2P0WA

Human histone acetyltransferase 1 (hat1)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
319
structure length
319
Chain Sequence
AEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human histone acetyltransferase 1 (HAT1) in complex with acetylcoenzyme A and histone peptide H4
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone acetyltransferase type B catalytic subunit
total genus 93
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2p0wA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2p0wA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 2p0wA01
1KZFA 5KTCA 4PV6A 1QSOA 5F49A 2I79A 2AJ6A 2FS5A 2Z0ZA 2FT0A 1LRZA 2VQYA 4ORFA 3G3SA 3JVNA 4OAEA 1QSNA 4KOTA 1B6BA 4HNXB 2PR8A 3ZJ0A 2HQYA 3TFYA 3GYAA 4NCZA 3D8PA 4AB7A 1YREA 2OB0A 1OZPA 4XPDC 2VZYA 4XNHB 4MHDA 4ONUA 3D3SA 4QUSA 2FCKA 2FIWA 3PZJA 2ZW7A 3F5BA 3FXTA 2GE3A 2B4DA 3UY5A 5GCNA 2JLMA 5IB0A 3TO7A 3CXPA 4IUSA 3DR6A 4JJXA 1YVKA 3TE4A 1Q2DA 2WPXA 2Q04A 4KLVA 4CAVA 4B5PA 1MK4A 1IB1E 1V0CA 5E96A 1B87A 4BMHA 2VBQA 2Q44A 2ZW4A 4II9A 2H5MA 2PQ8A 3PP9A 3GKRA 4L89A 2X7BA 2EUIA 2D4PA 1YGHA 4U9ZA 1IYLA 1Z4EA 2P6GA 1IICA 3EXNA 3R9FA 2G3TA 3EC4A 2JDCA 2CNSA 4UWJA 2K5TA 4DNCA 1YLEA 1PU9A 2ZW5A 1QSTA 4FD7A 4FD6A 5F47A 1QSMA 5EC4A 2GIVA 1I1DA 4E2AA 1VHSA 4KVME 1XF8A 4GS4A 5JPHA 1KUYA 3R9GA 3I9SA 5I0CA 4X5KA 5F48A 2P0WA 1YR0A 3EY5A 2REEA 4OADA 4CRZB 4LUAA 1WK4A 3R1KA 2B58A 4FD5A 2HV2A 4CS0B 3ZZIA 3SXOA 3WR7A 2OU2A 3IGRA 2VXKA 2ARHA 2PC1A 5J8FA 2NMTA 4M85A 4YGOA 2Q7BA 4I49A 4KVXA 3FRMA 5JQ4A 4U5YA 4KOYA 2IL4A 2D4OA 2ZPAA 1P4NA 2VEZA 1U6MA 3CXQA 3T9YA 3V8IA 3RYOA 3EFAA 5FVJA 4K30A 4KOWA 4J3GA 1S7LA 1NSLA 2F5IA 1Y9KA 4KUBA 2Y0MA 2VZZA 3TOBA 1M1DA 3DR8A 4HNWB 3S6HA 4E8OA 3FBUA 5H86A 1NMTA 1IYKA 1PUAA 3QAHA 3TCVA 1S5KA 4E0AA 1I21A 3TO6A 4XPKA 3SHPA 2ZXVA 4KUAA 4KORA 2PR1A 2J8NA 3JUWA 4HKFA 2QIRA 4QC6A 1KUVA 2A4NA 3FYNA 3G8WA 4MI4A 3BJ7A 2R1IA 4JXQA 4L8AA 4PK3A 5C82A 4EVYA 4UWIA 2G0BA 1RO5A 3H4QA 1GHEA 2HUZA 2ATRA 3D2PA 4NXYA 3FB3A 4FD4A 2C27A 3R9EA 4PSXA 1I12A 2R98A 4NF1A 1CJWA 1MJ9A 2REFA 3W6XA 2B5GB 2WPWA 4MY3A 1NE9A 4RI1A 4B5PB 3GY9A 3FNCA 1K4JA 2QECA 1S60A 3DNSA 3N7ZA 5HMNA 3F0AA 5H84A 1IIDA 2FXFA 4PSWA 1WWZA 3T90A 1YK3A 1P0HA 2EVNA 2FL4A 4JD6A 5KTDA 2B4BA 4AVAA 5J8CA 1M44A 1VKCA 4JLYA 5DWNA 2QMLA 4NSQA 5KTAA 3VWDA 1XE4A 2Q4VA 4XPDB 3CXSA 5HH1A 1Y9WA 3TOAA 2J8MA 4AVCA 2BL1A 3QB8A 3DDDA 3DSBA 2R7HA 3VWEA 1S7FA 4B5OA 2BSWA 3KKWA 1Q2CA 4KVOE 1CM0A 3EO4A 3S6KA 2Z11A 2RC4A 3F8KA 2PDOA 4HNYB 3W91A 2B4DB 2J8RA 4MBUA 2CNTA 2FIAA 3TT2A 1XIXA 4KOUA 5IV0A 3BJ8A 1QSRA 4UA3A 2O28A 4H6ZA 2Q4YA 1KUXA 2B3UA 5CNPA 3B8GA 3MGDA 4YFJA 3P2HA 1M4DA 1M4IA 2PRBA 5ISVA 3LD2A 1J4JA 1SQHA 3D2MA 4LX9A 2OH1A 4QVTA 1TIQA 4Y49C 4R3KA 2CY2A 2B5GA 1L0CA 3SXNA 2R8VA 3S6GA 1YVOA 2B3VA 4KOVA 3W6SA 4XNHC 2Q0YA 4OLLA 3BLNA 2P6EA 3LODA 3P2FA 4CRYB 5F46A 1UFHA 2ZW6A 3K9UA 4IF5A 4PK2A 5IX3A 4MJ8A 1Z9UA 2OZUA 3FIXA 4AG7A 1XEBA 2BUEA 5EBVA 3C26A 1YX0A 4JXRA 2DXQA 4KOXA 3S6FA 2G3AA 4JWPA 3IWGA 1BO4A 1Z4RA 1MJBA 3NE7A 4Y49B 4NEXA 2OZHA 2KCWA 3TTHA 5C88A 3R96A 4RS2A 1ON0A 4R3LA 1S7KA 4AVBA 2VI7A 4CAWA 2FE7A 4M3SA 1MJAA 1RXTA 3R95A 2PSWA 1M4GA 5DWMA 2OZGA 2P6FA 2Z10A 4R57A 2AE6A 1S7NA 4MY0A 2GANA 4YRHA 4XPLA 4QB9A 3TO9A 4KOSA 4F0YA 2JDDA 4KLWA 4ZBGA 1FY7A 2FSRA 1Q2YA 4CAXA 2I00A 4U9YA 4H6UA 4R87A 4H89A 1S3ZA 3PGPA 4QBJA 1XMTA 2CNMA 4AG9A 2JEVA 4UBRA 3I3GA 4R9MA 3OWCA 4KZTA 4F6AA 1BOBA 3E0KA 1Y7RA 1R57A 1N71A 2BEIA
chains in the Genus database with same CATH superfamily
3W6KB 4KA4A 1KZFA 4M71A 3P9KA 3H92A 5KTCA 1W7PB 1QSOA 3ISPA 2HQNA 1OCPA 2AJ6A 4KSIA 2FT0A 1LRZA 3A9LA 1X1BA 3JVNA 4OAEA 1QSNA 2IGMA 3BPVA 1FOWA 3J7AO 4GGGA 1B6BA 2I3CA 1UB9A 3GLJA 2PJCA 3TDUC 3TP0A 3ZJ0A 4XRSA 2UZKA 4LLGF 4BU2A 1ITYA 3V7ZA 2XDVA 1OJLA 4NCZA 2HWVA 3CDXA 4RS8A 4ONWA 3IC7A 3KP6A 2FEZA 4IVNA 1PCAA 1GUUA 3U1KA 2BW3A 3NARA 4MNUA 3SJMA 2VZYA 2FOKA 2RREA 2Y30A 4I76A 4ZY1A 2AHQA 3SJEA 1IUYA 3FMQA 4LJZF 3QRFF 2GLOA 2P5KA 1T38A 2HXOA 3H0GJ 2Z3OA 3B7IA 3JR9A 1GXPA 4KSAA 4Q47A 1J9IA 3F5BA 4NC7A 3FXTA 2IW5A 4PJ0C 3HUGB 2LF8A 3KIOA 2K9SA 2Z1DA 1HQCA 2QKLB 2GE3A 2NSMA 4HX7A 5GCNA 1FIPA 4UUVA 3REOA 2EILH 4ESFA 2M4KA 2XEFA 2J5PA 2PEXA 3BJOA 5KHDA 1A31A 5ILUA 1F43A 3BZKA 4EJVA 1O3TA 1TKFA 3DEEA 4BH9A 3KHZA 2WYRA 3E5UA 3PQKA 4DW6A 3OYJA 4LIVA 2DJIA 1FYLA 3VDXA 2E71A 1MMGA 5HVHA 4QPOA 4MCRA 5DCMA 1TNSA 2K9MA 3GWZA 4HF2A 3DTIA 4KICA 1QBJA 3H5ZA 1STZA 4LMYA 2MG4A 1YVKA 4PFOA 4HX4A 3SDBA 1ZGWA 1Q2DA 4HSRA 2GXBA 4CAVA 4MGRA 1FOYA 1FEXA 4W9YA 2EZIA 3GXOA 3RZDJ 2JWTA 4KNYA 2CTBA 2VBQA 4PDKA 3K7AJ 3KR4A 4GM5A 2OPTA 4UCNA 5G20A 3RKXA 3D7FA 1QA6A 2KIUA 2H5MA 1UZCA 4I2OA 1YFHA 5HS8A 1UG2A 4BYYA 3DP7A 3CC4I 2DFIA 3ZQIA 4CDGA 2ADUA 3J7ZI 4CA0A 4ON0A 5DD8A 3ZQGA 3MKWB 3HLPA 2LY9A 4DBQA 1EH6A 1Z0XA 1ONVA 4BEHA 4CYNA 2LK2A 3GX4X 2D2WA 3DPTA 1X4OA 2A3SA 4EEFG 3PIPF 3PEIA 3ERMA 2CG4A 4AVPA 3NH8A 2FMYA 2K5TA 4UWJA 3TGNA 4XR6A 4DNCA 2R7OA 3CCRI 2WA0A 1YW8A 2R0QC 2DYRH 4M9ZA 2I8DA 1K4TA 4A3GJ 2QQAA 2ZW5A 4MEYF 3FVLA 1H8AC 2DT5A 1U5TA 1TLHB 3H35A 1ZN2A 3KEQA 2FXAA 2EBIA 3I71A 4ZGYB 4MFDA 9ANTA 1PUEE 1WJ5A 3ZQHA 3U1DA 5B3SH 5DM6F 1Z8TA 3RTRA 4Q36A 4MQ9F 2IS1A 3CF2A 4A3DJ 2E5ZA 4B47A 3HPHA 2DYSH 2HVRA 3ISXA 3MZHA 1MMAA 3K4MA 1LB2A 1KUYA 4G1PA 3R9GA 2W25A 5C4XJ 4PQAA 4XLNF 4E7JA 4D1QA 4J19A 5I0CA 2VC1A 4IHWA 4X5KA 5IB9A 4RB3C 4BHPA 2XAJA 2CTCA 4E7IA 3LAPA 3EY5A 2ZKZA 4UFXA 2REEA 2R93J 5BPDA 4MHYA 4OADA 3NFZA 3JCUC 2VJ5A 1WK4A 4A95A 5HDNA 1B9NA 1UG0A 3GW2A 3ABLH 3K69A 4AIJA 4N0BA 4IRIA 4FD5A 2F6CA 2V4JC 3A03A 3QPLA 1G3SA 1OYWA 4DIQA 3LACA 1XJOA 1IAWA 1BAVA 2PC1A 4Y33A 3BZ6A 3HYIA 4XLEA 2G7UA 3FECA 3L2CA 2Q7BA 3WTXC 4I0AA 2R7XA 1MBHA 2ZOFA 1BIBA 2BCOA 1ZKGA 1BI3A 3IWZA 1YI2I 4KOYA 5ILSA 4HEA2 3AKZA 4BE1A 2M7BA 1XSDA 1XBUA 1SVMA 3IWEA 2CU7A 3M9AA 3CXQA 4C68A 2R5ZB 2VXZA 2IP2A 2BY3A 2BVLA 3ZOBA 1TP4A 1HLVA 1IOIA 2R7RA 4XRSG 2DODA 3V8IA 4BXXJ 1F2OA 1FBUA 4RGUA 3RYOA 4YIRX 1E2XA 4RA2A 2IEKA 4NBQA 4EJUA 1LVKA 2CUZA 2XGXA 1YJWI 4K30A 3B3WA 1HSTA 3ZPLA 3LSIA 4MIMA 5J6XA 3QNVA 4PXEA 2O53A 1S7LA 2IJLA 5D5VB 1NSLA 2M8EA 3WABA 1VQ7I 4BJTA 3F8FA 5B1AH 2L7FP 3LSHA 5D8KB 3JRAA 4AIKA 2CUFA 3S1QJ 3I54A 4PJJA 5L3FA 1R7JA 2H6CA 3BR3A 2ZFUA 1IJWC 1XGNA 4DGWB 3QAYA 2VZZA 5CVRA 4YFKF 2HQ5A 3LFUA 1K79A 3S6HA 3WC5A 4IZZA 1IYKA 1YSJA 2FQ4A 1S5KA 2O03A 3TO6A 1I21A 2Q51A 4XPKA 1IRXA 4U87A 2NOGA 1WJCA 2D45A 1IG7A 1P9QC 4XQFA 5E17F 4JYWA 2PR1A 1XSXA 2D1HA 2FBIA 2GXGA 1X3UA 3BTLA 3NEUA 2RNGA 3W3CA 1X10A 4HKFA 1FYKA 5HDKA 2OTJI 4OKOA 2VPRA 2IA2A 2X6OA 4DJAA 5BNGA 1DU0A 1ORKA 5D29A 3WU1B 2BGCA 4CYDA 2EK5A 3V7SA 5L3BA 5JVTA 2K3FA 5M3FJ 4A3EJ 2PX9A 3E7LA 4LGWA 4BAYA 4HDUA 1K6YA 3HG9A 2C6YA 3G8WA 4X2TA 2FF4A 1ZARA 3HDDA 3EUAA 1ARLA 4TWEA 4UWIA 3OIPA 2BE5F 1HKSA 3H3UA 4DQ2A 1D5YA 4P4DA 1Z3YA 2PMUA 2P7CB 4WJBA 1JUPA 1R5ID 4WCGA 1S9HA 1B8IB 3TQNA 1SD7A 2O7OA 1BN5A 1IV6A 5CVVA 2F48A 3SEQA 1LAPA 1Z8LA 1Y56A 2R92J 1ETQA 4NXYA 2DPDA 4XKBA 1I12A 2A5WA 3OOUA 5EDNA 3ZGKA 2R98A 1MJ9A 2M8GX 2MYSA 3W6XA 4KN7X 1Z7UA 1UFMA 5E8GA 3SI1A 2B5GB 4MY3A 4XRFA 5ICGA 2KP6A 3I53A 1ZQ3P 4A39A 1NE9A 2X6YA 1ELMP 1P92A 2NYQA 1LANA 4Y17A 1S29A 3CJNA 2X4HA 2VJIA 4CCJA 3J7YJ 1MDMB 2G9DA 2JQ7A 4MFJA 3OYDA 4CYOA 4XKVA 2ANPA 4HPSA 4B09A 4YU9A 1OQYA 1V55H 1ZGAA 3AL0C 2ZENA 4CGPA 5J1UA 2HYGD 2VASA 4M74A 2AFOA 3JRHA 4CH7A 2V8HA 3PB6X 4C2XA 2DAOA 2RB7A 3ZQ7A 2FOWA 5IOYA 3E0JB 1Y39A 3BP8A 1BBYA 2DOAA 3GFLA 1TF9A 1YW6A 2ZEEA 2FXFA 5H84A 4XLAA 3VB2A 2O3FA 2VJJA 2MH9A 2AQEA 4OMYA 2Y2ZA 3RQ4A 3KLNA 3WTSC 3J7AY 2HPMA 2DPUA 2OAZA 3LAJA 3RSNA 1RUOA 2PJRA 2E1NA 1MMDA 3FBIB 2B4BA 3VPRA 1OCTC 3JRUA 2CV0A 5L3GA 1SAXA 4MMOA 3S9LA 1BW6A 2VOPA 4KFCA 2BXZA 4QWQA 4A3KJ 2QMLA 2BZTA 5ERIA 1Y1VJ 5CYVA 1IXSB 1PVEA 3HSEA 1SFOJ 1GT0C 2H8RA 1N78A 2OCEA 2ZEDA 1RTQA 2V79A 2IVMA 4BE0A 2J8MA 1TT5B 1U9NA 2DXIA 2BL1A 1RR7A 1I3QJ 1AKHB 4F91B 1CPXA 3T0YA 1U78A 1S7FA 1QQIA 4RN7A 1S7OA 2LFBA 2JSPA 2IS2A 3WC7A 3LSJA 1SFEA 3ML6A 3K4NA 1R49A 2R7DA 1JT6A 2YX4A 3A0BC 4ENNA 1GDTA 1CM0A 2DT6A 3EO4A 2HOSA 4A2ZA 3NH5A 5AONA 3HEFA 1YS7A 3RBUA 4BINA 4PXCA 2RC4A 2WV0A 1O3SA 2R7TA 3DU5A 3FF3A 3S9NA 4KIBA 3ABKH 5DD4A 1KQ0A 2VT2A 2EV5A 3HIFA 3H5RA 2V7FA 3CUQC 5ICCA 4MBUA 2CW0F 2EZKA 5JGFA 3K10A 5IV0A 1FJLA 3M8FA 3DQVC 1WJAA 5EJCA 4Y7NJ 3PO2J 3BJ8A 3CJTB 3OY9A 1AUGA 4FUUA 1MKMA 2DK8A 2QSHX 5CNPA 5AGEA 3FMCA 2A6TA 1FWZA 2GWRA 2NS8A 5GTHC 3MGDA 2DOFA 1IGBA 1M4DA 2PRBA 4UXNA 1G3WA 3BROA 3F6OA 1YW7A 4ZYAA 4CCKA 1R9TJ 4IHYA 1SQHA 5DDGA 2OR4A 3PFOA 3M7GA 4QVTA 2GLFA 2CY2A 1TWAJ 1WJEA 2QM3A 3I58A 4RBOA 5EGOA 3WTTC 2V9PA 1B1BA 2PBIA 2X6XA 4XK4A 1D8JA 1KUVA 1L0CA 3R60A 3GTLJ 2XPUA 4EJWA 1AWCA 2B3VA 1RPWA 2MC4A 1JTXA 4A32A 2O6GE 4HRIA 3DXJF 3FXMA 3OMYA 3Q5FA 4A2UA 2P6EA 2QVOA 3LODA 3IIBA 1V5GA 2I10A 2GQQA 1EA3A 2G7HA 4W1UA 5TJJA 3RJPA 2NVXJ 4IF5A 1ZAOA 2YSRA 4MJ8A 5IX3A 4XOPA 4OIWA 2BUEA 4E4HA 2LY2A 1FBSA 1VHEA 5JH9A 1TQPA 4X1EA 2CRGA 5FLXK 4DOZA 5EBVA 1MZBA 3C26A 1YX0A 4KOXA 3I56I 4NHJA 2DMQA 2OTLI 3S6FA 2XF6A 2PLYA 2G3AA 4JWPA 2V1NA 3CCQI 2ZXIA 5FROA 4O5VA 4HNUA 3CZ6A 3BG7A 5DTDA 1MJBA 3ECOA 4IQ4A 4EM1A 5C44J 3RKQA 2R4GA 4ENKA 1O7FA 2KCWA 1J2XA 3KL9A 4V2FA 3TTHA 2X51A 4HBLA 5D5UB 3RI4A 2L9RA 1T6SA 2P6TA 5EEAA 3FX3A 3R96A 2O5RA 1R4MB 2DA5A 2EQRA 2LBFA 1ON0A 4R3LA 1S7KA 2XAGA 4KIFA 1HW1A 2QWWA 2LSOA 3F8BA 1BW5A 1T33A 4RLFA 2E1OA 4NGNA 4CAWA 3TBIA 4NGQA 3L09A 1D0XA 1XGSA 4Q48A 2PJ8A 2E2JJ 2FNPA 2DMNA 4UVBA 4BY1J 3R95A 2PI0A 5GP9A 4IHSA 2PSWA 2Y0SA 2ZXWH 4PCQA 5BS6A 4G6DA 5DWMA 1UHMA 3V38A 2R7FA 1PP7U 4R57A 5CBMA 1BOAA 1WZ2A 3GTGJ 1S7NA 5IT9K 3RQIA 3LSRA 1OYIA 4XPLA 2E19A 1K83J 1BIAA 2V9KA 1S7EA 1DDNA 2V8VA 3KQXA 4GFBA 5HLGA 4KLWA 1YITI 4PGHA 4ZBGA 2M34A 4K2EA 1W0TA 2IBDA 1Q2YA 1VFCA 1Z8XA 1RI7A 3LSKA 3HOZJ 1A6QA 4R87A 5DS9A 2Y9ZA 1IRZA 3JSPA 1S3ZA 3PGPA 2ZJPF 5LHHA 2L3DA 4B3XA 2CNMA 4AG9A 3RYPA 4U7DA 4A3IJ 1YTYA 4RUHA 3HOVJ 3HOTA 3H9GA 2PJ6A 3NAUA 4A5NA 3S3OA 3CUQB 1U5TB 3GIUA 5TGTA 3GUXA 4KZTA 4EFDA 3L2QA 4F6AA 1BR4A 1YJNI 4GDFA 3BCBA 3S17J 2PJ9A 4L9NA 2OZ6A 3OYNA 2BEIA 2MBFA 1I1SA 1JKOC 5LHIA 5I4MA 4CCLA 4RB1A 4EM0B 4OIOF 4PV6A 5F49A 2FS5A 2Z0ZA 2VQYA 2VKDA 3MN2A 3G3SA 1W7PA 2LVSA 4BEHB 1VTNC 4N4NB 1CGPA 2AFWA 3R6SA 4HNXB 4KOTA 4UB6C 2R7SA 4C7HA 4LB6B 1J59A 3DTKA 4RAGA 1KZHA 3OYMA 1YRNA 2HQYA 2BOAA 4O23A 4UF4A 1BC7C 4E7ZA 2VPLA 4F9UA 3R4KA 5L3EA 2CV2A 4XPDC 4J01A 2IS6A 5FB2A 3JRFA 4S05A 2ZMEC 1ZTRA 3H8EA 4JX5A 3D3SA 1EV7A 1YLOA 3PZJA 2A5YB 4BBHA 1MD0A 3P9CA 2VQCA 4P9FA 4U88A 2G9WA 4Y13A 1PP8F 2JA2A 1ZH5A 1KWMA 3HM5A 4F9VA 4RGSA 3T8TA 4EQQA 4Y4RA 4ZY0A 3OS2A 1O3RA 2ME0A 3LSTA 2ISZA 5G1ZA 1FT9A 3MEXA 1IN8A 3UY5A 4G9YA 2H1LA 5DCMB 2IGKA 1JKPC 3OSGA 2FBKA 3BG9A 1LDKB 1KU9A 2GXAA 3JRIA 3FX6A 2CMPA 3M4OJ 2GIZA 1RNLA 3HGGA 5BPIA 2JRTA 2LMDA 5JLXA 3PJRA 2WTEA 3KFWX 4DYQA 4UV8A 4CGLA 4IUSA 3SFZA 4B11A 3F23A 2ELKA 4KDPA 1DQUA 1X2NA 3L2RA 4D5CA 4A30A 2QSFX 3TE4A 1H0MA 3RKWA 1ODDA 2XAUA 1EJ9A 2WPXA 5KNLA 5CQEA 1LVAA 4KLVA 1UHWA 3CCMI 1MBGA 1QRYA 2HI3A 2UUZA 2FUG2 4L9TA 4UEFA 2X1CA 1BJAA 3HHGA 4RAFA 1IB1E 2CW8A 3BR2A 3LA7A 3OL4A 5CPRB 2CH0A 4IO9F 1HCRA 4LQ6A 1GXQA 1PYVA 4HX8A 1B87A 4MFZA 1G59A 4NGTA 4BMHA 2CQQA 3HGYA 1XOVA 4PGGA 4ZX8A 2BW3B 2PRQA 2VL8A 2ZXJA 3GF2A 4JX4A 3M1CA 4HV5A 4PJLA 1LEAA 3COAC 2CWEA 1JE8A 4LLNA 3GKRA 3SDGA 2QF7A 2EUIA 3DCFA 3CDHA 2E2IJ 1ELLP 2PIZA 1X3ZB 3F21A 3LNQA 3I4NJ 3JREA 4NNJA 1Q7LA 1LFPA 2DFHA 4HA8A 1D5VA 4TNUA 5FKKA 1IICA 2HDCA 4OMEA 2L9NA 2WB1N 3EC4A 2HVQA 2H27A 1UCRA 2CNSA 2PJ1A 3K0LA 5F08A 3BTCA 2YNCC 1PU9A 5JM6A 1I6XA 2ZMEA 2F7VA 4C2YA 1D0ZA 1IXCA 5LLQA 4IKFA 3S2HJ 4M6GA 1XX5A 4MXUA 3M07A 3MKYB 4R79A 4Q38A 5FRNA 3O2PE 4DYCA 5F47A 3HRUA 1QSMA 1T98A 4PZJA 3CC7I 1ZK8A 2IPQX 2LF7A 2DW4A 5HXDA 3T5XA 2OBPA 2GIVA 5B1BH 4O3MA 2IJZA 3C3WA 2P5VA 1J75A 2BO9A 2IQ6A 4B12A 4X8IA 3VYSB 5D6FA 3JTHA 3CCUI 4KUMA 2XGDA 2PG4A 1Z9CA 1TQIA 4R1HA 2WBMA 2K9NA 2W00A 2X1DA 4H2KA 1XN7A 1CX8A 1B9MA 5AG5A 4F55A 5GAEJ 3BR6A 3RDIA 5IYBJ 4M6VA 4M9XA 3JRCA 3FXOA 1JTYA 3BR1A 5ILVA 3IC1A 2ZB9A 4LD5A 3BC8A 8CPAA 4F0XA 2KZVA 4UB8C 3DKXA 3BJAA 4CS0B 1B8IA 5DV5A 4JOMA 3SXOA 3AG2H 2OU2A 3WR7A 3CD6I 2ZEHA 1BM9A 2V9VA 4ZTJA 1L0OC 1OLTA 5J8FA 2ARHA 1OYYA 1HDPA 2RFHA 2YNDA 4P4EA 4GRIA 4I49A 2BEOA 3DBRB 2P81A 2EZHA 4BBRJ 4C9YA 1YE9A 2UXXA 1T56A 2E60A 3A01B 3SJFA 2D4OA 1Z21A 1ZHFA 2CF4A 3WGGA 3FDYA 1P4NA 5JHUA 2VEZA 1QO0D 3MMYB 4M6YA 2MH2A 4ZJZA 1FTZA 2LY1A 1LAMA 1IXRC 2X1EA 3MD2A 3T9YA 3GEZA 2CQ7A 2K5CA 4NDLA 4A38A 5EEGA 4UFVA 2XSJC 5E18F 3UKGA 4KOWA 2Z3LA 2Q43A 5GTIC 2DN0A 2ZC2A 4G6QA 4ABZA 1OBRA 4XLFA 4M6IA 4MFKA 2PJAA 1E3OC 4KN4X 5L3DA 4FX4A 1F36A 2M7AA 3D66A 2F5IA 4A93J 1Y9KA 1O7LA 2KKOA 2VBYA 2ZCWA 2AXTC 3MZYA 3TOBA 3DR8A 4HNWB 2M87A 3G3ZA 1JT0A 5H86A 4EGYA 3QAHA 5EZGA 2DA7A 1YG2A 1HSJA 1MH4A 2ZXVA 1U0JA 3IV5A 4KORA 4YIIA 1S6LA 2J8NA 4DUKA 5FKMA 1ZELA 1HKTA 3OYCA 2LTPA 4L5EA 3R0AA 3SHFA 4FHTA 4MLOA 3HXLA 3NRVA 1FMVA 2VKVA 4Y3OA 1ZRCA 4Y52J 2HOTA 2QIRA 3TC8A 2WAFA 4A0XA 4ZYQA 3WGHA 2A4NA 1YX3A 3FYNA 2Q8KA 4KSFA 2DDAA 1SC7A 5HODA 3CTAA 5ED4A 4GXHA 4JQFA 1T08B 5HNHA 2W4SA 1K4SA 1WRJA 3FXQA 2HTSA 5C82A 4UVCA 2PJ4A 3N4MA 1P2FA 3KE2A 3G4SI 2A6EF 3EYYA 2M1BA 5IPAA 2NXNB 4KS9A 1LOKA 1IGNA 4FWUA 1CF7B 2ODFA 2LH9A 2M9HA 5GPCA 2JEWA 4BQQA 4H0EA 3HTUA 3H4QA 4A31A 2DMTA 3NH4A 4X0GA 2KPMA 5BQTA 3BXMA 3CMYA 3PB9X 4ZY2A 4D5FA 3PL8A 3FB3A 1VNDA 2B7EA 2PMZA 3FKIJ 2LYCA 3ZMSA 2VE9A 4NF1A 3PQJA 2POKA 2EZLA 2REFA 4AYBN 3CCJI 5LRSA 1TKJA 2L4MA 1YX5A 2IMOA 4L9JA 2EFPA 5IP7J 1Z05A 1LEBA 2ETHA 4RI1A 5GADJ 2HOAA 1ZLHA 3G6EI 3HKZN 2V6EA 1ZLIA 2EV0A 1IDZA 1R4NB 3EUHA 1K4JA 1FSHA 1NSAA 4ESBA 4R76A 2F5FA 2Z2SB 4HV6A 2LR8A 2QECA 2ZEMA 4QTRA 5EF6A 1FYMA 2K7LA 3I1UA 1HXDA 1S60A 2Y0SN 4UNOA 3N7ZA 1R3NA 2GAUA 4L0ZB 3GBGA 2WY7Q 2AFUA 2LDUA 3F0AA 5GAHJ 3L2UA 2C6CA 2P6SA 2IS4A 4YRVA 3GTKJ 1XCBA 2HTJA 5DYMA 2IXSA 1YK3A 1MH3A 2EB7A 2YX7A 3QU3A 2VLAA 2EVNA 1RESA 4XLPF 3AFHA 4JZ0A 1ZG1A 5KTDA 4HG2A 1HBXG 2L9VA 4CGMA 4DYOA 5E3LA 5AG4A 5J8CA 1I50J 1QVUA 3M1EA 1YQAA 4JLYA 2QQ9A 3T8WA 2GZWA 1XD7A 2XAHA 1HEEA 1Y9WA 3TOAA 4RAYA 5HLIA 3HUVA 1MGTA 2VQGA 4XKWA 4ANJA 2F2EA 2ICWG 2E1MC 1GV5A 2W84A 3DSBA 3Q0WA 3W2AA 4BXUA 5KAIC 2LD5A 4XLHA 3SFIA 4ZI6A 4P96A 4B10A 4G94A 3KKWA 3K4KA 3ZXSA 4MCSA 2O9LA 2J5OA 2QEXI 3KP2A 3DFGA 1CBXA 3S6KA 2RAEA 3QODA 3ERED 2O8KA 3G1MA 2ZSIB 2ZO4A 4EJTA 5B5EC 1R58A 4BBSJ 3CT9A 4ZYEA 3Q0UA 1S5LC 3ECHA 2V1DA 2NRAC 2PDOA 4HNYB 1EKEA 3ABUA 3LWFA 4M72A 4ZC3A 3PB4X 5HNFA 5HLTA 3OYIA 1HC8A 3GTJJ 2JPCA 1HW2A 3LSGA 2V8GA 2KIMA 1RETA 4WXCA 4S0HB 3CO6C 2CNTA 2FIAA 3FXLA 3TT2A 2Z3NA 3HRTA 2A07F 3VSLA 2BYVE 2QGUA 5IP6A 1KQ8A 1JGSA 5EEHA 5TRDA 1QSRA 2O28A 4UA3A 5D5XB 3I3LA 5K8MA 5K5RA 2CQNA 2O0YA 4ZYGA 1JWQA 2CUJA 3B8GA 3CMMA 2EK8A 2KRCA 5DEQA 4U0VA 1FTTA 1DTDA 3ZP5A 3G71I 1TW2A 4C3IJ 4UEZA 1ZG9A 5ISVA 2XAFA 4FBEA 3LD2A 4NJRA 2QA4I 1WPKA 4LX9A 1G3YA 2OH1A 1HDUA 2ID6A 2QCOA 1TIQA 3DBHB 4R3KA 4LK1F 1QVTA 2XKOA 4K3NA 1JUSA 3AG1H 3S1RJ 1R1VA 1WHUA 4DYRA 2KL4A 2RVCA 3F72A 3TL4X 3RCOA 2CV1A 4P4JA 2DA1A 3K4LA 5A28A 3S3MA 4P6YA 5DS0A 5LYFA 4RM3A 2ZSHB 4XNHC 5F1JA 2MW8A 2JSCA 2Q0YA 1YYVA 4IHVA 1ZRDA 2VE8A 3BLNA 5G21A 4CRYB 3MZ8A 1UFHA 3KGQA 4E6KG 3FXKA 3I64A 3LMMA 2O61A 4EJOA 4E7HA 2OZUA 1H8LA 1R5HA 2MA3A 3ZMUA 4AG7A 1Z1DA 2XASA 2OC6A 2VJ4A 1CQTA 2CXAA 4YG2F 3T8RA 2ZEOA 3BG6A 3OSFA 1S3JA 1U2WA 2FD5A 1VQOI 4JXRA 1R5GA 2L02A 3ZRGA 3TKYA 2NYXA 1I39A 2MGQA 4N4OB 2Y31A 5H6RA 4A37A 3CMEI 1APLC 1A2ZA 2QUFA 1POGA 3QOEA 1IU8A 1ZG3A 3FK7A 1FC3A 4F8ZA 5EG0A 3OYGA 3S93A 3VATA 4MO7A 3CQZJ 4FTHA 1SMTA 1ZREA 3LMSA 2R7VA 3GTMJ 3LFKA 4I7HA 4OIPF 4IPAA 2NS0A 2RN7A 3ZMDA 4BL0B 2PJPA 1R6RA 2ZJ2A 2XGEA 2VI7A 2XPWA 4A12A 2B63J 2XEIA 4KITB 3QYFA 3S2WA 2AQFA 2VBXA 2BHYA 4M3SA 2F4IA 3WTVC 1ON1A 1Z77A 1WI3A 4XOTA 4P4BA 1LFUP 2WAEA 1VF9A 1M4GA 1EH8A 2KMUA 4F3QA 2OZGA 1MSFC 2CYYA 2Z10A 1QHGA 4ENJA 3HOUJ 3DKYA 4MY0A 3G2BA 4RB2C 4P4FA 3DKWA 1J0RA 1RR8C 2RV8A 4II2A 4F0YA 2JDDA 1A36A 3CUQA 3P7NA 3FH4A 3K6GA 1VQ9I 4OC4A 2YGWA 3KQZA 2F4MB 1X58A 2YPRA 1YIJI 1OISA 4ESJA 2VIXA 1K78B 4H6UA 2EPFA 2ZEPA 1F5TA 2OA4A 3R0JA 4BXFA 4YIFA 2E1MB 4U0WA 4EWTA 5H2FC 2QZ8A 4NC6A 2HKXA 4OWRB 3ZN1A 2P7VB 4MRIA 1W0UA 2W7NA 3SQNA 3I9V2 2VONA 5ICFA 4CGZA 4L5JA 2CFXA 2CIJA 1FNNA 3WHBA 4RB0A 1U9OA 1BOBA 1ARMA 1OCOH 2LLKA 1W7PD 4M3EA 1R57A 4NFRA 3GZ6A 2PVVA 1N71A 2DU9A 3PNVA 5CKTA 2Z9OA 4WXHA 3PM1A 1XB4A 2DO7A 4OMZA 2PJBA 2H1KA 2Y69H 3DU6A 3L2WA 2CSOA 2I79A 2DOEA 2E35A 2IA1A 4FT8A 2WUUA 2MD0A 2AFSA 1SANA 2HNHA 3GMEA 1XCVA 2PR8A 5E3NA 4HQEA 1T0FC 5AG7A 1QPMA 2VB6A 2EA4A 2X9DA 3PB8X 2X85A 3TFYA 1Z7LA 3FISA 4LB5A 3BOQA 1NK3P 3D8PA 1YREA 2WZNA 4WF2A 1HF0A 3FIWA 2OB0A 1OR7A 4BDYA 3D5SC 4V2GA 3KP7A 3HOYJ 2KISA 2CW7A 1SMYF 2VC0A 3QWLA 3HSRA 1FNOA 4LQGA 2PN6A 1MNEA 4C7IA 1Y8QB 1TWGJ 2EA2A 3KYDB 3WHCA 2ZW7A 4KMUX 1PYTB 3GZNB 1Y7EA 1ACIA 1IRGA 2IT0A 4JBAA 3OS0A 1BI0A 4D0PA 1ZGJA 2M3AA 2KDZA 1P4AA 4FE7A 3HKZA 4P9UA 1ZYRF 2QQ8A 3K2ZA 1FPQA 5IB0A 1R36A 3TW6A 1DUXC 3GZ5A 3I4PA 1DE4C 1Y0YA 2IRFG 5FRMA 2PJ7A 3VFZA 1W5CC 3IUOA 2BBYA 2DDBA 1EE3P 1BPMA 3C18A 2STWA 2BY0A 4RLQA 2KIFA 3C1DA 1XMBA 4XLCA 4JJXA 5IOZA 1JHHA 3MVPA 1T39A 4QSHA 3CJQB 3FHZA 1A5JA 3ZCOA 4IOAF 5FD6A 2EJRA 3H36A 1BC8C 5E79C 1O4XA 4OAYA 2HOEA 1TKHA 5E96A 3BWGA 4OU0A 3L2NA 3FHNA 2A69F 2DTRA 4PJNA 3X2QH 4O6JA 4II9A 1CPSA 2PQ8A 3OOPA 5IY5H 2DPSA 4PXBA 3PP9A 3JRGA 4YWYA 5JLWA 5AIQA 4AM3A 4A0YA 2X7BA 4NGMA 3AG4H 2QJ8A 4CCMA 1YGHA 4PJMA 1FP1D 4MTEA 1IYLA 1WWXA 3S15J 2LKPA 2DA3A 4HAMA 3PO3J 4I01A 5DCFA 2K02A 1RKWA 3S16J 5A27A 2GA2A 3HJEA 5CJ9A 1MNMC 4XNFA 1S7AA 3HSFA 2D1VA 2DQRA 2I5UA 3P5JA 3AAFA 5FKLA 4HNTA 1QQ9A 1AA7A 1SFXA 3ZMTA 5ICEA 1FOXA 3H1CA 5LGUA 3K1MA 1FBQA 1QSTA 2F4OB 3Q9VA 1HKQA 1G2HA 1MBJA 2RQPA 4M3DA 3MKLA 4AXVA 4UIBA 2W1OA 2YNCA 2STTA 3HL2A 1QNTA 3BR0A 3D4UA 3IH2A 2XRLA 5FGMA 6PAXA 4ZX9A 1I1DA 2Q1ZB 2DF5A 4E2AA 1VHSA 4KVME 1YW4A 4OIDA 5J47A 3IKTA 2EH3A 3B3TA 3KPHA 5HS9A 2ABZA 5JPHA 4CGOA 4AIDA 2WADA 4MCQA 5J4YA 3GB0A 4A6DA 1WGXA 2A61A 3I9SA 2ZNYA 1WJDA 2NS7A 1D1AA 4E7LA 4HF1A 5F48A 1U3EM 2JBJA 1MMNA 1JUMA 3V8KA 1QGPA 3MKZA 1S8NA 4FAIA 4CRZB 2K85A 4LUAA 5FKOA 2B58A 1IDYA 2E36A 3ZMVA 4XICA 1LPQA 1JQGA 5IT3A 2HV2A 3ZZIA 4IF4A 4KT6A 5CLSA 3U21A 3JAMZ 5F1RA 4OIQF 4M85A 4HDVA 5K5QA 2CQKA 1AHDP 4CZCA 4YGOA 3Q0VA 2ZJQF 1K6OA 5HVGA 1YMEA 1Z8WA 1P7IA 3FRMA 3WT4A 4P1WA 4C3JJ 1IO2A 3IH3A 2W57A 2JA8J 3GUDA 4PUSA 2IL4A 3SZTA 4S04A 3WE3A 5LGNA 3KX2A 1VQ4I 3GCMA 1U6MA 2ZOGA 2W82A 5D6EA 3B2YA 4AUXA 3EFAA 3PRTA 2M2EA 3C2BA 4ZYDA 3OR2C 1WH7A 1X19A 4E7SA 1QZZA 4GXOA 1IRFA 4MFLA 5FVJA 4DBRA 3I59B 1VHOA 3RKYA 3HOXJ 1TW3A 3SXYA 3QOPA 1LE8A 3D0SA 4I02A 1V5FA 2LREA 5M5YJ 4I0BA 3GFIA 3S1NJ 4M3BA 4EVIA 1TZLA 5K8PA 3TDZC 2EWBA 1F57A 3DTEA 2QBYA 4B3AA 3GTPJ 5G22A 2PE3A 2BHZA 2HQRA 1JJ8C 1Q1VA 4KUBA 3ZQFA 4A3FJ 1ZR4A 4KYWA 5IT9Z 3IO1A 2EFOA 1LUJB 1MW7A 4P55A 5FFXA 2K86A 3QQAA 1M1DA 3LA3A 4WXDA 4E8OA 4FASD 3FBUA 3CLOA 3H9JA 1ULYA 3HPGA 3CCLI 3CCVI 3B3VA 5BWAB 1G6NA 5EG0B 2XUBA 3PUFA 5F0HA 3KETA 3SI0A 1H89C 4FCYA 5K8OA 3IAM2 3IWFA 2GLJA 3I55I 4H4KC 3JUWA 4B8XA 1T95A 4MEXF 2M30A 3CDIA 3I5UA 2R7ZJ 1LDJA 1T0FA 5GPAA 1ETWA 3OYAA 1Q1HA 1Y0RA 3VYTB 3GTQJ 3S8PA 2WB1A 1SAUA 4HSTA 5F04A 5J1YA 3S3NA 1YRNB 1WJBA 3N5FA 4OC0A 3BDDA 3AG3H 3OYKA 2XGCA 4IXAA 5FFZA 4AD9A 4HF0A 2DT7B 4BACA 3HHHA 4JXQA 4L8AA 2JVGA 2RQQA 2WY8Q 1A6IA 2ME6A 5K7FA 4OP4A 4OC3A 1SFKA 1U8RA 2G0BA 2F5VA 4GYIA 4LLLA 4UFWA 1QZYA 4CXFA 3DPUA 3O8GA 4Y15A 5D8LB 4NC8A 4C2MJ 2QBYB 2Q2EB 3EUKL 1VQNI 2ZJRF 3IH4A 1TQMA 2X6WA 4NJQA 2GBYA 3QYEA 1WFXA 2P4WA 2ATRA 2HUZA 3D2PA 3IJ3A 5IYDJ 3GYHX 2RNJA 1WCMJ 4FD4A 2L54A 2C27A 4BE2A 4PSXA 4IHMA 3R9EA 1FIAA 2K9QA 4KT5C 1CJWA 5LFAA 1FP2A 3SJXA 5JI6A 4OAZA 5CVUA 5THWA 1NK2P 2WPWA 2NVQJ 3VOEA 3KCCA 3ZQCA 1XG1A 3Q3SA 1L3LA 3M8EA 3MFKA 5E3MA 3TEDA 4CICA 3K70D 2VKHA 2DMUA 2PMHA 4HYEA 4NGSA 4B6ZA 1XDSA 3B02A 3WG9A 4AIHA 4HPQA 3S2DJ 3M8JA 4D9JA 1KONA 2UV1A 3IRQA 1GV2A 5DM7F 4NGRA 2MLKA 1KA8A 3DNSA 1VZ0A 3KASA 1QZEA 1Y8RB 2K40A 4I98B 5HMNA 1OCRH 4XIDA 1CP6A 2Y48A 3EDPA 1ETKA 5F0FA 2G0EA 4P5OA 4LIUA 2RGVA 1H9TA 1AU7A 1IIDA 1DGRM 2CFOA 2NVYJ 3V7RA 2ZFWA 1RUNA 1W1WE 3T90A 2DCEA 1P4WA 2Z16A 1K61A 1C0WA 1SD6A 2JT1A 1BA5A 2OQGA 1UELB 4JD6A 2R7WA 3HUGA 3QPTA 4YELA 2XHKA 1VQ6I 3SYTA 3JAMK 1XMXA 2BXYA 1B59A 4XSXF 1EH7A 4AVAA 5KVRA 1OFCX 3K70C 3KHXA 3TW7A 5KTAA 4BD9A 4D7NA 1ZRFA 1XE4A 2Q4VA 4XPDB 4N9IA 4CYCB 3WU2C 5KAFC 3KYLA 3CXSA 5HH1A 3WTZA 2VI6A 1TWFJ 1DP3A 1AMPA 4ZDOA 3CPXA 3FMRA 2K3PA 2K9LA 1FOKA 3S32A 1M4LA 3QB8A 2JA5J 2R7HA 2CO5A 2HYFA 3VWEA 3ONQA 2V26A 1AOYA 2JZYA 1MBKA 4BS9A 3H5AA 1W5SA 2BSWA 5CPAA 5FLXZ 2VBZA 2Q4ZA 5HLHA 4HQMA 2WV1A 4B43A 3QPHA 2FVGA 3BZCA 3NQOA 2Z11A 2KHMA 2JA6J 4IRHA 2FNAA 1EF4A 5K5OA 3M3YJ 3IU2A 4YFXF 5E1WA 4RDUA 3HTSB 3H9QA 2Z3KA 3F8KA 3W91A 2V1XA 3JTKA 1IN5A 1YW9A 2B4DB 3OV8A 3KP5A 2J8RA 3PB7X 4I99C 4AC0A 3L1PA 2E1CA 1XIXA 4KOUA 1X1PA 4H6ZA 2Q4YA 3UR3C 2HYJA 1Y6IA 3CC2I 4P4IA 2QLZA 2EFNA 2R3SA 3KI9A 2KFDA 1NHAA 3C2HA 3J81K 1D3YA 3V4GA 1MDMA 1M4IA 2K27A 2NNNA 3RZOJ 1J4JA 4J00A 4W97A 4EV0A 3OIOA 1ETOA 2HC9A 4Y49C 3VH9A 4FQGA 1LDDA 5J40A 2B5GA 2VODA 4RMNA 1ZG8A 1P4XA 2HDDA 3SXNA 3S6GA 2XV4S 1YVOA 1W5TA 4XMYA 3WU0A 4WWVA 2LOOA 5LRKA 4PXDA 5AG6A 3D5RC 3W6SA 4C2UA 5AIPA 3PSFA 4NQWA 3D67A 4CAEA 4CZZA 3P2FA 5F46A 2AS5F 1NTCA 4M73A 3ESWB 1G4DA 5E3OA 2HKOA 2W85A 2NAZA 4FISA 2FQ3A 3RIRA 4UUSA 2ZW6A 3FM3A 4PK2A 1Z9UA 4UCPA 4BHCA 1XEBA 4CAFA 5BOXA 3K4JA 2XB5A 2R7UA 2XC7A 3WTYC 1ENHA 1R43A 1BR1A 2DXQA 2ZEGA 2L01A 2L7KA 2OF7A 5CVJA 1I3AA 2DBBA 2QKMB 5BMZA 3MQ0A 3W6JB 1VIXA 3H3VK 1BPNA 1IV8A 1ZLJA 1LNWA 2VQHA 4HW0A 3FZVA 1Z4RA 3BHXA 1T8IA 2RDPA 3NE7A 4Y49B 1R23A 1XS9A 2R5YB 2HXIA 1MIJA 2KJCA 2OZHA 1VQ8I 2R7QA 1QHHD 2ACJA 5C4JJ 1E17A 2HS5A 2KLOA 3KYCB 4DZPA 1Y1WJ 3QYBA 4A3CJ 5C88A 5M5XJ 4RS2A 3OS1A 2OD5A 2LKXA 2OOTA 2YR2A 4AVBA 1FSEA 4Q7AA 2HR3A 3FF5A 2V1UA 2PJRB 1TNTA 3TP3A 5FJ8J 1UAAA 1IY7A 5LBQA 4ZTFA 3GLLA 2ZBKA 3OWTA 2FE7A 1XGMA 4PPZA 1QPIA 1V5EA 2K4BA 1YQEA 1WI9A 4UIAA 3ROUA 3CCSI 1MBFA 2YUSA 3R61A 2DLLA 4JYKA 3ASOH 3E3VA 1B72B 4LK0F 4U7BA 3WG7H 3MCZA 2P6FA 5LYLA 1J5YA 1WVRA 3K9TA 3WGIA 1FLIA 2M4GA 5D4SA 2AFMA 3NWSA 5F27A 4CCOA 1NH3A 2GU2A 4QB9A 4KOSA 3F3XA 1K7AA 5J1RA 4HLXA 4CHUA 3BI1A 2CUEA 5LYIA 4KJZA 1UWYA 2FSRA 3FJUA 1X1CA 3J80Z 3A02A 5D4RA 4CAXA 4U9YA 3D7GA 3D7DA 3RO0A 4U0YA 1ETVA 2IGNA 4FE4A 1I5ZA 4OINF 2BVMA 1R00A 1D0YA 3SZGA 1XMTA 4KIGA 1OCCH 2JEVA 4IAVA 4PK4A 5LRGA 3JTGA 1KU7A 5EYRA 2PVWA 1WH5A 4P45A 1BI2A 1WQ2A 1K78A 5K1YA 5JR3A 4QIWN 4R9MA 2QYOA 3RPUA 1TC3C 3WTWC 3E0KA 1MNDA 2Z5UA 4E70A 2KRHA 2COBA 3FXJA 3KZZA 3LA2A 4I6ZA 4R6TA 2ID3A 2M5WA 3F8NA 2TRTA 4HNVA 1YIOA 4NQWB 4XM3A 1IF1A 3L2VA 3N05A 4C2ZA 4B13A 4A6EA 1OPCA 3N97A 4ORFA 4UUSB 4JX6A 1JJ6C 2YU3A 1FMWA 3PUBA 5LHGA 1REPC 2F5EA 3F8CA 2PCUA 1G3TA 3JRBA 