2P0WA

Human histone acetyltransferase 1 (hat1)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
319
structure length
319
Chain Sequence
AEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase type B catalytic subunit
publication title The crystal structure of human histone acetyltransferase 1 (HAT1) in complex with acetylcoenzyme A and histone peptide H4
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2p0wA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2p0wA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 2p0wA01
5DWMA 4Y49C 3TO7A 5EBVA 3PZJA 4PK2A 2D4PA 4FD5A 5KTDA 2B4DA 4F6AA 4QB9A 2PSWA 4BMHA 4UBRA 3SXNA 2FE7A 4HKFA 4KORA 4AVCA 2B4BA 4RI1A 4AG7A 3ZZIA 4KVOE 3EXNA 2FIWA 4ORFA 3TTHA 3RYOA 4CAVA 3D3SA 1IICA 1YVOA 2GE3A 3JUWA 4R3KA 2F5IA 4PSXA 3FIXA 4K30A 2FSRA 3TE4A 1M4DA 1P0HA 1I12A 1KZFA 5KTCA 4NEXA 3VWEA 2NMTA 2Q4YA 2P6GA 1XIXA 2GANA 1QSMA 3LD2A 3GKRA 3I3GA 5F47A 2CNTA 3DNSA 3TT2A 1YR0A 2FXFA 3P2FA 4KOSA 3T90A 3FRMA 3T9YA 5C88A 2ZPAA 4JLYA 3TOAA 3DDDA 1QSRA 1WK4A 4M3SA 5I0CA 4H6UA 4L89A 3FBUA 4KLVA 1P4NA 4B5PB 1Q2DA 3IGRA 3KKWA 2QIRA 3TCVA 2GIVA 4R87A 3W91A 1S7LA 4MY3A 1B87A 4XNHC 4PV6A 2QECA 3EC4A 2ARHA 2PRBA 1YGHA 5KTAA 2O28A 4UA3A 5J8FA 4KUBA 4FD4A 1U6MA 4RS2A 2PR1A 3F0AA 5F48A 1S3ZA 3N7ZA 2OZUA 3WR7A 2VBQA 3H4QA 3BJ8A 4U9YA 2JEVA 4E0AA 1MJAA 2AJ6A 1IYLA 2R1IA 4JJXA 2VEZA 2H5MA 1CM0A 1XE4A 2REEA 1S7KA 2PDOA 3QB8A 4HNWB 5GCNA 3S6KA 4FD7A 3IWGA 1S5KA 2ZW6A 3GY9A 2HV2A 2A4NA 3SHPA 2BUEA 4KZTA 1N71A 4PSWA 3G8WA 3E0KA 5H84A 4CS0B 1M44A 1Z9UA 3GYAA 4KLWA 4F0YA 4GS4A 5IV0A 4KUAA 4AVAA 4MY0A 2WPXA 3CXPA 2Z10A 5F49A 2R98A 3S6FA 2KCWA 3R9FA 5JPHA 3BJ7A 4PK3A 4OAEA 4JXQA 2EUIA 4OADA 1XEBA 4UWJA 2VI7A 3JVNA 2OZHA 4KVME 5E96A 2R7HA 4XPKA 4QVTA 4KOTA 4XNHB 4JD6A 2HQYA 5IB0A 1VHSA 1TIQA 3K9UA 2B5GB 2JDDA 4EVYA 4KOYA 5ISVA 4DNCA 3EY5A 1NE9A 1NSLA 5DWNA 2FIAA 2DXQA 4NF1A 1BO4A 2P6EA 1XMTA 2PC1A 2B5GA 4LUAA 4QBJA 3DSBA 1B6BA 2G3TA 4YGOA 2JLMA 1J4JA 3V8IA 2I00A 4QC6A 2VXKA 4ONUA 1KUYA 3FXTA 4L8AA 4MJ8A 2BL1A 1Y9KA 2Q44A 4B5PA 4R57A 2D4OA 3W6XA 3F5BA 1WWZA 3QAHA 4AB7A 2C27A 1Y9WA 2AE6A 1MK4A 1KUVA 2CY2A 4KVXA 4NCZA 3TO9A 2HUZA 3G3SA 2OH1A 3ZJ0A 2RC4A 2VZYA 3NE7A 1YREA 2K5TA 2EVNA 2REFA 5J8CA 2OZGA 2Q04A 4CRZB 2CNMA 3D2MA 3D2PA 4AG9A 2X7BA 2IL4A 4R3LA 5EC4A 2B3UA 2R8VA 2FS5A 3MGDA 3FNCA 4HNXB 4JXRA 1YK3A 1Q2YA 3FYNA 4UWIA 3R96A 2B3VA 1ON0A 4X5KA 4LX9A 4II9A 2P0WA 5HH1A 1FY7A 2BEIA 3TO6A 2G3AA 1Z4RA 4KOUA 5F46A 4M85A 1MJ9A 3BLNA 4MI4A 4NXYA 3F8KA 2I79A 1LRZA 2Z0ZA 1IYKA 2PQ8A 3PP9A 2J8RA 1Q2CA 1I1DA 1S7FA 4KOXA 3B8GA 2J8MA 1R57A 2P6FA 4I49A 4CAXA 2VQYA 3CXSA 2QMLA 4CAWA 1M4GA 4ZBGA 1VKCA 2JDCA 3DR8A 3SXOA 3P2HA 2G0BA 4HNYB 4MHDA 2ZW7A 2ZW5A 2Y0MA 3C26A 3UY5A 2Q4VA 3R95A 2CNSA 1UFHA 2FCKA 3DR6A 1CJWA 2ZW4A 3LODA 4FD6A 2BSWA 1L0CA 2ATRA 3R9GA 1QSOA 3TFYA 4H6ZA 4J3GA 2OU2A 4MBUA 3R9EA 4OLLA 3S6HA 2J8NA 1NMTA 4YFJA 4H89A 1QSNA 3EO4A 4KOWA 2Q7BA 1M1DA 5IX3A 4AVBA 2FL4A 2WPWA 1QSTA 4XPLA 1YLEA 2B58A 2PR8A 2Z11A 3I9SA 2OB0A 4QUSA 4NSQA 1PUAA 4U5YA 1S60A 1YX0A 1RO5A 1BOBA 1S7NA 3W6SA 1V0CA 1MJBA 3R1KA 4XPDB 1PU9A 1I21A 4E8OA 5HMNA 1Y7RA 2ZXVA 4YRHA 4B5OA 3VWDA 2Q0YA 3PGPA 5H86A 4KOVA 4Y49B 1YVKA 3TOBA 1IB1E 4R9MA 1Z4EA 4CRYB 2FT0A 3OWCA 3S6GA 1XF8A 3FB3A 4IUSA 1K4JA 5CNPA 5FVJA 2VZZA 1RXTA 1OZPA 1IIDA 1M4IA 3CXQA 3EFAA 5JQ4A 2B4DB 4E2AA 4U9ZA 1KUXA 4IF5A 4XPDC 5C82A 4JWPA 1GHEA 3D8PA 1SQHA
