2P0WA

Human histone acetyltransferase 1 (hat1)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
319
structure length
319
Chain Sequence
AEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase type B catalytic subunit
publication title The crystal structure of human histone acetyltransferase 1 (HAT1) in complex with acetylcoenzyme A and histone peptide H4
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2p0wA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2p0wA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 2p0wA01
1M4GA 1N71A 3S6FA 1PUAA 4FD4A 3R95A 2REEA 2FL4A 1WK4A 5EC4A 2F5IA 2PRBA 3TO6A 2P6EA 3EXNA 3EC4A 4AG7A 4YGOA 4MY3A 3G8WA 4OLLA 4JLYA 5KTDA 1MJAA 4HKFA 3BJ7A 3TOBA 4QC6A 3R1KA 2Z0ZA 3CXQA 4CRZB 4NF1A 1S7NA 4JXQA 3R9EA 3BJ8A 1Z9UA 4L89A 4NEXA 1KUXA 5DWNA 2B3UA 3DDDA 4KUBA 3EO4A 3PGPA 4AG9A 4CAVA 1YVOA 3SHPA 3VWDA 4KZTA 3LD2A 5F49A 2G3AA 3WR7A 4LUAA 2A4NA 3ZJ0A 3KKWA 3TFYA 2ZW7A 4JJXA 4QVTA 2BL1A 2JDCA 4R3LA 2QECA 2R8VA 5GCNA 3TOAA 3EY5A 1KUYA 3S6HA 4E0AA 5KTCA 4KORA 2Q4YA 5HH1A 2ZW4A 1Z4RA 1LRZA 1XIXA 2PQ8A 3TTHA 4H6UA 3QAHA 2B4BA 3F8KA 2VZYA 1S7FA 1Q2CA 5H84A 2D4PA 3TT2A 3RYOA 4AVCA 4I49A 2VXKA 4U9ZA 4NSQA 2HQYA 2BEIA 2FE7A 3VWEA 1P0HA 4J3GA 4HNYB 3F5BA 4R3KA 3DR6A 1YK3A 3DSBA 3K9UA 2BSWA 3R9GA 4E2AA 1Q2YA 4OAEA 4AVAA 2EUIA 1Z4EA 4M85A 4H89A 4KLWA 2JLMA 1I12A 2B58A 2ATRA 4HNWB 4KOSA 2X7BA 2FIWA 3I3GA 3S6KA 4KVOE 3FBUA 1YGHA 2PSWA 2P0WA 2VI7A 1I21A 3PP9A 2ZW6A 3JVNA 1CJWA 4GS4A 3GKRA 1TIQA 4KOUA 2AE6A 1VHSA 4PK3A 3D2MA 1SQHA 4UA3A 1S3ZA 1MK4A 4OADA 3CXSA 3FRMA 2CNTA 4FD7A 5F48A 2K5TA 1QSOA 1S5KA 5I0CA 4MY0A 3E0KA 2B4DB 5ISVA 4AB7A 4MI4A 2G3TA 4M3SA 4RS2A 4RI1A 1FY7A 4JD6A 3UY5A 3DR8A 1I1DA 4H6ZA 2JDDA 1IIDA 1RXTA 2J8NA 1CM0A 2C27A 4YFJA 1QSNA 2Q44A 4KOXA 5CNPA 3R9FA 2J8MA 2AJ6A 5F47A 1VKCA 1P4NA 2B4DA 3F0AA 3PZJA 4KOYA 3SXOA 2DXQA 2IL4A 1Y7RA 3R96A 2B5GB 4JXRA 2QMLA 1L0CA 2I00A 4IF5A 4ORFA 4IUSA 3QB8A 4FD6A 4FD5A 3GY9A 2KCWA 3N7ZA 5HMNA 1B6BA 2BUEA 1YR0A 2HV2A 2OZHA 2FSRA 1S7LA 4PSXA 3H4QA 5E96A 2B5GA 3I9SA 4U5YA 5IX3A 2VQYA 2VBQA 3TE4A 2PC1A 3EFAA 4CS0B 2OU2A 1IYLA 4UWJA 3TO7A 1S7KA 1MJ9A 4U9YA 4CAWA 3D8PA 3W6SA 5IB0A 2Q04A 3FNCA 3SXNA 3D2PA 5JQ4A 2R1IA 4Y49B 4MBUA 4KVXA 2Q7BA 5J8FA 2Z10A 3S6GA 1BO4A 3BLNA 2Q4VA 1NSLA 1KUVA 4UBRA 4ZBGA 3P2HA 3NE7A 3JUWA 4ONUA 2Q0YA 2ZPAA 3V8IA 4LX9A 4R57A 1J4JA 1K4JA 1OZPA 2PR8A 2R7HA 4PK2A 4XPDB 2QIRA 2CNMA 2J8RA 2RC4A 3B8GA 2PR1A 2FS5A 5F46A 4PSWA 2OZGA 1UFHA 4YRHA 2WPXA 2I79A 1BOBA 3ZZIA 4CAXA 5EBVA 1XEBA 1XE4A 4Y49C 2HUZA 5IV0A 1QSMA 2VEZA 3IWGA 2OB0A 4XNHB 3G3SA 2NMTA 3P2FA 2Y0MA 4UWIA 1IYKA 3LODA 2FT0A 3TO9A 3W91A 2P6FA 2GANA 2R98A 2G0BA 2OZUA 1M4DA 4E8OA 1Y9WA 3FB3A 4BMHA 1R57A 2GIVA 4R9MA 1QSTA 2PDOA 1KZFA 4B5OA 1M1DA 3FYNA 3FIXA 3GYAA 2CNSA 1IICA 3OWCA 2B3VA 2GE3A 3D3SA 4F0YA 3IGRA 1QSRA 4XPLA 4KVME 4X5KA 2O28A 4NXYA 1Y9KA 1NMTA 4QB9A 1U6MA 4HNXB 4JWPA 5DWMA 4XPDC 4B5PB 1WWZA 3FXTA 5H86A 2WPWA 2FIAA 2ZW5A 3MGDA 4CRYB 3W6XA 1YREA 4KUAA 2VZZA 2FCKA 1XF8A 1YX0A 5C82A 3TCVA 4XPKA 2CY2A 1PU9A 4PV6A 2Z11A 3CXPA 4NCZA 1MJBA 2FXFA 4KOVA 2ARHA 1B87A 1YVKA 4XNHC 4MHDA 2EVNA 1M44A 3DNSA 1YLEA 2OH1A 1M4IA 4B5PA 4EVYA 1NE9A 1GHEA 5C88A 1RO5A 4L8AA 4AVBA 1S60A 2JEVA 4R87A 2ZXVA 5J8CA 3C26A 5FVJA 4KLVA 4K30A 2REFA 2D4OA 4QBJA 3T90A 4MJ8A 4DNCA 4KOWA 2H5MA 1IB1E 4QUSA 1ON0A 3T9YA 5KTAA 1V0CA 1XMTA 5JPHA 4KOTA 1Q2DA 2P6GA 4F6AA 4II9A
chains in the Genus database with same CATH superfamily
3FKJA 4F7ZA 1M4GA 4C2ZA 1RZ4A 1PUAA 2LOOA 2A6HF 5LRJA 2LLKA 1UG0A 1WJAA 2EZHA 3CQZJ 3NE8A 4KICA 1BIBA 4FBEA 1WK4A 5EC4A 2W24A 4XLFA 2TCTA 4ZYHA 1MSEC 2PRBA 1SEUA 3WABA 3E6BA 2P6EA 3EETA 3S93A 5FRNA 5HVHA 1XBUA 3SI2A 1NHAA 2Y75A 2GA2A 3M7GA 3ML6A 3D0SA 3CC4I 3I4MJ 4OP4A 1K78B 5M5YJ 1QHGA 5D5UB 1BL0A 4QTRA 1LEBA 2L7FP 1J9IA 4OLLA 2JSPA 2IRFG 3GTLJ 3K1MA 4KDPA 1AMPA 3U1DA 1A6QA 1Y56A 3V42A 1MJAA 1R7JA 2TDXA 4CO8A 1T38A 1I3QJ 5DEQA 3TBIA 1O7FA 4KIBA 4HKFA 1D3YA 4ZTFA 4V19K 4Q5SF 5K5QA 1KONA 3CUOA 1TKFA 4OC3A 1QZYA 2JPBA 2LKXA 4E4HA 2VBZA 5LGUA 1QO0D 3OYHA 4A6EA 3F21A 2H8RA 2HDCA 5FFXA 3F0CA 4LQGA 1UHWA 4Y17A 5H6RA 4RB2C 4BJ5C 1XSVA 4XK4A 2HI3A 5FKOA 2ZJ2A 4G6QA 4A3EJ 4JXQA 3R9EA 3BJ8A 4ZYAA 5DV5A 1B9MA 4L89A 2FQ4A 4A0XA 2GXBA 3LSMA 4BJTA 3DDDA 2K85A 4B12A 1IG7A 2VQHA 3QPTA 4RAFA 2BZTA 2HR3A 4LK1F 4P9FA 2B0LA 1QZZA 5J3LA 3D7HA 2FEZA 3RZOJ 2XUBA 5D5WB 3RI4A 3LA2A 3EQLF 5HLIA 4CZCA 2PMZN 5IT9K 2PJ0A 1RKWA 5K8MA 5E79C 3SHPA 4EQQA 3VWDA 4CCOA 4X6AJ 1Z8TA 4XQFA 4UFXA 1TBXA 1T95A 1FOYA 3HTUA 5EDNA 3E1SA 4UCPA 2LR8A 5CQEA 1TZLA 1DUXC 3SDBA 4B48A 3S1MJ 3A0HC 2OR4A 2EFNA 2IA2A 3SJXA 3KZIC 3SZPA 1JWQA 2AFXA 3F9KA 2Z9OA 1K6OA 1VGYA 4EV0A 5K7ZA 4R1HA 1E3OC 1X10A 3K10A 2NXNB 4U7BA 4E0AA 2K02A 4XONA 1ETWA 3LSKA 4A0YA 2NOGA 3RO0A 5AIQA 3NH4A 5BQTA 2I8DA 2Z2SB 1PJRA 2Q1ZB 3M1EA 5B3SH 1AWCA 5L3GA 1F9NA 1BOAA 3IUOA 3PNTA 1IRGA 2ZW4A 1PUFB 4PJJA 1LRZA 4RM2A 4JX5A 1IUYA 1FTTA 4H6UA 5AG6A 4RGSA 4X1EA 5LYLA 3ABMH 3BR3A 1FBSA 2OBPA 1T98A 3PFIA 3VYTB 4KYWA 1Q2CA 5EEAA 2M9HA 4AM3A 1NH3A 3PB8X 3OOUA 2DAOA 3DLLF 2EBJA 2VXKA 5K8NA 2XPUA 5M3FJ 4OIOF 2L5QA 3K4LA 4LK0F 2BEIA 2V1NA 2ZC2A 3P9CA 3WHBA 1P92A 4Z2YA 1P0HA 2FE7A 1MMSA 4J3GA 1KQ0A 3T1BA 3DSBA 3FXKA 5EGOB 2WAQA 4OIQF 2JZYA 2LC2A 4BY1J 1E2XA 2DQLA 2FJ1A 4M6XA 4IO9F 2X85A 3G1LA 4TV7A 3LMSA 3NH8A 3VODA 1WWXA 4B3AA 4P10A 1HDQA 1Y0RA 3OL4A 4WWVA 4M85A 4N9HA 3WTXC 2AFOA 4KLWA 1MH4A 3JRFA 2B58A 4HNWB 1Q1VA 1UHSA 1R1TA 3R60A 1JKRC 4RGRA 3S6KA 4OAYA 5DD4A 4Y7NJ 2QBYA 1DGRM 2PSWA 1I21A 1EJ9A 2FQ3A 2VBYA 4MHGA 3IU2A 1HEEA 3T0YA 2ICWG 1TWHJ 1JKPC 3SDGA 4BXXJ 5FO5A 5D5VB 2M5WA 4I99C 3K1PA 2Z3KA 3DEEA 4GS4A 5TGTA 1TIQA 4KOUA 3QP6A 3VARA 2QGUA 2M7AA 3G2BA 1JT0A 1VHSA 2R7FA 4HG2A 5AGEA 1DQUA 1FOXA 3OY9A 1BR4A 2H6BA 5F6FA 3ZMSA 1LKXA 3HRMA 3E5XA 4UIBA 4IPAA 2IGMA 3F6VA 3WTYC 2YX4A 1MK4A 4A39A 1OFCX 1R1UA 3HOVJ 4A31A 4EVIA 2OUMA 1W0TA 2KDOA 2QSFX 1JJ6C 2CNTA 3FRMA 3WTTC 5LEKA 4MTEA 3E6MA 4FD7A 1ZKGA 2JUCA 2E2IJ 2GIZA 3W2WA 1ZG9A 2IBDA 5D8NA 3VYRB 4DBQA 1LFUP 4LG0B 3LSTA 4E70A 4H4KC 4LOCA 3TX8A 1S6LA 1TWGJ 3BY6A 3I55I 1HOMA 4MCRA 1G3SA 2K5CA 4MHPA 3GTOJ 1U5TC 1FYMA 2R7ZJ 2RB7A 2QYOA 2CQNA 3HTSB 1UFMA 3UY5A 2VASA 2MSYA 2DFIA 1REPC 3E6DA 2DDAA 3BJ6A 3DR8A 2Z3YA 1R49A 4PUSA 5GADJ 3CCMI 4XLHA 4QPQA 3RKYA 2BYVE 3RPQA 1ZRDA 4IHXA 3GUXA 4O23A 1CM0A 3DBRB 2RQQA 2F5EA 3E0JB 4PXEA 2MBFA 4P4IA 1O3TA 2WA0A 3MZHA 4KOXA 2R7DA 2BY0A 2XAUA 2WB1N 3DXJF 4JQFA 3ZQCA 5L3BA 1VKCA 2EFQA 2VC0A 1P4NA 3EYYA 4CZZA 2DK5A 3IC1A 3SXOA 2XGXA 3HSEA 5ILSA 4XICA 2HKOA 2R5YA 1Y7RA 1ONVA 5F64A 4U87A 3KZZA 2CUFA 2EINH 4GYIA 2DMPA 2AXLA 5DUKA 4D5CA 1B4AA 3IIBA 2QMLA 2K86A 2Z99A 2ZXWH 5LHIA 4IF5A 1X4PA 1ZK8A 4A12A 1ON2A 3H3UA 1IJWC 4HDVA 4E7JA 4HF2A 2FRHA 2ZBKA 1IO2A 1W36C 1ERDA 1G8XA 2EZIA 3EUAA 3N05A 4QLCU 5HMNA 3SQNA 3CF5F 3IH2A 4BEHB 4P9UA 3PQKA 5GTHC 4A33A 3WGIA 5GP9A 3CZ6A 1CP6A 2O8KA 1JTXA 2XAFA 3ZCOA 1IY7A 2V9KA 3MVPA 2IGKA 4PFPA 4OC4A 4UXNA 4L18B 4BDZA 2VQGA 3JAMZ 3WTVC 1VQPI 3BC8A 2DF5A 3ZRGA 5DS0A 5IX3A 2L02A 2V7FA 4BBSJ 1JQGA 4KSIA 2WC2A 3A03A 4BE0A 3DCFA 1F57A 1S3JA 4CCLA 1ETOA 4EMEA 2PC1A 3TDUC 3EFAA 3WC5A 3K0LA 4UWJA 2ZOGA 1WH5A 2EZLA 3PEIA 1UZCA 1NK3P 3D5LA 2PMHA 2NYXA 4D5FA 1MJ9A 3SJFA 3QNVA 2JRTA 4BEHA 1HCRA 1Z8XA 4N4NB 1GV5A 3D1NI 3KR5A 2K9NA 4XRSA 4CAWA 1LDJA 1YS6A 3LSJA 3WTSC 2PJRA 2DODA 4BJ6C 3W6SA 1OYWA 4II2A 5IB0A 2W48A 4HYEA 3H36A 1OCCH 4OIDA 3E97A 3CMEI 4MGRA 2NSMA 4YFKF 3FX3A 3BQZA 1Z77A 3K4CA 3IRQA 2Q4ZA 2HPIA 1R58A 3DWLE 2W00A 1IAWA 4F52A 4B43A 1OQYA 1K4TA 4I0BA 2NVTJ 4CYQA 4A3LJ 2QENA 1IXSB 5ICEA 2I3CA 2M8GX 2IA1A 2J9AA 2H27A 3LWFA 2GREA 3CCSI 4KSFA 3WTWC 4S04A 1YW4A 4UBRA 2CXAA 4ZBGA 4EMSA 4OOIA 1X12A 1IXCA 1HF0A 2Z3PA 1POGA 2E60A 3FHZA 3FF3A 3JRDA 1K61A 1BI0A 1Y0NA 2OV7A 2Q0YA 1QZEA 5EMIA 1ZAOA 3M8JA 1JTYA 2ZPAA 1JUMA 2P5LC 3KEOA 3TP0A 1VHEA 3GUDA 2EH3A 1HC8A 4Y3OA 1J4JA 5B1BH 3ISZA 4ZI6A 4XPDB 2OTLI 2R7UA 1BR1A 2HKXA 1XMKA 2LVSA 3BJAA 5HODA 2HXOA 5H2FC 1MD0A 1RI7A 3GVAA 3T5XA 3VWBA 2OAZA 1TXRA 4CICA 5F46A 4PSWA 3SYTA 5M5WJ 2OZGA 1QPMA 4UF4A 2B63J 3H35A 4CGMA 5JGFA 4YFNF 2WPXA 1ELMP 3ZGKA 1FP1D 2R4GA 4CAXA 2PJ4A 2EK9A 1WCMJ 2VKHA 3KIOA 4B4CA 1XEBA 2ZKZA 4UUTA 3A01A 2FOKA 4HX7A 2VEZA 4Y49C 1WKMA 1HA8A 4ESJA 1GYTA 2X48A 4KJZA 2G7HA 5TJJA 2DI3A 3W2AA 4CCMA 3G3SA 4XNHB 2CS3A 2JVGA 5DD8A 4IHYA 2NMTA 4P44A 4L5JA 4RB3C 4IRIA 3L09A 1FT7A 2V26A 1IYKA 1ZELA 3NQOA 1ZQ3P 3TO9A 2FT0A 2PJBA 4B14A 4A5NA 2ZXJA 3M4OJ 2G0BA 5C4XJ 3WGHA 3KFWX 4JX4A 1M4DA 1Z3YA 5GTIC 1STZA 1XRYA 4R9MA 1TWAJ 4PJMA 2PDOA 2ZEGA 1R36A 1S72I 2CSOA 2EV6A 2P5KA 3FYNA 3DTKA 3QYEA 4G7HF 3FIXA 1IICA 4LLGF 2BGCA 2HQNA 4LIVA 2GQQA 5E3MA 2XC7A 1VQMI 2GE3A 1I50J 1RESA 3D3SA 3IGRA 3KP5A 1D0XA 1JGGA 4PPZA 4KVME 4JBAA 2P81A 3CDIA 4X5KA 1HLVA 3FMSA 4UCNA 1X2MA 4QB9A 4HNXB 4CCJA 3QYFA 3Q9SA 3CCUI 2B9SA 3OR2C 4HBLA 5L3EA 2WPWA 2FIAA 3HEFA 2VXZA 3RZAA 3NWTA 2JPCA 4HSTA 3W6XA 4B8XA 3A4CA 3WT4A 3MMYB 1YREA 2LKSA 2MC3A 3T8RA 3TW7A 1BW6A 5K8PA 5DS9A 3QU3A 2VZZA 2LY9A 1FMWA 2HXIA 2ID6A 2WYRA 3GMEA 3ISPA 1YX0A 4OKOA 3B6AA 3OYBA 1D8KA 2WY8Q 3L2NA 3SI0A 2DMQA 2LG4A 3HOXJ 5K1YA 4NDLA 3DKWA 3LL7A 3CCYA 2HC9A 4O5VA 2IQ6A 3AG3H 1U3EM 2NRAC 1XSXA 4S0HB 2QQ9A 3ZN1A 1M44A 1P2FA 3VOEA 4A32A 1SMYF 3CO6C 1ZTRA 1W7PA 5CVIA 2FF4A 3KP4A 1D5YA 1USTA 1WVRA 2VPLA 5HDKA 2R7TA 1TQPA 4WJBA 2XKPA 5FGMA 1HKQA 3BWGA 4GDFA 2JA6J 4LQ6A 3ZOBA 2C6YA 2P6TA 4ZZDA 4UB8C 3R4KA 3A0BC 3ECHA 3LOCA 5LHHA 2F8HA 4CYPA 4AVBA 3N5FA 3OR1C 3KQXA 2RNGA 3LAJA 4IX7A 4L0ZB 4FT8A 1W5TA 5J8CA 2GLFA 3LFUA 3U9GA 3E6CC 1DP3A 3KZYA 1U2WA 5FVJA 4BHCA 1R23A 2E35A 2FE3A 1VIXA 2D4OA 4QBJA 2X1EA 4AIDA 3FHNA 5F0FA 4MJ8A 4CGZA 2O6GE 4KOWA 3GLXA 3RKXA 3T9YA 2RV8A 2KL4A 3JSOA 5JPHA 3RQIA 1Q2DA 2DT5A 1T8IA 3GIUA 2F2EA 4OINF 1WJCA 1MMNA 2ZOFA 3WG7H 1JKQC 3BOQA 4CGNA 2XF6A 4FD4A 1LFPA 2REEA 4NB5A 1XOVA 1BA5A 3H8EA 3L2RA 4LLLA 3FM5A 1H9TA 5LEJA 3JTHA 2FL4A 2JBKA 1TT0A 1WJDA 2A61A 2EV0A 5J4VA 1SANA 4MO7A 1I5ZA 3K7AJ 2F5IA 5JFRA 3D66A 1EH6A 3FBNB 3EXNA 4YIFA 5E8GA 4FASD 2NVQJ 3EC4A 1RIOH 4AG7A 1U5TA 1FYLA 3H9JA 5AIPA 1UB9A 4JX6A 4EJTA 4AYBN 4KA4A 1R5HA 4MHZA 1KU2A 4DW6A 1EKEA 1Z9CA 2V9PA 4IL6C 3M9AA 3ZN0A 4L9JA 4OAZA 5FROA 2VE9A 1VQOI 2QSHX 4KSAA 2HNHA 5IP7J 3OYNA 1HW2A 5LD2C 2PVVA 3NA6A 1R9TJ 3KP3A 1T6SA 4QC6A 2DPDA 3HBLA 3DP7A 2DFEA 3DBHB 4UEFA 1ULYA 3CXQA 4NBQA 5D5XB 6CPAA 2KJCA 2MG4A 1NG6A 2KIUA 3OYGA 2DEAA 2ZEDA 4AD9A 4ZYEA 4CRZB 4OMYA 1S7NA 1LB2A 4NJQA 1SVOA 3A9LA 4YEJA 3FH4A 3WG9A 4LD5A 1Z9UA 4BGDA 4RDUA 2E1OA 2GAUA 3SZTA 4NGPA 1ZG7A 2K4JA 2XPVA 4B1RA 2IS4A 3RNZA 3S9MA 4OIPF 1QGPA 2Y69H 2XASA 4M73A 3UR3C 3KYCB 2LBFB 5F1RA 3EO4A 4NGSA 2RREA 3PGPA 3LFKA 2PFBA 3JRUA 2VT2A 4KZTA 3S9NA 4FAIA 3LD2A 5F49A 4A3BJ 2G0EA 3B7IA 3C2GA 2LD5A 3D68A 2VKDA 4EGZA 1ZO0A 1OCTC 3TFYA 1FSHA 2HTJA 3QPSA 4G94A 3J7AY 5E17F 2WUUA 2CUZA 3KETA 3GFJA 4UVBA 4QVTA 2LFBA 4RAYA 4UEEA 1J2XA 1Z91A 1IN4A 3RPUD 4R3LA 2AXTC 3B02A 2QECA 4MXUA 5IYDJ 4ZDPA 3CC2I 2ZFWA 5GCNA 1LCPA 1U78A 4BY7J 2L3DA 1LQ1A 3X2QH 1BIAA 1IV6A 1YHQI 1GHCA 1XFOA 1ETYA 2CWEA 4RAGA 3S6HA 2EZKA 5E8IA 2VOOA 1AA7A 4R8HA 1MNDA 3FMCA 4IKFA 4A94A 4BACA 2LDUA 1AOYA 1FPQA 2HOEA 2WAEA 3Q0UA 4M3EA 3F23A 1G3YA 4O3MA 3HKZN 3K70C 4GCVA 1CBXA 1TKHA 1K83J 3DTEA 5DTDA 3B73A 4BU2A 1Z4RA 5IYBJ 1XIXA 2E1CA 1TKJA 2H1LA 3K2KA 1A04A 3SJMA 3IHUA 3MQ0A 1F1ZA 1XG1A 1SC7A 4K3NA 3HPHA 1S7FA 