1I12A

Crystal structure of saccharomyces cerevisiae gna1 complexed with accoa
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
154
Chain Sequence
LPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFCKLIKYWNEATVWNDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSNAGVEMQIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
publication title The crystal structures of Apo and complexed Saccharomyces cerevisiae GNA1 shed light on the catalytic mechanism of an amino-sugar N-acetyltransferase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 43
structure length 154
sequence length 157
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2001-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1i12A00
2F5IA 4KVXA 1YGHA 4I49A 5F46A 1QSMA 1I21A 2PQ8A 2B4BA 2FS5A 3PGPA 2G3AA 2B5GB 1S5KA 5JPHA 2VZYA 3KKWA 2A4NA 4R3LA 4NF1A 2X7BA 1S7NA 2REFA 1QSNA 4E0AA 1GHEA 2GIVA 4RS2A 3F8KA 1IYKA 2WPXA 4KOVA 3E0KA 5HH1A 2K5TA 1SQHA 4ONUA 2BEIA 2FCKA 2O28A 2FXFA 4U9ZA 4R57A 1YX0A 3QB8A 1I1DA 2ZW7A 4UBRA 5IB0A 1S3ZA 1S7FA 2OZHA 2P6GA 4YGOA 1M4GA 4NEXA 3UY5A 4HNWB 4XNHC 1YK3A 1WWZA 3DNSA 5C88A 4BMHA 3TCVA 4AB7A 4XPDB 5IV0A 2PRBA 3FB3A 3P2FA 5E96A 3S6HA 1I12A 2GANA 4LX9A 5KTCA 2VZZA 5I0CA 4L89A 1MJ9A 2Q04A 1M1DA 2RC4A 5F49A 3MGDA 3TO7A 2QIRA 1PU9A 2PSWA 4PK2A 4H6UA 4XPLA 4QBJA 1NMTA 2Q4YA 1YREA 3DR6A 3R95A 1NSLA 4E8OA 5ISVA 5J8FA 3GKRA 2KCWA 1RXTA 3EO4A 3GYAA 5DWMA 4B5OA 3FXTA 1QSTA 3C26A 2REEA 5FVJA 5C82A 1YVOA 1ON0A 3R1KA 1PUAA 3TO9A 2JDDA 2BSWA 4R87A 2VEZA 3NE7A 2P6EA 2IL4A 1B6BA 3R96A 3QAHA 1Z9UA 3PZJA 1Y7RA 2BL1A 4LUAA 4KUAA 2CNSA 4PSWA 4PSXA 1L0CA 2ZW5A 1MK4A 2C27A 4QVTA 4NSQA 1KZFA 4QB9A 1Y9WA 3BJ8A 4JD6A 4KOUA 4MHDA 2J8MA 2J8RA 2PDOA 2OZUA 4II9A 2OH1A 4PK3A 2G3TA 3N7ZA 2FIWA 4AVAA 4OAEA 3K9UA 2FIAA 1Y9KA 2NMTA 1CM0A 2VBQA 2I79A 3CXPA 5HMNA 3LODA 2FSRA 2VI7A 2BUEA 4OADA 5DWNA 4KOTA 3H4QA 1KUXA 2P0WA 2HUZA 4DNCA 4XPKA 1P0HA 3W6SA 4UWIA 3TT2A 3ZZIA 4KOYA 4KVME 4FD4A 3EY5A 4KOSA 2J8NA 4JLYA 1IB1E 2H5MA 2JLMA 2FT0A 3D3SA 3DSBA 2P6FA 3D2PA 4CAXA 3JVNA 3R9FA 4Y49C 2G0BA 3IGRA 4ZBGA 4M85A 2QMLA 4KOWA 5IX3A 3JUWA 4FD6A 1Z4RA 5H84A 2WPWA 3F5BA 4B5PA 4KLVA 4CRZB 3ZJ0A 1R57A 3TO6A 2AE6A 1Q2CA 4GS4A 3W91A 2GE3A 3D8PA 2R8VA 4IUSA 5CNPA 1N71A 1S60A 2PC1A 1IICA 1YR0A 2CY2A 2DXQA 3P2HA 1S7LA 4NXYA 2HQYA 1XF8A 1VHSA 5EC4A 3EFAA 1BOBA 5GCNA 1K4JA 1XIXA 2PR1A 2R98A 3TOAA 3BLNA 1CJWA 1P4NA 4MY0A 5H86A 4ORFA 1V0CA 4KZTA 1FY7A 3CXSA 4CS0B 4OLLA 2VQYA 3B8GA 3FNCA 4XNHB 4U5YA 3OWCA 1B87A 4PV6A 3SXNA 3SHPA 1XE4A 1MJAA 1WK4A 2ZXVA 5KTDA 1QSOA 4AVCA 2EUIA 2QECA 2HV2A 2FE7A 3FYNA 5KTAA 2B3UA 3RYOA 3DR8A 3FBUA 1M4IA 1YLEA 1LRZA 1S7KA 3TE4A 3IWGA 4JXQA 3S6FA 4CRYB 2Z10A 4XPDC 3GY9A 2R7HA 2D4OA 3S6KA 2Q0YA 2ZPAA 4R9MA 2PR8A 2Z11A 2CNMA 2CNTA 3LD2A 3T9YA 4MY3A 4B5PB 2OB0A 4HNYB 4QUSA 3VWDA 4H6ZA 4U9YA 4EVYA 3BJ7A 5J8CA 2B4DA 3FRMA 3EXNA 3I9SA 4K30A 4HKFA 5F47A 3D2MA 3R9EA 1Q2YA 2B58A 3EC4A 4KUBA 2ARHA 2VXKA 1IIDA 2B5GA 1XMTA 4FD7A 2ZW6A 4F6AA 3WR7A 3G3SA 3PP9A 5EBVA 1MJBA 3G8WA 4HNXB 2Q4VA 4H89A 1Z4EA 3SXOA 1U6MA 3VWEA 1M44A 1TIQA 3S6GA 3W6XA 3T90A 2JDCA 2Q44A 3TTHA 1Q2DA 4L8AA 1BO4A 4UA3A 5F48A 4YFJA 2D4PA 3TFYA 4YRHA 1KUYA 4MJ8A 4F0YA 4CAVA 4RI1A 1QSRA 4NCZA 4MBUA 4R3KA 4JWPA 4UWJA 3V8IA 2B3VA 4KLWA 2Q7BA 2OU2A 2R1IA 4JJXA 1KUVA 1VKCA 4J3GA 4E2AA 1IYLA 3DDDA 3R9GA 1XEBA 4Y49B 2FL4A 4AG7A 3I3GA 4X5KA 2OZGA 3TOBA 1YVKA 2ATRA 4FD5A 4M3SA 4AG9A 4MI4A 2AJ6A 2JEVA 1UFHA 2ZW4A 2EVNA 4JXRA 4KOXA 1J4JA 4AVBA 2I00A 1RO5A 1OZPA 2Y0MA 2Z0ZA 4QC6A 4IF5A 3FIXA 4KORA 1NE9A 3CXQA 4KVOE 3F0AA 1M4DA 4CAWA 2B4DB 5JQ4A
chains in the Genus database with same CATH superfamily