chains in the Genus database with same CATH superfamily
3FMRA 4UUVA 2CS3A 2D4PA 1K79A 1R36A 2EPFA 4P45A 2HOEA 4XOTA 2P5LC 2IS4A 4AIJA 4UBRA 4ABZA 4WX9A 3SXNA 2E34A 3MKZA 4AVCA 4RS8A 4RI1A 1FT9A 3OS2A 2A6HF 4AM3A 1LANA 2GLJA 2ZMEB 3TTHA 2M1BA 1OBRA 4XSXF 2GE3A 3GEZA 3KEYA 1SFKA 1BW6A 1CP7A 2R7VA 4CUGA 5KHDA 4U0YA 2GAUA 4BY1J 1K83J 2EJRA 1P0HA 2AXTC 3I1UA 3TKYA 3JSPA 3PB7X 5LGUA 2VI6A 3DKWA 4HYEA 2VL1A 1BL0A 5KTCA 3FH4A 2OJED 2L7KA 5CLSA 1T8IA 3SZTA 4UNOA 1XCBA 1XS9A 4C2YA 2W7NA 2NMTA 2W00A 2Q4YA 4RLFA 1OYWA 3WGHA 3TL4X 2NVXJ 2Y9ZA 1QSMA 1IRGA 4JX5A 5F47A 4B14A 2CW8A 5FLXK 4P1WA 5EEAA 1UHMA 3ZQGA 1BAVA 4YELA 3T0YA 2PMHA 3H5RA 3BJAA 3T90A 3FRMA 5C4XJ 4MHYA 2UUZA 4A31A 5K5OA 2V1NA 2VE9A 4CGMA 4XKBA 3F21A 3O2PE 3TOAA 1HDPA 1R49A 1FSEA 3SI2A 2Q0OA 1ZRDA 1QSRA 2TRTA 2PX9A 2DMQA 3I53A 5K7FA 3FK7A 1IY7A 2VBYA 1IF1A 3L2RA 5DUIA 4E7JA 1Z5RA 5I0CA 3L1PA 4Y13A 3HOZJ 4H6UA 4BQNA 3PNTA 1LVKA 3FBUA 2YX4A 1NK2P 1Z2LA 3I54A 4JQFA 3SJGA 1ZG8A 2IEKA 2DO7A 3IGRA 4NGNA 4NHJA 4MEYF 1X1CA 2QIRA 4M73A 3KZWA 2ANPA 1ZGWA 1KU2A 1BA5A 2JUCA 4UVBA 2E1CA 4B09A 5E3MA 1IGNA 2QECA 5HLTA 1LFPA 3FX6A 4HSRA 4XKWA 4MNUA 1VQ4I 1SD5A 1BI3A 5J8FA 4UA3A 4BUPA 2LG4A 4FD4A 2W4SA 1U6MA 2F5CA 3K4MA 2ME6A 3F0AA 3DV8A 3PM1A 5F48A 3COAC 2VBQA 2PJ8A 1MZBA 2A6EF 4ITVA 4I76A 2TDXA 3HHGA 4R76A 3M8EA 2KRHA 3DWLE 4YG2F 3RZAA 3CJTB 3IJ3A 2QUFA 3BXMA 1R5GA 4A3GJ 1YTYA 3KASA 2V8DA 3V7RA 2VOPA 1TP4A 5B3SH 4U0WA 5DM7F 3HOWJ 1CM0A 1XE4A 1UG0A 2DPDA 2YNDA 3CF2A 4MCRA 1SVLA 4F0XA 3LSTA 5LHGA 4C2ZA 2BY2A 5GCNA 2M34A 4FD7A 2HYFA 1YFHA 1S5KA 2IW5A 1MBJA 1D0ZA 1OFCX 1IXRC 2DPUA 2HV2A 3R0AA 4GXOA 1QVUA 3HEFA 2A6TA 4J00A 2XRLA 2L7FP 3ZOBA 2E19A 2BBYA 4GGGA 1TC3C 2NNNA 4NGQA 5LYLA 4EEFG 4D7NA 1GV5A 4PSWA 2NNYA 2R3SA 1RRJA 1JJ8C 1ZR4A 3SI1A 1U9NA 2WV1A 3CJQB 4LIUA 3VSLA 1RR7A 4ENMA 4UIBA 4B43A 2HYJA 3CCEI 2FXAA 2R4GA 1P4WA 3I58A 3SQNA 1QA6A 4JYWA 4LQ6A 4CS0B 4HDUA 4OIPF 1PYVA 4U7DA 1LQ1A 2BOLA 1Z9UA 2PMZA 3VATA 1NHAA 3WE2A 3VH9A 3AG2H 4R6TA 2KMUA 4CYDA 4KLWA 4Q48A 5D8LB 1Z6RA 4FUUA 3OV8A 1A04A 4F0YA 4C7IA 5AONA 3R4KA 5IV0A 3IRQA 3IRRA 2OC6A 1IAWA 3E6DA 2WY7Q 2ZOGA 2R5YB 4AVAA 3ASOH 4MY0A 1JT6A 5LRRA 3SEZA 2D45A 2CMPA 1WI9A 2FNAA 5FLMJ 2UXNA 3MQ0A 3WG9A 1VQOI 2Z10A 3TC8A 4UFXA 1G3TA 2P5KA 1LAMA 4CH7A 5CBMA 1UFMA 1TZLA 2MW8A 4KMFA 1F1ZA 4CCNA 2WAEA 3K70C 2VODA 1OMIA 2Z16A 5ILUA 2EUIA 4OWRB 3MD2A 5C3EJ 2R5YA 4OADA 1XEBA 4L5IA 5M3MJ 2PIYA 4BBHA 1F2PA 3W3CA 5C44J 1U78A 5FLXZ 3G73A 3KR5A 4IHXA 4K3NA 4KVME 4KS9A 2R7HA 4CGLA 5GADJ 3WTVC 3ECOA 2F7VA 4ESFA 4BU2A 1Y7EA 5ELYA 3D7GA 3E0JB 4KOTA 3GTQJ 3BY6A 2OQGA 2ZJRF 1U8BA 4BD9A 3ZR8X 4KMUX 1YITI 3CCVI 1TIQA 4ZJZA 3LA3A 6PAXA 2VPRA 1W5CC 4D5CA 1ITYA 4B10A 3CMYA 1ZRCA 2EIJH 3LSKA 4OC0A 3EY5A 4CYQA 1ACIA 2DMTA 2FIAA 2E71A 5IYBJ 1Z9CA 3FEEA 1NK3P 2Z3PA 1BO4A 2LKXA 1F4KA 4XN3A 2ZFWA 1XMTA 3K6GA 1TLHB 2PC1A 3CCQI 4UVCA 3SFZA 1R5HA 1Z7UA 3DSBA 3GBGA 1N25A 1Z3YA 3ONQA 3S8PA 4BL0B 1EA3A 4M6XA 1MMNA 2O5RA 1DGRM 3CTAA 2F2EA 2A07F 4ZYAA 3HC7A 1ZN2A 2F4IA 2I00A 3CO6C 1G6NA 1FWZA 4L8AA 1IZ1A 1JWQA 2K4BA 2VL8A 2A5WA 5H6RA 4ESJA 1TNSA 5BPDA 1BI2A 1SAUA 3E6BA 5F6FA 1Y9KA 2M45A 2O9LA 3HPGA 2DT7B 1NG7A 2UV1A 4HSTA 2QF7A 4W9YA 2DYSH 1WCMJ 4A0YA 1DTDA 3M8FA 1YIOA 1WWZA 3KP6A 3KHZA 3M07A 4EGYA 2W25A 4B12A 4OMEA 4II2A 