1BPNA 3JREA 5H84A 5HS7A 1AKHB 2D4PA 2VPRA 2CU7A 2Z1DA 3JSPA 4M9ZA 3BLYA 4JYWA 4MTDA 1GXPA 2LKPA 5IYCJ 1FMVA 2BVLA 2R7QA 1P4WA 4M6YA 3F5BA 2EILH 3N97A 3R9GA 4CDGA 1Q2YA 4AVAA 2ZEOA 3CD6I 2V1XA 4NNJA 1IN6A 1DTDA 2M0MA 1A5JA 4RN7A 3JR9A 1Z4EA 4HF1A 3PQJA 1A2ZA 4S05A 3H5NA 3JRGA 1I12A 2JEWA 2JLMA 4MFJA 4KOSA 3FK7A 3S2HJ 4OC2A 1TL8A 2Z3OA 2K9MA 4W1UA 1YO5C 2HOSA 1D5VA 1FSEA 4KVOE 2JQ7A 2P0WA 1R4NB 3HRSA 3W2VA 3VSLA 1Z8WA 4F9UA 3PP9A 1APLC 3CDHA 4OC0A 1CPXA 4EWTA 3MAJA 3TL4X 4ZYQA 2R7VA 1F2PA 2F5CA 4IQJA 2MA3A 3N4MA 1BR2A 3CUQC 4A0ZA 4BBRJ 5HLHA 1C0WA 1ZRCA 3QOEA 3JRHA 4PK3A 4BHPA 2MLKA 3D2MA 1SQHA 3K2ZA 3FX6A 3V8JA 5ILUA 2DT7B 3WE3A 4E7KA 1YLOA 3HOUJ 2GFQA 4MHYA 4UA3A 4ZY0A 3OYEA 3AL0B 3PBEA 3BG7A 4N4OB 5G1ZA 1Y1WJ 4RLFA 2D5VA 4M6IA 2KDZA 1FBQA 1R1VA 1RR7A 1X1CA 2R3SA 2O03A 3BZCA 3D5SC 2XDVA 5FLXK 5I0CA 3G1OA 5E3LA 3IP4B 1NK2P 1Z5RA 4AVZA 4MY0A 4EJWA 4XMYA 3LQQA 2BEOA 1AYEA 2RKHA 4TWEA 3F8CA 1Z6RA 5HVFA 1X1AA 3DPUA 1UELB 2Q51A 5ISVA 2CG4A 2G3TA 2VKEA 2HPMA 4AU7A 3S8PA 2X51A 1HKSA 1B6AA 1E3HA 1YQAA 1MGTA 4P96A 4YFXF 2XRNA 3QODA 3QU6A 1XSDA 1YJ9I 1MMDA 1NTCA 3MEXA 1U6GA 3REOA 1I1DA 4BDYA 3L2QA 4F91B 3GFLA 2PJ2A 2WAFA 3WE2A 2AFZA 3AG2H 4CSWA 1HSTA 3PO3J 1T0FC 5F0CA 1S7AA 1YYVA 4YFJA 4DJAA 1IOIA 4WXHA 1QSNA 3FXUA 3BCBA 2X6YA 2DYRH 5CPRB 2HVQA 4I02A 5KAIC 3JTGA 1LAPA 1VQNI 2AJ6A 3PZJA 3E7LA 3WGGA 4KOYA 5JR3A 3PBBA 2RVCA 2Y0SA 3D5RC 2DXQA 2IL4A 2EIJH 3GW2A 3JRCA 4R7MA 3CF2A 4KS9A 2G9WA 3BTJA 1YIJI 2HQRA 4XRSG 5A28A 1F43A 1PCAA 2O4HA 5B66C 3KEQA 3OYDA 2I00A 2P5VA 4E6KG 4ORFA 1I1GA 1V54H 2JVHA 3H9GA 4EEFG 3SI1A 3BPXA 3ZQIA 4C2YA 3LACA 1XN7A 2OF7A 2UV1A 2JA8J 2CW8A 1W1WE 1R3NA 1HSJA 4D9JA 4G12A 3N7ZA 2IS6A 1P9QC 5M3MJ 1N75A 3MRUA 2EIMH 4XKBA 3PUBA 3S2DJ 2M3AA 2HOTA 1YR0A 2HV2A 2OZHA 4LMYA 2XSDC 3RZDJ 2FSRA 4IHVA 2QUFA 4XBFA 3MKZA 4NGMA 4PSXA 4CAEA 2VE8A 1SAXA 2QBYB 3V8KA 3ZMUA 2FMLA 2ANPA 4A30A 3ZQHA 2LSOA 4XSXF 3ZMTA 2VL8A 1SD5A 2PRQA 1XDUA 3UKGA 1RUOA 4BBHA 2F4OB 2OJED 3GZ5A 3PSFA 1QRYA 4HNUA 2N8GA 3TE4A 3FXOA 1E3PA 1XGNA 2HB6A 2L4AA 2QJ8A 2DPSA 2XIGA 4XRMA 4P6YA 2CYYA 4YG2F 2EIKH 2P8TA 2E2JJ 1I1SA 1IYLA 4D1QA 2YNCC 1ZYRF 3DEWA 1UCRA 1N77A 1H89C 1CP7A 4P4BA 1D0YA 4UV9A 3JRAA 3CMAI 4MEYF 2VKVA 3TO7A 1R4MB 5AG4A 2XGCA 3W6JB 5JLWA 1XCBA 4F3QA 1MIJA 2ZMEC 1XGOA 4XN3A 5DDGA 4HZFA 2DA2A 4PZJA 3D8PA 2B7EA 1FZPB 4ON0A 3VFZA 4F93B 3OYAA 1HDPA 3OMYA 2DQRA 2XB5A 3K4MA 2RDPA 4DQ2A 2DW4A 3RKWA 5ICGA 5FLMJ 3H5AA 5EG0B 2HVSA 3H0GJ 4KVXA 1ZR2A 4H2KA 5ILVA 3VYSB 2PI0A 5FD5A 3JRBA 1HBXG 5J8FA 1SAUA 4CA0A 2Q7BA 2TRTA 2ZENA 1OJLA 2OD5A 3K69A 3I4NJ 2JN6A 2YX7A 4MFLA 2VXDA 1BAVA 4JOMA 1XTAA 4EJVA 3FECA 3B2YA 2K3FA 2PMUA 3BCAA 3S6GA 3VH9A 4KN4X 1BO4A 3CMMA 5CLSA 2EV5A 5LGNA 1KUVA 1VTNC 2ACJA 4ESBA 3HRTA 4R76A 3P2HA 2XGEA 4C9YA 3G6EI 1FOKA 2QQ8A 1T39A 3NE7A 2KPMA 2YR2A 2V1UA 1YLFA 3LWUA 1JUSA 1Z3XA 3MCZA 1JE8A 4FX4A 4P45A 4N9IA 3RYRA 3BR0A 5EG0A 3IEHA 1B59A 1V5GA 2QVOA 2UWMA 4GYGA 2FD5A 3D4UA 4DGWB 4KIFA 5HLTA 3IWWA 3PFOA 1K4JA 4R57A 2YUSA 1ON1A 1LOKA 4PK2A 2ISZA 2QIRA 3D7FA 2PEXA 1GUUA 2R5YB 3PSIA 5F04A 3LSPA 4C68A 4DUKA 2BE5F 4ZY1A 2PR1A 2ZSHB 2JJ7A 3CJTB 4M3DA 1JGSA 4CCNA 4LGWA 1LDDA 5CJ9A 4MCPA 4AIHA 2ZELA 1X2NA 5LYFA 1OR7C 2IMOA 1DU0A 3KI9A 1R22A 1NSAA 2I79A 1BOBA 5K5RA 3CCQI 4UIAA 3NAUA 4HX4A 4N0BA 3ROUA 4ZX8A 4NUBA 2MH9A 4A5MA 4MQ9F 4HF0A 4GXOA 1TC3C 2JBJA 1XE4A 2HUZA 3TW6A 2LYCA 3ABKH 4LB6B 5TRDA 3RIRA 2WTEA 2OB0A 2VN2A 3I54A 2O8XA 1CGPA 1JXSA 4C2XA 1OISA 1M1EB 1XC5A 3P2FA 4KISA 2GLJA 4UUSB 3W91A 2GANA 3OYCA 2PJ6A 4OU0A 4KN7X 2KFDA 4G7OF 5F09A 2OZUA 2PCUA 5CKTA 3DU5A 5L3FA 1SFUA 1Y9WA 3FB3A 2PJAA 4BMHA 3VDXA 2E7XA 1MDMA 1KZFA 1KU3A 4B5OA 1M1DA 3KCCA 2Y9ZA 3KP7A 2R7SA 2YSRA 3OWCA 3KLNA 2B3VA 5HVGA 4LJZF 1GV2A 3J7YJ 4BE2A 3TDZC 3DPTA 3CESA 1F4KA 5KAFC 4XPLA 4UVCA 1P4AA 3HLPA 2FBHA 2O28A 2X6XA 1X1PA 4XLNF 3B3TA 2V1DA 1T08B 1NMTA 1P6RA 2HZTA 2VQLA 3COAC 1BJAA 4JWPA 4B5PB 5GAHJ 3FXTA 2E1MB 3QP5A 1DPUA 4IVNA 2GA1A 2ZW5A 2ZJQF 2PJRB 4UCMA 4UUSA 8CPAA 3C2BA 1XMXA 2L9SA 3W6KB 1FNOA 4YRVA 2C6GA 2VJ4A 4L9TA 1IOFA 3HXLA 1PUEE 1MMGA 2EA2A 1USSA 3C1DA 1IN7A 2GWRA 3ESWB 2HYGD 4ETSA 3OYIA 5JHUA 2VI6A 5IP6A 1FBUA 1J75A 1J0RA 2Z16A 1PU9A 2NNNA 3O8HA 5A27A 3CLQA 1MJBA 2BHYA 3ERMA 4KOVA 2CW7A 1B87A 2X1DA 2PJ3A 1FWZA 2HGCA 5JM6A 4BXUA 2IGNA 1BJZA 2XRLA 4DBRA 2EVNA 3H8GA 4MHDA 3S32A 1GLNA 1IXRC 1X3WB 3P9KA 4J00A 2W84A 4LLNA 2OH1A 2KIFA 3QPHA 2WY7Q 1R6RA 1M4IA 5F08A 5H6QA 1ZN2A 4B5PA 2IVMA 3L2VA 3BDDA 3D7DA 4HV5A 4CGOA 3HOTA 3AG4H 3WODF 1FEXA 1D1AA 1H0MA 2FBKA 3BT9A 1SD4A 4NGNA 4ONWA 2DK8A 4L8AA 4R87A 3HM5A 2O5RA 3IV5A 1B8IA 4FWUA 2FU4A 1CQTA 1EE3P 3KEYA 2W1OA 4I01A 1KGSA 2BXZA 2CW0F 3FKIJ 1Z7LA 4A2UA 3BI1A 4ZGYB 3BQYA 2DA7A 2O7OA 4P1WA 4XL9A 1F36A 2GXGA 5F0HA 1TW3A 1UJ8A 2KRFA 3F72A 4DIQA 2VBXA 4DNCA 2W82A 3K4BA 4QUSA 3I4PA 1V5FA 4MFDA 2F5VA 4DZPA 3GTKJ 4UVAA 1LE8B 3DU6A 3Q0VA 2JK3A 2V8HA 5D6FA 4MFKA 2XPWA 2WZNA 2EPFA 3ZXSA 3LSIA 3KQZA 3PFEA 4JK1X 3S6FA 4B6ZA 3A01B 3OWTA 1ZG5A 3R95A 4MRIA 3ZMZA 4PGGA 3OIQA 5D8LB 1FNNA 3KYLA 1ETVA 2DTZA 3NWSA 2UUZA 3H5RA 4C3IJ 1ZG1A 1WZ2A 2V9VA 3TO6A 2NVUB 3EYIA 3G1MA 4M74A 1QQIA 3I71A 4YGOA 2COBA 2L54A 1V5EA 2EO8A 3HB9A 4MY3A 1LVKA 3G8WA 1I39A 1VI0A 1LDKB 4JLYA 2E36A 2HTSA 1W4MA 5FKKA 3CDLA 1LE8A 2OC6A 1J7KA 3GTGJ 2CQQA 1TNSA 5KVRA 3BJ7A 1S8NA 1T0FA 2BY1A 3RDIA 2DJNA 5CVJA 4BQAA 2DA5A 4MMOA 1P4XA 2CGPA 1Y0UA 3PM1A 3CJRB 2F4MB 3HPGA 2F6CA 4ZTJA 4X8IA 4RGUA 3S9LA 2KQRA 1TWCJ 2UZKA 1WQ2A 2DA1A 4HAMA 3HOZJ 2ABZA 4ANJA 4IAVA 4NEXA 3SJEA 3OS2A 2RN7A 1ZRFA 2W57A 2P7VB 3BP8A 3L2WA 3DGVA 2IEKA 4GM5A 4KUMA 1PP8F 1IN8A 2KZGA 4U0VA 5M5XJ 1MBJA 5BPIA 5I4MA 4RA2A 1BC7C 4AG9A 1YVOA 2A6EF 2V8VA 1R00A 2Q8KA 3KLOA 1N25A 3B3CA 2ZCWA 3WR7A 3DF8A 2A4NA 4HPQA 4B13A 3PNYA 3IO1A 1O57A 1IV8A 4E7IA 3FXRA 1WH7A 3KE2A 4II3A 3OYJA 3J7ZI 4NGTA 4RUHA 1W7PB 2JDCA 3TKYA 1RKTA 3TC8A 4B44A 4X0GA 1WRJA 1MBEA 4XR6A 3TOAA 2LY2A 4M3GA 5A2QZ 1YI2I 4IHSA 2LREA 1A6IA 3R6SA 1YW9A 4P4DA 3AFHA 2CV2A 1GVJA 2EFWA 1Z0XA 3M07A 4A3FJ 4A69C 2EWNA 2D1HA 1KZHA 2XAHA 5KTCA 4EM1A 2NS0A 5FKLA 3FMQA 4KORA 2NVXJ 1S7OA 5AG5A 5HH1A 3CZXA 5LRSA 3EPZA 3HYIA 2X4HA 4AC0A 4XLEA 2AQEA 2R5ZA 1EF4A 1XMBA 1Y7EA 3CDXA 1TQMA 3TTHA 2ID3A 2CMPA 2YNCA 1VFCA 1TLHB 3I59A 3QAHA 3ZMVA 4F0XA 1DU6A 2G7UA 2PMZA 1PP7U 3F8KA 3F22A 2VZYA 2CRGA 3J81Z 5LRRA 4ASNA 1B9NA 1B72A 2MABA 3FEDA 3ABLH 4AVCA 4I49A 4U9ZA 2FMYA 2IJZA 4NSQA 2FXAA 7CPAA 2HQYA 2ESNA 2K9QA 1U8BA 4IHMA 3DFGA 3BG6A 5KHDA 3VWEA 1ZGWA 2XB0X 1GDTA 1RPWA 2VUMJ 3DKXA 4R3KA 2A69F 4RB0A 2BSWA 1JUPA 3CCJI 4E2AA 3GO5A 1SFEA 1U5TB 3ABUA 1RC9A 2O3FA 3B3VA 2VLAA 3GB0A 3FVLA 3HHGA 3IC7A 3G73A 1U8RA 2DN0A 2K3PA 1OMIA 2EUIA 4H89A 5EEGA 3HRUA 2M34A 1QNTA 5CYVA 4B09A 4PQAA 2FIWA 4D0PA 4HQEA 1HQCA 1VQKI 2P7CB 2ZB9A 1BM9A 3B6CA 3VPRA 1LFWA 4MEXF 4ZC3A 5GPAA 3J80K 4ZY2A 2HFHA 2VI7A 2QKLB 1D0ZA 2EFOA 4C3HJ 5EF6A 5J1UA 1H9GA 2L9RA 1Y39A 1DE4C 1XD7A 2L9VA 3ASOH 4CHUA 4Q36A 2POKA 5E1ZB 1QA6A 1HXDA 1IUFA 3HUGA 3UNGC 1CJWA 4ITVA 3FEEA 2YS9A 2KRCA 1XPXA 1Z7UA 1EH7A 5HLGA 3NEUA 2HVRA 2MH2A 2A6TA 4PJLA 3QOPA 4UHTA 2P4WA 3GYHX 2CV0A 4HNVA 3PNVA 1EV7A 3PB7X 5JLXA 1ARLA 5D4RA 2C1CA 2YPRA 5ERIA 3M8FA 2AQFA 4NQWB 2EFPA 3BHXA 2KP6A 1CX8A 2BY2A 3GCMA 4XKWA 4OADA 3PFYA 3FIWA 3GFMA 2ECBA 4KNYA 3CXSA 1VQ8I 4OC5A 4ZX9A 5L3DA 3BR5A 3RCOA 3QAYA 2QF7A 1ZLJA 5F48A 4L5EA 1L0OC 4L9VA 2K5TA 1Y1VJ 2WADA 1Z8LA 4XM3A 4M72A 2L2OA 2BY3A 3IH4A 1KYZA 4Q48A 4HNTA 3E0KA 3EUHC 4LIUA 4OIRF 3HOYJ 1MBKA 4AVPA 3I0TA 1RUNA 4AB7A 4EATA 2KT0A 3C18A 1XX5A 3GLLA 4IOCF 5FRMA 4A95A 3OYFA 4C7IA 4M3SA 1IW7F 5FKMA 1YW8A 3FF5A 3OSGA 4RI1A 3GBGA 1S9HA 2JUGA 3QYBA 1X58A 4GGGA 1QBJA 4KFCA 4B11A 4QPOA 1YRNB 3DPLC 2FVGA 5EZGA 5LRKA 1CPSA 2IAIA 5G22A 2HWVA 1XDSA 3CP8A 1WGXA 3FXLA 3HHHA 4WXDA 4DYCA 2OTJI 4HOBA 4YU9A 1VQ5I 4H6ZA 4NQWA 1IIDA 3H8FA 4AIKA 2R7OA 1ITYA 1W7PD 3IKTA 1W5SA 2C27A 1ELLP 2E71A 3HDDA 3V7ZA 2Q44A 3MFKA 2IT0A 4MCQA 2YU3A 3SJGA 4U7DA 2GOMA 1XJOA 2JA5J 4E7SA 3HJEA 3L1PA 2J8MA 1TTYA 3V7SA 4WX9A 5F47A 4PDKA 3K4JA 1S7EA 1UG2A 1OCOH 3DKYA 5F1JA 3RKQA 1IGBA 3HUVA 4Y33A 4IOAF 2PBIA 3R96A 4AXVA 2B5GB 2CTBA 3LSGA 4XLPF 2V4JC 4U0WA 2OA4A 4JXRA 1YRNA 4Y15A 1L0CA 3FJUA 1GVDA 4Q7AA 2RAEA 5HXDA 2KMUA 2L4MA 2PJ7A 3QB8A 1VNDA 1K6YA 4FD6A 4ZJZA 4A3CJ 2ZNYA 1FTZA 2Q43A 1BC8C 4FD5A 2M87A 3O8GA 2J5OA 3OIPA 3GY9A 1YIOA 1QHHD 2OZ6A 2XEIA 4BKXA 4Q47A 3SEQA 1SVMA 1B6BA 2BUEA 1LJ9A 3I5UA 2MD5A 1Y6IA 4UV8A 4F55A 3GZ6A 2Z0ZA 2MD0A 4CYCB 4DYOA 1V55H 2JRMA 3H0DA 4QSHA 3AAFA 4MQVA 2DDBA 5BMZA 5BPDA 4UEZA 3C7JA 4PK4A 4V2FA 3H4QA 3MZ8A 3RJPA 2Y9YA 5E96A 2WB1A 2PN6A 2MFZA 3JW4A 4AUXA 5LHGA 2B5GA 3I9SA 4U5YA 2XF7A 5B5EC 2L01A 2IS1A 2C6PA 1N78A 1Z6TA 4E7LA 2QCOA 4HRIA 2VBQA 3VYUB 2VJIA 3ELKA 1I6XA 4XN0A 2M0CA 2V6CA 2ELKA 2QM3A 2QQBA 4AWXB 4DOZA 5K7HA 1ZLKA 1ETKA 1K7AA 4CS0B 1Z05A 1X1DA 4L0YB 4ZYGA 3OOPA 4HPSA 1XB4A 1ODDA 2KZVA 2O53A 1RNLA 1DDNA 1X3UA 2V8GA 2D1VA 4GXHA 1BW5A 5JHFA 4U9YA 3JCUC 3BJOA 1YS7A 3LSHA 4CYCA 1AUGA 3KZWA 3MZYA 2ZXIA 4BD9A 2PVWA 4BQNA 1YE9A 3RYPA 4Q38A 4D7MA 4CXFA 4K2EA 4A3JJ 3FNCA 3SXNA 3D2PA 2R1IA 3FXQA 4Y49B 4Z65A 5HS8A 3LSRA 4P55A 4WXCA 5LGTA 1A36A 2CF4A 4MBUA 3IWFA 2LH9A 3MD2A 2M4KA 3CJQB 1Z21A 4XNFA 4KMFA 2Z10A 2BW3A 1ORKA 1LUJB 2JA2A 3W3CA 5EJCA 3O6BB 2OPTA 1FYKA 2DO7A 3ZQFA 3I56I 4AIJA 1ZH5A 4A3MJ 3V38A 2K9LA 1SFXA 2A68F 2ELHA 3O3KA 2ZO4A 2COMA 5BNGA 1W36D 2Q4VA 4MHNA 1MKMA 3LA3A 1RTQA 4UB6C 2PJ9A 1U9OA 2W25A 3HSRA 2XROA 3Q5FA 5LLQA 4HSRA 2AO9A 4D7NA 3K6GA 3JUWA 4ONUA 4H0EA 4FUUA 3WC6A 1LEAA 4O6JA 1YX3A 3ZQGA 3PIOF 3KP2A 2WWYA 4MFQA 9ANTA 2RFHA 4KT5C 3H92A 2AFUA 3RAMA 2QEXI 4XLAA 1MSFC 2IGOA 1ZR4A 3TQNA 2LTPA 1OZPA 3FISA 5JVTA 1RRJA 2BO9A 2KKOA 2CNMA 1G3TA 5HDNA 2JWTA 2HYFA 1IU8A 4OMZA 2EA4A 3JRIA 1I6HJ 3KP6A 2F5FA 2G9DA 3B8GA 2D45A 4DJLA 1G2HA 4M6VA 1E17A 2DMTA 2FS5A 5CVUA 3GTPJ 4YRHA 2ADUA 3F8NA 4CYNA 3FBIB 1YITI 1SVLA 2XSJC 1QVTA 5B1AH 4CH7A 2KLOA 3P7NA 4MIMA 5DUIA 2IW5A 5IV0A 2Y48A 3CP2A 1XS9A 3IWGA 4NC7A 1TQIA 4W97A 1XCVA 3WC7A 2R93J 1Z1DA 3A1YA 1M4LA 1TNTA 3HOSA 1QMUA 3S14J 2Y0MA 2J5PA 2XF5A 2LMDA 4HEA2 4KITB 3NRVA 4A93J 2KRHA 2ESHA 2P6FA 3TGNA 4PXDA 1OYYA 1SMTA 3BR1A 3IFEA 5CVRA 3WTZA 3CCEI 3BG5A 1OCZH 4Y13A 5LYIA 1K78A 4V2GA 3BTLA 4OIWA 1BPMA 2JT1A 4ZZLA 1QSTA 3CPAA 5IT3A 3Q0WA 1YOVB 3SHFA 1IRFA 3MKLA 3SZGA 2NS8A 3R61A 4XOPA 5GPCA 2XV4S 1KQ8A 3GYAA 1O7LA 5HDGA 5CPAA 3GWZA 2HDDA 2R92J 3PUFA 1IGNA 4LB5A 3KR4A 4F0YA 4I0AA 1QSRA 1OPCA 2FNAA 1O4XA 1Z2LA 3S3OA 2QA4I 2XAJA 1BBYA 2YU9J 2CQKA 3BR6A 2NNYA 1Y9KA 1ENHA 3K4KA 5EZHA 1R71A 3S1NJ 4NFRA 2ZXHA 4CGPA 5DWMA 2XHKA 3LQRA 2PJ1A 3V8LA 4XPDC 5H86A 5JI6A 4NC6A 4XOTA 1ETXA 4YIIA 3ULQB 2PX9A 2W85A 1VHOA 3MGDA 4HX8A 4WF2A 3KYDB 1X3ZB 1OLTA 1FLIA 1IDZA 1IF1A 5D29A 3CPXA 1O3QA 2HDWA 4G9YA 4KUAA 1AU7A 5FJ8J 5FLXZ 5CBMA 5CQGA 4UUVA 2VJJA 5C82A 4U88A 3TCVA 2GZWA 2FX0A 3G3ZA 3TEDA 4XPKA 3HZJA 2CY2A 4PV6A 1XMAA 4NCZA 3BTCA 2K9SA 2VB6A 5E20A 3S15J 3QPLA 2ARHA 1S29A 2ODFA 1Y0YA 4XNHC 3DBLB 1YFHA 2QQAA 5C44J 1ZARA 2KHMA 4PCQA 2A07F 2CUEA 2DJIA 4HV6A 3TP3A 2BV6A 1HDDC 4DYQA 1I27A 4EVYA 4RAZA 2QWWA 2ZEFA 4ENMA 5HVQC 2JMWA 4U0YA 1ZG3A 1YX5A 2PJPA 4DZJA 2YNEA 1GHEA 4FCYA 2DXIA 2CV1A 4LG3A 5IT9Z 4F92B 1S60A 1RETA 2DOEA 2ZXVA 5J1YA 5FLVA 3C26A 3SXYA 2PIYA 1OBRA 4K30A 1WHUA 2LK2A 1J09A 5CVVA 2L7KA 3QRFF 1PUFA 4C7HA 1VZ0A 3QQAA 1JI8A 3DEUA 1F5TA 2RGVA 2ZEMA 1ON0A 3F3XA 1IC8A 2Q7SA 