6CPAA 3QAYA 1BPNA 1HEEA 2F5IA 4KVXA 1YGHA 4I49A 1X10A 5F46A 3B3SA 2BO9A 1QSMA 1XJOA 3S9NA 1TF8A 1I21A 2Z3OA 2PQ8A 2B4BA 2CF4A 2OOTA 4OC3A 2FS5A 1AYEA 5DS0A 3PGPA 2G3AA 3IFEA 5AG6A 2B5GB 3D68A 1S5KA 5JPHA 2VZYA 3KKWA 2A4NA 4AXVA 1DTDA 1FNOA 2YNEA 2V8GA 1S7NA 2X7BA 4MHPA 2REFA 4NF1A 1RTQA 4R3LA 5AGEA 1LFWA 2ZEPA 1QSNA 4PQAA 4E0AA 1GHEA 2GIVA 4RS2A 4CAEA 4NGQA 1CX8A 1YW4A 2IQ6A 3F8KA 1IYKA 2WPXA 4A39A 3FECA 2V8VA 4KOVA 2PIYA 3E0KA 1CP7A 5HH1A 1Y0RA 3BI1A 2K5TA 1SQHA 4ONUA 4GXHA 2BEIA 3LMSA 2FCKA 2O28A 4LQGA 2Q51A 2O53A 1LANA 5HXDA 2FXFA 4U9ZA 4YWYA 1BAVA 4BD9A 4R57A 1EE3P 4PXBA 1YX0A 1AMPA 3T8WA 3QB8A 4PXCA 1I1DA 3JRUA 2ZW7A 5K8MA 4UBRA 4R8FA 3B3TA 2YNCC 3BI0A 5IB0A 1S3ZA 4PPZA 4B12A 4MFLA 3NE8A 4DUKA 1S7FA 2XEGA 2OZHA 4Q38A 1NSAA 1VGYA 1X12A 2HB6A 2P6GA 2ZEOA 3B3VA 4NGPA 4UF4A 4X3RA 3CZXA 2PJBA 3HLPA 1CPSA 2Z3KA 5JM6A 2WYRA 1M4GA 1LOKA 4NEXA 3UY5A 4HNWB 4XNHC 1YK3A 1WWZA 3DNSA 4RN7A 1YW6A 4BMHA 5C88A 3D67A 3TCVA 2PJ1A 4AB7A 4XPDB 1XRYA 2NSMA 4CGPA 4MFKA 3WABA 2JBKA 5IV0A 2PRBA 5THWA 4CYNA 4TWEA 3FB3A 3TC8A 3P2FA 5E96A 1Z8XA 2ZEHA 3S6HA 1Q7LA 1I12A 3WC6A 3PBEA 2GANA 4LX9A 5KTCA 2VZZA 5I0CA 4L89A 1MJ9A 3FF3A 4CYQA 2V8DA 2Q04A 1M1DA 2RC4A 3PB9X 5F49A 3MGDA 4A95A 3TO7A 1F57A 2QIRA 2Q43A 3KGQA 1PU9A 3PFEA 4UEEA 2PSWA 4PK2A 4H6UA 4UIAA 4XPLA 4B13A 4QBJA 1NMTA 2PVVA 1ELMP 3B7IA 4NJRA 5HVHA 3PB8X 2Q4YA 1YREA 3DR6A 3R95A 1NSLA 4E8OA 5ISVA 4KSIA 3GKRA 5J8FA 4ZGYB 3WT4A 4OC4A 2KCWA 1RXTA 3EO4A 3GYAA 2AFXA 5DWMA 4B5OA 3FXTA 4P44A 2C6PA 1QSTA 3C26A 2GLFA 2REEA 3I1UA 1YVOA 5FVJA 3WC5A 3NH5A 5C82A 3H8FA 1TKJA 3KHZA 1XBUA 3IU2A 3PEIA 4IAVA 4OP4A 4EWTA 3SJGA 4P45A 1ON0A 2YNDA 3R1KA 5G20A 2PIZA 1JQGA 1PUAA 4F8ZA 2WUUA 2EO8A 2JDDA 3TO9A 5JGFA 2BSWA 1LAMA 4FWUA 4R87A 4C7HA 3FVLA 2EBJA 2QYVA 2VEZA 2ZELA 4MFPA 2Q7SA 3NE7A 4C7IA 1IOFA 4P10A 2P6EA 5LYIA 1JWQA 2IL4A 2DF5A 1B6BA 4MFJA 3R96A 1GYTA 3QAHA 1Z9UA 3K9TA 3PZJA 3IO1A 1Y7RA 3D7GA 4GM5A 3RAMA 4CGNA 3B35A 2BL1A 4YGOA 4LUAA 4KUAA 2CNSA 3PFOA 3IIBA 4PSWA 1Z2LA 2JEWA 4PSXA 2WSAA 4WWVA 1L0CA 5HVFA 2ZW5A 2AFWA 4R6TA 1TXRA 2QVPA 1MK4A 2C27A 4QVTA 4NSQA 4MRIA 4A2ZA 1KZFA 8CPAA 4UEZA 4QB9A 1Y9WA 3KASA 4OMEA 3BJ8A 5G1ZA 4JD6A 4KOUA 4MHDA 2J8MA 2J8RA 2PDOA 2XEIA 4MHZA 2OZUA 2YNCA 2F8HA 4II9A 3JTKA 3KL9A 3A9LA 4KS9A 2OH1A 4ZYQA 3V38A 2DPTA 4PK3A 2V77A 2G3TA 2PJ3A 5BWAB 3NH4A 2PCUA 4WJBA 3N7ZA 2FIWA 3IWEA 2PRQA 4AVAA 4OAEA 4PXDA 3K9UA 4NGMA 2ABZA 1Y9KA 2FIAA 1CM0A 2NMTA 2ODFA 2VBQA 3CPAA 4OC1A 2Q4ZA 2I79A 3CXPA 3FEEA 1F2PA 3PRTA 5HMNA 3LODA 4FBEA 2FSRA 3H5ZA 2VI7A 4IHMA 4UFVA 2Z3NA 2BUEA 4JYWA 4OADA 5DWNA 1ZG9A 4KOTA 5LYFA 3H4QA 3V7ZA 1KUXA 2P0WA 2HUZA 2OR4A 4DNCA 3KI9A 4XPKA 1P0HA 2PJ6A 3H8EA 2F7VA 3CT9A 5AG7A 2PJ2A 3W6SA 3PB6X 4UWIA 1ZLIA 2J9AA 3TT2A 3ZZIA 4KOYA 4Q36A 4KVME 4F0XA 4FD4A 1R43A 3EY5A 4K3NA 1ZG7A 2J8NA 4KOSA 4JLYA 1IB1E 2H5MA 2PE3A 3L2NA 2JLMA 2FT0A 4ZY2A 5A28A 3D3SA 4UFXA 1HDQA 4C2ZA 2ZEGA 3N5FA 2PJ4A 3DSBA 2P6FA 1TKHA 1FT7A 1AUGA 3H8GA 3D2PA 1R3NA 4RUHA 4P4DA 4CAXA 3JVNA 2ZEDA 3R9FA 2QJ8A 3SI1A 3TX8A 4Y49C 4CGOA 5LRJA 2G0BA 3IGRA 5CPAA 3KR5A 4M85A 1XMBA 3NH8A 2QMLA 3IJ3A 4KOWA 4JZ0A 4ZBGA 4ZY1A 4W9YA 3ISXA 4ZX8A 5IX3A 5K8PA 3JUWA 4FD6A 3S9MA 1Z4RA 4UCNA 5H84A 4A31A 3B3CA 2WPWA 4OIWA 3RO0A 3F5BA 1F2OA 2O4HA 4B5PA 4KLVA 4BINA 1PYTB 4CRZB 3S9LA 3MN8A 4P4JA 4CGMA 4X8IA 3ZJ0A 4A94A 1R57A 4OKOA 3TO6A 3VARA 3D4UA 4EMEA 5LYLA 2AE6A 1Q2CA 4HPSA 2V8HA 3KR4A 4GS4A 1YLOA 1CG2A 3W91A 2GE3A 2NYQA 3D8PA 3HUVA 2R8VA 4IUSA 5CNPA 1N71A 1S60A 3PBBA 4UEFA 2PC1A 1IICA 1Z8LA 1YR0A 4P4BA 2CY2A 2DXQA 2GFQA 3D7DA 1PCAA 1S7LA 1HDUA 3P2HA 4NXYA 3SI2A 4Q7AA 5IB9A 4CGLA 1TF9A 2HQYA 1XF8A 4OC0A 1VHSA 5EC4A 2HC9A 1CP6A 5LRKA 3EFAA 2ZOFA 1ARLA 1BOBA 3FEDA 4A38A 5AG5A 2PJ9A 5GCNA 1XOVA 2AFZA 4NGSA 1K4JA 3CPXA 3LACA 1XIXA 3SI0A 2PR1A 2R98A 3TOAA 3BLNA 4CPAA 2XEFA 3NFZA 1CJWA 4KSAA 1P4NA 4MY0A 4MCSA 2DPSA 5H86A 1IY7A 1DE4C 3RBUA 5JH9A 4ORFA 1V0CA 4KZTA 3BHXA 1FY7A 3CXSA 4F9UA 4CS0B 4OLLA 3D7FA 1BLLE 2GU2A 2VQYA 1IOIA 3B8GA 3FNCA 1QQ9A 4XNHB 2ZEFA 4MHYA 2ANPA 4U5YA 3OWCA 1B87A 4MCPA 4IK2A 4PV6A 3SXNA 3SHPA 1XE4A 1MJAA 2XEJA 4MFQA 4UCMA 1YQEA 4MHNA 1WK4A 3KHXA 4R76A 1IU8A 4B14A 5CBMA 1ZLHA 5A27A 3IEHA 2POKA 3FX6A 4F9VA 5K8NA 2ZXVA 4PXEA 1Z8WA 4CYPA 1QSOA 2IMOA 4AVCA 5KTDA 2EUIA 2QECA 2HV2A 2C6GA 2FE7A 3D7HA 3VATA 3FYNA 5KTAA 3RZAA 2B3UA 2RB7A 3RYOA 4CAFA 3DR8A 3FBUA 1M4IA 1A2ZA 1H8LA 1YLEA 4MXUA 1LRZA 1S7KA 3TE4A 2Z3MA 1OBRA 3IWGA 5AG4A 2GLJA 4JXQA 1UWYA 4OIDA 3S6FA 4YU9A 2CIJA 1Z5RA 4CRYB 