2P0WA

Human histone acetyltransferase 1 (hat1)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
319
structure length
319
Chain Sequence
b'AEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase type B catalytic subunit
publication title The crystal structure of human histone acetyltransferase 1 (HAT1) in complex with acetylcoenzyme A and histone peptide H4
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2p0wA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2p0wA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 2p0wA01
3KKWA 3W6XA 3SXOA 2QMLA 2GIVA 3T90A 1YR0A 2OB0A 3T9YA 2ATRA 3WR7A 1VHSA 4M3SA 1S7LA 4R87A 2B4DB 1YGHA 1MK4A 5I0CA 1S7FA 3VWDA 4K30A 2JDDA 4J3GA 1N71A 4HKFA 2ZPAA 5KTCA 1M4IA 4JXQA 1S7KA 2OZHA 3EC4A 2Z10A 1IYKA 4XNHC 5CNPA 5KTAA 2FXFA 3DR8A 2GANA 3S6FA 2QIRA 4UA3A 3DR6A 3TO7A 2Y0MA 2J8RA 1CJWA 3F5BA 2BEIA 2FIAA 2PQ8A 1Z4EA 2ARHA 2OU2A 3W6SA 2PRBA 1YVOA 4XPKA 4NSQA 4QBJA 4YFJA 2CY2A 3DNSA 5EBVA 2X7BA 1M4DA 3TO9A 3TFYA 1QSNA 1NSLA 3NE7A 4KVME 5C88A 3P2FA 4KOTA 1Y9KA 4ORFA 2PC1A 2B5GB 3IGRA 4EVYA 4CAWA 3SXNA 3PZJA 2EVNA 5F49A 1IIDA 4HNWB 2FT0A 5GCNA 2ZW5A 3PGPA 1WWZA 2R8VA 2RC4A 3D3SA 5EC4A 4PV6A 2JLMA 4X5KA 3DDDA 2F5IA 3EFAA 4OLLA 1XMTA 1Y7RA 3OWCA 1KZFA 4PSWA 1XF8A 2Q0YA 2GE3A 4U9ZA 1IB1E 3C26A 4IF5A 4XPDC 1QSMA 2NMTA 3GY9A 1OZPA 2ZW4A 4H89A 2HUZA 2P6GA 4KOVA 2B5GA 3TO6A 4NXYA 4KLWA 3RYOA 3GYAA 1XEBA 1TIQA 3CXSA 1S5KA 1Q2DA 4R9MA 3EO4A 4U5YA 3TTHA 2R98A 4RS2A 1Z9UA 1LRZA 4KZTA 2P0WA 3VWEA 1RO5A 4AVAA 2WPXA 4Y49B 2CNTA 4B5OA 3SHPA 3S6HA 2Q7BA 2ZW7A 3QAHA 3N7ZA 2OZGA 1YLEA 1Q2YA 3I9SA 1NE9A 2CNMA 4KLVA 1QSTA 2REFA 2QECA 1FY7A 1U6MA 2ZXVA 3R95A 2B4BA 5H86A 4KOUA 2R1IA 3TOAA 4QUSA 3V8IA 3F8KA 4B5PB 5DWNA 2K5TA 4R3KA 2KCWA 4E0AA 2VBQA 4UWJA 5F47A 5F46A 1B6BA 4MY0A 5J8CA 3FBUA 5HMNA 1S60A 4MI4A 1BOBA 2VXKA 3PP9A 2P6EA 4ZBGA 2HQYA 3D8PA 2OH1A 2I79A 1I21A 1K4JA 4F0YA 4CRYB 5JQ4A 3QB8A 3FRMA 4E2AA 4H6UA 2Q04A 1PUAA 2FE7A 4KOWA 2PR8A 3TT2A 2G3AA 3G8WA 4FD5A 2O28A 2HV2A 5F48A 3F0AA 1KUXA 4QC6A 4B5PA 5J8FA 3TE4A 4XNHB 4R57A 3R96A 3W91A 1NMTA 3LD2A 2G3TA 4QB9A 3B8GA 2DXQA 1P4NA 4FD6A 2BUEA 2VQYA 4II9A 2JDCA 4BMHA 4FD4A 4JLYA 4CRZB 4L8AA 1YX0A 4HNYB 4UBRA 2J8MA 4KOXA 5C82A 4AVCA 1J4JA 4JD6A 1CM0A 2FS5A 1MJBA 5IV0A 3S6GA 4E8OA 4AVBA 3FNCA 4LUAA 4U9YA 2PR1A 2JEVA 4LX9A 3K9UA 2VEZA 1XE4A 2B3VA 1M1DA 1YVKA 3BLNA 2B58A 2AE6A 3TOBA 2EUIA 3R9GA 4JWPA 1RXTA 1Z4RA 2FSRA 5HH1A 3JUWA 4NCZA 2B3UA 4AB7A 5IX3A 2REEA 2Q4YA 1IICA 4L89A 2FIWA 3LODA 3IWGA 3D2PA 4CAXA 2VI7A 4DNCA 2AJ6A 1IYLA 1M44A 2PSWA 1S3ZA 1SQHA 3G3SA 4JXRA 4NF1A 1Y9WA 5IB0A 1S7NA 4FD7A 4XPDB 3EXNA 2IL4A 4YRHA 1GHEA 3FXTA 3UY5A 4KVXA 1QSRA 5E96A 2I00A 1MJ9A 1KUYA 2A4NA 1YREA 4KVOE 5ISVA 1V0CA 4NEXA 1I1DA 4OAEA 1MJAA 2C27A 1KUVA 2OZUA 3CXPA 4YGOA 3R9EA 3FB3A 1L0CA 2D4PA 4F6AA 1WK4A 5H84A 4KOSA 3TCVA 4ONUA 1UFHA 1VKCA 2FCKA 2BL1A 4PK3A 1QSOA 2VZZA 4MJ8A 3MGDA 2B4DA 3DSBA 3BJ7A 3S6KA 4JJXA 2Q44A 3CXQA 3P2HA 1P0HA 3E0KA 3R1KA 4CS0B 2PDOA 4RI1A 2Z0ZA 2CNSA 3ZZIA 4XPLA 1PU9A 5FVJA 2J8NA 4KUAA 1Q2CA 1YK3A 1ON0A 3EY5A 4MHDA 4Y49C 1I12A 1B87A 2VZYA 4MBUA 3JVNA 4M85A 5KTDA 2BSWA 4KUBA 4PK2A 3GKRA 4KOYA 2R7HA 3FYNA 4PSXA 3D2MA 2ZW6A 1XIXA 2P6FA 2Q4VA 4GS4A 1M4GA 4CAVA 4UWIA 4IUSA 4HNXB 3BJ8A 4AG7A 4QVTA 2H5MA 3ZJ0A 4AG9A 1BO4A 3H4QA 2D4OA 5JPHA 4H6ZA 4I49A 4KORA 2G0BA 2FL4A 5DWMA 3FIXA 4MY3A 2WPWA 3R9FA 2Z11A 4OADA 3I3GA 1R57A 4R3LA
chains in the Genus database with same CATH superfamily
3D68A 1WJBA 4XRSG 1H8AC 1YIJI 1TWFJ 3SXOA 5IT3A 5F04A 4BXFA 3GW2A 2DYRH 5J1RA 3H0DA 2HTSA 3SEZA 2BEOA 2R7ZJ 4CHUA 1EH6A 2O8XA 2OB0A 2XAQA 3K10A 3P9IA 3ZQ7A 4KMFA 3NH4A 5GTHC 4A3BJ 4LK1F 4UF4A 2OJED 3T9YA 1J2XA 1X1CA 1OYIA 3IIBA 2XKOA 3RDIA 4A3LJ 1NG7A 2VT2A 2B4DB 2PJ9A 4AM3A 3WC5A 3IAM2 3KYCB 4UCMA 3R4KA 4J01A 4RN7A 4YU9A 3IC1A 4D0PA 4M73A 4J3GA 2ME6A 1N71A 3X2QH 4ANJA 1S7KA 3GZ5A 3H92A 3HM5A 4ESJA 3FXRA 3HUVA 4P4JA 2RV8A 1EE3P 5D6EA 1ZG8A 5KTAA 4FT8A 2FXFA 1IV8A 4CUGA 2VC1A 4R8HA 3ZMUA 4IKFA 2RDPA 5GAHJ 3OYMA 1HDPA 3HTSB 1Z8LA 3BOQA 4RM3A 1XD7A 1Z05A 5D5UB 4PJJA 5M5WJ 4EMEA 4UA3A 5M3FJ 3TO7A 2PVWA 2AHQA 2CFOA 1JI8A 2Y48A 2ME0A 1EKEA 2K9NA 4R6TA 1BC8C 3F6VA 1ULYA 1N77A 3GYHX 3BT9A 2UWMA 5EG0A 1J75A 1UHSA 2BEIA 3DEUA 3FH4A 4II3A 2E71A 3SJXA 4XLHA 3CF5F 2Z3KA 1Z4EA 1UB9A 2A68F 4BINA 4FAIA 2FE3A 3SDBA 1LAPA 3HHHA 2E36A 3KIOA 3OIOA 3WTWC 2PRBA 1B4AA 1J59A 4ZYEA 4YIIA 1XS9A 4IOAF 3SJFA 1LKXA 2QGUA 4A5MA 3JTGA 4I6ZA 1HW5A 1Y0YA 2R7FA 3RKWA 4A0ZA 2NVUB 2JEWA 2V8HA 3VH9A 2POKA 1VZ0A 3TFYA 4E70A 1W7PD 3CCMI 2ISYA 4P4DA 5D29A 1WH7A 3FM5A 3CCJI 2JK3A 5E3LA 1FBSA 2W24A 1OCZH 3D5LA 2EK5A 4IF4A 2EWNA 2L9NA 1U0JA 2BBYA 1D0XA 1ITYA 2XF5A 3HRTA 4HNVA 1JE8A 1OLTA 4C30A 2H27A 2C6YA 3DEEA 1LFBA 4B48A 1LDDA 2B5GB 3MKZA 2UXNA 2PFBA 4OMYA 1BAVA 4R76A 1RKTA 1V3FA 2V77A 5H6RA 1SAXA 3H8EA 3FKIJ 2EINH 2C6PA 2BY0A 1IIDA 2GXGA 4HNWB 3CO6C 2CXAA 3VYUB 1IN4A 2Z2SB 4B6ZA 4LLGF 3E1SA 2ZW5A 4A94A 2ESNA 3KPHA 5LRRA 1PCAA 1WWZA 1JGSA 1KU7A 4CCNA 5EC4A 2RVCA 4P4IA 1JJ6C 1WJ5A 2MG4A 2H94A 3KHZA 2YSRA 3HHGA 3OYDA 2G9DA 1JGGA 1A31A 1WKMA 5L3DA 2P6TA 5IYCJ 5M3MJ 1HOMA 5IT9Z 1XMTA 1MNDA 2WAFA 1KZFA 2VPLA 2Q0YA 1IN6A 3BCBA 1ARLA 3D66A 2OD5A 3E6MA 2Z3YA 3R6SA 4X8IA 1ZHFA 3HPHA 5CVIA 5G1ZA 2DA5A 1UAAA 1QSMA 3DFGA 4ZX9A 4BGDA 2OTJI 1MNEA 2Q43A 4AVPA 4CAFA 1WVRA 4E7LA 2M3AA 1XDSA 5E17F 1K83J 3ASNH 4LG3A 3CCRI 3FEDA 4W1UA 4F7ZA 3ZPLA 3KYLA 1ENHA 4M3BA 2AS5F 1FBUA 4MEYF 3BZ6A 2DPUA 3OIQA 2XC7A 4ZC3A 4NXYA 5LRJA 1YG2A 3SJMA 4TNUA 2EWBA 1XEBA 4RUHA 1TWCJ 4HX7A 5ICGA 1TQMA 2HYFA 3B3CA 5IY5H 1LFPA 1VQ5I 3I71A 3DLLF 4PPZA 5K5OA 2QA4I 3K2KA 4MFJA 1EA3A 1BBYA 1QQIA 1R5ID 2EQRA 2G9WA 5LGUA 1VHOA 2LY9A 3U9GA 1Z9UA 2VODA 1GXQA 1N75A 1F2OA 4KZTA 3VWEA 3I59B 2RB7A 2E7XA 3Q0WA 1RO5A 3V38A 1BIBA 3WHCA 3C7JA 3NWTA 4NQWB 2R7WA 1XGOA 3LFUA 2WPXA 2O8KA 3F3XA 2W25A 2BGCA 1DPUA 2CJJA 1A36A 2FSWA 4XIDA 3FISA 2DTZA 2EB7A 1PUFA 5FD5A 2EZLA 4ZY1A 2ZW7A 3PNVA 4JX4A 3FF3A 3VDXA 1DU6A 1U8RA 3N7ZA 4G1PA 3HIFA 1D0YA 4IL6C 1ZK8A 2ZELA 1BI1A 1SVMA 2EZHA 3R0JA 2IJZA 2YX4A 4P9FA 1NE9A 2F4IA 2KRCA 4KLVA 1EH7A 2A05A 5A2QK 2REFA 4IQ4A 1FOWA 3DBRB 4I01A 5D4SA 3ZN1A 2YPRA 1X3UA 2PLYA 5ILSA 3HZJA 3OYJA 3RTRA 3R95A 4I0AA 4CH7A 5H86A 3V7SA 4NFRA 3L2WA 2P6SA 1RUOA 4QUSA 1U9NA 3JAMZ 2XHKA 3A03A 3F8NA 2R7SA 3CP2A 3P9CA 4LIVA 5JVGF 3QRFF 2B63J 3F8KA 3FMRA 5LRGA 2JSPA 2RNGA 5EGOA 4PXDA 4B44A 2ZXHA 4HQEA 4E0AA 3W2VA 3RJPA 4X0GA 1TKFA 3RPUD 4S05A 1YX5A 3C3WA 5C3EJ 1P2FA 2X6YA 5F1JA 4G8XA 1XG1A 2OTLI 5DS9A 2O6GE 1U5TC 1G3YA 5J8CA 3NEUA 4ZDOA 2RQQA 3G1LA 2PJRB 1WJEA 3HDDA 1Z7UA 3B3TA 3JRHA 2VN2A 4RB2C 3PO3J 3GUXA 5TISC 1BJAA 1BN5A 4OIDA 4C2MJ 1R22A 3PFYA 1FZPB 1LUJB 5IPAA 2G7UA 5FROA 2KZGA 2I79A 3AAFA 2WAEA 4BE0A 1I21A 1JWQA 2R7UA 1QHGA 2QLZA 5EMIA 3VB2A 2XVCA 2NXNB 3L2CA 1TBXA 3UNGC 2QCOA 2OA4A 4OC4A 1OCCH 4M3GA 4Y15A 4DYQA 1YW9A 5ICEA 2DMQA 4Q48A 3VFZA 3ABUA 3ZR8X 3BG6A 3OWTA 2Q04A 3K9TA 2QVPA 2FE7A 4KOWA 1I6HJ 1Z1DA 2GFQA 4PDKA 3KEYA 2L4AA 2HZTA 4E4HA 1EJ9A 1JUPA 2DFIA 3CCUI 3G8WA 4EWTA 2O28A 1DGRM 4EJTA 3SJEA 5D8NA 4WWCA 3PB6X 2W85A 4EQQA 4YFXF 3JSOA 1KQ0A 5CJ9A 1W36C 1KUXA 3J7ZI 3JTKA 2GLOA 4BS9A 4FX4A 1BW5A 5J8FA 3TE4A 3WT4A 2Z33A 4A3KJ 1Z8XA 2EA2A 1IXRC 3E97A 2CUFA 5J47A 4ENJA 1LFUP 1LPQA 1WFXA 2H8WA 3CLQA 1MMNA 4UV9A 2CO5A 3PM1A 4YFNF 3S9MA 5HODA 1YW4A 1RR8C 2F5DA 4C7HA 1Z7LA 4QB9A 3B8GA 1Z3YA 1VGYA 3K1NA 4BE2A 2KT0A 2E7WA 3C18A 1BI0A 3MVPA 4II9A 1QZZA 2JDCA 1YRNA 3IH3A 4HSRA 2Z3NA 4ABZA 4A30A 2P7CB 1ODDA 1IC8A 1FT7A 5FD6A 3RQ4A 2WY7Q 1FYMA 5THWA 4LG0B 2J8MA 1MDMA 4UEEA 2YU3A 3CC4I 4NJQA 2K86A 2PI0A 2IBDA 3F72A 1FMWA 1A2ZA 4JD6A 1CM0A 2HTJA 2FS5A 1ZR4A 5HVHA 3TKYA 4E7JA 2L7ZA 1FP1D 3A0BC 4LOCA 2XB0X 1QGPA 1A04A 2R7DA 3RYRA 4C3JJ 3K70C 4V19K 4U9YA 1ETVA 4OIWA 2ZNYA 4NNJA 2HOEA 1OR7C 1A6QA 4HPSA 4Q7AA 1YVKA 2ZJRF 4U7DA 2DBBA 4ZTJA 2CU7A 4HNTA 2XEIA 4HF2A 5F08A 1Y1WJ 3R9GA 4C2YA 3FZVA 4I09A 1JT6A 4N9IA 4L0ZB 2FSRA 5FKOA 2QWWA 4FASD 1RC9A 3AL0C 4LK0F 4CA0A 2DA3A 1JT0A 1MIJA 1NG6A 1CP7A 1X1DA 5GP9A 1BA5A 4DBQA 4DJLA 4ZX8A 4CO8A 3GBGA 2EK8A 3OYNA 3KQXA 2ANPA 3QAYA 5GAEJ 4S04A 1I50J 1T0FA 3I55I 5ICCA 1X3ZB 3V8JA 2LKXA 3CDLA 2FJ1A 5J4VA 1TL8A 3I4PA 1YSJA 2PSWA 2R4GA 1AWCA 1V55H 3D7GA 2CV2A 2EIKH 4ZI6A 2IGMA 1YE9A 7CPAA 2CRGA 4BHPA 3FXOA 4NGRA 5IB0A 2EILH 2ZBKA 3GF2A 1HA8A 2YNCA 1S7NA 2FA5A 3HXLA 1CG2A 3HBLA 1Z8TA 4BHBA 4XN3A 3NA6A 4FD7A 1GHEA 3FXTA 4DZPA 4BH9A 4PJMA 2E1CA 4BY1J 1XMKA 4D7MA 1MJ9A 1X1PA 1FYLA 3DU5A 1V4RA 3CJTB 3BR1A 5L3CA 3L9FA 2L7MP 4IRIA 2A4NA 5HVQC 1E3HA 1FPQA 2CQKA 4QTRA 4E7IA 1ZGWA 1MKMA 1WRJA 3G73A 4NEXA 3KCCA 4OAEA 5DD4A 4BJ6C 4HF0A 4BYYA 3NH8A 3MCZA 3FXQA 3CJRB 2W84A 1TWGJ 4BXUA 1KYWA 3DKYA 4XQFA 3IU2A 2KKOA 2Z1DA 3K1PA 3SQNA 1AKHB 3DBLB 2ZMEA 2LR8A 4YGOA 3FB3A 4E7HA 2GREA 3S9NA 5CVUA 2D4PA 4AD9A 4IRGA 1S5LC 2CS3A 4BEHB 4UVCA 5HNFA 2NNYA 1RKWA 2HOAA 2XF6A 2I10A 3NAUA 2FCKA 1H89C 2BL1A 4OC3A 3L00A 1KQ9A 2RNJA 3MKYB 2HDCA 1UZCA 2IMOA 3F8MA 3TP3A 5HS7A 4K3NA 2PJ3A 3HRUA 3DSBA 3D0SA 1T8IA 1MBFA 1OISA 2IGOA 3LFKA 3DQVC 1VQNI 3P2HA 1XRYA 3OYAA 2XAFA 3TL4X 4NGNA 1RI7A 4P96A 2DA4A 1F2PA 1XGNA 2LK2A 3CZ6A 4KIFA 1YJWI 1H88C 4C2ZA 1LJ9A 2LYCA 2QVOA 1OJLA 2KIFA 2ECCA 2QBYA 2DA6A 1D8JA 4FWUA 4JBAA 1TWAJ 4R1HA 2XIGA 4XSXF 5FVJA 3OS0A 3F21A 4F0XA 2P8TA 3PQJA 1AA7A 1XSXA 1I1GA 2ZNZA 3W3CA 1LNWA 5D8KB 4BBRJ 4KIBA 4MHDA 1B87A 3DCFA 2ZEFA 3AG1H 4MBUA 1T38A 2PMZN 3JCUC 3PB8X 4M85A 5KTDA 4KUBA 4JOMA 1RTQA 3GKRA 1LEBA 4KOYA 4IHYA 1H9TA 3FYNA 2ODFA 2FRHA 3LMMA 3BPXA 4LB5A 2QQ9A 1AU7A 2VBZA 3RKQA 4NHJA 1UG0A 3D2MA 4CGPA 1S29A 4B1RA 5JHFA 1GVDA 2PJ4A 1Z3XA 5DUIA 3BJOA 4A39A 2NOJB 4FE4A 4NBQA 4PJ0C 3D67A 4GS4A 2LDUA 4YRVA 3KZWA 4YEJA 2UXXA 3BJ8A 1SMYF 4EEFG 2F6CA 4QVTA 2V8VA 2DFHA 3HOVJ 1V5FA 3COAC 4AG9A 3ZMSA 5A2QZ 3J7YJ 3H4QA 3V7ZA 2D4OA 4ON0A 1K61A 3F8BA 3KL9A 2PMHA 1PYVA 1R7JA 3T0YA 3RIRA 2IS4A 3D4UA 3I53A 5JVTA 1G3TA 1R4MB 4H6ZA 4CYOA 3GLLA 5GPCA 4CYPA 2A5YB 2WC2A 5FKKA 3TC8A 3BR2A 1HC8A 1OCPA 2GM4A 3PFIA 4C68A 1SD4A 4BQOA 3IV5A 2PJ8A 3QP6A 4X1EA 3P5JA 4RMNA 4HBLA 5FGMA 3A2KA 5DM7F 2VQCA 4KNYA 4IHVA 2DU9A 1YTYA 1IRFA 4BE1A 3R9FA 2VPRA 2ZSIB 5EG0B 4XR6A 2IAIA 5CKTA 3S1RJ 3HGYA 3QODA 3I3GA 1R57A 2NVYJ 3KKWA 3FIWA 2IRFG 2XASA 3FEEA 4UVAA 5K7ZA 1M4LA 2PJ7A 3MFKA 5IT9K 2ATRA 1VF9A 3V7CA 2WTEA 3WTYC 4NGTA 2AO9A 4BU2A 1YIOA 3D1NI 1BPMA 4UB8C 1S7LA 3NRVA 4R87A 1YGHA 3OYKA 1MK4A 5I0CA 3KR4A 4HQMA 2QSGX 1JUSA 1U8BA 2DFFA 1OCOH 3M8EA 3KE2A 2AXLA 2ECBA 3CUOA 3CUQC 4KMUX 4HKFA 5KTCA 1M4IA 3J7AY 3FWEA 3C2BA 1PP8F 1CP6A 3IEHA 2OZHA 3WC6A 1B9NA 2X1EA 4L9TA 3MZHA 3GLJA 3K2ZA 2Z10A 3S1NJ 1ZO0A 1FOXA 1EF4A 1Q7LA 4A95A 4WXHA 3CC7I 2WB1N 3RKXA 4XONA 2DT5A 2NS0A 2CQXA 5JFRA 3DKWA 4LJZF 2KRFA 2OUMA 3KETA 2DW4A 3OL4A 4LQ6A 2KL4A 1ONVA 5LRSA 3DR6A 4HX8A 1K6YA 3O8HA 3H1CA 1B8IB 2QJ8A 2KJCA 3KLOA 3ZP5A 2HVSA 2ZOGA 1MZBA 4ESBA 3H5AA 2GOXB 4XNFA 2FIAA 1QRYA 3E6DA 5F64A 2ZJPF 4OKOA 4I76A 5IB9A 2DK5A 1R00A 2HR3A 1SEUA 3ASOH 2JWTA 1IY7A 3PSIA 4RB0A 3NFZA 5LYFA 2FBHA 2X1DA 3W6SA 1VNDA 1GYTA 2BY1A 1CBXA 4NSQA 4QBJA 3IKTA 2F5CA 1YO5C 4HF1A 1XGSA 3BR3A 1DTDA 4MFZA 5KCMA 4IHXA 2XPUA 5F0FA 3CD6I 4C3IJ 3BI0A 2STTA 3GZNB 3TO9A 4KT6A 1ON1A 2X4HA 4XLNF 2MH9A 2Y30A 2KFDA 3HSRA 1TW2A 4KVME 2E60A 5E8IA 4ORFA 2D1HA 2PC1A 4JYWA 1M1EB 3IP4B 1FSEA 2NAZA 1JJ8C 2ZJQF 1TNTA 5HLHA 4G7HF 3IGRA 3OYLA 1HXDA 1D1BA 4XMYA 