WWZ A;  3TCV A;  4HNY B;  4PSX A;  2YGW A;  3SHP A;  5CNP A;  4ZBG A;  4A2Z A;  2WUU A;  4KOX A;  2Q7B A;  5AG6 A;  4B5P A;  3VWD A;  2Z10 A;  2WPW A;  3VWE A;  3GYA A;  2REF A;  2KCW A;  2YNC C;  4U5Y A;  3I3G A;  5KTC A;  3OWC A;  1QSN A;  2CY2 A;  4XNH B;  4B14 A;  1XF8 A;  4F6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...