1LCPA 2Z10A 4XPDC 2AFSA 3KQZA 3GY9A 2R7HA 3SJFA 2D4OA 1ZO0A 3S6KA 4A37A 2PJCA 2AFUA 2Q0YA 3D66A 4P4FA 5K8OA 4OC2A 3ISZA 5J1QA 2ZPAA 2PJ7A 2PR8A 4R9MA 4C2XA 2Z11A 2PJ8A 4MCQA 2G9DA 2CNMA 3PB4X 2CNTA 3LWUA 3GLJA 4X2TA 3LD2A 3T9YA 4M6IA 3IWWA 4MY3A 4B5PB 2OB0A 4HNYB 2RFHA 1LAPA 4QUSA 3VWDA 4H6ZA 2CTBA 4MFZA 4U9YA 3KZWA 4EVYA 4NFRA 3BJ7A 4DYOA 5J8CA 4P4IA 2CTCA 2B4DA 4C2YA 3EXNA 3FRMA 3I9SA 4K30A 4HKFA 4ZI6A 5F47A 3D2MA 3RNZA 2AFOA 3R9EA 1Q2YA 2B58A 3EC4A 3VH9A 3GUXA 4KUBA 4FUUA 2ARHA 2VXKA 1IIDA 4ZY0A 2ZENA 3DLJA 2ZOGA 2B5GA 1XMTA 4FD7A 4UFWA 2ZW6A 5LYDA 4F6AA 3B2YA 3FMCA 1IGBA 1QMUA 3IU1A 3WR7A 3G3SA 3PP9A 5EBVA 5HVGA 1MJBA 3G8WA 3GB0A 5G22A 4HNXB 2C6CA 2Q4VA 3IC1A 3FJUA 2EK8A 1VHOA 4H89A 2JBJA 2WZNA 1Z4EA 3SXOA 3QNVA 4R7MA 5ELYA 1U6MA 4Z65A 3VWEA 3DGVA 1M44A 1TIQA 3S6GA 3W6XA 3T90A 2JDCA 2Q44A 3TTHA 1CPXA 2AFMA 1Q2DA 4M6HA 7CPAA 1Z8TA 4L8AA 1BO4A 4UA3A 3NA6A 1YMEA 2BCOA 4BBHA 1Y0YA 1Y7EA 1YSJA 2EK9A 4KSFA 4B10A 4NGRA 5F48A 2BOAA 4YFJA 3SJXA 2D4PA 2GREA 3FH4A 3TFYA 4O23A 4YRHA 4B6ZA 1KUYA 4MJ8A 1XFOA 4A30A 4CAVA 4F0YA 2EWBA 3B3WA 3SJEA 4RI1A 2ZEEA 1QSRA 4NCZA 1ZG8A 2PJ0A 4MBUA 4JWPA 4MMOA 1M4LA 2ZEMA 4R3KA 2VL1A 4H2KA 4UWJA 3V8IA 4EFDA 2B3VA 4KLWA 2Q7BA 2OU2A 2R1IA 4JJXA 3BXMA 4NGNA 4ZX9A 1KUVA 1VKCA 2FVGA 5I4MA 4J3GA 4NJQA 4E2AA 3PB7X 5D29A 1IYLA 4ONWA 3DDDA 3K2KA 3KQXA 4UIBA 3R9GA 1XEBA 2Z3LA 4UCPA 1VIXA 4Y49B 2FL4A 4FAIA 4CYOA 4MCRA 4M6GA 4AG7A 3I3GA 4P4EA 4X5KA 2I3CA 4TNUA 2OZGA 3TOBA 5LRGA 2PVWA 1YVKA 2ATRA 4FD5A 4M3SA 4AG9A 2PJAA 4MI4A 2AJ6A 2JEVA 1UFHA 2ZW4A 4C68A 3MRUA 2EVNA 1KWMA 1TKFA 4JXRA 5F09A 4KOXA 2C1CA 2IJZA 1J4JA 3WC7A 2I00A 4AVBA 4A33A 3GIUA 4LQ6A 1RO5A 4B11A 5G21A 1OZPA 2Y0MA 2Z0ZA 4A32A 4QC6A 1ELLP 1CBXA 4NGTA 1BPMA 2DEAA 4P6YA 2Z3PA 3FIXA 2PJ5A 4IF5A 4OC5A 4KORA 1NE9A 1VHEA 3CXQA 4KVOE 3F0AA 5EMIA 1ARMA 4DJLA 1M4DA 4CAWA 2B4DB 2CXAA 2YGWA 5D8NA 4G1PA 3CDXA 5JQ4A
chains in the Genus database with same CATH topology
2F5IA 4KVXA 1YGHA 4I49A 5F46A 1QSMA 1I21A 2Z3OA 2PQ8A 2B4BA 2FS5A 3PGPA 2G3AA 5AG6A 2B5GB 1S5KA 5JPHA 2VZYA 3KKWA 2A4NA 2YNEA 4NF1A 2X7BA 1S7NA 4R3LA 5AGEA 2REFA 1QSNA 4E0AA 1GHEA 2GIVA 4RS2A 4CAEA 3F8KA 1IYKA 2WPXA 4KOVA 3E0KA 5HH1A 2K5TA 1SQHA 4ONUA 2BEIA 2FCKA 2O28A 2FXFA 4U9ZA 4R57A 1YX0A 3QB8A 1I1DA 2ZW7A 4UBRA 2YNCC 5IB0A 1S3ZA 4B12A 4MFLA 1S7FA 4Q38A 2OZHA 2P6GA 4YGOA 2Z3KA 1M4GA 4NEXA 3UY5A 4HNWB 4XNHC 1YK3A 1WWZA 3DNSA 5C88A 4BMHA 3TCVA 4AB7A 4XPDB 4CGPA 4MFKA 5IV0A 2PRBA 4CYNA 3FB3A 3P2FA 5E96A 3S6HA 1I12A 2GANA 4LX9A 5KTCA 2VZZA 5I0CA 4L89A 1MJ9A 4CYQA 2Q04A 1M1DA 2RC4A 5F49A 3MGDA 4A95A 3TO7A 2QIRA 1PU9A 2PSWA 4PK2A 4H6UA 4XPLA 4B13A 4QBJA 1NMTA 2Q4YA 1YREA 3DR6A 3R95A 1NSLA 4E8OA 5ISVA 5J8FA 3GKRA 4ZGYB 2KCWA 1RXTA 3EO4A 3GYAA 5DWMA 4B5OA 3FXTA 1QSTA 3C26A 2REEA 5FVJA 5C82A 1YVOA 3IU2A 1ON0A 2YNDA 3R1KA 5G20A 1PUAA 2WUUA 2JDDA 3TO9A 2BSWA 4R87A 4C7HA 4MFPA 2VEZA 3NE7A 4C7IA 2P6EA 2IL4A 1B6BA 4MFJA 3R96A 3QAHA 1Z9UA 3PZJA 1Y7RA 4CGNA 2BL1A 4LUAA 4KUAA 2CNSA 4PSWA 4PSXA 2WSAA 1L0CA 2ZW5A 1MK4A 2C27A 4QVTA 4NSQA 4A2ZA 1KZFA 4QB9A 1Y9WA 3BJ8A 5G1ZA 4JD6A 4KOUA 4MHDA 2J8MA 2J8RA 2PDOA 2OZUA 2YNCA 4II9A 3JTKA 3A9LA 4KS9A 2OH1A 2DPTA 4PK3A 2G3TA 5BWAB 3N7ZA 2FIWA 3IWEA 4AVAA 4OAEA 3K9UA 2FIAA 1Y9KA 2NMTA 1CM0A 2VBQA 2I79A 3CXPA 5HMNA 3LODA 2FSRA 3H5ZA 2VI7A 4UFVA 2Z3NA 2BUEA 4OADA 5DWNA 4KOTA 3H4QA 1KUXA 2P0WA 2HUZA 4DNCA 4XPKA 1P0HA 5AG7A 3W6SA 4UWIA 3TT2A 3ZZIA 4KOYA 4Q36A 4KVME 4F0XA 4FD4A 3EY5A 4KOSA 2J8NA 4JLYA 1IB1E 2H5MA 2JLMA 2FT0A 5A28A 3D3SA 4UFXA 4C2ZA 3DSBA 2P6FA 3D2PA 4CAXA 3JVNA 3R9FA 4Y49C 4CGOA 2G0BA 3IGRA 4ZBGA 4M85A 2QMLA 4KOWA 5IX3A 3JUWA 4FD6A 1Z4RA 4UCNA 5H84A 4A31A 2WPWA 3F5BA 4B5PA 4KLVA 4CRZB 4CGMA 3ZJ0A 1R57A 3TO6A 2AE6A 1Q2CA 4GS4A 3W91A 2GE3A 3D8PA 2R8VA 4IUSA 5CNPA 1N71A 1S60A 2PC1A 1IICA 1YR0A 2CY2A 2DXQA 3P2HA 1S7LA 4NXYA 4CGLA 2HQYA 1XF8A 1VHSA 5EC4A 3EFAA 1BOBA 5AG5A 5GCNA 1K4JA 1XIXA 2PR1A 2R98A 3TOAA 3BLNA 4KSAA 1CJWA 1P4NA 4MY0A 2DPSA 5H86A 4ORFA 1V0CA 4KZTA 1FY7A 3CXSA 4CS0B 4OLLA 2VQYA 3B8GA 3FNCA 4XNHB 4U5YA 3OWCA 1B87A 4PV6A 3SXNA 