5D5XB 2CW7A 3I59B 4BQOA 1MDMA 5LYDA 3GZ6A 4PJMA 5GAEJ 5A28A 4G94A 3JW4A 1SVMA 2VQLA 4A3CJ 3ABTA 1EE3P 2PEXA 4MQ9F 4DZJA 1TNTA 5ERIA 2B63J 3FVLA 3VWBA 4NCZA 5LBQA 4O5VA 1FTTA 3PSIA 2F8HA 2WAQA 4CPAA 2HUZA 2VC0A 2A5YB 2GBYA 2YUSA 2DK5A 4M9ZA 3I59A 2HC9A 4B47A 1F43A 4OIWA 4NQWA 3RBUA 1HEEA 3CCLI 4KN7X 3NE7A 2F4OB 4UVAA 4KIBA 2REFA 2PIZA 5J8CA 2Q04A 3WC7A 4CRZB 4NGMA 4XSZF 4CCKA 2K86A 3FK6A 2V6CA 3D2PA 1R23A 1H88C 5H20A 2M7BA 2BY0A 5DUKA 3ELKA 4M74A 4R3LA 5JFRA 2HVSA 2R8VA 3PFOA 2GREA 3DBRB 1QZYA 2FS5A 1T95A 3MGDA 1FYMA 1D8JA 3FNCA 4L9TA 4BHPA 2CSOA 2ZELA 1Y8QB 5J40A 3H5AA 2EA4A 5LRSA 4E7SA 3KLNA 1Q2YA 1HF0A 2RAEA 4X1EA 4EJOA 4RLQA 2CUJA 2Y0SA 3IH2A 3RPUA 2C6CA 3FXLA 3SXYA 5HS8A 4EGZA 3B3TA 2Z9OA 1CPSA 1MIJA 5HH1A 1FY7A 4D0PA 1LDDA 3R6SA 3JRAA 1TWGJ 1EH8A 5E1WA 3TO6A 2DA1A 2G3AA 3WU0A 4OP4A 4KOUA 3L2QA 2R7RA 1YLFA 1FMWA 4UCMA 5EF6A 5DS9A 1X4PA 1XBUA 2JEWA 5I4MA 4NC6A 4OIQF 2EO8A 3F8KA 2FBIA 5IP7J 5KAFC 5KNLA 2GWRA 2PQ8A 4QIWN 2JA7J 1IYKA 4N4NB 1TXRA 3PP9A 4ONWA 3CD6I 1D1AA 2XAQA 1E3OC 1W4MA 4ZTJA 1S7FA 1SD4A 2PG4A 3H9QA 4UF4A 5EYRA 1XG1A 1X4OA 2VE8A 2WV0A 4YRVA 1TQMA 1TF8A 3IO1A 4MHNA 4IQJA 2RKHA 2XV4S 4G6TB 5JR3A 3KI9A 1SD7A 1GDTA 2AFUA 1XD7A 2DTZA 2V4JC 3GMEA 2IA0A 1MMSA 3Q5FA 4HA8A 2E7WA 2VPLA 1Z1DA 2HKOA 3OL3A 1FOWA 3PB4X 2HPMA 3I4PA 4ZH4F 2MD0A 3N4MA 2JDCA 4DZPA 2E5ZA 1EKEA 1Q1HA 2FNPA 1PUFB 2BCOA 3LWUA 3IC7A 1PP8F 1Z0XA 3DGVA 2DT5A 2VKDA 3D0SA 4HNYB 1XMKA 2DOFA 3NFZA 2VJIA 4CDGA 4BHBA 2KFDA 5HDGA 4FASD 3GTPJ 2F6CA 2HXIA 5HS9A 2XAJA 2VKHA 4I01A 3KHXA 2DA3A 2HTSA 3LSHA 4GFBA 5A2QK 1QBJA 3MAJA 1UFHA 2KDZA 4P6YA 5CVRA 3V8LA 4QSHA 3HOTA 5TJJA 2A3SA 2OTLI 3MMYB 1L0CA 1X19A 1XSXA 2ELKA 5E3LA 2ZOFA 4CICA 4BEHB 3TFYA 3ASNH 3EDPA 1G2HA 3CCSI 4PQAA 3E5QA 1HXDA 3DU6A 4MBUA 4YFNF 5FROA 1Z8LA 3G6EI 3RZOJ 3PB6X 4OLLA 2ECCA 3G71I 1ZGJA 2BOAA 4FT8A 3S14J 4BGDA 4AVPA 4IJAA 3DBHB 3GTOJ 3K4BA 1JHFA 1YX3A 4XONA 3FZVA 3SJFA 2BVMA 2Q7BA 4WWVA 4E7HA 1I27A 2V79A 3NAUA 3ZMDA 1M1DA 4PJNA 3D7HA 4AVBA 1YRNB 3JRHA 2HKXA 3JTKA 4ZY0A 3DTIA 4PGHA 3OL4A 3O8GA 3S1QJ 2FL4A 4PUSA 2Z3MA 2GLOA 3J7AO 3FKJA 4XPLA 2DF5A 1P7JA 2WAFA 2JZYA 4B6ZA 3H36A 1FOKA 4Z2YA 3QOPA 3TW6A 3G1OA 3ZQFA 1UB9A 3DTEA 4MCPA 2E1MB 1BOBA 4KISA 3OIOA 3P9CA 1OCZH 2WSAA 1YRNA 1QHHD 1MJBA 2EINH 4MGRA 1MSEC 4MLOA 3FXUA 4E8OA 4Q36A 2E1OA 2J5OA 1Y7RA 2ZJ2A 3F3XA 4YWYA 2IBDA 4FE7A 2O53A 3PGPA 1IUFA 3GUDA 4KDPA 1DQUA 1Y1VJ 1ON2A 3CQZJ 4Y49B 2P81A 1YW4A 5IP6A 1DP7P 4G12A 2ISZA 3OS0A 2J9AA 5LRJA 2Z3OA 3BPVA 2DMPA 5D8NA 1BIBA 2RDPA 3IWFA 1YI2I 3D66A 3WU2C 1MBEA 4R9MA 2FBKA 4BKXA 3K69A 2VB6A 5ICEA 2FT0A 2ZEPA 3OWCA 1XF8A 3S6GA 4LK0F 2EWBA 2HEOA 4M6IA 1IRZA 4DOZA 4RGSA 3FB3A 1IUYA 3FXKA 1Z8XA 2VZZA 2OAZA 2FF4A 1RXTA 1TKFA 4A38A 4KIGA 1PP7U 1WJBA 1D0XA 4S05A 4HQMA 4DBQA 4AD9A 3CXQA 2ESHA 2JJ7A 4DYQA 5EDNA 2G9DA 5JQ4A 3I0TA 4E2AA 4OOIA 4LLGF 2V9VA 1OYIA 3ZMVA 2YX7A 1R71A 4CGOA 1OCRH 3IH4A 3REOA 2HU9A 5FD6A 5FKMA 4A95A 4F9VA 3MZYA 1CF7B 1DPUA 2CUEA 2BV6A 3S17J 1SQHA 1VTNC 1BC8C 2D5VA 5DCMA 2Y31A 5EBVA 2JVHA 3I56I 2YR2A 2GQQA 3CP8A 1CP6A 3PRTA 3OOPA 3FM5A 4QB9A 3CDLA 2NRAC 4BMHA 1QMUA 2G7UA 3F6OA 3BG9A 4PJJA 4FETA 1VFCA 2FE7A 2QQ8A 1ZLKA 1RTQA 3WGIA 1X3UA 5F08A 1RIOH 4HKFA 4IO9F 3ZQLA 5BS6A 3KZIC 5L3EA 2BXYA 1CF7A 1QVTA 3LFKA 3S1MJ 4CGNA 5FB2A 4C9YA 4G6QA 2QA4I 3EXNA 1HDUA 4A30A 2CQQA 2FIWA 2IA1A 1LEAA 4JP0A 