4QWQA 1LVAA 2HYJA 3GFIA 2F5DA 2GLOA 2CFOA 3EDPA 2LRDA 3DQVC 1RR8C 1DGWY 5J4YA 1YW6A 4II9A 1CF7B 1N71A 2C6CA 3F8MA 1XGMA 1BI3A 4QIWN 3HL2A 2PE3A 3KL9A 2BCOA 3V7CA 3M1CA 1H88C 2XEFA 3OIOA 3FXMA 1TF9A 5EGOA 3IJ3A 3EUHA 4B10A 2KJBA 5DYMA 4XIDA 2FNPA 2JA7J 1WJFA 3CTAA 1VQLI 3I64A 3I9V2 1TT5B 2KISA 3ECOA 1YJNI 3OL3A 3Q9VA 3CMYA 1WSUA 4RMNA 4NGRA 3D67A 3DLJA 2DA3A 1IN5A 1MDMB 2GOXB 3CCRI 5KTDA 1FC3A 4BL0B 1MBHA 4HQMA 3PB9X 2M2EA 3GF2A 5FD6A 5HS9A 3B35A 1P7JA 3JAMK 4C2MJ 3TOBA 4R79A 5H20A 2MGQA 1CF7A 2P6SA 4Y4RA 1H8LA 2NS7A 2X0LA 2ZJPF 3R1KA 4UFWA 3BTIA 3Q3SA 2VODA 4RLQA 2E5NA 2X6WA 4IZZA 3E5UA 4XKCA 4NF1A 2Y31A 4IJAA 2HU9A 2CIJA 2ZEEA 4XRFA 1KUXA 5DWNA 4CUGA 2B3UA 4UNOA 5GAEJ 3T8WA 1G3WA 1KA8A 2E7WA 2DU9A 1AHDP 4KUBA 5LRGA 3VATA 5K8OA 4E7ZA 2NAZA 2VJ5A 3FM3A 2H94A 3I3LA 5J1QA 1BN5A 2VIXA 5DCMB 1YTYA 4GFBA 3BR2A 3H1CA 4CAVA 3PL8A 2CJJA 4IK2A 1MW7A 4AYBA 4MFPA 2EK5A 2G3AA 4LUAA 3ZJ0A 5ICFA 4EJOA 3OYLA 3KKWA 2ZW7A 4JJXA 5D4SA 3DV8A 4LG0A 4Y52J 4BINA 4J01A 4HLYA 3KHXA 2OQRA 1MZBA 1FJLA 2VOPA 2K40A 4EM0B 6PAXA 2BL1A 2DPUA 2EWBA 5FFZA 3U1KA 2I10A 4BQOA 4OMEA 4C2TA 2R8VA 2QZ8A 2DBBA 3OV8A 3M3YJ 3I1UA 3EY5A 1EA3A 4A3DJ 5D6EA 4I76A 2XEJA 2EK8A 1IDYA 3U2RA 1LANA 2FA5A 1KUYA 4NGQA 4BE1A 4ZDOA 5IOYA 1MNEA 2OOTA 4NHJA 1YSJA 5JH9A 4MLOA 1B8IB 1WJBA 1YJWI 2BHZA 2BOAA 3BZ6A 1GT0C 2K4BA 2Q4YA 1X4OA 2DT6A 2W4SA 1WJ5A 4BXFA 4F9VA 5DCMA 1U0JA 3CUQB 1HKTA 4XLCA 4IHTA 2L7MP 2UXNA 2PQ8A 1OCRH 2IP2A 4BYYA 3V4GA 4EFDA 4G1PA 1P7IA 2DTRA 2WV1A 1PYVA 5F27A 3GZNB 1JKOC 1QQ9A 2DFFA 4FQGA 2HQ5A 2DCEA 4G7ZF 1T56A 5G20A 2B4BA 1WPKA 4LFUA 3BG3A 2DMUA 4PJ0C 5J40A 4I6ZA 1L3LA 2V6EA 4PXCA 4R8FA 3TT2A 2RQPA 2M7BA 1B1BA 2RNJA 5C4JJ 3RYOA 3F8BA 4NC8A 5TISC 3SFZA 2XVCA 4A3KJ 2XGDA 2V79A 3CLOA 3BXMA 2IJLA 4FE7A 4WK8F 1VQ6I 1DPRA 3E3VA 3PO2J 2IA0A 2IPQX 2ZEHA 4HNYB 4CAFA 4F8ZA 3DR6A 1YK3A 3K9UA 1FOWA 3BZKA 3DLAA 2Z33A 3J7AO 2VBWA 4OAEA 4HW0A 3S16J 2OQGA 3OSFA 2V8DA 4HA8A 3CUQA 2M8EA 3PIPF 3BG9A 3IKVA 2Z5UA 1G59A 5IPAA 4FHTA 2BXYA 4IEJA 2ATRA 5ELYA 2X7BA 1MNMC 2K7LA 4M6HA 2AHQA 3HKZA 4DYRA 3GTQJ 3I3GA 2A05A 1MH3A 4G6TB 3FBUA 1YGHA 3IH3A 1UAAA 5DM6F 2K27A 3W6VA 1G4DA 4I09A 1YQEA 2GU2A 2R7XA 3QWLA 2ZW6A 3HSFA 1TWFJ 3JVNA 3RBUA 5D8KB 2DLLA 4CPAA 4M6GA 1BI1A 3IL2A 4EJUA 2AFMA 2E1NA 1VF9A 2EB7A 4IRHA 5LBQA 5K5OA 1VQ4I 1Z67A 2F48A 4B3XA 3I53A 3GKRA 4IRGA 3G4SI 2MYSA 1LFBA 3I58A 4IXAA 1IRXA 2AE6A 4FETA 1A35A 2CQXA 2QYVA 4BNCA 3K70D 2PJ5A 3TMOA 5ICCA 1DP7P 2FOWA 2VQCA 4UFVA 3ABTA 2GXAA 3S17J 5A2QK 2PG4A 1O3SA 5C3EJ 1Y8QB 3KPHA 2O61A 3OYKA 1S3ZA 4I98B 5KK1A 2E34A 4P4FA 2LF7A 1IRZA 4PJNA 2Y0SN 1LNWA 4BQQA 3HGYA 1QSOA 1S5KA 2H09A 3IWZA 2Y30A 5E18F 4EGYA 1S5LC 2B4DB 4C2UA 2R7RA 3M8EA 4MI4A 4XSZF 1ZGJA 4G6DA 4ZDLA 4R6TA 2A5WA 4RS2A 5BS6A 1HDUA 1FY7A 3A2KA 4JD6A 1YG2A 3L00A 3J81K 3BROA 3FK6A 3MKYB 3CCLI 4P4EA 4P4JA 2Z3LA 5AG7A 3FMRA 3BI0A 3LAPA 3L2CA 2A3SA 1UMQA 4W9YA 5L3CA 3MN8A 2JDDA 2H1KA 1RXTA 2M4GA 2J8NA 4NJRA 2DA6A 3ASNH 4PGHA 5J6XA 2LY1A 3WTUC 3OYMA 3L9FA 1K79A 2R5ZB 2Y2ZA 2HS5A 5CNPA 1R5GA 4FISA 2BOLA 3I59B 1MBFA 4BS9A 5FKNA 1WJEA 1W5CC 2DA4A 1T33A 4FX0A 2XEGA 3R9FA 4CYOA 3PRTA 4OC1A 4BH9A 3P5JA 2B4DA 3F0AA 2VL1A 2JSCA 4M9SA 2GBYA 2ZMEB 4E7HA 1B72B 1KU9A 2WAQN 2DYSH 1X1BA 4YELA 4C30A 4BAYA 3CT9A 2F4IA 4CGLA 1QVUA 3SFIA 3AL0C 4RGXA 5E3NA 3NARA 1JJ8C 4MFEA 1OKRA 2HOAA 3RTRA 2BVMA 2IXSA 1ZLIA 4IUSA 2NVYJ 4HLXA 4I7HA 3K4NA 4B47A 2H6CA 1BI2A 4OWRB 2O0YA 4GO1A 2KCWA 3MWMA 5E1XA 3C3WA 3D7GA 2DPTA 1I3AA 2XAQA 1VQ7I 3ZMDA 1H8AC 1U9NA 3C2HA 2E5ZA 3H9QA 5ED4A 5HOOA 3GTMJ 2ME6A 2EQRA 2A5YB 1S7LA 2CH0A 5IB9A 3IAM2 2X1CA 4A3GJ 1ETQA 1E0EA 2ZMEA 2E2HJ 4L5IA 1WFXA 3AG1H 3P9IA 2VT3A 3R0JA 1TW2A 4ENJA 3HGGA 3NH5A 3FWEA 1W0UA 3CCVI 1QU3A 1SD6A 4M3FA 2ZNZA 2LP0A 1T2KA 4J19A 2VQYA 3HUGB 3K2AA 4YIRX 3A02A 2AFWA 3PB4X 4P5OA 2OCEA 2E19A 2ETHA 2OU2A 1QPIA 3S1QJ 3JTKA 4X2TA 3FDYA 1JT6A 1PYTB 4UY8I 4RB1A 1SFOJ 3ZQLA 3ZQQA 1S7KA 3GEZA 2DOAA 1MBGA 4TNUA 3LA7A 2M45A 5HNHA 2ISYA 5K7FA 3H3VK 2M1BA 1CG2A 3HOWJ 1XGSA 4BHBA 2Q04A 4G8XA 4C3JJ 4HDUA 2ZJRF 2Q0OA 2OCCH 2R0QC 5JQ4A 4IQ4A 3T8TA 2NYQA 5G21A 3RPUA 3IAS2 3E5QA 2PLYA 3ZR8X 3GTJJ 3H5ZA 2NOJB 4BUPA 1KWMA 2KIQA 2YGWA 2FSWA 4CYDA 3AKZA 3GXOA 2R7WA 1ZREA 1Q1HA 3IRRA 4IF4A 3BLNA 3PB6X 1NG7A 2QKMB 3HG9A 1NSLA 4L9NA 2HEOA 1MMAA 2D2WA 3OS1A 1FIPA 3CC7I 1PVEA 1OR7A 4ZYDA 5KCMA 3IU1A 3L7WA 4FTHA 5KNLA 3FZVA 2STTA 3RQ4A 3LMMA 3B3SA 3U21A 3L2UA 2ZFUA 3CO7C 2GM4A 3V8IA 2ZSIB 2WV0A 4LX9A 4ABZA 1YW7A 5DM7F 2PR8A 2R7HA 4KIGA 1KYWA 3WHCA 2J8RA 3K9TA 2RC4A 4WCGA 2HQAA 2IS2A 2L0KA 2UXXA 2PIZA 2VONA 3KGQA 1D1BA 2ELJA 1OCPA 2CO5A 2AFSA 1ARMA 1HW5A 1UFHA 1YMEA 5DCFA 4KMUX 1HW1A 3ZZIA 5EBVA 3O2PE 1A31A 5GAGJ 2X6OA 1OYIA 3SEZA 4Z6YA 3WU2C 1QSMA 2ECCA 4ZH4F 2VC1A 2PJCA 4MNUA 1KU7A 2WSAA 5THWA 2DOFA 4WWCA 3PJRA 1ACIA 1JHFA 1F2OA 3LODA 4UWIA 5J47A 2R98A 1LAMA 4A3IJ 4GRIA 3KASA 1J59A 1GXQA 3ZQ7A 2I5UA 2M30A 3J80Z 4E8OA 2XAGA 4PXBA 2GIVA 2W7NA 3ZPLA 1R57A 4FE4A 4KT6A 1IZ1A 2AS5F 1FP2A 3WU1B 5LFAA 3G71I 1TF8A 2ME0A 2CNSA 5AONA 1J5YA 4LITA 3EUKL 4CCKA 1PDNC 1JHHA 1R43A 3LNQA 1SD7A 1WI9A 5IY5H 3V7RA 3HC7A 2CUJA 2Z3MA 5HNFA 4RBOA 3MN2A 1FT9A 4NXYA 1G6NA 2Q2EB 2QLZA 3S2WA 3WU0A 1D8JA 2STWA 1U6MA 4ENKA 3VSKA 4A6DA 3HIFA 1WWZA 2F7VA 2EJRA 5EEHA 2O9LA 1FX7A 1KQ9A 3OS0A 3MKWB 4CRYB 5E3OA 4YWYA 4JYKA 4A38A 3F8FA 3DTIA 3S1RJ 2QVPA 4XKVA 1SFKA 2DFHA 4EM2A 2CQ7A 4PFOA 3B3WA 1BLLE 2FCKA 3R0AA 4I2OA 1XF8A 2LBFA 3IWEA 4JP0A 4RM3A 1V4RA 3VEPA 2L9NA 2PJ8A 2BW3B 4IHWA 4M3BA 2Z11A 2LF8A 3CXPA 1FIAA 2MW8A 2FXFA 1ZLHA 1YVKA 2X9DA 3KX2A 4M71A 4ENNA 1ZG8A 5E1WA 2Q2EA 1YLEA 3RSNA 2MLGA 3DNSA 2V77A 1WI3A 2H8WA 5EYRA 1NE9A 1VQ9I 5LYDA 2XKOA 1EH8A 2FUG2 1UWYA 4MCSA 5C88A 3BPVA 2FBIA 4Q4ZF 2L7ZA 5IOZA 1RO5A 1Q7LA 5BWAB 2JEVA 2WBMA 1TP4A 2CTCA 1D1CA 3FXJA 3H3ZA 3ONQA 4X3RA 2BBYA 5FB2A 4MFZA 4A2ZA 2JTVA 1UHMA 5IP9J 2YNDA 2REFA 1X19A 4XORA 3GX4X 2ZEPA 4KLVA 4JZ0A 1ZGAA 4ESFA 3T90A 2CFXA 1Y8RB 4A37A 3S3NA 1LPQA 4M9XA 3CJNA 5JVGF 3KHZA 3GLJA 2KIMA 2H5MA 1IB1E 2HZDA 3F6OA 1R5ID 4RS8A 3ERED 5KTAA 3K1NA 1K4SA 5BOXA 1V0CA 1XMTA 2QSGX 2EBIA 2E1MC 1ZHFA 3ZP5A 2P6GA 4KOTA 4F6AA 2LNBA 3VB2A 1V3FA 2DMNA 1O3RA 5J1RA 1AKHA 3ISXA 3NFZA 3S3MA 2Z3NA 2MC4A
chains in the Genus database with same CATH topology
3FKJA 1M4GA 4C2ZA 1N71A 3S6FA 2XF6A 1PUAA 3OWTA 2LOOA 1LFPA 3HL2A 4FD4A 3R95A 1UG0A 2REEA 1WJAA 3M1CA 3L2RA 3OIQA 2FL4A 1WK4A 5EC4A 4CAFA 3KYLA 5J8FA 1TT0A 1WJDA 3NWSA 4XLFA 2UUZA 3H5RA 2F5IA 2PRBA 3FBNB 4B10A 3TO6A 2P6EA 3EXNA 3S93A 4FASD 5FRNA 3EC4A 4AG7A 3H9JA 1WJFA 4YGOA 3I9V2 3OL3A 1V5EA 4RMNA 1QHGA 1LVKA 4MY3A 3G8WA 4OLLA 2JSPA 1LDKB 2GOXB 4JLYA 5KTDA 1Y56A 3V42A 4BL0B 1MJAA 2OC6A 4OAZA 5FROA 3TBIA 4HKFA 4KSAA 3BJ7A 2HNHA 3OYNA 4R79A 3TOBA 5LD2C 4ZTFA 4Y4RA 4QC6A 1KONA 3R1KA 4E4HA 2Z0ZA 4UFWA 3OYHA 3CXQA 4BJ5C 1NG6A 3OYGA 4RLQA 3CJRB 2E5NA 2X6WA 3HPGA 2F6CA 4XKCA 4IZZA 4ZTJA 1S7NA 4NF1A 4CRZB 3A9LA 4JXQA 4YEJA 3BJ8A 4ZYAA 2KQRA 3R9EA 2HU9A 1Z9UA 4L89A 4NEXA 4BGDA 1KUXA 4CUGA 4ANJA 2B3UA 5DWNA 3LSMA 4BJTA 3DDDA 3OS2A 2IS4A 4B12A 4KUBA 2VQHA 3L2WA 4E7ZA 2VJ5A 3UR3C 2LBFB 3I3LA 3EO4A 2VIXA 4CZCA 2RREA 3PGPA 4AG9A 4CAVA 1YVOA 3SHPA 3VWDA 3PL8A 4KZTA 4CCOA 3LD2A 5F49A 1MW7A 3C2GA 4AYBA 2G3AA 4MFPA 4LUAA 2A4NA 2VKDA 4HPQA 4XQFA 1ZO0A 3OYLA 3KKWA 3PNYA 2ZW7A 4JJXA 3J7AY 4UFXA 1T95A 2WUUA 3TFYA 2CUZA 4J01A 4E7IA 3E1SA 4QVTA 2BL1A 4II3A 4UCPA 3OYJA 5BWAB 3WR7A 5CQEA 3RPUD 2JDCA 4R3LA 4UWIA 4BQOA 1TZLA 3SDBA 4B44A 4B48A 4X0GA 4XR6A 4ZDPA 4C2TA 2QECA 2LY2A 2R8VA 5GCNA 3TOAA 3EY5A 2LREA 1EA3A 3F9KA 3AFHA 2CV2A 1KUYA 3K10A 4U7BA 4BE1A 4ZDOA 1MNEA 4XONA 1AA7A 3S6HA 4E0AA 3LSKA 1MNDA 3ZJ0A 5KTCA 4MLOA 4IKFA 4BACA 4KORA 1WJBA 2I8DA 2WAEA 2Z2SB 1PJRA 2Q1ZB 2Q4YA 1X4OA 2DT6A 2W4SA 3K70C 5AG5A 1WJ5A 4BXFA 5HH1A 3IUOA 1U0JA 3PNTA 3DTEA 2ZW4A 3EPZA 4XLCA 4BU2A 1LRZA 4PJJA 2AQEA 4RM2A 4XLEA 1XIXA 1Z4RA 2PQ8A 3TTHA 2CMPA 2YNCA 4H6UA 1PYVA 5AG6A 3QAHA 4F0XA 2DCEA 5G20A 2B4BA 2PMZA 3F8KA 3HPHA 2VZYA 1S7FA 1Q2CA 3VYTB 5H84A 2V6EA 2MABA 2D4PA 3TT2A 3OOUA 2M7BA 3RYOA 4AVCA 2Z1DA 4NC8A 4I49A 2VXKA 4U9ZA 4NSQA 3BLYA 2HQYA 2L5QA 3K4LA 2BEIA 2V1NA 3BG6A 1FMVA 2BVLA 2R7QA 5KHDA 1P0HA 2FE7A 3F5BA 4HNYB 3DKXA 3DR6A 4J3GA 1YK3A 3DSBA 3K9UA 3DLAA 2BSWA 2WAQA 2LC2A 3R9GA 4E2AA 1Q2YA 4OAEA 4AVAA 2X85A 4NNJA 2VLAA 2M0MA 2EUIA 2K3PA 3OL4A 1Z4EA 4M85A 1G59A 4H89A 4KLWA 4MFJA 3H5NA 1I12A 2JLMA 2B58A 2ATRA 4HNWB 4KOSA 2X7BA 3HKZA 2FIWA 2Z3OA 2K9MA 3I3GA 3S6KA 4OAYA 4G6TB 4KVOE 3FBUA 1DGRM 4ZC3A 2P0WA 1YGHA 2PSWA 4GS4A 3W2VA 1UAAA 3VSLA 1I21A 2VI7A 2QKLB 1D0ZA 3PP9A 3IU2A 2R7XA 2ZW6A 3JVNA 4Q36A 3TL4X 2R7VA 3UNGC 4IQJA 1CJWA 4ITVA 4B3XA 3DEEA 2Z3KA 3GKRA 5TGTA 2KRCA 1BR2A 2HVRA 2MYSA 1TIQA 4KOUA 2M7AA 1IRXA 3G2BA 3QOEA 4FETA 2A6TA 2AE6A 4PJLA 1VHSA 4PK3A 4HG2A 3D2MA 5AGEA 2CV0A 3K70D 1DQUA 3PNVA 1SQHA 2DT7B 3TMOA 4E7KA 4UA3A 3OY9A 1BR4A 3OYEA 1LKXA 3AL0B 2VQCA 4UFVA 3BG7A 4N4OB 5G1ZA 2AQFA 4NQWB 4RLFA 1S3ZA 2IGMA 3OYKA 1MK4A 2KP6A 4OADA 4XKWA 3PFYA 1X1CA 4A31A 2OUMA 3CXSA 2KDOA 4PJNA 2CNTA 3FRMA 3RCOA 4FD7A 3D5SC 5F48A 2XDVA 3W2WA 4BQQA 2K5TA 1QSOA 2WADA 1S5KA 5I0CA 4XM3A 3IP4B 3VYRB 4DBQA 2L2OA 4AVZA 4MY0A 4XMYA 3E0KA 4HNTA 4H4KC 2B4DB 3EUHC 4LIUA 4C2UA 1X1AA 3DPUA 1UELB 2R7RA 2K5CA 4AB7A 5ISVA 4EATA 4MI4A 2G3TA 4A95A 2HPMA 5FRMA 4ZDLA 4AU7A 2A5WA 3S8PA 3OYFA 4M3SA 4RI1A 4RS2A 4C7IA 2X51A 1FY7A 3A2KA 3GBGA 1S9HA 2JUGA 3QYBA 4JD6A 3UY5A 2VASA 4B11A 3MKYB 4QPOA 3DPLC 3QODA 2Z3LA 1MMDA 3DR8A 5AG7A 5G22A 3CP8A 4PUSA 1I1DA 4BDYA 4XLHA 4QPQA 1IIDA 3L2QA 2JDDA 4H6ZA 4F91B 1RXTA 2R7OA 2M4GA 2WAFA 1CM0A 2J8NA 2RQQA 4CSWA 3E0JB 2LY1A 3OYMA 2C27A 1T0FC 4YFJA 2WA0A 4DJAA 1QSNA 2Q44A 4KOXA 5CNPA 3BCBA 2X6YA 2BOLA 2GOMA 2XAUA 5CPRB 4BS9A 4CYOA 1WJEA 2HVQA 4JQFA 4E7SA 3R9FA 2J8MA 2AJ6A 5F47A 3K4JA 1VKCA 1P4NA 2B4DA 3F0AA 3PZJA 4KOYA 3DKYA 3SXOA 2Y0SA 3D5RC 4E7HA 2DXQA 2IL4A 4Y33A 1Y7RA 4YELA 3R96A 1X1BA 4C30A 2B5GB 3CF2A 2F4IA 3LSGA 4KS9A 4CGLA 3AL0C 2V4JC 4U87A 5A28A 4JXRA 1L0CA 2QMLA 3OYDA 2I00A 4IF5A 4E6KG 2KMUA 1X4PA 3RTRA 4ORFA 2BVMA 2JVHA 3H9GA 2IXSA 4IUSA 3QB8A 1K6YA 4FD6A 4ZJZA 3K4NA 4E7JA 4FD5A 4B47A 4C2YA 2UV1A 4OWRB 2CW8A 3OIPA 3GY9A 1W36C 1ERDA 1QHHD 4D9JA 2KCWA 1G8XA 3EUAA 3N05A 2DPTA 2IS6A 1P9QC 3N7ZA 5HMNA 1N75A 3SEQA 1B6BA 4XKBA 3PUBA 3H9QA 2M3AA 2E5ZA 1Y6IA 3C2HA 4BEHB 4F55A 5HOOA 2MD0A 1YR0A 2FSRA 2HV2A 2OZHA 4A33A 3CZ6A 2CH0A 3MKZA 1S7LA 3H0DA 3IAM2 4PSXA 4CAEA 2X1CA 3ZCOA 4CGNA 4PK4A 1E0EA 2V9KA 3H4QA 1WFXA 2IGKA 2WB1A 4PFPA 5E96A 4A30A 2MFZA 2B5GA 4BDZA 2VQGA 3I9SA 4U5YA 2XF7A 2VL8A 3BC8A 1QU3A 2IS1A 4BBHA 3ZRGA 1N78A 5IX3A 2V7FA 3PSFA 4E7LA 4HRIA 3HUGB 4HNUA 3VYUB 2VBQA 2VJIA 2VQYA 3TE4A 4BE0A 4P5OA 4XN0A 4CCLA 4DOZA 2PC1A 2DPSA 3EFAA 4CS0B 2OU2A 2YNCC 1X1DA 1IYLA 4UWJA 3JTKA 4D1QA 3FDYA 1N77A 1D0YA 2KZVA 3D5LA 3TO7A 3ZQQA 1S7KA 1MJ9A 2DOAA 5AG4A 4BEHA 5JHFA 4U9YA 4N4NB 4F3QA 4XN3A 3LSHA 5HNHA 4CAWA 2ZXIA 4BQNA 2PJRA 1YE9A 4BJ6C 3D8PA 3W6SA 4II2A 4Q38A 2Q04A 5IB0A 4F93B 3OYAA 3FNCA 3OMYA 3D2PA 3SXNA 5JQ4A 4IQ4A 2R1IA 4Y49B 3K4MA 2HVSA 3H5AA 3K4CA 5G21A 4MBUA 4KVXA 2HPIA 3IAS2 2LH9A 3DWLE 3MD2A 3VYSB 2W00A 3ZR8X 3H5ZA 2Q7BA 2NOJB 1SAUA 2M4KA 1Z21A 3CJQB 4XNFA 4B43A 4BUPA 4CA0A 4F52A 2Z10A 2BW3A 2JA2A 3W3CA 4CYQA 4MFLA 2VXDA 4JOMA 2YGWA 3AKZA 3BCAA 2R7WA 3S6GA 1BO4A 2K9LA 3CMMA 3BLNA 4KSFA 1NG7A 2Q4VA 2QKMB 1W36D 3HG9A 1NSLA 1KUVA 4UBRA 2CXAA 1MMAA 