2EK9A 4MFEA 4XN0A 2TCTA 1IW7F 3GYAA 4AYBA 4AB7A 3EPZA 4G12A 3B3CA 4YFNF 3O6BB 1OZPA 3VYUB 3BTJA 3BQZA 1T2KA 3W6VA 4UY8I 3C7JA 4MQVA 4XNHB 3J81Z 1V4RA 3BLYA 3AL0B 4MHDA 3K2KA 4ONUA 2KT0A 4QUSA 1LQ1A 2FCKA 2FIWA 5LRRA 1O3QA 2GA1A 1IZ1A 1R1UA 1SD4A 3H0DA 2Y75A 1IN4A 1S72I 1XC5A 3GFMA 1WKMA 2HZDA 3BCAA 3I0TA 3LL7A 4G7HF 1Z3XA 2B4DA 4CCNA 5CQGA 2XRNA 1B72A 2JLMA 1OMIA 3G1LA 1JI8A 1Z91A 2AXLA 1VQPI 1F2PA 3TO7A 1F9NA 2ECBA 5E1ZB 5HOOA 2L0KA 1LFWA 3CXPA 1TWCJ 1U6GA 3E5XA 4OIRF 5E8IA 1Z5RA 3IKVA 5D8NA 4IOCF 2LRDA 3DLAA 3S1MJ 5LD2C 1QMUA 2GOMA 3E1SA 1HDQA 1TT0A 4XRMA 2L2OA 2FRHA 4IHTA 3B6AA 3DR6A 2L4AA 2PJ0A 4MHPA 2WAQA 3BY6A 2KZGA 4GO1A 4BJ6C 1XRYA 5JFRA 2Q04A 2R5ZA 4B5PA 1IN7A 1X4PA 1MK4A 4Z2YA 1XFOA 5E20A 3MAJA 1LKXA 4II3A 4L0YB 3EQLF 5IYCJ 4A3MJ 3H8GA 1V0CA 1OKRA 2K4JA 2XKPA 2BV6A 3HRMA 4RAZA 4FETA 2MLGA 2Q44A 2ZW4A 2LG4A 1D1BA 4UUTA 3K4CA 1PDNC 1Z67A 4A3JJ 4L89A 2LC2A 1XSVA 4CO8A 2D4PA 1B6AA 3VODA 2Z33A 3L9FA 4G8XA 2FA5A 1Y0UA 2PJ2A 3VEPA 4A5MA 4U9ZA 4IQJA 4CYPA 2QSGX 3O8HA 1Z4EA 4OC2A 2P6GA 4IEJA 3PNYA 4NUBA 1YO5C 1SFUA 3D1NI 3PFYA 1GHCA 3EXNA 4MCPA 3R9FA 2OCCH 2V77A 3IAS2 4B4CA 4EATA 2G3TA 2PJ5A 1VQMI 1P6RA 1KGSA 1Y0NA 2CQXA 2F8HA 2JDCA 5DUKA 1R22A 2ZEFA 5J1QA 4ZH4F 4ZDPA 2PMZN 3RNZA 2DQLA 1YLEA 2KQRA 5JVGF 3DEWA 1BJZA 7CPAA 3O3KA 2EV6A 4F52A 3I4MJ 3IU1A 4AWXB 1RKTA 3CMAI 1YOVB 4AVZA 3DV8A 4F7ZA 4FD7A 4FD6A 4C3HJ 4A3BJ 4OC5A 5IP9J 4A94A 2AFZA 1JHFA 2JRMA 4ZZLA 4X6AJ 5EC4A 2RKHA 1X2MA 3Q9SA 4QPQA 2M0MA 3HBLA 2DA6A 4NGPA 4IRGA 4BGDA 3A4CA 3QP6A 1XF8A 2DTZA 4GS4A 3IRRA 4MFQA 3PIOF 1SD5A 2XVCA 2J9AA 3QPSA 4M3GA 1ZLKA 3PNTA 4B14A 3CLQA 5F0CA 3JRDA 2JUCA 4BNCA 1X12A 2H6BA 2E34A 2VT3A 1VQ5I 1B4AA 2P8TA 3IEHA 4IJAA 2P0WA 1SVLA 2JVHA 1YR0A 1N75A 4IL6C 3WE2A 5HVFA 4MFPA 4JP0A 1YS6A 3BR5A 1ZG7A 3R1KA 2H09A 2VBWA 3E6MA 2ISYA 1USSA 2DI3A 2DA4A 3K1NA 1UMQA 4TV7A 3L00A 2IA0A 2FSWA 3IGRA 2TDXA 5HVQC 2VXKA 2XF5A 3E6DA 2NMTA 5F09A 3A0HC 4JK1X 2UWMA 2KRFA 3VWBA 1W36C 3BG3A 4EGZA 1YHQI 2PIYA 2XIGA 2KDOA 3PFIA 3H8FA 4KVXA 2HZTA 5JQ4A 5KK1A 5D5WB 4U5YA 4LG0A 4BKXA 3ZN0A 2PJ3A 3G1OA 4UV9A 2ZPAA 3U2RA 1E3HA 1DPUA 5B66C 3L7WA 3KP4A 4IK2A 4Z6YA 2YNEA 3IP4B 4G6TB 3BPXA 2EIMH 3E97A 3WC6A 4WK8F 3V8JA 1Z6TA 2Y9YA 3VSKA 4C30A 1TXRA 4ZDLA 1W4MA 5ELYA 4A33A 4M9SA 2PFBA 2E7WA 4ITVA 3P9IA 2GOXB 1KU2A 3K1PA 3V7CA 1ZR2A 1XMKA 2EFQA 2KJBA 4BQAA 4J3GA 3RPQA 4KMFA 1TTYA 4MHZA 2L7MP 3S14J 3BTIA 4Q4ZF 1HOMA 3KZWA 1TWHJ 2JMWA 3DLJA 1J09A 5M5WJ 1I6HJ 1X1DA 4GYGA 4L18B 4Q5SF 2UXNA 2Y0MA 1IUFA 2D5VA 1ETXA 3E5QA 5K7HA 1VGYA 3FM5A 2LBFB 1IOFA 1NMTA 1PUAA 4XSZF 3EETA 4F93B 3TCVA 1LE8B 1JKQC 3K4BA 4E0AA 3F22A 3F0CA 2XAQA 1AKHA 4KUAA 3SHPA 3MWMA 5LYDA 4CSWA 1V54H 3F8MA 2B0LA 2C6PA 2OQRA 3BQYA 1USTA 2KIQA 3HOSA 2WAQN 1P7JA 2BY2A 4WWCA 5LEJA 4RGXA 2FX0A 1G8XA 2MSYA 2P5LC 2NVUB 2L5QA 3FEDA 3HRSA 2EINH 4XN3A 2ELJA 2MABA 2VQLA 4ENMA 1DP7P 4QC6A 2ECCA 2DMPA 1E0EA 1CG2A 1ZG5A 1Z2LA 2JJ7A 2LP0A 3B6CA 3UNGC 2QYVA 4MI4A 1X1AA 2Z3MA 3BJ7A 4UEEA 2BOLA 2Q2EA 3OL3A 2R1IA 4PK3A 2NNYA 3FBNB 4XORA 4EVYA 3GFJA 1D1CA 4EMSA 2CS3A 1MBEA 3B35A 3SEZA 1IN6A 3DLLF 1D8KA 2E7XA 3BG5A 1GYTA 1RO5A 3QP5A 1TF8A 2MFZA 3CF5F 2MC3A 1CF7A 5H6QA 3IFEA 3CESA 5LEKA 1GVJA 3WODF 4HZFA 4V19K 1GHEA 5EGOB 4A3LJ 3ABMH 1AYEA 2VL1A 4IX7A 4N9HA 1DPRA 4LG3A 3NWTA 1VQKI 1ERDA 2ESHA 3FWEA 3JW4A 3CCYA 3NE8A 1O57A 3BJ6A 4BJ5C 1TL8A 3F6VA 4XL9A 2QQBA 2L9SA 3HZJA 2A05A 3KLOA 5HDGA 2DK5A 3IHUA 2LKSA 1V3FA 1UHSA 5EZHA 3GO5A 2R5YA 4LG0B 2EFWA 1XDUA 2ESNA 2XF7A 5A2QZ 5KCMA 4ASNA 3OIQA 4P10A 4B5PB 3GY9A 2JTVA 1BLLE 3FNCA 4M3FA 3A01A 4B1RA 4CPAA 3FKJA 3OYBA 2CGPA 1H9GA 5GAGJ 4XBFA 5LGTA 4OOIA 1U8BA 1KYWA 2VXDA 2XEGA 2W48A 3V8LA 4QLCU 4I09A 2HGCA 2HEOA 3QU6A 3B3SA 4MHNA 4BHBA 3KZIC 1SEUA 2F5DA 2HQAA 5J4VA 1LJ9A 3WTUC 3SI2A 2Z3PA 3ZQLA 2QENA 5C3EJ 2B9SA 3GTOJ 3DPLC 4CUGA 4BDZA 4PSWA 4EM2A 1BL0A 3I59A 3C2GA 2AO9A 2DFFA 5A2QK 2FJ1A 1WWZA 3B73A 5J3LA 3CPAA 1RIOH 5DUIA 1F1ZA 2HB6A 1P0HA 4D7MA 2FL4A 3LWUA 4XONA 2A68F 2MD5A 3G73A 4G7ZF 2VOOA 1RZ4A 2M0CA 1M44A 1VKCA 1XPXA 2OJED 3ELKA 2FU4A 4ZZDA 2OUMA 5HS7A 4B48A 5DWNA 1NG6A 4NSQA 5EMIA 4CGNA 3VWDA 3LSPA 2A6HF 2HVSA 2N8GA 4DJLA 1VI0A 1W36D 4F92B 2HDWA 4LFUA 5F64A 4M6HA 4BUPA 5FO5A 4AVCA 1R71A 3MN8A 3HOWJ 2EBJA 2M45A 2DJNA 2OV7A 3FXUA 3W2WA 1IC8A 3DDDA 3S9MA 2ZELA 3KEOA 1OCZH 2AFXA 2QVPA 2LNBA 4XKCA 3V42A 3MRUA 4B5OA 1J7KA 4GCVA 3DWLE 1BR2A 1ZO0A 3D7HA 5JHFA 2O8XA 1Q2CA 3FEEA 4KVOE 1PJRA 3DEUA 4B44A 2DA2A 3HC7A 2CJJA 2XSDC 2JUGA 3EUHC 5FLVA 3LOCA 4KISA 2X48A 2JPBA 1WSUA 4A0ZA 5LRJA 2IAIA 5M3MJ 2ELHA 3DF8A 5H20A 4HLYA 2IGOA 3IWWA 3KZYA 3FXRA 4L5IA 1LCPA 3KEYA 3PFEA 4OC1A 2C6GA 3E6CC 3PBBA 1PUFB 1KUXA 2EIJH 4M6XA 1KU3A 1WJFA 1XMAA 5E1XA 2B3UA 4NB5A 3VYRB 3ISZA 3P2HA 5L3CA 4YFJA 1FX7A 2O4HA 2XROA 4AU7A 1UJ8A 4CYCA 3EYIA 2V6CA 1XGOA 3OYFA 2FMLA 3GLXA 3PBEA 4Z65A 4EMEA 2V8DA 2WC2A 2E2HJ 3D2MA 1F4KA 1ON2A 2HU9A 1PUFA 3KP3A 3KR5A 1MSEC 2L7ZA 2GM4A 2Z3YA 4G7OF 3A2KA 1YLFA 4UHTA 1FZPB 2R8VA 1GLNA 2YS9A 2XPVA 3D5LA 2ZXHA 4HOBA 1HA8A 2ZMEB 3LSMA 4KOVA 3CZXA 6CPAA 1I27A 4C2TA 4OLLA 2NOJB 1E3PA 2E5NA 2NVTJ 4BY7J 1DU6A 4DZJA 4R8HA 3OR1C 3LQQA 3FK6A 3K9UA 2GFQA 2DPTA 3FIXA 1JXSA 3FMSA 5K7ZA 5FKNA 3VARA 3HB9A 3T1BA 1H88C 2JBKA 3H3ZA 4UCMA 3CUOA 3CJRB 4BQOA 1DGWY 3BT9A 3TX8A 5CVIA 2JA7J 3IWGA 4LITA 4YEJA 3CDLA 3JSOA 3CCEI 3CP8A 1BO4A 1FT7A 2WSAA 4FX0A 3NA6A 1A04A 4NEXA 4CYQA 1M1EB 3IL2A 4PFPA 4MTDA 3RAMA 2FE3A 3DBLB 3SZPA 1KYZA 2HFHA 3W2VA 3ZQQA 5FLMJ 3OYHA 1CP7A 1GVDA 3ULQB 3OYEA 4UVAA 2Z99A 1JGGA 3ABTA 4P44A 1U5TC 4LOCA 1N25A 3F9KA 3RPUD 1N77A 2EWNA 2YU9J 1HW5A 2HPIA 1RRJA 1YJ9I 5F6FA 2GREA 1XTAA 4IHXA 3H5NA 3RZAA 4ZYHA 3ZR8X 1X3WB 2Q0OA 2Q7SA 1BI1A 2BY1A 4R8FA 3RYRA 1MJAA 1RXTA 1NG7A 1QU3A 2FBHA 4RM2A 3DGVA 1VQLI 1MMSA 2XEJA 3LQRA 2AE6A 4R7MA 1RC9A 2X0LA 1KQ9A 3CP2A 2DFEA 2GANA 4YRHA 4MHGA 2VN2A 3J80K 3TO9A 2COMA 2EO8A 2W24A 3D68A 2DEAA 2WWYA 5FD5A 1FY7A 4L9VA 1I1GA 3E6BA 1HDDC 2JK3A 2I00A 3A1YA 3TMOA 2EIKH 5TISC 1ETYA 3ASNH 3U9GA 4BQNA 4H89A 2F5CA 3OYLA 4ETSA 4QBJA 2C1CA 3BI0A 4RGRA 1R1TA 2H94A 1JKRC 4UBRA 1TBXA 2XB0X 1LFBA 3ZMZA 2VKEA 3PSIA 3GVAA 1A35A 3CO7C 3I3GA 4E7KA 3OWCA 2H8WA 4WX9A 3SJGA 2JN6A 2ZNZA 1Y7RA 1OR7C 1Z6RA 4A69C 2VUMJ 5K8NA 4X3RA 3K2AA 1SVOA
chains in the Genus database with same CATH topology
1KZFA 4CCLA 3KKWA 4NQWB 5KTCA 4PV6A 4XM3A 1QSOA 3L2VA 5F49A 3N05A 2I79A 3DU6A 3L2WA 2AJ6A 2FS5A 4B13A 2Z0ZA 4C2ZA 2FT0A 1LRZA 2VQYA 2VKDA 1X1BA 3A9LA 3G3SA 3JVNA 1QSNA 2IGMA 1FMWA 2MD0A 4N4NB 4BEHB 2WUUA 3PUBA 2HNHA 1B6BA 2R7SA 4HNXB 4KOTA 4C7HA 2PR8A 3ZJ0A 3DTKA 1T0FC 4XN0A 3OYMA 2VB6A 5AG7A 2HQYA 4BU2A 2X85A 3TFYA 2XDVA 1Z7LA 3GYAA 4NCZA 4AYBA 3D8PA 3EPZA 4AB7A 4E7ZA 1YREA 2VPLA 2OB0A 1OZPA 4BDYA 3VYUB 2CV2A 3D5SC 4XPDC 5A28A 2BW3A 4J01A 2IS6A 2VZYA 2CW7A 2RREA 4XNHB 4MHDA 3BLYA 3AL0B 4ONUA 3D3SA 4QUSA 2FCKA 2FIWA 1MNEA 3PZJA 4BBHA 4C7IA 2Z3OA 2ZW7A 2VQCA 3H0DA 2JA2A 4KSAA 3F5BA 4NC7A 4Y4RA 3OS2A 3FXTA 3OS0A 3HUGB 2M3AA 2Z1DA 2HZDA 3BCAA 3HKZA 3LL7A 2QKLB 1Z3XA 2B4DA 4CCNA 2GE3A 5CQGA 5AG6A 5G1ZA 3UY5A 5GCNA 2JLMA 2IGKA 5IB0A 1JI8A 2M4KA 1LDKB 3TO7A 5KHDA 5HOOA 3CXPA 2CMPA 3DEEA 3OYJA 5FRMA 4LIVA 2LRDA 2DJIA 3DLAA 3IUOA 3PJRA 5LD2C 3VDXA 2GOMA 1MMGA 3E1SA 4IUSA 1TT0A 4B11A 2L2OA 4QPOA 2K9MA 1DQUA 3L2RA 3DTIA 3DR6A 4RLQA 3H5ZA 2WAQA 4XLCA 4JJXA 4A30A 1YVKA 3TE4A 4BJ6C 4PFOA 3SDBA 1Q2DA 2XAUA 2WPXA 4HSRA 5KNLA 3CJQB 5CQEA 2Q04A 3ZCOA 4KLVA 4B5PA 4CAVA 1X4PA 2UUZA 2FUG2 1MK4A 2X1CA 1LKXA 2CW8A 4II3A 5CPRB 3OL4A 4OAYA 2CH0A 1IB1E 1V0CA 5E96A 1PYVA 1B87A 4MFZA 4BMHA 1G59A 2VBQA 5G20A 4UCNA 3FHNA 4FETA 2Q44A 2BW3B 4PJNA 2ZW4A 2LG4A 1D1BA 4II9A 3K4CA 2VL8A 2H5MA 2DPSA 2PQ8A 3M1CA 4PJLA 3PP9A 3GKRA 4L89A 2LC2A 2X7BA 2EUIA 2D4PA 4CCMA 1YGHA 4PJMA 4U9ZA 4CA0A 4IQJA 1IYLA 4NNJA 4CYPA 1LFPA 3MKWB 1Z4EA 2P6GA 4DBQA 3PNYA 4NUBA 3PFYA 4BEHA 1IICA 3EXNA 3R9FA 4CYNA 2L9NA 5A27A 3IAS2 2G3TA 4EATA 3EC4A 2JDCA 3DPTA 2HVQA 1X4OA 2CNSA 4UWJA 4XNFA 2K5TA 4ZDPA 4XR6A 4DNCA 2R7OA 1YLEA 2KQRA 2WA0A 2YNCC 4HNTA 1PU9A 4F52A 1AA7A 4C2YA 2I8DA 3IU1A 3IWGA 1D0ZA 4IKFA 2ZW5A 1QSTA 3MKYB 4AVZA 4R79A 4FD7A 4FD6A 4Q38A 5FRNA 3H35A 5F47A 1QSMA 4ZGYB 2W1OA 2YNCA 5EC4A 3HL2A 2GIVA 4QPQA 4CGLA 1WJ5A 2M0MA 3RTRA 4Q36A 2IS1A 4B12A 3CF2A 1I1DA 2Q1ZB 4BGDA 2E5ZA 4E2AA 3A4CA 3VYSB 1VHSA 1XF8A 4B47A 3HPHA 4GS4A 4KVME 4MFQA 2HVRA 5JPHA 4CGOA 1MMAA 2WBMA 2W00A 3PNTA 3K4MA 2WADA 2X1DA 1KUYA 3R9GA 4B14A 5AG5A 4F55A 3ZZIA 4E7JA 3I9SA 4D1QA 5I0CA 1WJDA 4X5KA 1D1AA 2P0WA 4E7LA 5F48A 2JVHA 1YR0A 1N75A 4E7IA 1MMNA 3MKZA 3EY5A 4UFXA 2REEA 4MFPA 4OADA 4LUAA 4CRZB 2VJ5A 1WK4A 3R1KA 4A95A 3BC8A 1UG0A 2B58A 4F0XA 2KZVA 3DKXA 4FD5A 2F6CA 2V4JC 2HV2A 4JOMA 3SXOA 3WR7A 4DIQA 4KT6A 3U21A 2OU2A 3IGRA 5HVQC 4ZTJA 2VXKA 1OLTA 2XF5A 2ARHA 2NMTA 2PC1A 5J8FA 4Y33A 2YNDA 4M85A 2UWMA 4XLEA 4YGOA 3VWBA 4CZCA 2Q7BA 1W36C 4GRIA 4I49A 4OAEA 2KDOA 3FRMA 2R7XA 4KVXA 4P1WA 1YE9A 4C9YA 5JQ4A 4U5YA 4KOYA 2E60A 4PUSA 2IL4A 2D4OA 1Z21A 4HEA2 3AKZA 4BE1A 2ZPAA 2M7BA 3FDYA 3KX2A 1P4NA 2VEZA 2YNEA 3MMYB 1U6MA 3IWEA 3CXQA 4ZJZA 4C68A 2LY1A 2VXZA 3IP4B 4G6TB 2BVLA 2W82A 2X1EA 3MD2A 3T9YA 2R7RA 3V8IA 2K5CA 3EFAA 3RYOA 3VSKA 3OR2C 4C30A 1X19A 4ZDLA 4E7SA 2XSJC 4UFVA 1LVKA 2CUZA 4MFLA 4A33A 5FVJA 4DBRA 4K30A 4ITVA 4KOWA 2GOXB 2Z3LA 3LSIA 4J3GA 1V5FA 2LREA 4MFKA 4XLFA 1S7LA 1NSLA 1TZLA 2M7AA 3DTEA 2F5IA 4BJTA 3LSHA 5G22A 1J09A 1Y9KA 1X1DA 4PJJA 4KUBA 2ZFUA 4DGWB 2Y0MA 1MW7A 2VZZA 3TOBA 1M1DA 3DR8A 4HNWB 3LFUA 3S6HA 4E8OA 4FASD 3FBUA 3H9JA 2LBFB 5H86A 4IZZA 1IYKA 1NMTA 1PUAA 3QAHA 4F93B 3TCVA 1S5KA 3HPGA 3K4BA 4E0AA 1I21A 3TO6A 4XPKA 1IRXA 4U87A 5BWAB 3SHPA 2ZXVA 1WJCA 4KUAA 1U0JA 1P9QC 4CSWA 4XQFA 4KORA 2PR1A 2J8NA 3HOSA 3IAM2 1ZELA 4H4KC 2RNGA 3OYCA 3JUWA 3W3CA 1T95A 4HKFA 1G8XA 3OYAA 4MLOA 3HXLA 4Y3OA 1FMVA 2L5QA 3VYTB 2QIRA 4DJAA 4XN3A 3S8PA 2WB1A 2WAFA 1SAUA 2ELJA 2MABA 2VQLA 4HSTA 4QC6A 3S3NA 1E0EA 1WJBA 1ERDA 1KUVA 2A4NA 1YX3A 3OYKA 3UNGC 3FYNA 4KSFA 3G8WA 1K6YA 3HG9A 1X1AA 1BO4A 4MI4A 2Z3MA 3BJ7A 2DT7B 2BOLA 3OL3A 3EUAA 4JQFA 2W4SA 5HNHA 2JVGA 2RQQA 2WY8Q 2R1IA 4JXQA 3FBNB 4XORA 4L8AA 4PK3A 4EVYA 5C82A 1SFKA 1D1CA 4UWIA 3OIPA 2CS3A 2F5VA 2G0BA 4UFWA 4KS9A 3SEZA 1Z3YA 1RO5A 3DPUA 2MFZA 4NC8A 1S9HA 2LH9A 2Q2EB 3EUKL 3CESA 4BQQA 3SEQA 2BEIA 3H4QA 4A31A 4X0GA 2KPMA 1Y56A 2X6WA 3QYEA 1WFXA 1GHEA 2ATRA 2HUZA 3D2PA 4NXYA 3PL8A 3FB3A 4IX7A 2PMZA 4FD4A 2LYCA 4LG3A 3NWTA 4PSXA 4XKBA 4BE2A 1I12A 2A5WA 3OOUA 2C27A 3ZGKA 2R98A 4NF1A 1CJWA 1MJ9A 4BJ5C 5LFAA 2MYSA 4XL9A 2REFA 3W6XA 2L9SA 4OAZA 2B5GB 2WPWA 4MY3A 2KP6A 1YX5A 1NE9A 2X6YA 4RI1A 2VJIA 4CCJA 4MFJA 3K70D 4CYOA 2VKHA 2XF7A 3OYDA 4XKVA 5KCMA 3OIQA 4B5PB 2V6EA 3AL0C 3GY9A 3FNCA 4CGPA 4HPQA 1K4JA 3M8JA 2VASA 4D9JA 4CH7A 1KONA 2UV1A 3FKJA 3OYBA 4C2XA 2Z2SB 2QECA 2VXDA 1S60A 3DNSA 3N7ZA 1VZ0A 2HQAA 3GBGA 2WY7Q 3E0JB 5HMNA 3F0AA 2Z3PA 2DOAA 3L2UA 5H84A 1IIDA 2FXFA 3DPLC 4P5OA 4LIUA 4XLAA 4CUGA 4YRVA 4BDZA 1DGRM 2CFOA 2VJJA 4PSWA 2IS4A 2AQEA 3C2GA 2IXSA 1WWZA 3RQ4A 1YK3A 2DCEA 2Z16A 2VLAA 3J7AY 3T90A 2HPMA 1P0HA 2EVNA 2FL4A 1UELB 4JD6A 2R7WA 3AFHA 4XONA 3RSNA 2PJRA 4YELA 5KTDA 4HG2A 4CGMA 3SYTA 5AG4A 1MMDA 3FBIB 2B4BA 4AVAA 5J8CA 1M44A 1VKCA 2CV0A 4JLYA 3K70C 2OUMA 4B48A 5DWNA 2QMLA 1NG6A 4NSQA 4CGNA 5KTAA 3VWDA 2HVSA 1N78A 1XE4A 2Q4VA 4XPDB 3KYLA 3CXSA 1W36D 4F92B 2HDWA 5HH1A 4BE0A 1DP3A 4BUPA 1Y9WA 4ZDOA 2J8MA 3TOAA 4AVCA 2K3PA 2K9LA 