1BPMA 4ORFA 3CC7I 2V9PA 3WHCA 3C18A 4OMYA 4R3KA 2R7TA 2F5IA 3S1RJ 3LQQA 2W82A 3C7JA 3D5SC 2R93J 1M4DA 2QJ8A 3T8RA 2BHZA 4WCGA 3V7ZA 4UUTA 1I12A 1KZFA 3H0GJ 2DFFA 5LFAA 3GVAA 5HLGA 1BI0A 5A2QZ 3ZMSA 5DTDA 2CTBA 1Z91A 2Z1DA 3VWEA 2UXXA 3HIFA 3ZCOA 3BG7A 2ID3A 1XIXA 1K7AA 4OIDA 1KU9A 3GKRA 3CLQA 3I3GA 1YO5C 3NQOA 3LSPA 5D29A 5CVIA 3TT2A 4FHTA 2XSJC 2FXFA 5AIPA 2LKPA 5C88A 4L5JA 2MSYA 4NC8A 2GOXB 4E7KA 2ZPAA 3KETA 3H8GA 2ZMEC 4HNTA 2DTRA 5FRNA 4JLYA 4MCQA 1CX8A 2HI3A 3DDDA 1RUNA 1HKSA 3K0LA 1FYKA 4O3MA 1K78B 1JGGA 1FX7A 5F27A 1EJ9A 4OKOA 3BR6A 2EV5A 4UV9A 5EJCA 2RQPA 4BXFA 5E3OA 1VGYA 1U8RA 1BJAA 2DDAA 3DPTA 3RTRA 2DYRH 1E17A 1X3ZB 2FU4A 4J19A 4L89A 3I4MJ 2BXZA 1ON1A 2RQQA 4IOCF 3BZKA 1BR1A 1FBSA 4HNUA 4EJUA 3QU3A 1K78A 3HPHA 4XLNF 3D7FA 1I39A 3H3UA 3BJ6A 1MNDA 1W7PD 5K8OA 3T8TA 1NG6A 4IRGA 4R87A 1V3FA 2K9LA 3G1MA 1ZGAA 4XIDA 4HLYA 4BE1A 4UHTA 5JVGF 2Z3NA 4MY3A 4XNHC 2LP0A 4A5MA 4CO8A 4PV6A 2EZLA 4BXXJ 4XLFA 2ARHA 3QWLA 2CW0F 3QNVA 1YGHA 2Q2EB 4L0ZB 5HDKA 1A31A 1VQLI 3BI0A 4F91B 3JRBA 3AL0B 4BINA 1QRYA 3S15J 4KICA 3CDIA 1ETQA 2HXOA 1FLIA 3TDZC 2KIMA 3S2DJ 1BBYA 2CGPA 3H4QA 4RBOA 4BAYA 4AIHA 3BJ8A 1W1WE 1VQMI 4PXCA 4U9YA 5L3DA 2JEVA 1MBFA 4BBRJ 4MQVA 1QZZA 5K8PA 3V4GA 1JI8A 1IYLA 2EFNA 2R1IA 2HOSA 1MKMA 2NS7A 1EF4A 2QKLB 2V1UA 4HG2A 1S7KA 1UMQA 4NNJA 5BOXA 3H8EA 2PJCA 3NH8A 2VJ5A 2ETHA 2X6YA 4HNWB 2DW4A 3AAFA 1JUPA 3HKZA 2GXAA 4L9VA 5G1ZA 3IWGA 3GLXA 5E20A 4A3KJ 3EPZA 5IOZA 1CBXA 2FSWA 2H8WA 3FJUA 4ESBA 3SHPA 1OCPA 1EH7A 1LVAA 4XKVA 3I9V2 4KUMA 5ICGA 2MFZA 1T98A 2QGUA 3BTJA 3DXJF 3TP3A 5BNGA 3NWSA 3F22A 1B72B 3RKYA 3OR1C 4F93B 3G8WA 3V8KA 1KQ8A 2P6SA 5FJ8J 4XL9A 5B1AH 5H84A 3LMMA 3HHHA 3GZ5A 2VONA 1FJLA 2PVVA 4L9JA 4ZYHA 1XFOA 3HLPA 4WXCA 2Q1ZB 3BOQA 1RKWA 1SC7A 1A35A 2XPWA 2V8VA 1W0TA 2FBHA 1B72A 5HVGA 2L7ZA 2XAHA 2NOGA 2XF7A 5KVRA 3OYBA 5IYCJ 1XC5A 2EH3A 2CUZA 2VQGA 1BN5A 1O57A 2LRDA 4M3BA 4BJTA 2JA6J 1R3NA 2GZWA 2KDOA 2K3FA 1TKHA 3S6FA 3RZDJ 1LPQA 1TKJA 3KIOA 5FD5A 1MNMC 4PFOA 4PK3A 4MRIA 4A3LJ 3RNZA 4JXQA 3ZP5A 4CCMA 3HUGB 2IRFG 2L4MA 4LB5A 4EM2A 2OD5A 1VHEA 4UWJA 3JVNA 2R7UA 3VYTB 2QQBA 3L00A 1IOIA 1ZO0A 2ZMEA 1W5SA 2X1EA 3DU5A 2IP2A 5LLQA 3H9JA 2XGEA 2PJ7A 1ERDA 4X0GA 2BVLA 1OISA 4XRSG 1Y0UA 5HLHA 3F23A 4EWTA 4KIFA 4QVTA 3KPHA 1UHSA 4DYCA 1OJLA 4C3JJ 3HUGA 3N05A 4ZTFA 4XNHB 2O7OA 2HQYA 4JD6A 2PBIA 3O8HA 1PJRA 1Y6IA 2Y48A 1S72I 3MN2A 1ELMP 3QPHA 4QTRA 3K9UA 2CQKA 5L3BA 2B5GB 3D68A 4A2UA 4KOYA 2C1CA 1ZG3A 3G4SI 3DKYA 1ZH5A 2EZKA 4UFVA 2XAGA 2L3DA 4U88A 3FM3A 1NE9A 1NSLA 3IH3A 4HQEA 3F9KA 4XN0A 2HYGD 2L5QA 3TBIA 3L2WA 1D5YA 4MHPA 3BCAA 2PJ0A 1MMDA 3HXLA 2L4AA 4M72A 2B5GA 4WK8F 4BNCA 2M3AA 5GP9A 1APLC 5D8KB 4OIOF 2YGWA 1DP3A 3J7YJ 2KJBA 5C4JJ 3S3NA 4QBJA 1WSUA 2Z3YA 1TW2A 3LSIA 1TBXA 4YEJA 4YGOA 5FKLA 1BOAA 1JKQC 4UEEA 2GA1A 2M9HA 2X85A 4Z6YA 2JLMA 3CPAA 3K1NA 4I98B 4F9UA 2YSRA 2AFSA 5L3CA 4QC6A 3GTMJ 2VXKA 3IKVA 5GPCA 4OAZA 3LQRA 2L2OA 3C2GA 4CXFA 1P9QC 2ODFA 5E17F 4AWXB 2D4OA 5BWAB 2MGQA 3F5BA 1M1EB 4XBFA 5J1RA 3JCUC 3ZQQA 4NB5A 4PXBA 1MMAA 3QAHA 1GLNA 1NSAA 1TQIA 4JK1X 3TMOA 1WH5A 2OZ6A 1C0WA 2OCEA 2C27A 1ZTRA 3BP8A 4P10A 4EMEA 2JSCA 5LRKA 1ZREA 3K7AJ 2K40A 1Y0RA 4ENNA 1JUSA 4HF1A 2VXDA 4I99C 4KVXA 1K61A 3Q3SA 1QU3A 3NRVA 3F0CA 4II3A 4Y33A 3BQZA 4Z65A 2XUBA 1J09A 4Y52J 2OH1A 3GFLA 2HPIA 4BQAA 4IHMA 3ZJ0A 3A4CA 3OYFA 5M5WJ 