2O03A 4A6EA 4DYRA 1DDNA 2EBIA 3FXJA 5DTDA 4WF2A 2X6OA 3PZJA 1D5YA 1USSA 3HUGA 5LYDA 4M9ZA 3LNQA 1W4MA 2WUUA 2DT7B 5DCMA 3B7IA 8CPAA 2MH2A 3G1OA 1UELB 1ZLKA 5GCNA 3PGPA 1QBJA 3DPUA 5D5VB 1IGNA 2R8VA 1KQ8A 1AMPA 3D3SA 1W5CC 1MSEC 2VOOA 4X5KA 4Q38A 1UMQA 3FBNB 2ZSHB 2OQGA 5LYLA 4B10A 2BHZA 4D1QA 2LMDA 3OWCA 4A69C 4PSWA 4LGWA 4CCLA 2KP6A 2Y2ZA 2PIYA 4P9UA 4IHMA 5FKNA 1I6XA 1QNTA 1PUFB 4BDYA 2V26A 2Q2EA 1MD0A 5J4YA 1WQ2A 4UUSB 3JREA 4GRIA 2BE5F 4KYWA 3S3NA 3HGGA 3C26A 5JI6A 1RZ4A 3ELKA 4MRIA 1MGTA 3W2WA 3ISXA 5IYDJ 3GY9A 2COMA 2MFZA 4CCJA 3BR5A 5DM6F 1PJRA 3N97A 1CF7A 3VWBA 2XRLA 2QF7A 3K7AJ 2R7TA 1HSTA 4FQGA 2KHMA 2L02A 3RKYA 3MRUA 1STZA 2HUZA 4H89A 1YS6A 2DFEA 5BPIA 1Y39A 2VBXA 4ZY2A 2COBA 3RYOA 3GYAA 2CH0A 2M7AA 4CAEA 3DP7A 3GFLA 4XM3A 5EZGA 5F09A 1TLHB 3MN2A 1TIQA 3S9LA 1S5KA 5EGOB 5DUKA 2PCUA 2M30A 6CPAA 3MN8A 1FOKA 2PJBA 1LFWA 5K5QA 2XGEA 3CESA 4ITVA 4AXVA 2XGXA 1LRZA 3C2HA 3K69A 2VC0A 1XSDA 3H3ZA 1F1ZA 4B12A 1Y1VJ 4B14A 2CNTA 1DE4C 1BI3A 1POGA 3QPLA 2ESHA 1IJWC 5LHIA 3B3WA 5A27A 2JZYA 1ARMA 2PMZA 1VFCA 3TX8A 5HXDA 3DV8A 1O7LA 1HKTA 1DU0A 3QAHA 2OPTA 5K5RA 3NH5A 5HS8A 4NJRA 1XC5A 2OZGA 2HVQA 3TDUC 3ZQHA 3SI2A 2W57A 3HOWJ 1Q2YA 2CNMA 5I4MA 4G6DA 3ZQQA 5F0HA 3WU2C 2V9VA 1UHWA 1FY7A 4L5EA 1SD6A 2OAZA 3QNVA 4OIOF 3CCSI 2V8DA 4F9VA 4KOUA 4H2KA 2R1IA 3TOAA 3O2PE 3E5UA 1MMGA 4BQNA 2VBYA 4F55A 1VQMI 4HRIA 4RGXA 3IKVA 4ENMA 3DGVA 3MKWB 4UY8I 2K5TA 4R3KA 2KCWA 4HLYA 1ZLIA 2VBQA 1ETQA 1X19A 3TEDA 2UV1A 4OMEA 1YS7A 4HEA2 5F47A 4LD5A 3BP8A 4MY0A 2PEXA 2A6HF 2VOPA 3LWUA 3BQZA 5FKMA 3NE8A 5LGNA 2XPWA 2CW7A 4MGRA 3F23A 4Q5SF 4MI4A 3GWZA 3S8PA 2VXKA 3ONQA 3PP9A 1YRNB 1IRZA 1LDKB 1B72A 4NC6A 3GUDA 2JTVA 3FF5A 4C9YA 2E1NA 1XMAA 2FNAA 2OH1A 5LHHA 3BCAA 3KP5A 2BOLA 1K4JA 2EA4A 5CVRA 3PJRA 2CW0F 1E17A 2X6XA 1WI3A 1JHFA 4I2OA 3L2VA 2M8EA 3Q9VA 4KT5C 2LLKA 4PUSA 3B3VA 2PJCA 2IQ6A 2WYRA 1PUAA 2X9DA 1TT0A 2HOSA 3H9QA 3CLOA 3FXLA 3ZQIA 4IXAA 3TT2A 4XBFA 4FD5A 4AIHA 3RCOA 2HV2A 3H36A 1QQ9A 3HOSA 4XLAA 2AFMA 4GFBA 2DA7A 2L9RA 2Q4ZA 5D6FA 3M9AA 3L2RA 3HKZN 4B5PA 3WGGA 5KHDA 3HPGA 2BVLA 4XNHB 4QLCU 1BPNA 5DS0A 2IA1A 3DLAA 1NMTA 2DPDA 3SYTA 3OYHA 2OC6A 2WB1A 2NS8A 2QM3A 1TQIA 2GLJA 1AOYA 3FHZA 1FP2A 1OYYA 3LSTA 4HV6A 1TC3C 3WGIA 2RN7A 3OS1A 3SZPA 1LB2A 4XK4A 4FTHA 1NH3A 2PJPA 4KICA 2PE3A 1VQLI 4M74A 5DDGA 3IO1A 4ZY0A 4BMHA 4GYIA 4FD4A 2K02A 1T08B 4CRZB 4L8AA 3M3YJ 1ETKA 2R3SA 2RAEA 4AVCA 2HDWA 4M6IA 3EYIA 4MCRA 3L09A 3WTSC 3RSNA 4AVAA 3B35A 2KZVA 2I3CA 3WABA 4ETSA 4AVBA 2BW3A 2FQ4A 4OP4A 4CDGA 2PIZA 2ZB9A 5TRDA 2EV6A 4PXCA 2PJ2A 2QZ8A 5ICFA 2CV0A 2KIQA 5CYVA 3ZMVA 2HQ5A 5C4JJ 3GX4X 1X4OA 1U9OA 2V1DA 4XOPA 3BLNA 2EFNA 2B58A 1I39A 1PVEA 5L3FA 3JTHA 2E2HJ 4IX7A 4A38A 4HW0A 3W2AA 1RXTA 1Z4RA 2XAUA 3JUWA 5CPRB 3BR6A 2VKVA 5B66C 3T5XA 4D5FA 4CGZA 5DCFA 3M8FA 3ERED 4IHTA 2REEA 5IX3A 5JGFA 3PUFA 4DGWB 2ZMEB 2ZENA 3LMSA 1SD7A 2RKHA 3TW7A 3FXUA 3LOCA 4GCVA 3CQZJ 2JVGA 1Z77A 4DYCA 4JQFA 4HNUA 1VQ8I 1LE8A 1FC3A 2VI7A 4PZJA 4EGYA 4DNCA 5B1BH 2W4SA 3GTMJ 3I5UA 4O5VA 1G2HA 3L2NA 5JM6A 2K7LA 1IU8A 4KS9A 5KVRA 2FQ3A 3LSHA 3VYSB 5ED4A 1EV7A 3E6BA 1U5TA 2WAQN 1HQCA 2W48A 3ECHA 3FX3A 4G9YA 4Z2YA 4F91B 5E3OA 4A3FJ 1H8LA 1X2NA 1ZGJA 2AFSA 3KLNA 4X3RA 3LA7A 2HFHA 1YOVB 3QPTA 4M6YA 1FYKA 4NF1A 3SJGA 1P7IA 1IN5A 1BR2A 3K0LA 1JTXA 2UUZA 1KZHA 2WBMA 3EUHA 4AU7A 2EK9A 1Z67A 4KA4A 2K4BA 3UY5A 2OBPA 4ZH4F 1QSRA 2PBIA 5TGTA 5K8PA 2QBYB 2DCEA 1XFOA 1B59A 1T56A 3IWEA 2FF4A 3KHXA 2LF8A 1G4DA 1X1BA 2K5CA 4DW6A 4MCQA 1YREA 1WJFA 4TV7A 3T8RA 2DXIA 4BD9A 2VLAA 4KVOE 2A6TA 1V0CA 4I02A 2DEAA 4BHCA 4I99C 1I1DA 2E1MB 3P9KA 3MZYA 3KZIC 2O5RA 4ZYAA 3KASA 1BW6A 3OR2C 3CT9A 3R9EA 2DJIA 4I0BA 1YQAA 2B9SA 3DTIA 3L2QA 1GXPA 4F6AA 3H9GA 4KN4X 1TZLA 1BC7C 1HDQA 5B1AH 3A9LA 1KONA 4KOSA 5J1QA 5GPAA 3TCVA 4O6JA 4MIMA 2VXZA 3IUOA 2L7KA 4EJUA 3U21A 2F4OB 1QSOA 4MJ8A 2I8DA 1D8KA 3A01B 3VATA 5H2FC 3U1DA 2F4MB 2Y9ZA 2B4DA 4PQAA 4DUKA 5J3LA 4ZYDA 4F8ZA 1I27A 4JJXA 1GT0C 2Q44A 3E3VA 2DDBA 1P0HA 1XMBA 1I3QJ 1AUGA 3V4GA 2XRNA 3Q5FA 3AG2H 4RM2A 2Z0ZA 2JT1A 2CNSA 2Q7SA 2CQNA 2CUZA 3JRDA 1IN7A 1O7FA 2HGCA 3LWFA 5AIPA 2KJBA 4HDUA 2Z9OA 4XPLA 1X12A 2KISA 2DOFA 4M72A 4KUAA 5DD8A 2HPMA 1Q2CA 2R0QC 1VQPI 4PFOA 1YK3A 1XDUA 1ON0A 4A3DJ 3KQZA 1HSJA 4C2TA 3JRFA 2VZYA 1WPKA 1YJNI 3JVNA 4NGQA 2BSWA 5D4RA 1R23A 4PK2A 2CMPA 3LAPA 1I1SA 5A28A 1OMIA 2G0EA 5FB2A 2CUJA 4L9VA 1YLOA 2ZW6A 4MCPA 1XIXA 2P6FA 1S3JA 5LEKA 1YW7A 3PO2J 3M1EA 5AONA 2Q4VA 3JRBA 1U3EM 4FCYA 3T8TA 3QYEA 2F5VA 3FBIB 4NC7A 3V8KA 1IGBA 1BR4A 2IW5A 3UKGA 2ZXJA 4OMZA 2K3FA 1C0WA 3OYFA 3GTQJ 2FBIA 2VKDA 3CCVI 2LH9A 4UUTA 4AG7A 2ELHA 2E5ZA 2K40A 2BXYA 5FJ8J 1SVOA 3VPRA 4U87A 2VB6A 1IUYA 2HEOA 5BWAB 4EV0A 4B4CA 5ELYA 4PXBA 4UHTA 2IS1A 3I9V2 3P7NA 1MBEA 2BVMA 5FLXK 4UCNA 5HDKA 1G59A 4MXUA 1Q1HA 2F5FA 3S32A 4KFCA 3L2UA 2FL4A 4JP0A 4NUBA 4RGUA 5AG4A 1Z0XA 3GTPJ 4YIRX 1FOYA 3RI4A 2VQGA 2IS2A 2LC2A 5BOXA 4QSHA 3ZGKA 3LSPA 4IQJA 2K4JA 3PRTA 2WPWA 2Z11A 3QWLA 1MMAA 3IRQA 1RR7A 4R3LA 4HYEA 3W6XA 2FXAA 4UNOA 5LGTA 3VSLA 4BL0B 3CMEI 2QYOA 3BHXA 3HKZA 2IA2A 2GIVA 1DP7P 3I54A 4HV5A 4GYGA 1VQKI 1LCPA 4MHZA 5E3MA 2EIJH 4P10A 1HKSA 2ELKA 5L3GA 2M8GX 3W6KB 2NS7A 2GIZA 4O23A 3R61A 4KSAA 2PN6A 2XSJC 3B6CA 2X1CA 1ZG3A 4MFDA 4U0WA 2O7OA 5J1YA 2X51A 3FJUA 4K30A 2JDDA 5CPAA 4O3MA 1IF1A 2FU4A 3K4KA 1IW7F 2RQPA 3AG3H 4ZYHA 2DO7A 5CBMA 3LSMA 2VI6A 1R58A 4B09A 4WWVA 1FTZA 1CX8A 1BL0A 3EC4A 5EDNA 5FLMJ 3IFEA 3U1KA 3ROUA 3S2DJ 4FETA 1IYKA 3JR9A 1MMSA 3V42A 4XNHC 3F9KA 2QQ8A 4MQVA 2GANA 1R5GA 1WWXA 1FIAA 4IRHA 4Q47A 1TKHA 2IA0A 2EFWA 3E5QA 2Y0MA 5DCMB 3H5ZA 1BOAA 3TQNA 3F5BA 5KAFC 4P4EA 3OV8A 1DGWY 3CCYA 3BZKA 2XV4S 3M1CA 2LSOA 4CYQA 2V79A 4OWRB 2MC3A 2HQAA 2BY3A 3SDGA 1HBXG 4KSFA 1TF9A 1KYZA 3J80K 3IH4A 3QOEA 3Q9SA 4ASNA 1GDTA 3MKLA 1F9NA 1SFUA 1YVOA 1ZKGA 2MLKA 4B3XA 2X48A 5JR3A 3ABKH 2L5QA 1A35A 3DNSA 4AUXA 1MBGA 2Q2EB 4MNUA 3HLPA 2XDVA 2X7BA 5EBVA 3WU1B 1M4DA 2VASA 4A93J 4MFQA 4IK2A 4FX0A 2ZEDA 4XSZF 1NSLA 3NE7A 3JRCA 3FK6A 5C88A 1IDZA 2HB6A 4Y52J 1CF7B 1IOIA 2NRAC 3ECOA 2KMUA 4EM0B 3ZMTA 4XLCA 1S9HA 2KLOA 3DTEA 2V9KA 1ORKA 4RAYA 3PFOA 2H8RA 2XEJA 4Q36A 3EETA 1Y8QB 2P5KA 2WAQA 4A32A 2VJJA 2ZEOA 4BAYA 1R43A 2LRDA 3WTUC 5D5XB 2P81A 4XKBA 3SXNA 5ERIA 3PL8A 3BDDA 2ABZA 3N5FA 2EVNA 1SANA 2MYSA 2P4WA 3ZN0A 3HOTA 2V1NA 1A5JA 2ZMEC 4I98B 1D1CA 2FT0A 1B1BA 1QZYA 4DIQA 2L3DA 1R1VA 4A2ZA 3BG3A 2Z3MA 2RC4A 3GTOJ 4V2FA 3ZCOA 1IXSB 1IZ1A 1X1AA 2JLMA 4G12A 4IHSA 5FLVA 2E2IJ 3CF2A 3HYIA 2F5IA 5LRKA 3I4MJ 2DT6A 4PJLA 1TW3A 1FWZA 1F36A 5HLIA 3CO7C 1CQTA 1Y7RA 1XF8A 2CG4A 2HKXA 3LSKA 4CSWA 3FMQA 4J19A 4ONWA 4OIRF 4RGSA 4D9JA 2W7NA 2EPFA 5JLWA 1WSUA 3GTKJ 4IF5A 2EZKA 4PCQA 3N4MA 1P4XA 2NMTA 4FBEA 4XRFA 1ZG5A 2EH3A 2TCTA 1VHEA 3AG4H 1V54H 2VL8A 2GZWA 2DMTA 2STWA 3RZOJ 4MHNA 5HVFA 1D3YA 1ZGAA 2WV0A 2O3FA 5C4XJ 3CCLI 4M3FA 4MHPA 1JKQC 2P6GA 4EATA 3PIOF 3FK7A 4KOVA 3EYYA 3TO6A 5E1XA 5CQGA 3QPSA 2A07F 4LQGA 3C2GA 1LVAA 1VIXA 2MC4A 3B3SA 4MTEA 3KR5A 3EQLF 4XKCA 2K9LA 3CUQA 1K78A 3CXSA 3B02A 3TW6A 2F5EA 3F8CA 1Q2DA 2PJ5A 2EV0A 2L54A 2GQQA 1R1UA 3SFZA 5LFAA 4R9MA 4U5YA 4UIBA 2DMNA 4MHGA 2R98A 1F5TA 1CPSA 2V4JC 1ZYRF 4RA2A 3CC2I 1ELLP 3CMYA 2NOGA 2DI3A 5D8LB 4B5OA 1B72B 3SHPA 1R71A 5AG7A 1Y0RA 3S6HA 5G20A 2IP2A 3K4CA 4RB3C 2Q7BA 1P9QC 3SEQA 5IP7J 4DZJA 4UFXA 4F52A 2V8GA 5CQEA 1WH5A 3OR1C 3ZOBA 1K7AA 4OC1A 3OS2A 4MEXF 1YLEA 5G22A 3D5RC 3O8GA 2IT0A 1Y7EA 1SFEA 2ZFUA 4G6TB 5HLTA 2ZEGA 3I9SA 3U2RA 3OYIA 3BC8A 2B7EA 2MLGA 2QECA 4P4BA 3OL3A 1DQUA 1U6MA 2HXIA 3IC7A 4ZGYB 3PFEA 1P6RA 4A3EJ 4K2EA 5HDGA 1HW2A 3GO5A 2GXBA 1TNSA 2W1OA 3VYTB 1BI2A 3RO0A 2XEGA 3LAJA 1XPXA 1ZLJA 2CF4A 1GV2A 2Y0SN 5EEHA 2NYQA 4B5PB 4B47A 3WG9A 2DYSH 2FMLA 3OOUA 2F7VA 4WXCA 4E7SA 4EFDA 1W7PA 4Y3OA 2C6CA 2XPVA 2AQEA 2HC9A 4UWJA 1ON2A 4WX9A 1B6BA 4N0BA 1W1WE 5IP9J 3LSRA 5HMNA 4KSIA 3TGNA 3O6BB 2ZOFA 5GTIC 2MD0A 1VQ9I 2KIMA 2V6CA 1QO0D 4EM2A 4S0HB 4A3JJ 3D8PA 2JPBA 3DTKA 3D7DA 2NVQJ 3GIUA 1XCBA 4XL9A 3S17J 3DBHB 2FMYA 2UZKA 3OYCA 2AFOA 4YELA 4H0EA 2GOMA 3TDZC 5JQ4A 1FMVA 4LLLA 2Z3PA 1E3PA 3BQYA 3HRMA 3KP7A 5FLXZ 3DXJF 4YWYA 1O4XA 1Y6IA 2VT3A 4H6UA 3EDPA 2R5ZA 2BW3B 4HG2A 5F1RA 1IRGA 1NK3P 2HOTA 2BO9A 1RPWA 1Z6RA 2JPCA 1SFXA 4QWQA 2CIJA 2PR8A 3LSJA 2EJRA 1WJCA 4IEJA 2H1KA 5J6XA 2N8GA 3JSPA 5F48A 4AIJA 5JHUA 2LTPA 3HJEA 3H8FA 3S2WA 2PJ0A 1OKRA 1E2XA 1REPC 1R1TA 2G7HA 2HNHA 3NQOA 1OQYA 2JUGA 5EJCA 5J40A 1FLIA 4E6KG 3REOA 2LF7A 3IU1A 3LD2A 3CCEI 3QYBA 1ETYA 3Q0VA 2C6GA 5LYIA 2G3TA 3A1YA 2QSFX 3WHBA 1Z9CA 4ZZLA 1ZG7A 2K9MA 3S16J 3W6JB 1MH4A 4FD6A 2BUEA 2VQYA 2HZDA 1K79A 1LE8B 3S15J 4PK4A 4M6GA 2EFOA 2IS6A 4P44A 3BTCA 1L3LA 3G1MA 4JLYA 3I3LA 3ZRGA 2P5VA 4YIFA 6PAXA 3KYDB 3I0TA 4UUVA 4RBOA 4KOXA 4IO9F 2AFXA 4HDVA 4CYNA 2OCCH 3LA2A 1U5TB 1J4JA 4LIUA 4MQ9F 2JA6J 3BG5A 2ZEPA 1MJBA 3IWZA 4BDZA 4LITA 3RZDJ 1H9GA 1BM9A 5L3EA 3O3KA 4E8OA 3FNCA 4LUAA 2K27A 2PR1A 4JX5A 5C44J 4LX9A 1LEAA 2VEZA 1W5SA 1PUEE 1RETA 2R7OA 1XE4A 2B3VA 5BQTA 3DPTA 1M1DA 4Y17A 3PBEA 3JRAA 3HL2A 3S93A 3CMMA 3FMSA 3IHUA 3TOBA 3E5XA 2AE6A 2EUIA 4C2UA 4L5JA 4CGLA 3S1QJ 2WY8Q 2YX7A 3ESWB 2HPIA 2HXOA 4RS8A 4UIAA 3BXMA 4JK1X 3CDXA 3FVLA 4G7ZF 5HH1A 2Z99A 2CWEA 2ETHA 4N4NB 1R6RA 5H20A 3J80Z 3HB9A 4CCOA 1RIOH 1JXSA 2B3UA 5DEQA 2WZNA 1IICA 1XB4A 4L9NA 4P5OA 3JRUA 1OCTC 1HW1A 1TF8A 1SD5A 4X2TA 2YU9J 4XN0A 2FIWA 3LODA 3B2YA 3D2PA 4CAXA 3BLYA 2HQNA 1X3WB 2MD5A 1RESA 1O3RA 2AJ6A 1IYLA 1KU2A 5E79C 4XKWA 3PSFA 2E1OA 1ERDA 3RPUA 1SQHA 1LDJA 3DWLE 2LVSA 2ZFWA 3BWGA 3DF8A 4HOBA 4EVIA 3JRGA 3MD2A 2EBJA 3MAJA 1Y9WA 2A6EF 2ID3A 2Q51A 2F8HA 4GGGA 2PG4A 3IJ3A 3KI9A 1BJZA 4XPDB 2L9SA 5LLQA 1F4KA 2JBJA 4BACA 2IL4A 4YRHA 3LSIA 4BJTA 2M5WA 2QKLB 3KP6A 1FSHA 2KRHA 4ZYQA 4KVXA 3J81K 1ETOA 1GHCA 2EFPA 1W5TA 3CDIA 4AIDA 2ACJA 2HQRA 4XLEA 1KUYA 4G94A 5G21A 3IAS2 4ZYGA 4IVNA 5DYMA 1R4NB 9ANTA 2ID6A 2L0KA 1XN7A 3ABLH 4HPQA 1UWYA 1X58A 4E7ZA 4A3MJ 2V7FA 4P45A 1MJAA 1K4TA 1NTCA 4DBRA 2D1VA 3ISZA 2Z5UA 2E2JJ 1VQ6I 2OZUA 3CXPA 2KQRA 1Y8RB 1L0CA 1UFMA 4A31A 1MDMB 2MW8A 4RAFA 5DV5A 4MTDA 1YI2I 5AIQA 2V1UA 4XORA 4XKVA 1ZG9A 2BYVE 3AL0B 4XLPF 1UFHA 1VKCA 2PX9A 4JZ0A 4YFKF 2AFUA 1FEXA 1J5YA 1DP3A 1LQ1A 4KJZA 5TJJA 2OQRA 4BUPA 3MGDA 5K7HA 3ABTA 4IHWA 2R7XA 3GFJA 4HZFA 1NK2P 3S6KA 2LBFA 2VJ4A 2FNPA 3K4JA 1RRJA 5IOZA 3CXQA 1ZRCA 3E0JB 2E35A 1PDNC 2Z3LA 1GUUA 2DF5A 1EH8A 3KFWX 1MBHA 3R1KA 4FHTA 4KUMA 2XF7A 2P5LC 1Z8WA 2MBFA 5KK1A 2QSHX 1X10A 4CGNA 1YLFA 3WTVC 2M1BA 4Y7NJ 5K8MA 3MMYB 1WJAA 2DAOA 1ZTRA 4EMSA 1U78A 4UXNA 2X0LA 4CGOA 4FE7A 4AVZA 1VQOI 1SVLA 3KEQA 2FVGA 2ZC2A 5BS6A 2L9VA 2IVMA 3FKJA 2EFQA 1B8IA 5FRNA 5E1ZB 2R93J 2Y0SA 2ADUA 4WJBA 2R7HA 3EUKL 2F2EA 1PP7U 2DJNA 4Y4RA 2IGKA 4J00A 1ZELA 1UG2A 1QPIA 1Z91A 1S6LA 1LOKA 4MMOA 2DMUA 4CGMA 2LD5A 4CCMA 3DKXA 2BCOA 5J1UA 3B73A 4HNXB 2R5YA 2R92J 2H5MA 3ZJ0A 1BO4A 1JTYA 2GBYA 2M34A 4EJWA 1MNMC 3OYBA 2H6CA 4W9YA 1P7JA 3SXYA 4RLQA 4AYBN 4RLFA 1X2MA 1YITI 5HS9A 4I49A 2A69F 4ZDLA 3PB4X 3HOYJ 4KORA 2XAJA 2VQLA 1IN8A 3ULQB 4TWEA 2JUCA 5CVVA 2BXZA 2JSCA 1F57A 2HU9A 3VSKA 3E7LA 1KU3A 2LFBA 3QOPA 5JLXA 3FIXA 4R8FA 5BPDA 3G2BA 3K4NA 2JA5J 4MY3A 2XAHA 1MSFC 1S72I 3F22A 4RAGA 4UEZA 4NB5A 3L1PA 3I4NJ 4OADA 1WJDA 3FX6A 4HAMA 3S3MA 2PRQA 2ZKZA 3N05A 4BQAA 2HI3A 4ENKA 1WHUA 3SZGA 4A6DA 1IOFA 2L2OA 4U88A 2K9QA 2WWYA 1TXRA 2EIMH 4P1WA 2QMLA 3T90A 3VYRB 1YR0A 2PVVA 1J09A 3KZZA 2CGPA 3R0AA 2JBKA 2K3PA 3WR7A 2ISZA 