1I12A

Crystal structure of saccharomyces cerevisiae gna1 complexed with accoa
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
154
Chain Sequence
LPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFCKLIKYWNEATVWNDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSNAGVEMQIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
publication title The crystal structures of Apo and complexed Saccharomyces cerevisiae GNA1 shed light on the catalytic mechanism of an amino-sugar N-acetyltransferase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 43
structure length 154
sequence length 157
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2001-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1i12A00
4YGOA 2PC1A 1XIXA 4HNXB 3PGPA 4ORFA 3F8KA 2QIRA 2JEVA 2G0BA 1SQHA 3PP9A 3D8PA 3R9EA 5H84A 3FIXA 3G8WA 1MJ9A 1QSNA 3TOAA 4CS0B 2FIWA 4H6ZA 1IYLA 3K9UA 3R9GA 2ZW7A 3W6SA 4ONUA 2EUIA 1VHSA 3FYNA 2K5TA 3NE7A 2B5GB 2RC4A 4QC6A 5KTDA 1QSOA 5HMNA 1QSMA 3SXOA 3EC4A 3JVNA 3GY9A 1KUVA 3QB8A 4RI1A 4R3KA 4X5KA 4E2AA 3VWEA 1S3ZA 2OZUA 2D4PA 4HKFA 3CXPA 2ARHA 4I49A 4U9ZA 3T9YA 3IWGA 1R57A 1K4JA 3BJ8A 2X7BA 5DWNA 2OU2A 1M4IA 2B3VA 4YRHA 2OZHA 4MHDA 3PZJA 1MJAA 2KCWA 1Z4RA 4CRYB 3EY5A 1M4GA 1S5KA 1TIQA 3DNSA 3TOBA 4JWPA 3R96A 3VWDA 3DR8A 2Q7BA 3S6FA 1CJWA 1PUAA 4QBJA 2Q0YA 2QECA 2B58A 1J4JA 1OZPA 4JXQA 1B87A 4KORA 3ZZIA 2B4DA 4AG9A 4KOYA 3IGRA 4RS2A 2VXKA 1M1DA 4QB9A 4L89A 3JUWA 3F0AA 2ZXVA 3OWCA 4M85A 4H6UA 4J3GA 3P2FA 4XPLA 4KVOE 2I00A 3QAHA 5J8CA 5EBVA 3R1KA 2FIAA 3V8IA 2CY2A 1Z4EA 2FCKA 1MJBA 3R95A 4QVTA 2VZYA 2P6FA 2G3TA 5GCNA 3CXQA 4H89A 4UWIA 2R7HA 2OZGA 2FL4A 3FNCA 4R3LA 1MK4A 1KZFA 4XPDB 2Q4YA 2I79A 2OB0A 3F5BA 1B6BA 2A4NA 3D3SA 5DWMA 4OLLA 1I1DA 4ZBGA 1RXTA 3FB3A 4B5PA 4KOUA 2AE6A 4KLWA 2R1IA 4F0YA 2DXQA 2VQYA 2ZW5A 1Z9UA 4MI4A 4MBUA 4L8AA 4XNHB 3EO4A 3FBUA 4AG7A 1CM0A 4FD6A 2OH1A 1S7KA 1YREA 1Y7RA 3W6XA 3ZJ0A 5F49A 1Q2DA 2REFA 3WR7A 3TFYA 1XEBA 4OADA 5C88A 4KOXA 1YVOA 2BSWA 2BEIA 2O28A 4NEXA 2PSWA 2GE3A 5KTAA 1KUXA 2REEA 2BL1A 2PQ8A 4KOWA 4Y49C 2CNMA 3MGDA 3TTHA 1ON0A 5JQ4A 1IIDA 4FD5A 2VZZA 4PV6A 4XPKA 3I3GA 4JLYA 1XF8A 4IUSA 3TO6A 4LX9A 4NCZA 2PR1A 1NE9A 2B5GA 2VI7A 4M3SA 2FSRA 4CAXA 2QMLA 4YFJA 2GIVA 1XE4A 3D2MA 3SHPA 1S7NA 4GS4A 1I12A 2B4BA 4PK2A 1M44A 1I21A 4U9YA 4DNCA 2P0WA 2C27A 4FD4A 2WPXA 3B8GA 1YX0A 3TE4A 1YLEA 3FRMA 3G3SA 3LD2A 4KLVA 4XPDC 5C82A 3E0KA 2PR8A 3FXTA 1WWZA 2AJ6A 2GANA 3GKRA 3H4QA 4KUBA 4AB7A 4UWJA 4KVME 2H5MA 3N7ZA 5EC4A 2ZW6A 1N71A 2Z10A 4FD7A 1S60A 2PRBA 5H86A 4XNHC 2R98A 5E96A 4HNYB 4JJXA 4CRZB 4E8OA 2FE7A 2VBQA 1WK4A 5IB0A 5HH1A 1Q2YA 1P4NA 4U5YA 5ISVA 2Z11A 3TO7A 4E0AA 2HQYA 2FT0A 1RO5A 2Y0MA 4NSQA 5I0CA 2CNTA 3TO9A 1YR0A 1YK3A 4PSXA 1S7FA 2Q44A 2HV2A 4II9A 4KUAA 5F46A 2IL4A 4AVAA 4KOTA 2JDCA 2F5IA 2WPWA 4AVCA 1NMTA 5F48A 1YVKA 4K30A 4KOVA 1BOBA 2EVNA 4JXRA 2HUZA 3GYAA 4JD6A 1Y9WA 1FY7A 3T90A 4CAVA 4MJ8A 1UFHA 2JLMA 1IB1E 3BJ7A 3D2PA 2FS5A 4IF5A 2P6EA 1IICA 4LUAA 3DR6A 2B4DB 1L0CA 5CNPA 3P2HA 2BUEA 3KKWA 4NF1A 2G3AA 2J8RA 2ZW4A 3I9SA 1GHEA 4PSWA 3LODA 4AVBA 2ZPAA 1LRZA 1M4DA 2B3UA 2R8VA 2ATRA 4PK3A 1P0HA 2NMTA 1QSTA 3RYOA 4KZTA 2VEZA 3DSBA 3TCVA 2Q4VA 4CAWA 4EVYA 1IYKA 4B5OA 1YGHA 1NSLA 3S6GA 4KOSA 2J8NA 5KTCA 4R57A 4NXYA 2CNSA 2P6GA 1Q2CA 2PDOA 3EXNA 4MY3A 4HNWB 2JDDA 4R87A 1S7LA 4R9MA 3S6HA 4OAEA 2J8MA 1V0CA 1PU9A 2FXFA 4B5PB 3TT2A 5JPHA 4UA3A 2Q04A 1Y9KA 5F47A 3S6KA 1VKCA 5IV0A 1XMTA 3W91A 5J8FA 4MY0A 3C26A 3SXNA 1KUYA 3EFAA 1QSRA 3BLNA 4Y49B 4F6AA 5IX3A 2Z0ZA 4QUSA 3R9FA 1BO4A 3UY5A 4BMHA 2D4OA 3DDDA 4UBRA 5FVJA 4KVXA 1U6MA 3CXSA
chains in the Genus database with same CATH superfamily