3SJMA 2DAOA 5F64A 5E1ZB 2ICWG 2RC4A 2VQCA 2VZYA 4XLCA 4IKFA 2HNHA 1ETVA 3KCCA 2PI0A 1FTZA 2XF5A 4RB1A 2Z33A 4HF0A 2CIJA 5M5YJ 2DLLA 2K85A 1FMVA 2PMUA 2K5TA 5K5QA 1G3SA 2JRMA 3QPLA 3HOUJ 2CNMA 3D2MA 3J81K 3BR2A 3NWTA 3GB0A 1BJZA 2XASA 4AUXA 4IVNA 5EG0B 3J80K 2R7OA 2GU2A 4NFRA 2VQHA 1FBQA 1UELB 4HLXA 5F09A 3HOSA 2IL4A 4I0AA 3JTGA 5EC4A 3E97A 1R7JA 2ZJPF 4GYIA 3TGNA 1SANA 1JKOC 4IL6C 2VUMJ 1JQGA 1UWYA 5HVFA 3LSJA 2KIQA 1Z67A 2HTJA 3PUFA 1HBXG 2B7EA 1YK3A 5B66C 4XRFA 4MTEA 2XF6A 1WI3A 2OCCH 1W0UA 4UWIA 2EFOA 1VQKI 1ON0A 2R7WA 1RC9A 2H1LA 1K6OA 2DA6A 3ISZA 5G21A 1J0RA 4EFDA 2CUFA 3LAJA 4H0EA 2E60A 5TGTA 1D5VA 2FEZA 3VYSB 4MCSA 5F46A 3BTIA 3MN8A 4MFZA 1MJ9A 3BLNA 4MI4A 4MHZA 3WC6A 2ZEDA 2OF7A 5DV5A 3W6JB 2CF4A 4HV6A 2Z0ZA 5DDGA 1XMAA 2HFHA 4A3IJ 2J8RA 5KK1A 2PJ3A 5J1QA 3IU1A 4FX4A 3GUXA 2HWVA 2V1DA 2W1OA 3DLAA 3ML6A 4Y17A 5DD8A 2P6FA 3LNQA 3PB9X 1GV2A 3H1CA 1PVEA 2X48A 4KFCA 2R92J 2AFWA 5LYIA 2OOTA 1B4AA 4CAWA 4BJ5C 1FT7A 2EZIA 2BY3A 4ZBGA 3F8MA 3MZ8A 4CCOA 1QNTA 4M71A 2AHQA 2ID6A 2EFWA 4RGRA 1VQ9I 1O7LA 1KA8A 3PNVA 3SXOA 3QU6A 2G0BA 1YHQI 5H2FC 4ZYDA 4Q4ZF 2ZW7A 2Y0MA 4FCYA 4X6AJ 2K9MA 1SD6A 3HSEA 3S93A 1NH3A 1TTYA 2R7FA 5DD4A 3QRFF 4I02A 2X0LA 5CJ9A 5B1BH 1X1DA 3C2BA 2JPBA 2WB1A 2M7AA 1WGXA 3KLOA 1MH4A 2X51A 1EV7A 1O3TA 2STTA 2DMUA 3ROUA 4GYGA 2CNSA 2F5EA 3DBLB 4HX7A 2DOAA 1W5TA 1R1UA 3RPQA 1BLLE 1S7AA 2LFBA 3F8CA 1TT0A 4EV0A 1CJWA 3LODA 3MWMA 4IXAA 5K8MA 4Q7AA 2HZDA 1SMTA 3B2YA 2M2EA 1UHWA 3ABKH 1QSOA 3SJXA 3L7WA 1U5TB 1L0OC 4J3GA 3ZN1A 2LKSA 1MW7A 3OYHA 4AYBN 4PFPA 1ZK8A 4P4FA 1UG2A 2QQAA 3JRUA 2Y2ZA 1YQAA 2JMWA 4CZZA 1PUEE 3CO7C 1MBKA 1R58A 1NMTA 1YW9A 4WWCA 4H89A 2KIFA 3ZMTA 3AG3H 3ZMUA 3NH5A 1YE9A 4PXDA 3H8FA 1XGOA 5D4RA 1F9NA 2E7XA 4M3EA 2ZO4A 4CGZA 2IPQX 1XDUA 4V19K 4RB3C 1YLEA 1WH7A 1ETKA 2CTCA 1IU8A 1PUAA 3PSFA 4GDFA 2O8KA 1A36A 2O61A 5A27A 4UV8A 2IT0A 1RO5A 1LFWA 1T56A 1IDYA 4IEJA 5JLWA 4BE2A 2FVGA 2CQXA 4NUBA 2D1HA 3S32A 4U7BA 3RQ4A 1S3JA 3W6SA 1HSJA 4CCJA 1AHDP 2W57A 1Q1VA 1V0CA 4XPDB 3KP3A 1I21A 1PU9A 4XM3A 4DW6A 3L09A 3J81Z 2L01A 5KCMA 1N78A 1S8NA 5K1YA 3J80Z 4WJBA 3CMEI 1ZG5A 5FLVA 1V5EA 5H86A 3I3LA 3JRCA 4KOVA 1YVKA 3MFKA 2X9DA 4DJLA 3RDIA 3I4NJ 2ZEOA 2FOWA 5JVTA 3ZQCA 3RKXA 3ZMZA 1ZQ3P 3V42A 3LSRA 2V26A 5LEJA 5HS7A 3O6BB 4R8HA 2DA2A 1RPWA 1MD0A 2XPVA 1H8LA 3B3SA 1K4JA 5CNPA 4A39A 1ONVA 3VSKA 1IN8A 2ZSIB 2NAZA 4C2TA 3EQLF 3HRTA 4A3MJ 4G1PA 4AVZA 1M4IA 4PJLA 2H6BA 1USTA 2HQ5A 2P6TA 1F36A 4LQGA 3LWFA 1BR2A 3EFAA 2E1MC 3PO2J 1P4AA 4U9ZA 3V38A 2Q7SA 4XMYA 3ZQIA 4XNFA 1P7IA 2L0KA 2MLGA 2ACJA 9ANTA 2GXGA 4JWPA 1Y8RB 4KT6A 2LDUA 1G59A 3D8PA 2IGKA 1WQ2A 4G7ZF 2NVTJ 4DGWB 4Y49C 3VYUB 3PZJA 4F55A 3MKLA 2VN2A 3U9GA 1W7PB 1XSVA 3VFZA 2WYRA 2QENA 3HGGA 5HVHA 2MH2A 3NH4A 4LK1F 1JTXA 4I0BA 3K2ZA 1LJ9A 4LITA 1KZHA 2KL4A 4A32A 2JUGA 2ZNYA 3KEOA 1KONA 3KYDB 1W36D 3U1KA 2B4BA 3VPRA 3ZZIA 1YYVA 4PCQA 2V77A 4KVOE 2WUUA 1LFUP 1Z8WA 3P9KA 3QP5A 2IS2A 3RYOA 2XAUA 1IICA 1YVOA 1W7PA 3JUWA 2LBFB 4D1QA 3FEDA 2HS5A 3U21A 1XJOA 2QSHX 2ZENA 1IG7A 3KFWX 4PSXA 3GF2A 3FIXA 4K30A 5HXDA 2ZJQF 2ESNA 2CXAA 2M4GA 4O23A 2Y69H 4G9YA 3OYNA 2IA2A 4P9FA 2Y75A 1HKTA 1T33A 4NEXA 3HSRA 1PYTB 3OR2C 4E7LA 2P6GA 2PJ4A 2LBFA 2EK8A 3A02A 1IRFA 3QPSA 2PJBA 3U2RA 1XTAA 3LD2A 2DCEA 4BQQA 3HTUA 2KISA 1FBUA 4F3QA 2CNTA 1I1GA 3DQVC 4F52A 3V7SA 3DNSA 1PUFA 4ZY2A 1HQCA 1J7KA 