4ZBGA 3P2HA 3OS1A 4C9YA 3NE7A 2KPMA 4HSRA 5KCMA 2Z3PA 3IU1A 2E60A 5KNLA 3K6GA 1Z3XA 3JUWA 3RQ4A 4ONUA 2OV7A 2Q0YA 3LMMA 1YX3A 3U21A 3L2UA 4MFQA 2ZFUA 3M8JA 2ZPAA 3V8IA 2ZSIB 1V5GA 2UWMA 4XLAA 4LX9A 4R57A 2IGOA 4Y3OA 4DGWB 5HLTA 1J4JA 1K4JA 1OZPA 2PR8A 2R7HA 2R7UA 4PK2A 4XPDB 1BR1A 2QIRA 2CNMA 2J8RA 3PSIA 2RC4A 3VWEA 2HQAA 2IS2A 4C68A 3B8GA 2PR1A 2ZSHB 1D1BA 4CCNA 2ELJA 3VWBA 2FS5A 5F46A 4PSWA 3SYTA 2BUEA 2OZGA 1OR7C 1UFHA 4CGMA 3H35A 4YRHA 2WPXA 2I79A 1BOBA 3ZGKA 2R4GA 3ZZIA 4CAXA 4CYNA 3FBIB 5EBVA 2XSJC 4NUBA 4CH7A 2KLOA 1XEBA 2VKHA 3SEZA 1XE4A 4Y49C 2HUZA 5IV0A 3CP2A 1QSMA 2VEZA 2LYCA 4NC7A 1HA8A 3IWGA 2OB0A 4KJZA 3W2AA 4XNHB 4CCMA 3G3SA 4C2XA 2CS3A 2JVGA 2NMTA 3A1YA 2WSAA 3HOSA 3P2FA 4HEA2 2V26A 2XF5A 4KITB 1ZELA 3PJRA 4KISA 1IYKA 2Y0MA 3LODA 2KRHA 2FT0A 3TO9A 3W91A 4B13A 2P6FA 2GANA 3OYCA 4B14A 2R98A 4GRIA 2G0BA 2OZUA 5CKTA 1M4DA 1Z3YA 3DU5A 4E8OA 1Y9WA 3FB3A 4BMHA 1R57A 3VDXA 2W7NA 2GIVA 1QSTA 4PJMA 2PDOA 1KZFA 4R9MA 4KT6A 4B5OA 3SZGA 1M1DA 4XOPA 3DTKA 3QYEA 3FIXA 2CNSA 5LFAA 3FYNA 1IICA 2R7SA 3GYAA 3OWCA 2XC7A 2B3VA 4LIVA 2GE3A 4LITA 3EUKL 4CCKA 4BE2A 3D3SA 4F0YA 3DPTA 3CESA 1QSRA 1D0XA 3IGRA 4XPLA 2Z3MA 3S3OA 3HC7A 2CUJA 4KVME 5HNFA 4X5KA 2O28A 2X6XA 4NXYA 1Y9KA 2Q2EB 4II9A 3K4KA 4UCNA 1NMTA 4QB9A 1U6MA 4HNXB 2VQLA 2ZXHA 3QYFA 4CCJA 3VSKA 4JWPA 4XPDC 5DWMA 1WWZA 4B5PB 4CGPA 3FXTA 5H86A 4QBJA 3OR2C 4XOTA 2E1MB 2WPWA 2FIAA 2ZW5A 2VXZA 3OS0A 3MKWB 2PJRB 3NWTA 3MGDA 4UCMA 4CRYB 4HSTA 3W6XA 2L9SA 3A4CA 1OLTA 3MMYB 3DTIA 1YREA 4YRVA 4XKVA 1SFKA 2VJ4A 2HDWA 4PFOA 2FCKA 1FMWA 3HXLA 2VZZA 4KUAA 1XF8A 5CQGA 1YX0A 2LBFA 1MMGA 3IWEA 4RM3A 2VJJA 5C82A 3OYBA 3OYIA 3TCVA 2L9NA 2WY8Q 2BW3B 2LG4A 4XPKA 2Z16A 2CY2A 1PU9A 4PV6A 3LL7A 2Z11A 3CXPA 1MJBA 4NCZA 5A27A 2VB6A 2FXFA 4KOVA 2ARHA 2CW7A 1B87A 1YVKA 2X1DA 4XNHC 3KX2A 2IGNA 2KHMA 4DBRA 2EVNA 4MHDA 1M44A 2DJIA 3S32A 1GLNA 1YLEA 3DNSA 3RSNA 4J00A 2OH1A 4A32A 2WY7Q 1R6RA 1M4IA 4B5PA 4EVYA 2VPLA 2R7TA 1NE9A 3L2VA 5HVQC 2FUG2 4CGOA 1YX5A 3HOTA 2YNEA 1GHEA 2DXIA 2CV1A 5C88A 4LG3A 1D1AA 4CYPA 4F92B 1RO5A 4L8AA 1S60A 2WBMA 3OR1C 2JEVA 4R87A 4AVBA 2RNGA 2O5RA 4IX7A 1D1CA 2ZXVA 5J8CA 3ONQA 3KEYA 3LFUA 2W1OA 3C26A 1DP3A 4MFZA 4A2ZA 5FVJA 2YNDA 1Z7LA 2REFA 1X19A 4XORA 2D4OA 4K30A 2X1EA 1J09A 4KLVA 2L7KA 3T90A 4ZGYB 3FHNA 1VZ0A 4C7HA 4P1WA 4XL9A 3S3NA 1JI8A 4DIQA 4MJ8A 4DNCA 4KOWA 2H5MA 1IB1E 2W82A 3K4BA 2HZDA 1ON0A 4QUSA 1V5FA 3T9YA 5KTAA 2F5VA 2KL4A 1V0CA 1XMTA 5JPHA 2E1MC 4KOTA 1Q2DA 2CFOA 2P6GA 2LRDA 3DU6A 4R3KA 3DQVC 4F6AA 4MFKA 1DGWY 1MMNA 1WJCA 3ZXSA 3LSIA 3S3MA 2Z3NA 2MC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M4G A;  1N71 A;  3S6F A;  1PUA A;  4FD4 A;  3R95 A;  2REE A;  2FL4 A;  1WK4 A;  5EC4 A;  2F5I A;  2PRB A;  3TO6 A;  2P6E A;  3EXN A;  3EC4 A;  4AG7 A;  4YGO A;  4MY3 A;  3G8W A;  4OLL A;  4JLY A;  5KTD A;  1MJA A;  4HKF A;  3BJ7 A;  3TOB A;  4QC6 A;  3R1K A;  2Z0Z A;  3CXQ A;  4CRZ B;  4NF1 A;  1S7N A;  4JXQ A;  3R9E A;  3BJ8 A;  1Z9U A;  4L89 A;  4NEX A;  1KUX A;  5DWN A;  2B3U A;  3DDD A;  4KUB A;  3EO4 A;  3PGP A;  4AG9 A;  4CAV A;  1YVO A;  3SHP A;  3VWD A;  4KZT A;  3LD2 A;  5F49 A;  2G3A A;  3WR7 A;  4LUA A;  2A4N A;  3ZJ0 A;  3KKW A;  3TFY A;  2ZW7 A;  4JJX A;  4QVT A;  2BL1 A;  2JDC A;  4R3L A;  2QEC A;  2R8V A;  5GCN A;  3TOA A;  3EY5 A;  1KUY A;  3S6H A;  4E0A A;  5KTC A;  4KOR A;  2Q4Y A;  5HH1 A;  2ZW4 A;  1Z4R A;  1LRZ A;  1XIX A;  2PQ8 A;  3TTH A;  4H6U A;  3QAH A;  2B4B A;  3F8K A;  2VZY A;  1S7F A;  1Q2C A;  5H84 A;  2D4P A;  3TT2 A;  3RYO A;  4AVC A;  4I49 A;  2VXK A;  4U9Z A;  4NSQ A;  2HQY A;  2BEI A;  2FE7 A;  3VWE A;  1P0H A;  4J3G A;  4HNY B;  3F5B A;  4R3K A;  3DR6 A;  1YK3 A;  3DSB A;  3K9U A;  2BSW A;  3R9G A;  4E2A A;  1Q2Y A;  4OAE A;  4AVA A;  2EUI A;  1Z4E A;  4M85 A;  4H89 A;  4KLW A;  2JLM A;  1I12 A;  2B58 A;  2ATR A;  4HNW B;  4KOS A;  2X7B A;  2FIW A;  3I3G A;  3S6K A;  4KVO E;  3FBU A;  1YGH A;  2PSW A;  2P0W A;  2VI7 A;  1I21 A;  3PP9 A;  2ZW6 A;  3JVN A;  1CJW A;  4GS4 A;  3GKR A;  1TIQ A;  4KOU A;  2AE6 A;  1VHS A;  4PK3 A;  3D2M A;  1SQH A;  4UA3 A;  1S3Z A;  1MK4 A;  4OAD A;  3CXS A;  3FRM A;  2CNT A;  4FD7 A;  5F48 A;  2K5T A;  1QSO A;  1S5K A;  5I0C A;  4MY0 A;  3E0K A;  2B4D B;  5ISV A;  4AB7 A;  4MI4 A;  2G3T A;  4M3S A;  4RS2 A;  4RI1 A;  1FY7 A;  4JD6 A;  3UY5 A;  3DR8 A;  1I1D A;  4H6Z A;  2JDD A;  1IID A;  1RXT A;  2J8N A;  1CM0 A;  2C27 A;  4YFJ A;  1QSN A;  2Q44 A;  4KOX A;  5CNP A;  3R9F A;  2J8M A;  2AJ6 A;  5F47 A;  1VKC A;  1P4N A;  2B4D A;  3F0A A;  3PZJ A;  4KOY A;  3SXO A;  2DXQ A;  2IL4 A;  1Y7R A;  3R96 A;  2B5G B;  4JXR A;  2QML A;  1L0C A;  2I00 A;  4IF5 A;  4ORF A;  4IUS A;  3QB8 A;  4FD6 A;  4FD5 A;  3GY9 A;  2KCW A;  3N7Z A;  5HMN A;  1B6B A;  2BUE A;  1YR0 A;  2HV2 A;  2OZH A;  2FSR A;  1S7L A;  4PSX A;  3H4Q A;  5E96 A;  2B5G A;  3I9S A;  4U5Y A;  5IX3 A;  2VQY A;  2VBQ A;  3TE4 A;  2PC1 A;  3EFA A;  4CS0 B;  2OU2 A;  1IYL A;  4UWJ A;  3TO7 A;  1S7K A;  1MJ9 A;  4U9Y A;  4CAW A;  3D8P A;  3W6S A;  5IB0 A;  2Q04 A;  3FNC A;  3SXN A;  3D2P A;  5JQ4 A;  2R1I A;  4Y49 B;  4MBU A;  4KVX A;  2Q7B A;  5J8F A;  2Z10 A;  3S6G A;  1BO4 A;  3BLN A;  2Q4V A;  1NSL A;  1KUV A;  4UBR A;  4ZBG A;  3P2H A;  3NE7 A;  3JUW A;  4ONU A;  2Q0Y A;  2ZPA A;  3V8I A;  4LX9 A;  4R57 A;  1J4J A;  1K4J A;  1OZP A;  2PR8 A;  2R7H A;  4PK2 A;  4XPD B;  2QIR A;  2CNM A;  2J8R A;  2RC4 A;  3B8G A;  2PR1 A;  2FS5 A;  5F46 A;  4PSW A;  2OZG A;  1UFH A;  4YRH A;  2WPX A;  2I79 A;  1BOB A;  3ZZI A;  4CAX A;  5EBV A;  1XEB A;  1XE4 A;  4Y49 C;  2HUZ A;  5IV0 A;  1QSM A;  2VEZ A;  3IWG A;  2OB0 A;  4XNH B;  3G3S A;  2NMT A;  3P2F A;  2Y0M A;  4UWI A;  1IYK A;  3LOD A;  2FT0 A;  3TO9 A;  3W91 A;  2P6F A;  2GAN A;  2R98 A;  2G0B A;  2OZU A;  1M4D A;  4E8O A;  1Y9W A;  3FB3 A;  4BMH A;  1R57 A;  2GIV A;  4R9M A;  1QST A;  2PDO A;  1KZF A;  4B5O A;  1M1D A;  3FYN A;  3FIX A;  3GYA A;  2CNS A;  1IIC A;  3OWC A;  2B3V A;  2GE3 A;  3D3S A;  4F0Y A;  3IGR A;  1QSR A;  4XPL A;  4KVM E;  4X5K A;  2O28 A;  4NXY A;  1Y9K A;  1NMT A;  4QB9 A;  1U6M A;  4HNX B;  4JWP A;  5DWM A;  4XPD C;  4B5P B;  1WWZ A;  3FXT A;  5H86 A;  2WPW A;  2FIA A;  2ZW5 A;  3MGD A;  4CRY B;  3W6X A;  1YRE A;  4KUA A;  2VZZ A;  2FCK A;  1XF8 A;  1YX0 A;  5C82 A;  3TCV A;  4XPK A;  2CY2 A;  1PU9 A;  4PV6 A;  2Z11 A;  3CXP A;  4NCZ A;  1MJB A;  2FXF A;  4KOV A;  2ARH A;  1B87 A;  1YVK A;  4XNH C;  4MHD A;  2EVN A;  1M44 A;  3DNS A;  1YLE A;  2OH1 A;  1M4I A;  4B5P A;  4EVY A;  1NE9 A;  1GHE A;  5C88 A;  1RO5 A;  4L8A A;  4AVB A;  1S60 A;  2JEV A;  4R87 A;  2ZXV A;  5J8C A;  3C26 A;  5FVJ A;  4KLV A;  4K30 A;  2REF A;  2D4O A;  4QBJ A;  3T90 A;  4MJ8 A;  4DNC A;  4KOW A;  2H5M A;  1IB1 E;  4QUS A;  1ON0 A;  3T9Y A;  5KTA A;  1V0C A;  1XMT A;  5JPH A;  4KOT A;  1Q2D A;  2P6G A;  4F6A A;  4II9 A; 
#chains in the Genus database with same CATH topology
 3FKJ A;  4F7Z A;  1M4G A;  4C2Z A;  1RZ4 A;  1PUA A;  2LOO A;  2A6H F;  5LRJ A;  2LLK A;  1UG0 A;  1WJA A;  2EZH A;  3CQZ J;  3NE8 A;  4KIC A;  1BIB A;  4FBE A;  1WK4 A;  5EC4 A;  2W24 A;  4XLF A;  2TCT A;  4ZYH A;  1MSE C;  2PRB A;  1SEU A;  3WAB A;  3E6B A;  2P6E A;  3EET A;  3S93 A;  5FRN A;  5HVH A;  1XBU A;  3SI2 A;  1NHA A;  2Y75 A;  2GA2 A;  3M7G A;  3ML6 A;  3D0S A;  3CC4 I;  3I4M J;  4OP4 A;  1K78 B;  5M5Y J;  1QHG A;  5D5U B;  1BL0 A;  4QTR A;  1LEB A;  2L7F P;  1J9I A;  4OLL A;  2JSP A;  2IRF G;  3GTL J;  3K1M A;  4KDP A;  1AMP A;  3U1D A;  1A6Q A;  1Y56 A;  3V42 A;  1MJA A;  1R7J A;  2TDX A;  4CO8 A;  1T38 A;  1I3Q J;  5DEQ A;  3TBI A;  1O7F A;  4KIB A;  4HKF A;  1D3Y A;  4ZTF A;  4V19 K;  4Q5S F;  5K5Q A;  1KON A;  3CUO A;  1TKF A;  4OC3 A;  1QZY A;  2JPB A;  2LKX A;  4E4H A;  2VBZ A;  5LGU A;  1QO0 D;  3OYH A;  4A6E A;  3F21 A;  2H8R A;  2HDC A;  5FFX A;  3F0C A;  4LQG A;  1UHW A;  4Y17 A;  5H6R A;  4RB2 C;  4BJ5 C;  1XSV A;  4XK4 A;  2HI3 A;  5FKO A;  2ZJ2 A;  4G6Q A;  4A3E J;  4JXQ A;  3R9E A;  3BJ8 A;  4ZYA A;  5DV5 A;  1B9M A;  4L89 A;  2FQ4 A;  4A0X A;  2GXB A;  3LSM A;  4BJT A;  3DDD A;  2K85 A;  4B12 A;  1IG7 A;  2VQH A;  3QPT A;  4RAF A;  2BZT A;  2HR3 A;  4LK1 F;  4P9F A;  2B0L A;  1QZZ A;  5J3L A;  3D7H A;  2FEZ A;  3RZO J;  2XUB A;  5D5W B;  3RI4 A;  3LA2 A;  3EQL F;  5HLI A;  4CZC A;  2PMZ N;  5IT9 K;  2PJ0 A;  1RKW A;  5K8M A;  5E79 C;  3SHP A;  4EQQ A;  3VWD A;  4CCO A;  4X6A J;  1Z8T A;  4XQF A;  4UFX A;  1TBX A;  1T95 A;  1FOY A;  3HTU A;  5EDN A;  3E1S A;  4UCP A;  2LR8 A;  5CQE A;  1TZL A;  1DUX C;  3SDB A;  4B48 A;  3S1M J;  3A0H C;  2OR4 A;  2EFN A;  2IA2 A;  3SJX A;  3KZI C;  3SZP A;  1JWQ A;  2AFX A;  3F9K A;  2Z9O A;  1K6O A;  1VGY A;  4EV0 A;  5K7Z A;  4R1H A;  1E3O C;  1X10 A;  3K10 A;  2NXN B;  4U7B A;  4E0A A;  2K02 A;  4XON A;  1ETW A;  3LSK A;  4A0Y A;  2NOG A;  3RO0 A;  5AIQ A;  3NH4 A;  5BQT A;  2I8D A;  2Z2S B;  1PJR A;  2Q1Z B;  3M1E A;  5B3S H;  1AWC A;  5L3G A;  1F9N A;  1BOA A;  3IUO A;  3PNT A;  1IRG A;  2ZW4 A;  1PUF B;  4PJJ A;  1LRZ A;  4RM2 A;  4JX5 A;  1IUY A;  1FTT A;  4H6U A;  5AG6 A;  4RGS A;  4X1E A;  5LYL A;  3ABM H;  3BR3 A;  1FBS A;  2OBP A;  1T98 A;  3PFI A;  3VYT B;  4KYW A;  1Q2C A;  5EEA A;  2M9H A;  4AM3 A;  1NH3 A;  3PB8 X;  3OOU A;  2DAO A;  3DLL F;  2EBJ A;  2VXK A;  5K8N A;  2XPU A;  5M3F J;  4OIO F;  2L5Q A;  3K4L A;  4LK0 F;  2BEI A;  2V1N A;  2ZC2 A;  3P9C A;  3WHB A;  1P92 A;  4Z2Y A;  1P0H A;  2FE7 A;  1MMS A;  4J3G A;  1KQ0 A;  3T1B A;  3DSB A;  3FXK A;  5EGO B;  2WAQ A;  4OIQ F;  2JZY A;  2LC2 A;  4BY1 J;  1E2X A;  2DQL A;  2FJ1 A;  4M6X A;  4IO9 F;  2X85 A;  3G1L A;  4TV7 A;  3LMS A;  3NH8 A;  3VOD A;  1WWX A;  4B3A A;  4P10 A;  1HDQ A;  1Y0R A;  3OL4 A;  4WWV A;  4M85 A;  4N9H A;  3WTX C;  2AFO A;  4KLW A;  1MH4 A;  3JRF A;  2B58 A;  4HNW B;  1Q1V A;  1UHS A;  1R1T A;  3R60 A;  1JKR C;  4RGR A;  3S6K A;  4OAY A;  5DD4 A;  4Y7N J;  2QBY A;  1DGR M;  2PSW A;  1I21 A;  1EJ9 A;  2FQ3 A;  2VBY A;  4MHG A;  3IU2 A;  1HEE A;  3T0Y A;  2ICW G;  1TWH J;  1JKP C;  3SDG A;  4BXX J;  5FO5 A;  5D5V B;  2M5W A;  4I99 C;  3K1P A;  2Z3K A;  3DEE A;  4GS4 A;  5TGT A;  1TIQ A;  4KOU A;  3QP6 A;  3VAR A;  2QGU A;  2M7A A;  3G2B A;  1JT0 A;  1VHS A;  2R7F A;  4HG2 A;  5AGE A;  1DQU A;  1FOX A;  3OY9 A;  1BR4 A;  2H6B A;  5F6F A;  3ZMS A;  1LKX A;  3HRM A;  3E5X A;  4UIB A;  4IPA A;  2IGM A;  3F6V A;  3WTY C;  2YX4 A;  1MK4 A;  4A39 A;  1OFC X;  1R1U A;  3HOV J;  4A31 A;  4EVI A;  2OUM A;  1W0T A;  2KDO A;  2QSF X;  1JJ6 C;  2CNT A;  3FRM A;  3WTT C;  5LEK A;  4MTE A;  3E6M A;  4FD7 A;  1ZKG A;  2JUC A;  2E2I J;  2GIZ A;  3W2W A;  1ZG9 A;  2IBD A;  5D8N A;  3VYR B;  4DBQ A;  1LFU P;  4LG0 B;  3LST A;  4E70 A;  4H4K C;  4LOC A;  3TX8 A;  1S6L A;  1TWG J;  3BY6 A;  3I55 I;  1HOM A;  4MCR A;  1G3S A;  2K5C A;  4MHP A;  3GTO J;  1U5T C;  1FYM A;  2R7Z J;  2RB7 A;  2QYO A;  2CQN A;  3HTS B;  1UFM A;  3UY5 A;  2VAS A;  2MSY A;  2DFI A;  1REP C;  3E6D A;  2DDA A;  3BJ6 A;  3DR8 A;  2Z3Y A;  1R49 A;  4PUS A;  5GAD J;  3CCM I;  4XLH A;  4QPQ A;  3RKY A;  2BYV E;  3RPQ A;  1ZRD A;  4IHX A;  3GUX A;  4O23 A;  1CM0 A;  3DBR B;  2RQQ A;  2F5E A;  3E0J B;  4PXE A;  2MBF A;  4P4I A;  