3SHPA 1XE4A 1MJAA 4MFQA 4UCMA 1WK4A 4B14A 5A27A 2ZXVA 4CYPA 1QSOA 5KTDA 4AVCA 2EUIA 2QECA 2HV2A 2FE7A 3FYNA 5KTAA 2B3UA 3RYOA 4CAFA 3DR8A 3FBUA 1M4IA 1YLEA 1LRZA 1S7KA 3TE4A 2Z3MA 3IWGA 5AG4A 4JXQA 3S6FA 4CRYB 2Z10A 4XPDC 3GY9A 2R7HA 2D4OA 1ZO0A 3S6KA 2Q0YA 2ZPAA 4R9MA 2PR8A 4C2XA 2Z11A 2CNMA 2CNTA 3LD2A 3T9YA 4MY3A 4B5PB 2OB0A 4HNYB 4QUSA 3VWDA 4H6ZA 4MFZA 4U9YA 4EVYA 3BJ7A 5J8CA 2B4DA 4C2YA 3FRMA 3EXNA 3I9SA 4K30A 4HKFA 5F47A 3D2MA 3R9EA 1Q2YA 2B58A 3EC4A 4KUBA 2ARHA 2VXKA 1IIDA 2B5GA 1XMTA 4FD7A 4UFWA 2ZW6A 4F6AA 3IU1A 3WR7A 3G3SA 3PP9A 5EBVA 1MJBA 3G8WA 5G22A 4HNXB 2Q4VA 4H89A 1Z4EA 3SXOA 1U6MA 3VWEA 1M44A 1TIQA 3S6GA 3W6XA 3T90A 2JDCA 2Q44A 3TTHA 1Q2DA 4L8AA 1BO4A 4UA3A 4BBHA 4B10A 4KSFA 5F48A 4YFJA 2D4PA 3TFYA 4YRHA 1KUYA 4MJ8A 4F0YA 4A30A 4CAVA 4RI1A 1QSRA 4NCZA 4MBUA 4R3KA 4JWPA 4UWJA 3V8IA 2B3VA 4KLWA 2Q7BA 2OU2A 2R1IA 4JJXA 1KUVA 1VKCA 4J3GA 4E2AA 1IYLA 3DDDA 3R9GA 1XEBA 2Z3LA 4UCPA 4Y49B 2FL4A 4CYOA 4AG7A 3I3GA 4X5KA 2OZGA 3TOBA 1YVKA 2ATRA 4FD5A 4M3SA 4AG9A 4MI4A 2AJ6A 2JEVA 1UFHA 2ZW4A 4C68A 2EVNA 4JXRA 4KOXA 1J4JA 4AVBA 2I00A 4A33A 1RO5A 4B11A 5G21A 1OZPA 2Y0MA 2Z0ZA 4A32A 4QC6A 4IF5A 2Z3PA 3FIXA 4KORA 1NE9A 3CXQA 4KVOE 3F0AA 1M4DA 4CAWA 2B4DB 2CXAA 2YGWA 5JQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5I A;  4KVX A;  1YGH A;  4I49 A;  5F46 A;  1QSM A;  1I21 A;  2PQ8 A;  2B4B A;  2FS5 A;  3PGP A;  2G3A A;  2B5G B;  1S5K A;  5JPH A;  2VZY A;  3KKW A;  2A4N A;  4R3L A;  4NF1 A;  2X7B A;  1S7N A;  2REF A;  1QSN A;  4E0A A;  1GHE A;  2GIV A;  4RS2 A;  3F8K A;  1IYK A;  2WPX A;  4KOV A;  3E0K A;  5HH1 A;  2K5T A;  1SQH A;  4ONU A;  2BEI A;  2FCK A;  2O28 A;  2FXF A;  4U9Z A;  4R57 A;  1YX0 A;  3QB8 A;  1I1D A;  2ZW7 A;  4UBR A;  5IB0 A;  1S3Z A;  1S7F A;  2OZH A;  2P6G A;  4YGO A;  1M4G A;  4NEX A;  3UY5 A;  4HNW B;  4XNH C;  1YK3 A;  1WWZ A;  3DNS A;  5C88 A;  4BMH A;  3TCV A;  4AB7 A;  4XPD B;  5IV0 A;  2PRB A;  3FB3 A;  3P2F A;  5E96 A;  3S6H A;  1I12 A;  2GAN A;  4LX9 A;  5KTC A;  2VZZ A;  5I0C A;  4L89 A;  1MJ9 A;  2Q04 A;  1M1D A;  2RC4 A;  5F49 A;  3MGD A;  3TO7 A;  2QIR A;  1PU9 A;  2PSW A;  4PK2 A;  4H6U A;  4XPL A;  4QBJ A;  1NMT A;  2Q4Y A;  1YRE A;  3DR6 A;  3R95 A;  1NSL A;  4E8O A;  5ISV A;  5J8F A;  3GKR A;  2KCW A;  1RXT A;  3EO4 A;  3GYA A;  5DWM A;  4B5O A;  3FXT A;  1QST A;  3C26 A;  2REE A;  5FVJ A;  5C82 A;  1YVO A;  1ON0 A;  3R1K A;  1PUA A;  3TO9 A;  2JDD A;  2BSW A;  4R87 A;  2VEZ A;  3NE7 A;  2P6E A;  2IL4 A;  1B6B A;  3R96 A;  3QAH A;  1Z9U A;  3PZJ A;  1Y7R A;  2BL1 A;  4LUA A;  4KUA A;  2CNS A;  4PSW A;  4PSX A;  1L0C A;  2ZW5 A;  1MK4 A;  2C27 A;  4QVT A;  4NSQ A;  1KZF A;  4QB9 A;  1Y9W A;  3BJ8 A;  4JD6 A;  4KOU A;  4MHD A;  2J8M A;  2J8R A;  2PDO A;  2OZU A;  4II9 A;  2OH1 A;  4PK3 A;  2G3T A;  3N7Z A;  2FIW A;  4AVA A;  4OAE A;  3K9U A;  2FIA A;  1Y9K A;  2NMT A;  1CM0 A;  2VBQ A;  2I79 A;  3CXP A;  5HMN A;  3LOD A;  2FSR A;  2VI7 A;  2BUE A;  4OAD A;  5DWN A;  4KOT A;  3H4Q A;  1KUX A;  2P0W A;  2HUZ A;  4DNC A;  4XPK A;  1P0H A;  3W6S A;  4UWI A;  3TT2 A;  3ZZI A;  4KOY A;  4KVM E;  4FD4 A;  3EY5 A;  4KOS A;  2J8N A;  4JLY A;  1IB1 E;  2H5M A;  2JLM A;  2FT0 A;  3D3S A;  3DSB A;  2P6F A;  3D2P A;  4CAX A;  3JVN A;  3R9F A;  4Y49 C;  2G0B A;  3IGR A;  4ZBG A;  4M85 A;  2QML A;  4KOW A;  5IX3 A;  3JUW A;  4FD6 A;  1Z4R A;  5H84 A;  2WPW A;  3F5B A;  4B5P A;  4KLV A;  4CRZ B;  3ZJ0 A;  1R57 A;  3TO6 A;  2AE6 A;  1Q2C A;  4GS4 A;  3W91 A;  2GE3 A;  3D8P A;  2R8V A;  4IUS A;  5CNP A;  1N71 A;  1S60 A;  2PC1 A;  1IIC A;  1YR0 A;  2CY2 A;  2DXQ A;  3P2H A;  1S7L A;  4NXY A;  2HQY A;  1XF8 A;  1VHS A;  5EC4 A;  3EFA A;  1BOB A;  5GCN A;  1K4J A;  1XIX A;  2PR1 A;  2R98 A;  3TOA A;  3BLN A;  1CJW A;  1P4N A;  4MY0 A;  5H86 A;  4ORF A;  1V0C A;  4KZT A;  1FY7 A;  3CXS A;  4CS0 B;  4OLL A;  2VQY A;  3B8G A;  3FNC A;  4XNH B;  4U5Y A;  3OWC A;  1B87 A;  4PV6 A;  3SXN A;  3SHP A;  1XE4 A;  1MJA A;  1WK4 A;  2ZXV A;  5KTD A;  1QSO A;  4AVC A;  2EUI A;  2QEC A;  2HV2 A;  