5M5XJ 1YW6A 2V9PA 1ETXA 2JMWA 4OINF 1TT5B 1VHSA 4M3SA 2XB5A 4DJAA 5IP6A 1W0TA 3MWMA 1VQ4I 1ACIA 3BTIA 1ETWA 1KGSA 2RREA 3BROA 2P7VB 4WCGA 1S7FA 1Z2LA 3VWDA 1MMDA 4A0YA 3OOPA 3HC7A 4M3EA 5KNLA 3RYPA 2NVXJ 4BNCA 2VQHA 3TBIA 2ZPAA 3T8WA 2WADA 4UEFA 4A37A 4BBHA 4C7IA 1Y0NA 4UUSA 2AQFA 4JXQA 1MBKA 3MQ0A 4LMYA 1LAMA 2L01A 3A02A 2JA7J 5AG5A 3WODF 2GA2A 4A5NA 2J9AA 2M4GA 5CNPA 4AC0A 2Q1ZB 2Y75A 3DR8A 1NHAA 2W82A 2DA1A 2E19A 5F6FA 5KAIC 3EPZA 3RAMA 1YHQI 1VTNC 2JA8J 3S6FA 2QIRA 4IOCF 1WI9A 4CYCA 3SI1A 1FTTA 2E5NA 1QZEA 2J8RA 2C1CA 1CJWA 3FMCA 2YNEA 1XTAA 4RAZA 1R5HA 3M8JA 3FECA 2QQAA 3GTLJ 4OC5A 3GTGJ 2K85A 4II2A 2PQ8A 4C3HJ 2LY1A 4B43A 1T6SA 3RQIA 2QKMB 4Y13A 2ARHA 5B5EC 3WC7A 2OU2A 2QENA 3IH2A 4MFLA 5K8NA 4OC2A 1B6AA 4R79A 3A4CA 4NDLA 4M6HA 2HS5A 3PNTA 4XPKA 4YFJA 1ZLHA 2OR4A 1AYEA 3ZQCA 2CY2A 2M9HA 4HSTA 4CICA 2V6EA 1DPRA 1NSAA 1XCVA 1S7AA 5F0CA 3GFIA 4DOZA 1HF0A 4X6AJ 3EUHC 4KISA 4D5CA 2XGDA 1QHHD 1GV5A 4NGMA 4RB1A 3AFHA 1QSNA 3PB7X 4B13A 4Z6YA 1I5ZA 2BY2A 3IWWA 2KPMA 4IPAA 4GDFA 3P2FA 4DYOA 3SZTA 3QPHA 4KOTA 2M2EA 1Y9KA 2ZCWA 3G4SI 1ZN2A 1SAUA 1S7EA 4QIWN 3CMAI 2VBWA 2LNBA 2RGVA 3QU6A 1BIAA 3KZYA 4GXOA 5K1YA 2HDDA 1IRXA 2O4HA 4EVYA 4CZCA 3GLXA 1GVJA 1J0RA 2I5UA 4CAWA 1OCRH 3EUAA 5LBQA 4IZZA 3S3OA 3L7WA 3FHNA 1WCMJ 2IXSA 3CUQB 1K78B 2ZJ2A 4P4FA 5F49A 1JKRC 2XAGA 1R36A 3LSGA 4XRSA 1BLLE 3CZXA 1OR7A 3RBUA 1JKPC 1FNOA 1B9MA 1G6NA 1R9TJ 3WE3A 4PV6A 3HEFA 2DN0A 4M71A 1H0MA 3SHFA 3DDDA 4G6QA 2FOWA 1QMUA 4F92B 4BXXJ 3DLJA 4OLLA 3F0CA 1N78A 1T98A 5EF6A 5FFZA 2GE3A 2BV6A 2FOKA 4U9ZA 1TQPA 1IB1E 2XKPA 4EJOA 4XPDC 2LOOA 2DTRA 2JJ7A 1ZRDA 3IRRA 5CLSA 4RGRA 3K2AA 1DUXC 3ZQLA 3OSFA 4HA8A 2VKEA 1O3QA 2D45A 1UJ8A 1OZPA 2XEFA 3GXOA 3J81Z 1ZR2A 2ZW4A 2ICWG 1KA8A 2ZEMA 2L7FP 3QQAA 3D5SC 2VE9A 4UV8A 4ZJZA 4BJ5C 2B5GA 1Z6TA 3QYFA 2JQ7A 2DQRA 1CGPA 4KLWA 3S2HJ 1U6GA 1S7OA 2VIXA 2FBKA 4PJNA 3S1MJ 2CFXA 1W7PB 1XX5A 4P55A 5B3SH 3AKZA 1ZG1A 2V1XA 3EO4A 5EYRA 2IGNA 3VODA 2B0LA 3TTHA 3BJAA 4KDPA 4B3AA 2JVHA 4M3DA 4RS2A 3OYGA 2M4KA 2YUSA 3BR0A 1VI0A 2P0WA 5ILUA 2R7RA 5AGEA 1U2WA 4JYKA 2E34A 3DPLC 5IOYA 3GTJJ 4XLFA 5EZHA 1YW8A 5D5WB 4Y49B 1HLVA 1PYTB 4L0YB 3VOEA 3PBBA 4MCSA 3H9JA 3BI1A 2L4MA 1FX7A 3JW4A 3GFMA 5L3BA 4A0XA 1IG7A 3HG9A 1IAWA 5LHGA 1X4PA 2CSOA 3K4LA 4E7KA 3K4MA 2O9LA 2LKSA 4NGPA 1D1AA 4HLXA 4BQQA 3PIPF 2BOAA 2PMUA 2X85A 3GEZA 4LB6B 2FEZA 2R5ZB 1QSTA 2MSYA 1TTYA 4Y33A 3LQQA 4AIKA 3DU6A 2VONA 3J7AO 4BBSJ 3M7GA 1MH3A 2ZXVA 1MBJA 3HSEA 3HTUA 1Y56A 2J5PA 3HUGB 2CV1A 2B4BA 3D7HA 2M0CA 1TP4A 4V2GA 1JKOC 4DQ2A 2FD5A 3V8IA 1Y0UA 1YJ9I 1FJLA 1ZAOA 3E6CC 1OFCX 1T0FC 2TRTA 4AYBA 2Y9YA 1S8NA 4IAVA 2VKHA 2FX0A 5DWNA 2VJIA 2JRTA 3VEPA 1HKQA 3H5RA 4I7HA 3HOXJ 2Q8KA 2LKPA 3H3UA 2R7VA 4B11A 3H0GJ 5F46A 3MEXA 4PFPA 3FBUA 2A5WA 1SFOJ 3K4BA 4Z65A 3FDYA 3D7FA 3WTZA 2PJ6A 3FM3A 1S60A 1I3AA 3I59A 1R3NA 1BOBA 3M4OJ 3HSFA 4NQWA 1YQEA 1E0EA 2D5VA 2VL1A 2YNCC 4A3GJ 5BNGA 2IEKA 1ZH5A 5ILVA 3G3ZA 2P6EA 4ZBGA 2HQYA 4CPAA 2GAUA 3BTLA 1JUMA 1ELMP 2DLLA 4F0YA 1HEEA 4A3IJ 1XMXA 2NSMA 4ESFA 4PGGA 1QPMA 2OOTA 3G71I 1JQGA 2A3SA 2WV1A 4MO7A 4CRYB 3WTXC 2BHYA 4BKXA 1IO2A 2YR2A 3WE2A 3QB8A 3ZMDA 3OMYA 3UR3C 4KITB 3FRMA 4E2AA 1IXCA 3WG7H 3ZMZA 3WGHA 2QQBA 3TP0A 1T33A 1JHHA 1Z21A 5GAGJ 4MLOA 2G3AA 2JN6A 1T95A 3H8GA 4MFKA 2D2WA 1W36D 4M6VA 2AFZA 2BZTA 1TKJA 4N9HA 1QVTA 3HOUJ 3F0AA 4QC6A 3BG9A 2LP0A 1G8XA 2DOAA 3GVAA 2HYJA 3M07A 2O61A 4R57A 2AFWA 3R96A 2DPSA 5FRMA 3W91A 1SFKA 4A2UA 3PUBA 2YNDA 2ZEHA 4G7OF 4RDUA 4A3CJ 3ERMA 3KP4A 1XGMA 2X6WA 3KP2A 3KEOA 4B8XA 3ML6A 4D7NA 4W97A 1XSVA 4UB6C 4L18B 2OV7A 2GA1A 2PJRA 1L0OC 2ZO4A 4M9SA 3ZXSA 2DXQA 1P4NA 2M87A 4C2XA 2LG4A 4KN7X 3HOZJ 4L5IA 3BG7A 1MW7A 1YX0A 2DPTA 4HNYB 4UBRA 2PJ1A 4CZZA 4F9UA 2A61A 5E18F 2GU2A 3F8FA 3GMEA 5C82A 2ZXWH 2YS9A 4JX6A 3C1DA 1T39A 4NGSA 1V5EA 1FIPA 4XOTA 5IV0A 5IYBJ 5BMZA 3K70D 4UVBA 1P4WA 4UFWA 4BY7J 3A01A 3RNZA 4F3QA 1ZREA 3CPAA 2E1MC 1XBUA 1CPXA 2NNNA 3R60A 1G3SA 2JEVA 3NARA 1N25A 1ZRFA 3FXKA 3K9UA 5HVGA 2NVTJ 2M0MA 1D5VA 2DMPA 4EJVA 1T2KA 2FUG2 5FO5A 2VXDA 1QA6A 5AG6A 4ENNA 3I56I 1SC7A 1FT9A 3G6EI 3CCQI 4JWPA 2DA2A 5JH9A 1BR1A 3GCMA 2HYGD 1IDYA 2H6BA 1OBRA 3FXMA 1P92A 2JRMA 5F27A 1F43A 1D0ZA 2VJ5A 4NCZA 2HKOA 3H35A 4AB7A 3CJNA 4OAYA 3RPQA 5HLGA 3V8LA 1RNLA 2Q4YA 1ZQ3P 1HDUA 4YG2F 1Z5RA 4NC8A 4L89A 4WXDA 1WZ2A 3IWGA 4Q4ZF 3I64A 4U7BA 3OSGA 2M45A 1J7KA 2K9SA 4A12A 1M44A 4XRMA 3IL2A 1O57A 5E1WA 4LG0A 4FISA 1S3ZA 1HDDC 3GB0A 3G3SA 4EGZA 3BY6A 4JXRA 1YFHA 1AHDP 3MZ8A 4LFUA 2CUEA 1UHMA 2LBFB 4OIQF 1RUNA 2Y69H 2VUMJ 2WA0A 1OYWA 3EXNA 3CJQB 3QP5A 5HDNA 4PXEA 5M5YJ 2CW8A 2KIUA 3Q0UA 5E96A 4A33A 2I00A 2WSAA 3BPVA 4MFEA 1TWHJ 4CYDA 2KDOA 3T1BA 3OYEA 3I1UA 2GLFA 2XUBA 1USTA 5E3NA 1K4SA 3CDHA 3WTTC 2O53A 5ISVA 3ABMH 3W6VA 5LD2C 1YX3A 2HVRA 3H5NA 2C27A 1KUVA 1XOVA 3ISPA 2GWRA 2H1LA 2GXAA 3PNYA 1W0UA 2YGWA 4EM1A 1O3SA 2RFHA 3LACA 3ZQFA 4L9JA 1J9IA 2AXTC 1YYVA 4M6XA 4GO1A 1K6OA 5E20A 4P6YA 2DODA 1P4AA 2CQ7A 2DDAA 2DOEA 3LA3A 1WK4A 1GLNA 3V7RA 5H84A 1IUFA 5E8GA 1FNNA 2OF7A 3I58A 4ONUA 2QEXI 4MFPA 5K7FA 2IPQX 2EO8A 3BZCA 4PK3A 2R5YB 2VZZA 2Z16A 2DQLA 3K6GA 5FFXA 1KWMA 3BJ7A 3K1MA 3KX2A 2Z3OA 1QVUA 3SI0A 2DK8A 4LLNA 2KDZA 4OU0A 1Q1VA 3E0KA 4UCPA 1YMEA 1SMTA 4HX4A 2LREA 4QPOA 4CS0B 4F93B 2PDOA 2MA3A 1LANA 2IJLA 1R49A 1HCRA 4RI1A 2R7QA 3KP3A 4N4OB 3BJ6A 3EFAA 4FUUA 3ZZIA 3F6OA 3PQKA 1PU9A 4OAZA 4H4KC 3HRSA 2J8NA 2F48A 2OZ6A 2W00A 3CP8A 3JAMK 5K8OA 4UFVA 3IWFA 4QPQA 3EY5A 3TMOA 4AWXB 4IJAA 4Y49C 4XICA 5H6QA 1I12A 3OY9A 1UCRA 5EEAA 4OC0A 5FKLA 2PJAA 3A0HC 2TDXA 4WK8F 2XSDC 1KU9A 3RZAA 3QU3A 2QYVA 1AKHA 2ZXIA 4PSXA 1A6IA 3ZQGA 3PEIA 2LY2A 2CYYA 5HNHA 4MHYA 1G3WA 5GADJ 4ZZDA 4OIPF 3KGQA 1O3TA 3VARA 1XJOA 4BEHA 2XGCA 3WU0A 3JRIA 2MGQA 4U0VA 4CCKA 3LL7A 1IV6A 1M4GA 4CAVA 4UWIA 2JA2A 4IUSA 4R7MA 2VE8A 3GZ6A 2NYXA 2H09A 1ZARA 4ZTFA 3BTJA 4PGHA 2EZIA 3LQRA 1APLC 5JPHA 3H3VK 2OCEA 4OOIA 1LVKA 1FBQA 3CTAA 3PB9X 2Q0OA 2CTCA 4GM5A 3S14J 2EV5A 5HOOA 5LEJA 3Q3SA 2J5OA 1OPCA 2G0BA 1E3OC 2ZEEA 2CQQA 5DWMA 2Y31A 3B6AA 2O0YA 2XROA 2MABA 2QUFA 1QU3A 3NWSA 4U0YA 2HWVA 2CTBA 4CYCB 5EEGA 4M9XA 2ELJA 4ZDPA 1VQ7I 4GXHA 3SFIA 3DEWA 5CVJA 4CXFA 1V5GA 3CPXA 1WGXA 4KIGA 3OIPA 3S6GA 2M7BA
chains in the Genus database with same CATH topology
1WJBA 3KKWA 3W6XA 3SZGA 3SXOA 3VSLA 4BL0B 4BXFA 2L2OA 4P1WA 3HKZA 2QMLA 3H0DA 2GIVA 3SEZA 3VYRB 1YR0A 3T90A 2OB0A 1J09A 3K10A 2K3PA 2ATRA 3T9YA 3WR7A 1X1CA 4BU2A 1VHSA 4M3SA 1S7LA 1NG7A 4DJAA 4R87A 2B4DB 1YGHA 3OYKA 1MK4A 5I0CA 4KSAA 2RREA 2XSJC 3IAM2 2X1CA 1S7FA 4K30A 4UCMA 1MMDA 5KNLA 2X51A 3HC7A 4J01A 2JDDA 3VWDA 4J3GA 1N71A 3K4KA 4BBHA 2VQHA 3TBIA 2ZPAA 4HKFA 2WADA 4C7IA 3LSMA 1M4IA 5KTCA 3J7AY 2AQFA 4ANJA 1S7KA 4JXQA 2OZHA 3EC4A 5AG5A 2X1EA 2Z10A 2M4GA 4FETA 1IYKA 1ZO0A 3V42A 4XNHC 5CNPA 4A95A 3F9KA 2FXFA 5KTAA 2Q1ZB 4CUGA 3DR8A 4XONA 2W82A 4IKFA 3OYMA 3EPZA 2GANA 4RM3A 2OUMA 4PJJA 3OL4A 3S6FA 2QIRA 4UA3A 2KL4A 3DR6A 1JI8A 2CFOA 3TO7A 1K6YA 2Y0MA 2E5NA 2J8RA 2HVSA 1CJWA 1N77A 3H5ZA 2UWMA 2YNEA 3F5BA 3H5AA 2GOXB 4XNFA 2BEIA 1DGWY 3M8JA 2FIAA 4II3A 3M1CA 4XLHA 4II2A 2Z3KA 4CYQA 2PQ8A 4OWRB 2LY1A 4B43A 1Z4EA 2ARHA 2HQAA 2QKMB 3PSIA 4KSFA 2OU2A 4MFLA 3SDBA 3QOEA 2X1DA 4R79A 3A4CA 3W6SA 2PRBA 3PNTA 1YVOA 4XPKA 4NSQA 4QBJA 4YFJA 2CY2A 4HSTA 4B3XA 4MFZA 2V6EA 5KCMA 2L5QA 3DNSA 1LKXA 2Q2EB 2XDVA 2X7BA 5EBVA 4DOZA 1M4DA 2VASA 3EUHC 4KISA 4MFQA 3TO9A 4KT6A 1VZ0A 3TFYA 1QHHD 3AFHA 1QSNA 1NSLA 4B13A 3NE7A 4KVME 5C88A 2KPMA 3D5LA 3P2FA 2E60A 2KMUA 4KOTA 2L9NA 1U0JA 1Y9KA 4XLCA 4ORFA 1S9HA 2KLOA 1D0XA 1SAUA 2V9KA 2XF5A 3DTEA 2PC1A 4Q36A 1OLTA 3IP4B 4C30A 3DEEA 4B48A 1IRXA 2WAQA 2B5GB 2VJJA 4A32A 3IGRA 3OYLA 4CZCA 1D1BA 4XMYA 3MKZA 4CAWA 4CGPA 4EVYA 2LRDA 3EUAA 4IZZA 3S3OA 3FHNA 4XKBA 3SXNA 2IXSA 3PZJA 3PL8A 2EVNA 2MYSA 5F49A 2WUUA 3HOTA 1IIDA 2V1NA 4HNWB 2DT7B 2FT0A 1D1CA 2CXAA 3VYUB 3LSGA 2Z2SB 4DIQA 1UELB 3E1SA 2ZW5A 5GCNA 3PGPA 4A2ZA 1WWZA 3DPUA 2Z3MA 2R8VA 2RC4A 3D3SA 4CCNA 3ZCOA 5EC4A 4PV6A 1WJ5A 1X1AA 2JLMA 4X5KA 3OYDA 4Q38A 3FBNB 2ZSHB 3DDDA 3CF2A 2F5IA 4B10A 2DT6A 4PJLA 4F92B 1XMTA 4D1QA 3EFAA 1Y7RA 4OLLA 1MNDA 2WAFA 1KZFA 4PSWA 4CCLA 1XF8A 2KP6A 1N78A 3LSKA 2VPLA 2Q0YA 4CSWA 3BCBA 2GE3A 4D9JA 2W7NA 2V26A 4BDYA 3HPHA 4U9ZA 4GRIA 1IB1E 3C26A 3S3NA 4IF5A 4XPDC 1UAAA 1QSMA 4XPDB 2LOOA 4BGDA 1MNEA 2NMTA 3W2WA 4CAFA 3GY9A 2MFZA 4E7LA 4CCJA 2VL8A 2M3AA 1PJRA 3VWBA 4LG3A 1OZPA 3KYLA 2R7TA 2ZW4A 2KHMA 4H89A 2HUZA 3D5SC 2P6GA 4EATA 4ZJZA 4BJ5C 2B5GA 4KOVA 3TO6A 5CQGA 3OIQA 2XC7A 4ZC3A 3QYFA 3C2GA 4NXYA 4KLWA 3RYOA 3GYAA 2MC4A 1XEBA 2CH0A 2M7AA 4CAEA 2VIXA 4XKCA 4XM3A 2K9LA 1TIQA 4PJNA 1S5KA 3CXSA 1LFPA 1Q2DA 4MFJA 5LFAA 3AKZA 4R9MA 3EO4A 1EA3A 4U5YA 2IGNA 3TTHA 2JVHA 3CESA 4ITVA 3OYGA 2R98A 4RS2A 2V4JC 2M4KA 1Z9UA 1LRZA 1N75A 3C2HA 4KZTA 2P0WA 2R7RA 5AGEA 1RO5A 3VWEA 4AVAA 3DPLC 2R7WA 2WPXA 3NWTA 4NQWB 4XLFA 3LFUA 2CNTA 4Y49B 4B12A 4B14A 4B5OA 3SHPA 5A27A 5AG7A 3S6HA 3H9JA 2PMZA 3K4CA 5G20A 2Q7BA 1P9QC 3SEQA 2ZW7A 3QAHA 3PNVA 4F52A 5CQEA 4UFXA 3OR1C 3HG9A 3VDXA 3N7ZA 2OZGA 2HVQA 1D0YA 1X4PA 3K4LA 3OS2A 4E7KA 3K4MA 3D5RC 1YLEA 3I3GA 5G22A 2ZFUA 4G6TB 1D1AA 4BQQA 5HLTA 1Q2YA 3I9SA 1NE9A 2X85A 2CNMA 3ZQQA 2F4IA 2KRCA 3OYIA 4KLVA 3BC8A 1QSTA 2REFA 2QECA 4IQ4A 3OL3A 4Y33A 1DQUA 3DU6A 1FY7A 1U6MA 4ZGYB 2ZXVA 3OYJA 3RTRA 3R95A 2B4BA 1Y56A 3HUGB 4CH7A 2CV1A 5H86A 4KOUA 2W1OA 3VYTB 2R1IA 3TOAA 1MMGA 4BQNA 3L2WA 4QUSA 3V8IA 2R7SA 3F8KA 5G1ZA 3CP2A 4LIVA 4B47A 1T0FC 4AYBA 4F55A 4HRIA 5DWNA 4B5PB 2VKHA 2JSPA 2RNGA 2VJIA 3OOUA 4B44A 2ZXHA 3H5RA 4E7SA 3MKWB 2K5TA 4R3KA 4Y3OA 3W2VA 4X0GA 2KCWA 2VBQA 1X19A 3RPUD 2R7VA 1YX5A 2AQEA 4UWJA 2UV1A 4B11A 4HEA2 2X6YA 5F47A 5F46A 1B6BA 4MY0A 4PFPA 5J8CA 3FBUA 2A5WA 4ZDOA 2RQQA 3K4BA 3FDYA 2CW7A 5HMNA 2PJRB 1WJEA 1S60A 4MI4A 1BOBA 3S8PA 2VXKA 3ONQA 1E0EA 3PP9A 2MD0A 2YNCC 2P6EA 1LDKB 4ZBGA 3PFYA 4C9YA 2HQYA 3D8PA 2OH1A 5FROA 3DTKA 2I79A 2WAEA 4BE0A 1I21A 3BCAA 2R7UA 1QHGA 2BOLA 4XL9A 1K4JA 4F0YA 3OYCA 3PJRA 4YELA 4CRYB 2GOMA 2X6XA 3UNGC 5JQ4A 1FMVA 2Z3PA 3L2VA 3QB8A 3OMYA 3UR3C 4KITB 4PUSA 3FRMA 4E2AA 4CRZB 1Y6IA 4H6UA 3ZR8X 3BG6A 3OWTA 2Q04A 2BW3B 4HG2A 1PUAA 2FE7A 4KOWA 1TT0A 3H9QA 1Z21A 3KEYA 4MLOA 4E4HA 2G3AA 2PR8A 3TT2A 1T95A 3G8WA 4FD5A 4MFKA 2O28A 1DGRM 1WJCA 3RCOA 2HV2A 1W36D 3HOSA 5F48A 4XLAA 3F0AA 1W36C 3L2RA 1KUXA 4QC6A 3JTKA 4BS9A 4B5PA 1G8XA 2DOAA 2HNHA 2BVLA 3HPGA 5KHDA 2JUGA 4R57A 4XNHB 5J8FA 3TE4A 3R96A 4E6KG 3DLAA 5FRMA 2DPSA 1NMTA 3W91A 1SFKA 3SYTA 3OYHA 2OC6A 3IU1A 2WB1A 3LD2A 1WFXA 3PUBA 2YNDA 3QYBA 1MMNA 2X6WA 2G3TA 3A1YA 2K9MA 4C7HA 1Z7LA 2OV7A 3OS1A 3B8GA 4QB9A 1Z3YA 2PJRA 4BE2A 3ZXSA 2DXQA 1P4NA 4FD6A 2BUEA 2VQYA 4II9A 2JDCA 2HZDA 4C2XA 2LG4A 4PK4A 2IS6A 4HSRA 2Z3NA 4A30A 4FD4A 4BMHA 3BG7A 1MW7A 4JLYA 3I3LA 3ZRGA 1YX0A 2DPTA 4HNYB 3RQ4A 2WY7Q 4L8AA 4UBRA 2J8MA 4KOXA 5C82A 4CYNA 4AVCA 1J4JA 1FMWA 4LIUA 4JD6A 2HDWA 1CM0A 2FS5A 1MJBA 4BDZA 1V5EA 5IV0A 4XOTA 4LITA 4E7JA 3RSNA 3K70D 3S6GA 2KZVA 4UFWA 4E8OA 4AVBA 2BW3A 4F3QA 3FNCA 4LUAA 4U9YA 3K70C 2E1MC 2PR1A 2JEVA 4LX9A 3K9UA 4NNJA 2VEZA 2CV0A 2R7OA 1XE4A 2B3VA 2M0MA 1OR7C 3DPTA 1M1DA 2FUG2 1X4OA 1YVKA 3HL2A 4XOPA 2VXDA 3BLNA 3S93A 3CMMA 4ZTJA 2AE6A 2B58A 5AG6A 3TOBA 2EUIA 4C2UA 4CGLA 2WY8Q 4HNTA 4IX7A 3R9GA 2HPIA 4JWPA 4C2YA 3W2AA 1RXTA 1BR1A 1Z4RA 2FSRA 2XAUA 4FASD 3AL0C 3JUWA 5CPRB 5HH1A 4CA0A 4N4NB 1NG6A 1R6RA 1D0ZA 2VJ5A 4NCZA 