3LACA 4UFXA 4YGOA 1Z5RA 4C2ZA 5JGFA 2PC1A 1XIXA 4G1PA 4HNXB 4CGMA 2GREA 3PGPA 1CBXA 4ORFA 5G22A 3F8KA 1XOVA 3PFEA 2PVWA 2QIRA 2OOTA 4KS9A 4R7MA 2JEVA 2G0BA 4NFRA 2PE3A 4P4JA 3SJGA 1SQHA 2ODFA 3PP9A 3PB9X 1VIXA 3D8PA 3R9EA 3B2YA 2PCUA 1Z8LA 3NFZA 4UEFA 5H84A 4BINA 3FIXA 4FBEA 3G8WA 1MJ9A 4OC3A 3IU2A 3BI1A 4UCNA 4NJQA 1QSNA 3TOAA 4CS0B 2FIWA 4H6ZA 2HB6A 1IYLA 4GXHA 3K9UA 3R9GA 2ZW7A 3PB4X 4ONUA 4P4IA 5AGEA 2EUIA 3W6SA 1VHSA 5BWAB 3B3TA 2G9DA 3FYNA 2K5TA 3NE7A 4OP4A 2B5GB 2RC4A 4QC6A 5KTDA 3KHXA 1QSOA 2V8VA 5HMNA 1QSMA 3SXOA 4LQ6A 5DS0A 1ARLA 3EC4A 3JVNA 3GY9A 3L2NA 1KUVA 3QB8A 2O4HA 4RI1A 1F2PA 4OMEA 2Z3KA 4R3KA 1F2OA 1JQGA 4X5KA 4E2AA 3VWEA 1R43A 3N5FA 4MXUA 2ZEDA 1S3ZA 3KASA 1ZLIA 2OZUA 4MFPA 3CDXA 1TKJA 1QMUA 2D4PA 5JM6A 4HKFA 4A39A 3CXPA 2GFQA 2ABZA 2ARHA 2PJ6A 3GLJA 4I49A 4U9ZA 3SJEA 2OR4A 3FJUA 5G1ZA 2ZELA 1AMPA 1Y7EA 1Z8TA 3IWGA 2Z3OA 3NE8A 4P4DA 3T9YA 1R57A 1X12A 1XJOA 2RFHA 1K4JA 3B3CA 4PPZA 4CGNA 3BJ8A 2X7BA 4ZX8A 2QYVA 4UFVA 4ZX9A 5DWNA 3D66A 2DEAA 3CPXA 2Z3MA 2OU2A 4ZI6A 1M4IA 2B3VA 4YRHA 2OZHA 4MHDA 3PZJA 1MJAA 2DF5A 2KCWA 4CYQA 1Z4RA 4Q7AA 1TKHA 2PJCA 4CRYB 3EY5A 5D8NA 2Q51A 1DE4C 4CYOA 1M4GA 2PJ4A 1S5KA 4C7IA 1TIQA 4CGOA 3S9LA 3DNSA 2QVPA 1F57A 3TOBA 1A2ZA 3D7GA 4JWPA 4NGSA 3B3SA 1Y0RA 4H2KA 3R96A 5LRGA 4C7HA 4KSIA 5K8NA 3RNZA 3VWDA 3DR8A 2Q7BA 3S6FA 1CJWA 1PUAA 4QBJA 2Q0YA 1ZG8A 3PB7X 4X2TA 3TC8A 2QECA 2B58A 4C68A 1J4JA 2Z3NA 1OZPA 4JXQA 2DPTA 4UIBA 4MCRA 4IK2A 4TWEA 1B87A 3D7DA 4IAVA 4KORA 3ZZIA 1CP7A 3FH4A 4MHPA 2V8HA 2B4DA 4AG9A 4KOYA 1DTDA 3IGRA 3ISXA 4PXEA 4RS2A 5EMIA 2VXKA 1M1DA 3VATA 4QB9A 4L89A 3JUWA 4MHYA 5HXDA 2AFOA 3RBUA 3TE4A 3F0AA 4A33A 4WWVA 1ZG7A 4MFQA 2ZXVA 1R3NA 5LYDA 3GB0A 3PEIA 3OWCA 2ZEMA 1BPNA 3D68A 4M85A 4H6UA 4J3GA 3P2FA 3IFEA 4XPLA 4KVOE 4EWTA 1M4LA 4F9VA 1YLOA 3H8EA 2I00A 2CTCA 5HVGA 3QAHA 2RB7A 1LCPA 3CPAA 5J8CA 2AFWA 5EBVA 5K8OA 1H8LA 4Q36A 4B14A 3R1KA 2FIAA 3KR5A 3V8IA 2CY2A 1Z4EA 4R6TA 2FCKA 1MJBA 3R95A 4QVTA 2J9AA 3IWWA 1XFOA 5CBMA 2VZYA 1XRYA 2YNDA 2P6FA 2G3TA 4P4EA 1BPMA 2PVVA 2Z3LA 5GCNA 3CXQA 4H89A 2BO9A 3LWUA 2R7HA 4NGPA 4UWIA 1LAMA 4P45A 2OZGA 2CTBA 3H8FA 2FL4A 3FNCA 4R3LA 1RTQA 1CP6A 1MK4A 1KZFA 4XPDB 1YQEA 2Q4YA 2I79A 1XBUA 2OB0A 2VL1A 5A28A 4ZGYB 3F5BA 3V38A 1B6BA 2A4NA 3D3SA 3FECA 3D67A 4OLLA 5DWMA 2PJ2A 5CPAA 1I1DA 3SI1A 1YMEA 4ZBGA 1RXTA 3FB3A 7CPAA 4B5PA 4KOUA 1HEEA 4ZY0A 4KSFA 1HDUA 3WC7A 2AE6A 4A30A 4KLWA 2R1IA 4F0YA 4P6YA 3FEDA 2DXQA 2VQYA 2ZW5A 5AG4A 4X8IA 3GIUA 2CXAA 1Z9UA 4ZY2A 4MI4A 3IEHA 2ZENA 4L8AA 4MBUA 4A38A 4XNHB 1Z8XA 3EO4A 4NGTA 4CGLA 1ELLP 3FBUA 4EMEA 4AG7A 5HVFA 3H8GA 1CM0A 4FD6A 3IWEA 2OH1A 1S7KA 1TF8A 1YREA 3IJ3A 1CX8A 1Y7RA 3W6XA 3ZJ0A 1IGBA 1EE3P 5LRKA 5F49A 1Q2DA 2REFA 3WR7A 3TFYA 3K2KA 4O23A 3PRTA 1PYTB 4ONWA 3JTKA 1XEBA 5LYFA 4OADA 4B10A 5C88A 5J1QA 1ZLHA 4KOXA 3PB8X 1YVOA 1FNOA 2BSWA 2BEIA 3KGQA 2O28A 4A37A 4M6GA 3KR4A 4C2YA 4NEXA 2Q4ZA 2PSWA 2GE3A 2ZOGA 5KTAA 1KUXA 3FX6A 1ELMP 2REEA 4FAIA 2BL1A 2PQ8A 2ZOFA 4CAFA 4KOWA 1Z8WA 4Y49C 4ZY1A 2CNMA 3MGDA 4NGQA 1ON0A 3TTHA 2NSMA 5JQ4A 2PIYA 1IIDA 3KI9A 4FD5A 1LAPA 2VZZA 4PV6A 4XPKA 6CPAA 3H5ZA 3I3GA 4JLYA 4ZYQA 1XF8A 4IUSA 5G20A 3TO6A 4LX9A 1IU8A 2PR1A 4M6IA 2WSAA 2WYRA 4NCZA 1NE9A 2B5GA 2VI7A 3KZWA 5ELYA 3NH4A 3VARA 4M3SA 2FSRA 4P4FA 3BHXA 4CAXA 4DYOA 1Z2LA 4F9UA 2QMLA 4B11A 4YFJA 2XEGA 2C6CA 2GIVA 1XE4A 3NH5A 2Q7SA 3D2MA 3DGVA 3SHPA 2BOAA 1S7NA 4F8ZA 4MMOA 2JBKA 4MFKA 4GS4A 1I12A 2B4BA 4PK2A 4OIDA 3CT9A 1M44A 8CPAA 1YW6A 1I21A 1TF9A 2EWBA 3BXMA 4U9YA 4DNCA 2P0WA 2C27A 2ZEEA 2YNEA 3ISZA 4FD4A 4FUUA 2ZEPA 4Z65A 2WPXA 3B8GA 1YX0A 2FVGA 2IMOA 1YLEA 3FRMA 3G3SA 4PXBA 3T8WA 3LD2A 1OBRA 4KLVA 4XPDC 3E0KA 5C82A 1QQ9A 4A32A 2PR8A 3FXTA 2C6GA 1WWZA 2AJ6A 4UFWA 2GANA 4BD9A 3GKRA 5LRJA 5HVHA 3H4QA 2YGWA 2GLFA 4KUBA 4AB7A 1XMBA 4UWJA 4KVME 2H5MA 3N7ZA 1VHOA 5I4MA 1KWMA 3SI0A 5EC4A 4OIWA 2ZW6A 3FEEA 4KSAA 3A9LA 1UWYA 1N71A 2Z10A 2F8HA 3D4UA 4FD7A 3IIBA 3QAYA 1ZO0A 4HPSA 1S60A 3KQXA 3V7ZA 2PRBA 5H86A 4FWUA 4UCPA 2R98A 2AFSA 2V8GA 4MHZA 4XNHC 5LYIA 1VHEA 3FF3A 4MHNA 3PBEA 5E96A 4HNYB 3IU1A 4JJXA 4CRZB 3VH9A 4E8OA 5K8PA 4M6HA 2V77A 4B13A 4BBHA 4MRIA 2FE7A 3I1UA 2VBQA 1WK4A 2ANPA 5IB0A 4PXCA 5HH1A 1Q2YA 1P4NA 4U5YA 4B6ZA 5ISVA 2Z11A 3TO7A 4E0AA 3DLJA 2HQYA 2FT0A 1RO5A 2Y0MA 2XEIA 4NSQA 2I3CA 5A27A 2CNTA 3TO9A 1YR0A 5I0CA 1JWQA 1YK3A 4YWYA 4B12A 2F7VA 4K3NA 4PSXA 1S7FA 2YNCC 3D7HA 2Z3PA 2CIJA 3PB6X 3RO0A 2Q44A 5K8MA 2HV2A 4II9A 3HLPA 4KUAA 4JYWA 5F46A 4OC1A 2PJBA 4DJLA 3B3WA 2IL4A 