2FE7 A;  3FYN A;  5KTA A;  2B3U A;  3RYO A;  3DR8 A;  3FBU A;  1M4I A;  1YLE A;  1LRZ A;  1S7K A;  3TE4 A;  3IWG A;  4JXQ A;  3S6F A;  4CRY B;  2Z10 A;  4XPD C;  3GY9 A;  2R7H A;  2D4O A;  3S6K A;  2Q0Y A;  2ZPA A;  4R9M A;  2PR8 A;  2Z11 A;  2CNM A;  2CNT A;  3LD2 A;  3T9Y A;  4MY3 A;  4B5P B;  2OB0 A;  4HNY B;  4QUS A;  3VWD A;  4H6Z A;  4U9Y A;  4EVY A;  3BJ7 A;  5J8C A;  2B4D A;  3FRM A;  3EXN A;  3I9S A;  4K30 A;  4HKF A;  5F47 A;  3D2M A;  3R9E A;  1Q2Y A;  2B58 A;  3EC4 A;  4KUB A;  2ARH A;  2VXK A;  1IID A;  2B5G A;  1XMT A;  4FD7 A;  2ZW6 A;  4F6A A;  3WR7 A;  3G3S A;  3PP9 A;  5EBV A;  1MJB A;  3G8W A;  4HNX B;  2Q4V A;  4H89 A;  1Z4E A;  3SXO A;  1U6M A;  3VWE A;  1M44 A;  1TIQ A;  3S6G A;  3W6X A;  3T90 A;  2JDC A;  2Q44 A;  3TTH A;  1Q2D A;  4L8A A;  1BO4 A;  4UA3 A;  5F48 A;  4YFJ A;  2D4P A;  3TFY A;  4YRH A;  1KUY A;  4MJ8 A;  4F0Y A;  4CAV A;  4RI1 A;  1QSR A;  4NCZ A;  4MBU A;  4R3K A;  4JWP A;  4UWJ A;  3V8I A;  2B3V A;  4KLW A;  2Q7B A;  2OU2 A;  2R1I A;  4JJX A;  1KUV A;  1VKC A;  4J3G A;  4E2A A;  1IYL A;  3DDD A;  3R9G A;  1XEB A;  4Y49 B;  2FL4 A;  4AG7 A;  3I3G A;  4X5K A;  2OZG A;  3TOB A;  1YVK A;  2ATR A;  4FD5 A;  4M3S A;  4AG9 A;  4MI4 A;  2AJ6 A;  2JEV A;  1UFH A;  2ZW4 A;  2EVN A;  4JXR A;  4KOX A;  1J4J A;  4AVB A;  2I00 A;  1RO5 A;  1OZP A;  2Y0M A;  2Z0Z A;  4QC6 A;  4IF5 A;  3FIX A;  4KOR A;  1NE9 A;  3CXQ A;  4KVO E;  3F0A A;  1M4D A;  4CAW A;  2B4D B;  5JQ4 A; 
#chains in the Genus database with same CATH topology
 6CPA A;  3QAY A;  1BPN A;  1HEE A;  2F5I A;  4KVX A;  1YGH A;  4I49 A;  1X10 A;  5F46 A;  3B3S A;  2BO9 A;  1QSM A;  1XJO A;  3S9N A;  1TF8 A;  1I21 A;  2Z3O A;  2PQ8 A;  2B4B A;  2CF4 A;  2OOT A;  4OC3 A;  2FS5 A;  1AYE A;  5DS0 A;  3PGP A;  2G3A A;  3IFE A;  5AG6 A;  2B5G B;  3D68 A;  1S5K A;  5JPH A;  2VZY A;  3KKW A;  2A4N A;  4AXV A;  1DTD A;  1FNO A;  2YNE A;  2V8G A;  1S7N A;  2X7B A;  4MHP A;  2REF A;  4NF1 A;  1RTQ A;  4R3L A;  5AGE A;  1LFW A;  2ZEP A;  1QSN A;  4PQA A;  4E0A A;  1GHE A;  2GIV A;  4RS2 A;  4CAE A;  4NGQ A;  1CX8 A;  1YW4 A;  2IQ6 A;  3F8K A;  1IYK A;  2WPX A;  4A39 A;  3FEC A;  2V8V A;  4KOV A;  2PIY A;  3E0K A;  1CP7 A;  5HH1 A;  1Y0R A;  3BI1 A;  2K5T A;  1SQH A;  4ONU A;  4GXH A;  2BEI A;  3LMS A;  2FCK A;  2O28 A;  4LQG A;  2Q51 A;  2O53 A;  1LAN A;  5HXD A;  2FXF A;  4U9Z A;  4YWY A;  1BAV A;  4BD9 A;  4R57 A;  1EE3 P;  4PXB A;  1YX0 A;  1AMP A;  3T8W A;  3QB8 A;  4PXC A;  1I1D A;  3JRU A;  2ZW7 A;  5K8M A;  4UBR A;  4R8F A;  3B3T A;  2YNC C;  3BI0 A;  5IB0 A;  1S3Z A;  4PPZ A;  4B12 A;  4MFL A;  3NE8 A;  4DUK A;  1S7F A;  2XEG A;  2OZH A;  4Q38 A;  1NSA A;  1VGY A;  1X12 A;  2HB6 A;  2P6G A;  2ZEO A;  3B3V A;  4NGP A;  4UF4 A;  4X3R A;  3CZX A;  2PJB A;  3HLP A;  1CPS A;  2Z3K A;  5JM6 A;  2WYR A;  1M4G A;  1LOK A;  4NEX A;  3UY5 A;  4HNW B;  4XNH C;  1YK3 A;  1WWZ A;  3DNS A;  4RN7 A;  1YW6 A;  4BMH A;  5C88 A;  3D67 A;  3TCV A;  2PJ1 A;  4AB7 A;  4XPD B;  1XRY A;  2NSM A;  4CGP A;  4MFK A;  3WAB A;  2JBK A;  5IV0 A;  2PRB A;  5THW A;  4CYN A;  4TWE A;  3FB3 A;  3TC8 A;  3P2F A;  5E96 A;  1Z8X A;  2ZEH A;  3S6H A;  1Q7L A;  1I12 A;  3WC6 A;  3PBE A;  2GAN A;  4LX9 A;  5KTC A;  2VZZ A;  5I0C A;  4L89 A;  1MJ9 A;  3FF3 A;  4CYQ A;  2V8D A;  2Q04 A;  1M1D A;  2RC4 A;  3PB9 X;  5F49 A;  3MGD A;  4A95 A;  3TO7 A;  1F57 A;  2QIR A;  2Q43 A;  3KGQ A;  1PU9 A;  3PFE A;  4UEE A;  2PSW A;  4PK2 A;  4H6U A;  4UIA A;  4XPL A;  4B13 A;  4QBJ A;  1NMT A;  2PVV A;  1ELM P;  3B7I A;  4NJR A;  5HVH A;  3PB8 X;  2Q4Y A;  1YRE A;  3DR6 A;  3R95 A;  1NSL A;  4E8O A;  5ISV A;  4KSI A;  3GKR A;  5J8F A;  4ZGY B;  3WT4 A;  4OC4 A;  2KCW A;  1RXT A;  3EO4 A;  3GYA A;  2AFX A;  5DWM A;  4B5O A;  3FXT A;  4P44 A;  2C6P A;  1QST A;  3C26 A;  2GLF A;  2REE A;  3I1U A;  1YVO A;  5FVJ A;  3WC5 A;  3NH5 A;  5C82 A;  3H8F A;  1TKJ A;  3KHZ A;  1XBU A;  3IU2 A;  3PEI A;  4IAV A;  4OP4 A;  4EWT A;  3SJG A;  4P45 A;  1ON0 A;  2YND A;  3R1K A;  5G20 A;  2PIZ A;  1JQG A;  1PUA A;  4F8Z A;  2WUU A;  2EO8 A;  2JDD A;  3TO9 A;  5JGF A;  2BSW A;  1LAM A;  4FWU A;  4R87 A;  4C7H A;  3FVL A;  2EBJ A;  2QYV A;  2VEZ A;  2ZEL A;  4MFP A;  2Q7S A;  3NE7 A;  4C7I A;  1IOF A;  4P10 A;  2P6E A;  5LYI A;  1JWQ A;  2IL4 A;  2DF5 A;  1B6B A;  4MFJ A;  3R96 A;  1GYT A;  3QAH A;  1Z9U A;  3K9T A;  3PZJ A;  3IO1 A;  1Y7R A;  3D7G A;  4GM5 A;  3RAM A;  4CGN A;  3B35 A;  2BL1 A;  4YGO A;  4LUA A;  4KUA A;  2CNS A;  3PFO A;  3IIB A;  4PSW A;  1Z2L A;  2JEW A;  4PSX A;  2WSA A;  4WWV A;  1L0C A;  5HVF A;  2ZW5 A;  2AFW A;  4R6T A;  1TXR A;  2QVP A;  1MK4 A;  2C27 A;  4QVT A;  4NSQ A;  4MRI A;  4A2Z A;  1KZF A;  8CPA A;  4UEZ A;  4QB9 A;  1Y9W A;  3KAS A;  4OME A;  3BJ8 A;  5G1Z A;  4JD6 A;  4KOU A;  4MHD A;  2J8M A;  2J8R A;  2PDO A;  2XEI A;  4MHZ A;  2OZU A;  2YNC A;  2F8H A;  4II9 A;  3JTK A;  3KL9 A;  3A9L A;  4KS9 A;  2OH1 A;  4ZYQ A;  3V38 A;  2DPT A;  4PK3 A;  2V77 A;  2G3T A;  2PJ3 A;  5BWA B;  3NH4 A;  2PCU A;  4WJB A;  3N7Z A;  2FIW A;  3IWE A;  2PRQ A;  4AVA A;  4OAE A;  4PXD A;  3K9U A;  4NGM A;  2ABZ A;  1Y9K A;  2FIA A;  1CM0 A;  2NMT A;  2ODF A;  2VBQ A;  3CPA A;  4OC1 A;  2Q4Z A;  2I79 A;  3CXP A;  3FEE A;  1F2P A;  3PRT A;  5HMN A;  3LOD A;  4FBE A;  2FSR A;  3H5Z A;  2VI7 A;  4IHM A;  4UFV A;  2Z3N A;  2BUE A;  4JYW A;  4OAD A;  5DWN A;  1ZG9 A;  4KOT A;  5LYF A;  3H4Q A;  3V7Z A;  1KUX A;  2P0W A;  2HUZ A;  2OR4 A;  4DNC A;  3KI9 A;  4XPK A;  1P0H A;  2PJ6 A;  3H8E A;  2F7V A;  3CT9 A;  5AG7 A;  2PJ2 A;  3W6S A;  3PB6 X;  4UWI A;  1ZLI A;  2J9A A;  3TT2 A;  3ZZI A;  4KOY A;  4Q36 A;  4KVM E;  4F0X A;  4FD4 A;  1R43 A;  3EY5 A;  4K3N A;  1ZG7 A;  2J8N A;  4KOS A;  4JLY A;  1IB1 E;  2H5M A;  2PE3 A;  3L2N A;  2JLM A;  2FT0 A;  4ZY2 A;  5A28 A;  3D3S A;  4UFX A;  1HDQ A;  4C2Z A;  2ZEG A;  3N5F A;  2PJ4 A;  3DSB A;  2P6F A;  1TKH A;  1FT7 A;  1AUG A;  3H8G A;  3D2P A;  1R3N A;  4RUH A;  4P4D A;  4CAX A;  3JVN A;  2ZED A;  3R9F A;  2QJ8 A;  3SI1 A;  3TX8 A;  4Y49 C;  4CGO A;  5LRJ A;  2G0B A;  3IGR A;  5CPA A;  3KR5 A;  4M85 A;  1XMB A;  3NH8 A;  2QML A;  3IJ3 A;  4KOW A;  4JZ0 A;  4ZBG A;  4ZY1 A;  4W9Y A;  3ISX A;  4ZX8 A;  5IX3 A;  5K8P A;  3JUW A;  4FD6 A;  3S9M A;  1Z4R A;  4UCN A;  5H84 A;  4A31 A;  3B3C A;  2WPW A;  4OIW A;  3RO0 A;  3F5B A;  1F2O A;  2O4H A;  4B5P A;  4KLV A;  4BIN A;  1PYT B;  4CRZ B;  3S9L A;  3MN8 A;  4P4J A;  4CGM A;  4X8I A;  3ZJ0 A;  4A94 A;  1R57 A;  4OKO A;  3TO6 A;  3VAR A;  3D4U A;  4EME A;  5LYL A;  2AE6 A;  1Q2C A;  4HPS A;  2V8H A;  3KR4 A;  4GS4 A;  1YLO A;  1CG2 A;  3W91 A;  2GE3 A;  2NYQ A;  3D8P A;  3HUV A;  2R8V A;  4IUS A;  5CNP A;  1N71 A;  1S60 A;  3PBB A;  4UEF A;  2PC1 A;  1IIC A;  1Z8L A;  1YR0 A;  4P4B A;  2CY2 A;  2DXQ A;  2GFQ A;  3D7D A;  1PCA A;  1S7L A;  1HDU A;  3P2H A;  4NXY A;  3SI2 A;  4Q7A A;  5IB9 A;  4CGL A;  1TF9 A;  2HQY A;  1XF8 A;  4OC0 A;  1VHS A;  5EC4 A;  2HC9 A;  1CP6 A;  5LRK A;  3EFA A;  2ZOF A;  1ARL A;  1BOB A;  3FED A;  4A38 A;  5AG5 A;  2PJ9 A;  5GCN A;  1XOV A;  2AFZ A;  4NGS A;  1K4J A;  3CPX A;  3LAC A;  1XIX A;  3SI0 A;  2PR1 A;  2R98 A;  3TOA A;  3BLN A;  4CPA A;  2XEF A;  3NFZ A;  1CJW A;  4KSA A;  1P4N A;  4MY0 A;  4MCS A;  2DPS A;  5H86 A;  1IY7 A;  1DE4 C;  3RBU A;  5JH9 A;  4ORF A;  1V0C A;  4KZT A;  3BHX A;  1FY7 A;  3CXS A;  4F9U A;  4CS0 B;  4OLL A;  3D7F A;  1BLL E;  2GU2 A;  2VQY A;  1IOI A;  3B8G A;  3FNC A;  1QQ9 A;  4XNH B;  2ZEF A;  4MHY A;  2ANP A;  4U5Y A;  3OWC A;  1B87 A;  4MCP A;  4IK2 A;  4PV6 A;  3SXN A;  3SHP A;  1XE4 A;  1MJA A;  2XEJ A;  4MFQ A;  4UCM A;  1YQE A;  4MHN A;  1WK4 A;  3KHX A;  4R76 A;  1IU8 A;  4B14 A;  5CBM A;  1ZLH A;  5A27 A;  3IEH A;  2POK A;  3FX6 A;  4F9V A;  5K8N A;  2ZXV A;  4PXE A;  1Z8W A;  4CYP A;  1QSO A;  2IMO A;  4AVC A;  5KTD A;  2EUI A;  2QEC A;  2HV2 A;  2C6G A;  2FE7 A;  3D7H A;  3VAT A;  3FYN A;  5KTA A;  3RZA A;  2B3U A;  2RB7 A;  3RYO A;  4CAF A;  3DR8 A;  3FBU A;  1M4I A;  1A2Z A;  1H8L A;  1YLE A;  4MXU A;  1LRZ A;  1S7K A;  