1X1DA 3H35A 4CCOA 4DBQA 2B3UA 4AB7A 5IX3A 4OAYA 3GBGA 2REEA 3OYNA 2Q4YA 4DGWB 1IICA 4P5OA 4NC8A 4HNUA 4L89A 4XN0A 2JVGA 2FIWA 3LODA 4JQFA 3IWGA 3D2PA 4CAXA 2VI7A 3BLYA 4U7BA 4DNCA 2W4SA 2AJ6A 1IYLA 1M44A 4FD7A 2PSWA 4XKWA 3PSFA 4KS9A 3LSHA 2R4GA 3VYSB 1ERDA 1S3ZA 1SQHA 3G3SA 3DWLE 4JXRA 2CV2A 4F91B 2IGMA 3MD2A 2LBFB 1YE9A 4NF1A 1Y9WA 5IB0A 2WA0A 1BR2A 1HA8A 2YNCA 2UUZA 3HXLA 2L9SA 2WBMA 1S7NA 3EXNA 4BACA 4XN3A 4AU7A 2IL4A 4YRHA 3CJQB 3LSIA 1GHEA 4BJTA 2QKLB 3FXTA 3UY5A 4PJMA 2KRHA 4KVXA 2CW8A 1QSRA 5E96A 5TGTA 4A33A 2I00A 2DCEA 1MJ9A 2WSAA 3IWEA 3DU5A 2KDOA 3OYEA 1X1BA 4XLEA 2K5CA 1KUYA 5G21A 3IAS2 2A4NA 5HVQC 1YREA 1WJFA 4E7IA 2DXIA 2VLAA 4KVOE 4HPQA 2A6TA 1V0CA 5ISVA 4NEXA 4E7ZA 1I1DA 4OAEA 2E1MB 2V7FA 5LD2C 1YX3A 4BJ6C 3H5NA 2HVRA 1KUVA 1MJAA 3CJRB 2O5RA 4DBRA 2C27A 4ZYAA 3DKYA 4XQFA 3IU2A 3PNYA 2Z1DA 2YGWA 3OR2C 3OWCA 2OZUA 3CXPA 4YGOA 2KQRA 3FB3A 4E7HA 3R9EA 1L0CA 2DJIA 4A31A 3DTIA 3L2QA 2D4PA 4F6AA 3H9GA 4BEHB 1TZLA 1GLNA 2CS3A 1WK4A 5H84A 3A9LA 4XORA 4XKVA 1KONA 5HNFA 2XF6A 4KOSA 3TCVA 3AL0B 4ONUA 2VXZA 3IUOA 1UFHA 2L7KA 1VKCA 2BL1A 2FCKA 4MFPA 3U21A 3MKYB 1DP3A 4PK3A 1QSOA 2VZZA 4MJ8A 2I8DA 4KJZA 3MGDA 4BUPA 2Z16A 3K6GA 2B4DA 3DSBA 3BJ7A 2R7XA 3KX2A 2Z3OA 3S6KA 2LBFA 2VJ4A 4JJXA 3K4JA 2IGOA 2Q44A 3DQVC 3CXQA 3P2HA 1P0HA 3OYAA 3E0KA 3TL4X 3E0JB 4UCPA 2Z3LA 2LREA 3CZ6A 4QPOA 3R1KA 4CS0B 4RM2A 4F93B 2PDOA 2LYCA 2Z0ZA 2XF7A 4RI1A 4C2ZA 2R7QA 2CNSA 4N4OB 4CGNA 2CUZA 3ZZIA 3MMYB 1WJAA 4XPLA 1PU9A 5FVJA 4OAZA 3OS0A 4H4KC 4F0XA 2J8NA 4KUAA 2HPMA 1Q2CA 4CGOA 1AA7A 2W00A 3CP8A 4AVZA 4PFOA 1YK3A 4QPQA 4UFVA 3W3CA 1ON0A 3EY5A 3TMOA 4MHDA 4C2TA 4Y49C 1I12A 1B87A 3OY9A 2VZYA 4MBUA 3FKJA 3JVNA 5FRNA 4M85A 2Y0SA 2BSWA 4KUBA 4PK2A 5KTDA 4JOMA 2CMPA 3GKRA 4KOYA 2R7HA 3EUKL 3FYNA 2ZXIA 4PSXA 5A28A 3LMMA 3D2MA 2CUJA 4J00A 4Y4RA 2IGKA 2ZW6A 1XIXA 1UG0A 1ZELA 2LY2A 5HNHA 2P6FA 5JHFA 2Q4VA 1Z3XA 4BEHA 4CGMA 3QYEA 2F5VA 2NOJB 3FBIB 4NC7A 4CCMA 4GS4A 1BR4A 4CCKA 3LL7A 3DKXA 1M4GA 4YRVA 4CAVA 4UWIA 2JA2A 3OYFA 4YEJA 4HNXB 2VKDA 3BJ8A 4IUSA 2F6CA 2LH9A 4QVTA 4AG7A 2H5MA 3ZJ0A 1V5FA 4AG9A 2E5ZA 1BO4A 3H4QA 2D4OA 3OYBA 4U87A 2VB6A 4ZTFA 1PYVA 5JPHA 2IS4A 4H6ZA 4CYOA 4RLQA 5BWAB 4RLFA 1LVKA 4CYPA 4I49A 4ZDLA 2IS1A 3I9V2 4KORA 4UCNA 2BVMA 2VQLA 5HOOA 1G59A 4E0AA 3S32A 2G0BA 2FL4A 4BQOA 3L2UA 4NUBA 4C68A 5DWMA 5AG4A 2HU9A 3VSKA 3FIXA 2MABA 4RMNA 1QU3A 3NWSA 2VQGA 2IS2A 3G2BA 3K4NA 2LC2A 2VQCA 3A2KA 4MY3A 3ZGKA 2ELJA 4ZDPA 4IQJA 2WPWA 3R9FA 1V5GA 4BE1A 2ZSIB 2Z11A 4XR6A 5CKTA 1MMAA 4OADA 3QODA 1WJDA 3S3MA 1R57A 3OIPA 4R3LA 3N05A 2M7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KKW A;  3W6X A;  3SXO A;  2QML A;  2GIV A;  3T90 A;  1YR0 A;  2OB0 A;  3T9Y A;  2ATR A;  3WR7 A;  1VHS A;  4M3S A;  1S7L A;  4R87 A;  2B4D B;  1YGH A;  1MK4 A;  5I0C A;  1S7F A;  3VWD A;  4K30 A;  2JDD A;  4J3G A;  1N71 A;  4HKF A;  2ZPA A;  5KTC A;  1M4I A;  4JXQ A;  1S7K A;  2OZH A;  3EC4 A;  2Z10 A;  1IYK A;  4XNH C;  5CNP A;  5KTA A;  2FXF A;  3DR8 A;  2GAN A;  3S6F A;  2QIR A;  4UA3 A;  3DR6 A;  3TO7 A;  2Y0M A;  2J8R A;  1CJW A;  3F5B A;  2BEI A;  2FIA A;  2PQ8 A;  1Z4E A;  2ARH A;  2OU2 A;  3W6S A;  2PRB A;  1YVO A;  4XPK A;  4NSQ A;  4QBJ A;  4YFJ A;  2CY2 A;  3DNS A;  5EBV A;  2X7B A;  1M4D A;  3TO9 A;  3TFY A;  1QSN A;  1NSL A;  3NE7 A;  4KVM E;  5C88 A;  3P2F A;  4KOT A;  1Y9K A;  4ORF A;  2PC1 A;  2B5G B;  3IGR A;  4EVY A;  4CAW A;  3SXN A;  3PZJ A;  2EVN A;  5F49 A;  1IID A;  4HNW B;  2FT0 A;  5GCN A;  2ZW5 A;  3PGP A;  1WWZ A;  2R8V A;  2RC4 A;  3D3S A;  5EC4 A;  4PV6 A;  2JLM A;  4X5K A;  3DDD A;  2F5I A;  3EFA A;  4OLL A;  1XMT A;  1Y7R A;  3OWC A;  1KZF A;  4PSW A;  1XF8 A;  2Q0Y A;  2GE3 A;  4U9Z A;  1IB1 E;  3C26 A;  4IF5 A;  4XPD C;  1QSM A;  2NMT A;  3GY9 A;  1OZP A;  2ZW4 A;  4H89 A;  2HUZ A;  2P6G A;  4KOV A;  2B5G A;  3TO6 A;  4NXY A;  4KLW A;  3RYO A;  3GYA A;  1XEB A;  1TIQ A;  3CXS A;  1S5K A;  1Q2D A;  4R9M A;  3EO4 A;  4U5Y A;  3TTH A;  2R98 A;  4RS2 A;  1Z9U A;  1LRZ A;  4KZT A;  2P0W A;  3VWE A;  1RO5 A;  4AVA A;  2WPX A;  4Y49 B;  2CNT A;  4B5O A;  3SHP A;  3S6H A;  2Q7B A;  2ZW7 A;  3QAH A;  3N7Z A;  2OZG A;  1YLE A;  1Q2Y A;  3I9S A;  1NE9 A;  2CNM A;  4KLV A;  1QST A;  2REF A;  2QEC A;  1FY7 A;  1U6M A;  2ZXV A;  3R95 A;  2B4B A;  5H86 A;  4KOU A;  2R1I A;  3TOA A;  4QUS A;  3V8I A;  3F8K A;  4B5P B;  5DWN A;  2K5T A;  4R3K A;  2KCW A;  4E0A A;  2VBQ A;  4UWJ A;  5F47 A;  5F46 A;  1B6B A;  4MY0 A;  5J8C A;  3FBU A;  5HMN A;  1S60 A;  4MI4 A;  1BOB A;  2VXK A;  3PP9 A;  2P6E A;  4ZBG A;  2HQY A;  3D8P A;  2OH1 A;  2I79 A;  1I21 A;  1K4J A;  4F0Y A;  4CRY B;  5JQ4 A;  3QB8 A;  3FRM A;  4E2A A;  4H6U A;  2Q04 A;  1PUA A;  2FE7 A;  4KOW A;  2PR8 A;  3TT2 A;  2G3A A;  3G8W A;  4FD5 A;  2O28 A;  2HV2 A;  5F48 A;  3F0A A;  1KUX A;  4QC6 A;  4B5P A;  5J8F A;  3TE4 A;  4XNH B;  4R57 A;  3R96 A;  3W91 A;  1NMT A;  3LD2 A;  2G3T A;  4QB9 A;  3B8G A;  2DXQ A;  1P4N A;  4FD6 A;  2BUE A;  2VQY A;  4II9 A;  2JDC A;  4BMH A;  4FD4 A;  4JLY A;  4CRZ B;  4L8A A;  1YX0 A;  4HNY B;  4UBR A;  2J8M A;  4KOX A;  5C82 A;  4AVC A;  1J4J A;  4JD6 A;  1CM0 A;  2FS5 A;  1MJB A;  5IV0 A;  3S6G A;  4E8O A;  4AVB A;  3FNC A;  4LUA A;  4U9Y A;  2PR1 A;  2JEV A;  4LX9 A;  3K9U A;  2VEZ A;  1XE4 A;  2B3V A;  1M1D A;  1YVK A;  3BLN A;  2B58 A;  2AE6 A;  3TOB A;  2EUI A;  3R9G A;  4JWP A;  1RXT A;  1Z4R A;  2FSR A;  5HH1 A;  3JUW A;  4NCZ A;  2B3U A;  4AB7 A;  5IX3 A;  2REE A;  2Q4Y A;  1IIC A;  4L89 A;  2FIW A;  3LOD A;  3IWG A;  3D2P A;  4CAX A;  2VI7 A;  4DNC A;  2AJ6 A;  1IYL A;  1M44 A;  2PSW A;  1S3Z A;  1SQH A;  3G3S A;  4JXR A;  4NF1 A;  1Y9W A;  5IB0 A;  1S7N A;  4FD7 A;  4XPD B;  3EXN A;  2IL4 A;  4YRH A;  1GHE A;  3FXT A;  3UY5 A;  4KVX A;  1QSR A;  5E96 A;  2I00 A;  1MJ9 A;  1KUY A;  2A4N A;  1YRE A;  4KVO E;  5ISV A;  1V0C A;  4NEX A;  1I1D A;  4OAE A;  1MJA A;  2C27 A;  1KUV A;  2OZU A;  3CXP A;  4YGO A;  3R9E A;  3FB3 A;  1L0C A;  2D4P A;  4F6A A;  1WK4 A;  5H84 A;  4KOS A;  3TCV A;  4ONU A;  1UFH A;  1VKC A;  2FCK A;  2BL1 A;  4PK3 A;  1QSO A;  2VZZ A;  4MJ8 A;  3MGD A;  2B4D A;  3DSB A;  3BJ7 A;  3S6K A;  4JJX A;  2Q44 A;  3CXQ A;  3P2H A;  1P0H A;  3E0K A;  3R1K A;  4CS0 B;  2PDO A;  4RI1 A;  2Z0Z A;  2CNS A;  3ZZI A;  4XPL A;  1PU9 A;  5FVJ A;  2J8N A;  4KUA A;  1Q2C A;  1YK3 A;  1ON0 A;  3EY5 A;  4MHD A;  4Y49 C;  1I12 A;  1B87 A;  2VZY A;  4MBU A;  3JVN A;  4M85 A;  5KTD A;  2BSW A;  4KUB A;  4PK2 A;  3GKR A;  4KOY A;  2R7H A;  3FYN A;  4PSX A;  3D2M A;  2ZW6 A;  1XIX A;  2P6F A;  2Q4V A;  4GS4 A;  1M4G A;  4CAV A;  4UWI A;  4IUS A;  4HNX B;  3BJ8 A;  4AG7 A;  4QVT A;  2H5M A;  3ZJ0 A;  4AG9 A;  1BO4 A;  3H4Q A;  2D4O A;  5JPH A;  4H6Z A;  4I49 A;  4KOR A;  2G0B A;  2FL4 A;  5DWM A;  3FIX A;  4MY3 A;  2WPW A;  3R9F A;  2Z11 A;  4OAD A;  3I3G A;  1R57 A;  4R3L A; 
#chains in the Genus database with same CATH topology
 3D68 A;  1WJB A;  4XRS G;  1H8A C;  1YIJ I;  1TWF J;  3SXO A;  5IT3 A;  5F04 A;  4BXF A;  3GW2 A;  2DYR H;  5J1R A;  3H0D A;  2HTS A;  3SEZ A;  2BEO A;  2R7Z J;  4CHU A;  1EH6 A;  2O8X A;  2OB0 A;  2XAQ A;  3K10 A;  3P9I A;  3ZQ7 A;  4KMF A;  3NH4 A;  5GTH C;  4A3B J;  4LK1 F;  4UF4 A;  2OJE D;  3T9Y A;  1J2X A;  1X1C A;  1OYI A;  3IIB A;  2XKO A;  3RDI A;  4A3L J;  1NG7 A;  2VT2 A;  2B4D B;  2PJ9 A;  4AM3 A;  3WC5 A;  3IAM 2;  3KYC B;  4UCM A;  3R4K A;  4J01 A;  4RN7 A;  4YU9 A;  3IC1 A;  4D0P A;  4M73 A;  4J3G A;  2ME6 A;  1N71 A;  3X2Q H;  4ANJ A;  1S7K A;  3GZ5 A;  3H92 A;  3HM5 A;  4ESJ A;  3FXR A;  3HUV A;  4P4J A;  2RV8 A;  1EE3 P;  5D6E A;  1ZG8 A;  5KTA A;  4FT8 A;  2FXF A;  1IV8 A;  4CUG A;  2VC1 A;  4R8H A;  3ZMU A;  4IKF A;  2RDP A;  5GAH J;  3OYM A;  1HDP A;  3HTS B;  1Z8L A;  3BOQ A;  4RM3 A;  1XD7 A;  1Z05 A;  5D5U B;  4PJJ A;  5M5W J;  4EME A;  4UA3 A;  5M3F J;  3TO7 A;  2PVW A;  2AHQ A;  2CFO A;  1JI8 A;  2Y48 A;  2ME0 A;  1EKE A;  2K9N A;  4R6T A;  1BC8 C;  3F6V A;  1ULY A;  1N77 A;  3GYH X;  3BT9 A;  2UWM A;  5EG0 A;  1J75 A;  1UHS A;  2BEI A;  3DEU A;  3FH4 A;  4II3 A;  2E71 A;  3SJX A;  4XLH A;  3CF5 F;  2Z3K A;  1Z4E A;  1UB9 A;  2A68 F;  4BIN A;  4FAI A;  2FE3 A;  3SDB A;  1LAP A;  3HHH A;  2E36 A;  3KIO A;  3OIO A;  3WTW C;  2PRB A;  1B4A A;  1J59 A;  4ZYE A;  4YII A;  1XS9 A;  4IOA F;  3SJF A;  1LKX A;  2QGU A;  4A5M A;  3JTG A;  4I6Z A;  1HW5 A;  1Y0Y A;  2R7F A;  3RKW A;  4A0Z A;  2NVU B;  2JEW A;  2V8H A;  3VH9 A;  2POK A;  1VZ0 A;  3TFY A;  4E70 A;  1W7P D;  3CCM I;  2ISY A;  4P4D A;  5D29 A;  1WH7 A;  3FM5 A;  3CCJ I;  2JK3 A;  5E3L A;  1FBS A;  2W24 A;  1OCZ H;  3D5L A;  2EK5 A;  4IF4 A;  2EWN A;  2L9N A;  1U0J A;  2BBY A;  1D0X A;  1ITY A;  2XF5 A;  3HRT A;  4HNV A;  1JE8 A;  1OLT A;  4C30 A;  2H27 A;  2C6Y A;  3DEE A;  1LFB A;  4B48 A;  1LDD A;  2B5G B;  3MKZ A;  2UXN A;  2PFB A;  4OMY A;  1BAV A;  4R76 A;  1RKT A;  1V3F A;  2V77 A;  5H6R A;  1SAX A;  3H8E A;  3FKI J;  2EIN H;  2C6P A;  2BY0 A;  1IID A;  2GXG A;  4HNW B;  3CO6 C;  2CXA A;  3VYU B;  1IN4 A;  2Z2S B;  4B6Z A;  4LLG F;  3E1S A;  2ZW5 A;  4A94 A;  2ESN A;  3KPH A;  5LRR A;  1PCA A;  1WWZ A;  1JGS A;  1KU7 A;  4CCN A;  5EC4 A;  2RVC A;  4P4I A;  1JJ6 C;  1WJ5 A;  2MG4 A;  2H94 A;  3KHZ A;  2YSR A;  3HHG A;  3OYD A;  2G9D A;  1JGG A;  1A31 A;  1WKM A;  5L3D A;  2P6T A;  5IYC J;  5M3M J;  1HOM A;  5IT9 Z;  1XMT A;  1MND A;  2WAF A;  1KZF A;  2VPL A;  2Q0Y A;  1IN6 A;  3BCB A;  1ARL A;  3D66 A;  2OD5 A;  3E6M A;  2Z3Y A;  3R6S A;  4X8I A;  1ZHF A;  3HPH A;  5CVI A;  5G1Z A;  2DA5 A;  1UAA A;  1QSM A;  3DFG A;  4ZX9 A;  4BGD A;  2OTJ I;  1MNE A;  2Q43 A;  4AVP A;  4CAF A;  1WVR A;  4E7L A;  2M3A A;  1XDS A;  5E17 F;  1K83 J;  3ASN H;  4LG3 A;  3CCR I;  3FED A;  4W1U A;  4F7Z A;  3ZPL A;  3KYL A;  1ENH A;  4M3B A;  2AS5 F;  1FBU A;  4MEY F;  3BZ6 A;  2DPU A;  3OIQ A;  2XC7 A;  4ZC3 A;  4NXY A;  5LRJ A;  1YG2 A;  3SJM A;  4TNU A;  2EWB A;  1XEB A;  4RUH A;  1TWC J;  4HX7 A;  5ICG A;  1TQM A;  2HYF A;  3B3C A;  5IY5 H;  1LFP A;  1VQ5 I;  3I71 A;  3DLL F;  4PPZ A;  5K5O A;  2QA4 I;  3K2K A;  4MFJ A;  1EA3 A;  1BBY A;  1QQI A;  1R5I D;  2EQR A;  2G9W A;  5LGU A;  1VHO A;  2LY9 A;  3U9G A;  1Z9U A;  2VOD A;  1GXQ A;  1N75 A;  1F2O A;  4KZT A;  3VWE A;  3I59 B;  2RB7 A;  2E7X A;  3Q0W A;  1RO5 A;  3V38 A;  1BIB A;  3WHC A;  3C7J A;  3NWT A;  4NQW B;  2R7W A;  1XGO A;  3LFU A;  2WPX A;  2O8K A;  3F3X A;  2W25 A;  2BGC A;  1DPU A;  2CJJ A;  1A36 A;  2FSW A;  4XID A;  3FIS A;  2DTZ A;  2EB7 A;  1PUF A;  5FD5 A;  2EZL A;  4ZY1 A;  2ZW7 A;  3PNV A;  4JX4 A;  3FF3 A;  3VDX A;  1DU6 A;  1U8R A;  3N7Z A;  4G1P A;  3HIF A;  1D0Y A;  4IL6 C;  1ZK8 A;  2ZEL A;  1BI1 A;  1SVM A;  2EZH A;  3R0J A;  2IJZ A;  2YX4 A;  4P9F A;  1NE9 A;  2F4I A;  2KRC A;  4KLV A;  1EH7 A;  2A05 A;  5A2Q K;  2REF A;  4IQ4 A;  1FOW A;  3DBR B;  4I01 A;  5D4S A;  3ZN1 A;  2YPR A;  1X3U A;  2PLY A;  5ILS A;  3HZJ A;  3OYJ A;  3RTR A;  3R95 A;  4I0A A;  4CH7 A;  5H86 A;  3V7S A;  4NFR A;  3L2W A;  2P6S A;  1RUO A;  4QUS A;  1U9N A;  3JAM Z;  2XHK A;  3A03 A;  3F8N A;  2R7S A;  3CP2 A;  3P9C A;  4LIV A;  5JVG F;  3QRF F;  2B63 J;  3F8K A;  3FMR A;  5LRG A;  2JSP A;  2RNG A;  5EGO A;  