1O3T A;  2WA0 A;  3MZH A;  4KOX A;  2R7D A;  2BY0 A;  2XAU A;  2WB1 N;  3DXJ F;  4JQF A;  3ZQC A;  5L3B A;  1VKC A;  2EFQ A;  2VC0 A;  1P4N A;  3EYY A;  4CZZ A;  2DK5 A;  3IC1 A;  3SXO A;  2XGX A;  3HSE A;  5ILS A;  4XIC A;  2HKO A;  2R5Y A;  1Y7R A;  1ONV A;  5F64 A;  4U87 A;  3KZZ A;  2CUF A;  2EIN H;  4GYI A;  2DMP A;  2AXL A;  5DUK A;  4D5C A;  1B4A A;  3IIB A;  2QML A;  2K86 A;  2Z99 A;  2ZXW H;  5LHI A;  4IF5 A;  1X4P A;  1ZK8 A;  4A12 A;  1ON2 A;  3H3U A;  1IJW C;  4HDV A;  4E7J A;  4HF2 A;  2FRH A;  2ZBK A;  1IO2 A;  1W36 C;  1ERD A;  1G8X A;  2EZI A;  3EUA A;  3N05 A;  4QLC U;  5HMN A;  3SQN A;  3CF5 F;  3IH2 A;  4BEH B;  4P9U A;  3PQK A;  5GTH C;  4A33 A;  3WGI A;  5GP9 A;  3CZ6 A;  1CP6 A;  2O8K A;  1JTX A;  2XAF A;  3ZCO A;  1IY7 A;  2V9K A;  3MVP A;  2IGK A;  4PFP A;  4OC4 A;  4UXN A;  4L18 B;  4BDZ A;  2VQG A;  3JAM Z;  3WTV C;  1VQP I;  3BC8 A;  2DF5 A;  3ZRG A;  5DS0 A;  5IX3 A;  2L02 A;  2V7F A;  4BBS J;  1JQG A;  4KSI A;  2WC2 A;  3A03 A;  4BE0 A;  3DCF A;  1F57 A;  1S3J A;  4CCL A;  1ETO A;  4EME A;  2PC1 A;  3TDU C;  3EFA A;  3WC5 A;  3K0L A;  4UWJ A;  2ZOG A;  1WH5 A;  2EZL A;  3PEI A;  1UZC A;  1NK3 P;  3D5L A;  2PMH A;  2NYX A;  4D5F A;  1MJ9 A;  3SJF A;  3QNV A;  2JRT A;  4BEH A;  1HCR A;  1Z8X A;  4N4N B;  1GV5 A;  3D1N I;  3KR5 A;  2K9N A;  4XRS A;  4CAW A;  1LDJ A;  1YS6 A;  3LSJ A;  3WTS C;  2PJR A;  2DOD A;  4BJ6 C;  3W6S A;  1OYW A;  4II2 A;  5IB0 A;  2W48 A;  4HYE A;  3H36 A;  1OCC H;  4OID A;  3E97 A;  3CME I;  4MGR A;  2NSM A;  4YFK F;  3FX3 A;  3BQZ A;  1Z77 A;  3K4C A;  3IRQ A;  2Q4Z A;  2HPI A;  1R58 A;  3DWL E;  2W00 A;  1IAW A;  4F52 A;  4B43 A;  1OQY A;  1K4T A;  4I0B A;  2NVT J;  4CYQ A;  4A3L J;  2QEN A;  1IXS B;  5ICE A;  2I3C A;  2M8G X;  2IA1 A;  2J9A A;  2H27 A;  3LWF A;  2GRE A;  3CCS I;  4KSF A;  3WTW C;  4S04 A;  1YW4 A;  4UBR A;  2CXA A;  4ZBG A;  4EMS A;  4OOI A;  1X12 A;  1IXC A;  1HF0 A;  2Z3P A;  1POG A;  2E60 A;  3FHZ A;  3FF3 A;  3JRD A;  1K61 A;  1BI0 A;  1Y0N A;  2OV7 A;  2Q0Y A;  1QZE A;  5EMI A;  1ZAO A;  3M8J A;  1JTY A;  2ZPA A;  1JUM A;  2P5L C;  3KEO A;  3TP0 A;  1VHE A;  3GUD A;  2EH3 A;  1HC8 A;  4Y3O A;  1J4J A;  5B1B H;  3ISZ A;  4ZI6 A;  4XPD B;  2OTL I;  2R7U A;  1BR1 A;  2HKX A;  1XMK A;  2LVS A;  3BJA A;  5HOD A;  2HXO A;  5H2F C;  1MD0 A;  1RI7 A;  3GVA A;  3T5X A;  3VWB A;  2OAZ A;  1TXR A;  4CIC A;  5F46 A;  4PSW A;  3SYT A;  5M5W J;  2OZG A;  1QPM A;  4UF4 A;  2B63 J;  3H35 A;  4CGM A;  5JGF A;  4YFN F;  2WPX A;  1ELM P;  3ZGK A;  1FP1 D;  2R4G A;  4CAX A;  2PJ4 A;  2EK9 A;  1WCM J;  2VKH A;  3KIO A;  4B4C A;  1XEB A;  2ZKZ A;  4UUT A;  3A01 A;  2FOK A;  4HX7 A;  2VEZ A;  4Y49 C;  1WKM A;  1HA8 A;  4ESJ A;  1GYT A;  2X48 A;  4KJZ A;  2G7H A;  5TJJ A;  2DI3 A;  3W2A A;  4CCM A;  3G3S A;  4XNH B;  2CS3 A;  2JVG A;  5DD8 A;  4IHY A;  2NMT A;  4P44 A;  4L5J A;  4RB3 C;  4IRI A;  3L09 A;  1FT7 A;  2V26 A;  1IYK A;  1ZEL A;  3NQO A;  1ZQ3 P;  3TO9 A;  2FT0 A;  2PJB A;  4B14 A;  4A5N A;  2ZXJ A;  3M4O J;  2G0B A;  5C4X J;  3WGH A;  3KFW X;  4JX4 A;  1M4D A;  1Z3Y A;  5GTI C;  1STZ A;  1XRY A;  4R9M A;  1TWA J;  4PJM A;  2PDO A;  2ZEG A;  1R36 A;  1S72 I;  2CSO A;  2EV6 A;  2P5K A;  3FYN A;  3DTK A;  3QYE A;  4G7H F;  3FIX A;  1IIC A;  4LLG F;  2BGC A;  2HQN A;  4LIV A;  2GQQ A;  5E3M A;  2XC7 A;  1VQM I;  2GE3 A;  1I50 J;  1RES A;  3D3S A;  3IGR A;  3KP5 A;  1D0X A;  1JGG A;  4PPZ A;  4KVM E;  4JBA A;  2P81 A;  3CDI A;  4X5K A;  1HLV A;  3FMS A;  4UCN A;  1X2M A;  4QB9 A;  4HNX B;  4CCJ A;  3QYF A;  3Q9S A;  3CCU I;  2B9S A;  3OR2 C;  4HBL A;  5L3E A;  2WPW A;  2FIA A;  3HEF A;  2VXZ A;  3RZA A;  3NWT A;  2JPC A;  4HST A;  3W6X A;  4B8X A;  3A4C A;  3WT4 A;  3MMY B;  1YRE A;  2LKS A;  2MC3 A;  3T8R A;  3TW7 A;  1BW6 A;  5K8P A;  5DS9 A;  3QU3 A;  2VZZ A;  2LY9 A;  1FMW A;  2HXI A;  2ID6 A;  2WYR A;  3GME A;  3ISP A;  1YX0 A;  4OKO A;  3B6A A;  3OYB A;  1D8K A;  2WY8 Q;  3L2N A;  3SI0 A;  2DMQ A;  2LG4 A;  3HOX J;  5K1Y A;  4NDL A;  3DKW A;  3LL7 A;  3CCY A;  2HC9 A;  4O5V A;  2IQ6 A;  3AG3 H;  1U3E M;  2NRA C;  1XSX A;  4S0H B;  2QQ9 A;  3ZN1 A;  1M44 A;  1P2F A;  3VOE A;  4A32 A;  1SMY F;  3CO6 C;  1ZTR A;  1W7P A;  5CVI A;  2FF4 A;  3KP4 A;  1D5Y A;  1UST A;  1WVR A;  2VPL A;  5HDK A;  2R7T A;  1TQP A;  4WJB A;  2XKP A;  5FGM A;  1HKQ A;  3BWG A;  4GDF A;  2JA6 J;  4LQ6 A;  3ZOB A;  2C6Y A;  2P6T A;  4ZZD A;  4UB8 C;  3R4K A;  3A0B C;  3ECH A;  3LOC A;  5LHH A;  2F8H A;  4CYP A;  4AVB A;  3N5F A;  3OR1 C;  3KQX A;  2RNG A;  3LAJ A;  4IX7 A;  4L0Z B;  4FT8 A;  1W5T A;  5J8C A;  2GLF A;  3LFU A;  3U9G A;  3E6C C;  1DP3 A;  3KZY A;  1U2W A;  5FVJ A;  4BHC A;  1R23 A;  2E35 A;  2FE3 A;  1VIX A;  2D4O A;  4QBJ A;  2X1E A;  4AID A;  3FHN A;  5F0F A;  4MJ8 A;  4CGZ A;  2O6G E;  4KOW A;  3GLX A;  3RKX A;  3T9Y A;  2RV8 A;  2KL4 A;  3JSO A;  5JPH A;  3RQI A;  1Q2D A;  2DT5 A;  1T8I A;  3GIU A;  2F2E A;  4OIN F;  1WJC A;  1MMN A;  2ZOF A;  3WG7 H;  1JKQ C;  3BOQ A;  4CGN A;  2XF6 A;  4FD4 A;  1LFP A;  2REE A;  4NB5 A;  1XOV A;  1BA5 A;  3H8E A;  3L2R A;  4LLL A;  3FM5 A;  1H9T A;  5LEJ A;  3JTH A;  2FL4 A;  2JBK A;  1TT0 A;  1WJD A;  2A61 A;  2EV0 A;  5J4V A;  1SAN A;  4MO7 A;  1I5Z A;  3K7A J;  2F5I A;  5JFR A;  3D66 A;  1EH6 A;  3FBN B;  3EXN A;  4YIF A;  5E8G A;  4FAS D;  2NVQ J;  3EC4 A;  1RIO H;  4AG7 A;  1U5T A;  1FYL A;  3H9J A;  5AIP A;  1UB9 A;  4JX6 A;  4EJT A;  4AYB N;  4KA4 A;  1R5H A;  4MHZ A;  1KU2 A;  4DW6 A;  1EKE A;  1Z9C A;  2V9P A;  4IL6 C;  3M9A A;  3ZN0 A;  4L9J A;  4OAZ A;  5FRO A;  2VE9 A;  1VQO I;  2QSH X;  4KSA A;  2HNH A;  5IP7 J;  3OYN A;  1HW2 A;  5LD2 C;  2PVV A;  3NA6 A;  1R9T J;  3KP3 A;  1T6S A;  4QC6 A;  2DPD A;  3HBL A;  3DP7 A;  2DFE A;  3DBH B;  4UEF A;  1ULY A;  3CXQ A;  4NBQ A;  5D5X B;  6CPA A;  2KJC A;  2MG4 A;  1NG6 A;  2KIU A;  3OYG A;  2DEA A;  2ZED A;  4AD9 A;  4ZYE A;  4CRZ B;  4OMY A;  1S7N A;  1LB2 A;  4NJQ A;  1SVO A;  3A9L A;  4YEJ A;  3FH4 A;  3WG9 A;  4LD5 A;  1Z9U A;  4BGD A;  4RDU A;  2E1O A;  2GAU A;  3SZT A;  4NGP A;  1ZG7 A;  2K4J A;  2XPV A;  4B1R A;  2IS4 A;  3RNZ A;  3S9M A;  4OIP F;  1QGP A;  2Y69 H;  2XAS A;  4M73 A;  3UR3 C;  3KYC B;  2LBF B;  5F1R A;  3EO4 A;  4NGS A;  2RRE A;  3PGP A;  3LFK A;  2PFB A;  3JRU A;  2VT2 A;  4KZT A;  3S9N A;  4FAI A;  3LD2 A;  5F49 A;  4A3B J;  2G0E A;  3B7I A;  3C2G A;  2LD5 A;  3D68 A;  2VKD A;  4EGZ A;  1ZO0 A;  1OCT C;  3TFY A;  1FSH A;  2HTJ A;  3QPS A;  4G94 A;  3J7A Y;  5E17 F;  2WUU A;  2CUZ A;  3KET A;  3GFJ A;  4UVB A;  4QVT A;  2LFB A;  4RAY A;  4UEE A;  1J2X A;  1Z91 A;  1IN4 A;  3RPU D;  4R3L A;  2AXT C;  3B02 A;  2QEC A;  4MXU A;  5IYD J;  4ZDP A;  3CC2 I;  2ZFW A;  5GCN A;  1LCP A;  1U78 A;  4BY7 J;  2L3D A;  1LQ1 A;  3X2Q H;  1BIA A;  1IV6 A;  1YHQ I;  1GHC A;  1XFO A;  1ETY A;  2CWE A;  4RAG A;  3S6H A;  2EZK A;  5E8I A;  2VOO A;  1AA7 A;  4R8H A;  1MND A;  3FMC A;  4IKF A;  4A94 A;  4BAC A;  2LDU A;  1AOY A;  1FPQ A;  2HOE A;  2WAE A;  3Q0U A;  4M3E A;  3F23 A;  1G3Y A;  4O3M A;  3HKZ N;  3K70 C;  4GCV A;  1CBX A;  1TKH A;  1K83 J;  3DTE A;  5DTD A;  3B73 A;  4BU2 A;  1Z4R A;  5IYB J;  1XIX A;  2E1C A;  1TKJ A;  2H1L A;  3K2K A;  1A04 A;  3SJM A;  3IHU A;  3MQ0 A;  1F1Z A;  1XG1 A;  1SC7 A;  4K3N A;  3HPH A;  1S7F A;  1BPN A;  3JRE A;  5H84 A;  5HS7 A;  1AKH B;  2D4P A;  2VPR A;  2CU7 A;  2Z1D A;  3JSP A;  4M9Z A;  3BLY A;  4JYW A;  4MTD A;  1GXP A;  2LKP A;  5IYC J;  1FMV A;  2BVL A;  2R7Q A;  1P4W A;  4M6Y A;  3F5B A;  2EIL H;  3N97 A;  3R9G A;  4CDG A;  1Q2Y A;  4AVA A;  2ZEO A;  3CD6 I;  2V1X A;  4NNJ A;  1IN6 A;  1DTD A;  2M0M A;  1A5J A;  4RN7 A;  3JR9 A;  1Z4E A;  4HF1 A;  3PQJ A;  1A2Z A;  4S05 A;  3H5N A;  3JRG A;  1I12 A;  2JEW A;  2JLM A;  4MFJ A;  4KOS A;  3FK7 A;  3S2H J;  4OC2 A;  1TL8 A;  2Z3O A;  2K9M A;  4W1U A;  1YO5 C;  2HOS A;  1D5V A;  1FSE A;  4KVO E;  2JQ7 A;  2P0W A;  1R4N B;  3HRS A;  3W2V A;  3VSL A;  1Z8W A;  4F9U A;  3PP9 A;  1APL C;  3CDH A;  4OC0 A;  1CPX A;  4EWT A;  3MAJ A;  3TL4 X;  4ZYQ A;  2R7V A;  1F2P A;  2F5C A;  4IQJ A;  2MA3 A;  3N4M A;  1BR2 A;  3CUQ C;  4A0Z A;  4BBR J;  5HLH A;  1C0W A;  1ZRC A;  3QOE A;  3JRH A;  4PK3 A;  4BHP A;  2MLK A;  3D2M A;  1SQH A;  3K2Z A;  3FX6 A;  3V8J A;  5ILU A;  2DT7 B;  3WE3 A;  4E7K A;  1YLO A;  3HOU J;  2GFQ A;  4MHY A;  4UA3 A;  4ZY0 A;  3OYE A;  3AL0 B;  3PBE A;  3BG7 A;  4N4O B;  5G1Z A;  1Y1W J;  4RLF A;  2D5V A;  4M6I A;  2KDZ A;  1FBQ A;  1R1V A;  1RR7 A;  1X1C A;  2R3S A;  2O03 A;  3BZC A;  3D5S C;  2XDV A;  5FLX K;  5I0C A;  3G1O A;  5E3L A;  3IP4 B;  1NK2 P;  1Z5R A;  4AVZ A;  4MY0 A;  4EJW A;  4XMY A;  3LQQ A;  2BEO A;  1AYE A;  2RKH A;  4TWE A;  3F8C A;  1Z6R A;  5HVF A;  1X1A A;  3DPU A;  1UEL B;  2Q51 A;  5ISV A;  2CG4 A;  2G3T A;  2VKE A;  2HPM A;  4AU7 A;  3S8P A;  2X51 A;  1HKS A;  1B6A A;  1E3H A;  1YQA A;  1MGT A;  4P96 A;  4YFX F;  2XRN A;  3QOD A;  3QU6 A;  1XSD A;  1YJ9 I;  1MMD A;  1NTC A;  3MEX A;  1U6G A;  3REO A;  1I1D A;  4BDY A;  3L2Q A;  4F91 B;  3GFL A;  2PJ2 A;  2WAF A;  3WE2 A;  2AFZ A;  3AG2 H;  4CSW A;  1HST A;  3PO3 J;  1T0F C;  5F0C A;  1S7A A;  1YYV A;  4YFJ A;  4DJA A;  1IOI A;  4WXH A;  1QSN A;  3FXU A;  3BCB A;  2X6Y A;  2DYR H;  5CPR B;  2HVQ A;  4I02 A;  5KAI C;  3JTG A;  1LAP A;  1VQN I;  2AJ6 A;  3PZJ A;  3E7L A;  3WGG A;  4KOY A;  5JR3 A;  3PBB A;  2RVC A;  2Y0S A;  3D5R C;  2DXQ A;  2IL4 A;  2EIJ H;  3GW2 A;  3JRC A;  4R7M A;  3CF2 A;  4KS9 A;  2G9W A;  3BTJ A;  1YIJ I;  2HQR A;  4XRS G;  5A28 A;  1F43 A;  1PCA A;  2O4H A;  5B66 C;  3KEQ A;  3OYD A;  2I00 A;  2P5V A;  4E6K G;  4ORF A;  1I1G A;  1V54 H;  2JVH A;  3H9G A;  4EEF G;  3SI1 A;  3BPX A;  3ZQI A;  4C2Y A;  3LAC A;  1XN7 A;  2OF7 A;  2UV1 A;  2JA8 J;  2CW8 A;  1W1W E;  1R3N A;  1HSJ A;  4D9J A;  4G12 A;  3N7Z A;  2IS6 A;  1P9Q C;  5M3M J;  1N75 A;  3MRU A;  2EIM H;  4XKB A;  3PUB A;  3S2D J;  2M3A A;  2HOT A;  1YR0 A;  2HV2 A;  2OZH A;  4LMY A;  2XSD C;  3RZD J;  2FSR A;  4IHV A;  2QUF A;  4XBF A;  3MKZ A;  4NGM A;  4PSX A;  4CAE A;  2VE8 A;  1SAX A;  2QBY B;  3V8K A;  3ZMU A;  2FML A;  2ANP A;  4A30 A;  3ZQH A;  2LSO A;  4XSX F;  3ZMT A;  2VL8 A;  1SD5 A;  2PRQ A;  1XDU A;  3UKG A;  1RUO A;  4BBH A;  2F4O B;  2OJE D;  3GZ5 A;  3PSF A;  1QRY A;  4HNU A;  2N8G A;  3TE4 A;  3FXO A;  1E3P A;  1XGN A;  2HB6 A;  2L4A A;  2QJ8 A;  2DPS A;  2XIG A;  4XRM A;  4P6Y A;  2CYY A;  4YG2 F;  2EIK H;  2P8T A;  2E2J J;  1I1S A;  1IYL A;  4D1Q A;  2YNC C;  1ZYR F;  3DEW A;  1UCR A;  1N77 A;  1H89 C;  1CP7 A;  4P4B A;  1D0Y A;  4UV9 A;  3JRA A;  3CMA I;  4MEY F;  2VKV A;  3TO7 A;  1R4M B;  5AG4 A;  2XGC A;  3W6J B;  5JLW A;  1XCB A;  4F3Q A;  1MIJ A;  2ZME C;  1XGO A;  4XN3 A;  5DDG A;  4HZF A;  2DA2 A;  4PZJ A;  3D8P A;  2B7E A;  1FZP B;  4ON0 A;  3VFZ A;  4F93 B;  3OYA A;  1HDP A;  3OMY A;  2DQR A;  2XB5 A;  3K4M A;  2RDP A;  4DQ2 A;  2DW4 A;  3RKW A;  5ICG A;  5FLM J;  3H5A A;  5EG0 B;  2HVS A;  3H0G J;  4KVX A;  1ZR2 A;  4H2K A;  5ILV A;  3VYS B;  2PI0 A;  5FD5 A;  3JRB A;  1HBX G;  5J8F A;  1SAU A;  4CA0 A;  2Q7B A;  2TRT A;  2ZEN A;  1OJL A;  2OD5 A;  3K69 A;  3I4N J;  2JN6 A;  