2VQGA 2DXIA 2BL1A 4XKWA 3S32A 4ANJA 2E1MC 3QB8A 4F91B 3DDDA 2OV7A 3W2WA 3W2AA 2R7HA 3DSBA 3VWEA 1S7FA 3ONQA 2V26A 2JSPA 2IS2A 4XKCA 4XLHA 3V42A 4BS9A 4B5OA 4B10A 3DWLE 1BR2A 3H5AA 3K4NA 5JHFA 1Q2CA 3K4KA 1ZO0A 3ZXSA 2BSWA 4KVOE 1PJRA 1CM0A 4B43A 4B44A 2DT6A 3EO4A 3HC7A 3S6KA 2Z11A 2KHMA 3QODA 4A2ZA 2JUGA 3EUHC 2ZSIB 4KISA 3IU2A 2R7TA 2RC4A 3F8KA 3DU5A 3H9QA 2PDOA 2Z3KA 4HNYB 3W91A 4ZC3A 3JTKA 5HNFA 2B4DB 3H5RA 2V7FA 5HLTA 3OYIA 2J8RA 3LSGA 2IGOA 4MBUA 2CNTA 2FIAA 3TT2A 2Z3NA 1XIXA 3VSLA 3K10A 4KOUA 5IV0A 3DQVC 1WJAA 3KEYA 3BJ8A 1QSRA 4UA3A 2O28A 3OY9A 4H6ZA 3I3LA 2Q4YA 3UR3C 1KUXA 1Y6IA 2B3UA 1WJFA 2CUJA 3B8GA 2A6TA 3CMMA 5AGEA 2KRCA 3VYRB 5CNPA 3R9EA 3C2HA 3MGDA 3P2HA 4YFJA 1M4DA 4AU7A 4BACA 1M4IA 2PRBA 3OYFA 5ISVA 3LD2A 4ZYAA 4CCKA 4J00A 1J4JA 1SQHA 3D2MA 4LX9A 2HU9A 2OH1A 4QVTA 1TIQA 4Y49C 4R3KA 2CY2A 1WJEA 2B5GA 3A2KA 2X6XA 1L0CA 4RMNA 3SXNA 2R8VA 3S6GA 1GLNA 1YVOA 2B3VA 2KL4A 3D5LA 4XMYA 2ZXHA 3TL4X 3RCOA 2MC4A 2CV1A 4A32A 1HA8A 2LOOA 3K4LA 3LSMA 3S3MA 4HRIA 3D5RC 4KOVA 4C2UA 4RM3A 2ZSHB 3OMYA 2Q0YA 4C2TA 4OLLA 3BLNA 3PSFA 2NOJB 4XNHC 5G21A 4CAEA 2P6EA 2E5NA 3LODA 3P2FA 4CRYB 1V5GA 5F46A 1UFHA 3OR1C 1EA3A 4E6KG 2ZW6A 3K9UA 4IF5A 3LMMA 4PK2A 4MJ8A 5IX3A 4E7HA 1Z9UA 2DPTA 2OZUA 3FIXA 4XOPA 1XEBA 2BUEA 4E4HA 4UCPA 2LY2A 4CAFA 2OC6A 2VJ4A 3K4JA 2R7UA 2CXAA 4UCMA 2XC7A 4DOZA 5EBVA 3BG6A 3C26A 1BR1A 1YX0A 4JXRA 3CJRB 4BQOA 1DGWY 2DXQA 4KOXA 2L7KA 3ZRGA 3S6FA 2XF6A 2G3AA 4JWPA 2QKMB 2V1NA 2ZXIA 4LITA 4YEJA 5FROA 3BG7A 3CP8A 3CZ6A 4N4OB 4HNUA 2VQHA 1MJBA 1Z4RA 2WSAA 3NE7A 4IQ4A 4Y49B 3QOEA 4NEXA 4CYQA 2R4GA 2OZHA 2KCWA 2R7QA 1QHHD 4PFPA 3OYGA 3S93A 2X51A 3TTHA 3W2VA 3ZQQA 2KLOA 3OYHA 3OYEA 3QYBA 5C88A 3R96A 4CS0B 2R7VA 4RS2A 2O5RA 3OS1A 3F9KA 1N77A 3RPUD 2LBFA 1ON0A 4R3LA 2HPIA 1S7KA 4AVBA 3H5NA 4BL0B 2PJRB 2VI7A 1R6RA 4RLFA 3ZR8X 1UAAA 4CAWA 3TBIA 4KITB 3QYFA 1D0XA 3OWTA 2AQFA 4ZTFA 2FE7A 4M3SA 1MJAA 2F4IA 1V5EA 1RXTA 1NG7A 4XOTA 3R95A 1QU3A 2PSWA 2Y0SA 2WAEA 1M4GA 4RM2A 5DWMA 2KMUA 4AG7A 4F3QA 2OZGA 4U7BA 2P6FA 2Z10A 4ORFA 1QHGA 4R57A 2AE6A 3DKYA 3CP2A 2M4GA 3G2BA 1S7NA 4MY0A 2GANA 4YRHA 4XPLA 3NWSA 4CCOA 4QB9A 2V9KA 3TO9A 4II2A 4KOSA 4F0YA 2JDDA 3K6GA 4KLWA 2YGWA 4ZBGA 1FY7A 4KJZA 2FSRA 1X1CA 1Q2YA 4CAXA 2I00A 3A1YA 3LSKA 2VIXA 3TMOA 4H6UA 4U9YA 4R87A 2IGNA 4BQNA 4H89A 4BXFA 1S3ZA 2E1MB 3OYLA 2BVMA 3PGPA 4QBJA 4B3XA 1D0YA 3SZGA 1XMTA 2CNMA 4OWRB 4AG9A 2JEVA 4UBRA 4PK4A 2W7NA 3I9V2 3PSIA 3HOTA 3W6SA 3H9GA 3S3OA 3I3GA 4R9MA 4E7KA 3OWCA 5TGTA 4KZTA 3L2QA 4F6AA 1BR4A 1BOBA 3E0KA 1MNDA 1Y7RA 2KRHA 1R57A 1OR7C 3BCBA 1N71A 5CKTA 3PNVA 3OYNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KZF A;  5KTC A;  4PV6 A;  1QSO A;  5F49 A;  2I79 A;  2AJ6 A;  2FS5 A;  2Z0Z A;  2FT0 A;  1LRZ A;  2VQY A;  4ORF A;  3G3S A;  3JVN A;  4OAE A;  1QSN A;  4KOT A;  1B6B A;  4HNX B;  2PR8 A;  3ZJ0 A;  2HQY A;  3TFY A;  3GYA A;  4NCZ A;  3D8P A;  4AB7 A;  1YRE A;  2OB0 A;  1OZP A;  4XPD C;  2VZY A;  4XNH B;  4MHD A;  4ONU A;  3D3S A;  4QUS A;  2FCK A;  2FIW A;  3PZJ A;  2ZW7 A;  3F5B A;  3FXT A;  2GE3 A;  2B4D A;  3UY5 A;  5GCN A;  2JLM A;  5IB0 A;  3TO7 A;  3CXP A;  4IUS A;  3DR6 A;  4JJX A;  1YVK A;  3TE4 A;  1Q2D A;  2WPX A;  2Q04 A;  4KLV A;  4CAV A;  4B5P A;  1MK4 A;  1IB1 E;  1V0C A;  5E96 A;  1B87 A;  4BMH A;  2VBQ A;  2Q44 A;  2ZW4 A;  4II9 A;  2H5M A;  2PQ8 A;  3PP9 A;  3GKR A;  4L89 A;  2X7B A;  2EUI A;  2D4P A;  1YGH A;  4U9Z A;  1IYL A;  1Z4E A;  2P6G A;  1IIC A;  3EXN A;  3R9F A;  2G3T A;  3EC4 A;  2JDC A;  2CNS A;  4UWJ A;  2K5T A;  4DNC A;  1YLE A;  1PU9 A;  2ZW5 A;  1QST A;  4FD7 A;  4FD6 A;  5F47 A;  1QSM A;  5EC4 A;  2GIV A;  1I1D A;  4E2A A;  1VHS A;  4KVM E;  1XF8 A;  4GS4 A;  5JPH A;  1KUY A;  3R9G A;  3I9S A;  5I0C A;  4X5K A;  5F48 A;  2P0W A;  1YR0 A;  3EY5 A;  2REE A;  4OAD A;  4CRZ B;  4LUA A;  1WK4 A;  3R1K A;  2B58 A;  4FD5 A;  2HV2 A;  4CS0 B;  3ZZI A;  3SXO A;  3WR7 A;  2OU2 A;  3IGR A;  2VXK A;  2ARH A;  2PC1 A;  5J8F A;  2NMT A;  4M85 A;  4YGO A;  2Q7B A;  4I49 A;  4KVX A;  3FRM A;  5JQ4 A;  4U5Y A;  4KOY A;  2IL4 A;  2D4O A;  2ZPA A;  1P4N A;  2VEZ A;  1U6M A;  3CXQ A;  3T9Y A;  3V8I A;  3RYO A;  3EFA A;  5FVJ A;  4K30 A;  4KOW A;  4J3G A;  1S7L A;  1NSL A;  2F5I A;  1Y9K A;  4KUB A;  2Y0M A;  2VZZ A;  3TOB A;  1M1D A;  3DR8 A;  4HNW B;  3S6H A;  4E8O A;  3FBU A;  5H86 A;  1NMT A;  1IYK A;  1PUA A;  3QAH A;  3TCV A;  1S5K A;  4E0A A;  1I21 A;  3TO6 A;  4XPK A;  3SHP A;  2ZXV A;  4KUA A;  4KOR A;  2PR1 A;  2J8N A;  3JUW A;  4HKF A;  2QIR A;  4QC6 A;  1KUV A;  2A4N A;  3FYN A;  3G8W A;  4MI4 A;  3BJ7 A;  2R1I A;  4JXQ A;  4L8A A;  4PK3 A;  5C82 A;  4EVY A;  4UWI A;  2G0B A;  1RO5 A;  3H4Q A;  1GHE A;  2HUZ A;  2ATR A;  3D2P A;  4NXY A;  3FB3 A;  4FD4 A;  2C27 A;  3R9E A;  4PSX A;  1I12 A;  2R98 A;  4NF1 A;  1CJW A;  1MJ9 A;  2REF A;  3W6X A;  2B5G B;  2WPW A;  4MY3 A;  1NE9 A;  4RI1 A;  4B5P B;  3GY9 A;  3FNC A;  1K4J A;  2QEC A;  1S60 A;  3DNS A;  3N7Z A;  5HMN A;  3F0A A;  5H84 A;  1IID A;  2FXF A;  4PSW A;  1WWZ A;  3T90 A;  1YK3 A;  1P0H A;  2EVN A;  2FL4 A;  4JD6 A;  5KTD A;  2B4B A;  4AVA A;  5J8C A;  1M44 A;  1VKC A;  4JLY A;  5DWN A;  2QML A;  4NSQ A;  5KTA A;  3VWD A;  1XE4 A;  2Q4V A;  4XPD B;  3CXS A;  5HH1 A;  1Y9W A;  3TOA A;  2J8M A;  4AVC A;  2BL1 A;  3QB8 A;  3DDD A;  3DSB A;  2R7H A;  3VWE A;  1S7F A;  4B5O A;  2BSW A;  3KKW A;  1Q2C A;  4KVO E;  1CM0 A;  3EO4 A;  3S6K A;  2Z11 A;  2RC4 A;  3F8K A;  2PDO A;  4HNY B;  3W91 A;  2B4D B;  2J8R A;  4MBU A;  2CNT A;  2FIA A;  3TT2 A;  1XIX A;  4KOU A;  5IV0 A;  3BJ8 A;  1QSR A;  4UA3 A;  2O28 A;  4H6Z A;  2Q4Y A;  1KUX A;  2B3U A;  5CNP A;  3B8G A;  3MGD A;  4YFJ A;  3P2H A;  1M4D A;  1M4I A;  2PRB A;  5ISV A;  3LD2 A;  1J4J A;  1SQH A;  3D2M A;  4LX9 A;  2OH1 A;  4QVT A;  1TIQ A;  4Y49 C;  4R3K A;  2CY2 A;  2B5G A;  1L0C A;  3SXN A;  2R8V A;  3S6G A;  1YVO A;  2B3V A;  4KOV A;  3W6S A;  4XNH C;  2Q0Y A;  4OLL A;  3BLN A;  2P6E A;  3LOD A;  3P2F A;  4CRY B;  5F46 A;  1UFH A;  2ZW6 A;  3K9U A;  4IF5 A;  4PK2 A;  5IX3 A;  4MJ8 A;  1Z9U A;  2OZU A;  3FIX A;  4AG7 A;  1XEB A;  2BUE A;  5EBV A;  3C26 A;  1YX0 A;  4JXR A;  2DXQ A;  4KOX A;  3S6F A;  2G3A A;  4JWP A;  3IWG A;  1BO4 A;  1Z4R A;  1MJB A;  3NE7 A;  4Y49 B;  4NEX A;  2OZH A;  2KCW A;  3TTH A;  5C88 A;  3R96 A;  4RS2 A;  1ON0 A;  4R3L A;  1S7K A;  4AVB A;  2VI7 A;  4CAW A;  2FE7 A;  4M3S A;  1MJA A;  1RXT A;  3R95 A;  2PSW A;  1M4G A;  5DWM A;  2OZG A;  2P6F A;  2Z10 A;  4R57 A;  2AE6 A;  1S7N A;  4MY0 A;  2GAN A;  4YRH A;  4XPL A;  4QB9 A;  3TO9 A;  4KOS A;  4F0Y A;  2JDD A;  4KLW A;  4ZBG A;  1FY7 A;  2FSR A;  1Q2Y A;  4CAX A;  2I00 A;  4U9Y A;  4H6U A;  4R87 A;  4H89 A;  1S3Z A;  3PGP A;  4QBJ A;  1XMT A;  2CNM A;  4AG9 A;  2JEV A;  4UBR A;  3I3G A;  4R9M A;  3OWC A;  4KZT A;  4F6A A;  1BOB A;  3E0K A;  1Y7R A;  1R57 A;  1N71 A;  2BEI A; 
#chains in the Genus database with same CATH topology
 3W6K B;  4KA4 A;  1KZF A;  4M71 A;  3P9K A;  3H92 A;  5KTC A;  1W7P B;  1QSO A;  3ISP A;  2HQN A;  1OCP A;  2AJ6 A;  4KSI A;  2FT0 A;  1LRZ A;  3A9L A;  1X1B A;  3JVN A;  4OAE A;  1QSN A;  2IGM A;  3BPV A;  1FOW A;  3J7A O;  4GGG A;  1B6B A;  2I3C A;  1UB9 A;  3GLJ A;  2PJC A;  3TDU C;  3TP0 A;  3ZJ0 A;  4XRS A;  2UZK A;  4LLG F;  4BU2 A;  1ITY A;  3V7Z A;  2XDV A;  1OJL A;  4NCZ A;  2HWV A;  3CDX A;  4RS8 A;  4ONW A;  3IC7 A;  3KP6 A;  2FEZ A;  4IVN A;  1PCA A;  1GUU A;  3U1K A;  2BW3 A;  3NAR A;  4MNU A;  3SJM A;  2VZY A;  2FOK A;  2RRE A;  2Y30 A;  4I76 A;  4ZY1 A;  2AHQ A;  3SJE A;  1IUY A;  3FMQ A;  4LJZ F;  3QRF F;  2GLO A;  2P5K A;  1T38 A;  2HXO A;  3H0G J;  2Z3O A;  3B7I A;  3JR9 A;  1GXP A;  4KSA A;  4Q47 A;  1J9I A;  3F5B A;  4NC7 A;  3FXT A;  2IW5 A;  4PJ0 C;  3HUG B;  2LF8 A;  3KIO A;  2K9S A;  2Z1D A;  1HQC A;  2QKL B;  2GE3 A;  2NSM A;  4HX7 A;  5GCN A;  1FIP A;  4UUV A;  3REO A;  2EIL H;  4ESF A;  2M4K A;  2XEF A;  2J5P A;  2PEX A;  3BJO A;  5KHD A;  1A31 A;  5ILU A;  1F43 A;  3BZK A;  4EJV A;  1O3T A;  1TKF A;  3DEE A;  4BH9 A;  3KHZ A;  2WYR A;  3E5U A;  3PQK A;  4DW6 A;  3OYJ A;  4LIV A;  2DJI A;  1FYL A;  3VDX A;  2E71 A;  1MMG A;  5HVH A;  4QPO A;  4MCR A;  5DCM A;  1TNS A;  2K9M A;  3GWZ A;  4HF2 A;  3DTI A;  4KIC A;  1QBJ A;  3H5Z A;  1STZ A;  4LMY A;  2MG4 A;  1YVK A;  4PFO A;  4HX4 A;  3SDB A;  1ZGW A;  1Q2D A;  4HSR A;  2GXB A;  4CAV A;  4MGR A;  1FOY A;  1FEX A;  4W9Y A;  2EZI A;  3GXO A;  3RZD J;  2JWT A;  4KNY A;  2CTB A;  2VBQ A;  4PDK A;  3K7A J;  3KR4 A;  4GM5 A;  2OPT A;  4UCN A;  5G20 A;  3RKX A;  3D7F A;  1QA6 A;  2KIU A;  2H5M A;  1UZC A;  4I2O A;  1YFH A;  5HS8 A;  1UG2 A;  4BYY A;  3DP7 A;  3CC4 I;  2DFI A;  3ZQI A;  4CDG A;  2ADU A;  3J7Z I;  4CA0 A;  4ON0 A;  5DD8 A;  3ZQG A;  3MKW B;  3HLP A;  2LY9 A;  4DBQ A;  1EH6 A;  1Z0X A;  1ONV A;  4BEH A;  4CYN A;  2LK2 A;  3GX4 X;  2D2W A;  3DPT A;  1X4O A;  2A3S A;  4EEF G;  3PIP F;  3PEI A;  3ERM A;  2CG4 A;  4AVP A;  3NH8 A;  2FMY A;  2K5T A;  4UWJ A;  3TGN A;  4XR6 A;  4DNC A;  2R7O A;  3CCR I;  2WA0 A;  1YW8 A;  2R0Q C;  2DYR H;  4M9Z A;  2I8D A;  1K4T A;  4A3G J;  2QQA A;  2ZW5 A;  4MEY F;  3FVL A;  1H8A C;  2DT5 A;  1U5T A;  1TLH B;  3H35 A;  1ZN2 A;  3KEQ A;  2FXA A;  2EBI A;  3I71 A;  4ZGY B;  4MFD A;  9ANT A;  1PUE E;  1WJ5 A;  3ZQH A;  3U1D A;  5B3S H;  5DM6 F;  1Z8T A;  3RTR A;  4Q36 A;  4MQ9 F;  2IS1 A;  3CF2 A;  4A3D J;  2E5Z A;  4B47 A;  3HPH A;  2DYS H;  2HVR A;  3ISX A;  3MZH A;  1MMA A;  3K4M A;  1LB2 A;  1KUY A;  4G1P A;  3R9G A;  2W25 A;  5C4X J;  4PQA A;  4XLN F;  4E7J A;  4D1Q A;  4J19 A;  5I0C A;  2VC1 A;  4IHW A;  4X5K A;  5IB9 A;  4RB3 C;  4BHP A;  2XAJ A;  2CTC A;  4E7I A;  3LAP A;  3EY5 A;  2ZKZ A;  4UFX A;  2REE A;  2R93 J;  5BPD A;  4MHY A;  4OAD A;  3NFZ A;  3JCU C;  2VJ5 A;  1WK4 A;  4A95 A;  5HDN A;  1B9N A;  1UG0 A;  3GW2 A;  3ABL H;  3K69 A;  4AIJ A;  4N0B A;  4IRI A;  4FD5 A;  2F6C A;  2V4J C;  3A03 A;  3QPL A;  1G3S A;  1OYW A;  4DIQ A;  3LAC A;  1XJO A;  1IAW A;  1BAV A;  2PC1 A;  4Y33 A;  3BZ6 A;  3HYI A;  4XLE A;  2G7U A;  3FEC A;  3L2C A;  2Q7B A;  3WTX C;  4I0A A;  2R7X A;  1MBH A;  2ZOF A;  1BIB A;  2BCO A;  1ZKG A;  1BI3 A;  3IWZ A;  1YI2 I;  4KOY A;  5ILS A;  4HEA 2;  3AKZ A;  4BE1 A;  2M7B A;  1XSD A;  1XBU A;  1SVM A;  3IWE A;  2CU7 A;  3M9A A;  3CXQ A;  4C68 A;  2R5Z B;  2VXZ A;  2IP2 A;  2BY3 A;  2BVL A;  3ZOB A;  1TP4 A;  1HLV A;  1IOI A;  2R7R A;  4XRS G;  2DOD A;  3V8I A;  4BXX J;  1F2O A;  1FBU A;  4RGU A;  3RYO A;  4YIR X;  1E2X A;  4RA2 A;  2IEK A;  4NBQ A;  4EJU A;  1LVK A;  2CUZ A;  2XGX A;  1YJW I;  4K30 A;  3B3W A;  1HST A;  3ZPL A;  3LSI A;  4MIM A;  5J6X A;  3QNV A;  4PXE A;  2O53 A;  1S7L A;  2IJL A;  5D5V B;  1NSL A;  2M8E A;  3WAB A;  1VQ7 I;  4BJT A;  3F8F A;  5B1A H;  2L7F P;  3LSH A;  5D8K B;  3JRA A;  4AIK A;  2CUF A;  3S1Q J;  3I54 A;  4PJJ A;  5L3F A;  1R7J A;  2H6C A;  3BR3 A;  2ZFU A;  1IJW C;  1XGN A;  4DGW B;  3QAY A;  2VZZ A;  5CVR A;  4YFK F;  2HQ5 A;  3LFU A;  1K79 A;  3S6H A;  3WC5 A;  4IZZ A;  1IYK A;  1YSJ A;  2FQ4 A;  1S5K A;  2O03 A;  3TO6 A;  1I21 A;  2Q51 A;  4XPK A;  1IRX A;  4U87 A;  2NOG A;  1WJC A;  2D45 A;  1IG7 A;  1P9Q C;  4XQF A;  5E17 