2POKA 4OC4A 3KHZA 4AVAA 4KOTA 2JDCA 2F5IA 2PJ0A 1IOIA 2AFMA 2WPWA 4UEEA 2PJAA 3RAMA 1NMTA 2WZNA 3IC1A 4AVCA 4P10A 5F48A 5LYLA 4NJRA 4PQAA 2AFZA 1YVKA 2C6PA 4K30A 3K9TA 3LMSA 1BOBA 3HUVA 2EK9A 3NA6A 4KOVA 3WC6A 5AG5A 2EVNA 2JBJA 4JXRA 2HUZA 4MCSA 3GYAA 1ARMA 1PCAA 2NYQA 4JD6A 3PFOA 2WUUA 1Y9WA 1FY7A 3T90A 3SI2A 4CAVA 1BAVA 4MJ8A 1NSAA 1X10A 1UFHA 2ZEGA 3FMCA 1YW4A 2AFXA 2JLMA 1TKFA 2AFUA 4UF4A 1IB1E 3BJ7A 1AYEA 4R8FA 3D2PA 2HC9A 3JRUA 2V8DA 2C1CA 2FS5A 4IF5A 3B3VA 2P6EA 1IICA 4LUAA 3DR6A 3RZAA 3KL9A 2B4DB 1TXRA 4RN7A 3MRUA 4MFZA 2DPSA 2EK8A 3MN8A 4LQGA 3SJFA 3WT4A 1L0CA 5CNPA 4NGRA 2O53A 3P2HA 5F09A 2BUEA 3KKWA 1VGYA 4NF1A 4UIAA 3B7IA 2XEJA 4OC0A 2G3AA 3NH8A 2J8RA 2ZW4A 1HDQA 4A31A 4P44A 2PJ3A 3I9SA 1GHEA 4MFLA 4PSWA 3PBBA 3LODA 5AG7A 4AVBA 4CGPA 3S9NA 5AG6A 2ZEHA 2BCOA 2ZPAA 1LRZA 1IY7A 1M4DA 2B3UA 4C2XA 1IOFA 2QJ8A 2R8VA 4NGMA 4WJBA 4P4BA 2ATRA 4YU9A 4PK3A 4UCMA 3QNVA 4A2ZA 4CYNA 1P0HA 2NMTA 1LFWA 1QSTA 3RYOA 4KZTA 2PJ7A 2VEZA 2PIZA 3DSBA 3TCVA 2Q4VA 4CAWA 4A94A 4EVYA 2IQ6A 3KQZA 3B35A 1IYKA 4Q38A 1BLLE 1FT7A 1YGHA 1ZG9A 2PJ5A 4B5OA 1NSLA 2XEFA 3S6GA 4KOSA 2J8NA 4MCPA 5KTCA 2PRQA 4R57A 4NXYA 1CPSA 3CZXA 4GM5A 4UEZA 5THWA 2CNSA 4CAEA 2P6GA 2ZEOA 1Q2CA 3WC5A 2PJ9A 2PDOA 1GYTA 3EXNA 4MY3A 4HNWB 4CPAA 4W9YA 2JDDA 4R87A 1Q7LA 4PXDA 1CG2A 2GU2A 1S7LA 4R9MA 4EFDA 4JZ0A 4OKOA 3TX8A 4OC2A 5IB9A 3S9MA 3S6HA 4OAEA 2J8MA 1V0CA 1PU9A 2FXFA 2ZEFA 2JEWA 4B5PB 3TT2A 4CYPA 4A95A 4UA3A 5JPHA 4NGNA 2Q04A 2PJ1A 5G21A 1Y9KA 5F47A 4DUKA 2EBJA 4IHMA 4MFJA 3D7FA 4R76A 3S6KA 4RUHA 3IO1A 1CPXA 4AXVA 1VKCA 3FVLA 3GUXA 5IV0A 1XMTA 1Y0YA 3W91A 4MY0A 5J8FA 2IJZA 2YNCA 3C26A 3WABA 3SXNA 1KUYA 2EO8A 2CF4A 2Q43A 4OC5A 3EFAA 5JH9A 1QSRA 3BLNA 4MCQA 4Y49B 4F6AA 5IX3A 2Z0ZA 4QUSA 3R9FA 1BO4A 3BI0A 3UY5A 4BMHA 1LOKA 1LANA 1AUGA 2D4OA 2PJ8A 4X3RA 3SJXA 3DDDA 4UBRA 4TNUA 5FVJA 5D29A 4KVXA 4F0XA 1U6MA 1YSJA 3CXSA 2GLJA
chains in the Genus database with same CATH topology
4UFXA 4YGOA 4C2ZA 2PC1A 1XIXA 4HNXB 4CGMA 3PGPA 4ORFA 5G22A 3F8KA 2QIRA 4KS9A 2JEVA 2G0BA 1SQHA 3PP9A 3D8PA 3R9EA 5H84A 3FIXA 3G8WA 1MJ9A 3IU2A 4UCNA 1QSNA 3TOAA 4CS0B 2FIWA 4H6ZA 1IYLA 3K9UA 3R9GA 2ZW7A 3W6SA 4ONUA 5AGEA 2EUIA 5BWAB 1VHSA 3FYNA 2K5TA 3NE7A 2B5GB 2RC4A 4QC6A 5KTDA 1QSOA 5HMNA 1QSMA 3SXOA 3EC4A 3JVNA 3GY9A 1KUVA 3QB8A 4RI1A 2Z3KA 4R3KA 4X5KA 4E2AA 3VWEA 1S3ZA 2OZUA 4MFPA 2D4PA 4HKFA 3CXPA 2ARHA 4I49A 4U9ZA 5G1ZA 3T9YA 3IWGA 2Z3OA 1R57A 1K4JA 4CGNA 3BJ8A 2X7BA 4UFVA 5DWNA 2Z3MA 2OU2A 1M4IA 2B3VA 4YRHA 2OZHA 4MHDA 3PZJA 1MJAA 2KCWA 4CYQA 1Z4RA 4CRYB 3EY5A 4CYOA 1M4GA 1S5KA 4C7IA 1TIQA 4CGOA 3DNSA 3TOBA 4JWPA 3R96A 4C7HA 3VWDA 3DR8A 2Q7BA 3S6FA 1CJWA 1PUAA 4QBJA 2Q0YA 2QECA 2B58A 4C68A 1J4JA 2Z3NA 1OZPA 4JXQA 2DPTA 1B87A 4KORA 3ZZIA 2B4DA 4AG9A 4KOYA 3IGRA 4RS2A 2VXKA 1M1DA 4QB9A 4L89A 3JUWA 3F0AA 4A33A 4MFQA 2ZXVA 3OWCA 4M85A 4H6UA 4J3GA 3P2FA 4XPLA 4KVOE 2I00A 3QAHA 5J8CA 5EBVA 4Q36A 4B14A 3R1KA 2FIAA 3V8IA 2CY2A 1Z4EA 2FCKA 1MJBA 3R95A 4QVTA 2VZYA 2YNDA 2P6FA 2G3TA 5GCNA 2Z3LA 3CXQA 4H89A 4UWIA 2R7HA 2OZGA 2FL4A 3FNCA 4R3LA 1MK4A 1KZFA 4XPDB 2Q4YA 2I79A 2OB0A 5A28A 4ZGYB 3F5BA 1B6BA 2A4NA 3D3SA 5DWMA 4OLLA 1I1DA 4ZBGA 1RXTA 3FB3A 4B5PA 4KOUA 4KSFA 2AE6A 4A30A 4KLWA 2R1IA 4F0YA 2DXQA 2VQYA 2ZW5A 5AG4A 2CXAA 1Z9UA 4MI4A 4MBUA 4L8AA 4XNHB 3EO4A 4CGLA 3FBUA 4AG7A 1CM0A 4FD6A 3IWEA 2OH1A 1S7KA 1YREA 1Y7RA 3W6XA 3ZJ0A 5F49A 1Q2DA 2REFA 3WR7A 3TFYA 3JTKA 1XEBA 4OADA 4B10A 5C88A 4KOXA 1YVOA 2BSWA 2BEIA 2O28A 4C2YA 4NEXA 2PSWA 2GE3A 5KTAA 1KUXA 2REEA 2BL1A 2PQ8A 4CAFA 4KOWA 4Y49C 2CNMA 3MGDA 3TTHA 1ON0A 5JQ4A 1IIDA 4FD5A 2VZZA 4PV6A 4XPKA 3H5ZA 3I3GA 4JLYA 1XF8A 4IUSA 5G20A 3TO6A 4LX9A 4NCZA 2PR1A 2WSAA 1NE9A 2B5GA 2VI7A 4M3SA 2FSRA 4CAXA 2QMLA 4B11A 4YFJA 2GIVA 1XE4A 3D2MA 3SHPA 1S7NA 4MFKA 4GS4A 1I12A 2B4BA 4PK2A 1M44A 1I21A 4U9YA 4DNCA 2P0WA 2C27A 4FD4A 2YNEA 2WPXA 3B8GA 1YX0A 3TE4A 1YLEA 3FRMA 3G3SA 3LD2A 4KLVA 4XPDC 5C82A 3E0KA 4A32A 2PR8A 3FXTA 4UFWA 1WWZA 2AJ6A 2GANA 3GKRA 3H4QA 2YGWA 4KUBA 4AB7A 4UWJA 4KVME 2H5MA 3N7ZA 5EC4A 2ZW6A 4KSAA 3A9LA 1N71A 2Z10A 4FD7A 1ZO0A 