2YX7 A;  4MFL A;  2VXD A;  1BAV A;  4JOM A;  1XTA A;  4EJV A;  3FEC A;  3B2Y A;  2K3F A;  2PMU A;  3BCA A;  3S6G A;  3VH9 A;  4KN4 X;  1BO4 A;  3CMM A;  5CLS A;  2EV5 A;  5LGN A;  1KUV A;  1VTN C;  2ACJ A;  4ESB A;  3HRT A;  4R76 A;  3P2H A;  2XGE A;  4C9Y A;  3G6E I;  1FOK A;  2QQ8 A;  1T39 A;  3NE7 A;  2KPM A;  2YR2 A;  2V1U A;  1YLF A;  3LWU A;  1JUS A;  1Z3X A;  3MCZ A;  1JE8 A;  4FX4 A;  4P45 A;  4N9I A;  3RYR A;  3BR0 A;  5EG0 A;  3IEH A;  1B59 A;  1V5G A;  2QVO A;  2UWM A;  4GYG A;  2FD5 A;  3D4U A;  4DGW B;  4KIF A;  5HLT A;  3IWW A;  3PFO A;  1K4J A;  4R57 A;  2YUS A;  1ON1 A;  1LOK A;  4PK2 A;  2ISZ A;  2QIR A;  3D7F A;  2PEX A;  1GUU A;  2R5Y B;  3PSI A;  5F04 A;  3LSP A;  4C68 A;  4DUK A;  2BE5 F;  4ZY1 A;  2PR1 A;  2ZSH B;  2JJ7 A;  3CJT B;  4M3D A;  1JGS A;  4CCN A;  4LGW A;  1LDD A;  5CJ9 A;  4MCP A;  4AIH A;  2ZEL A;  1X2N A;  5LYF A;  1OR7 C;  2IMO A;  1DU0 A;  3KI9 A;  1R22 A;  1NSA A;  2I79 A;  1BOB A;  5K5R A;  3CCQ I;  4UIA A;  3NAU A;  4HX4 A;  4N0B A;  3ROU A;  4ZX8 A;  4NUB A;  2MH9 A;  4A5M A;  4MQ9 F;  4HF0 A;  4GXO A;  1TC3 C;  2JBJ A;  1XE4 A;  2HUZ A;  3TW6 A;  2LYC A;  3ABK H;  4LB6 B;  5TRD A;  3RIR A;  2WTE A;  2OB0 A;  2VN2 A;  3I54 A;  2O8X A;  1CGP A;  1JXS A;  4C2X A;  1OIS A;  1M1E B;  1XC5 A;  3P2F A;  4KIS A;  2GLJ A;  4UUS B;  3W91 A;  2GAN A;  3OYC A;  2PJ6 A;  4OU0 A;  4KN7 X;  2KFD A;  4G7O F;  5F09 A;  2OZU A;  2PCU A;  5CKT A;  3DU5 A;  5L3F A;  1SFU A;  1Y9W A;  3FB3 A;  2PJA A;  4BMH A;  3VDX A;  2E7X A;  1MDM A;  1KZF A;  1KU3 A;  4B5O A;  1M1D A;  3KCC A;  2Y9Z A;  3KP7 A;  2R7S A;  2YSR A;  3OWC A;  3KLN A;  2B3V A;  5HVG A;  4LJZ F;  1GV2 A;  3J7Y J;  4BE2 A;  3TDZ C;  3DPT A;  3CES A;  1F4K A;  5KAF C;  4XPL A;  4UVC A;  1P4A A;  3HLP A;  2FBH A;  2O28 A;  2X6X A;  1X1P A;  4XLN F;  3B3T A;  2V1D A;  1T08 B;  1NMT A;  1P6R A;  2HZT A;  2VQL A;  3COA C;  1BJA A;  4JWP A;  4B5P B;  5GAH J;  3FXT A;  2E1M B;  3QP5 A;  1DPU A;  4IVN A;  2GA1 A;  2ZW5 A;  2ZJQ F;  2PJR B;  4UCM A;  4UUS A;  8CPA A;  3C2B A;  1XMX A;  2L9S A;  3W6K B;  1FNO A;  4YRV A;  2C6G A;  2VJ4 A;  4L9T A;  1IOF A;  3HXL A;  1PUE E;  1MMG A;  2EA2 A;  1USS A;  3C1D A;  1IN7 A;  2GWR A;  3ESW B;  2HYG D;  4ETS A;  3OYI A;  5JHU A;  2VI6 A;  5IP6 A;  1FBU A;  1J75 A;  1J0R A;  2Z16 A;  1PU9 A;  2NNN A;  3O8H A;  5A27 A;  3CLQ A;  1MJB A;  2BHY A;  3ERM A;  4KOV A;  2CW7 A;  1B87 A;  2X1D A;  2PJ3 A;  1FWZ A;  2HGC A;  5JM6 A;  4BXU A;  2IGN A;  1BJZ A;  2XRL A;  4DBR A;  2EVN A;  3H8G A;  4MHD A;  3S32 A;  1GLN A;  1IXR C;  1X3W B;  3P9K A;  4J00 A;  2W84 A;  4LLN A;  2OH1 A;  2KIF A;  3QPH A;  2WY7 Q;  1R6R A;  1M4I A;  5F08 A;  5H6Q A;  1ZN2 A;  4B5P A;  2IVM A;  3L2V A;  3BDD A;  3D7D A;  4HV5 A;  4CGO A;  3HOT A;  3AG4 H;  3WOD F;  1FEX A;  1D1A A;  1H0M A;  2FBK A;  3BT9 A;  1SD4 A;  4NGN A;  4ONW A;  2DK8 A;  4L8A A;  4R87 A;  3HM5 A;  2O5R A;  3IV5 A;  1B8I A;  4FWU A;  2FU4 A;  1CQT A;  1EE3 P;  3KEY A;  2W1O A;  4I01 A;  1KGS A;  2BXZ A;  2CW0 F;  3FKI J;  1Z7L A;  4A2U A;  3BI1 A;  4ZGY B;  3BQY A;  2DA7 A;  2O7O A;  4P1W A;  4XL9 A;  1F36 A;  2GXG A;  5F0H A;  1TW3 A;  1UJ8 A;  2KRF A;  3F72 A;  4DIQ A;  2VBX A;  4DNC A;  2W82 A;  3K4B A;  4QUS A;  3I4P A;  1V5F A;  4MFD A;  2F5V A;  4DZP A;  3GTK J;  4UVA A;  1LE8 B;  3DU6 A;  3Q0V A;  2JK3 A;  2V8H A;  5D6F A;  4MFK A;  2XPW A;  2WZN A;  2EPF A;  3ZXS A;  3LSI A;  3KQZ A;  3PFE A;  4JK1 X;  3S6F A;  4B6Z A;  3A01 B;  3OWT A;  1ZG5 A;  3R95 A;  4MRI A;  3ZMZ A;  4PGG A;  3OIQ A;  5D8L B;  1FNN A;  3KYL A;  1ETV A;  2DTZ A;  3NWS A;  2UUZ A;  3H5R A;  4C3I J;  1ZG1 A;  1WZ2 A;  2V9V A;  3TO6 A;  2NVU B;  3EYI A;  3G1M A;  4M74 A;  1QQI A;  3I71 A;  4YGO A;  2COB A;  2L54 A;  1V5E A;  2EO8 A;  3HB9 A;  4MY3 A;  1LVK A;  3G8W A;  1I39 A;  1VI0 A;  1LDK B;  4JLY A;  2E36 A;  2HTS A;  1W4M A;  5FKK A;  3CDL A;  1LE8 A;  2OC6 A;  1J7K A;  3GTG J;  2CQQ A;  1TNS A;  5KVR A;  3BJ7 A;  1S8N A;  1T0F A;  2BY1 A;  3RDI A;  2DJN A;  5CVJ A;  4BQA A;  2DA5 A;  4MMO A;  1P4X A;  2CGP A;  1Y0U A;  3PM1 A;  3CJR B;  2F4M B;  3HPG A;  2F6C A;  4ZTJ A;  4X8I A;  4RGU A;  3S9L A;  2KQR A;  1TWC J;  2UZK A;  1WQ2 A;  2DA1 A;  4HAM A;  3HOZ J;  2ABZ A;  4ANJ A;  4IAV A;  4NEX A;  3SJE A;  3OS2 A;  2RN7 A;  1ZRF A;  2W57 A;  2P7V B;  3BP8 A;  3L2W A;  3DGV A;  2IEK A;  4GM5 A;  4KUM A;  1PP8 F;  1IN8 A;  2KZG A;  4U0V A;  5M5X J;  1MBJ A;  5BPI A;  5I4M A;  4RA2 A;  1BC7 C;  4AG9 A;  1YVO A;  2A6E F;  2V8V A;  1R00 A;  2Q8K A;  3KLO A;  1N25 A;  3B3C A;  2ZCW A;  3WR7 A;  3DF8 A;  2A4N A;  4HPQ A;  4B13 A;  3PNY A;  3IO1 A;  1O57 A;  1IV8 A;  4E7I A;  3FXR A;  1WH7 A;  3KE2 A;  4II3 A;  3OYJ A;  3J7Z I;  4NGT A;  4RUH A;  1W7P B;  2JDC A;  3TKY A;  1RKT A;  3TC8 A;  4B44 A;  4X0G A;  1WRJ A;  1MBE A;  4XR6 A;  3TOA A;  2LY2 A;  4M3G A;  5A2Q Z;  1YI2 I;  4IHS A;  2LRE A;  1A6I A;  3R6S A;  1YW9 A;  4P4D A;  3AFH A;  2CV2 A;  1GVJ A;  2EFW A;  1Z0X A;  3M07 A;  4A3F J;  4A69 C;  2EWN A;  2D1H A;  1KZH A;  2XAH A;  5KTC A;  4EM1 A;  2NS0 A;  5FKL A;  3FMQ A;  4KOR A;  2NVX J;  1S7O A;  5AG5 A;  5HH1 A;  3CZX A;  5LRS A;  3EPZ A;  3HYI A;  2X4H A;  4AC0 A;  4XLE A;  2AQE A;  2R5Z A;  1EF4 A;  1XMB A;  1Y7E A;  3CDX A;  1TQM A;  3TTH A;  2ID3 A;  2CMP A;  2YNC A;  1VFC A;  1TLH B;  3I59 A;  3QAH A;  3ZMV A;  4F0X A;  1DU6 A;  2G7U A;  2PMZ A;  1PP7 U;  3F8K A;  3F22 A;  2VZY A;  2CRG A;  3J81 Z;  5LRR A;  4ASN A;  1B9N A;  1B72 A;  2MAB A;  3FED A;  3ABL H;  4AVC A;  4I49 A;  4U9Z A;  2FMY A;  2IJZ A;  4NSQ A;  2FXA A;  7CPA A;  2HQY A;  2ESN A;  2K9Q A;  1U8B A;  4IHM A;  3DFG A;  3BG6 A;  5KHD A;  3VWE A;  1ZGW A;  2XB0 X;  1GDT A;  1RPW A;  2VUM J;  3DKX A;  4R3K A;  2A69 F;  4RB0 A;  2BSW A;  1JUP A;  3CCJ I;  4E2A A;  3GO5 A;  1SFE A;  1U5T B;  3ABU A;  1RC9 A;  2O3F A;  3B3V A;  2VLA A;  3GB0 A;  3FVL A;  3HHG A;  3IC7 A;  3G73 A;  1U8R A;  2DN0 A;  2K3P A;  1OMI A;  2EUI A;  4H89 A;  5EEG A;  3HRU A;  2M34 A;  1QNT A;  5CYV A;  4B09 A;  4PQA A;  2FIW A;  4D0P A;  4HQE A;  1HQC A;  1VQK I;  2P7C B;  2ZB9 A;  1BM9 A;  3B6C A;  3VPR A;  1LFW A;  4MEX F;  4ZC3 A;  5GPA A;  3J80 K;  4ZY2 A;  2HFH A;  2VI7 A;  2QKL B;  1D0Z A;  2EFO A;  4C3H J;  5EF6 A;  5J1U A;  1H9G A;  2L9R A;  1Y39 A;  1DE4 C;  1XD7 A;  2L9V A;  3ASO H;  4CHU A;  4Q36 A;  2POK A;  5E1Z B;  1QA6 A;  1HXD A;  1IUF A;  3HUG A;  3UNG C;  1CJW A;  4ITV A;  3FEE A;  2YS9 A;  2KRC A;  1XPX A;  1Z7U A;  1EH7 A;  5HLG A;  3NEU A;  2HVR A;  2MH2 A;  2A6T A;  4PJL A;  3QOP A;  4UHT A;  2P4W A;  3GYH X;  2CV0 A;  4HNV A;  3PNV A;  1EV7 A;  3PB7 X;  5JLX A;  1ARL A;  5D4R A;  2C1C A;  2YPR A;  5ERI A;  3M8F A;  2AQF A;  4NQW B;  2EFP A;  3BHX A;  2KP6 A;  1CX8 A;  2BY2 A;  3GCM A;  4XKW A;  4OAD A;  3PFY A;  3FIW A;  3GFM A;  2ECB A;  4KNY A;  3CXS A;  1VQ8 I;  4OC5 A;  4ZX9 A;  5L3D A;  3BR5 A;  3RCO A;  3QAY A;  2QF7 A;  1ZLJ A;  5F48 A;  4L5E A;  1L0O C;  4L9V A;  2K5T A;  1Y1V J;  2WAD A;  1Z8L A;  4XM3 A;  4M72 A;  2L2O A;  2BY3 A;  3IH4 A;  1KYZ A;  4Q48 A;  4HNT A;  3E0K A;  3EUH C;  4LIU A;  4OIR F;  3HOY J;  1MBK A;  4AVP A;  3I0T A;  1RUN A;  4AB7 A;  4EAT A;  2KT0 A;  3C18 A;  1XX5 A;  3GLL A;  4IOC F;  5FRM A;  4A95 A;  3OYF A;  4C7I A;  4M3S A;  1IW7 F;  5FKM A;  1YW8 A;  3FF5 A;  3OSG A;  4RI1 A;  3GBG A;  1S9H A;  2JUG A;  3QYB A;  1X58 A;  4GGG A;  1QBJ A;  4KFC A;  4B11 A;  4QPO A;  1YRN B;  3DPL C;  2FVG A;  5EZG A;  5LRK A;  1CPS A;  2IAI A;  5G22 A;  2HWV A;  1XDS A;  3CP8 A;  1WGX A;  3FXL A;  3HHH A;  4WXD A;  4DYC A;  2OTJ I;  4HOB A;  4YU9 A;  1VQ5 I;  4H6Z A;  4NQW A;  1IID A;  3H8F A;  4AIK A;  2R7O A;  1ITY A;  1W7P D;  3IKT A;  1W5S A;  2C27 A;  1ELL P;  2E71 A;  3HDD A;  3V7Z A;  2Q44 A;  3MFK A;  2IT0 A;  4MCQ A;  2YU3 A;  3SJG A;  4U7D A;  2GOM A;  1XJO A;  2JA5 J;  4E7S A;  3HJE A;  3L1P A;  2J8M A;  1TTY A;  3V7S A;  4WX9 A;  5F47 A;  4PDK A;  3K4J A;  1S7E A;  1UG2 A;  1OCO H;  3DKY A;  5F1J A;  3RKQ A;  1IGB A;  3HUV A;  4Y33 A;  4IOA F;  2PBI A;  3R96 A;  4AXV A;  2B5G B;  2CTB A;  3LSG A;  4XLP F;  2V4J C;  4U0W A;  2OA4 A;  4JXR A;  1YRN A;  4Y15 A;  1L0C A;  3FJU A;  1GVD A;  4Q7A A;  2RAE A;  5HXD A;  2KMU A;  2L4M A;  2PJ7 A;  3QB8 A;  1VND A;  1K6Y A;  4FD6 A;  4ZJZ A;  4A3C J;  2ZNY A;  1FTZ A;  2Q43 A;  1BC8 C;  4FD5 A;  2M87 A;  3O8G A;  2J5O A;  3OIP A;  3GY9 A;  1YIO A;  1QHH D;  2OZ6 A;  2XEI A;  4BKX A;  4Q47 A;  3SEQ A;  1SVM A;  1B6B A;  2BUE A;  1LJ9 A;  3I5U A;  2MD5 A;  1Y6I A;  4UV8 A;  4F55 A;  3GZ6 A;  2Z0Z A;  2MD0 A;  4CYC B;  4DYO A;  1V55 H;  2JRM A;  3H0D A;  4QSH A;  3AAF A;  4MQV A;  2DDB A;  5BMZ A;  5BPD A;  4UEZ A;  3C7J A;  4PK4 A;  4V2F A;  3H4Q A;  3MZ8 A;  3RJP A;  2Y9Y A;  5E96 A;  2WB1 A;  2PN6 A;  2MFZ A;  3JW4 A;  4AUX A;  5LHG A;  2B5G A;  3I9S A;  4U5Y A;  2XF7 A;  5B5E C;  2L01 A;  2IS1 A;  2C6P A;  1N78 A;  1Z6T A;  4E7L A;  2QCO A;  4HRI A;  2VBQ A;  3VYU B;  2VJI A;  3ELK A;  1I6X A;  4XN0 A;  2M0C A;  2V6C A;  2ELK A;  2QM3 A;  2QQB A;  4AWX B;  4DOZ A;  5K7H A;  1ZLK A;  1ETK A;  1K7A A;  4CS0 B;  1Z05 A;  1X1D A;  4L0Y B;  4ZYG A;  3OOP A;  4HPS A;  1XB4 A;  1ODD A;  2KZV A;  2O53 A;  1RNL A;  1DDN A;  1X3U A;  2V8G A;  2D1V A;  4GXH A;  1BW5 A;  5JHF A;  4U9Y A;  3JCU C;  3BJO A;  1YS7 A;  3LSH A;  4CYC A;  1AUG A;  3KZW A;  3MZY A;  2ZXI A;  4BD9 A;  2PVW A;  4BQN A;  1YE9 A;  3RYP A;  4Q38 A;  4D7M A;  4CXF A;  4K2E A;  4A3J J;  3FNC A;  3SXN A;  3D2P A;  2R1I A;  3FXQ A;  4Y49 B;  4Z65 A;  5HS8 A;  3LSR A;  4P55 A;  4WXC A;  5LGT A;  1A36 A;  2CF4 A;  4MBU A;  3IWF A;  2LH9 A;  3MD2 A;  2M4K A;  3CJQ B;  1Z21 A;  4XNF A;  4KMF A;  2Z10 A;  2BW3 A;  1ORK A;  1LUJ B;  2JA2 A;  3W3C A;  5EJC A;  3O6B B;  2OPT A;  1FYK A;  2DO7 A;  3ZQF A;  3I56 I;  4AIJ A;  1ZH5 A;  4A3M J;  3V38 A;  2K9L A;  1SFX A;  2A68 F;  2ELH A;  3O3K A;  2ZO4 A;  2COM A;  5BNG A;  1W36 D;  2Q4V A;  4MHN A;  1MKM A;  3LA3 A;  1RTQ A;  4UB6 C;  2PJ9 A;  1U9O A;  2W25 A;  3HSR A;  2XRO A;  3Q5F A;  5LLQ A;  4HSR A;  2AO9 A;  4D7N A;  3K6G A;  3JUW A;  4ONU A;  4H0E A;  4FUU A;  3WC6 A;  1LEA A;  4O6J A;  1YX3 A;  3ZQG A;  3PIO F;  3KP2 A;  2WWY A;  4MFQ A;  9ANT A;  2RFH A;  4KT5 C;  3H92 A;  2AFU A;  3RAM A;  2QEX I;  4XLA A;  1MSF C;  2IGO A;  1ZR4 A;  3TQN A;  2LTP A;  1OZP A;  3FIS A;  5JVT A;  1RRJ A;  2BO9 A;  2KKO A;  2CNM A;  1G3T A;  5HDN A;  2JWT A;  2HYF A;  1IU8 A;  4OMZ A;  2EA4 A;  3JRI A;  1I6H J;  3KP6 A;  2F5F A;  2G9D A;  3B8G A;  2D45 A;  4DJL A;  1G2H A;  4M6V A;  1E17 A;  2DMT A;  2FS5 A;  5CVU A;  3GTP J;  4YRH A;  2ADU A;  3F8N A;  4CYN A;  3FBI B;  1YIT I;  1SVL A;  2XSJ C;  1QVT A;  5B1A H;  4CH7 A;  2KLO A;  3P7N A;  4MIM A;  5DUI A;  2IW5 A;  5IV0 A;  2Y48 A;  3CP2 A;  1XS9 A;  3IWG A;  4NC7 A;  1TQI A;  4W97 A;  1XCV A;  3WC7 A;  2R93 J;  1Z1D A;  3A1Y A;  1M4L A;  1TNT A;  3HOS A;  1QMU A;  3S14 J;  2Y0M A;  2J5P A;  2XF5 A;  2LMD A;  4HEA 2;  4KIT B;  3NRV A;  4A93 J;  2KRH A;  2ESH A;  2P6F A;  3TGN A;  4PXD A;  1OYY A;  1SMT A;  3BR1 A;  3IFE A;  5CVR A;  3WTZ A;  3CCE I;  3BG5 A;  1OCZ H;  4Y13 A;  5LYI A;  1K78 A;  