F;  4JYW A;  2PR1 A;  1XSX A;  2D1H A;  2FBI A;  2GXG A;  1X3U A;  3BTL A;  3NEU A;  2RNG A;  3W3C A;  1X10 A;  4HKF A;  1FYK A;  5HDK A;  2OTJ I;  4OKO A;  2VPR A;  2IA2 A;  2X6O A;  4DJA A;  5BNG A;  1DU0 A;  1ORK A;  5D29 A;  3WU1 B;  2BGC A;  4CYD A;  2EK5 A;  3V7S A;  5L3B A;  5JVT A;  2K3F A;  5M3F J;  4A3E J;  2PX9 A;  3E7L A;  4LGW A;  4BAY A;  4HDU A;  1K6Y A;  3HG9 A;  2C6Y A;  3G8W A;  4X2T A;  2FF4 A;  1ZAR A;  3HDD A;  3EUA A;  1ARL A;  4TWE A;  4UWI A;  3OIP A;  2BE5 F;  1HKS A;  3H3U A;  4DQ2 A;  1D5Y A;  4P4D A;  1Z3Y A;  2PMU A;  2P7C B;  4WJB A;  1JUP A;  1R5I D;  4WCG A;  1S9H A;  1B8I B;  3TQN A;  1SD7 A;  2O7O A;  1BN5 A;  1IV6 A;  5CVV A;  2F48 A;  3SEQ A;  1LAP A;  1Z8L A;  1Y56 A;  2R92 J;  1ETQ A;  4NXY A;  2DPD A;  4XKB A;  1I12 A;  2A5W A;  3OOU A;  5EDN A;  3ZGK A;  2R98 A;  1MJ9 A;  2M8G X;  2MYS A;  3W6X A;  4KN7 X;  1Z7U A;  1UFM A;  5E8G A;  3SI1 A;  2B5G B;  4MY3 A;  4XRF A;  5ICG A;  2KP6 A;  3I53 A;  1ZQ3 P;  4A39 A;  1NE9 A;  2X6Y A;  1ELM P;  1P92 A;  2NYQ A;  1LAN A;  4Y17 A;  1S29 A;  3CJN A;  2X4H A;  2VJI A;  4CCJ A;  3J7Y J;  1MDM B;  2G9D A;  2JQ7 A;  4MFJ A;  3OYD A;  4CYO A;  4XKV A;  2ANP A;  4HPS A;  4B09 A;  4YU9 A;  1OQY A;  1V55 H;  1ZGA A;  3AL0 C;  2ZEN A;  4CGP A;  5J1U A;  2HYG D;  2VAS A;  4M74 A;  2AFO A;  3JRH A;  4CH7 A;  2V8H A;  3PB6 X;  4C2X A;  2DAO A;  2RB7 A;  3ZQ7 A;  2FOW A;  5IOY A;  3E0J B;  1Y39 A;  3BP8 A;  1BBY A;  2DOA A;  3GFL A;  1TF9 A;  1YW6 A;  2ZEE A;  2FXF A;  5H84 A;  4XLA A;  3VB2 A;  2O3F A;  2VJJ A;  2MH9 A;  2AQE A;  4OMY A;  2Y2Z A;  3RQ4 A;  3KLN A;  3WTS C;  3J7A Y;  2HPM A;  2DPU A;  2OAZ A;  3LAJ A;  3RSN A;  1RUO A;  2PJR A;  2E1N A;  1MMD A;  3FBI B;  2B4B A;  3VPR A;  1OCT C;  3JRU A;  2CV0 A;  5L3G A;  1SAX A;  4MMO A;  3S9L A;  1BW6 A;  2VOP A;  4KFC A;  2BXZ A;  4QWQ A;  4A3K J;  2QML A;  2BZT A;  5ERI A;  1Y1V J;  5CYV A;  1IXS B;  1PVE A;  3HSE A;  1SFO J;  1GT0 C;  2H8R A;  1N78 A;  2OCE A;  2ZED A;  1RTQ A;  2V79 A;  2IVM A;  4BE0 A;  2J8M A;  1TT5 B;  1U9N A;  2DXI A;  2BL1 A;  1RR7 A;  1I3Q J;  1AKH B;  4F91 B;  1CPX A;  3T0Y A;  1U78 A;  1S7F A;  1QQI A;  4RN7 A;  1S7O A;  2LFB A;  2JSP A;  2IS2 A;  3WC7 A;  3LSJ A;  1SFE A;  3ML6 A;  3K4N A;  1R49 A;  2R7D A;  1JT6 A;  2YX4 A;  3A0B C;  4ENN A;  1GDT A;  1CM0 A;  2DT6 A;  3EO4 A;  2HOS A;  4A2Z A;  3NH5 A;  5AON A;  3HEF A;  1YS7 A;  3RBU A;  4BIN A;  4PXC A;  2RC4 A;  2WV0 A;  1O3S A;  2R7T A;  3DU5 A;  3FF3 A;  3S9N A;  4KIB A;  3ABK H;  5DD4 A;  1KQ0 A;  2VT2 A;  2EV5 A;  3HIF A;  3H5R A;  2V7F A;  3CUQ C;  5ICC A;  4MBU A;  2CW0 F;  2EZK A;  5JGF A;  3K10 A;  5IV0 A;  1FJL A;  3M8F A;  3DQV C;  1WJA A;  5EJC A;  4Y7N J;  3PO2 J;  3BJ8 A;  3CJT B;  3OY9 A;  1AUG A;  4FUU A;  1MKM A;  2DK8 A;  2QSH X;  5CNP A;  5AGE A;  3FMC A;  2A6T A;  1FWZ A;  2GWR A;  2NS8 A;  5GTH C;  3MGD A;  2DOF A;  1IGB A;  1M4D A;  2PRB A;  4UXN A;  1G3W A;  3BRO A;  3F6O A;  1YW7 A;  4ZYA A;  4CCK A;  1R9T J;  4IHY A;  1SQH A;  5DDG A;  2OR4 A;  3PFO A;  3M7G A;  4QVT A;  2GLF A;  2CY2 A;  1TWA J;  1WJE A;  2QM3 A;  3I58 A;  4RBO A;  5EGO A;  3WTT C;  2V9P A;  1B1B A;  2PBI A;  2X6X A;  4XK4 A;  1D8J A;  1KUV A;  1L0C A;  3R60 A;  3GTL J;  2XPU A;  4EJW A;  1AWC A;  2B3V A;  1RPW A;  2MC4 A;  1JTX A;  4A32 A;  2O6G E;  4HRI A;  3DXJ F;  3FXM A;  3OMY A;  3Q5F A;  4A2U A;  2P6E A;  2QVO A;  3LOD A;  3IIB A;  1V5G A;  2I10 A;  2GQQ A;  1EA3 A;  2G7H A;  4W1U A;  5TJJ A;  3RJP A;  2NVX J;  4IF5 A;  1ZAO A;  2YSR A;  4MJ8 A;  5IX3 A;  4XOP A;  4OIW A;  2BUE A;  4E4H A;  2LY2 A;  1FBS A;  1VHE A;  5JH9 A;  1TQP A;  4X1E A;  2CRG A;  5FLX K;  4DOZ A;  5EBV A;  1MZB A;  3C26 A;  1YX0 A;  4KOX A;  3I56 I;  4NHJ A;  2DMQ A;  2OTL I;  3S6F A;  2XF6 A;  2PLY A;  2G3A A;  4JWP A;  2V1N A;  3CCQ I;  2ZXI A;  5FRO A;  4O5V A;  4HNU A;  3CZ6 A;  3BG7 A;  5DTD A;  1MJB A;  3ECO A;  4IQ4 A;  4EM1 A;  5C44 J;  3RKQ A;  2R4G A;  4ENK A;  1O7F A;  2KCW A;  1J2X A;  3KL9 A;  4V2F A;  3TTH A;  2X51 A;  4HBL A;  5D5U B;  3RI4 A;  2L9R A;  1T6S A;  2P6T A;  5EEA A;  3FX3 A;  3R96 A;  2O5R A;  1R4M B;  2DA5 A;  2EQR A;  2LBF A;  1ON0 A;  4R3L A;  1S7K A;  2XAG A;  4KIF A;  1HW1 A;  2QWW A;  2LSO A;  3F8B A;  1BW5 A;  1T33 A;  4RLF A;  2E1O A;  4NGN A;  4CAW A;  3TBI A;  4NGQ A;  3L09 A;  1D0X A;  1XGS A;  4Q48 A;  2PJ8 A;  2E2J J;  2FNP A;  2DMN A;  4UVB A;  4BY1 J;  3R95 A;  2PI0 A;  5GP9 A;  4IHS A;  2PSW A;  2Y0S A;  2ZXW H;  4PCQ A;  5BS6 A;  4G6D A;  5DWM A;  1UHM A;  3V38 A;  2R7F A;  1PP7 U;  4R57 A;  5CBM A;  1BOA A;  1WZ2 A;  3GTG J;  1S7N A;  5IT9 K;  3RQI A;  3LSR A;  1OYI A;  4XPL A;  2E19 A;  1K83 J;  1BIA A;  2V9K A;  1S7E A;  1DDN A;  2V8V A;  3KQX A;  4GFB A;  5HLG A;  4KLW A;  1YIT I;  4PGH A;  4ZBG A;  2M34 A;  4K2E A;  1W0T A;  2IBD A;  1Q2Y A;  1VFC A;  1Z8X A;  1RI7 A;  3LSK A;  3HOZ J;  1A6Q A;  4R87 A;  5DS9 A;  2Y9Z A;  1IRZ A;  3JSP A;  1S3Z A;  3PGP A;  2ZJP F;  5LHH A;  2L3D A;  4B3X A;  2CNM A;  4AG9 A;  3RYP A;  4U7D A;  4A3I J;  1YTY A;  4RUH A;  3HOV J;  3HOT A;  3H9G A;  2PJ6 A;  3NAU A;  4A5N A;  3S3O A;  3CUQ B;  1U5T B;  3GIU A;  5TGT A;  3GUX A;  4KZT A;  4EFD A;  3L2Q A;  4F6A A;  1BR4 A;  1YJN I;  4GDF A;  3BCB A;  3S17 J;  2PJ9 A;  4L9N A;  2OZ6 A;  3OYN A;  2BEI A;  2MBF A;  1I1S A;  1JKO C;  5LHI A;  5I4M A;  4CCL A;  4RB1 A;  4EM0 B;  4OIO F;  4PV6 A;  5F49 A;  2FS5 A;  2Z0Z A;  2VQY A;  2VKD A;  3MN2 A;  3G3S A;  1W7P A;  2LVS A;  4BEH B;  1VTN C;  4N4N B;  1CGP A;  2AFW A;  3R6S A;  4HNX B;  4KOT A;  4UB6 C;  2R7S A;  4C7H A;  4LB6 B;  1J59 A;  3DTK A;  4RAG A;  1KZH A;  3OYM A;  1YRN A;  2HQY A;  2BOA A;  4O23 A;  4UF4 A;  1BC7 C;  4E7Z A;  2VPL A;  4F9U A;  3R4K A;  5L3E A;  2CV2 A;  4XPD C;  4J01 A;  2IS6 A;  5FB2 A;  3JRF A;  4S05 A;  2ZME C;  1ZTR A;  3H8E A;  4JX5 A;  3D3S A;  1EV7 A;  1YLO A;  3PZJ A;  2A5Y B;  4BBH A;  1MD0 A;  3P9C A;  2VQC A;  4P9F A;  4U88 A;  2G9W A;  4Y13 A;  1PP8 F;  2JA2 A;  1ZH5 A;  1KWM A;  3HM5 A;  4F9V A;  4RGS A;  3T8T A;  4EQQ A;  4Y4R A;  4ZY0 A;  3OS2 A;  1O3R A;  2ME0 A;  3LST A;  2ISZ A;  5G1Z A;  1FT9 A;  3MEX A;  1IN8 A;  3UY5 A;  4G9Y A;  2H1L A;  5DCM B;  2IGK A;  1JKP C;  3OSG A;  2FBK A;  3BG9 A;  1LDK B;  1KU9 A;  2GXA A;  3JRI A;  3FX6 A;  2CMP A;  3M4O J;  2GIZ A;  1RNL A;  3HGG A;  5BPI A;  2JRT A;  2LMD A;  5JLX A;  3PJR A;  2WTE A;  3KFW X;  4DYQ A;  4UV8 A;  4CGL A;  4IUS A;  3SFZ A;  4B11 A;  3F23 A;  2ELK A;  4KDP A;  1DQU A;  1X2N A;  3L2R A;  4D5C A;  4A30 A;  2QSF X;  3TE4 A;  1H0M A;  3RKW A;  1ODD A;  2XAU A;  1EJ9 A;  2WPX A;  5KNL A;  5CQE A;  1LVA A;  4KLV A;  1UHW A;  3CCM I;  1MBG A;  1QRY A;  2HI3 A;  2UUZ A;  2FUG 2;  4L9T A;  4UEF A;  2X1C A;  1BJA A;  3HHG A;  4RAF A;  1IB1 E;  2CW8 A;  3BR2 A;  3LA7 A;  3OL4 A;  5CPR B;  2CH0 A;  4IO9 F;  1HCR A;  4LQ6 A;  1GXQ A;  1PYV A;  4HX8 A;  1B87 A;  4MFZ A;  1G59 A;  4NGT A;  4BMH A;  2CQQ A;  3HGY A;  1XOV A;  4PGG A;  4ZX8 A;  2BW3 B;  2PRQ A;  2VL8 A;  2ZXJ A;  3GF2 A;  4JX4 A;  3M1C A;  4HV5 A;  4PJL A;  1LEA A;  3COA C;  2CWE A;  1JE8 A;  4LLN A;  3GKR A;  3SDG A;  2QF7 A;  2EUI A;  3DCF A;  3CDH A;  2E2I J;  1ELL P;  2PIZ A;  1X3Z B;  3F21 A;  3LNQ A;  3I4N J;  3JRE A;  4NNJ A;  1Q7L A;  1LFP A;  2DFH A;  4HA8 A;  1D5V A;  4TNU A;  5FKK A;  1IIC A;  2HDC A;  4OME A;  2L9N A;  2WB1 N;  3EC4 A;  2HVQ A;  2H27 A;  1UCR A;  2CNS A;  2PJ1 A;  3K0L A;  5F08 A;  3BTC A;  2YNC C;  1PU9 A;  5JM6 A;  1I6X A;  2ZME A;  2F7V A;  4C2Y A;  1D0Z A;  1IXC A;  5LLQ A;  4IKF A;  3S2H J;  4M6G A;  1XX5 A;  4MXU A;  3M07 A;  3MKY B;  4R79 A;  4Q38 A;  5FRN A;  3O2P E;  4DYC A;  5F47 A;  3HRU A;  1QSM A;  1T98 A;  4PZJ A;  3CC7 I;  1ZK8 A;  2IPQ X;  2LF7 A;  2DW4 A;  5HXD A;  3T5X A;  2OBP A;  2GIV A;  5B1B H;  4O3M A;  2IJZ A;  3C3W A;  2P5V A;  1J75 A;  2BO9 A;  2IQ6 A;  4B12 A;  4X8I A;  3VYS B;  5D6F A;  3JTH A;  3CCU I;  4KUM A;  2XGD A;  2PG4 A;  1Z9C A;  1TQI A;  4R1H A;  2WBM A;  2K9N A;  2W00 A;  2X1D A;  4H2K A;  1XN7 A;  1CX8 A;  1B9M A;  5AG5 A;  4F55 A;  5GAE J;  3BR6 A;  3RDI A;  5IYB J;  4M6V A;  4M9X A;  3JRC A;  3FXO A;  1JTY A;  3BR1 A;  5ILV A;  3IC1 A;  2ZB9 A;  4LD5 A;  3BC8 A;  8CPA A;  4F0X A;  2KZV A;  4UB8 C;  3DKX A;  3BJA A;  4CS0 B;  1B8I A;  5DV5 A;  4JOM A;  3SXO A;  3AG2 H;  2OU2 A;  3WR7 A;  3CD6 I;  2ZEH A;  1BM9 A;  2V9V A;  4ZTJ A;  1L0O C;  1OLT A;  5J8F A;  2ARH A;  1OYY A;  1HDP A;  2RFH A;  2YND A;  4P4E A;  4GRI A;  4I49 A;  2BEO A;  3DBR B;  2P81 A;  2EZH A;  4BBR J;  4C9Y A;  1YE9 A;  2UXX A;  1T56 A;  2E60 A;  3A01 B;  3SJF A;  2D4O A;  1Z21 A;  1ZHF A;  2CF4 A;  3WGG A;  3FDY A;  1P4N A;  5JHU A;  2VEZ A;  1QO0 D;  3MMY B;  4M6Y A;  2MH2 A;  4ZJZ A;  1FTZ A;  2LY1 A;  1LAM A;  1IXR C;  2X1E A;  3MD2 A;  3T9Y A;  3GEZ A;  2CQ7 A;  2K5C A;  4NDL A;  4A38 A;  5EEG A;  4UFV A;  2XSJ C;  5E18 F;  3UKG A;  4KOW A;  2Z3L A;  2Q43 A;  5GTI C;  2DN0 A;  2ZC2 A;  4G6Q A;  4ABZ A;  1OBR A;  4XLF A;  4M6I A;  4MFK A;  2PJA A;  1E3O C;  4KN4 X;  5L3D A;  4FX4 A;  1F36 A;  2M7A A;  3D66 A;  2F5I A;  4A93 J;  1Y9K A;  1O7L A;  2KKO A;  2VBY A;  2ZCW A;  2AXT C;  3MZY A;  3TOB A;  3DR8 A;  4HNW B;  2M87 A;  3G3Z A;  1JT0 A;  5H86 A;  4EGY A;  3QAH A;  5EZG A;  2DA7 A;  1YG2 A;  1HSJ A;  1MH4 A;  2ZXV A;  1U0J A;  3IV5 A;  4KOR A;  4YII A;  1S6L A;  2J8N A;  4DUK A;  5FKM A;  1ZEL A;  1HKT A;  3OYC A;  2LTP A;  4L5E A;  3R0A A;  3SHF A;  4FHT A;  4MLO A;  3HXL A;  3NRV A;  1FMV A;  2VKV A;  4Y3O A;  1ZRC A;  4Y52 J;  2HOT A;  2QIR A;  3TC8 A;  2WAF A;  4A0X A;  4ZYQ A;  3WGH A;  2A4N A;  1YX3 A;  3FYN A;  2Q8K A;  4KSF A;  2DDA A;  1SC7 A;  5HOD A;  3CTA A;  5ED4 A;  4GXH A;  4JQF A;  1T08 B;  5HNH A;  2W4S A;  1K4S A;  1WRJ A;  3FXQ A;  2HTS A;  5C82 A;  4UVC A;  2PJ4 A;  3N4M A;  1P2F A;  3KE2 A;  3G4S I;  2A6E F;  3EYY A;  2M1B A;  5IPA A;  2NXN B;  4KS9 A;  1LOK A;  1IGN A;  4FWU A;  1CF7 B;  2ODF A;  2LH9 A;  2M9H A;  5GPC A;  2JEW A;  4BQQ A;  4H0E A;  3HTU A;  3H4Q A;  4A31 A;  2DMT A;  3NH4 A;  4X0G A;  2KPM A;  5BQT A;  3BXM A;  3CMY A;  3PB9 X;  4ZY2 A;  4D5F A;  3PL8 A;  3FB3 A;  1VND A;  2B7E A;  2PMZ A;  3FKI J;  2LYC A;  3ZMS A;  2VE9 A;  4NF1 A;  3PQJ A;  2POK A;  2EZL A;  2REF A;  4AYB N;  3CCJ I;  5LRS A;  1TKJ A;  2L4M A;  1YX5 A;  2IMO A;  4L9J A;  2EFP A;  5IP7 J;  1Z05 A;  1LEB A;  2ETH A;  4RI1 A;  5GAD J;  2HOA A;  1ZLH A;  3G6E I;  3HKZ N;  2V6E A;  1ZLI A;  2EV0 A;  1IDZ A;  1R4N B;  3EUH A;  1K4J A;  1FSH A;  1NSA A;  4ESB A;  4R76 A;  2F5F A;  2Z2S B;  4HV6 A;  2LR8 A;  2QEC A;  2ZEM A;  4QTR A;  5EF6 A;  1FYM A;  2K7L A;  3I1U A;  1HXD A;  1S60 A;  2Y0S N;  4UNO A;  3N7Z A;  1R3N A;  2GAU A;  4L0Z B;  3GBG A;  2WY7 Q;  2AFU A;  2LDU A;  3F0A A;  5GAH J;  3L2U A;  2C6C A;  2P6S A;  2IS4 A;  4YRV A;  3GTK J;  1XCB A;  2HTJ A;  5DYM A;  2IXS A;  1YK3 A;  1MH3 A;  2EB7 A;  2YX7 A;  3QU3 A;  2VLA A;  2EVN A;  1RES A;  4XLP F;  3AFH A;  4JZ0 A;  1ZG1 A;  5KTD A;  4HG2 A;  1HBX G;  2L9V A;  4CGM A;  4DYO A;  5E3L A;  5AG4 A;  5J8C A;  1I50 J;  1QVU A;  3M1E A;  1YQA A;  4JLY A;  2QQ9 A;  3T8W A;  2GZW A;  1XD7 A;  2XAH A;  