3DEEA 4UB8C 1KYWA 2JWTA 3P2FA 3KP7A 4KOSA 4PXEA 3S9MA 3GFJA 2PRQA 2ZEFA 3J7ZI 3IHUA 3IAM2 2AFZA 2BO9A 3LA7A 4BJ6C 1MNEA 2PVWA 1DE4C 4OC2A 2LY9A 5CPRB 4EVIA 2VT3A 3ZXSA 1FP2A 2K27A 3HZJA 1QQ9A 3CZXA 3DLLF 3H3ZA 1I5ZA 3SJEA 2CRGA 2K3PA 1HDDC 2LNBA 3BR0A 3PB8X 1WK4A 2D1VA 2KRCA 4AU7A 4BYYA 2P7VB 2L02A 2DMNA 4H2KA 3LSGA 1OPCA 4UXNA 1WPKA 3QYEA 4KLVA 1EH6A 2LF7A 4BEHA 1P4NA 4B5PB 2BY1A 1AKHB 1Q2DA 1HCRA 2M5WA 1D0YA 5D5WB 2R5ZB 3BQYA 4NGPA 5CVVA 3W91A 1S7LA 1B87A 1FIAA 5F04A 5HLIA 1LFBA 2CJJA 3HRUA 4IOAF 3EC4A 2L54A 5KTAA 1TT5B 2QYOA 3DP7A 3TW7A 3W2VA 2B9SA 1FYLA 2KLOA 4KITB 4KUBA 4BE0A 2DA7A 3E5XA 3HBLA 3N97A 1MSFC 4RS2A 2PLYA 2XGCA 1OCCH 2R5ZA 4UIAA 3DTKA 3ZQHA 3V7CA 4BBSJ 4A5NA 2VKVA 3N7ZA 1I3AA 3WR7A 3OYJA 3OYKA 4NJRA 4XR6A 3WTSC 3IWZA 4NBQA 2M8GX 3Q9SA 3W6KB 1QQIA 4HF2A 3B3CA 4XKCA 4X3RA 1DUXC 5M5XJ 1R22A 3JAMK 4UUSB 4E0AA 1ZG1A 2PJRB 1IW7F 2FOKA 4JJXA 4A3FJ 2DQRA 5G20A 3DEUA 4DIQA 3PJRA 3KR4A 4M9XA 2REEA 2WZNA 5ICFA 2DI3A 3M1CA 2Q51A 5JM6A 1X3WB 2EV0A 4ZYQA 3QB8A 4P96A 4LG3A 3CUQC 1XN7A 5CKTA 3FBIB 5EMIA 2AO9A 3HSFA 1T38A 1AOYA 3QAYA 4UUSA 2ZXHA 3TEDA 2VBXA 1G4DA 2CU7A 2LSOA 1VQ7I 5E79C 2H1KA 3GXOA 2PJRA 3GY9A 4U0VA 1RETA 4ETSA 5CVUA 2A4NA 4FTHA 4FWUA 4C2MJ 1BC7C 3LA2A 1FPQA 2UWMA 3PEIA 4CYNA 1IRXA 1N71A 1YW7A 3AL0C 2QKMB 2D2WA 1D1CA 4BH9A 4EM1A 3MKWB 2X1CA 1SFEA 2PJPA 2IS1A 1X2NA 2V8HA 1ZG7A 2EA2A 4MFLA 3K4KA 2H27A 2DDBA 3K2KA 3H92A 3MVPA 5LYFA 4CGPA 2ELHA 2BYVE 3HOYJ 4Q5SF 5FKOA 4B13A 4RB2C 4C68A 2ZXJA 4YFXF 1D3YA 1RI7A 4JBAA 2JVGA 4GS4A 4A33A 1V5GA 3CMMA 1RUOA 5EEHA 4M9SA 2C6PA 5DEQA 4Y3OA 1JHHA 5FGMA 3MKYB 2WPXA 3FMSA 1DPRA 2XC7A 4AC0A 1ETXA 1IN4A 2LMDA 3FF5A 2KIUA 5ED4A 2VASA 2JA5J 3CXPA 1ODDA 2EFQA 1Y0NA 5F49A 2KHMA 4ZI6A 2KCWA 4P9UA 2PMZN 2Q43A 4RGXA 3HDDA 5JI6A 1V54H 2JT1A 2AFOA 1LE8B 2GLFA 3BJ7A 5JPHA 4IX7A 2R7DA 3K4CA 3R61A 2LY1A 2HDWA 5GAGJ 4GXHA 4M6GA 1T2KA 1GVDA 1H9GA 1A6IA 2RNJA 3PBEA 2M87A 3EUHA 1VZ0A 3V8JA 1R1TA 3KE2A 2E2JJ 4A6DA 2OR4A 3SFIA 3L2CA 1A6QA 1U3EM 4G6DA 4HOBA 2BHYA 2MA3A 2X4HA 2ELJA 1F5TA 1JTYA 4XPKA 2XROA 1LE8A 1Q7LA 3VDXA 4E6KG 1BR4A 3IAS2 3S3OA 1Z8TA 1VQ6I 2ZBKA 5IB0A 1YMEA 2LC2A 4OINF 1FSHA 2XEIA 5KAIC 2FQ4A 1VHSA 4ZC3A 1BI1A 3KEQA 2JDDA 2IMOA 3HUVA 2CG4A 4YFKF 2XB0X 3F72A 3F8BA 4DNCA 1MMGA 1TF9A 2G7HA 3H9GA 2FUG2 3LAPA 2GIZA 4NF1A 3K70D 1B8IB 1HSTA 2P6EA 4RMNA 1ARMA 2XVCA 4JOMA 3ULQB 1H9TA 2IXSA 2PJ9A 4MMOA 3LSMA 1HW5A 4LUAA 3OYMA 2NYXA 1XB4A 1J59A 4WF2A 3RSNA 5F1JA 3E6CC 1B6BA 1R43A 2JTVA 4JZ0A 2EK5A 2LH9A 2QQ9A 2XAFA 1GT0C 3PFIA 4D5FA 3GWZA 1A5JA 3CUQB 4P4EA 2DQLA 2M0MA 4OC1A 3V8IA 1X10A 2M30A 2RGVA 4XLHA 4U87A 5JH9A 3BJOA 1KUYA 2LYCA 3IEHA 4MJ8A 4CYCB 3T5XA 4ENKA 4ZZDA 1Y1WJ 2BL1A 3FHZA 1T08B 2Q44A 2ZKZA 1T6SA 1UAAA 3D4UA 1JE8A 3RYRA 3BTCA 4UEZA 5CPAA 3W6XA 3JAMZ 2CYYA 3K4JA 3VEPA 1SFXA 3CUQA 2DJNA 2H8RA 2HDDA 1S5LC 2E36A 3WE3A 2DPSA 4ASNA 4AB7A 4BDZA 4XRSA 5E3NA 4CYCA 1ZLIA 1R5ID 3SEQA 4E4HA 1E0EA 1I1SA 2AE6A 4IRIA 2K9QA 1MK4A 2Q2EA 2KT0A 3WTZA 2QVOA 2H94A 4ZDOA 5HOOA 2CY2A 1R00A 2F48A 2VJ4A 2RB7A 4IHWA 1QPMA 2TCTA 1E3PA 2VC1A 3UKGA 2QBYB 4TV7A 4F92B 3TO9A 5LRGA 2DA4A 4XOPA 3IWEA 4R8FA 4GO1A 4DQ2A 2VJJA 2K9NA 4ANJA 4LLNA 4RUHA 2DFIA 1FC3A 1LNWA 3MEXA 1G8XA 4Y15A 2O03A 1PDNC 2Z3KA 3KP5A 3E3VA 4ZZLA 2EZHA 2PE3A 4LOCA 1KQ9A 4C3IJ 2QBYA 2EVNA 1YS6A 4ON0A 1FZPB 2OZGA 2WAQN 4CYPA 4UCPA 1ELLP 4A37A 