4PXD A;  4B44 A;  2ZXH A;  4HQE A;  4E0A A;  3W2V A;  3RJP A;  4X0G A;  1TKF A;  3RPU D;  4S05 A;  1YX5 A;  3C3W A;  5C3E J;  1P2F A;  2X6Y A;  5F1J A;  4G8X A;  1XG1 A;  2OTL I;  5DS9 A;  2O6G E;  1U5T C;  1G3Y A;  5J8C A;  3NEU A;  4ZDO A;  2RQQ A;  3G1L A;  2PJR B;  1WJE A;  3HDD A;  1Z7U A;  3B3T A;  3JRH A;  2VN2 A;  4RB2 C;  3PO3 J;  3GUX A;  5TIS C;  1BJA A;  1BN5 A;  4OID A;  4C2M J;  1R22 A;  3PFY A;  1FZP B;  1LUJ B;  5IPA A;  2G7U A;  5FRO A;  2KZG A;  2I79 A;  3AAF A;  2WAE A;  4BE0 A;  1I21 A;  1JWQ A;  2R7U A;  1QHG A;  2QLZ A;  5EMI A;  3VB2 A;  2XVC A;  2NXN B;  3L2C A;  1TBX A;  3UNG C;  2QCO A;  2OA4 A;  4OC4 A;  1OCC H;  4M3G A;  4Y15 A;  4DYQ A;  1YW9 A;  5ICE A;  2DMQ A;  4Q48 A;  3VFZ A;  3ABU A;  3ZR8 X;  3BG6 A;  3OWT A;  2Q04 A;  3K9T A;  2QVP A;  2FE7 A;  4KOW A;  1I6H J;  1Z1D A;  2GFQ A;  4PDK A;  3KEY A;  2L4A A;  2HZT A;  4E4H A;  1EJ9 A;  1JUP A;  2DFI A;  3CCU I;  3G8W A;  4EWT A;  2O28 A;  1DGR M;  4EJT A;  3SJE A;  5D8N A;  4WWC A;  3PB6 X;  2W85 A;  4EQQ A;  4YFX F;  3JSO A;  1KQ0 A;  5CJ9 A;  1W36 C;  1KUX A;  3J7Z I;  3JTK A;  2GLO A;  4BS9 A;  4FX4 A;  1BW5 A;  5J8F A;  3TE4 A;  3WT4 A;  2Z33 A;  4A3K J;  1Z8X A;  2EA2 A;  1IXR C;  3E97 A;  2CUF A;  5J47 A;  4ENJ A;  1LFU P;  1LPQ A;  1WFX A;  2H8W A;  3CLQ A;  1MMN A;  4UV9 A;  2CO5 A;  3PM1 A;  4YFN F;  3S9M A;  5HOD A;  1YW4 A;  1RR8 C;  2F5D A;  4C7H A;  1Z7L A;  4QB9 A;  3B8G A;  1Z3Y A;  1VGY A;  3K1N A;  4BE2 A;  2KT0 A;  2E7W A;  3C18 A;  1BI0 A;  3MVP A;  4II9 A;  1QZZ A;  2JDC A;  1YRN A;  3IH3 A;  4HSR A;  2Z3N A;  4ABZ A;  4A30 A;  2P7C B;  1ODD A;  1IC8 A;  1FT7 A;  5FD6 A;  3RQ4 A;  2WY7 Q;  1FYM A;  5THW A;  4LG0 B;  2J8M A;  1MDM A;  4UEE A;  2YU3 A;  3CC4 I;  4NJQ A;  2K86 A;  2PI0 A;  2IBD A;  3F72 A;  1FMW A;  1A2Z A;  4JD6 A;  1CM0 A;  2HTJ A;  2FS5 A;  1ZR4 A;  5HVH A;  3TKY A;  4E7J A;  2L7Z A;  1FP1 D;  3A0B C;  4LOC A;  2XB0 X;  1QGP A;  1A04 A;  2R7D A;  3RYR A;  4C3J J;  3K70 C;  4V19 K;  4U9Y A;  1ETV A;  4OIW A;  2ZNY A;  4NNJ A;  2HOE A;  1OR7 C;  1A6Q A;  4HPS A;  4Q7A A;  1YVK A;  2ZJR F;  4U7D A;  2DBB A;  4ZTJ A;  2CU7 A;  4HNT A;  2XEI A;  4HF2 A;  5F08 A;  1Y1W J;  3R9G A;  4C2Y A;  3FZV A;  4I09 A;  1JT6 A;  4N9I A;  4L0Z B;  2FSR A;  5FKO A;  2QWW A;  4FAS D;  1RC9 A;  3AL0 C;  4LK0 F;  4CA0 A;  2DA3 A;  1JT0 A;  1MIJ A;  1NG6 A;  1CP7 A;  1X1D A;  5GP9 A;  1BA5 A;  4DBQ A;  4DJL A;  4ZX8 A;  4CO8 A;  3GBG A;  2EK8 A;  3OYN A;  3KQX A;  2ANP A;  3QAY A;  5GAE J;  4S04 A;  1I50 J;  1T0F A;  3I55 I;  5ICC A;  1X3Z B;  3V8J A;  2LKX A;  3CDL A;  2FJ1 A;  5J4V A;  1TL8 A;  3I4P A;  1YSJ A;  2PSW A;  2R4G A;  1AWC A;  1V55 H;  3D7G A;  2CV2 A;  2EIK H;  4ZI6 A;  2IGM A;  1YE9 A;  7CPA A;  2CRG A;  4BHP A;  3FXO A;  4NGR A;  5IB0 A;  2EIL H;  2ZBK A;  3GF2 A;  1HA8 A;  2YNC A;  1S7N A;  2FA5 A;  3HXL A;  1CG2 A;  3HBL A;  1Z8T A;  4BHB A;  4XN3 A;  3NA6 A;  4FD7 A;  1GHE A;  3FXT A;  4DZP A;  4BH9 A;  4PJM A;  2E1C A;  4BY1 J;  1XMK A;  4D7M A;  1MJ9 A;  1X1P A;  1FYL A;  3DU5 A;  1V4R A;  3CJT B;  3BR1 A;  5L3C A;  3L9F A;  2L7M P;  4IRI A;  2A4N A;  5HVQ C;  1E3H A;  1FPQ A;  2CQK A;  4QTR A;  4E7I A;  1ZGW A;  1MKM A;  1WRJ A;  3G73 A;  4NEX A;  3KCC A;  4OAE A;  5DD4 A;  4BJ6 C;  4HF0 A;  4BYY A;  3NH8 A;  3MCZ A;  3FXQ A;  3CJR B;  2W84 A;  1TWG J;  4BXU A;  1KYW A;  3DKY A;  4XQF A;  3IU2 A;  2KKO A;  2Z1D A;  3K1P A;  3SQN A;  1AKH B;  3DBL B;  2ZME A;  2LR8 A;  4YGO A;  3FB3 A;  4E7H A;  2GRE A;  3S9N A;  5CVU A;  2D4P A;  4AD9 A;  4IRG A;  1S5L C;  2CS3 A;  4BEH B;  4UVC A;  5HNF A;  2NNY A;  1RKW A;  2HOA A;  2XF6 A;  2I10 A;  3NAU A;  2FCK A;  1H89 C;  2BL1 A;  4OC3 A;  3L00 A;  1KQ9 A;  2RNJ A;  3MKY B;  2HDC A;  1UZC A;  2IMO A;  3F8M A;  3TP3 A;  5HS7 A;  4K3N A;  2PJ3 A;  3HRU A;  3DSB A;  3D0S A;  1T8I A;  1MBF A;  1OIS A;  2IGO A;  3LFK A;  3DQV C;  1VQN I;  3P2H A;  1XRY A;  3OYA A;  2XAF A;  3TL4 X;  4NGN A;  1RI7 A;  4P96 A;  2DA4 A;  1F2P A;  1XGN A;  2LK2 A;  3CZ6 A;  4KIF A;  1YJW I;  1H88 C;  4C2Z A;  1LJ9 A;  2LYC A;  2QVO A;  1OJL A;  2KIF A;  2ECC A;  2QBY A;  2DA6 A;  1D8J A;  4FWU A;  4JBA A;  1TWA J;  4R1H A;  2XIG A;  4XSX F;  5FVJ A;  3OS0 A;  3F21 A;  4F0X A;  2P8T A;  3PQJ A;  1AA7 A;  1XSX A;  1I1G A;  2ZNZ A;  3W3C A;  1LNW A;  5D8K B;  4BBR J;  4KIB A;  4MHD A;  1B87 A;  3DCF A;  2ZEF A;  3AG1 H;  4MBU A;  1T38 A;  2PMZ N;  3JCU C;  3PB8 X;  4M85 A;  5KTD A;  4KUB A;  4JOM A;  1RTQ A;  3GKR A;  1LEB A;  4KOY A;  4IHY A;  1H9T A;  3FYN A;  2ODF A;  2FRH A;  3LMM A;  3BPX A;  4LB5 A;  2QQ9 A;  1AU7 A;  2VBZ A;  3RKQ A;  4NHJ A;  1UG0 A;  3D2M A;  4CGP A;  1S29 A;  4B1R A;  5JHF A;  1GVD A;  2PJ4 A;  1Z3X A;  5DUI A;  3BJO A;  4A39 A;  2NOJ B;  4FE4 A;  4NBQ A;  4PJ0 C;  3D67 A;  4GS4 A;  2LDU A;  4YRV A;  3KZW A;  4YEJ A;  2UXX A;  3BJ8 A;  1SMY F;  4EEF G;  2F6C A;  4QVT A;  2V8V A;  2DFH A;  3HOV J;  1V5F A;  3COA C;  4AG9 A;  3ZMS A;  5A2Q Z;  3J7Y J;  3H4Q A;  3V7Z A;  2D4O A;  4ON0 A;  1K61 A;  3F8B A;  3KL9 A;  2PMH A;  1PYV A;  1R7J A;  3T0Y A;  3RIR A;  2IS4 A;  3D4U A;  3I53 A;  5JVT A;  1G3T A;  1R4M B;  4H6Z A;  4CYO A;  3GLL A;  5GPC A;  4CYP A;  2A5Y B;  2WC2 A;  5FKK A;  3TC8 A;  3BR2 A;  1HC8 A;  1OCP A;  2GM4 A;  3PFI A;  4C68 A;  1SD4 A;  4BQO A;  3IV5 A;  2PJ8 A;  3QP6 A;  4X1E A;  3P5J A;  4RMN A;  4HBL A;  5FGM A;  3A2K A;  5DM7 F;  2VQC A;  4KNY A;  4IHV A;  2DU9 A;  1YTY A;  1IRF A;  4BE1 A;  3R9F A;  2VPR A;  2ZSI B;  5EG0 B;  4XR6 A;  2IAI A;  5CKT A;  3S1R J;  3HGY A;  3QOD A;  3I3G A;  1R57 A;  2NVY J;  3KKW A;  3FIW A;  2IRF G;  2XAS A;  3FEE A;  4UVA A;  5K7Z A;  1M4L A;  2PJ7 A;  3MFK A;  5IT9 K;  2ATR A;  1VF9 A;  3V7C A;  2WTE A;  3WTY C;  4NGT A;  2AO9 A;  4BU2 A;  1YIO A;  3D1N I;  1BPM A;  4UB8 C;  1S7L A;  3NRV A;  4R87 A;  1YGH A;  3OYK A;  1MK4 A;  5I0C A;  3KR4 A;  4HQM A;  2QSG X;  1JUS A;  1U8B A;  2DFF A;  1OCO H;  3M8E A;  3KE2 A;  2AXL A;  2ECB A;  3CUO A;  3CUQ C;  4KMU X;  4HKF A;  5KTC A;  1M4I A;  3J7A Y;  3FWE A;  3C2B A;  1PP8 F;  1CP6 A;  3IEH A;  2OZH A;  3WC6 A;  1B9N A;  2X1E A;  4L9T A;  3MZH A;  3GLJ A;  3K2Z A;  2Z10 A;  3S1N J;  1ZO0 A;  1FOX A;  1EF4 A;  1Q7L A;  4A95 A;  4WXH A;  3CC7 I;  2WB1 N;  3RKX A;  4XON A;  2DT5 A;  2NS0 A;  2CQX A;  5JFR A;  3DKW A;  4LJZ F;  2KRF A;  2OUM A;  3KET A;  2DW4 A;  3OL4 A;  4LQ6 A;  2KL4 A;  1ONV A;  5LRS A;  3DR6 A;  4HX8 A;  1K6Y A;  3O8H A;  3H1C A;  1B8I B;  2QJ8 A;  2KJC A;  3KLO A;  3ZP5 A;  2HVS A;  2ZOG A;  1MZB A;  4ESB A;  3H5A A;  2GOX B;  4XNF A;  2FIA A;  1QRY A;  3E6D A;  5F64 A;  2ZJP F;  4OKO A;  4I76 A;  5IB9 A;  2DK5 A;  1R00 A;  2HR3 A;  1SEU A;  3ASO H;  2JWT A;  1IY7 A;  3PSI A;  4RB0 A;  3NFZ A;  5LYF A;  2FBH A;  2X1D A;  3W6S A;  1VND A;  1GYT A;  2BY1 A;  1CBX A;  4NSQ A;  4QBJ A;  3IKT A;  2F5C A;  1YO5 C;  4HF1 A;  1XGS A;  3BR3 A;  1DTD A;  4MFZ A;  5KCM A;  4IHX A;  2XPU A;  5F0F A;  3CD6 I;  4C3I J;  3BI0 A;  2STT A;  3GZN B;  3TO9 A;  4KT6 A;  1ON1 A;  2X4H A;  4XLN F;  2MH9 A;  2Y30 A;  2KFD A;  3HSR A;  1TW2 A;  4KVM E;  2E60 A;  5E8I A;  4ORF A;  2D1H A;  2PC1 A;  4JYW A;  1M1E B;  3IP4 B;  1FSE A;  2NAZ A;  1JJ8 C;  2ZJQ F;  1TNT A;  5HLH A;  4G7H F;  3IGR A;  3OYL A;  1HXD A;  1D1B A;  4XMY A;  2O03 A;  4A6E A;  4DYR A;  1DDN A;  2EBI A;  3FXJ A;  5DTD A;  4WF2 A;  2X6O A;  3PZJ A;  1D5Y A;  1USS A;  3HUG A;  5LYD A;  4M9Z A;  3LNQ A;  1W4M A;  2WUU A;  2DT7 B;  5DCM A;  3B7I A;  8CPA A;  2MH2 A;  3G1O A;  1UEL B;  1ZLK A;  5GCN A;  3PGP A;  1QBJ A;  3DPU A;  5D5V B;  1IGN A;  2R8V A;  1KQ8 A;  1AMP A;  3D3S A;  1W5C C;  1MSE C;  2VOO A;  4X5K A;  4Q38 A;  1UMQ A;  3FBN B;  2ZSH B;  2OQG A;  5LYL A;  4B10 A;  2BHZ A;  4D1Q A;  2LMD A;  3OWC A;  4A69 C;  4PSW A;  4LGW A;  4CCL A;  2KP6 A;  2Y2Z A;  2PIY A;  4P9U A;  4IHM A;  5FKN A;  1I6X A;  1QNT A;  1PUF B;  4BDY A;  2V26 A;  2Q2E A;  1MD0 A;  5J4Y A;  1WQ2 A;  4UUS B;  3JRE A;  4GRI A;  2BE5 F;  4KYW A;  3S3N A;  3HGG A;  3C26 A;  5JI6 A;  1RZ4 A;  3ELK A;  4MRI A;  1MGT A;  3W2W A;  3ISX A;  5IYD J;  3GY9 A;  2COM A;  2MFZ A;  4CCJ A;  3BR5 A;  5DM6 F;  1PJR A;  3N97 A;  1CF7 A;  3VWB A;  2XRL A;  2QF7 A;  3K7A J;  2R7T A;  1HST A;  4FQG A;  2KHM A;  2L02 A;  3RKY A;  3MRU A;  1STZ A;  2HUZ A;  4H89 A;  1YS6 A;  2DFE A;  5BPI A;  1Y39 A;  2VBX A;  4ZY2 A;  2COB A;  3RYO A;  3GYA A;  2CH0 A;  2M7A A;  4CAE A;  3DP7 A;  3GFL A;  4XM3 A;  5EZG A;  5F09 A;  1TLH B;  3MN2 A;  1TIQ A;  3S9L A;  1S5K A;  5EGO B;  5DUK A;  2PCU A;  2M30 A;  6CPA A;  3MN8 A;  1FOK A;  2PJB A;  1LFW A;  5K5Q A;  2XGE A;  3CES A;  4ITV A;  4AXV A;  2XGX A;  1LRZ A;  3C2H A;  3K69 A;  2VC0 A;  1XSD A;  3H3Z A;  1F1Z A;  4B12 A;  1Y1V J;  4B14 A;  2CNT A;  1DE4 C;  1BI3 A;  1POG A;  3QPL A;  2ESH A;  1IJW C;  5LHI A;  3B3W A;  5A27 A;  2JZY A;  1ARM A;  2PMZ A;  1VFC A;  3TX8 A;  5HXD A;  3DV8 A;  1O7L A;  1HKT A;  1DU0 A;  3QAH A;  2OPT A;  5K5R A;  3NH5 A;  5HS8 A;  4NJR A;  1XC5 A;  2OZG A;  2HVQ A;  3TDU C;  3ZQH A;  3SI2 A;  2W57 A;  3HOW J;  1Q2Y A;  2CNM A;  5I4M A;  4G6D A;  3ZQQ A;  5F0H A;  3WU2 C;  2V9V A;  1UHW A;  1FY7 A;  4L5E A;  1SD6 A;  2OAZ A;  3QNV A;  4OIO F;  3CCS I;  2V8D A;  4F9V A;  4KOU A;  4H2K A;  2R1I A;  3TOA A;  3O2P E;  3E5U A;  1MMG A;  4BQN A;  2VBY A;  4F55 A;  1VQM I;  4HRI A;  4RGX A;  3IKV A;  4ENM A;  3DGV A;  3MKW B;  4UY8 I;  2K5T A;  4R3K A;  2KCW A;  4HLY A;  1ZLI A;  2VBQ A;  1ETQ A;  1X19 A;  3TED A;  2UV1 A;  4OME A;  1YS7 A;  4HEA 2;  5F47 A;  4LD5 A;  3BP8 A;  4MY0 A;  2PEX A;  2A6H F;  2VOP A;  3LWU A;  3BQZ A;  5FKM A;  3NE8 A;  5LGN A;  2XPW A;  2CW7 A;  4MGR A;  3F23 A;  4Q5S F;  4MI4 A;  3GWZ A;  3S8P A;  2VXK A;  3ONQ A;  3PP9 A;  1YRN B;  1IRZ A;  1LDK B;  1B72 A;  4NC6 A;  3GUD A;  2JTV A;  3FF5 A;  4C9Y A;  2E1N A;  1XMA A;  2FNA A;  2OH1 A;  5LHH A;  3BCA A;  3KP5 A;  2BOL A;  1K4J A;  2EA4 A;  5CVR A;  3PJR A;  2CW0 F;  1E17 A;  2X6X A;  1WI3 A;  1JHF A;  4I2O A;  3L2V A;  2M8E A;  3Q9V A;  4KT5 C;  2LLK A;  4PUS A;  3B3V A;  2PJC A;  2IQ6 A;  2WYR A;  1PUA A;  2X9D A;  1TT0 A;  2HOS A;  3H9Q A;  3CLO A;  3FXL A;  3ZQI A;  4IXA A;  3TT2 A;  4XBF A;  4FD5 A;  4AIH A;  3RCO A;  2HV2 A;  3H36 A;  1QQ9 A;  3HOS A;  4XLA A;  2AFM A;  4GFB A;  2DA7 A;  2L9R A;  2Q4Z A;  5D6F A;  3M9A A;  3L2R A;  3HKZ N;  4B5P A;  3WGG A;  5KHD A;  3HPG A;  2BVL A;  4XNH B;  4QLC U;  1BPN A;  5DS0 A;  2IA1 A;  3DLA A;  1NMT A;  2DPD A;  3SYT A;  3OYH A;  2OC6 A;  2WB1 A;  2NS8 A;  2QM3 A;  1TQI A;  2GLJ A;  1AOY A;  3FHZ A;  1FP2 A;  1OYY A;  3LST A;  4HV6 A;  1TC3 C;  3WGI A;  2RN7 A;  3OS1 A;  3SZP A;  1LB2 A;  4XK4 A;  4FTH A;  1NH3 A;  2PJP A;  4KIC A;  2PE3 A;  1VQL I;  4M74 A;  5DDG A;  3IO1 A;  4ZY0 A;  4BMH A;  4GYI A;  4FD4 A;  2K02 A;  1T08 B;  4CRZ B;  4L8A A;  3M3Y J;  1ETK A;  2R3S A;  2RAE A;  4AVC A;  2HDW A;  4M6I A;  3EYI A;  4MCR A;  3L09 A;  3WTS C;  3RSN A;  4AVA A;  3B35 A;  2KZV A;  2I3C A;  3WAB A;  4ETS A;  4AVB A;  2BW3 A;  2FQ4 A;  4OP4 A;  4CDG A;  2PIZ A;  2ZB9 A;  5TRD A;  2EV6 A;  4PXC A;  2PJ2 A;  2QZ8 A;  5ICF A;  2CV0 A;  2KIQ A;  5CYV A;  