1S60A 2PRBA 5H86A 4UCPA 2R98A 4XNHC 5E96A 4HNYB 3IU1A 4JJXA 4CRZB 4E8OA 4B13A 4BBHA 2FE7A 2VBQA 1WK4A 5IB0A 5HH1A 1Q2YA 1P4NA 4U5YA 5ISVA 2Z11A 3TO7A 4E0AA 2HQYA 2FT0A 1RO5A 2Y0MA 4NSQA 5A27A 5I0CA 2CNTA 3TO9A 1YR0A 1YK3A 4B12A 4PSXA 1S7FA 2YNCC 2Z3PA 2Q44A 2HV2A 4II9A 4KUAA 5F46A 2IL4A 4AVAA 4KOTA 2JDCA 2F5IA 2WPWA 4AVCA 1NMTA 5F48A 1YVKA 4K30A 4KOVA 1BOBA 5AG5A 2EVNA 4JXRA 2HUZA 3GYAA 4JD6A 2WUUA 1Y9WA 1FY7A 3T90A 4CAVA 4MJ8A 1UFHA 2JLMA 1IB1E 3BJ7A 3D2PA 2FS5A 4IF5A 2P6EA 1IICA 4LUAA 3DR6A 2B4DB 4MFZA 2DPSA 1L0CA 5CNPA 3P2HA 2BUEA 3KKWA 4NF1A 2G3AA 2J8RA 2ZW4A 4A31A 3I9SA 1GHEA 4MFLA 4PSWA 3LODA 5AG7A 4AVBA 4CGPA 5AG6A 2ZPAA 1LRZA 1M4DA 2B3UA 4C2XA 2R8VA 2ATRA 4PK3A 4UCMA 4A2ZA 4CYNA 1P0HA 2NMTA 1QSTA 3RYOA 4KZTA 2VEZA 3DSBA 3TCVA 2Q4VA 4CAWA 4EVYA 1IYKA 4Q38A 4B5OA 1YGHA 1NSLA 3S6GA 4KOSA 2J8NA 5KTCA 4R57A 4NXYA 2CNSA 4CAEA 2P6GA 1Q2CA 2PDOA 3EXNA 4MY3A 4HNWB 2JDDA 4R87A 1S7LA 4R9MA 3S6HA 4OAEA 2J8MA 1V0CA 1PU9A 2FXFA 4B5PB 3TT2A 4CYPA 4A95A 4UA3A 5JPHA 2Q04A 5G21A 1Y9KA 5F47A 3S6KA 4MFJA 1VKCA 5IV0A 1XMTA 3W91A 5J8FA 4MY0A 2YNCA 3C26A 3SXNA 1KUYA 3EFAA 1QSRA 3BLNA 4Y49B 4F6AA 5IX3A 2Z0ZA 4QUSA 3R9FA 1BO4A 3UY5A 4BMHA 2D4OA 3DDDA 4UBRA 5FVJA 4F0XA 4KVXA 1U6MA 3CXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YGO A;  2PC1 A;  1XIX A;  4HNX B;  3PGP A;  4ORF A;  3F8K A;  2QIR A;  2JEV A;  2G0B A;  1SQH A;  3PP9 A;  3D8P A;  3R9E A;  5H84 A;  3FIX A;  3G8W A;  1MJ9 A;  1QSN A;  3TOA A;  4CS0 B;  2FIW A;  4H6Z A;  1IYL A;  3K9U A;  3R9G A;  2ZW7 A;  3W6S A;  4ONU A;  2EUI A;  1VHS A;  3FYN A;  2K5T A;  3NE7 A;  2B5G B;  2RC4 A;  4QC6 A;  5KTD A;  1QSO A;  5HMN A;  1QSM A;  3SXO A;  3EC4 A;  3JVN A;  3GY9 A;  1KUV A;  3QB8 A;  4RI1 A;  4R3K A;  4X5K A;  4E2A A;  3VWE A;  1S3Z A;  2OZU A;  2D4P A;  4HKF A;  3CXP A;  2ARH A;  4I49 A;  4U9Z A;  3T9Y A;  3IWG A;  1R57 A;  1K4J A;  3BJ8 A;  2X7B A;  5DWN A;  2OU2 A;  1M4I A;  2B3V A;  4YRH A;  2OZH A;  4MHD A;  3PZJ A;  1MJA A;  2KCW A;  1Z4R A;  4CRY B;  3EY5 A;  1M4G A;  1S5K A;  1TIQ A;  3DNS A;  3TOB A;  4JWP A;  3R96 A;  3VWD A;  3DR8 A;  2Q7B A;  3S6F A;  1CJW A;  1PUA A;  4QBJ A;  2Q0Y A;  2QEC A;  2B58 A;  1J4J A;  1OZP A;  4JXQ A;  1B87 A;  4KOR A;  3ZZI A;  2B4D A;  4AG9 A;  4KOY A;  3IGR A;  4RS2 A;  2VXK A;  1M1D A;  4QB9 A;  4L89 A;  3JUW A;  3F0A A;  2ZXV A;  3OWC A;  4M85 A;  4H6U A;  4J3G A;  3P2F A;  4XPL A;  4KVO E;  2I00 A;  3QAH A;  5J8C A;  5EBV A;  3R1K A;  2FIA A;  3V8I A;  2CY2 A;  1Z4E A;  2FCK A;  1MJB A;  3R95 A;  4QVT A;  2VZY A;  2P6F A;  2G3T A;  5GCN A;  3CXQ A;  4H89 A;  4UWI A;  2R7H A;  2OZG A;  2FL4 A;  3FNC A;  4R3L A;  1MK4 A;  1KZF A;  4XPD B;  2Q4Y A;  2I79 A;  2OB0 A;  3F5B A;  1B6B A;  2A4N A;  3D3S A;  5DWM A;  4OLL A;  1I1D A;  4ZBG A;  1RXT A;  3FB3 A;  4B5P A;  4KOU A;  2AE6 A;  4KLW A;  2R1I A;  4F0Y A;  2DXQ A;  2VQY A;  2ZW5 A;  1Z9U A;  4MI4 A;  4MBU A;  4L8A A;  4XNH B;  3EO4 A;  3FBU A;  4AG7 A;  1CM0 A;  4FD6 A;  2OH1 A;  1S7K A;  1YRE A;  1Y7R A;  3W6X A;  3ZJ0 A;  5F49 A;  1Q2D A;  2REF A;  3WR7 A;  3TFY A;  1XEB A;  4OAD A;  5C88 A;  4KOX A;  1YVO A;  2BSW A;  2BEI A;  2O28 A;  4NEX A;  2PSW A;  2GE3 A;  5KTA A;  1KUX A;  2REE A;  2BL1 A;  2PQ8 A;  4KOW A;  4Y49 C;  2CNM A;  3MGD A;  3TTH A;  1ON0 A;  5JQ4 A;  1IID A;  4FD5 A;  2VZZ A;  4PV6 A;  4XPK A;  3I3G A;  4JLY A;  1XF8 A;  4IUS A;  3TO6 A;  4LX9 A;  4NCZ A;  2PR1 A;  1NE9 A;  2B5G A;  2VI7 A;  4M3S A;  2FSR A;  4CAX A;  2QML A;  4YFJ A;  2GIV A;  1XE4 A;  3D2M A;  3SHP A;  1S7N A;  4GS4 A;  1I12 A;  2B4B A;  4PK2 A;  1M44 A;  1I21 A;  4U9Y A;  4DNC A;  2P0W A;  2C27 A;  4FD4 A;  2WPX A;  3B8G A;  1YX0 A;  3TE4 A;  1YLE A;  3FRM A;  3G3S A;  3LD2 A;  4KLV A;  4XPD C;  5C82 A;  3E0K A;  2PR8 A;  3FXT A;  1WWZ A;  2AJ6 A;  2GAN A;  3GKR A;  3H4Q A;  4KUB A;  4AB7 A;  4UWJ A;  4KVM E;  2H5M A;  3N7Z A;  5EC4 A;  2ZW6 A;  1N71 A;  2Z10 A;  4FD7 A;  1S60 A;  2PRB A;  5H86 A;  4XNH C;  2R98 A;  5E96 A;  4HNY B;  4JJX A;  4CRZ B;  4E8O A;  2FE7 A;  