1HEE A;  1Y9W A;  3TOA A;  4RAY A;  5HLI A;  3HUV A;  1MGT A;  2VQG A;  4XKW A;  4ANJ A;  2F2E A;  2ICW G;  2E1M C;  1GV5 A;  2W84 A;  3DSB A;  3Q0W A;  3W2A A;  4BXU A;  5KAI C;  2LD5 A;  4XLH A;  3SFI A;  4ZI6 A;  4P96 A;  4B10 A;  4G94 A;  3KKW A;  3K4K A;  3ZXS A;  4MCS A;  2O9L A;  2J5O A;  2QEX I;  3KP2 A;  3DFG A;  1CBX A;  3S6K A;  2RAE A;  3QOD A;  3ERE D;  2O8K A;  3G1M A;  2ZSI B;  2ZO4 A;  4EJT A;  5B5E C;  1R58 A;  4BBS J;  3CT9 A;  4ZYE A;  3Q0U A;  1S5L C;  3ECH A;  2V1D A;  2NRA C;  2PDO A;  4HNY B;  1EKE A;  3ABU A;  3LWF A;  4M72 A;  4ZC3 A;  3PB4 X;  5HNF A;  5HLT A;  3OYI A;  1HC8 A;  3GTJ J;  2JPC A;  1HW2 A;  3LSG A;  2V8G A;  2KIM A;  1RET A;  4WXC A;  4S0H B;  3CO6 C;  2CNT A;  2FIA A;  3FXL A;  3TT2 A;  2Z3N A;  3HRT A;  2A07 F;  3VSL A;  2BYV E;  2QGU A;  5IP6 A;  1KQ8 A;  1JGS A;  5EEH A;  5TRD A;  1QSR A;  2O28 A;  4UA3 A;  5D5X B;  3I3L A;  5K8M A;  5K5R A;  2CQN A;  2O0Y A;  4ZYG A;  1JWQ A;  2CUJ A;  3B8G A;  3CMM A;  2EK8 A;  2KRC A;  5DEQ A;  4U0V A;  1FTT A;  1DTD A;  3ZP5 A;  3G71 I;  1TW2 A;  4C3I J;  4UEZ A;  1ZG9 A;  5ISV A;  2XAF A;  4FBE A;  3LD2 A;  4NJR A;  2QA4 I;  1WPK A;  4LX9 A;  1G3Y A;  2OH1 A;  1HDU A;  2ID6 A;  2QCO A;  1TIQ A;  3DBH B;  4R3K A;  4LK1 F;  1QVT A;  2XKO A;  4K3N A;  1JUS A;  3AG1 H;  3S1R J;  1R1V A;  1WHU A;  4DYR A;  2KL4 A;  2RVC A;  3F72 A;  3TL4 X;  3RCO A;  2CV1 A;  4P4J A;  2DA1 A;  3K4L A;  5A28 A;  3S3M A;  4P6Y A;  5DS0 A;  5LYF A;  4RM3 A;  2ZSH B;  4XNH C;  5F1J A;  2MW8 A;  2JSC A;  2Q0Y A;  1YYV A;  4IHV A;  1ZRD A;  2VE8 A;  3BLN A;  5G21 A;  4CRY B;  3MZ8 A;  1UFH A;  3KGQ A;  4E6K G;  3FXK A;  3I64 A;  3LMM A;  2O61 A;  4EJO A;  4E7H A;  2OZU A;  1H8L A;  1R5H A;  2MA3 A;  3ZMU A;  4AG7 A;  1Z1D A;  2XAS A;  2OC6 A;  2VJ4 A;  1CQT A;  2CXA A;  4YG2 F;  3T8R A;  2ZEO A;  3BG6 A;  3OSF A;  1S3J A;  1U2W A;  2FD5 A;  1VQO I;  4JXR A;  1R5G A;  2L02 A;  3ZRG A;  3TKY A;  2NYX A;  1I39 A;  2MGQ A;  4N4O B;  2Y31 A;  5H6R A;  4A37 A;  3CME I;  1APL C;  1A2Z A;  2QUF A;  1POG A;  3QOE A;  1IU8 A;  1ZG3 A;  3FK7 A;  1FC3 A;  4F8Z A;  5EG0 A;  3OYG A;  3S93 A;  3VAT A;  4MO7 A;  3CQZ J;  4FTH A;  1SMT A;  1ZRE A;  3LMS A;  2R7V A;  3GTM J;  3LFK A;  4I7H A;  4OIP F;  4IPA A;  2NS0 A;  2RN7 A;  3ZMD A;  4BL0 B;  2PJP A;  1R6R A;  2ZJ2 A;  2XGE A;  2VI7 A;  2XPW A;  4A12 A;  2B63 J;  2XEI A;  4KIT B;  3QYF A;  3S2W A;  2AQF A;  2VBX A;  2BHY A;  4M3S A;  2F4I A;  3WTV C;  1ON1 A;  1Z77 A;  1WI3 A;  4XOT A;  4P4B A;  1LFU P;  2WAE A;  1VF9 A;  1M4G A;  1EH8 A;  2KMU A;  4F3Q A;  2OZG A;  1MSF C;  2CYY A;  2Z10 A;  1QHG A;  4ENJ A;  3HOU J;  3DKY A;  4MY0 A;  3G2B A;  4RB2 C;  4P4F A;  3DKW A;  1J0R A;  1RR8 C;  2RV8 A;  4II2 A;  4F0Y A;  2JDD A;  1A36 A;  3CUQ A;  3P7N A;  3FH4 A;  3K6G A;  1VQ9 I;  4OC4 A;  2YGW A;  3KQZ A;  2F4M B;  1X58 A;  2YPR A;  1YIJ I;  1OIS A;  4ESJ A;  2VIX A;  1K78 B;  4H6U A;  2EPF A;  2ZEP A;  1F5T A;  2OA4 A;  3R0J A;  4BXF A;  4YIF A;  2E1M B;  4U0W A;  4EWT A;  5H2F C;  2QZ8 A;  4NC6 A;  2HKX A;  4OWR B;  3ZN1 A;  2P7V B;  4MRI A;  1W0U A;  2W7N A;  3SQN A;  3I9V 2;  2VON A;  5ICF A;  4CGZ A;  4L5J A;  2CFX A;  2CIJ A;  1FNN A;  3WHB A;  4RB0 A;  1U9O A;  1BOB A;  1ARM A;  1OCO H;  2LLK A;  1W7P D;  4M3E A;  1R57 A;  4NFR A;  3GZ6 A;  2PVV A;  1N71 A;  2DU9 A;  3PNV A;  5CKT A;  2Z9O A;  4WXH A;  3PM1 A;  1XB4 A;  2DO7 A;  4OMZ A;  2PJB A;  2H1K A;  2Y69 H;  3DU6 A;  3L2W A;  2CSO A;  2I79 A;  2DOE A;  2E35 A;  2IA1 A;  4FT8 A;  2WUU A;  2MD0 A;  2AFS A;  1SAN A;  2HNH A;  3GME A;  1XCV A;  2PR8 A;  5E3N A;  4HQE A;  1T0F C;  5AG7 A;  1QPM A;  2VB6 A;  2EA4 A;  2X9D A;  3PB8 X;  2X85 A;  3TFY A;  1Z7L A;  3FIS A;  4LB5 A;  3BOQ A;  1NK3 P;  3D8P A;  1YRE A;  2WZN A;  4WF2 A;  1HF0 A;  3FIW A;  2OB0 A;  1OR7 A;  4BDY A;  3D5S C;  4V2G A;  3KP7 A;  3HOY J;  2KIS A;  2CW7 A;  1SMY F;  2VC0 A;  3QWL A;  3HSR A;  1FNO A;  4LQG A;  2PN6 A;  1MNE A;  4C7I A;  1Y8Q B;  1TWG J;  2EA2 A;  3KYD B;  3WHC A;  2ZW7 A;  4KMU X;  1PYT B;  3GZN B;  1Y7E A;  1ACI A;  1IRG A;  2IT0 A;  4JBA A;  3OS0 A;  1BI0 A;  4D0P A;  1ZGJ A;  2M3A A;  2KDZ A;  1P4A A;  4FE7 A;  3HKZ A;  4P9U A;  1ZYR F;  2QQ8 A;  3K2Z A;  1FPQ A;  5IB0 A;  1R36 A;  3TW6 A;  1DUX C;  3GZ5 A;  3I4P A;  1DE4 C;  1Y0Y A;  2IRF G;  5FRM A;  2PJ7 A;  3VFZ A;  1W5C C;  3IUO A;  2BBY A;  2DDB A;  1EE3 P;  1BPM A;  3C18 A;  2STW A;  2BY0 A;  4RLQ A;  2KIF A;  3C1D A;  1XMB A;  4XLC A;  4JJX A;  5IOZ A;  1JHH A;  3MVP A;  1T39 A;  4QSH A;  3CJQ B;  3FHZ A;  1A5J A;  3ZCO A;  4IOA F;  5FD6 A;  2EJR A;  3H36 A;  1BC8 C;  5E79 C;  1O4X A;  4OAY A;  2HOE A;  1TKH A;  5E96 A;  3BWG A;  4OU0 A;  3L2N A;  3FHN A;  2A69 F;  2DTR A;  4PJN A;  3X2Q H;  4O6J A;  4II9 A;  1CPS A;  2PQ8 A;  3OOP A;  5IY5 H;  2DPS A;  4PXB A;  3PP9 A;  3JRG A;  4YWY A;  5JLW A;  5AIQ A;  4AM3 A;  4A0Y A;  2X7B A;  4NGM A;  3AG4 H;  2QJ8 A;  4CCM A;  1YGH A;  4PJM A;  1FP1 D;  4MTE A;  1IYL A;  1WWX A;  3S15 J;  2LKP A;  2DA3 A;  4HAM A;  3PO3 J;  4I01 A;  5DCF A;  2K02 A;  1RKW A;  3S16 J;  5A27 A;  2GA2 A;  3HJE A;  5CJ9 A;  1MNM C;  4XNF A;  1S7A A;  3HSF A;  2D1V A;  2DQR A;  2I5U A;  3P5J A;  3AAF A;  5FKL A;  4HNT A;  1QQ9 A;  1AA7 A;  1SFX A;  3ZMT A;  5ICE A;  1FOX A;  3H1C A;  5LGU A;  3K1M A;  1FBQ A;  1QST A;  2F4O B;  3Q9V A;  1HKQ A;  1G2H A;  1MBJ A;  2RQP A;  4M3D A;  3MKL A;  4AXV A;  4UIB A;  2W1O A;  2YNC A;  2STT A;  3HL2 A;  1QNT A;  3BR0 A;  3D4U A;  3IH2 A;  2XRL A;  5FGM A;  6PAX A;  4ZX9 A;  1I1D A;  2Q1Z B;  2DF5 A;  4E2A A;  1VHS A;  4KVM E;  1YW4 A;  4OID A;  5J47 A;  3IKT A;  2EH3 A;  3B3T A;  3KPH A;  5HS9 A;  2ABZ A;  5JPH A;  4CGO A;  4AID A;  2WAD A;  4MCQ A;  5J4Y A;  3GB0 A;  4A6D A;  1WGX A;  2A61 A;  3I9S A;  2ZNY A;  1WJD A;  2NS7 A;  1D1A A;  4E7L A;  4HF1 A;  5F48 A;  1U3E M;  2JBJ A;  1MMN A;  1JUM A;  3V8K A;  1QGP A;  3MKZ A;  1S8N A;  4FAI A;  4CRZ B;  2K85 A;  4LUA A;  5FKO A;  2B58 A;  1IDY A;  2E36 A;  3ZMV A;  4XIC A;  1LPQ A;  1JQG A;  5IT3 A;  2HV2 A;  3ZZI A;  4IF4 A;  4KT6 A;  5CLS A;  3U21 A;  3JAM Z;  5F1R A;  4OIQ F;  4M85 A;  4HDV A;  5K5Q A;  2CQK A;  1AHD P;  4CZC A;  4YGO A;  3Q0V A;  2ZJQ F;  1K6O A;  5HVG A;  1YME A;  1Z8W A;  1P7I A;  3FRM A;  3WT4 A;  4P1W A;  4C3J J;  1IO2 A;  3IH3 A;  2W57 A;  2JA8 J;  3GUD A;  4PUS A;  2IL4 A;  3SZT A;  4S04 A;  3WE3 A;  5LGN A;  3KX2 A;  1VQ4 I;  3GCM A;  1U6M A;  2ZOG A;  2W82 A;  5D6E A;  3B2Y A;  4AUX A;  3EFA A;  3PRT A;  2M2E A;  3C2B A;  4ZYD A;  3OR2 C;  1WH7 A;  1X19 A;  4E7S A;  1QZZ A;  4GXO A;  1IRF A;  4MFL A;  5FVJ A;  4DBR A;  3I59 B;  1VHO A;  3RKY A;  3HOX J;  1TW3 A;  3SXY A;  3QOP A;  1LE8 A;  3D0S A;  4I02 A;  1V5F A;  2LRE A;  5M5Y J;  4I0B A;  3GFI A;  3S1N J;  4M3B A;  4EVI A;  1TZL A;  5K8P A;  3TDZ C;  2EWB A;  1F57 A;  3DTE A;  2QBY A;  4B3A A;  3GTP J;  5G22 A;  2PE3 A;  2BHZ A;  2HQR A;  1JJ8 C;  1Q1V A;  4KUB A;  3ZQF A;  4A3F J;  1ZR4 A;  4KYW A;  5IT9 Z;  3IO1 A;  2EFO A;  1LUJ B;  1MW7 A;  4P55 A;  5FFX A;  2K86 A;  3QQA A;  1M1D A;  3LA3 A;  4WXD A;  4E8O A;  4FAS D;  3FBU A;  3CLO A;  3H9J A;  1ULY A;  3HPG A;  3CCL I;  3CCV I;  3B3V A;  5BWA B;  1G6N A;  5EG0 B;  2XUB A;  3PUF A;  5F0H A;  3KET A;  3SI0 A;  1H89 C;  4FCY A;  5K8O A;  3IAM 2;  3IWF A;  2GLJ A;  3I55 I;  4H4K C;  3JUW A;  4B8X A;  1T95 A;  4MEX F;  2M30 A;  3CDI A;  3I5U A;  2R7Z J;  1LDJ A;  1T0F A;  5GPA A;  1ETW A;  3OYA A;  1Q1H A;  1Y0R A;  3VYT B;  3GTQ J;  3S8P A;  2WB1 A;  1SAU A;  4HST A;  5F04 A;  5J1Y A;  3S3N A;  1YRN B;  1WJB A;  3N5F A;  4OC0 A;  3BDD A;  3AG3 H;  3OYK A;  2XGC A;  4IXA A;  5FFZ A;  4AD9 A;  4HF0 A;  2DT7 B;  4BAC A;  3HHH A;  4JXQ A;  4L8A A;  2JVG A;  2RQQ A;  2WY8 Q;  1A6I A;  2ME6 A;  5K7F A;  4OP4 A;  4OC3 A;  1SFK A;  1U8R A;  2G0B A;  2F5V A;  4GYI A;  4LLL A;  4UFW A;  1QZY A;  4CXF A;  3DPU A;  3O8G A;  4Y15 A;  5D8L B;  4NC8 A;  4C2M J;  2QBY B;  2Q2E B;  3EUK L;  1VQN I;  2ZJR F;  3IH4 A;  1TQM A;  2X6W A;  4NJQ A;  2GBY A;  3QYE A;  1WFX A;  2P4W A;  2ATR A;  2HUZ A;  3D2P A;  3IJ3 A;  5IYD J;  3GYH X;  2RNJ A;  1WCM J;  4FD4 A;  2L54 A;  2C27 A;  4BE2 A;  4PSX A;  4IHM A;  3R9E A;  1FIA A;  2K9Q A;  4KT5 C;  1CJW A;  5LFA A;  1FP2 A;  3SJX A;  5JI6 A;  4OAZ A;  5CVU A;  5THW A;  1NK2 P;  2WPW A;  2NVQ J;  3VOE A;  3KCC A;  3ZQC A;  1XG1 A;  3Q3S A;  1L3L A;  3M8E A;  3MFK A;  5E3M A;  3TED A;  4CIC A;  3K70 D;  2VKH A;  2DMU A;  2PMH A;  4HYE A;  4NGS A;  4B6Z A;  1XDS A;  3B02 A;  3WG9 A;  4AIH A;  4HPQ A;  3S2D J;  3M8J A;  4D9J A;  1KON A;  2UV1 A;  3IRQ A;  1GV2 A;  5DM7 F;  4NGR A;  2MLK A;  1KA8 A;  3DNS A;  1VZ0 A;  3KAS A;  1QZE A;  1Y8R B;  2K40 A;  4I98 B;  5HMN A;  1OCR H;  4XID A;  1CP6 A;  2Y48 A;  3EDP A;  1ETK A;  5F0F A;  2G0E A;  4P5O A;  4LIU A;  2RGV A;  1H9T A;  1AU7 A;  1IID A;  1DGR M;  2CFO A;  2NVY J;  3V7R A;  2ZFW A;  1RUN A;  1W1W E;  3T90 A;  2DCE A;  1P4W A;  2Z16 A;  1K61 A;  1C0W A;  1SD6 A;  2JT1 A;  1BA5 A;  2OQG A;  1UEL B;  4JD6 A;  2R7W A;  3HUG A;  3QPT A;  4YEL A;  2XHK A;  1VQ6 I;  3SYT A;  3JAM K;  1XMX A;  2BXY A;  1B59 A;  4XSX F;  1EH7 A;  4AVA A;  5KVR A;  1OFC X;  3K70 C;  3KHX A;  3TW7 A;  5KTA A;  4BD9 A;  4D7N A;  1ZRF A;  1XE4 A;  2Q4V A;  4XPD B;  4N9I A;  4CYC B;  3WU2 C;  5KAF C;  3KYL A;  3CXS A;  5HH1 A;  3WTZ A;  2VI6 A;  1TWF J;  1DP3 A;  1AMP A;  4ZDO A;  3CPX A;  3FMR A;  2K3P A;  2K9L A;  1FOK A;  3S32 A;  1M4L A;  3QB8 A;  2JA5 J;  2R7H A;  2CO5 A;  2HYF A;  3VWE A;  3ONQ A;  2V26 A;  1AOY A;  2JZY A;  1MBK A;  4BS9 A;  3H5A A;  1W5S A;  2BSW A;  5CPA A;  5FLX Z;  2VBZ A;  2Q4Z A;  5HLH A;  4HQM A;  2WV1 A;  4B43 A;  3QPH A;  2FVG A;  3BZC A;  3NQO A;  2Z11 A;  2KHM A;  2JA6 J;  4IRH A;  2FNA A;  1EF4 A;  5K5O A;  3M3Y J;  3IU2 A;  4YFX F;  5E1W A;  4RDU A;  3HTS B;  3H9Q A;  2Z3K A;  3F8K A;  3W91 A;  2V1X A;  3JTK A;  1IN5 A;  1YW9 A;  2B4D B;  3OV8 A;  3KP5 A;  2J8R A;  3PB7 X;  4I99 C;  4AC0 A;  3L1P A;  2E1C A;  1XIX A;  4KOU A;  1X1P A;  4H6Z A;  2Q4Y A;  3UR3 C;  2HYJ A;  1Y6I A;  3CC2 I;  4P4I A;  2QLZ A;  2EFN A;  2R3S A;  3KI9 A;  2KFD A;  1NHA A;  3C2H A;  3J81 K;  1D3Y A;  3V4G A;  1MDM A;  1M4I A;  2K27 A;  2NNN A;  3RZO J;  1J4J A;  4J00 A;  4W97 A;  4EV0 A;  3OIO A;  1ETO A;  2HC9 A;  4Y49 C;  3VH9 A;  4FQG A;  1LDD A;  5J40 A;  2B5G A;  2VOD A;  4RMN A;  1ZG8 A;  1P4X A;  2HDD A;  3SXN A;  3S6G A;  2XV4 S;  1YVO A;  1W5T A;  4XMY A;  3WU0 A;  4WWV A;  2LOO A;  5LRK A;  4PXD A;  5AG6 A;  3D5R C;  3W6S A;  4C2U A;  5AIP A;  3PSF A;  4NQW A;  3D67 A;  4CAE A;  4CZZ A;  3P2F A;  5F46 A;  2AS5 F;  1NTC A;  4M73 A;  3ESW B;  1G4D A;  5E3O A;  2HKO A;  2W85 A;  2NAZ A;  4FIS A;  2FQ3 A;  3RIR A;  4UUS A;  2ZW6 A;  3FM3 A;  4PK2 A;  1Z9U A;  4UCP A;  4BHC A;  1XEB A;  4CAF A;  5BOX A;  3K4J A;  2XB5 A;  2R7U A;  2XC7 A;  3WTY C;  1ENH A;  1R43 A;  1BR1 A;  2DXQ A;  2ZEG A;  2L01 A;  2L7K A;  2OF7 A;  5CVJ A;  1I3A A;  2DBB A;  2QKM B;  5BMZ A;  3MQ0 A;  3W6J B;  1VIX A;  3H3V K;  1BPN A;  1IV8 A;  1ZLJ A;  1LNW A;  2VQH A;  4HW0 A;  3FZV A;  1Z4R A;  3BHX A;  1T8I A;  2RDP A;  3NE7 A;  4Y49 B;  1R23 