3ZMV A;  2HQ5 A;  5C4J J;  3GX4 X;  1X4O A;  1U9O A;  2V1D A;  4XOP A;  3BLN A;  2EFN A;  2B58 A;  1I39 A;  1PVE A;  5L3F A;  3JTH A;  2E2H J;  4IX7 A;  4A38 A;  4HW0 A;  3W2A A;  1RXT A;  1Z4R A;  2XAU A;  3JUW A;  5CPR B;  3BR6 A;  2VKV A;  5B66 C;  3T5X A;  4D5F A;  4CGZ A;  5DCF A;  3M8F A;  3ERE D;  4IHT A;  2REE A;  5IX3 A;  5JGF A;  3PUF A;  4DGW B;  2ZME B;  2ZEN A;  3LMS A;  1SD7 A;  2RKH A;  3TW7 A;  3FXU A;  3LOC A;  4GCV A;  3CQZ J;  2JVG A;  1Z77 A;  4DYC A;  4JQF A;  4HNU A;  1VQ8 I;  1LE8 A;  1FC3 A;  2VI7 A;  4PZJ A;  4EGY A;  4DNC A;  5B1B H;  2W4S A;  3GTM J;  3I5U A;  4O5V A;  1G2H A;  3L2N A;  5JM6 A;  2K7L A;  1IU8 A;  4KS9 A;  5KVR A;  2FQ3 A;  3LSH A;  3VYS B;  5ED4 A;  1EV7 A;  3E6B A;  1U5T A;  2WAQ N;  1HQC A;  2W48 A;  3ECH A;  3FX3 A;  4G9Y A;  4Z2Y A;  4F91 B;  5E3O A;  4A3F J;  1H8L A;  1X2N A;  1ZGJ A;  2AFS A;  3KLN A;  4X3R A;  3LA7 A;  2HFH A;  1YOV B;  3QPT A;  4M6Y A;  1FYK A;  4NF1 A;  3SJG A;  1P7I A;  1IN5 A;  1BR2 A;  3K0L A;  1JTX A;  2UUZ A;  1KZH A;  2WBM A;  3EUH A;  4AU7 A;  2EK9 A;  1Z67 A;  4KA4 A;  2K4B A;  3UY5 A;  2OBP A;  4ZH4 F;  1QSR A;  2PBI A;  5TGT A;  5K8P A;  2QBY B;  2DCE A;  1XFO A;  1B59 A;  1T56 A;  3IWE A;  2FF4 A;  3KHX A;  2LF8 A;  1G4D A;  1X1B A;  2K5C A;  4DW6 A;  4MCQ A;  1YRE A;  1WJF A;  4TV7 A;  3T8R A;  2DXI A;  4BD9 A;  2VLA A;  4KVO E;  2A6T A;  1V0C A;  4I02 A;  2DEA A;  4BHC A;  4I99 C;  1I1D A;  2E1M B;  3P9K A;  3MZY A;  3KZI C;  2O5R A;  4ZYA A;  3KAS A;  1BW6 A;  3OR2 C;  3CT9 A;  3R9E A;  2DJI A;  4I0B A;  1YQA A;  2B9S A;  3DTI A;  3L2Q A;  1GXP A;  4F6A A;  3H9G A;  4KN4 X;  1TZL A;  1BC7 C;  1HDQ A;  5B1A H;  3A9L A;  1KON A;  4KOS A;  5J1Q A;  5GPA A;  3TCV A;  4O6J A;  4MIM A;  2VXZ A;  3IUO A;  2L7K A;  4EJU A;  3U21 A;  2F4O B;  1QSO A;  4MJ8 A;  2I8D A;  1D8K A;  3A01 B;  3VAT A;  5H2F C;  3U1D A;  2F4M B;  2Y9Z A;  2B4D A;  4PQA A;  4DUK A;  5J3L A;  4ZYD A;  4F8Z A;  1I27 A;  4JJX A;  1GT0 C;  2Q44 A;  3E3V A;  2DDB A;  1P0H A;  1XMB A;  1I3Q J;  1AUG A;  3V4G A;  2XRN A;  3Q5F A;  3AG2 H;  4RM2 A;  2Z0Z A;  2JT1 A;  2CNS A;  2Q7S A;  2CQN A;  2CUZ A;  3JRD A;  1IN7 A;  1O7F A;  2HGC A;  3LWF A;  5AIP A;  2KJB A;  4HDU A;  2Z9O A;  4XPL A;  1X12 A;  2KIS A;  2DOF A;  4M72 A;  4KUA A;  5DD8 A;  2HPM A;  1Q2C A;  2R0Q C;  1VQP I;  4PFO A;  1YK3 A;  1XDU A;  1ON0 A;  4A3D J;  3KQZ A;  1HSJ A;  4C2T A;  3JRF A;  2VZY A;  1WPK A;  1YJN I;  3JVN A;  4NGQ A;  2BSW A;  5D4R A;  1R23 A;  4PK2 A;  2CMP A;  3LAP A;  1I1S A;  5A28 A;  1OMI A;  2G0E A;  5FB2 A;  2CUJ A;  4L9V A;  1YLO A;  2ZW6 A;  4MCP A;  1XIX A;  2P6F A;  1S3J A;  5LEK A;  1YW7 A;  3PO2 J;  3M1E A;  5AON A;  2Q4V A;  3JRB A;  1U3E M;  4FCY A;  3T8T A;  3QYE A;  2F5V A;  3FBI B;  4NC7 A;  3V8K A;  1IGB A;  1BR4 A;  2IW5 A;  3UKG A;  2ZXJ A;  4OMZ A;  2K3F A;  1C0W A;  3OYF A;  3GTQ J;  2FBI A;  2VKD A;  3CCV I;  2LH9 A;  4UUT A;  4AG7 A;  2ELH A;  2E5Z A;  2K40 A;  2BXY A;  5FJ8 J;  1SVO A;  3VPR A;  4U87 A;  2VB6 A;  1IUY A;  2HEO A;  5BWA B;  4EV0 A;  4B4C A;  5ELY A;  4PXB A;  4UHT A;  2IS1 A;  3I9V 2;  3P7N A;  1MBE A;  2BVM A;  5FLX K;  4UCN A;  5HDK A;  1G59 A;  4MXU A;  1Q1H A;  2F5F A;  3S32 A;  4KFC A;  3L2U A;  2FL4 A;  4JP0 A;  4NUB A;  4RGU A;  5AG4 A;  1Z0X A;  3GTP J;  4YIR X;  1FOY A;  3RI4 A;  2VQG A;  2IS2 A;  2LC2 A;  5BOX A;  4QSH A;  3ZGK A;  3LSP A;  4IQJ A;  2K4J A;  3PRT A;  2WPW A;  2Z11 A;  3QWL A;  1MMA A;  3IRQ A;  1RR7 A;  4R3L A;  4HYE A;  3W6X A;  2FXA A;  4UNO A;  5LGT A;  3VSL A;  4BL0 B;  3CME I;  2QYO A;  3BHX A;  3HKZ A;  2IA2 A;  2GIV A;  1DP7 P;  3I54 A;  4HV5 A;  4GYG A;  1VQK I;  1LCP A;  4MHZ A;  5E3M A;  2EIJ H;  4P10 A;  1HKS A;  2ELK A;  5L3G A;  2M8G X;  3W6K B;  2NS7 A;  2GIZ A;  4O23 A;  3R61 A;  4KSA A;  2PN6 A;  2XSJ C;  3B6C A;  2X1C A;  1ZG3 A;  4MFD A;  4U0W A;  2O7O A;  5J1Y A;  2X51 A;  3FJU A;  4K30 A;  2JDD A;  5CPA A;  4O3M A;  1IF1 A;  2FU4 A;  3K4K A;  1IW7 F;  2RQP A;  3AG3 H;  4ZYH A;  2DO7 A;  5CBM A;  3LSM A;  2VI6 A;  1R58 A;  4B09 A;  4WWV A;  1FTZ A;  1CX8 A;  1BL0 A;  3EC4 A;  5EDN A;  5FLM J;  3IFE A;  3U1K A;  3ROU A;  3S2D J;  4FET A;  1IYK A;  3JR9 A;  1MMS A;  3V42 A;  4XNH C;  3F9K A;  2QQ8 A;  4MQV A;  2GAN A;  1R5G A;  1WWX A;  1FIA A;  4IRH A;  4Q47 A;  1TKH A;  2IA0 A;  2EFW A;  3E5Q A;  2Y0M A;  5DCM B;  3H5Z A;  1BOA A;  3TQN A;  3F5B A;  5KAF C;  4P4E A;  3OV8 A;  1DGW Y;  3CCY A;  3BZK A;  2XV4 S;  3M1C A;  2LSO A;  4CYQ A;  2V79 A;  4OWR B;  2MC3 A;  2HQA A;  2BY3 A;  3SDG A;  1HBX G;  4KSF A;  1TF9 A;  1KYZ A;  3J80 K;  3IH4 A;  3QOE A;  3Q9S A;  4ASN A;  1GDT A;  3MKL A;  1F9N A;  1SFU A;  1YVO A;  1ZKG A;  2MLK A;  4B3X A;  2X48 A;  5JR3 A;  3ABK H;  2L5Q A;  1A35 A;  3DNS A;  4AUX A;  1MBG A;  2Q2E B;  4MNU A;  3HLP A;  2XDV A;  2X7B A;  5EBV A;  3WU1 B;  1M4D A;  2VAS A;  4A93 J;  4MFQ A;  4IK2 A;  4FX0 A;  2ZED A;  4XSZ F;  1NSL A;  3NE7 A;  3JRC A;  3FK6 A;  5C88 A;  1IDZ A;  2HB6 A;  4Y52 J;  1CF7 B;  1IOI A;  2NRA C;  3ECO A;  2KMU A;  4EM0 B;  3ZMT A;  4XLC A;  1S9H A;  2KLO A;  3DTE A;  2V9K A;  1ORK A;  4RAY A;  3PFO A;  2H8R A;  2XEJ A;  4Q36 A;  3EET A;  1Y8Q B;  2P5K A;  2WAQ A;  4A32 A;  2VJJ A;  2ZEO A;  4BAY A;  1R43 A;  2LRD A;  3WTU C;  5D5X B;  2P81 A;  4XKB A;  3SXN A;  5ERI A;  3PL8 A;  3BDD A;  2ABZ A;  3N5F A;  2EVN A;  1SAN A;  2MYS A;  2P4W A;  3ZN0 A;  3HOT A;  2V1N A;  1A5J A;  2ZME C;  4I98 B;  1D1C A;  2FT0 A;  1B1B A;  1QZY A;  4DIQ A;  2L3D A;  1R1V A;  4A2Z A;  3BG3 A;  2Z3M A;  2RC4 A;  3GTO J;  4V2F A;  3ZCO A;  1IXS B;  1IZ1 A;  1X1A A;  2JLM A;  4G12 A;  4IHS A;  5FLV A;  2E2I J;  3CF2 A;  3HYI A;  2F5I A;  5LRK A;  3I4M J;  2DT6 A;  4PJL A;  1TW3 A;  1FWZ A;  1F36 A;  5HLI A;  3CO7 C;  1CQT A;  1Y7R A;  1XF8 A;  2CG4 A;  2HKX A;  3LSK A;  4CSW A;  3FMQ A;  4J19 A;  4ONW A;  4OIR F;  4RGS A;  4D9J A;  2W7N A;  2EPF A;  5JLW A;  1WSU A;  3GTK J;  4IF5 A;  2EZK A;  4PCQ A;  3N4M A;  1P4X A;  2NMT A;  4FBE A;  4XRF A;  1ZG5 A;  2EH3 A;  2TCT A;  1VHE A;  3AG4 H;  1V54 H;  2VL8 A;  2GZW A;  2DMT A;  2STW A;  3RZO J;  4MHN A;  5HVF A;  1D3Y A;  1ZGA A;  2WV0 A;  2O3F A;  5C4X J;  3CCL I;  4M3F A;  4MHP A;  1JKQ C;  2P6G A;  4EAT A;  3PIO F;  3FK7 A;  4KOV A;  3EYY A;  3TO6 A;  5E1X A;  5CQG A;  3QPS A;  2A07 F;  4LQG A;  3C2G A;  1LVA A;  1VIX A;  2MC4 A;  3B3S A;  4MTE A;  3KR5 A;  3EQL F;  4XKC A;  2K9L A;  3CUQ A;  1K78 A;  3CXS A;  3B02 A;  3TW6 A;  2F5E A;  3F8C A;  1Q2D A;  2PJ5 A;  2EV0 A;  2L54 A;  2GQQ A;  1R1U A;  3SFZ A;  5LFA A;  4R9M A;  4U5Y A;  4UIB A;  2DMN A;  4MHG A;  2R98 A;  1F5T A;  1CPS A;  2V4J C;  1ZYR F;  4RA2 A;  3CC2 I;  1ELL P;  3CMY A;  2NOG A;  2DI3 A;  5D8L B;  4B5O A;  1B72 B;  3SHP A;  1R71 A;  5AG7 A;  1Y0R A;  3S6H A;  5G20 A;  2IP2 A;  3K4C A;  4RB3 C;  2Q7B A;  1P9Q C;  3SEQ A;  5IP7 J;  4DZJ A;  4UFX A;  4F52 A;  2V8G A;  5CQE A;  1WH5 A;  3OR1 C;  3ZOB A;  1K7A A;  4OC1 A;  3OS2 A;  4MEX F;  1YLE A;  5G22 A;  3D5R C;  3O8G A;  2IT0 A;  1Y7E A;  1SFE A;  2ZFU A;  4G6T B;  5HLT A;  2ZEG A;  3I9S A;  3U2R A;  3OYI A;  3BC8 A;  2B7E A;  2MLG A;  2QEC A;  4P4B A;  3OL3 A;  1DQU A;  1U6M A;  2HXI A;  3IC7 A;  4ZGY B;  3PFE A;  1P6R A;  4A3E J;  4K2E A;  5HDG A;  1HW2 A;  3GO5 A;  2GXB A;  1TNS A;  2W1O A;  3VYT B;  1BI2 A;  3RO0 A;  2XEG A;  3LAJ A;  1XPX A;  1ZLJ A;  2CF4 A;  1GV2 A;  2Y0S N;  5EEH A;  2NYQ A;  4B5P B;  4B47 A;  3WG9 A;  2DYS H;  2FML A;  3OOU A;  2F7V A;  4WXC A;  4E7S A;  4EFD A;  1W7P A;  4Y3O A;  2C6C A;  2XPV A;  2AQE A;  2HC9 A;  4UWJ A;  1ON2 A;  4WX9 A;  1B6B A;  4N0B A;  1W1W E;  5IP9 J;  3LSR A;  5HMN A;  4KSI A;  3TGN A;  3O6B B;  2ZOF A;  5GTI C;  2MD0 A;  1VQ9 I;  2KIM A;  2V6C A;  1QO0 D;  4EM2 A;  4S0H B;  4A3J J;  3D8P A;  2JPB A;  3DTK A;  3D7D A;  2NVQ J;  3GIU A;  1XCB A;  4XL9 A;  3S17 J;  3DBH B;  2FMY A;  2UZK A;  3OYC A;  2AFO A;  4YEL A;  4H0E A;  2GOM A;  3TDZ C;  5JQ4 A;  1FMV A;  4LLL A;  2Z3P A;  1E3P A;  3BQY A;  3HRM A;  3KP7 A;  5FLX Z;  3DXJ F;  4YWY A;  1O4X A;  1Y6I A;  2VT3 A;  4H6U A;  3EDP A;  2R5Z A;  2BW3 B;  4HG2 A;  5F1R A;  1IRG A;  1NK3 P;  2HOT A;  2BO9 A;  1RPW A;  1Z6R A;  2JPC A;  1SFX A;  4QWQ A;  2CIJ A;  2PR8 A;  3LSJ A;  2EJR A;  1WJC A;  4IEJ A;  2H1K A;  5J6X A;  2N8G A;  3JSP A;  5F48 A;  4AIJ A;  5JHU A;  2LTP A;  3HJE A;  3H8F A;  3S2W A;  2PJ0 A;  1OKR A;  1E2X A;  1REP C;  1R1T A;  2G7H A;  2HNH A;  3NQO A;  1OQY A;  2JUG A;  5EJC A;  5J40 A;  1FLI A;  4E6K G;  3REO A;  2LF7 A;  3IU1 A;  3LD2 A;  3CCE I;  3QYB A;  1ETY A;  3Q0V A;  2C6G A;  5LYI A;  2G3T A;  3A1Y A;  2QSF X;  3WHB A;  1Z9C A;  4ZZL A;  1ZG7 A;  2K9M A;  3S16 J;  3W6J B;  1MH4 A;  4FD6 A;  2BUE A;  2VQY A;  2HZD A;  1K79 A;  1LE8 B;  3S15 J;  4PK4 A;  4M6G A;  2EFO A;  2IS6 A;  4P44 A;  3BTC A;  1L3L A;  3G1M A;  4JLY A;  3I3L A;  3ZRG A;  2P5V A;  4YIF A;  6PAX A;  3KYD B;  3I0T A;  4UUV A;  4RBO A;  4KOX A;  4IO9 F;  2AFX A;  4HDV A;  4CYN A;  2OCC H;  3LA2 A;  1U5T B;  1J4J A;  4LIU A;  4MQ9 F;  2JA6 J;  3BG5 A;  2ZEP A;  1MJB A;  3IWZ A;  4BDZ A;  4LIT A;  3RZD J;  1H9G A;  1BM9 A;  5L3E A;  3O3K A;  4E8O A;  3FNC A;  4LUA A;  2K27 A;  2PR1 A;  4JX5 A;  5C44 J;  4LX9 A;  1LEA A;  2VEZ A;  1W5S A;  1PUE E;  1RET A;  2R7O A;  1XE4 A;  2B3V A;  5BQT A;  3DPT A;  1M1D A;  4Y17 A;  3PBE A;  3JRA A;  3HL2 A;  3S93 A;  3CMM A;  3FMS A;  3IHU A;  3TOB A;  3E5X A;  2AE6 A;  2EUI A;  4C2U A;  4L5J A;  4CGL A;  3S1Q J;  2WY8 Q;  2YX7 A;  3ESW B;  2HPI A;  2HXO A;  4RS8 A;  4UIA A;  3BXM A;  4JK1 X;  3CDX A;  3FVL A;  4G7Z F;  5HH1 A;  2Z99 A;  2CWE A;  2ETH A;  4N4N B;  1R6R A;  5H20 A;  3J80 Z;  3HB9 A;  4CCO A;  1RIO H;  1JXS A;  2B3U A;  5DEQ A;  2WZN A;  1IIC A;  1XB4 A;  4L9N A;  4P5O A;  3JRU A;  1OCT C;  1HW1 A;  1TF8 A;  1SD5 A;  4X2T A;  2YU9 J;  4XN0 A;  2FIW A;  3LOD A;  3B2Y A;  3D2P A;  4CAX A;  3BLY A;  2HQN A;  1X3W B;  2MD5 A;  1RES A;  1O3R A;  2AJ6 A;  1IYL A;  1KU2 A;  5E79 C;  4XKW A;  3PSF A;  2E1O A;  1ERD A;  3RPU A;  1SQH A;  1LDJ A;  3DWL E;  2LVS A;  2ZFW A;  3BWG A;  3DF8 A;  4HOB A;  4EVI A;  3JRG A;  3MD2 A;  2EBJ A;  3MAJ A;  1Y9W A;  2A6E F;  2ID3 A;  2Q51 A;  2F8H A;  4GGG A;  2PG4 A;  3IJ3 A;  3KI9 A;  1BJZ A;  4XPD B;  2L9S A;  5LLQ A;  1F4K A;  2JBJ A;  4BAC A;  2IL4 A;  4YRH A;  3LSI A;  4BJT A;  2M5W A;  2QKL B;  3KP6 A;  1FSH A;  2KRH A;  4ZYQ A;  4KVX A;  3J81 K;  1ETO A;  1GHC A;  2EFP A;  1W5T A;  3CDI A;  4AID A;  2ACJ A;  2HQR A;  4XLE A;  1KUY A;  4G94 A;  5G21 A;  3IAS 2;  4ZYG A;  4IVN A;  5DYM A;  1R4N B;  9ANT A;  2ID6 A;  2L0K A;  1XN7 A;  3ABL H;  4HPQ A;  1UWY A;  1X58 A;  4E7Z A;  4A3M J;  2V7F A;  4P45 A;  1MJA A;  1K4T A;  1NTC A;  4DBR A;  2D1V A;  3ISZ A;  2Z5U A;  2E2J J;  1VQ6 I;  2OZU A;  3CXP A;  2KQR A;  1Y8R B;  1L0C A;  1UFM A;  4A31 A;  1MDM B;  2MW8 A;  4RAF A;  5DV5 A;  4MTD A;  1YI2 I;  5AIQ A;  2V1U A;  4XOR A;  4XKV A;  1ZG9 A;  2BYV E;  3AL0 B;  4XLP F;  1UFH A;  1VKC A;  2PX9 A;  4JZ0 A;  4YFK F;  2AFU A;  1FEX A;  1J5Y A;  1DP3 A;  1LQ1 A;  4KJZ A;  5TJJ A;  2OQR A;  4BUP A;  3MGD A;  5K7H A;  3ABT A;  4IHW A;  2R7X