2VBQ A;  1WK4 A;  5IB0 A;  5HH1 A;  1Q2Y A;  1P4N A;  4U5Y A;  5ISV A;  2Z11 A;  3TO7 A;  4E0A A;  2HQY A;  2FT0 A;  1RO5 A;  2Y0M A;  4NSQ A;  5I0C A;  2CNT A;  3TO9 A;  1YR0 A;  1YK3 A;  4PSX A;  1S7F A;  2Q44 A;  2HV2 A;  4II9 A;  4KUA A;  5F46 A;  2IL4 A;  4AVA A;  4KOT A;  2JDC A;  2F5I A;  2WPW A;  4AVC A;  1NMT A;  5F48 A;  1YVK A;  4K30 A;  4KOV A;  1BOB A;  2EVN A;  4JXR A;  2HUZ A;  3GYA A;  4JD6 A;  1Y9W A;  1FY7 A;  3T90 A;  4CAV A;  4MJ8 A;  1UFH A;  2JLM A;  1IB1 E;  3BJ7 A;  3D2P A;  2FS5 A;  4IF5 A;  2P6E A;  1IIC A;  4LUA A;  3DR6 A;  2B4D B;  1L0C A;  5CNP A;  3P2H A;  2BUE A;  3KKW A;  4NF1 A;  2G3A A;  2J8R A;  2ZW4 A;  3I9S A;  1GHE A;  4PSW A;  3LOD A;  4AVB A;  2ZPA A;  1LRZ A;  1M4D A;  2B3U A;  2R8V A;  2ATR A;  4PK3 A;  1P0H A;  2NMT A;  1QST A;  3RYO A;  4KZT A;  2VEZ A;  3DSB A;  3TCV A;  2Q4V A;  4CAW A;  4EVY A;  1IYK A;  4B5O A;  1YGH A;  1NSL A;  3S6G A;  4KOS A;  2J8N A;  5KTC A;  4R57 A;  4NXY A;  2CNS A;  2P6G A;  1Q2C A;  2PDO A;  3EXN A;  4MY3 A;  4HNW B;  2JDD A;  4R87 A;  1S7L A;  4R9M A;  3S6H A;  4OAE A;  2J8M A;  1V0C A;  1PU9 A;  2FXF A;  4B5P B;  3TT2 A;  5JPH A;  4UA3 A;  2Q04 A;  1Y9K A;  5F47 A;  3S6K A;  1VKC A;  5IV0 A;  1XMT A;  3W91 A;  5J8F A;  4MY0 A;  3C26 A;  3SXN A;  1KUY A;  3EFA A;  1QSR A;  3BLN A;  4Y49 B;  4F6A A;  5IX3 A;  2Z0Z A;  4QUS A;  3R9F A;  1BO4 A;  3UY5 A;  4BMH A;  2D4O A;  3DDD A;  4UBR A;  5FVJ A;  4KVX A;  1U6M A;  3CXS A; 
#chains in the Genus database with same CATH topology
 3LAC A;  4UFX A;  4YGO A;  1Z5R A;  4C2Z A;  5JGF A;  2PC1 A;  1XIX A;  4G1P A;  4HNX B;  4CGM A;  2GRE A;  3PGP A;  1CBX A;  4ORF A;  5G22 A;  3F8K A;  1XOV A;  3PFE A;  2PVW A;  2QIR A;  2OOT A;  4KS9 A;  4R7M A;  2JEV A;  2G0B A;  4NFR A;  2PE3 A;  4P4J A;  3SJG A;  1SQH A;  2ODF A;  3PP9 A;  3PB9 X;  1VIX A;  3D8P A;  3R9E A;  3B2Y A;  2PCU A;  1Z8L A;  3NFZ A;  4UEF A;  5H84 A;  4BIN A;  3FIX A;  4FBE A;  3G8W A;  1MJ9 A;  4OC3 A;  3IU2 A;  3BI1 A;  4UCN A;  4NJQ A;  1QSN A;  3TOA A;  4CS0 B;  2FIW A;  4H6Z A;  2HB6 A;  1IYL A;  4GXH A;  3K9U A;  3R9G A;  2ZW7 A;  3PB4 X;  4ONU A;  4P4I A;  5AGE A;  2EUI A;  3W6S A;  1VHS A;  5BWA B;  3B3T A;  2G9D A;  3FYN A;  2K5T A;  3NE7 A;  4OP4 A;  2B5G B;  2RC4 A;  4QC6 A;  5KTD A;  3KHX A;  1QSO A;  2V8V A;  5HMN A;  1QSM A;  3SXO A;  4LQ6 A;  5DS0 A;  1ARL A;  3EC4 A;  3JVN A;  3GY9 A;  3L2N A;  1KUV A;  3QB8 A;  2O4H A;  4RI1 A;  1F2P A;  4OME A;  2Z3K A;  4R3K A;  1F2O A;  1JQG A;  4X5K A;  4E2A A;  3VWE A;  1R43 A;  3N5F A;  4MXU A;  2ZED A;  1S3Z A;  3KAS A;  1ZLI A;  2OZU A;  4MFP A;  3CDX A;  1TKJ A;  1QMU A;  2D4P A;  5JM6 A;  4HKF A;  4A39 A;  3CXP A;  2GFQ A;  2ABZ A;  2ARH A;  2PJ6 A;  3GLJ A;  4I49 A;  4U9Z A;  3SJE A;  2OR4 A;  3FJU A;  5G1Z A;  2ZEL A;  1AMP A;  1Y7E A;  1Z8T A;  3IWG A;  2Z3O A;  3NE8 A;  4P4D A;  3T9Y A;  1R57 A;  1X12 A;  1XJO A;  2RFH A;  1K4J A;  3B3C A;  4PPZ A;  4CGN A;  3BJ8 A;  2X7B A;  4ZX8 A;  2QYV A;  4UFV A;  4ZX9 A;  5DWN A;  3D66 A;  2DEA A;  3CPX A;  2Z3M A;  2OU2 A;  4ZI6 A;  1M4I A;  2B3V A;  4YRH A;  2OZH A;  4MHD A;  3PZJ A;  1MJA A;  2DF5 A;  2KCW A;  4CYQ A;  1Z4R A;  4Q7A A;  1TKH A;  2PJC A;  4CRY B;  3EY5 A;  5D8N A;  2Q51 A;  1DE4 C;  4CYO A;  1M4G A;  2PJ4 A;  1S5K A;  4C7I A;  1TIQ A;  4CGO A;  3S9L A;  3DNS A;  2QVP A;  1F57 A;  3TOB A;  1A2Z A;  3D7G A;  4JWP A;  4NGS A;  3B3S A;  1Y0R A;  4H2K A;  3R96 A;  5LRG A;  4C7H A;  4KSI A;  5K8N A;  3RNZ A;  3VWD A;  3DR8 A;  2Q7B A;  3S6F A;  1CJW A;  1PUA A;  4QBJ A;  2Q0Y A;  1ZG8 A;  3PB7 X;  4X2T A;  3TC8 A;  2QEC A;  2B58 A;  4C68 A;  1J4J A;  2Z3N A;  1OZP A;  4JXQ A;  2DPT A;  4UIB A;  4MCR A;  4IK2 A;  4TWE A;  1B87 A;  3D7D A;  4IAV A;  4KOR A;  3ZZI A;  1CP7 A;  3FH4 A;  4MHP A;  2V8H A;  2B4D A;  4AG9 A;  4KOY A;  1DTD A;  3IGR A;  3ISX A;  4PXE A;  4RS2 A;  5EMI A;  2VXK A;  1M1D A;  3VAT A;  4QB9 A;  4L89 A;  3JUW A;  4MHY A;  5HXD A;  2AFO A;  3RBU A;  3TE4 A;  3F0A A;  4A33 A;  4WWV A;  1ZG7 