A;  1XS9 A;  2R5Y B;  2HXI A;  1MIJ A;  2KJC A;  2OZH A;  1VQ8 I;  2R7Q A;  1QHH D;  2ACJ A;  5C4J J;  1E17 A;  2HS5 A;  2KLO A;  3KYC B;  4DZP A;  1Y1W J;  3QYB A;  4A3C J;  5C88 A;  5M5X J;  4RS2 A;  3OS1 A;  2OD5 A;  2LKX A;  2OOT A;  2YR2 A;  4AVB A;  1FSE A;  4Q7A A;  2HR3 A;  3FF5 A;  2V1U A;  2PJR B;  1TNT A;  3TP3 A;  5FJ8 J;  1UAA A;  1IY7 A;  5LBQ A;  4ZTF A;  3GLL A;  2ZBK A;  3OWT A;  2FE7 A;  1XGM A;  4PPZ A;  1QPI A;  1V5E A;  2K4B A;  1YQE A;  1WI9 A;  4UIA A;  3ROU A;  3CCS I;  1MBF A;  2YUS A;  3R61 A;  2DLL A;  4JYK A;  3ASO H;  3E3V A;  1B72 B;  4LK0 F;  4U7B A;  3WG7 H;  3MCZ A;  2P6F A;  5LYL A;  1J5Y A;  1WVR A;  3K9T A;  3WGI A;  1FLI A;  2M4G A;  5D4S A;  2AFM A;  3NWS A;  5F27 A;  4CCO A;  1NH3 A;  2GU2 A;  4QB9 A;  4KOS A;  3F3X A;  1K7A A;  5J1R A;  4HLX A;  4CHU A;  3BI1 A;  2CUE A;  5LYI A;  4KJZ A;  1UWY A;  2FSR A;  3FJU A;  1X1C A;  3J80 Z;  3A02 A;  5D4R A;  4CAX A;  4U9Y A;  3D7G A;  3D7D A;  3RO0 A;  4U0Y A;  1ETV A;  2IGN A;  4FE4 A;  1I5Z A;  4OIN F;  2BVM A;  1R00 A;  1D0Y A;  3SZG A;  1XMT A;  4KIG A;  1OCC H;  2JEV A;  4IAV A;  4PK4 A;  5LRG A;  3JTG A;  1KU7 A;  5EYR A;  2PVW A;  1WH5 A;  4P45 A;  1BI2 A;  1WQ2 A;  1K78 A;  5K1Y A;  5JR3 A;  4QIW N;  4R9M A;  2QYO A;  3RPU A;  1TC3 C;  3WTW C;  3E0K A;  1MND A;  2Z5U A;  4E70 A;  2KRH A;  2COB A;  3FXJ A;  3KZZ A;  3LA2 A;  4I6Z A;  4R6T A;  2ID3 A;  2M5W A;  3F8N A;  2TRT A;  4HNV A;  1YIO A;  4NQW B;  4XM3 A;  1IF1 A;  3L2V A;  3N05 A;  4C2Z A;  4B13 A;  4A6E A;  1OPC A;  3N97 A;  4ORF A;  4UUS B;  4JX6 A;  1JJ6 C;  2YU3 A;  1FMW A;  3PUB A;  5LHG A;  1REP C;  2F5E A;  3F8C A;  2PCU A;  1G3T A;  3JRB A;  2EK9 A;  4MFE A;  4XN0 A;  2TCT A;  1IW7 F;  3GYA A;  4AYB A;  4AB7 A;  3EPZ A;  4G12 A;  3B3C A;  4YFN F;  3O6B B;  1OZP A;  3VYU B;  3BTJ A;  3BQZ A;  1T2K A;  3W6V A;  4UY8 I;  3C7J A;  4MQV A;  4XNH B;  3J81 Z;  1V4R A;  3BLY A;  3AL0 B;  4MHD A;  3K2K A;  4ONU A;  2KT0 A;  4QUS A;  1LQ1 A;  2FCK A;  2FIW A;  5LRR A;  1O3Q A;  2GA1 A;  1IZ1 A;  1R1U A;  1SD4 A;  3H0D A;  2Y75 A;  1IN4 A;  1S72 I;  1XC5 A;  3GFM A;  1WKM A;  2HZD A;  3BCA A;  3I0T A;  3LL7 A;  4G7H F;  1Z3X A;  2B4D A;  4CCN A;  5CQG A;  2XRN A;  1B72 A;  2JLM A;  1OMI A;  3G1L A;  1JI8 A;  1Z91 A;  2AXL A;  1VQP I;  1F2P A;  3TO7 A;  1F9N A;  2ECB A;  5E1Z B;  5HOO A;  2L0K A;  1LFW A;  3CXP A;  1TWC J;  1U6G A;  3E5X A;  4OIR F;  5E8I A;  1Z5R A;  3IKV A;  5D8N A;  4IOC F;  2LRD A;  3DLA A;  3S1M J;  5LD2 C;  1QMU A;  2GOM A;  3E1S A;  1HDQ A;  1TT0 A;  4XRM A;  2L2O A;  2FRH A;  4IHT A;  3B6A A;  3DR6 A;  2L4A A;  2PJ0 A;  4MHP A;  2WAQ A;  3BY6 A;  2KZG A;  4GO1 A;  4BJ6 C;  1XRY A;  5JFR A;  2Q04 A;  2R5Z A;  4B5P A;  1IN7 A;  1X4P A;  1MK4 A;  4Z2Y A;  1XFO A;  5E20 A;  3MAJ A;  1LKX A;  4II3 A;  4L0Y B;  3EQL F;  5IYC J;  4A3M J;  3H8G A;  1V0C A;  1OKR A;  2K4J A;  2XKP A;  2BV6 A;  3HRM A;  4RAZ A;  4FET A;  2MLG A;  2Q44 A;  2ZW4 A;  2LG4 A;  1D1B A;  4UUT A;  3K4C A;  1PDN C;  1Z67 A;  4A3J J;  4L89 A;  2LC2 A;  1XSV A;  4CO8 A;  2D4P A;  1B6A A;  3VOD A;  2Z33 A;  3L9F A;  4G8X A;  2FA5 A;  1Y0U A;  2PJ2 A;  3VEP A;  4A5M A;  4U9Z A;  4IQJ A;  4CYP A;  2QSG X;  3O8H A;  1Z4E A;  4OC2 A;  2P6G A;  4IEJ A;  3PNY A;  4NUB A;  1YO5 C;  1SFU A;  3D1N I;  3PFY A;  1GHC A;  3EXN A;  4MCP A;  3R9F A;  2OCC H;  2V77 A;  3IAS 2;  4B4C A;  4EAT A;  2G3T A;  2PJ5 A;  1VQM I;  1P6R A;  1KGS A;  1Y0N A;  2CQX A;  2F8H A;  2JDC A;  5DUK A;  1R22 A;  2ZEF A;  5J1Q A;  4ZH4 F;  4ZDP A;  2PMZ N;  3RNZ A;  2DQL A;  1YLE A;  2KQR A;  5JVG F;  3DEW A;  1BJZ A;  7CPA A;  3O3K A;  2EV6 A;  4F52 A;  3I4M J;  3IU1 A;  4AWX B;  1RKT A;  3CMA I;  1YOV B;  4AVZ A;  3DV8 A;  4F7Z A;  4FD7 A;  4FD6 A;  4C3H J;  4A3B J;  4OC5 A;  5IP9 J;  4A94 A;  2AFZ A;  1JHF A;  2JRM A;  4ZZL A;  4X6A J;  5EC4 A;  2RKH A;  1X2M A;  3Q9S A;  4QPQ A;  2M0M A;  3HBL A;  2DA6 A;  4NGP A;  4IRG A;  4BGD A;  3A4C A;  3QP6 A;  1XF8 A;  2DTZ A;  4GS4 A;  3IRR A;  4MFQ A;  3PIO F;  1SD5 A;  2XVC A;  2J9A A;  3QPS A;  4M3G A;  1ZLK A;  3PNT A;  4B14 A;  3CLQ A;  5F0C A;  3JRD A;  2JUC A;  4BNC A;  1X12 A;  2H6B A;  2E34 A;  2VT3 A;  1VQ5 I;  1B4A A;  2P8T A;  3IEH A;  4IJA A;  2P0W A;  1SVL A;  2JVH A;  1YR0 A;  1N75 A;  4IL6 C;  3WE2 A;  5HVF A;  4MFP A;  4JP0 A;  1YS6 A;  3BR5 A;  1ZG7 A;  3R1K A;  2H09 A;  2VBW A;  3E6M A;  2ISY A;  1USS A;  2DI3 A;  2DA4 A;  3K1N A;  1UMQ A;  4TV7 A;  3L00 A;  2IA0 A;  2FSW A;  3IGR A;  2TDX A;  5HVQ C;  2VXK A;  2XF5 A;  3E6D A;  2NMT A;  5F09 A;  3A0H C;  4JK1 X;  2UWM A;  2KRF A;  3VWB A;  1W36 C;  3BG3 A;  4EGZ A;  1YHQ I;  2PIY A;  2XIG A;  2KDO A;  3PFI A;  3H8F A;  4KVX A;  2HZT A;  5JQ4 A;  5KK1 A;  5D5W B;  4U5Y A;  4LG0 A;  4BKX A;  3ZN0 A;  2PJ3 A;  3G1O A;  4UV9 A;  2ZPA A;  3U2R A;  1E3H A;  1DPU A;  5B66 C;  3L7W A;  3KP4 A;  4IK2 A;  4Z6Y A;  2YNE A;  3IP4 B;  4G6T B;  3BPX A;  2EIM H;  3E97 A;  3WC6 A;  4WK8 F;  3V8J A;  1Z6T A;  2Y9Y A;  3VSK A;  4C30 A;  1TXR A;  4ZDL A;  1W4M A;  5ELY A;  4A33 A;  4M9S A;  2PFB A;  2E7W A;  4ITV A;  3P9I A;  2GOX B;  1KU2 A;  3K1P A;  3V7C A;  1ZR2 A;  1XMK A;  2EFQ A;  2KJB A;  4BQA A;  4J3G A;  3RPQ A;  4KMF A;  1TTY A;  4MHZ A;  2L7M P;  3S14 J;  3BTI A;  4Q4Z F;  1HOM A;  3KZW A;  1TWH J;  2JMW A;  3DLJ A;  1J09 A;  5M5W J;  1I6H J;  1X1D A;  4GYG A;  4L18 B;  4Q5S F;  2UXN A;  2Y0M A;  1IUF A;  2D5V A;  1ETX A;  3E5Q A;  5K7H A;  1VGY A;  3FM5 A;  2LBF B;  1IOF A;  1NMT A;  1PUA A;  4XSZ F;  3EET A;  4F93 B;  3TCV A;  1LE8 B;  1JKQ C;  3K4B A;  4E0A A;  3F22 A;  3F0C A;  2XAQ A;  1AKH A;  4KUA A;  3SHP A;  3MWM A;  5LYD A;  4CSW A;  1V54 H;  3F8M A;  2B0L A;  2C6P A;  2OQR A;  3BQY A;  1UST A;  2KIQ A;  3HOS A;  2WAQ N;  1P7J A;  2BY2 A;  4WWC A;  5LEJ A;  4RGX A;  2FX0 A;  1G8X A;  2MSY A;  2P5L C;  2NVU B;  2L5Q A;  3FED A;  3HRS A;  2EIN H;  4XN3 A;  2ELJ A;  2MAB A;  2VQL A;  4ENM A;  1DP7 P;  4QC6 A;  2ECC A;  2DMP A;  1E0E A;  1CG2 A;  1ZG5 A;  1Z2L A;  2JJ7 A;  2LP0 A;  3B6C A;  3UNG C;  2QYV A;  4MI4 A;  1X1A A;  2Z3M A;  3BJ7 A;  4UEE A;  2BOL A;  2Q2E A;  3OL3 A;  2R1I A;  4PK3 A;  2NNY A;  3FBN B;  4XOR A;  4EVY A;  3GFJ A;  1D1C A;  4EMS A;  2CS3 A;  1MBE A;  3B35 A;  3SEZ A;  1IN6 A;  3DLL F;  1D8K A;  2E7X A;  3BG5 A;  1GYT A;  1RO5 A;  3QP5 A;  1TF8 A;  2MFZ A;  3CF5 F;  2MC3 A;  1CF7 A;  5H6Q A;  3IFE A;  3CES A;  5LEK A;  1GVJ A;  3WOD F;  4HZF A;  4V19 K;  1GHE A;  5EGO B;  4A3L J;  3ABM H;  1AYE A;  2VL1 A;  4IX7 A;  4N9H A;  1DPR A;  4LG3 A;  3NWT A;  1VQK I;  1ERD A;  2ESH A;  3FWE A;  3JW4 A;  3CCY A;  3NE8 A;  1O57 A;  3BJ6 A;  4BJ5 C;  1TL8 A;  3F6V A;  4XL9 A;  2QQB A;  2L9S A;  3HZJ A;  2A05 A;  3KLO A;  5HDG A;  2DK5 A;  3IHU A;  2LKS A;  1V3F A;  1UHS A;  5EZH A;  3GO5 A;  2R5Y A;  4LG0 B;  2EFW A;  1XDU A;  2ESN A;  2XF7 A;  5A2Q Z;  5KCM A;  4ASN A;  3OIQ A;  4P10 A;  4B5P B;  3GY9 A;  2JTV A;  1BLL E;  3FNC A;  4M3F A;  3A01 A;  4B1R A;  4CPA A;  3FKJ A;  3OYB A;  2CGP A;  1H9G A;  5GAG J;  4XBF A;  5LGT A;  4OOI A;  1U8B A;  1KYW A;  2VXD A;  2XEG A;  2W48 A;  3V8L A;  4QLC U;  4I09 A;  2HGC A;  2HEO A;  3QU6 A;  3B3S A;  4MHN A;  4BHB A;  3KZI C;  1SEU A;  2F5D A;  2HQA A;  5J4V A;  1LJ9 A;  3WTU C;  3SI2 A;  2Z3P A;  3ZQL A;  2QEN A;  5C3E J;  2B9S A;  3GTO J;  3DPL C;  4CUG A;  4BDZ A;  4PSW A;  4EM2 A;  1BL0 A;  3I59 A;  3C2G A;  2AO9 A;  2DFF A;  5A2Q K;  2FJ1 A;  1WWZ A;  3B73 A;  5J3L A;  3CPA A;  1RIO H;  5DUI A;  1F1Z A;  2HB6 A;  1P0H A;  4D7M A;  2FL4 A;  3LWU A;  4XON A;  2A68 F;  2MD5 A;  3G73 A;  4G7Z F;  2VOO A;  1RZ4 A;  2M0C A;  1M44 A;  1VKC A;  1XPX A;  2OJE D;  3ELK A;  2FU4 A;  4ZZD A;  2OUM A;  5HS7 A;  4B48 A;  5DWN A;  1NG6 A;  4NSQ A;  5EMI A;  4CGN A;  3VWD A;  3LSP A;  2A6H F;  2HVS A;  2N8G A;  4DJL A;  1VI0 A;  1W36 D;  4F92 B;  2HDW A;  4LFU A;  5F64 A;  4M6H A;  4BUP A;  5FO5 A;  4AVC A;  1R71 A;  3MN8 A;  3HOW J;  2EBJ A;  2M45 A;  2DJN A;  2OV7 A;  3FXU A;  3W2W A;  1IC8 A;  3DDD A;  3S9M A;  2ZEL A;  3KEO A;  1OCZ H;  2AFX A;  2QVP A;  2LNB A;  4XKC A;  3V42 A;  3MRU A;  4B5O A;  1J7K A;  4GCV A;  3DWL E;  1BR2 A;  1ZO0 A;  3D7H A;  5JHF A;  2O8X A;  1Q2C A;  3FEE A;  4KVO E;  1PJR A;  3DEU A;  4B44 A;  2DA2 A;  3HC7 A;  2CJJ A;  2XSD C;  2JUG A;  3EUH C;  5FLV A;  3LOC A;  4KIS A;  2X48 A;  2JPB A;  1WSU A;  4A0Z A;  5LRJ A;  2IAI A;  5M3M J;  2ELH A;  3DF8 A;  5H20 A;  4HLY A;  2IGO A;  3IWW A;  3KZY A;  3FXR A;  4L5I A;  1LCP A;  3KEY A;  3PFE A;  4OC1 A;  2C6G A;  3E6C C;  3PBB A;  1PUF B;  1KUX A;  2EIJ H;  4M6X A;  1KU3 A;  1WJF A;  1XMA A;  5E1X A;  2B3U A;  4NB5 A;  3VYR B;  3ISZ A;  3P2H A;  5L3C A;  4YFJ A;  1FX7 A;  2O4H A;  2XRO A;  4AU7 A;  1UJ8 A;  4CYC A;  3EYI A;  2V6C A;  1XGO A;  3OYF A;  2FML A;  3GLX A;  3PBE A;  4Z65 A;  4EME A;  2V8D A;  2WC2 A;  2E2H J;  3D2M A;  1F4K A;  1ON2 A;  2HU9 A;  1PUF A;  3KP3 A;  3KR5 A;  1MSE C;  2L7Z A;  2GM4 A;  2Z3Y A;  4G7O F;  3A2K A;  1YLF A;  4UHT A;  1FZP B;  2R8V A;  1GLN A;  2YS9 A;  2XPV A;  3D5L A;  2ZXH A;  4HOB A;  1HA8 A;  2ZME B;  3LSM A;  4KOV A;  3CZX A;  6CPA A;  1I27 A;  4C2T A;  4OLL A;  2NOJ B;  1E3P A;  2E5N A;  2NVT J;  4BY7 J;  1DU6 A;  4DZJ A;  4R8H A;  3OR1 C;  3LQQ A;  3FK6 A;  3K9U A;  2GFQ A;  2DPT A;  3FIX A;  1JXS A;  3FMS A;  5K7Z A;  5FKN A;  3VAR A;  3HB9 A;  3T1B A;  1H88 C;  2JBK A;  3H3Z A;  4UCM A;  3CUO A;  3CJR B;  4BQO A;  1DGW Y;  3BT9 A;  3TX8 A;  5CVI A;  2JA7 J;  3IWG A;  4LIT A;  4YEJ A;  3CDL A;  3JSO A;  3CCE I;  3CP8 A;  1BO4 A;  1FT7 A;  2WSA A;  4FX0 A;  3NA6 A;  1A04 A;  4NEX A;  4CYQ A;  1M1E B;  3IL2 A;  4PFP A;  4MTD A;  3RAM A;  2FE3 A;  3DBL B;  3SZP A;  1KYZ A;  2HFH A;  3W2V A;  3ZQQ A;  5FLM J;  3OYH A;  1CP7 A;  1GVD A;  3ULQ B;  3OYE A;  4UVA A;  2Z99 A;  1JGG A;  3ABT A;  4P44 A;  1U5T C;  4LOC A;  1N25 A;  3F9K A;  3RPU D;  1N77 A;  2EWN A;  2YU9 J;  1HW5 A;  2HPI A;  1RRJ A;  1YJ9 I;  5F6F A;  2GRE A;  1XTA A;  4IHX A;  3H5N A;  3RZA A;  4ZYH A;  3ZR8 X;  1X3W B;  2Q0O A;  2Q7S A;  1BI1 A;  2BY1 A;  4R8F A;  3RYR A;  1MJA A;  1RXT A;  1NG7 A;  1QU3 A;  2FBH A;  4RM2 A;  3DGV A;  1VQL I;  1MMS A;  2XEJ A;  3LQR A;  2AE6 A;  4R7M A;  1RC9 A;  2X0L A;  1KQ9 A;  3CP2 A;  2DFE A;  2GAN A;  4YRH A;  4MHG A;  2VN2 A;  3J80 K;  3TO9 A;  2COM A;  2EO8 A;  2W24 A;  3D68 A;  2DEA A;  2WWY A;  5FD5 A;  1FY7 A;  4L9V A;  1I1G A;  3E6B A;  1HDD C;  2JK3 A;  2I00 A;  3A1Y A;  3TMO A;  2EIK H;  5TIS C;  1ETY A;  3ASN H;  3U9G A;  4BQN A;  4H89 A;  2F5C A;  3OYL A;  4ETS A;  4QBJ A;  2C1C A;  3BI0 A;  4RGR A;  1R1T A;  2H94 A;  1JKR C;  4UBR A;  1TBX A;  2XB0 X;  1LFB A;  3ZMZ A;  2VKE A;  3PSI A;  3GVA A;  1A35 A;  3CO7 C;  3I3G A;  4E7K A;  3OWC A;  2H8W A;  4WX9 A;  3SJG A;  2JN6 A;  2ZNZ A;  1Y7R A;  1OR7 C;  1Z6R A;  4A69 C;  2VUM J;  5K8N A;  4X3R A;  3K2A A;  1SVO A; 
#chains in the Genus database with same CATH homology