A;  3GFJ A;  4HZF A;  1NK2 P;  3S6K A;  2LBF A;  2VJ4 A;  2FNP A;  3K4J A;  1RRJ A;  5IOZ A;  3CXQ A;  1ZRC A;  3E0J B;  2E35 A;  1PDN C;  2Z3L A;  1GUU A;  2DF5 A;  1EH8 A;  3KFW X;  1MBH A;  3R1K A;  4FHT A;  4KUM A;  2XF7 A;  2P5L C;  1Z8W A;  2MBF A;  5KK1 A;  2QSH X;  1X10 A;  4CGN A;  1YLF A;  3WTV C;  2M1B A;  4Y7N J;  5K8M A;  3MMY B;  1WJA A;  2DAO A;  1ZTR A;  4EMS A;  1U78 A;  4UXN A;  2X0L A;  4CGO A;  4FE7 A;  4AVZ A;  1VQO I;  1SVL A;  3KEQ A;  2FVG A;  2ZC2 A;  5BS6 A;  2L9V A;  2IVM A;  3FKJ A;  2EFQ A;  1B8I A;  5FRN A;  5E1Z B;  2R93 J;  2Y0S A;  2ADU A;  4WJB A;  2R7H A;  3EUK L;  2F2E A;  1PP7 U;  2DJN A;  4Y4R A;  2IGK A;  4J00 A;  1ZEL A;  1UG2 A;  1QPI A;  1Z91 A;  1S6L A;  1LOK A;  4MMO A;  2DMU A;  4CGM A;  2LD5 A;  4CCM A;  3DKX A;  2BCO A;  5J1U A;  3B73 A;  4HNX B;  2R5Y A;  2R92 J;  2H5M A;  3ZJ0 A;  1BO4 A;  1JTY A;  2GBY A;  2M34 A;  4EJW A;  1MNM C;  3OYB A;  2H6C A;  4W9Y A;  1P7J A;  3SXY A;  4RLQ A;  4AYB N;  4RLF A;  1X2M A;  1YIT I;  5HS9 A;  4I49 A;  2A69 F;  4ZDL A;  3PB4 X;  3HOY J;  4KOR A;  2XAJ A;  2VQL A;  1IN8 A;  3ULQ B;  4TWE A;  2JUC A;  5CVV A;  2BXZ A;  2JSC A;  1F57 A;  2HU9 A;  3VSK A;  3E7L A;  1KU3 A;  2LFB A;  3QOP A;  5JLX A;  3FIX A;  4R8F A;  5BPD A;  3G2B A;  3K4N A;  2JA5 J;  4MY3 A;  2XAH A;  1MSF C;  1S72 I;  3F22 A;  4RAG A;  4UEZ A;  4NB5 A;  3L1P A;  3I4N J;  4OAD A;  1WJD A;  3FX6 A;  4HAM A;  3S3M A;  2PRQ A;  2ZKZ A;  3N05 A;  4BQA A;  2HI3 A;  4ENK A;  1WHU A;  3SZG A;  4A6D A;  1IOF A;  2L2O A;  4U88 A;  2K9Q A;  2WWY A;  1TXR A;  2EIM H;  4P1W A;  2QML A;  3T90 A;  3VYR B;  1YR0 A;  2PVV A;  1J09 A;  3KZZ A;  2CGP A;  3R0A A;  2JBK A;  2K3P A;  3WR7 A;  2ISZ A;  5M5X J;  1YW6 A;  2V9P A;  1ETX A;  2JMW A;  4OIN F;  1TT5 B;  1VHS A;  4M3S A;  2XB5 A;  4DJA A;  5IP6 A;  1W0T A;  3MWM A;  1VQ4 I;  1ACI A;  3BTI A;  1ETW A;  1KGS A;  2RRE A;  3BRO A;  2P7V B;  4WCG A;  1S7F A;  1Z2L A;  3VWD A;  1MMD A;  4A0Y A;  3OOP A;  3HC7 A;  4M3E A;  5KNL A;  3RYP A;  2NVX J;  4BNC A;  2VQH A;  3TBI A;  2ZPA A;  3T8W A;  2WAD A;  4UEF A;  4A37 A;  4BBH A;  4C7I A;  1Y0N A;  4UUS A;  2AQF A;  4JXQ A;  1MBK A;  3MQ0 A;  4LMY A;  1LAM A;  2L01 A;  3A02 A;  2JA7 J;  5AG5 A;  3WOD F;  2GA2 A;  4A5N A;  2J9A A;  2M4G A;  5CNP A;  4AC0 A;  2Q1Z B;  2Y75 A;  3DR8 A;  1NHA A;  2W82 A;  2DA1 A;  2E19 A;  5F6F A;  5KAI C;  3EPZ A;  3RAM A;  1YHQ I;  1VTN C;  2JA8 J;  3S6F A;  2QIR A;  4IOC F;  1WI9 A;  4CYC A;  3SI1 A;  1FTT A;  2E5N A;  1QZE A;  2J8R A;  2C1C A;  1CJW A;  3FMC A;  2YNE A;  1XTA A;  4RAZ A;  1R5H A;  3M8J A;  3FEC A;  2QQA A;  3GTL J;  4OC5 A;  3GTG J;  2K85 A;  4II2 A;  2PQ8 A;  4C3H J;  2LY1 A;  4B43 A;  1T6S A;  3RQI A;  2QKM B;  4Y13 A;  2ARH A;  5B5E C;  3WC7 A;  2OU2 A;  2QEN A;  3IH2 A;  4MFL A;  5K8N A;  4OC2 A;  1B6A A;  4R79 A;  3A4C A;  4NDL A;  4M6H A;  2HS5 A;  3PNT A;  4XPK A;  4YFJ A;  1ZLH A;  2OR4 A;  1AYE A;  3ZQC A;  2CY2 A;  2M9H A;  4HST A;  4CIC A;  2V6E A;  1DPR A;  1NSA A;  1XCV A;  1S7A A;  5F0C A;  3GFI A;  4DOZ A;  1HF0 A;  4X6A J;  3EUH C;  4KIS A;  4D5C A;  2XGD A;  1QHH D;  1GV5 A;  4NGM A;  4RB1 A;  3AFH A;  1QSN A;  3PB7 X;  4B13 A;  4Z6Y A;  1I5Z A;  2BY2 A;  3IWW A;  2KPM A;  4IPA A;  4GDF A;  3P2F A;  4DYO A;  3SZT A;  3QPH A;  4KOT A;  2M2E A;  1Y9K A;  2ZCW A;  3G4S I;  1ZN2 A;  1SAU A;  1S7E A;  4QIW N;  3CMA I;  2VBW A;  2LNB A;  2RGV A;  3QU6 A;  1BIA A;  3KZY A;  4GXO A;  5K1Y A;  2HDD A;  1IRX A;  2O4H A;  4EVY A;  4CZC A;  3GLX A;  1GVJ A;  1J0R A;  2I5U A;  4CAW A;  1OCR H;  3EUA A;  5LBQ A;  4IZZ A;  3S3O A;  3L7W A;  3FHN A;  1WCM J;  2IXS A;  3CUQ B;  1K78 B;  2ZJ2 A;  4P4F A;  5F49 A;  1JKR C;  2XAG A;  1R36 A;  3LSG A;  4XRS A;  1BLL E;  3CZX A;  1OR7 A;  3RBU A;  1JKP C;  1FNO A;  1B9M A;  1G6N A;  1R9T J;  3WE3 A;  4PV6 A;  3HEF A;  2DN0 A;  4M71 A;  1H0M A;  3SHF A;  3DDD A;  4G6Q A;  2FOW A;  1QMU A;  4F92 B;  4BXX J;  3DLJ A;  4OLL A;  3F0C A;  1N78 A;  1T98 A;  5EF6 A;  5FFZ A;  2GE3 A;  2BV6 A;  2FOK A;  4U9Z A;  1TQP A;  1IB1 E;  2XKP A;  4EJO A;  4XPD C;  2LOO A;  2DTR A;  2JJ7 A;  1ZRD A;  3IRR A;  5CLS A;  4RGR A;  3K2A A;  1DUX C;  3ZQL A;  3OSF A;  4HA8 A;  2VKE A;  1O3Q A;  2D45 A;  1UJ8 A;  1OZP A;  2XEF A;  3GXO A;  3J81 Z;  1ZR2 A;  2ZW4 A;  2ICW G;  1KA8 A;  2ZEM A;  2L7F P;  3QQA A;  3D5S C;  2VE9 A;  4UV8 A;  4ZJZ A;  4BJ5 C;  2B5G A;  1Z6T A;  3QYF A;  2JQ7 A;  2DQR A;  1CGP A;  4KLW A;  3S2H J;  1U6G A;  1S7O A;  2VIX A;  2FBK A;  4PJN A;  3S1M J;  2CFX A;  1W7P B;  1XX5 A;  4P55 A;  5B3S H;  3AKZ A;  1ZG1 A;  2V1X A;  3EO4 A;  5EYR A;  2IGN A;  3VOD A;  2B0L A;  3TTH A;  3BJA A;  4KDP A;  4B3A A;  2JVH A;  4M3D A;  4RS2 A;  3OYG A;  2M4K A;  2YUS A;  3BR0 A;  1VI0 A;  2P0W A;  5ILU A;  2R7R A;  5AGE A;  1U2W A;  4JYK A;  2E34 A;  3DPL C;  5IOY A;  3GTJ J;  4XLF A;  5EZH A;  1YW8 A;  5D5W B;  4Y49 B;  1HLV A;  1PYT B;  4L0Y B;  3VOE A;  3PBB A;  4MCS A;  3H9J A;  3BI1 A;  2L4M A;  1FX7 A;  3JW4 A;  3GFM A;  5L3B A;  4A0X A;  1IG7 A;  3HG9 A;  1IAW A;  5LHG A;  1X4P A;  2CSO A;  3K4L A;  4E7K A;  3K4M A;  2O9L A;  2LKS A;  4NGP A;  1D1A A;  4HLX A;  4BQQ A;  3PIP F;  2BOA A;  2PMU A;  2X85 A;  3GEZ A;  4LB6 B;  2FEZ A;  2R5Z B;  1QST A;  2MSY A;  1TTY A;  4Y33 A;  3LQQ A;  4AIK A;  3DU6 A;  2VON A;  3J7A O;  4BBS J;  3M7G A;  1MH3 A;  2ZXV A;  1MBJ A;  3HSE A;  3HTU A;  1Y56 A;  2J5P A;  3HUG B;  2CV1 A;  2B4B A;  3D7H A;  2M0C A;  1TP4 A;  4V2G A;  1JKO C;  4DQ2 A;  2FD5 A;  3V8I A;  1Y0U A;  1YJ9 I;  1FJL A;  1ZAO A;  3E6C C;  1OFC X;  1T0F C;  2TRT A;  4AYB A;  2Y9Y A;  1S8N A;  4IAV A;  2VKH A;  2FX0 A;  5DWN A;  2VJI A;  2JRT A;  3VEP A;  1HKQ A;  3H5R A;  4I7H A;  3HOX J;  2Q8K A;  2LKP A;  3H3U A;  2R7V A;  4B11 A;  3H0G J;  5F46 A;  3MEX A;  4PFP A;  3FBU A;  2A5W A;  1SFO J;  3K4B A;  4Z65 A;  3FDY A;  3D7F A;  3WTZ A;  2PJ6 A;  3FM3 A;  1S60 A;  1I3A A;  3I59 A;  1R3N A;  1BOB A;  3M4O J;  3HSF A;  4NQW A;  1YQE A;  1E0E A;  2D5V A;  2VL1 A;  2YNC C;  4A3G J;  5BNG A;  2IEK A;  1ZH5 A;  5ILV A;  3G3Z A;  2P6E A;  4ZBG A;  2HQY A;  4CPA A;  2GAU A;  3BTL A;  1JUM A;  1ELM P;  2DLL A;  4F0Y A;  1HEE A;  4A3I J;  1XMX A;  2NSM A;  4ESF A;  4PGG A;  1QPM A;  2OOT A;  3G71 I;  1JQG A;  2A3S A;  2WV1 A;  4MO7 A;  4CRY B;  3WTX C;  2BHY A;  4BKX A;  1IO2 A;  2YR2 A;  3WE2 A;  3QB8 A;  3ZMD A;  3OMY A;  3UR3 C;  4KIT B;  3FRM A;  4E2A A;  1IXC A;  3WG7 H;  3ZMZ A;  3WGH A;  2QQB A;  3TP0 A;  1T33 A;  1JHH A;  1Z21 A;  5GAG J;  4MLO A;  2G3A A;  2JN6 A;  1T95 A;  3H8G A;  4MFK A;  2D2W A;  1W36 D;  4M6V A;  2AFZ A;  2BZT A;  1TKJ A;  4N9H A;  1QVT A;  3HOU J;  3F0A A;  4QC6 A;  3BG9 A;  2LP0 A;  1G8X A;  2DOA A;  3GVA A;  2HYJ A;  3M07 A;  2O61 A;  4R57 A;  2AFW A;  3R96 A;  2DPS A;  5FRM A;  3W91 A;  1SFK A;  4A2U A;  3PUB A;  2YND A;  2ZEH A;  4G7O F;  4RDU A;  4A3C J;  3ERM A;  3KP4 A;  1XGM A;  2X6W A;  3KP2 A;  3KEO A;  4B8X A;  3ML6 A;  4D7N A;  4W97 A;  1XSV A;  4UB6 C;  4L18 B;  2OV7 A;  2GA1 A;  2PJR A;  1L0O C;  2ZO4 A;  4M9S A;  3ZXS A;  2DXQ A;  1P4N A;  2M87 A;  4C2X A;  2LG4 A;  4KN7 X;  3HOZ J;  4L5I A;  3BG7 A;  1MW7 A;  1YX0 A;  2DPT A;  4HNY B;  4UBR A;  2PJ1 A;  4CZZ A;  4F9U A;  2A61 A;  5E18 F;  2GU2 A;  3F8F A;  3GME A;  5C82 A;  2ZXW H;  2YS9 A;  4JX6 A;  3C1D A;  1T39 A;  4NGS A;  1V5E A;  1FIP A;  4XOT A;  5IV0 A;  5IYB J;  5BMZ A;  3K70 D;  4UVB A;  1P4W A;  4UFW A;  4BY7 J;  3A01 A;  3RNZ A;  4F3Q A;  1ZRE A;  3CPA A;  2E1M C;  1XBU A;  1CPX A;  2NNN A;  3R60 A;  1G3S A;  2JEV A;  3NAR A;  1N25 A;  1ZRF A;  3FXK A;  3K9U A;  5HVG A;  2NVT J;  2M0M A;  1D5V A;  2DMP A;  4EJV A;  1T2K A;  2FUG 2;  5FO5 A;  2VXD A;  1QA6 A;  5AG6 A;  4ENN A;  3I56 I;  1SC7 A;  1FT9 A;  3G6E I;  3CCQ I;  4JWP A;  2DA2 A;  5JH9 A;  1BR1 A;  3GCM A;  2HYG D;  1IDY A;  2H6B A;  1OBR A;  3FXM A;  1P92 A;  2JRM A;  5F27 A;  1F43 A;  1D0Z A;  2VJ5 A;  4NCZ A;  2HKO A;  3H35 A;  4AB7 A;  3CJN A;  4OAY A;  3RPQ A;  5HLG A;  3V8L A;  1RNL A;  2Q4Y A;  1ZQ3 P;  1HDU A;  4YG2 F;  1Z5R A;  4NC8 A;  4L89 A;  4WXD A;  1WZ2 A;  3IWG A;  4Q4Z F;  3I64 A;  4U7B A;  3OSG A;  2M45 A;  1J7K A;  2K9S A;  4A12 A;  1M44 A;  4XRM A;  3IL2 A;  1O57 A;  5E1W A;  4LG0 A;  4FIS A;  1S3Z A;  1HDD C;  3GB0 A;  3G3S A;  4EGZ A;  3BY6 A;  4JXR A;  1YFH A;  1AHD P;  3MZ8 A;  4LFU A;  2CUE A;  1UHM A;  2LBF B;  4OIQ F;  1RUN A;  2Y69 H;  2VUM J;  2WA0 A;  1OYW A;  3EXN A;  3CJQ B;  3QP5 A;  5HDN A;  4PXE A;  5M5Y J;  2CW8 A;  2KIU A;  3Q0U A;  5E96 A;  4A33 A;  2I00 A;  2WSA A;  3BPV A;  4MFE A;  1TWH J;  4CYD A;  2KDO A;  3T1B A;  3OYE A;  3I1U A;  2GLF A;  2XUB A;  1UST A;  5E3N A;  1K4S A;  3CDH A;  3WTT C;  2O53 A;  5ISV A;  3ABM H;  3W6V A;  5LD2 C;  1YX3 A;  2HVR A;  3H5N A;  2C27 A;  1KUV A;  1XOV A;  3ISP A;  2GWR A;  2H1L A;  2GXA A;  3PNY A;  1W0U A;  2YGW A;  4EM1 A;  1O3S A;  2RFH A;  3LAC A;  3ZQF A;  4L9J A;  1J9I A;  2AXT C;  1YYV A;  4M6X A;  4GO1 A;  1K6O A;  5E20 A;  4P6Y A;  2DOD A;  1P4A A;  2CQ7 A;  2DDA A;  2DOE A;  3LA3 A;  1WK4 A;  1GLN A;  3V7R A;  5H84 A;  1IUF A;  5E8G A;  1FNN A;  2OF7 A;  3I58 A;  4ONU A;  2QEX I;  4MFP A;  5K7F A;  2IPQ X;  2EO8 A;  3BZC A;  4PK3 A;  2R5Y B;  2VZZ A;  2Z16 A;  2DQL A;  3K6G A;  5FFX A;  1KWM A;  3BJ7 A;  3K1M A;  3KX2 A;  2Z3O A;  1QVU A;  3SI0 A;  2DK8 A;  4LLN A;  2KDZ A;  4OU0 A;  1Q1V A;  3E0K A;  4UCP A;  1YME A;  1SMT A;  4HX4 A;  2LRE A;  4QPO A;  4CS0 B;  4F93 B;  2PDO A;  2MA3 A;  1LAN A;  2IJL A;  1R49 A;  1HCR A;  4RI1 A;  2R7Q A;  3KP3 A;  4N4O B;  3BJ6 A;  3EFA A;  4FUU A;  3ZZI A;  3F6O A;  3PQK A;  1PU9 A;  4OAZ A;  4H4K C;  3HRS A;  2J8N A;  2F48 A;  2OZ6 A;  2W00 A;  3CP8 A;  3JAM K;  5K8O A;  4UFV A;  3IWF A;  4QPQ A;  3EY5 A;  3TMO A;  4AWX B;  4IJA A;  4Y49 C;  4XIC A;  5H6Q A;  1I12 A;  3OY9 A;  1UCR A;  5EEA A;  4OC0 A;  5FKL A;  2PJA A;  3A0H C;  2TDX A;  4WK8 F;  2XSD C;  1KU9 A;  3RZA A;  3QU3 A;  2QYV A;  1AKH A;  2ZXI A;  4PSX A;  1A6I A;  3ZQG A;  3PEI A;  2LY2 A;  2CYY A;  5HNH A;  4MHY A;  1G3W A;  5GAD J;  4ZZD A;  4OIP F;  3KGQ A;  1O3T A;  3VAR A;  1XJO A;  4BEH A;  2XGC A;  3WU0 A;  3JRI A;  2MGQ A;  4U0V A;  4CCK A;  3LL7 A;  1IV6 A;  1M4G A;  4CAV A;  4UWI A;  2JA2 A;  4IUS A;  4R7M A;  2VE8 A;  3GZ6 A;  2NYX A;  2H09 A;  1ZAR A;  4ZTF A;  3BTJ A;  4PGH A;  2EZI A;  3LQR A;  1APL C;  5JPH A;  3H3V K;  2OCE A;  4OOI A;  1LVK A;  1FBQ A;  3CTA A;  3PB9 X;  2Q0O A;  2CTC A;  4GM5 A;  3S14 J;  2EV5 A;  5HOO A;  5LEJ A;  3Q3S A;  2J5O A;  1OPC A;  2G0B A;  1E3O C;  2ZEE A;  2CQQ A;  5DWM A;  2Y31 A;  3B6A A;  2O0Y A;  2XRO A;  2MAB A;  2QUF A;  1QU3 A;  3NWS A;  4U0Y A;  2HWV A;  2CTB A;  4CYC B;  5EEG A;  4M9X A;  2ELJ A;  4ZDP A;  1VQ7 I;  4GXH A;  3SFI A;  3DEW A;  5CVJ A;  4CXF A;  1V5G A;  3CPX A;  1WGX A;  4KIG A;  3OIP A;  3S6G A;  2M7B A; 
#chains in the Genus database with same CATH homology