2GA2A 2R7ZJ 2HDCA 3W2AA 4AG9A 2X7BA 3RO0A 3SZGA 2DU9A 2WWYA 3B6AA 1FOYA 2IS6A 5IPAA 2WTEA 1T0FC 1VF9A 1OCOH 2ABZA 4TNUA 5BMZA 2ZEGA 4NDLA 3FXJA 4JXRA 1LAPA 3OYDA 1J9IA 3GW2A 1ETWA 3L9FA 4RGUA 5BPIA 2KRFA 3DFGA 4LG0B 3QYFA 3FYNA 4II9A 3MRUA 5D6FA 2XDVA 1XGSA 5TISC 1DDNA 1DU0A 2BEIA 2BGCA 1XMBA 3PQKA 2M4KA 3KZZA 4Y4RA 2JPCA 1S29A 1Z4RA 2LREA 3QPTA 4M85A 4NXYA 2L9NA 3KP4A 4LG0A 4P4DA 5G22A 2I79A 1LRZA 3BG5A 2V9KA 4BS9A 3BZCA 4A6EA 1AU7A 1DGWY 2Y0SN 3CUOA 4UB6C 3I64A 2R0QC 5K8NA 2CV1A 4IHYA 1Q2CA 3WU1B 2EQRA 2NXNB 2MD5A 1I1DA 2MH9A 4KOXA 4D9JA 2DN0A 2V1XA 1IOFA 3G2BA 1FNNA 2J8MA 4A12A 1R57A 1LUJB 5CYVA 4AIKA 2DT6A 4QPQA 3A0BC 3FBNB 5K7ZA 3OSFA 2EBJA 4PK4A 4B44A 4FE4A 4MEXF 4NJQA 4HNVA 3OY9A 4C3HJ 3RI4A 3BHXA 2N8GA 3C1DA 3K1PA 1AWCA 4FISA 3HRSA 3PQJA 3B3WA 1ZAOA 4E7IA 3ERMA 5E18F 1ETOA 4R7MA 3P2HA 3VOEA 3IFEA 4RAYA 1JT0A 3A01B 2DEAA 2ZW5A 2X6OA 4J01A 5AG5A 2ECBA 3C26A 1Y0YA 2P5VA 2JBJA 1FIPA 4KJZA 4V2GA 3UY5A 2QLZA 2Q4VA 1S9HA 3GX4X 5F0CA 3M8JA 4M3GA 5FFXA 2QSGX 3OWTA 2FCKA 2CV2A 3DR6A 3IL2A 4XICA 2ZEMA 3BC8A 1R1VA 4KA4A 4NGRA 2ZW4A 4FD6A 2AQEA 3FX3A 3A01A 3QOEA 4L9NA 4CCLA 2E2HJ 2ATRA 1O7FA 1ZYRF 4QWQA 1N75A 1XCVA 2EWNA 1FNOA 2ISYA 5AG6A 1G3YA 2QM3A 1X12A 3ABMH 4H6ZA 2OV7A 3BT9A 4LGWA 4GRIA 3CCUI 4F8ZA 1JUMA 3DLJA 4PGGA 3S6HA 1S6LA 2PJ6A 2QWWA 2ZNZA 1WJFA 3FXRA 4R79A 3OS1A 1K4SA 4YFJA 4I09A 2HQAA 1P92A 1X1AA 2JK3A 3R0JA 4XLPF 1QSNA 4KOWA 2KPMA 2VKEA 1WJDA 3NEUA 3PFEA 1WJCA 4XORA 5IX3A 3GIUA 3TDUC 4MFJA 3Q0VA 1Z3XA 2HOAA 2LF8A 3UR3C 5J47A 4KYWA 4B3XA 3CPXA 4CAEA 3FKIJ 3BROA 2VOOA 3WABA 5JGFA 1QSTA 3WHBA 5JLXA 4KSIA 3FISA 3E1SA 2B58A 2PR8A 2Z11A 2OB0A 4RAZA 4NSQA 1IXSB 2E2IJ 3HTSB 3IWWA 4A69C 3VB2A 2EIMH 3CC2I 1XRYA 3J7AY 4UY8I 2LVSA 3ESWB 3P9IA 4MO7A 3NARA 4P55A 2H09A 2AQFA 4JX4A 1S7NA 2ZC2A 3OYGA 1VNDA 4I6ZA 2R7QA 5K7HA 1IDZA 1U5TC 3BDDA 4Y7NJ 1T0FA 1E3HA 2KQRA 1VHOA 3B7IA 3AKZA 2ZXVA 1CGPA 5B5EC 3CF5F 5DS0A 2I5UA 2VBZA 1O4XA 2Q0YA 3VWDA 3M1EA 4B5OA 1WKMA 4HBLA 3FMCA 1BM9A 4HEA2 5J6XA 1GUUA 2DFEA 2VT2A 3L2NA 1TL8A 1G3WA 3HGYA 2NS0A 3HRMA 3OYCA 1JJ6C 2VLAA 2DODA 3GTGJ 1WHUA 4M6VA 1F57A 4HX4A 4W97A 2POKA 4XK4A 3IKTA 4CRYB 1POGA 4EATA 4BY7J 4IUSA 3KYLA 1SEUA 2EIKH 2PJ2A 3C2HA 4E7ZA 3RKWA 3HOVJ 4A0XA 1CG2A 4MIMA 1IIDA 4K2EA 3H0DA 2HVRA 1K6YA 4ENJA 4G8XA 4PPZA 3CZ6A 2ZSHB 2F5VA 2OA4A 1ZLJA 2OPTA 5EG0A 3S9LA 2B4DB 2FA5A 3JRDA 3Q0WA 1KUXA 4IF5A 2RNGA 3D5LA 5J1UA 4EM0B 3G1LA 1O3QA 1D8KA 3JRFA 4NGTA 3ZPLA 4XPDC 3JTHA 2O0YA 4MTDA 3E5UA 5IT9K 1GHCA 1GHEA 2M0CA 2K9SA 5AG4A 2E1NA 4E70A 1R9TJ 5DWMA 2GM4A 3HYIA 2FE3A 2GFQA 3TO7A 3KX2A 3IIBA 5KTDA 1I50J 4G7HF 5FRMA 4FD5A 3FXMA 3CCRI 4PK2A 2B4DA 3K2AA 4MFPA 4F6AA 5L3FA 3CCYA 2FRHA 4P5OA 1ARLA 1XOVA 2PSWA 4OC5A 4RN7A 5IB9A 4KORA 1O3RA 2MLKA 3H35A 4AG7A 2XB5A 3JSOA 3OSGA 4A3DJ 2PJ5A 1XX5A 2KKOA 3ECHA 1IN6A 5H6QA 1JXSA 1QHGA 3OOUA 4G7OF 3D3SA 3TX8A 2ZXIA 4CAVA 1CQTA 1LB2A 1R4MB 3DF8A 2XSDC 2ZXWH 2Y30A 2FSRA 3TE4A 2I8DA 2GXBA 2XHKA 1ENHA 1VIXA 3FIWA 1P4XA 2NOJB 1YLOA 2IGOA 5GAHJ 2QSFX 1OLTA 4B3AA 2GANA 3I71A 1ORKA 4ZGYB 2L7MP 2DFHA 3IP4B 3K4NA 1HKQA 4XLEA 1LEBA 4ZYGA 5AG7A 4KSFA 1Z77A 2ADUA 5IOYA 2YU9J 1TWCJ 2XEFA 3PUBA 1ZR2A 5AIQA 1J5YA 2H6CA 5CVJA 1Z7LA 3A1YA 3F8FA 1A2ZA 2DK8A 4OIRF 4RAGA 1YR0A 2C6YA 5J3LA 3GTJJ 1F2OA 5LD2C 3EUKL 2R7XA 2Z3LA 2FMLA 2AXLA 3BLYA 2BW3B 2K7LA 3T9YA 4JYKA 3VYRB 4GCVA 3X2QH 