A;  4MFQ A;  2ZXV A;  1R3N A;  5LYD A;  3GB0 A;  3PEI A;  3OWC A;  2ZEM A;  1BPN A;  3D68 A;  4M85 A;  4H6U A;  4J3G A;  3P2F A;  3IFE A;  4XPL A;  4KVO E;  4EWT A;  1M4L A;  4F9V A;  1YLO A;  3H8E A;  2I00 A;  2CTC A;  5HVG A;  3QAH A;  2RB7 A;  1LCP A;  3CPA A;  5J8C A;  2AFW A;  5EBV A;  5K8O A;  1H8L A;  4Q36 A;  4B14 A;  3R1K A;  2FIA A;  3KR5 A;  3V8I A;  2CY2 A;  1Z4E A;  4R6T A;  2FCK A;  1MJB A;  3R95 A;  4QVT A;  2J9A A;  3IWW A;  1XFO A;  5CBM A;  2VZY A;  1XRY A;  2YND A;  2P6F A;  2G3T A;  4P4E A;  1BPM A;  2PVV A;  2Z3L A;  5GCN A;  3CXQ A;  4H89 A;  2BO9 A;  3LWU A;  2R7H A;  4NGP A;  4UWI A;  1LAM A;  4P45 A;  2OZG A;  2CTB A;  3H8F A;  2FL4 A;  3FNC A;  4R3L A;  1RTQ A;  1CP6 A;  1MK4 A;  1KZF A;  4XPD B;  1YQE A;  2Q4Y A;  2I79 A;  1XBU A;  2OB0 A;  2VL1 A;  5A28 A;  4ZGY B;  3F5B A;  3V38 A;  1B6B A;  2A4N A;  3D3S A;  3FEC A;  3D67 A;  4OLL A;  5DWM A;  2PJ2 A;  5CPA A;  1I1D A;  3SI1 A;  1YME A;  4ZBG A;  1RXT A;  3FB3 A;  7CPA A;  4B5P A;  4KOU A;  1HEE A;  4ZY0 A;  4KSF A;  1HDU A;  3WC7 A;  2AE6 A;  4A30 A;  4KLW A;  2R1I A;  4F0Y A;  4P6Y A;  3FED A;  2DXQ A;  2VQY A;  2ZW5 A;  5AG4 A;  4X8I A;  3GIU A;  2CXA A;  1Z9U A;  4ZY2 A;  4MI4 A;  3IEH A;  2ZEN A;  4L8A A;  4MBU A;  4A38 A;  4XNH B;  1Z8X A;  3EO4 A;  4NGT A;  4CGL A;  1ELL P;  3FBU A;  4EME A;  4AG7 A;  5HVF A;  3H8G A;  1CM0 A;  4FD6 A;  3IWE A;  2OH1 A;  1S7K A;  1TF8 A;  1YRE A;  3IJ3 A;  1CX8 A;  1Y7R A;  3W6X A;  3ZJ0 A;  1IGB A;  1EE3 P;  5LRK A;  5F49 A;  1Q2D A;  2REF A;  3WR7 A;  3TFY A;  3K2K A;  4O23 A;  3PRT A;  1PYT B;  4ONW A;  3JTK A;  1XEB A;  5LYF A;  4OAD A;  4B10 A;  5C88 A;  5J1Q A;  1ZLH A;  4KOX A;  3PB8 X;  1YVO A;  1FNO A;  2BSW A;  2BEI A;  3KGQ A;  2O28 A;  4A37 A;  4M6G A;  3KR4 A;  4C2Y A;  4NEX A;  2Q4Z A;  2PSW A;  2GE3 A;  2ZOG A;  5KTA A;  1KUX A;  3FX6 A;  1ELM P;  2REE A;  4FAI A;  2BL1 A;  2PQ8 A;  2ZOF A;  4CAF A;  4KOW A;  1Z8W A;  4Y49 C;  4ZY1 A;  2CNM A;  3MGD A;  4NGQ A;  1ON0 A;  3TTH A;  2NSM A;  5JQ4 A;  2PIY A;  1IID A;  3KI9 A;  4FD5 A;  1LAP A;  2VZZ A;  4PV6 A;  4XPK A;  6CPA A;  3H5Z A;  3I3G A;  4JLY A;  4ZYQ A;  1XF8 A;  4IUS A;  5G20 A;  3TO6 A;  4LX9 A;  1IU8 A;  2PR1 A;  4M6I A;  2WSA A;  2WYR A;  4NCZ A;  1NE9 A;  2B5G A;  2VI7 A;  3KZW A;  5ELY A;  3NH4 A;  3VAR A;  4M3S A;  2FSR A;  4P4F A;  3BHX A;  4CAX A;  4DYO A;  1Z2L A;  4F9U A;  2QML A;  4B11 A;  4YFJ A;  2XEG A;  2C6C A;  2GIV A;  1XE4 A;  3NH5 A;  2Q7S A;  3D2M A;  3DGV A;  3SHP A;  2BOA A;  1S7N A;  4F8Z A;  4MMO A;  2JBK A;  4MFK A;  4GS4 A;  1I12 A;  2B4B A;  4PK2 A;  4OID A;  3CT9 A;  1M44 A;  8CPA A;  1YW6 A;  1I21 A;  1TF9 A;  2EWB A;  3BXM A;  4U9Y A;  4DNC A;  2P0W A;  2C27 A;  2ZEE A;  2YNE A;  3ISZ A;  4FD4 A;  4FUU A;  2ZEP A;  4Z65 A;  2WPX A;  3B8G A;  1YX0 A;  2FVG A;  2IMO A;  1YLE A;  3FRM A;  3G3S A;  4PXB A;  3T8W A;  3LD2 A;  1OBR A;  4KLV A;  4XPD C;  3E0K A;  5C82 A;  1QQ9 A;  4A32 A;  2PR8 A;  3FXT A;  2C6G A;  1WWZ A;  2AJ6 A;  4UFW A;  2GAN A;  4BD9 A;  3GKR A;  5LRJ A;  5HVH A;  3H4Q A;  2YGW A;  2GLF A;  4KUB A;  4AB7 A;  1XMB A;  4UWJ A;  4KVM E;  2H5M A;  3N7Z A;  1VHO A;  5I4M A;  1KWM A;  3SI0 A;  5EC4 A;  4OIW A;  2ZW6 A;  3FEE A;  4KSA A;  3A9L A;  1UWY A;  1N71 A;  2Z10 A;  2F8H A;  3D4U A;  4FD7 A;  3IIB A;  3QAY A;  1ZO0 A;  4HPS A;  1S60 A;  3KQX A;  3V7Z A;  2PRB A;  5H86 A;  4FWU A;  4UCP A;  2R98 A;  2AFS A;  2V8G A;  4MHZ A;  4XNH C;  5LYI A;  1VHE A;  3FF3 A;  4MHN A;  3PBE A;  5E96 A;  4HNY B;  3IU1 A;  4JJX A;  4CRZ B;  3VH9 A;  4E8O A;  5K8P A;  4M6H A;  2V77 A;  4B13 A;  4BBH A;  4MRI A;  2FE7 A;  3I1U A;  2VBQ A;  1WK4 A;  2ANP A;  5IB0 A;  4PXC A;  5HH1 A;  1Q2Y A;  1P4N A;  4U5Y A;  4B6Z A;  5ISV A;  2Z11 A;  3TO7 A;  4E0A A;  3DLJ A;  2HQY A;  2FT0 A;  1RO5 A;  2Y0M A;  2XEI A;  4NSQ A;  2I3C A;  5A27 A;  2CNT A;  3TO9 A;  1YR0 A;  5I0C A;  1JWQ A;  1YK3 A;  4YWY A;  4B12 A;  2F7V A;  4K3N A;  4PSX A;  1S7F A;  2YNC C;  3D7H A;  2Z3P A;  2CIJ A;  3PB6 X;  