3TE4 A;  2Z3M A;  1OBR A;  3IWG A;  5AG4 A;  2GLJ A;  4JXQ A;  1UWY A;  4OID A;  3S6F A;  4YU9 A;  2CIJ A;  1Z5R A;  4CRY B;  1LCP A;  2Z10 A;  4XPD C;  2AFS A;  3KQZ A;  3GY9 A;  2R7H A;  3SJF A;  2D4O A;  1ZO0 A;  3S6K A;  4A37 A;  2PJC A;  2AFU A;  2Q0Y A;  3D66 A;  4P4F A;  5K8O A;  4OC2 A;  3ISZ A;  5J1Q A;  2ZPA A;  2PJ7 A;  2PR8 A;  4R9M A;  4C2X A;  2Z11 A;  2PJ8 A;  4MCQ A;  2G9D A;  2CNM A;  3PB4 X;  2CNT A;  3LWU A;  3GLJ A;  4X2T A;  3LD2 A;  3T9Y A;  4M6I A;  3IWW A;  4MY3 A;  4B5P B;  2OB0 A;  4HNY B;  2RFH A;  1LAP A;  4QUS A;  3VWD A;  4H6Z A;  2CTB A;  4MFZ A;  4U9Y A;  3KZW A;  4EVY A;  4NFR A;  3BJ7 A;  4DYO A;  5J8C A;  4P4I A;  2CTC A;  2B4D A;  4C2Y A;  3EXN A;  3FRM A;  3I9S A;  4K30 A;  4HKF A;  4ZI6 A;  5F47 A;  3D2M A;  3RNZ A;  2AFO A;  3R9E A;  1Q2Y A;  2B58 A;  3EC4 A;  3VH9 A;  3GUX A;  4KUB A;  4FUU A;  2ARH A;  2VXK A;  1IID A;  4ZY0 A;  2ZEN A;  3DLJ A;  2ZOG A;  2B5G A;  1XMT A;  4FD7 A;  4UFW A;  2ZW6 A;  5LYD A;  4F6A A;  3B2Y A;  3FMC A;  1IGB A;  1QMU A;  3IU1 A;  3WR7 A;  3G3S A;  3PP9 A;  5EBV A;  5HVG A;  1MJB A;  3G8W A;  3GB0 A;  5G22 A;  4HNX B;  2C6C A;  2Q4V A;  3IC1 A;  3FJU A;  2EK8 A;  1VHO A;  4H89 A;  2JBJ A;  2WZN A;  1Z4E A;  3SXO A;  3QNV A;  4R7M A;  5ELY A;  1U6M A;  4Z65 A;  3VWE A;  3DGV A;  1M44 A;  1TIQ A;  3S6G A;  3W6X A;  3T90 A;  2JDC A;  2Q44 A;  3TTH A;  1CPX A;  2AFM A;  1Q2D A;  4M6H A;  7CPA A;  1Z8T A;  4L8A A;  1BO4 A;  4UA3 A;  3NA6 A;  1YME A;  2BCO A;  4BBH A;  1Y0Y A;  1Y7E A;  1YSJ A;  2EK9 A;  4KSF A;  4B10 A;  4NGR A;  5F48 A;  2BOA A;  4YFJ A;  3SJX A;  2D4P A;  2GRE A;  3FH4 A;  3TFY A;  4O23 A;  4YRH A;  4B6Z A;  1KUY A;  4MJ8 A;  1XFO A;  4A30 A;  4CAV A;  4F0Y A;  2EWB A;  3B3W A;  3SJE A;  4RI1 A;  2ZEE A;  1QSR A;  4NCZ A;  1ZG8 A;  2PJ0 A;  4MBU A;  4JWP A;  4MMO A;  1M4L A;  2ZEM A;  4R3K A;  2VL1 A;  4H2K A;  4UWJ A;  3V8I A;  4EFD A;  2B3V A;  4KLW A;  2Q7B A;  2OU2 A;  2R1I A;  4JJX A;  3BXM A;  4NGN A;  4ZX9 A;  1KUV A;  1VKC A;  2FVG A;  5I4M A;  4J3G A;  4NJQ A;  4E2A A;  3PB7 X;  5D29 A;  1IYL A;  4ONW A;  3DDD A;  3K2K A;  3KQX A;  4UIB A;  3R9G A;  1XEB A;  2Z3L A;  4UCP A;  1VIX A;  4Y49 B;  2FL4 A;  4FAI A;  4CYO A;  4MCR A;  4M6G A;  4AG7 A;  3I3G A;  4P4E A;  4X5K A;  2I3C A;  4TNU A;  2OZG A;  3TOB A;  5LRG A;  2PVW A;  1YVK A;  2ATR A;  4FD5 A;  4M3S A;  4AG9 A;  2PJA A;  4MI4 A;  2AJ6 A;  2JEV A;  1UFH A;  2ZW4 A;  4C68 A;  3MRU A;  2EVN A;  1KWM A;  1TKF A;  4JXR A;  5F09 A;  4KOX A;  2C1C A;  2IJZ A;  1J4J A;  3WC7 A;  2I00 A;  4AVB A;  4A33 A;  3GIU A;  4LQ6 A;  1RO5 A;  4B11 A;  5G21 A;  1OZP A;  2Y0M A;  2Z0Z A;  4A32 A;  4QC6 A;  1ELL P;  1CBX A;  4NGT A;  1BPM A;  2DEA A;  4P6Y A;  2Z3P A;  3FIX A;  2PJ5 A;  4IF5 A;  4OC5 A;  4KOR A;  1NE9 A;  1VHE A;  3CXQ A;  4KVO E;  3F0A A;  5EMI A;  1ARM A;  4DJL A;  1M4D A;  4CAW A;  2B4D B;  2CXA A;  2YGW A;  5D8N A;  4G1P A;  3CDX A;  5JQ4 A; 
#chains in the Genus database with same CATH homology
 2F5I A;  4KVX A;  1YGH A;  4I49 A;  5F46 A;  1QSM A;  1I21 A;  2Z3O A;  2PQ8 A;  2B4B A;  2FS5 A;  3PGP A;  2G3A A;  5AG6 A;  2B5G B;  1S5K A;  5JPH A;  2VZY A;  3KKW A;  2A4N A;  2YNE A;  4NF1 A;  2X7B A;  1S7N A;  4R3L A;  5AGE A;  2REF A;  1QSN A;  4E0A A;  1GHE A;  2GIV A;  4RS2 A;  4CAE A;  3F8K A;  1IYK A;  2WPX A;  4KOV A;  3E0K A;  5HH1 A;  2K5T A;  1SQH A;  4ONU A;  2BEI A;  2FCK A;  2O28 A;  2FXF A;  4U9Z A;  4R57 A;  1YX0 A;  3QB8 A;  1I1D A;  2ZW7 A;  4UBR A;  2YNC C;  5IB0 A;  1S3Z A;  4B12 A;  4MFL A;  1S7F A;  4Q38 A;  2OZH A;  2P6G A;  4YGO A;  2Z3K A;  1M4G A;  4NEX A;  3UY5 A;  4HNW B;  4XNH C;  1YK3 A;  1WWZ A;  3DNS A;  5C88 A;  4BMH A;  3TCV A;  4AB7 A;  4XPD B;  4CGP A;  4MFK A;  5IV0 A;  2PRB A;  4CYN A;  3FB3 A;  3P2F A;  5E96 A;  3S6H A;  1I12 A;  2GAN A;  4LX9 A;  5KTC A;  2VZZ A;  5I0C A;  4L89 A;  1MJ9 A;  4CYQ A;  2Q04 A;  1M1D A;  2RC4 A;  5F49 A;  3MGD A;  4A95 A;  3TO7 A;  2QIR A;  1PU9 A;  2PSW A;  4PK2 A;  4H6U A;  4XPL A;  4B13 A;  