 1WJB A;  3KKW A;  3W6X A;  3SZG A;  3SXO A;  3VSL A;  4BL0 B;  4BXF A;  2L2O A;  4P1W A;  3HKZ A;  2QML A;  3H0D A;  2GIV A;  3SEZ A;  3VYR B;  1YR0 A;  3T90 A;  2OB0 A;  1J09 A;  3K10 A;  2K3P A;  2ATR A;  3T9Y A;  3WR7 A;  1X1C A;  4BU2 A;  1VHS A;  4M3S A;  1S7L A;  1NG7 A;  4DJA A;  4R87 A;  2B4D B;  1YGH A;  3OYK A;  1MK4 A;  5I0C A;  4KSA A;  2RRE A;  2XSJ C;  3IAM 2;  2X1C A;  1S7F A;  4K30 A;  4UCM A;  1MMD A;  5KNL A;  2X51 A;  3HC7 A;  4J01 A;  2JDD A;  3VWD A;  4J3G A;  1N71 A;  3K4K A;  4BBH A;  2VQH A;  3TBI A;  2ZPA A;  4HKF A;  2WAD A;  4C7I A;  3LSM A;  1M4I A;  5KTC A;  3J7A Y;  2AQF A;  4ANJ A;  1S7K A;  4JXQ A;  2OZH A;  3EC4 A;  5AG5 A;  2X1E A;  2Z10 A;  2M4G A;  4FET A;  1IYK A;  1ZO0 A;  3V42 A;  4XNH C;  5CNP A;  4A95 A;  3F9K A;  2FXF A;  5KTA A;  2Q1Z B;  4CUG A;  3DR8 A;  4XON A;  2W82 A;  4IKF A;  3OYM A;  3EPZ A;  2GAN A;  4RM3 A;  2OUM A;  4PJJ A;  3OL4 A;  3S6F A;  2QIR A;  4UA3 A;  2KL4 A;  3DR6 A;  1JI8 A;  2CFO A;  3TO7 A;  1K6Y A;  2Y0M A;  2E5N A;  2J8R A;  2HVS A;  1CJW A;  1N77 A;  3H5Z A;  2UWM A;  2YNE A;  3F5B A;  3H5A A;  2GOX B;  4XNF A;  2BEI A;  1DGW Y;  3M8J A;  2FIA A;  4II3 A;  3M1C A;  4XLH A;  4II2 A;  2Z3K A;  4CYQ A;  2PQ8 A;  4OWR B;  2LY1 A;  4B43 A;  1Z4E A;  2ARH A;  2HQA A;  2QKM B;  3PSI A;  4KSF A;  2OU2 A;  4MFL A;  3SDB A;  3QOE A;  2X1D A;  4R79 A;  3A4C A;  3W6S A;  2PRB A;  3PNT A;  1YVO A;  4XPK A;  4NSQ A;  4QBJ A;  4YFJ A;  2CY2 A;  4HST A;  4B3X A;  4MFZ A;  2V6E A;  5KCM A;  2L5Q A;  3DNS A;  1LKX A;  2Q2E B;  2XDV A;  2X7B A;  5EBV A;  4DOZ A;  1M4D A;  2VAS A;  3EUH C;  4KIS A;  4MFQ A;  3TO9 A;  4KT6 A;  1VZ0 A;  3TFY A;  1QHH D;  3AFH A;  1QSN A;  1NSL A;  4B13 A;  3NE7 A;  4KVM E;  5C88 A;  2KPM A;  3D5L A;  3P2F A;  2E60 A;  2KMU A;  4KOT A;  2L9N A;  1U0J A;  1Y9K A;  4XLC A;  4ORF A;  1S9H A;  2KLO A;  1D0X A;  1SAU A;  2V9K A;  2XF5 A;  3DTE A;  2PC1 A;  4Q36 A;  1OLT A;  3IP4 B;  4C30 A;  3DEE A;  4B48 A;  1IRX A;  2WAQ A;  2B5G B;  2VJJ A;  4A32 A;  3IGR A;  3OYL A;  4CZC A;  1D1B A;  4XMY A;  3MKZ A;  4CAW A;  4CGP A;  4EVY A;  2LRD A;  3EUA A;  4IZZ A;  3S3O A;  3FHN A;  4XKB A;  3SXN A;  2IXS A;  3PZJ A;  3PL8 A;  2EVN A;  2MYS A;  5F49 A;  2WUU A;  3HOT A;  1IID A;  2V1N A;  4HNW B;  2DT7 B;  2FT0 A;  1D1C A;  2CXA A;  3VYU B;  3LSG A;  2Z2S B;  4DIQ A;  1UEL B;  3E1S A;  2ZW5 A;  5GCN A;  3PGP A;  4A2Z A;  1WWZ A;  3DPU A;  2Z3M A;  2R8V A;  2RC4 A;  3D3S A;  4CCN A;  3ZCO A;  5EC4 A;  4PV6 A;  1WJ5 A;  1X1A A;  2JLM A;  4X5K A;  3OYD A;  4Q38 A;  3FBN B;  2ZSH B;  3DDD A;  3CF2 A;  2F5I A;  4B10 A;  2DT6 A;  4PJL A;  4F92 B;  1XMT A;  4D1Q A;  3EFA A;  1Y7R A;  4OLL A;  1MND A;  2WAF A;  1KZF A;  4PSW A;  4CCL A;  1XF8 A;  2KP6 A;  1N78 A;  3LSK A;  2VPL A;  2Q0Y A;  4CSW A;  3BCB A;  2GE3 A;  4D9J A;  2W7N A;  2V26 A;  4BDY A;  3HPH A;  4U9Z A;  4GRI A;  1IB1 E;  3C26 A;  3S3N A;  4IF5 A;  4XPD C;  1UAA A;  1QSM A;  4XPD B;  2LOO A;  4BGD A;  1MNE A;  2NMT A;  3W2W A;  4CAF A;  3GY9 A;  2MFZ A;  4E7L A;  4CCJ A;  2VL8 A;  2M3A A;  1PJR A;  3VWB A;  4LG3 A;  1OZP A;  3KYL A;  2R7T A;  2ZW4 A;  2KHM A;  4H89 A;  2HUZ A;  3D5S C;  2P6G A;  4EAT A;  4ZJZ A;  4BJ5 C;  2B5G A;  4KOV A;  3TO6 A;  5CQG A;  3OIQ A;  2XC7 A;  4ZC3 A;  3QYF A;  3C2G A;  4NXY A;  4KLW A;  3RYO A;  3GYA A;  2MC4 A;  1XEB A;  2CH0 A;  2M7A A;  4CAE A;  2VIX A;  4XKC A;  4XM3 A;  2K9L A;  1TIQ A;  4PJN A;  1S5K A;  3CXS A;  1LFP A;  1Q2D A;  4MFJ A;  5LFA A;  3AKZ A;  4R9M A;  3EO4 A;  1EA3 A;  4U5Y A;  2IGN A;  3TTH A;  2JVH A;  3CES A;  4ITV A;  3OYG A;  2R98 A;  4RS2 A;  2V4J C;  2M4K A;  1Z9U A;  1LRZ A;  1N75 A;  3C2H A;  4KZT A;  2P0W A;  2R7R A;  5AGE A;  1RO5 A;  3VWE A;  4AVA A;  3DPL C;  2R7W A;  2WPX A;  3NWT A;  4NQW B;  4XLF A;  3LFU A;  2CNT A;  4Y49 B;  4B12 A;  4B14 A;  4B5O A;  3SHP A;  5A27 A;  5AG7 A;  3S6H A;  3H9J A;  2PMZ A;  3K4C A;  5G20 A;  2Q7B A;  1P9Q C;  3SEQ A;  2ZW7 A;  3QAH A;  3PNV A;  4F52 A;  5CQE A;  4UFX A;  3OR1 C;  3HG9 A;  3VDX A;  3N7Z A;  2OZG A;  2HVQ A;  1D0Y A;  1X4P A;  3K4L A;  3OS2 A;  4E7K A;  3K4M A;  3D5R C;  1YLE A;  3I3G A;  5G22 A;  2ZFU A;  4G6T B;  1D1A A;  4BQQ A;  5HLT A;  1Q2Y A;  3I9S A;  1NE9 A;  2X85 A;  2CNM A;  3ZQQ A;  2F4I A;  2KRC A;  3OYI A;  4KLV A;  3BC8 A;  1QST A;  2REF A;  2QEC A;  4IQ4 A;  3OL3 A;  4Y33 A;  1DQU A;  3DU6 A;  1FY7 A;  1U6M A;  4ZGY B;  2ZXV A;  3OYJ A;  3RTR A;  3R95 A;  2B4B A;  1Y56 A;  3HUG B;  4CH7 A;  2CV1 A;  5H86 A;  4KOU A;  2W1O A;  3VYT B;  2R1I A;  3TOA A;  1MMG A;  4BQN A;  3L2W A;  4QUS A;  3V8I A;  2R7S A;  3F8K A;  5G1Z A;  3CP2 A;  4LIV A;  4B47 A;  1T0F C;  4AYB A;  4F55 A;  4HRI A;  5DWN A;  4B5P B;  2VKH A;  2JSP A;  2RNG A;  2VJI A;  3OOU A;  4B44 A;  2ZXH A;  3H5R A;  4E7S A;  3MKW B;  2K5T A;  4R3K A;  4Y3O A;  3W2V A;  4X0G A;  2KCW A;  2VBQ A;  1X19 A;  3RPU D;  2R7V A;  1YX5 A;  2AQE A;  4UWJ A;  2UV1 A;  4B11 A;  4HEA 2;  2X6Y A;  5F47 A;  5F46 A;  1B6B A;  4MY0 A;  4PFP A;  5J8C A;  3FBU A;  2A5W A;  4ZDO A;  2RQQ A;  3K4B A;  3FDY A;  2CW7 A;  5HMN A;  2PJR B;  1WJE A;  1S60 A;  4MI4 A;  1BOB A;  3S8P A;  2VXK A;  3ONQ A;  1E0E A;  3PP9 A;  2MD0 A;  2YNC C;  2P6E A;  1LDK B;  4ZBG A;  3PFY A;  4C9Y A;  2HQY A;  3D8P A;  2OH1 A;  5FRO A;  3DTK A;  2I79 A;  2WAE A;  4BE0 A;  1I21 A;  3BCA A;  2R7U A;  1QHG A;  2BOL A;  4XL9 A;  1K4J A;  4F0Y A;  3OYC A;  3PJR A;  4YEL A;  4CRY B;  2GOM A;  2X6X A;  3UNG C;  5JQ4 A;  1FMV A;  2Z3P A;  3L2V A;  3QB8 A;  3OMY A;  3UR3 C;  4KIT B;  4PUS A;  3FRM A;  4E2A A;  4CRZ B;  1Y6I A;  4H6U A;  3ZR8 X;  3BG6 A;  3OWT A;  2Q04 A;  2BW3 B;  4HG2 A;  1PUA A;  2FE7 A;  4KOW A;  1TT0 A;  3H9Q A;  1Z21 A;  3KEY A;  4MLO A;  4E4H A;  2G3A A;  2PR8 A;  3TT2 A;  1T95 A;  3G8W A;  4FD5 A;  4MFK A;  2O28 A;  1DGR M;  1WJC A;  3RCO A;  2HV2 A;  1W36 D;  3HOS A;  5F48 A;  4XLA A;  3F0A A;  1W36 C;  3L2R A;  1KUX A;  4QC6 A;  3JTK A;  4BS9 A;  4B5P A;  1G8X A;  2DOA A;  2HNH A;  2BVL A;  3HPG A;  5KHD A;  2JUG A;  4R57 A;  4XNH B;  5J8F A;  3TE4 A;  3R96 A;  4E6K G;  3DLA A;  5FRM A;  2DPS A;  1NMT A;  3W91 A;  1SFK A;  3SYT A;  3OYH A;  2OC6 A;  3IU1 A;  2WB1 A;  3LD2 A;  1WFX A;  3PUB A;  2YND A;  3QYB A;  1MMN A;  2X6W A;  2G3T A;  3A1Y A;  2K9M A;  4C7H A;  1Z7L A;  2OV7 A;  3OS1 A;  3B8G A;  4QB9 A;  1Z3Y A;  2PJR A;  4BE2 A;  3ZXS A;  2DXQ A;  1P4N A;  4FD6 A;  2BUE A;  2VQY A;  4II9 A;  2JDC A;  2HZD A;  4C2X A;  2LG4 A;  4PK4 A;  2IS6 A;  4HSR A;  2Z3N A;  4A30 A;  4FD4 A;  4BMH A;  3BG7 A;  1MW7 A;  4JLY A;  3I3L A;  3ZRG A;  1YX0 A;  2DPT A;  4HNY B;  3RQ4 A;  2WY7 Q;  4L8A A;  4UBR A;  2J8M A;  4KOX A;  5C82 A;  4CYN A;  4AVC A;  1J4J A;  1FMW A;  4LIU A;  4JD6 A;  2HDW A;  1CM0 A;  2FS5 A;  1MJB A;  4BDZ A;  1V5E A;  5IV0 A;  4XOT A;  4LIT A;  4E7J A;  3RSN A;  3K70 D;  3S6G A;  2KZV A;  4UFW A;  4E8O A;  4AVB A;  2BW3 A;  4F3Q A;  3FNC A;  4LUA A;  4U9Y A;  3K70 C;  2E1M C;  2PR1 A;  2JEV A;  4LX9 A;  3K9U A;  4NNJ A;  2VEZ A;  2CV0 A;  2R7O A;  1XE4 A;  2B3V A;  2M0M A;  1OR7 C;  3DPT A;  1M1D A;  2FUG 2;  1X4O A;  1YVK A;  3HL2 A;  4XOP A;  2VXD A;  3BLN A;  3S93 A;  3CMM A;  4ZTJ A;  2AE6 A;  2B58 A;  5AG6 A;  3TOB A;  2EUI A;  4C2U A;  4CGL A;  2WY8 Q;  4HNT A;  4IX7 A;  3R9G A;  2HPI A;  4JWP A;  4C2Y A;  3W2A A;  1RXT A;  1BR1 A;  1Z4R A;  2FSR A;  2XAU A;  4FAS D;  3AL0 C;  3JUW A;  5CPR B;  5HH1 A;  4CA0 A;  4N4N B;  1NG6 A;  1R6R A;  1D0Z A;  2VJ5 A;  4NCZ A;  1X1D A;  3H35 A;  4CCO A;  4DBQ A;  2B3U A;  4AB7 A;  5IX3 A;  4OAY A;  3GBG A;  2REE A;  3OYN A;  2Q4Y A;  4DGW B;  1IIC A;  4P5O A;  4NC8 A;  4HNU A;  4L89 A;  4XN0 A;  2JVG A;  2FIW A;  3LOD A;  4JQF A;  3IWG A;  3D2P A;  4CAX A;  2VI7 A;  3BLY A;  4U7B A;  4DNC A;  2W4S A;  2AJ6 A;  1IYL A;  1M44 A;  4FD7 A;  2PSW A;  4XKW A;  3PSF A;  4KS9 A;  3LSH A;  2R4G A;  3VYS B;  1ERD A;  1S3Z A;  1SQH A;  3G3S A;  3DWL E;  4JXR A;  2CV2 A;  4F91 B;  2IGM A;  3MD2 A;  2LBF B;  1YE9 A;  4NF1 A;  1Y9W A;  5IB0 A;  2WA0 A;  1BR2 A;  1HA8 A;  2YNC A;  2UUZ A;  3HXL A;  2L9S A;  2WBM A;  1S7N A;  3EXN A;  4BAC A;  4XN3 A;  4AU7 A;  2IL4 A;  4YRH A;  3CJQ B;  3LSI A;  1GHE A;  4BJT A;  2QKL B;  3FXT A;  3UY5 A;  4PJM A;  2KRH A;  4KVX A;  2CW8 A;  1QSR A;  5E96 A;  5TGT A;  4A33 A;  2I00 A;  2DCE A;  1MJ9 A;  2WSA A;  3IWE A;  3DU5 A;  2KDO A;  3OYE A;  1X1B A;  4XLE A;  2K5C A;  1KUY A;  5G21 A;  3IAS 2;  2A4N A;  5HVQ C;  1YRE A;  1WJF A;  4E7I A;  2DXI A;  2VLA A;  4KVO E;  4HPQ A;  2A6T A;  1V0C A;  5ISV A;  4NEX A;  4E7Z A;  1I1D A;  4OAE A;  2E1M B;  2V7F A;  5LD2 C;  1YX3 A;  4BJ6 C;  3H5N A;  2HVR A;  1KUV A;  1MJA A;  3CJR B;  2O5R A;  4DBR A;  2C27 A;  4ZYA A;  3DKY A;  4XQF A;  3IU2 A;  3PNY A;  2Z1D A;  2YGW A;  3OR2 C;  3OWC A;  2OZU A;  3CXP A;  4YGO A;  2KQR A;  3FB3 A;  4E7H A;  3R9E A;  1L0C A;  2DJI A;  4A31 A;  3DTI A;  3L2Q A;  2D4P A;  4F6A A;  3H9G A;  4BEH B;  1TZL A;  1GLN A;  2CS3 A;  1WK4 A;  5H84 A;  3A9L A;  4XOR A;  4XKV A;  1KON A;  5HNF A;  2XF6 A;  4KOS A;  3TCV A;  3AL0 B;  4ONU A;  2VXZ A;  3IUO A;  1UFH A;  2L7K A;  1VKC A;  2BL1 A;  2FCK A;  4MFP A;  3U21 A;  3MKY B;  1DP3 A;  4PK3 A;  1QSO A;  2VZZ A;  4MJ8 A;  2I8D A;  4KJZ A;  3MGD A;  4BUP A;  2Z16 A;  3K6G A;  2B4D A;  3DSB A;  3BJ7 A;  2R7X A;  3KX2 A;  2Z3O A;  3S6K A;  2LBF A;  2VJ4 A;  4JJX A;  3K4J A;  2IGO A;  2Q44 A;  3DQV C;  3CXQ A;  3P2H A;  1P0H A;  3OYA A;  3E0K A;  3TL4 X;  3E0J B;  4UCP A;  2Z3L A;  2LRE A;  3CZ6 A;  4QPO A;  3R1K A;  4CS0 B;  4RM2 A;  4F93 B;  2PDO A;  2LYC A;  2Z0Z A;  2XF7 A;  4RI1 A;  4C2Z A;  2R7Q A;  2CNS A;  4N4O B;  4CGN A;  2CUZ A;  3ZZI A;  3MMY B;  1WJA A;  4XPL A;  1PU9 A;  5FVJ A;  4OAZ A;  3OS0 A;  4H4K C;  4F0X A;  2J8N A;  4KUA A;  2HPM A;  1Q2C A;  4CGO A;  1AA7 A;  2W00 A;  3CP8 A;  4AVZ A;  4PFO A;  1YK3 A;  4QPQ A;  4UFV A;  3W3C A;  1ON0 A;  3EY5 A;  3TMO A;  4MHD A;  4C2T A;  4Y49 C;  1I12 A;  1B87 A;  3OY9 A;  2VZY A;  4MBU A;  3FKJ A;  3JVN A;  5FRN A;  4M85 A;  2Y0S A;  2BSW A;  4KUB A;  4PK2 A;  5KTD A;  4JOM A;  2CMP A;  3GKR A;  4KOY A;  2R7H A;  3EUK L;  3FYN A;  2ZXI A;  4PSX A;  5A28 A;  3LMM A;  3D2M A;  2CUJ A;  4J00 A;  4Y4R A;  2IGK A;  2ZW6 A;  1XIX A;  1UG0 A;  1ZEL A;  2LY2 A;  5HNH A;  2P6F A;  5JHF A;  2Q4V A;  1Z3X A;  4BEH A;  4CGM A;  3QYE A;  2F5V A;  2NOJ B;  3FBI B;  4NC7 A;  4CCM A;  4GS4 A;  1BR4 A;  4CCK A;  3LL7 A;  3DKX A;  1M4G A;  4YRV A;  4CAV A;  4UWI A;  2JA2 A;  3OYF A;  4YEJ A;  4HNX B;  2VKD A;  3BJ8 A;  4IUS A;  2F6C A;  2LH9 A;  4QVT A;  4AG7 A;  2H5M A;  3ZJ0 A;  1V5F A;  4AG9 A;  2E5Z A;  1BO4 A;  3H4Q A;  2D4O A;  3OYB A;  4U87 A;  2VB6 A;  4ZTF A;  1PYV A;  5JPH A;  2IS4 A;  4H6Z A;  4CYO A;  4RLQ A;  5BWA B;  4RLF A;  1LVK A;  4CYP A;  4I49 A;  4ZDL A;  2IS1 A;  3I9V 2;  4KOR A;  4UCN A;  2BVM A;  2VQL A;  5HOO A;  1G59 A;  4E0A A;  3S32 A;  2G0B A;  2FL4 A;  4BQO A;  3L2U A;  4NUB A;  4C68 A;  5DWM A;  5AG4 A;  2HU9 A;  3VSK A;  3FIX A;  2MAB A;  4RMN A;  1QU3 A;  3NWS A;  2VQG A;  2IS2 A;  3G2B A;  3K4N A;  2LC2 A;  2VQC A;  3A2K A;  4MY3 A;  3ZGK A;  2ELJ A;  4ZDP A;  4IQJ A;  2WPW A;  3R9F A;  1V5G A;  4BE1 A;  2ZSI B;  2Z11 A;  4XR6 A;  5CKT A;  1MMA A;  4OAD A;  3QOD A;  1WJD A;  3S3M A;  1R57 A;  3OIP A;  4R3L A;  3N05 A;  2M7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...