3RO0 A;  2Q44 A;  5K8M A;  2HV2 A;  4II9 A;  3HLP A;  4KUA A;  4JYW A;  5F46 A;  4OC1 A;  2PJB A;  4DJL A;  3B3W A;  2IL4 A;  2POK A;  4OC4 A;  3KHZ A;  4AVA A;  4KOT A;  2JDC A;  2F5I A;  2PJ0 A;  1IOI A;  2AFM A;  2WPW A;  4UEE A;  2PJA A;  3RAM A;  1NMT A;  2WZN A;  3IC1 A;  4AVC A;  4P10 A;  5F48 A;  5LYL A;  4NJR A;  4PQA A;  2AFZ A;  1YVK A;  2C6P A;  4K30 A;  3K9T A;  3LMS A;  1BOB A;  3HUV A;  2EK9 A;  3NA6 A;  4KOV A;  3WC6 A;  5AG5 A;  2EVN A;  2JBJ A;  4JXR A;  2HUZ A;  4MCS A;  3GYA A;  1ARM A;  1PCA A;  2NYQ A;  4JD6 A;  3PFO A;  2WUU A;  1Y9W A;  1FY7 A;  3T90 A;  3SI2 A;  4CAV A;  1BAV A;  4MJ8 A;  1NSA A;  1X10 A;  1UFH A;  2ZEG A;  3FMC A;  1YW4 A;  2AFX A;  2JLM A;  1TKF A;  2AFU A;  4UF4 A;  1IB1 E;  3BJ7 A;  1AYE A;  4R8F A;  3D2P A;  2HC9 A;  3JRU A;  2V8D A;  2C1C A;  2FS5 A;  4IF5 A;  3B3V A;  2P6E A;  1IIC A;  4LUA A;  3DR6 A;  3RZA A;  3KL9 A;  2B4D B;  1TXR A;  4RN7 A;  3MRU A;  4MFZ A;  2DPS A;  2EK8 A;  3MN8 A;  4LQG A;  3SJF A;  3WT4 A;  1L0C A;  5CNP A;  4NGR A;  2O53 A;  3P2H A;  5F09 A;  2BUE A;  3KKW A;  1VGY A;  4NF1 A;  4UIA A;  3B7I A;  2XEJ A;  4OC0 A;  2G3A A;  3NH8 A;  2J8R A;  2ZW4 A;  1HDQ A;  4A31 A;  4P44 A;  2PJ3 A;  3I9S A;  1GHE A;  4MFL A;  4PSW A;  3PBB A;  3LOD A;  5AG7 A;  4AVB A;  4CGP A;  3S9N A;  5AG6 A;  2ZEH A;  2BCO A;  2ZPA A;  1LRZ A;  1IY7 A;  1M4D A;  2B3U A;  4C2X A;  1IOF A;  2QJ8 A;  2R8V A;  4NGM A;  4WJB A;  4P4B A;  2ATR A;  4YU9 A;  4PK3 A;  4UCM A;  3QNV A;  4A2Z A;  4CYN A;  1P0H A;  2NMT A;  1LFW A;  1QST A;  3RYO A;  4KZT A;  2PJ7 A;  2VEZ A;  2PIZ A;  3DSB A;  3TCV A;  2Q4V A;  4CAW A;  4A94 A;  4EVY A;  2IQ6 A;  3KQZ A;  3B35 A;  1IYK A;  4Q38 A;  1BLL E;  1FT7 A;  1YGH A;  1ZG9 A;  2PJ5 A;  4B5O A;  1NSL A;  2XEF A;  3S6G A;  4KOS A;  2J8N A;  4MCP A;  5KTC A;  2PRQ A;  4R57 A;  4NXY A;  1CPS A;  3CZX A;  4GM5 A;  4UEZ A;  5THW A;  2CNS A;  4CAE A;  2P6G A;  2ZEO A;  1Q2C A;  3WC5 A;  2PJ9 A;  2PDO A;  1GYT A;  3EXN A;  4MY3 A;  4HNW B;  4CPA A;  4W9Y A;  2JDD A;  4R87 A;  1Q7L A;  4PXD A;  1CG2 A;  2GU2 A;  1S7L A;  4R9M A;  4EFD A;  4JZ0 A;  4OKO A;  3TX8 A;  4OC2 A;  5IB9 A;  3S9M A;  3S6H A;  4OAE A;  2J8M A;  1V0C A;  1PU9 A;  2FXF A;  2ZEF A;  2JEW A;  4B5P B;  3TT2 A;  4CYP A;  4A95 A;  4UA3 A;  5JPH A;  4NGN A;  2Q04 A;  2PJ1 A;  5G21 A;  1Y9K A;  5F47 A;  4DUK A;  2EBJ A;  4IHM A;  4MFJ A;  3D7F A;  4R76 A;  3S6K A;  4RUH A;  3IO1 A;  1CPX A;  4AXV A;  1VKC A;  3FVL A;  3GUX A;  5IV0 A;  1XMT A;  1Y0Y A;  3W91 A;  4MY0 A;  5J8F A;  2IJZ A;  2YNC A;  3C26 A;  3WAB A;  3SXN A;  1KUY A;  2EO8 A;  2CF4 A;  2Q43 A;  4OC5 A;  3EFA A;  5JH9 A;  1QSR A;  3BLN A;  4MCQ A;  4Y49 B;  4F6A A;  5IX3 A;  2Z0Z A;  4QUS A;  3R9F A;  1BO4 A;  3BI0 A;  3UY5 A;  4BMH A;  1LOK A;  1LAN A;  1AUG A;  2D4O A;  2PJ8 A;  4X3R A;  3SJX A;  3DDD A;  4UBR A;  4TNU A;  5FVJ A;  5D29 A;  4KVX A;  4F0X A;  1U6M A;  1YSJ A;  3CXS A;  2GLJ A; 
#chains in the Genus database with same CATH homology
 4UFX A;  4YGO A;  4C2Z A;  2PC1 A;  1XIX A;  4HNX B;  4CGM A;  3PGP A;  4ORF A;  5G22 A;  3F8K A;  2QIR A;  4KS9 A;  2JEV A;  2G0B A;  1SQH A;  3PP9 A;  3D8P A;  3R9E A;  5H84 A;  3FIX A;  3G8W A;  1MJ9 A;  3IU2 A;  4UCN A;  1QSN A;  3TOA A;  4CS0 B;  2FIW A;  4H6Z A;  1IYL A;  3K9U A;  3R9G A;  2ZW7 A;  3W6S A;  4ONU A;  5AGE A;  2EUI A;  5BWA B;  1VHS A;  3FYN A;  2K5T A;  3NE7 A;  2B5G B;  2RC4 A;  4QC6 A;  5KTD A;  1QSO A;  5HMN A;  1QSM A;  3SXO A;  3EC4 A;  3JVN A;  3GY9 A;  1KUV A;  3QB8 A;  4RI1 A;  2Z3K A;  4R3K A;  4X5K A;  4E2A A;  3VWE A;  1S3Z A;  2OZU A;  4MFP A;  2D4P A;  4HKF A;  3CXP A;  2ARH A;  4I49 A;  4U9Z A;  5G1Z A;  3T9Y A;  3IWG A;  2Z3O A;  1R57 A;  1K4J A;  4CGN A;  3BJ8 A;  2X7B A;  4UFV A;  5DWN A;  2Z3M A;  2OU2 A;  1M4I A;  2B3V A;  4YRH A;  2OZH A;  4MHD A;  3PZJ A;  1MJA A;  2KCW A;  4CYQ A;  1Z4R A;  4CRY B;  3EY5 A;  4CYO A;  1M4G A;  1S5K A;  4C7I A;  1TIQ A;  4CGO A;  3DNS A;  3TOB A;  4JWP A;  3R96 A;  4C7H A;  3VWD A;  3DR8 A;  