4QBJ A;  1NMT A;  2Q4Y A;  1YRE A;  3DR6 A;  3R95 A;  1NSL A;  4E8O A;  5ISV A;  5J8F A;  3GKR A;  4ZGY B;  2KCW A;  1RXT A;  3EO4 A;  3GYA A;  5DWM A;  4B5O A;  3FXT A;  1QST A;  3C26 A;  2REE A;  5FVJ A;  5C82 A;  1YVO A;  3IU2 A;  1ON0 A;  2YND A;  3R1K A;  5G20 A;  1PUA A;  2WUU A;  2JDD A;  3TO9 A;  2BSW A;  4R87 A;  4C7H A;  4MFP A;  2VEZ A;  3NE7 A;  4C7I A;  2P6E A;  2IL4 A;  1B6B A;  4MFJ A;  3R96 A;  3QAH A;  1Z9U A;  3PZJ A;  1Y7R A;  4CGN A;  2BL1 A;  4LUA A;  4KUA A;  2CNS A;  4PSW A;  4PSX A;  2WSA A;  1L0C A;  2ZW5 A;  1MK4 A;  2C27 A;  4QVT A;  4NSQ A;  4A2Z A;  1KZF A;  4QB9 A;  1Y9W A;  3BJ8 A;  5G1Z A;  4JD6 A;  4KOU A;  4MHD A;  2J8M A;  2J8R A;  2PDO A;  2OZU A;  2YNC A;  4II9 A;  3JTK A;  3A9L A;  4KS9 A;  2OH1 A;  2DPT A;  4PK3 A;  2G3T A;  5BWA B;  3N7Z A;  2FIW A;  3IWE A;  4AVA A;  4OAE A;  3K9U A;  2FIA A;  1Y9K A;  2NMT A;  1CM0 A;  2VBQ A;  2I79 A;  3CXP A;  5HMN A;  3LOD A;  2FSR A;  3H5Z A;  2VI7 A;  4UFV A;  2Z3N A;  2BUE A;  4OAD A;  5DWN A;  4KOT A;  3H4Q A;  1KUX A;  2P0W A;  2HUZ A;  4DNC A;  4XPK A;  1P0H A;  5AG7 A;  3W6S A;  4UWI A;  3TT2 A;  3ZZI A;  4KOY A;  4Q36 A;  4KVM E;  4F0X A;  4FD4 A;  3EY5 A;  4KOS A;  2J8N A;  4JLY A;  1IB1 E;  2H5M A;  2JLM A;  2FT0 A;  5A28 A;  3D3S A;  4UFX A;  4C2Z A;  3DSB A;  2P6F A;  3D2P A;  4CAX A;  3JVN A;  3R9F A;  4Y49 C;  4CGO A;  2G0B A;  3IGR A;  4ZBG A;  4M85 A;  2QML A;  4KOW A;  5IX3 A;  3JUW A;  4FD6 A;  1Z4R A;  4UCN A;  5H84 A;  4A31 A;  2WPW A;  3F5B A;  4B5P A;  4KLV A;  4CRZ B;  4CGM A;  3ZJ0 A;  1R57 A;  3TO6 A;  2AE6 A;  1Q2C A;  4GS4 A;  3W91 A;  2GE3 A;  3D8P A;  2R8V A;  4IUS A;  5CNP A;  1N71 A;  1S60 A;  2PC1 A;  1IIC A;  1YR0 A;  2CY2 A;  2DXQ A;  3P2H A;  1S7L A;  4NXY A;  4CGL A;  2HQY A;  1XF8 A;  1VHS A;  5EC4 A;  3EFA A;  1BOB A;  5AG5 A;  5GCN A;  1K4J A;  1XIX A;  2PR1 A;  2R98 A;  3TOA A;  3BLN A;  4KSA A;  1CJW A;  1P4N A;  4MY0 A;  2DPS A;  5H86 A;  4ORF A;  1V0C A;  4KZT A;  1FY7 A;  3CXS A;  4CS0 B;  4OLL A;  2VQY A;  3B8G A;  3FNC A;  4XNH B;  4U5Y A;  3OWC A;  1B87 A;  4PV6 A;  3SXN A;  3SHP A;  1XE4 A;  1MJA A;  4MFQ A;  4UCM A;  1WK4 A;  4B14 A;  5A27 A;  2ZXV A;  4CYP A;  1QSO A;  5KTD A;  4AVC A;  2EUI A;  2QEC A;  2HV2 A;  2FE7 A;  3FYN A;  5KTA A;  2B3U A;  3RYO A;  4CAF A;  3DR8 A;  3FBU A;  1M4I A;  1YLE A;  1LRZ A;  1S7K A;  3TE4 A;  2Z3M A;  3IWG A;  5AG4 A;  4JXQ A;  3S6F A;  4CRY B;  2Z10 A;  4XPD C;  3GY9 A;  2R7H A;  2D4O A;  1ZO0 A;  3S6K A;  2Q0Y A;  2ZPA A;  4R9M A;  2PR8 A;  4C2X A;  2Z11 A;  2CNM A;  2CNT A;  3LD2 A;  3T9Y A;  4MY3 A;  4B5P B;  2OB0 A;  4HNY B;  4QUS A;  3VWD A;  4H6Z A;  4MFZ A;  4U9Y A;  4EVY A;  3BJ7 A;  5J8C A;  2B4D A;  4C2Y A;  3FRM A;  3EXN A;  3I9S A;  4K30 A;  4HKF A;  5F47 A;  3D2M A;  3R9E A;  1Q2Y A;  2B58 A;  3EC4 A;  4KUB A;  2ARH A;  2VXK A;  1IID A;  2B5G A;  1XMT A;  4FD7 A;  4UFW A;  2ZW6 A;  4F6A A;  3IU1 A;  3WR7 A;  3G3S A;  3PP9 A;  5EBV A;  1MJB A;  3G8W A;  5G22 A;  4HNX B;  2Q4V A;  4H89 A;  1Z4E A;  3SXO A;  1U6M A;  3VWE A;  1M44 A;  1TIQ A;  3S6G A;  3W6X A;  3T90 A;  2JDC A;  2Q44 A;  3TTH A;  1Q2D A;  4L8A A;  1BO4 A;  4UA3 A;  4BBH A;  4B10 A;  4KSF A;  5F48 A;  4YFJ A;  2D4P A;  3TFY A;  4YRH A;  1KUY A;  4MJ8 A;  4F0Y A;  4A30 A;  4CAV A;  4RI1 A;  1QSR A;  4NCZ A;  4MBU A;  4R3K A;  4JWP A;  4UWJ A;  3V8I A;  2B3V A;  4KLW A;  2Q7B A;  2OU2 A;  2R1I A;  4JJX A;  1KUV A;  1VKC A;  4J3G A;  4E2A A;  1IYL A;  3DDD A;  3R9G A;  1XEB A;  2Z3L A;  4UCP A;  4Y49 B;  2FL4 A;  4CYO A;  4AG7 A;  3I3G A;  4X5K A;  2OZG A;  3TOB A;  1YVK A;  2ATR A;  4FD5 A;  4M3S A;  4AG9 A;  4MI4 A;  2AJ6 A;  2JEV A;  1UFH A;  2ZW4 A;  4C68 A;  2EVN A;  4JXR A;  4KOX A;  1J4J A;  4AVB A;  2I00 A;  4A33 A;  1RO5 A;  4B11 A;  5G21 A;  1OZP A;  2Y0M A;  2Z0Z A;  4A32 A;  4QC6 A;  4IF5 A;  2Z3P A;  3FIX A;  4KOR A;  1NE9 A;  3CXQ A;  4KVO E;  3F0A A;  1M4D A;  4CAW A;  2B4D B;  2CXA A;  2YGW A;  5JQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...