4V2G A;  3BTL A;  4OIW A;  1BPM A;  2JT1 A;  4ZZL A;  1QST A;  3CPA A;  5IT3 A;  3Q0W A;  1YOV B;  3SHF A;  1IRF A;  3MKL A;  3SZG A;  2NS8 A;  3R61 A;  4XOP A;  5GPC A;  2XV4 S;  1KQ8 A;  3GYA A;  1O7L A;  5HDG A;  5CPA A;  3GWZ A;  2HDD A;  2R92 J;  3PUF A;  1IGN A;  4LB5 A;  3KR4 A;  4F0Y A;  4I0A A;  1QSR A;  1OPC A;  2FNA A;  1O4X A;  1Z2L A;  3S3O A;  2QA4 I;  2XAJ A;  1BBY A;  2YU9 J;  2CQK A;  3BR6 A;  2NNY A;  1Y9K A;  1ENH A;  3K4K A;  5EZH A;  1R71 A;  3S1N J;  4NFR A;  2ZXH A;  4CGP A;  5DWM A;  2XHK A;  3LQR A;  2PJ1 A;  3V8L A;  4XPD C;  5H86 A;  5JI6 A;  4NC6 A;  4XOT A;  1ETX A;  4YII A;  3ULQ B;  2PX9 A;  2W85 A;  1VHO A;  3MGD A;  4HX8 A;  4WF2 A;  3KYD B;  1X3Z B;  1OLT A;  1FLI A;  1IDZ A;  1IF1 A;  5D29 A;  3CPX A;  1O3Q A;  2HDW A;  4G9Y A;  4KUA A;  1AU7 A;  5FJ8 J;  5FLX Z;  5CBM A;  5CQG A;  4UUV A;  2VJJ A;  5C82 A;  4U88 A;  3TCV A;  2GZW A;  2FX0 A;  3G3Z A;  3TED A;  4XPK A;  3HZJ A;  2CY2 A;  4PV6 A;  1XMA A;  4NCZ A;  3BTC A;  2K9S A;  2VB6 A;  5E20 A;  3S15 J;  3QPL A;  2ARH A;  1S29 A;  2ODF A;  1Y0Y A;  4XNH C;  3DBL B;  1YFH A;  2QQA A;  5C44 J;  1ZAR A;  2KHM A;  4PCQ A;  2A07 F;  2CUE A;  2DJI A;  4HV6 A;  3TP3 A;  2BV6 A;  1HDD C;  4DYQ A;  1I27 A;  4EVY A;  4RAZ A;  2QWW A;  2ZEF A;  4ENM A;  5HVQ C;  2JMW A;  4U0Y A;  1ZG3 A;  1YX5 A;  2PJP A;  4DZJ A;  2YNE A;  1GHE A;  4FCY A;  2DXI A;  2CV1 A;  4LG3 A;  5IT9 Z;  4F92 B;  1S60 A;  1RET A;  2DOE A;  2ZXV A;  5J1Y A;  5FLV A;  3C26 A;  3SXY A;  2PIY A;  1OBR A;  4K30 A;  1WHU A;  2LK2 A;  1J09 A;  5CVV A;  2L7K A;  3QRF F;  1PUF A;  4C7H A;  1VZ0 A;  3QQA A;  1JI8 A;  3DEU A;  1F5T A;  2RGV A;  2ZEM A;  1ON0 A;  3F3X A;  1IC8 A;  2Q7S A;  4QWQ A;  1LVA A;  2HYJ A;  3GFI A;  2F5D A;  2GLO A;  2CFO A;  3EDP A;  2LRD A;  3DQV C;  1RR8 C;  1DGW Y;  5J4Y A;  1YW6 A;  4II9 A;  1CF7 B;  1N71 A;  2C6C A;  3F8M A;  1XGM A;  1BI3 A;  4QIW N;  3HL2 A;  2PE3 A;  3KL9 A;  2BCO A;  3V7C A;  3M1C A;  1H88 C;  2XEF A;  3OIO A;  3FXM A;  1TF9 A;  5EGO A;  3IJ3 A;  3EUH A;  4B10 A;  2KJB A;  5DYM A;  4XID A;  2FNP A;  2JA7 J;  1WJF A;  3CTA A;  1VQL I;  3I64 A;  3I9V 2;  1TT5 B;  2KIS A;  3ECO A;  1YJN I;  3OL3 A;  3Q9V A;  3CMY A;  1WSU A;  4RMN A;  4NGR A;  3D67 A;  3DLJ A;  2DA3 A;  1IN5 A;  1MDM B;  2GOX B;  3CCR I;  5KTD A;  1FC3 A;  4BL0 B;  1MBH A;  4HQM A;  3PB9 X;  2M2E A;  3GF2 A;  5FD6 A;  5HS9 A;  3B35 A;  1P7J A;  3JAM K;  4C2M J;  3TOB A;  4R79 A;  5H20 A;  2MGQ A;  1CF7 A;  2P6S A;  4Y4R A;  1H8L A;  2NS7 A;  2X0L A;  2ZJP F;  3R1K A;  4UFW A;  3BTI A;  3Q3S A;  2VOD A;  4RLQ A;  2E5N A;  2X6W A;  4IZZ A;  3E5U A;  4XKC A;  4NF1 A;  2Y31 A;  4IJA A;  2HU9 A;  2CIJ A;  2ZEE A;  4XRF A;  1KUX A;  5DWN A;  4CUG A;  2B3U A;  4UNO A;  5GAE J;  3T8W A;  1G3W A;  1KA8 A;  2E7W A;  2DU9 A;  1AHD P;  4KUB A;  5LRG A;  3VAT A;  5K8O A;  4E7Z A;  2NAZ A;  2VJ5 A;  3FM3 A;  2H94 A;  3I3L A;  5J1Q A;  1BN5 A;  2VIX A;  5DCM B;  1YTY A;  4GFB A;  3BR2 A;  3H1C A;  4CAV A;  3PL8 A;  2CJJ A;  4IK2 A;  1MW7 A;  4AYB A;  4MFP A;  2EK5 A;  2G3A A;  4LUA A;  3ZJ0 A;  5ICF A;  4EJO A;  3OYL A;  3KKW A;  2ZW7 A;  4JJX A;  5D4S A;  3DV8 A;  4LG0 A;  4Y52 J;  4BIN A;  4J01 A;  4HLY A;  3KHX A;  2OQR A;  1MZB A;  1FJL A;  2VOP A;  2K40 A;  4EM0 B;  6PAX A;  2BL1 A;  2DPU A;  2EWB A;  5FFZ A;  3U1K A;  2I10 A;  4BQO A;  4OME A;  4C2T A;  2R8V A;  2QZ8 A;  2DBB A;  3OV8 A;  3M3Y J;  3I1U A;  3EY5 A;  1EA3 A;  4A3D J;  5D6E A;  4I76 A;  2XEJ A;  2EK8 A;  1IDY A;  3U2R A;  1LAN A;  2FA5 A;  1KUY A;  4NGQ A;  4BE1 A;  4ZDO A;  5IOY A;  1MNE A;  2OOT A;  4NHJ A;  1YSJ A;  5JH9 A;  4MLO A;  1B8I B;  1WJB A;  1YJW I;  2BHZ A;  2BOA A;  3BZ6 A;  1GT0 C;  2K4B A;  2Q4Y A;  1X4O A;  2DT6 A;  2W4S A;  1WJ5 A;  4BXF A;  4F9V A;  5DCM A;  1U0J A;  3CUQ B;  1HKT A;  4XLC A;  4IHT A;  2L7M P;  2UXN A;  2PQ8 A;  1OCR H;  2IP2 A;  4BYY A;  3V4G A;  4EFD A;  4G1P A;  1P7I A;  2DTR A;  2WV1 A;  1PYV A;  5F27 A;  3GZN B;  1JKO C;  1QQ9 A;  2DFF A;  4FQG A;  2HQ5 A;  2DCE A;  4G7Z F;  1T56 A;  5G20 A;  2B4B A;  1WPK A;  4LFU A;  3BG3 A;  2DMU A;  4PJ0 C;  5J40 A;  4I6Z A;  1L3L A;  2V6E A;  4PXC A;  4R8F A;  3TT2 A;  2RQP A;  2M7B A;  1B1B A;  2RNJ A;  5C4J J;  3RYO A;  3F8B A;  4NC8 A;  5TIS C;  3SFZ A;  2XVC A;  4A3K J;  2XGD A;  2V79 A;  3CLO A;  3BXM A;  2IJL A;  4FE7 A;  4WK8 F;  1VQ6 I;  1DPR A;  3E3V A;  3PO2 J;  2IA0 A;  2IPQ X;  2ZEH A;  4HNY B;  4CAF A;  4F8Z A;  3DR6 A;  1YK3 A;  3K9U A;  1FOW A;  3BZK A;  3DLA A;  2Z33 A;  3J7A O;  2VBW A;  4OAE A;  4HW0 A;  3S16 J;  2OQG A;  3OSF A;  2V8D A;  4HA8 A;  3CUQ A;  2M8E A;  3PIP F;  3BG9 A;  3IKV A;  2Z5U A;  1G59 A;  5IPA A;  4FHT A;  2BXY A;  4IEJ A;  2ATR A;  5ELY A;  2X7B A;  1MNM C;  2K7L A;  4M6H A;  2AHQ A;  3HKZ A;  4DYR A;  3GTQ J;  3I3G A;  2A05 A;  1MH3 A;  4G6T B;  3FBU A;  1YGH A;  3IH3 A;  1UAA A;  5DM6 F;  2K27 A;  3W6V A;  1G4D A;  4I09 A;  1YQE A;  2GU2 A;  2R7X A;  3QWL A;  2ZW6 A;  3HSF A;  1TWF J;  3JVN A;  3RBU A;  5D8K B;  2DLL A;  4CPA A;  4M6G A;  1BI1 A;  3IL2 A;  4EJU A;  2AFM A;  2E1N A;  1VF9 A;  2EB7 A;  4IRH A;  5LBQ A;  5K5O A;  1VQ4 I;  1Z67 A;  2F48 A;  4B3X A;  3I53 A;  3GKR A;  4IRG A;  3G4S I;  2MYS A;  1LFB A;  3I58 A;  4IXA A;  1IRX A;  2AE6 A;  4FET A;  1A35 A;  2CQX A;  2QYV A;  4BNC A;  3K70 D;  2PJ5 A;  3TMO A;  5ICC A;  1DP7 P;  2FOW A;  2VQC A;  4UFV A;  3ABT A;  2GXA A;  3S17 J;  5A2Q K;  2PG4 A;  1O3S A;  5C3E J;  1Y8Q B;  3KPH A;  2O61 A;  3OYK A;  1S3Z A;  4I98 B;  5KK1 A;  2E34 A;  4P4F A;  2LF7 A;  1IRZ A;  4PJN A;  2Y0S N;  1LNW A;  4BQQ A;  3HGY A;  1QSO A;  1S5K A;  2H09 A;  3IWZ A;  2Y30 A;  5E18 F;  4EGY A;  1S5L C;  2B4D B;  4C2U A;  2R7R A;  3M8E A;  4MI4 A;  4XSZ F;  1ZGJ A;  4G6D A;  4ZDL A;  4R6T A;  2A5W A;  4RS2 A;  5BS6 A;  1HDU A;  1FY7 A;  3A2K A;  4JD6 A;  1YG2 A;  3L00 A;  3J81 K;  3BRO A;  3FK6 A;  3MKY B;  3CCL I;  4P4E A;  4P4J A;  2Z3L A;  5AG7 A;  3FMR A;  3BI0 A;  3LAP A;  3L2C A;  2A3S A;  1UMQ A;  4W9Y A;  5L3C A;  3MN8 A;  2JDD A;  2H1K A;  1RXT A;  2M4G A;  2J8N A;  4NJR A;  2DA6 A;  3ASN H;  4PGH A;  5J6X A;  2LY1 A;  3WTU C;  3OYM A;  3L9F A;  1K79 A;  2R5Z B;  2Y2Z A;  2HS5 A;  5CNP A;  1R5G A;  4FIS A;  2BOL A;  3I59 B;  1MBF A;  4BS9 A;  5FKN A;  1WJE A;  1W5C C;  2DA4 A;  1T33 A;  4FX0 A;  2XEG A;  3R9F A;  4CYO A;  3PRT A;  4OC1 A;  4BH9 A;  3P5J A;  2B4D A;  3F0A A;  2VL1 A;  2JSC A;  4M9S A;  2GBY A;  2ZME B;  4E7H A;  1B72 B;  1KU9 A;  2WAQ N;  2DYS H;  1X1B A;  4YEL A;  4C30 A;  4BAY A;  3CT9 A;  2F4I A;  4CGL A;  1QVU A;  3SFI A;  3AL0 C;  4RGX A;  5E3N A;  3NAR A;  1JJ8 C;  4MFE A;  1OKR A;  2HOA A;  3RTR A;  2BVM A;  2IXS A;  1ZLI A;  4IUS A;  2NVY J;  4HLX A;  4I7H A;  3K4N A;  4B47 A;  2H6C A;  1BI2 A;  4OWR B;  2O0Y A;  4GO1 A;  2KCW A;  3MWM A;  5E1X A;  3C3W A;  3D7G A;  2DPT A;  1I3A A;  2XAQ A;  1VQ7 I;  3ZMD A;  1H8A C;  1U9N A;  3C2H A;  2E5Z A;  3H9Q A;  5ED4 A;  5HOO A;  3GTM J;  2ME6 A;  2EQR A;  2A5Y B;  1S7L A;  2CH0 A;  5IB9 A;  3IAM 2;  2X1C A;  4A3G J;  1ETQ A;  1E0E A;  2ZME A;  2E2H J;  4L5I A;  1WFX A;  3AG1 H;  3P9I A;  2VT3 A;  3R0J A;  1TW2 A;  4ENJ A;  3HGG A;  3NH5 A;  3FWE A;  1W0U A;  3CCV I;  1QU3 A;  1SD6 A;  4M3F A;  2ZNZ A;  2LP0 A;  1T2K A;  4J19 A;  2VQY A;  3HUG B;  3K2A A;  4YIR X;  3A02 A;  2AFW A;  3PB4 X;  4P5O A;  2OCE A;  2E19 A;  2ETH A;  2OU2 A;  1QPI A;  3S1Q J;  3JTK A;  4X2T A;  3FDY A;  1JT6 A;  1PYT B;  4UY8 I;  4RB1 A;  1SFO J;  3ZQL A;  3ZQQ A;  1S7K A;  3GEZ A;  2DOA A;  1MBG A;  4TNU A;  3LA7 A;  2M45 A;  5HNH A;  2ISY A;  5K7F A;  3H3V K;  2M1B A;  1CG2 A;  3HOW J;  1XGS A;  4BHB A;  2Q04 A;  4G8X A;  4C3J J;  4HDU A;  2ZJR F;  2Q0O A;  2OCC H;  2R0Q C;  5JQ4 A;  4IQ4 A;  3T8T A;  2NYQ A;  5G21 A;  3RPU A;  3IAS 2;  3E5Q A;  2PLY A;  3ZR8 X;  3GTJ J;  3H5Z A;  2NOJ B;  4BUP A;  1KWM A;  2KIQ A;  2YGW A;  2FSW A;  4CYD A;  3AKZ A;  3GXO A;  2R7W A;  1ZRE A;  1Q1H A;  3IRR A;  4IF4 A;  3BLN A;  3PB6 X;  1NG7 A;  2QKM B;  3HG9 A;  1NSL A;  4L9N A;  2HEO A;  1MMA A;  2D2W A;  3OS1 A;  1FIP A;  3CC7 I;  1PVE A;  1OR7 A;  4ZYD A;  5KCM A;  3IU1 A;  3L7W A;  4FTH A;  5KNL A;  3FZV A;  2STT A;  3RQ4 A;  3LMM A;  3B3S A;  3U21 A;  3L2U A;  2ZFU A;  3CO7 C;  2GM4 A;  3V8I A;  2ZSI B;  2WV0 A;  4LX9 A;  4ABZ A;  1YW7 A;  5DM7 F;  2PR8 A;  2R7H A;  4KIG A;  1KYW A;  3WHC A;  2J8R A;  3K9T A;  2RC4 A;  4WCG A;  2HQA A;  2IS2 A;  2L0K A;  2UXX A;  2PIZ A;  2VON A;  3KGQ A;  1D1B A;  2ELJ A;  1OCP A;  2CO5 A;  2AFS A;  1ARM A;  1HW5 A;  1UFH A;  1YME A;  5DCF A;  4KMU X;  1HW1 A;  3ZZI A;  5EBV A;  3O2P E;  1A31 A;  5GAG J;  2X6O A;  1OYI A;  3SEZ A;  4Z6Y A;  3WU2 C;  1QSM A;  2ECC A;  4ZH4 F;  2VC1 A;  2PJC A;  4MNU A;  1KU7 A;  2WSA A;  5THW A;  2DOF A;  4WWC A;  3PJR A;  1ACI A;  1JHF A;  1F2O A;  3LOD A;  4UWI A;  5J47 A;  2R98 A;  1LAM A;  4A3I J;  4GRI A;  3KAS A;  1J59 A;  1GXQ A;  3ZQ7 A;  2I5U A;  2M30 A;  3J80 Z;  4E8O A;  2XAG A;  4PXB A;  2GIV A;  2W7N A;  3ZPL A;  1R57 A;  4FE4 A;  4KT6 A;  1IZ1 A;  2AS5 F;  1FP2 A;  3WU1 B;  5LFA A;  3G71 I;  1TF8 A;  2ME0 A;  2CNS A;  5AON A;  1J5Y A;  4LIT A;  3EUK L;  4CCK A;  1PDN C;  1JHH A;  1R43 A;  3LNQ A;  1SD7 A;  1WI9 A;  5IY5 H;  3V7R A;  3HC7 A;  2CUJ A;  2Z3M A;  5HNF A;  4RBO A;  3MN2 A;  1FT9 A;  4NXY A;  1G6N A;  2Q2E B;  2QLZ A;  3S2W A;  3WU0 A;  1D8J A;  2STW A;  1U6M A;  4ENK A;  3VSK A;  4A6D A;  3HIF A;  1WWZ A;  2F7V A;  2EJR A;  5EEH A;  2O9L A;  1FX7 A;  1KQ9 A;  3OS0 A;  3MKW B;  4CRY B;  5E3O A;  4YWY A;  4JYK A;  4A38 A;  3F8F A;  3DTI A;  3S1R J;  2QVP A;  4XKV A;  1SFK A;  2DFH A;  4EM2 A;  2CQ7 A;  4PFO A;  3B3W A;  1BLL E;  2FCK A;  3R0A A;  4I2O A;  1XF8 A;  2LBF A;  3IWE A;  4JP0 A;  4RM3 A;  1V4R A;  3VEP A;  2L9N A;  2PJ8 A;  2BW3 B;  4IHW A;  4M3B A;  2Z11 A;  2LF8 A;  3CXP A;  1FIA A;  2MW8 A;  2FXF A;  1ZLH A;  1YVK A;  2X9D A;  3KX2 A;  4M71 A;  4ENN A;  1ZG8 A;  5E1W A;  2Q2E A;  1YLE A;  3RSN A;  2MLG A;  3DNS A;  2V77 A;  1WI3 A;  2H8W A;  5EYR A;  1NE9 A;  1VQ9 I;  5LYD A;  2XKO A;  1EH8 A;  2FUG 2;  1UWY A;  4MCS A;  5C88 A;  3BPV A;  2FBI A;  4Q4Z F;  2L7Z A;  5IOZ A;  1RO5 A;  1Q7L A;  5BWA B;  2JEV A;  2WBM A;  1TP4 A;  2CTC A;  1D1C A;  3FXJ A;  3H3Z A;  3ONQ A;  4X3R A;  2BBY A;  5FB2 A;  4MFZ A;  4A2Z A;  2JTV A;  1UHM A;  5IP9 J;  2YND A;  2REF A;  1X19 A;  4XOR A;  3GX4 X;  2ZEP A;  4KLV A;  4JZ0 A;  1ZGA A;  4ESF A;  3T90 A;  2CFX A;  1Y8R B;  4A37 A;  3S3N A;  1LPQ A;  4M9X A;  3CJN A;  5JVG F;  3KHZ A;  3GLJ A;  2KIM A;  2H5M A;  1IB1 E;  2HZD A;  3F6O A;  1R5I D;  4RS8 A;  3ERE D;  5KTA A;  3K1N A;  1K4S A;  5BOX A;  1V0C A;  1XMT A;  2QSG X;  2EBI A;  2E1M C;  1ZHF A;  3ZP5 A;  2P6G A;  4KOT A;  4F6A A;  2LNB A;  3VB2 A;  1V3F A;  2DMN A;  1O3R A;  5J1R A;  1AKH A;  3ISX A;  3NFZ A;  3S3M A;  2Z3N A;  2MC4 A; 
#chains in the Genus database with same CATH homology