 1KZF A;  4CCL A;  3KKW A;  4NQW B;  5KTC A;  4PV6 A;  4XM3 A;  1QSO A;  3L2V A;  5F49 A;  3N05 A;  2I79 A;  3DU6 A;  3L2W A;  2AJ6 A;  2FS5 A;  4B13 A;  2Z0Z A;  4C2Z A;  2FT0 A;  1LRZ A;  2VQY A;  2VKD A;  1X1B A;  3A9L A;  3G3S A;  3JVN A;  1QSN A;  2IGM A;  1FMW A;  2MD0 A;  4N4N B;  4BEH B;  2WUU A;  3PUB A;  2HNH A;  1B6B A;  2R7S A;  4HNX B;  4KOT A;  4C7H A;  2PR8 A;  3ZJ0 A;  3DTK A;  1T0F C;  4XN0 A;  3OYM A;  2VB6 A;  5AG7 A;  2HQY A;  4BU2 A;  2X85 A;  3TFY A;  2XDV A;  1Z7L A;  3GYA A;  4NCZ A;  4AYB A;  3D8P A;  3EPZ A;  4AB7 A;  4E7Z A;  1YRE A;  2VPL A;  2OB0 A;  1OZP A;  4BDY A;  3VYU B;  2CV2 A;  3D5S C;  4XPD C;  5A28 A;  2BW3 A;  4J01 A;  2IS6 A;  2VZY A;  2CW7 A;  2RRE A;  4XNH B;  4MHD A;  3BLY A;  3AL0 B;  4ONU A;  3D3S A;  4QUS A;  2FCK A;  2FIW A;  1MNE A;  3PZJ A;  4BBH A;  4C7I A;  2Z3O A;  2ZW7 A;  2VQC A;  3H0D A;  2JA2 A;  4KSA A;  3F5B A;  4NC7 A;  4Y4R A;  3OS2 A;  3FXT A;  3OS0 A;  3HUG B;  2M3A A;  2Z1D A;  2HZD A;  3BCA A;  3HKZ A;  3LL7 A;  2QKL B;  1Z3X A;  2B4D A;  4CCN A;  2GE3 A;  5CQG A;  5AG6 A;  5G1Z A;  3UY5 A;  5GCN A;  2JLM A;  2IGK A;  5IB0 A;  1JI8 A;  2M4K A;  1LDK B;  3TO7 A;  5KHD A;  5HOO A;  3CXP A;  2CMP A;  3DEE A;  3OYJ A;  5FRM A;  4LIV A;  2LRD A;  2DJI A;  3DLA A;  3IUO A;  3PJR A;  5LD2 C;  3VDX A;  2GOM A;  1MMG A;  3E1S A;  4IUS A;  1TT0 A;  4B11 A;  2L2O A;  4QPO A;  2K9M A;  1DQU A;  3L2R A;  3DTI A;  3DR6 A;  4RLQ A;  3H5Z A;  2WAQ A;  4XLC A;  4JJX A;  4A30 A;  1YVK A;  3TE4 A;  4BJ6 C;  4PFO A;  3SDB A;  1Q2D A;  2XAU A;  2WPX A;  4HSR A;  5KNL A;  3CJQ B;  5CQE A;  2Q04 A;  3ZCO A;  4KLV A;  4B5P A;  4CAV A;  1X4P A;  2UUZ A;  2FUG 2;  1MK4 A;  2X1C A;  1LKX A;  2CW8 A;  4II3 A;  5CPR B;  3OL4 A;  4OAY A;  2CH0 A;  1IB1 E;  1V0C A;  5E96 A;  1PYV A;  1B87 A;  4MFZ A;  4BMH A;  1G59 A;  2VBQ A;  5G20 A;  4UCN A;  3FHN A;  4FET A;  2Q44 A;  2BW3 B;  4PJN A;  2ZW4 A;  2LG4 A;  1D1B A;  4II9 A;  3K4C A;  2VL8 A;  2H5M A;  2DPS A;  2PQ8 A;  3M1C A;  4PJL A;  3PP9 A;  3GKR A;  4L89 A;  2LC2 A;  2X7B A;  2EUI A;  2D4P A;  4CCM A;  1YGH A;  4PJM A;  4U9Z A;  4CA0 A;  4IQJ A;  1IYL A;  4NNJ A;  4CYP A;  1LFP A;  3MKW B;  1Z4E A;  2P6G A;  4DBQ A;  3PNY A;  4NUB A;  3PFY A;  4BEH A;  1IIC A;  3EXN A;  3R9F A;  4CYN A;  2L9N A;  5A27 A;  3IAS 2;  2G3T A;  4EAT A;  3EC4 A;  2JDC A;  3DPT A;  2HVQ A;  1X4O A;  2CNS A;  4UWJ A;  4XNF A;  2K5T A;  4ZDP A;  4XR6 A;  4DNC A;  2R7O A;  1YLE A;  2KQR A;  2WA0 A;  2YNC C;  4HNT A;  1PU9 A;  4F52 A;  1AA7 A;  4C2Y A;  2I8D A;  3IU1 A;  3IWG A;  1D0Z A;  4IKF A;  2ZW5 A;  1QST A;  3MKY B;  4AVZ A;  4R79 A;  4FD7 A;  4FD6 A;  4Q38 A;  5FRN A;  3H35 A;  5F47 A;  1QSM A;  4ZGY B;  2W1O A;  2YNC A;  5EC4 A;  3HL2 A;  2GIV A;  4QPQ A;  4CGL A;  1WJ5 A;  2M0M A;  3RTR A;  4Q36 A;  2IS1 A;  4B12 A;  3CF2 A;  1I1D A;  2Q1Z B;  4BGD A;  2E5Z A;  4E2A A;  3A4C A;  3VYS B;  1VHS A;  1XF8 A;  4B47 A;  3HPH A;  4GS4 A;  4KVM E;  4MFQ A;  2HVR A;  5JPH A;  4CGO A;  1MMA A;  2WBM A;  2W00 A;  3PNT A;  3K4M A;  2WAD A;  2X1D A;  1KUY A;  3R9G A;  4B14 A;  5AG5 A;  4F55 A;  3ZZI A;  4E7J A;  3I9S A;  4D1Q A;  5I0C A;  1WJD A;  4X5K A;  1D1A A;  2P0W A;  4E7L A;  5F48 A;  2JVH A;  1YR0 A;  1N75 A;  4E7I A;  1MMN A;  3MKZ A;  3EY5 A;  4UFX A;  2REE A;  4MFP A;  4OAD A;  4LUA A;  4CRZ B;  2VJ5 A;  1WK4 A;  3R1K A;  4A95 A;  3BC8 A;  1UG0 A;  2B58 A;  4F0X A;  2KZV A;  3DKX A;  4FD5 A;  2F6C A;  2V4J C;  2HV2 A;  4JOM A;  3SXO A;  3WR7 A;  4DIQ A;  4KT6 A;  3U21 A;  2OU2 A;  3IGR A;  5HVQ C;  4ZTJ A;  2VXK A;  1OLT A;  2XF5 A;  2ARH A;  2NMT A;  2PC1 A;  5J8F A;  4Y33 A;  2YND A;  4M85 A;  2UWM A;  4XLE A;  4YGO A;  3VWB A;  4CZC A;  2Q7B A;  1W36 C;  4GRI A;  4I49 A;  4OAE A;  2KDO A;  3FRM A;  2R7X A;  4KVX A;  4P1W A;  1YE9 A;  4C9Y A;  5JQ4 A;  4U5Y A;  4KOY A;  2E60 A;  4PUS A;  2IL4 A;  2D4O A;  1Z21 A;  4HEA 2;  3AKZ A;  4BE1 A;  2ZPA A;  2M7B A;  3FDY A;  3KX2 A;  1P4N A;  2VEZ A;  2YNE A;  3MMY B;  1U6M A;  3IWE A;  3CXQ A;  4ZJZ A;  4C68 A;  2LY1 A;  2VXZ A;  3IP4 B;  4G6T B;  2BVL A;  2W82 A;  2X1E A;  3MD2 A;  3T9Y A;  2R7R A;  3V8I A;  2K5C A;  3EFA A;  3RYO A;  3VSK A;  3OR2 C;  4C30 A;  1X19 A;  4ZDL A;  4E7S A;  2XSJ C;  4UFV A;  1LVK A;  2CUZ A;  4MFL A;  4A33 A;  5FVJ A;  4DBR A;  4K30 A;  4ITV A;  4KOW A;  2GOX B;  2Z3L A;  3LSI A;  4J3G A;  1V5F A;  2LRE A;  4MFK A;  4XLF A;  1S7L A;  1NSL A;  1TZL A;  2M7A A;  3DTE A;  2F5I A;  4BJT A;  3LSH A;  5G22 A;  1J09 A;  1Y9K A;  1X1D A;  4PJJ A;  4KUB A;  2ZFU A;  4DGW B;  2Y0M A;  1MW7 A;  2VZZ A;  3TOB A;  1M1D A;  3DR8 A;  4HNW B;  3LFU A;  3S6H A;  4E8O A;  4FAS D;  3FBU A;  3H9J A;  2LBF B;  5H86 A;  4IZZ A;  1IYK A;  1NMT A;  1PUA A;  3QAH A;  4F93 B;  3TCV A;  1S5K A;  3HPG A;  3K4B A;  4E0A A;  1I21 A;  3TO6 A;  4XPK A;  1IRX A;  4U87 A;  5BWA B;  3SHP A;  2ZXV A;  1WJC A;  4KUA A;  1U0J A;  1P9Q C;  4CSW A;  4XQF A;  4KOR A;  2PR1 A;  2J8N A;  3HOS A;  3IAM 2;  1ZEL A;  4H4K C;  2RNG A;  3OYC A;  3JUW A;  3W3C A;  1T95 A;  4HKF A;  1G8X A;  3OYA A;  4MLO A;  3HXL A;  4Y3O A;  1FMV A;  2L5Q A;  3VYT B;  2QIR A;  4DJA A;  4XN3 A;  3S8P A;  2WB1 A;  2WAF A;  1SAU A;  2ELJ A;  2MAB A;  2VQL A;  4HST A;  4QC6 A;  3S3N A;  1E0E A;  1WJB A;  1ERD A;  1KUV A;  2A4N A;  1YX3 A;  3OYK A;  3UNG C;  3FYN A;  4KSF A;  3G8W A;  1K6Y A;  3HG9 A;  1X1A A;  1BO4 A;  4MI4 A;  2Z3M A;  3BJ7 A;  2DT7 B;  2BOL A;  3OL3 A;  3EUA A;  4JQF A;  2W4S A;  5HNH A;  2JVG A;  2RQQ A;  2WY8 Q;  2R1I A;  4JXQ A;  3FBN B;  4XOR A;  4L8A A;  4PK3 A;  4EVY A;  5C82 A;  1SFK A;  1D1C A;  4UWI A;  3OIP A;  2CS3 A;  2F5V A;  2G0B A;  4UFW A;  4KS9 A;  3SEZ A;  1Z3Y A;  1RO5 A;  3DPU A;  2MFZ A;  4NC8 A;  1S9H A;  2LH9 A;  2Q2E B;  3EUK L;  3CES A;  4BQQ A;  3SEQ A;  2BEI A;  3H4Q A;  4A31 A;  4X0G A;  2KPM A;  1Y56 A;  2X6W A;  3QYE A;  1WFX A;  1GHE A;  2ATR A;  2HUZ A;  3D2P A;  4NXY A;  3PL8 A;  3FB3 A;  4IX7 A;  2PMZ A;  4FD4 A;  2LYC A;  4LG3 A;  3NWT A;  4PSX A;  4XKB A;  4BE2 A;  1I12 A;  2A5W A;  3OOU A;  2C27 A;  3ZGK A;  2R98 A;  4NF1 A;  1CJW A;  1MJ9 A;  4BJ5 C;  5LFA A;  2MYS A;  4XL9 A;  2REF A;  3W6X A;  2L9S A;  4OAZ A;  2B5G B;  2WPW A;  4MY3 A;  2KP6 A;  1YX5 A;  1NE9 A;  2X6Y A;  4RI1 A;  2VJI A;  4CCJ A;  4MFJ A;  3K70 D;  4CYO A;  2VKH A;  2XF7 A;  3OYD A;  4XKV A;  5KCM A;  3OIQ A;  4B5P B;  2V6E A;  3AL0 C;  3GY9 A;  3FNC A;  4CGP A;  4HPQ A;  1K4J A;  3M8J A;  2VAS A;  4D9J A;  4CH7 A;  1KON A;  2UV1 A;  3FKJ A;  3OYB A;  4C2X A;  2Z2S B;  2QEC A;  2VXD A;  1S60 A;  3DNS A;  3N7Z A;  1VZ0 A;  2HQA A;  3GBG A;  2WY7 Q;  3E0J B;  5HMN A;  3F0A A;  2Z3P A;  2DOA A;  3L2U A;  5H84 A;  1IID A;  2FXF A;  3DPL C;  4P5O A;  4LIU A;  4XLA A;  4CUG A;  4YRV A;  4BDZ A;  1DGR M;  2CFO A;  2VJJ A;  4PSW A;  2IS4 A;  2AQE A;  3C2G A;  2IXS A;  1WWZ A;  3RQ4 A;  1YK3 A;  2DCE A;  2Z16 A;  2VLA A;  3J7A Y;  3T90 A;  2HPM A;  1P0H A;  2EVN A;  2FL4 A;  1UEL B;  4JD6 A;  2R7W A;  3AFH A;  4XON A;  3RSN A;  2PJR A;  4YEL A;  5KTD A;  4HG2 A;  4CGM A;  3SYT A;  5AG4 A;  1MMD A;  3FBI B;  2B4B A;  4AVA A;  5J8C A;  1M44 A;  1VKC A;  2CV0 A;  4JLY A;  3K70 C;  2OUM A;  4B48 A;  5DWN A;  2QML A;  1NG6 A;  4NSQ A;  4CGN A;  5KTA A;  3VWD A;  2HVS A;  1N78 A;  1XE4 A;  2Q4V A;  4XPD B;  3KYL A;  3CXS A;  1W36 D;  4F92 B;  2HDW A;  5HH1 A;  4BE0 A;  1DP3 A;  4BUP A;  1Y9W A;  4ZDO A;  2J8M A;  3TOA A;  4AVC A;  2K3P A;  2K9L A;  2VQG A;  2DXI A;  2BL1 A;  4XKW A;  3S32 A;  4ANJ A;  2E1M C;  3QB8 A;  4F91 B;  3DDD A;  2OV7 A;  3W2W A;  3W2A A;  2R7H A;  3DSB A;  3VWE A;  1S7F A;  3ONQ A;  2V26 A;  2JSP A;  2IS2 A;  4XKC A;  4XLH A;  3V42 A;  4BS9 A;  4B5O A;  4B10 A;  3DWL E;  1BR2 A;  3H5A A;  3K4N A;  5JHF A;  1Q2C A;  3K4K A;  1ZO0 A;  3ZXS A;  2BSW A;  4KVO E;  1PJR A;  1CM0 A;  4B43 A;  4B44 A;  2DT6 A;  3EO4 A;  3HC7 A;  3S6K A;  2Z11 A;  2KHM A;  3QOD A;  4A2Z A;  2JUG A;  3EUH C;  2ZSI B;  4KIS A;  3IU2 A;  2R7T A;  2RC4 A;  3F8K A;  3DU5 A;  3H9Q A;  2PDO A;  2Z3K A;  4HNY B;  3W91 A;  4ZC3 A;  3JTK A;  5HNF A;  2B4D B;  3H5R A;  2V7F A;  5HLT A;  3OYI A;  2J8R A;  3LSG A;  2IGO A;  4MBU A;  2CNT A;  2FIA A;  3TT2 A;  2Z3N A;  1XIX A;  3VSL A;  3K10 A;  4KOU A;  5IV0 A;  3DQV C;  1WJA A;  3KEY A;  3BJ8 A;  1QSR A;  4UA3 A;  2O28 A;  3OY9 A;  4H6Z A;  3I3L A;  2Q4Y A;  3UR3 C;  1KUX A;  1Y6I A;  2B3U A;  1WJF A;  2CUJ A;  3B8G A;  2A6T A;  3CMM A;  5AGE A;  2KRC A;  3VYR B;  5CNP A;  3R9E A;  3C2H A;  3MGD A;  3P2H A;  4YFJ A;  1M4D A;  4AU7 A;  4BAC A;  1M4I A;  2PRB A;  3OYF A;  5ISV A;  3LD2 A;  4ZYA A;  4CCK A;  4J00 A;  1J4J A;  1SQH A;  3D2M A;  4LX9 A;  2HU9 A;  2OH1 A;  4QVT A;  1TIQ A;  4Y49 C;  4R3K A;  2CY2 A;  1WJE A;  2B5G A;  3A2K A;  2X6X A;  1L0C A;  4RMN A;  3SXN A;  2R8V A;  3S6G A;  1GLN A;  1YVO A;  2B3V A;  2KL4 A;  3D5L A;  4XMY A;  2ZXH A;  3TL4 X;  3RCO A;  2MC4 A;  2CV1 A;  4A32 A;  1HA8 A;  2LOO A;  3K4L A;  3LSM A;  3S3M A;  4HRI A;  3D5R C;  4KOV A;  4C2U A;  4RM3 A;  2ZSH B;  3OMY A;  2Q0Y A;  4C2T A;  4OLL A;  3BLN A;  3PSF A;  2NOJ B;  4XNH C;  5G21 A;  4CAE A;  2P6E A;  2E5N A;  3LOD A;  3P2F A;  4CRY B;  1V5G A;  5F46 A;  1UFH A;  3OR1 C;  1EA3 A;  4E6K G;  2ZW6 A;  3K9U A;  4IF5 A;  3LMM A;  4PK2 A;  4MJ8 A;  5IX3 A;  4E7H A;  1Z9U A;  2DPT A;  2OZU A;  3FIX A;  4XOP A;  1XEB A;  2BUE A;  4E4H A;  4UCP A;  2LY2 A;  4CAF A;  2OC6 A;  2VJ4 A;  3K4J A;  2R7U A;  2CXA A;  4UCM A;  2XC7 A;  4DOZ A;  5EBV A;  3BG6 A;  3C26 A;  1BR1 A;  1YX0 A;  4JXR A;  3CJR B;  4BQO A;  1DGW Y;  2DXQ A;  4KOX A;  2L7K A;  3ZRG A;  3S6F A;  2XF6 A;  2G3A A;  4JWP A;  2QKM B;  2V1N A;  2ZXI A;  4LIT A;  4YEJ A;  5FRO A;  3BG7 A;  3CP8 A;  3CZ6 A;  4N4O B;  4HNU A;  2VQH A;  1MJB A;  1Z4R A;  2WSA A;  3NE7 A;  4IQ4 A;  4Y49 B;  3QOE A;  4NEX A;  4CYQ A;  2R4G A;  2OZH A;  2KCW A;  2R7Q A;  1QHH D;  4PFP A;  3OYG A;  3S93 A;  2X51 A;  3TTH A;  3W2V A;  3ZQQ A;  2KLO A;  3OYH A;  3OYE A;  3QYB A;  5C88 A;  3R96 A;  4CS0 B;  2R7V A;  4RS2 A;  2O5R A;  3OS1 A;  3F9K A;  1N77 A;  3RPU D;  2LBF A;  1ON0 A;  4R3L A;  2HPI A;  1S7K A;  4AVB A;  3H5N A;  4BL0 B;  2PJR B;  2VI7 A;  1R6R A;  4RLF A;  3ZR8 X;  1UAA A;  4CAW A;  3TBI A;  4KIT B;  3QYF A;  1D0X A;  3OWT A;  2AQF A;  4ZTF A;  2FE7 A;  4M3S A;  1MJA A;  2F4I A;  1V5E A;  1RXT A;  1NG7 A;  4XOT A;  3R95 A;  1QU3 A;  2PSW A;  2Y0S A;  2WAE A;  1M4G A;  4RM2 A;  5DWM A;  2KMU A;  4AG7 A;  4F3Q A;  2OZG A;  4U7B A;  2P6F A;  2Z10 A;  4ORF A;  1QHG A;  4R57 A;  2AE6 A;  3DKY A;  3CP2 A;  2M4G A;  3G2B A;  1S7N A;  4MY0 A;  2GAN A;  4YRH A;  4XPL A;  3NWS A;  4CCO A;  4QB9 A;  2V9K A;  3TO9 A;  4II2 A;  4KOS A;  4F0Y A;  2JDD A;  3K6G A;  4KLW A;  2YGW A;  4ZBG A;  1FY7 A;  4KJZ A;  2FSR A;  1X1C A;  1Q2Y A;  4CAX A;  2I00 A;  3A1Y A;  3LSK A;  2VIX A;  3TMO A;  4H6U A;  4U9Y A;  4R87 A;  2IGN A;  4BQN A;  4H89 A;  4BXF A;  1S3Z A;  2E1M B;  3OYL A;  2BVM A;  3PGP A;  4QBJ A;  4B3X A;  1D0Y A;  3SZG A;  1XMT A;  2CNM A;  4OWR B;  4AG9 A;  2JEV A;  4UBR A;  4PK4 A;  2W7N A;  3I9V 2;  3PSI A;  3HOT A;  3W6S A;  3H9G A;  3S3O A;  3I3G A;  4R9M A;  4E7K A;  3OWC A;  5TGT A;  4KZT A;  3L2Q A;  4F6A A;  1BR4 A;  1BOB A;  3E0K A;  1MND A;  1Y7R A;  2KRH A;  1R57 A;  1OR7 C;  3BCB A;  1N71 A;  5CKT A;  3PNV A;  3OYN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...