2Q7B A;  3S6F A;  1CJW A;  1PUA A;  4QBJ A;  2Q0Y A;  2QEC A;  2B58 A;  4C68 A;  1J4J A;  2Z3N A;  1OZP A;  4JXQ A;  2DPT A;  1B87 A;  4KOR A;  3ZZI A;  2B4D A;  4AG9 A;  4KOY A;  3IGR A;  4RS2 A;  2VXK A;  1M1D A;  4QB9 A;  4L89 A;  3JUW A;  3F0A A;  4A33 A;  4MFQ A;  2ZXV A;  3OWC A;  4M85 A;  4H6U A;  4J3G A;  3P2F A;  4XPL A;  4KVO E;  2I00 A;  3QAH A;  5J8C A;  5EBV A;  4Q36 A;  4B14 A;  3R1K A;  2FIA A;  3V8I A;  2CY2 A;  1Z4E A;  2FCK A;  1MJB A;  3R95 A;  4QVT A;  2VZY A;  2YND A;  2P6F A;  2G3T A;  5GCN A;  2Z3L A;  3CXQ A;  4H89 A;  4UWI A;  2R7H A;  2OZG A;  2FL4 A;  3FNC A;  4R3L A;  1MK4 A;  1KZF A;  4XPD B;  2Q4Y A;  2I79 A;  2OB0 A;  5A28 A;  4ZGY B;  3F5B A;  1B6B A;  2A4N A;  3D3S A;  5DWM A;  4OLL A;  1I1D A;  4ZBG A;  1RXT A;  3FB3 A;  4B5P A;  4KOU A;  4KSF A;  2AE6 A;  4A30 A;  4KLW A;  2R1I A;  4F0Y A;  2DXQ A;  2VQY A;  2ZW5 A;  5AG4 A;  2CXA A;  1Z9U A;  4MI4 A;  4MBU A;  4L8A A;  4XNH B;  3EO4 A;  4CGL A;  3FBU A;  4AG7 A;  1CM0 A;  4FD6 A;  3IWE A;  2OH1 A;  1S7K A;  1YRE A;  1Y7R A;  3W6X A;  3ZJ0 A;  5F49 A;  1Q2D A;  2REF A;  3WR7 A;  3TFY A;  3JTK A;  1XEB A;  4OAD A;  4B10 A;  5C88 A;  4KOX A;  1YVO A;  2BSW A;  2BEI A;  2O28 A;  4C2Y A;  4NEX A;  2PSW A;  2GE3 A;  5KTA A;  1KUX A;  2REE A;  2BL1 A;  2PQ8 A;  4CAF A;  4KOW A;  4Y49 C;  2CNM A;  3MGD A;  3TTH A;  1ON0 A;  5JQ4 A;  1IID A;  4FD5 A;  2VZZ A;  4PV6 A;  4XPK A;  3H5Z A;  3I3G A;  4JLY A;  1XF8 A;  4IUS A;  5G20 A;  3TO6 A;  4LX9 A;  4NCZ A;  2PR1 A;  2WSA A;  1NE9 A;  2B5G A;  2VI7 A;  4M3S A;  2FSR A;  4CAX A;  2QML A;  4B11 A;  4YFJ A;  2GIV A;  1XE4 A;  3D2M A;  3SHP A;  1S7N A;  4MFK A;  4GS4 A;  1I12 A;  2B4B A;  4PK2 A;  1M44 A;  1I21 A;  4U9Y A;  4DNC A;  2P0W A;  2C27 A;  4FD4 A;  2YNE A;  2WPX A;  3B8G A;  1YX0 A;  3TE4 A;  1YLE A;  3FRM A;  3G3S A;  3LD2 A;  4KLV A;  4XPD C;  5C82 A;  3E0K A;  4A32 A;  2PR8 A;  3FXT A;  4UFW A;  1WWZ A;  2AJ6 A;  2GAN A;  3GKR A;  3H4Q A;  2YGW A;  4KUB A;  4AB7 A;  4UWJ A;  4KVM E;  2H5M A;  3N7Z A;  5EC4 A;  2ZW6 A;  4KSA A;  3A9L A;  1N71 A;  2Z10 A;  4FD7 A;  1ZO0 A;  1S60 A;  2PRB A;  5H86 A;  4UCP A;  2R98 A;  4XNH C;  5E96 A;  4HNY B;  3IU1 A;  4JJX A;  4CRZ B;  4E8O A;  4B13 A;  4BBH A;  2FE7 A;  2VBQ A;  1WK4 A;  5IB0 A;  5HH1 A;  1Q2Y A;  1P4N A;  4U5Y A;  5ISV A;  2Z11 A;  3TO7 A;  4E0A A;  2HQY A;  2FT0 A;  1RO5 A;  2Y0M A;  4NSQ A;  5A27 A;  5I0C A;  2CNT A;  3TO9 A;  1YR0 A;  1YK3 A;  4B12 A;  4PSX A;  1S7F A;  2YNC C;  2Z3P A;  2Q44 A;  2HV2 A;  4II9 A;  4KUA A;  5F46 A;  2IL4 A;  4AVA A;  4KOT A;  2JDC A;  2F5I A;  2WPW A;  4AVC A;  1NMT A;  5F48 A;  1YVK A;  4K30 A;  4KOV A;  1BOB A;  5AG5 A;  2EVN A;  4JXR A;  2HUZ A;  3GYA A;  4JD6 A;  2WUU A;  1Y9W A;  1FY7 A;  3T90 A;  4CAV A;  4MJ8 A;  1UFH A;  2JLM A;  1IB1 E;  3BJ7 A;  3D2P A;  2FS5 A;  4IF5 A;  2P6E A;  1IIC A;  4LUA A;  3DR6 A;  2B4D B;  4MFZ A;  2DPS A;  1L0C A;  5CNP A;  3P2H A;  2BUE A;  3KKW A;  4NF1 A;  2G3A A;  2J8R A;  2ZW4 A;  4A31 A;  3I9S A;  1GHE A;  4MFL A;  4PSW A;  3LOD A;  5AG7 A;  4AVB A;  4CGP A;  5AG6 A;  2ZPA A;  1LRZ A;  1M4D A;  2B3U A;  4C2X A;  2R8V A;  2ATR A;  4PK3 A;  4UCM A;  4A2Z A;  4CYN A;  1P0H A;  2NMT A;  1QST A;  3RYO A;  4KZT A;  2VEZ A;  3DSB A;  3TCV A;  2Q4V A;  4CAW A;  4EVY A;  1IYK A;  4Q38 A;  4B5O A;  1YGH A;  1NSL A;  3S6G A;  4KOS A;  2J8N A;  5KTC A;  4R57 A;  4NXY A;  2CNS A;  4CAE A;  2P6G A;  1Q2C A;  2PDO A;  3EXN A;  4MY3 A;  4HNW B;  2JDD A;  4R87 A;  1S7L A;  4R9M A;  3S6H A;  4OAE A;  2J8M A;  1V0C A;  1PU9 A;  2FXF A;  4B5P B;  3TT2 A;  4CYP A;  4A95 A;  4UA3 A;  5JPH A;  2Q04 A;  5G21 A;  1Y9K A;  5F47 A;  3S6K A;  4MFJ A;  1VKC A;  5IV0 A;  1XMT A;  3W91 A;  5J8F A;  4MY0 A;  2YNC A;  3C26 A;  3SXN A;  1KUY A;  3EFA A;  1QSR A;  3BLN A;  4Y49 B;  4F6A A;  5IX3 A;  2Z0Z A;  4QUS A;  3R9F A;  1BO4 A;  3UY5 A;  4BMH A;  2D4O A;  3DDD A;  4UBR A;  5FVJ A;  4F0X A;  4KVX A;  1U6M A;  3CXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...