 3FKJ A;  1M4G A;  4C2Z A;  1N71 A;  3S6F A;  2XF6 A;  1PUA A;  3OWT A;  2LOO A;  1LFP A;  3HL2 A;  4FD4 A;  3R95 A;  1UG0 A;  2REE A;  1WJA A;  3M1C A;  3L2R A;  3OIQ A;  2FL4 A;  1WK4 A;  5EC4 A;  4CAF A;  3KYL A;  5J8F A;  1TT0 A;  1WJD A;  3NWS A;  4XLF A;  2UUZ A;  3H5R A;  2F5I A;  2PRB A;  3FBN B;  4B10 A;  3TO6 A;  2P6E A;  3EXN A;  3S93 A;  4FAS D;  5FRN A;  3EC4 A;  4AG7 A;  3H9J A;  1WJF A;  4YGO A;  3I9V 2;  3OL3 A;  1V5E A;  4RMN A;  1QHG A;  1LVK A;  4MY3 A;  3G8W A;  4OLL A;  2JSP A;  1LDK B;  2GOX B;  4JLY A;  5KTD A;  1Y56 A;  3V42 A;  4BL0 B;  1MJA A;  2OC6 A;  4OAZ A;  5FRO A;  3TBI A;  4HKF A;  4KSA A;  3BJ7 A;  2HNH A;  3OYN A;  4R79 A;  3TOB A;  5LD2 C;  4ZTF A;  4Y4R A;  4QC6 A;  1KON A;  3R1K A;  4E4H A;  2Z0Z A;  4UFW A;  3OYH A;  3CXQ A;  4BJ5 C;  1NG6 A;  3OYG A;  4RLQ A;  3CJR B;  2E5N A;  2X6W A;  3HPG A;  2F6C A;  4XKC A;  4IZZ A;  4ZTJ A;  1S7N A;  4NF1 A;  4CRZ B;  3A9L A;  4JXQ A;  4YEJ A;  3BJ8 A;  4ZYA A;  2KQR A;  3R9E A;  2HU9 A;  1Z9U A;  4L89 A;  4NEX A;  4BGD A;  1KUX A;  4CUG A;  4ANJ A;  2B3U A;  5DWN A;  3LSM A;  4BJT A;  3DDD A;  3OS2 A;  2IS4 A;  4B12 A;  4KUB A;  2VQH A;  3L2W A;  4E7Z A;  2VJ5 A;  3UR3 C;  2LBF B;  3I3L A;  3EO4 A;  2VIX A;  4CZC A;  2RRE A;  3PGP A;  4AG9 A;  4CAV A;  1YVO A;  3SHP A;  3VWD A;  3PL8 A;  4KZT A;  4CCO A;  3LD2 A;  5F49 A;  1MW7 A;  3C2G A;  4AYB A;  2G3A A;  4MFP A;  4LUA A;  2A4N A;  2VKD A;  4HPQ A;  4XQF A;  1ZO0 A;  3OYL A;  3KKW A;  3PNY A;  2ZW7 A;  4JJX A;  3J7A Y;  4UFX A;  1T95 A;  2WUU A;  3TFY A;  2CUZ A;  4J01 A;  4E7I A;  3E1S A;  4QVT A;  2BL1 A;  4II3 A;  4UCP A;  3OYJ A;  5BWA B;  3WR7 A;  5CQE A;  3RPU D;  2JDC A;  4R3L A;  4UWI A;  4BQO A;  1TZL A;  3SDB A;  4B44 A;  4B48 A;  4X0G A;  4XR6 A;  4ZDP A;  4C2T A;  2QEC A;  2LY2 A;  2R8V A;  5GCN A;  3TOA A;  3EY5 A;  2LRE A;  1EA3 A;  3F9K A;  3AFH A;  2CV2 A;  1KUY A;  3K10 A;  4U7B A;  4BE1 A;  4ZDO A;  1MNE A;  4XON A;  1AA7 A;  3S6H A;  4E0A A;  3LSK A;  1MND A;  3ZJ0 A;  5KTC A;  4MLO A;  4IKF A;  4BAC A;  4KOR A;  1WJB A;  2I8D A;  2WAE A;  2Z2S B;  1PJR A;  2Q1Z B;  2Q4Y A;  1X4O A;  2DT6 A;  2W4S A;  3K70 C;  5AG5 A;  1WJ5 A;  4BXF A;  5HH1 A;  3IUO A;  1U0J A;  3PNT A;  3DTE A;  2ZW4 A;  3EPZ A;  4XLC A;  4BU2 A;  1LRZ A;  4PJJ A;  2AQE A;  4RM2 A;  4XLE A;  1XIX A;  1Z4R A;  2PQ8 A;  3TTH A;  2CMP A;  2YNC A;  4H6U A;  1PYV A;  5AG6 A;  3QAH A;  4F0X A;  2DCE A;  5G20 A;  2B4B A;  2PMZ A;  3F8K A;  3HPH A;  2VZY A;  1S7F A;  1Q2C A;  3VYT B;  5H84 A;  2V6E A;  2MAB A;  2D4P A;  3TT2 A;  3OOU A;  2M7B A;  3RYO A;  4AVC A;  2Z1D A;  4NC8 A;  4I49 A;  2VXK A;  4U9Z A;  4NSQ A;  3BLY A;  2HQY A;  2L5Q A;  3K4L A;  2BEI A;  2V1N A;  3BG6 A;  1FMV A;  2BVL A;  2R7Q A;  5KHD A;  1P0H A;  2FE7 A;  3F5B A;  4HNY B;  3DKX A;  3DR6 A;  4J3G A;  1YK3 A;  3DSB A;  3K9U A;  3DLA A;  2BSW A;  2WAQ A;  2LC2 A;  3R9G A;  4E2A A;  1Q2Y A;  4OAE A;  4AVA A;  2X85 A;  4NNJ A;  2VLA A;  2M0M A;  2EUI A;  2K3P A;  3OL4 A;  1Z4E A;  4M85 A;  1G59 A;  4H89 A;  4KLW A;  4MFJ A;  3H5N A;  1I12 A;  2JLM A;  2B58 A;  2ATR A;  4HNW B;  4KOS A;  2X7B A;  3HKZ A;  2FIW A;  2Z3O A;  2K9M A;  3I3G A;  3S6K A;  4OAY A;  4G6T B;  4KVO E;  3FBU A;  1DGR M;  4ZC3 A;  2P0W A;  1YGH A;  2PSW A;  4GS4 A;  3W2V A;  1UAA A;  3VSL A;  1I21 A;  2VI7 A;  2QKL B;  1D0Z A;  3PP9 A;  3IU2 A;  2R7X A;  2ZW6 A;  3JVN A;  4Q36 A;  3TL4 X;  2R7V A;  3UNG C;  4IQJ A;  1CJW A;  4ITV A;  4B3X A;  3DEE A;  2Z3K A;  3GKR A;  5TGT A;  2KRC A;  1BR2 A;  2HVR A;  2MYS A;  1TIQ A;  4KOU A;  2M7A A;  1IRX A;  3G2B A;  3QOE A;  4FET A;  2A6T A;  2AE6 A;  4PJL A;  1VHS A;  4PK3 A;  4HG2 A;  3D2M A;  5AGE A;  2CV0 A;  3K70 D;  1DQU A;  3PNV A;  1SQH A;  2DT7 B;  3TMO A;  4E7K A;  4UA3 A;  3OY9 A;  1BR4 A;  3OYE A;  1LKX A;  3AL0 B;  2VQC A;  4UFV A;  3BG7 A;  4N4O B;  5G1Z A;  2AQF A;  4NQW B;  4RLF A;  1S3Z A;  2IGM A;  3OYK A;  1MK4 A;  2KP6 A;  4OAD A;  4XKW A;  3PFY A;  1X1C A;  4A31 A;  2OUM A;  3CXS A;  2KDO A;  4PJN A;  2CNT A;  3FRM A;  3RCO A;  4FD7 A;  3D5S C;  5F48 A;  2XDV A;  3W2W A;  4BQQ A;  2K5T A;  1QSO A;  2WAD A;  1S5K A;  5I0C A;  4XM3 A;  3IP4 B;  3VYR B;  4DBQ A;  2L2O A;  4AVZ A;  4MY0 A;  4XMY A;  3E0K A;  4HNT A;  4H4K C;  2B4D B;  3EUH C;  4LIU A;  4C2U A;  1X1A A;  3DPU A;  1UEL B;  2R7R A;  2K5C A;  4AB7 A;  5ISV A;  4EAT A;  4MI4 A;  2G3T A;  4A95 A;  2HPM A;  5FRM A;  4ZDL A;  4AU7 A;  2A5W A;  3S8P A;  3OYF A;  4M3S A;  4RI1 A;  4RS2 A;  4C7I A;  2X51 A;  1FY7 A;  3A2K A;  3GBG A;  1S9H A;  2JUG A;  3QYB A;  4JD6 A;  3UY5 A;  2VAS A;  4B11 A;  3MKY B;  4QPO A;  3DPL C;  3QOD A;  2Z3L A;  1MMD A;  3DR8 A;  5AG7 A;  5G22 A;  3CP8 A;  4PUS A;  1I1D A;  4BDY A;  4XLH A;  4QPQ A;  1IID A;  3L2Q A;  2JDD A;  4H6Z A;  4F91 B;  1RXT A;  2R7O A;  2M4G A;  2WAF A;  1CM0 A;  2J8N A;  2RQQ A;  4CSW A;  3E0J B;  2LY1 A;  3OYM A;  2C27 A;  1T0F C;  4YFJ A;  2WA0 A;  4DJA A;  1QSN A;  2Q44 A;  4KOX A;  5CNP A;  3BCB A;  2X6Y A;  2BOL A;  2GOM A;  2XAU A;  5CPR B;  4BS9 A;  4CYO A;  1WJE A;  2HVQ A;  4JQF A;  4E7S A;  3R9F A;  2J8M A;  2AJ6 A;  5F47 A;  3K4J A;  1VKC A;  1P4N A;  2B4D A;  3F0A A;  3PZJ A;  4KOY A;  3DKY A;  3SXO A;  2Y0S A;  3D5R C;  4E7H A;  2DXQ A;  2IL4 A;  4Y33 A;  1Y7R A;  4YEL A;  3R96 A;  1X1B A;  4C30 A;  2B5G B;  3CF2 A;  2F4I A;  3LSG A;  4KS9 A;  4CGL A;  3AL0 C;  2V4J C;  4U87 A;  5A28 A;  4JXR A;  1L0C A;  2QML A;  3OYD A;  2I00 A;  4IF5 A;  4E6K G;  2KMU A;  1X4P A;  3RTR A;  4ORF A;  2BVM A;  2JVH A;  3H9G A;  2IXS A;  4IUS A;  3QB8 A;  1K6Y A;  4FD6 A;  4ZJZ A;  3K4N A;  4E7J A;  4FD5 A;  4B47 A;  4C2Y A;  2UV1 A;  4OWR B;  2CW8 A;  3OIP A;  3GY9 A;  1W36 C;  1ERD A;  1QHH D;  4D9J A;  2KCW A;  1G8X A;  3EUA A;  3N05 A;  2DPT A;  2IS6 A;  1P9Q C;  3N7Z A;  5HMN A;  1N75 A;  3SEQ A;  1B6B A;  4XKB A;  3PUB A;  3H9Q A;  2M3A A;  2E5Z A;  1Y6I A;  3C2H A;  4BEH B;  4F55 A;  5HOO A;  2MD0 A;  1YR0 A;  2FSR A;  2HV2 A;  2OZH A;  4A33 A;  3CZ6 A;  2CH0 A;  3MKZ A;  1S7L A;  3H0D A;  3IAM 2;  4PSX A;  4CAE A;  2X1C A;  3ZCO A;  4CGN A;  4PK4 A;  1E0E A;  2V9K A;  3H4Q A;  1WFX A;  2IGK A;  2WB1 A;  4PFP A;  5E96 A;  4A30 A;  2MFZ A;  2B5G A;  4BDZ A;  2VQG A;  3I9S A;  4U5Y A;  2XF7 A;  2VL8 A;  3BC8 A;  1QU3 A;  2IS1 A;  4BBH A;  3ZRG A;  1N78 A;  5IX3 A;  2V7F A;  3PSF A;  4E7L A;  4HRI A;  3HUG B;  4HNU A;  3VYU B;  2VBQ A;  2VJI A;  2VQY A;  3TE4 A;  4BE0 A;  4P5O A;  4XN0 A;  4CCL A;  4DOZ A;  2PC1 A;  2DPS A;  3EFA A;  4CS0 B;  2OU2 A;  2YNC C;  1X1D A;  1IYL A;  4UWJ A;  3JTK A;  4D1Q A;  3FDY A;  1N77 A;  1D0Y A;  2KZV A;  3D5L A;  3TO7 A;  3ZQQ A;  1S7K A;  1MJ9 A;  2DOA A;  5AG4 A;  4BEH A;  5JHF A;  4U9Y A;  4N4N B;  4F3Q A;  4XN3 A;  3LSH A;  5HNH A;  4CAW A;  2ZXI A;  4BQN A;  2PJR A;  1YE9 A;  4BJ6 C;  3D8P A;  3W6S A;  4II2 A;  4Q38 A;  2Q04 A;  5IB0 A;  4F93 B;  3OYA A;  3FNC A;  3OMY A;  3D2P A;  3SXN A;  5JQ4 A;  4IQ4 A;  2R1I A;  4Y49 B;  3K4M A;  2HVS A;  3H5A A;  3K4C A;  5G21 A;  4MBU A;  4KVX A;  2HPI A;  3IAS 2;  2LH9 A;  3DWL E;  3MD2 A;  3VYS B;  2W00 A;  3ZR8 X;  3H5Z A;  2Q7B A;  2NOJ B;  1SAU A;  2M4K A;  1Z21 A;  3CJQ B;  4XNF A;  4B43 A;  4BUP A;  4CA0 A;  4F52 A;  2Z10 A;  2BW3 A;  2JA2 A;  3W3C A;  4CYQ A;  4MFL A;  2VXD A;  4JOM A;  2YGW A;  3AKZ A;  3BCA A;  2R7W A;  3S6G A;  1BO4 A;  2K9L A;  3CMM A;  3BLN A;  4KSF A;  1NG7 A;  2Q4V A;  2QKM B;  1W36 D;  3HG9 A;  1NSL A;  1KUV A;  4UBR A;  2CXA A;  1MMA A;  4ZBG A;  3P2H A;  3OS1 A;  4C9Y A;  3NE7 A;  2KPM A;  4HSR A;  5KCM A;  2Z3P A;  3IU1 A;  2E60 A;  5KNL A;  3K6G A;  1Z3X A;  3JUW A;  3RQ4 A;  4ONU A;  2OV7 A;  2Q0Y A;  3LMM A;  1YX3 A;  3U21 A;  3L2U A;  4MFQ A;  2ZFU A;  3M8J A;  2ZPA A;  3V8I A;  2ZSI B;  1V5G A;  2UWM A;  4XLA A;  4LX9 A;  4R57 A;  2IGO A;  4Y3O A;  4DGW B;  5HLT A;  1J4J A;  1K4J A;  1OZP A;  2PR8 A;  2R7H A;  2R7U A;  4PK2 A;  4XPD B;  1BR1 A;  2QIR A;  2CNM A;  2J8R A;  3PSI A;  2RC4 A;  3VWE A;  2HQA A;  2IS2 A;  4C68 A;  3B8G A;  2PR1 A;  2ZSH B;  1D1B A;  4CCN A;  2ELJ A;  3VWB A;  2FS5 A;  5F46 A;  4PSW A;  3SYT A;  2BUE A;  2OZG A;  1OR7 C;  1UFH A;  4CGM A;  3H35 A;  4YRH A;  2WPX A;  2I79 A;  1BOB A;  3ZGK A;  2R4G A;  3ZZI A;  4CAX A;  4CYN A;  3FBI B;  5EBV A;  2XSJ C;  4NUB A;  4CH7 A;  2KLO A;  1XEB A;  2VKH A;  3SEZ A;  1XE4 A;  4Y49 C;  2HUZ A;  5IV0 A;  3CP2 A;  1QSM A;  2VEZ A;  2LYC A;  4NC7 A;  1HA8 A;  3IWG A;  2OB0 A;  4KJZ A;  3W2A A;  4XNH B;  4CCM A;  3G3S A;  4C2X A;  2CS3 A;  2JVG A;  2NMT A;  3A1Y A;  2WSA A;  3HOS A;  3P2F A;  4HEA 2;  2V26 A;  2XF5 A;  4KIT B;  1ZEL A;  3PJR A;  4KIS A;  1IYK A;  2Y0M A;  3LOD A;  2KRH A;  2FT0 A;  3TO9 A;  3W91 A;  4B13 A;  2P6F A;  2GAN A;  3OYC A;  4B14 A;  2R98 A;  4GRI A;  2G0B A;  2OZU A;  5CKT A;  1M4D A;  1Z3Y A;  3DU5 A;  4E8O A;  1Y9W A;  3FB3 A;  4BMH A;  1R57 A;  3VDX A;  2W7N A;  2GIV A;  1QST A;  4PJM A;  2PDO A;  1KZF A;  4R9M A;  4KT6 A;  4B5O A;  3SZG A;  1M1D A;  4XOP A;  3DTK A;  3QYE A;  3FIX A;  2CNS A;  5LFA A;  3FYN A;  1IIC A;  2R7S A;  3GYA A;  3OWC A;  2XC7 A;  2B3V A;  4LIV A;  2GE3 A;  4LIT A;  3EUK L;  4CCK A;  4BE2 A;  3D3S A;  4F0Y A;  3DPT A;  3CES A;  1QSR A;  1D0X A;  3IGR A;  4XPL A;  2Z3M A;  3S3O A;  3HC7 A;  2CUJ A;  4KVM E;  5HNF A;  4X5K A;  2O28 A;  2X6X A;  4NXY A;  1Y9K A;  2Q2E B;  4II9 A;  3K4K A;  4UCN A;  1NMT A;  4QB9 A;  1U6M A;  4HNX B;  2VQL A;  2ZXH A;  3QYF A;  4CCJ A;  3VSK A;  4JWP A;  4XPD C;  5DWM A;  1WWZ A;  4B5P B;  4CGP A;  3FXT A;  5H86 A;  4QBJ A;  3OR2 C;  4XOT A;  2E1M B;  2WPW A;  2FIA A;  2ZW5 A;  2VXZ A;  3OS0 A;  3MKW B;  2PJR B;  3NWT A;  3MGD A;  4UCM A;  4CRY B;  4HST A;  3W6X A;  2L9S A;  3A4C A;  1OLT A;  3MMY B;  3DTI A;  1YRE A;  4YRV A;  4XKV A;  1SFK A;  2VJ4 A;  2HDW A;  4PFO A;  2FCK A;  1FMW A;  3HXL A;  2VZZ A;  4KUA A;  1XF8 A;  5CQG A;  1YX0 A;  2LBF A;  1MMG A;  3IWE A;  4RM3 A;  2VJJ A;  5C82 A;  3OYB A;  3OYI A;  3TCV A;  2L9N A;  2WY8 Q;  2BW3 B;  2LG4 A;  4XPK A;  2Z16 A;  2CY2 A;  1PU9 A;  4PV6 A;  3LL7 A;  2Z11 A;  3CXP A;  1MJB A;  4NCZ A;  5A27 A;  2VB6 A;  2FXF A;  4KOV A;  2ARH A;  2CW7 A;  1B87 A;  1YVK A;  2X1D A;  4XNH C;  3KX2 A;  2IGN A;  2KHM A;  4DBR A;  2EVN A;  4MHD A;  1M44 A;  2DJI A;  3S32 A;  1GLN A;  1YLE A;  3DNS A;  3RSN A;  4J00 A;  2OH1 A;  4A32 A;  2WY7 Q;  1R6R A;  1M4I A;  4B5P A;  4EVY A;  2VPL A;  2R7T A;  1NE9 A;  3L2V A;  5HVQ C;  2FUG 2;  4CGO A;  1YX5 A;  3HOT A;  2YNE A;  1GHE A;  2DXI A;  2CV1 A;  5C88 A;  4LG3 A;  1D1A A;  4CYP A;  4F92 B;  1RO5 A;  4L8A A;  1S60 A;  2WBM A;  3OR1 C;  2JEV A;  4R87 A;  4AVB A;  2RNG A;  2O5R A;  4IX7 A;  1D1C A;  2ZXV A;  5J8C A;  3ONQ A;  3KEY A;  3LFU A;  2W1O A;  3C26 A;  1DP3 A;  4MFZ A;  4A2Z A;  5FVJ A;  2YND A;  1Z7L A;  2REF A;  1X19 A;  4XOR A;  2D4O A;  4K30 A;  2X1E A;  1J09 A;  4KLV A;  2L7K A;  3T90 A;  4ZGY B;  3FHN A;  1VZ0 A;  4C7H A;  4P1W A;  4XL9 A;  3S3N A;  1JI8 A;  4DIQ A;  4MJ8 A;  4DNC A;  4KOW A;  2H5M A;  1IB1 E;  2W82 A;  3K4B A;  2HZD A;  1ON0 A;  4QUS A;  1V5F A;  3T9Y A;  5KTA A;  2F5V A;  2KL4 A;  1V0C A;  1XMT A;  5JPH A;  2E1M C;  4KOT A;  1Q2D A;  2CFO A;  2P6G A;  2LRD A;  3DU6 A;  4R3K A;  3DQV C;  4F6A A;  4MFK A;  1DGW Y;  1MMN A;  1WJC A;  3ZXS A;  3LSI A;  3S3M A;  2Z3N A;  2MC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...