2O3FA 2CFOA 5HNFA 2UZKA 4C2UA 1JGSA 1QGPA 2KP6A 1XPXA 1JKPC 3PBBA 4B4CA 1H0MA 1U0JA 4EJWA 3EUAA 5THWA 5GPAA 1B6AA 3AG1H 2L9SA 2QVPA 5AGEA 4A94A 4M3SA 1P6RA 1TQPA 3O3KA 4HX8A 1WWXA 2BW3A 3BG3A 4M6YA 3TP0A 3CC4I 2DPTA 3OYEA 2O4HA 1ETYA 3ZRGA 2AFXA 3CDHA 4LIVA 1YJNI 1U5TA 4IHVA 3SI0A 1AUGA 3BR5A 4CSWA 3KKWA 1DU6A 3LFUA 4OAYA 4BHCA 3BG6A 3TCVA 2GIVA 1VQ8I 1YQEA 1X1BA 4A93J 3EETA 3TQNA 1QZEA 5D4SA 3WGGA 3B02A 5IYDJ 3BI1A 1MDMB 4RDUA 3S3MA 2PRBA 4HDVA 2PJ1A 2VXZA 3FXQA 2O28A 1HOMA 1OYYA 1MH3A 2XRNA 4BACA 2P8TA 3L2VA 3T8WA 2HOTA 4XQFA 2PR1A 2O8XA 6CPAA 1B1BA 2P7CB 1T39A 5JHUA 3D7DA 1V55H 3DPLC 1S3ZA 1J75A 2OZUA 2IQ6A 4MFQA 4L0YB 3M3YJ 2L9RA 3FHNA 1XDSA 5LHHA 1ZKGA 3NA6A 2YNEA 4EJTA 1MBGA 4UFWA 1TWFJ 3DCFA 1MJAA 4NQWB 1BW5A 2AJ6A 4FX0A 3ERED 4MXUA 1KU3A 3E7LA 2VEZA 1V4RA 1YW8A 4ZY1A 4KNYA 2H5MA 4OC4A 5EGOB 4MFDA 2R7SA 1XGNA 1WRJA 2PDOA 4DBRA 3S6KA 1I6XA 3PIOF 2V7FA 2ZW6A 2MABA 2WY8Q 4OMZA 2P4WA 4ZX9A 3CCJI 5IT9Z 2RREA 4PJ0C 3GTKJ 1IGBA 2BUEA 2MC3A 3WODF 3ABLH 1HA8A 1MBHA 2RV8A 4HV5A 5EGOA 3BCBA 3RIRA 1JKRC 2JBKA 4IHSA 4KZTA 4P4BA 4YIFA 3B3VA 1Z05A 3KZYA 4N9IA 1XMXA 2KZVA 5FKNA 3SDBA 5LGNA 2Z5UA 3HKZN 2F5FA 1WVRA 5L3GA 1RESA 1P2FA 2HQNA 3ISPA 3GYHX 1YSJA 3E0KA 1M44A 3N5FA 3WTWC 5GTHC 3S1NJ 1Z6TA 3MCZA 3A2KA 3JREA 3GYAA 1KU7A 2HR3A 4OC3A 3F6VA 2XPUA 3LMSA 1NTCA 1YOVB 1YJ9I 4TWEA 1RNLA 1AMPA 2BZTA 1J2XA 1IV6A 3B35A 4DYOA 2NVQJ 4KUAA 1AYEA 2K4JA 4M3DA 3U1DA 2QYVA 2ZCWA 4QLCU 1U9OA 1VQ5I 5DM6F 3JR9A 4AIDA 3W2WA 1YS7A 5BQTA 1WJ5A 2R98A 1R4NB 2XKOA 1RZ4A 5DCFA 1FOXA 3PFYA 3R9FA 4QPOA 1SFUA 2IAIA 4IK2A 4IHTA 5M3FJ 4OAEA 3ZGKA 1HLVA 4P44A 1XSDA 1R6RA 4ZYEA 4N4OB 2DA5A 2O6GE 4EMSA 1B9MA 2VI7A 3SDGA 4UCNA 1YG2A 2ZB9A 3BTLA 1GXPA 2OZHA 2MYSA 3T1BA 5E96A 2EB7A 3SYTA 1SVOA 3BPXA 2V8GA 2X6XA 5GTIC 2IGNA 2PCUA 1KWMA 4HW0A 3H5NA 1FP1D 5ILSA 2LOOA 1E2XA 2DJIA 4XLAA 4BDYA 3HB9A 5E8IA 4FAIA 2YS9A 3EUHC 5HVQC 3JRIA 1H8AC 1L3LA 4EVYA 3S9NA 5ISVA 3WTTC 2XEJA 2LR8A 1YJWI 2HGCA 5DWNA 1ZRFA 2AFMA 5EZGA 2DXQA 3KP2A 1B59A 3IV5A 3PL8A 5ILVA 1XGMA 3S16J 4LB6B 2XIGA 1FEXA 2CQ7A 3KYCB 3QP6A 4LMYA 4EJVA 2ZFUA 1U2WA 5HDNA 2MC4A 1VI0A 2COBA 2DOEA 4YIIA 3RCOA 4N9HA 2G3TA 3PIPF 3ISXA 1VQPI 1Z21A 4CYOA 2YU3A 3IUOA 3OMYA 4B1RA 1SFOJ 4X2TA 1J4JA 1OKRA 4H4KC 4B8XA 5J1YA 1V5FA 3WTYC 3GO5A 4ONUA 3FXTA 2Y9YA 1I3QJ 3OYIA 2YNCC 4IZZA 4HPSA 3K1MA 3RYPA 4KT5C 4L5EA 4B5PA 1AKHA 2MBFA 4R57A 5F0HA 2A69F 4MHGA 3NE8A 4L18B 2KZGA 3I55I 4ZDLA 5D5VB 5F0FA 2PN6A 1LKXA 3M7GA 4C7HA 1D1BA 1OQYA 5J4YA 2VIXA 3CMAI 1KGSA 2JSPA 1CPXA 1Y9WA 1YW6A 3P7NA 3FF3A 3CP2A 2X1DA 3GCMA 1ZG9A 1LCPA 3A0HC 1KUVA 1Y56A 2QEXI 4UEFA 1QPIA 3FDYA 4X8IA 4A3JJ 4WXDA 5EEGA 3DEWA 3R60A 3GFIA 4C30A 3QQAA 3G3SA 2FQ3A 2Q4ZA 3KQZA 4DJAA 4A2ZA 1BPNA 1MGTA 2K02A 4CAFA 3OIPA 2I3CA 1YREA 2JA2A 4RM2A 2CQNA 3A9LA 3WG7H 3AFHA 1RKTA 2A61A 3CJNA 2L9VA 2OBPA 2AS5F 3CESA 1HW2A 5IP9J 2XEGA 2FMYA 3W6VA 1WZ2A 2RFHA 2A05A 2J5PA 2WC2A 3ABUA 1AA7A 2XKPA 1HDQA 5HODA 2CO5A 2BEOA 8CPAA 2B3UA 1HW1A 1OR7C 2W85A 3FXOA 4HZFA 4IPAA 4D7MA 1I6HJ 3D5RC 5E1XA 3DPUA 4RM3A 2CV0A 3S2HJ 1IJWC 2EV6A 2NVUB 4HNXB 4MFKA 2K5CA 3BR1A 1HC8A 1BIAA 5DCMB 1S7EA 2RVCA 3CCMI 1IC8A 1YX5A 4M3FA 1UZCA 2I10A 3R96A 4BXUA 3QYBA 2B3VA 4X5KA 4LX9A 3WTXC 5IY5H 1REPC 5IT3A 2P0WA 2CFXA 4PZJA 4W1UA 5FKKA 1PCAA 4A0ZA 5E8GA 2STWA 5LEKA 2E5NA 4P4JA 2LD5A 1KQ0A 4I2OA 4CZCA 1IN7A 4IRHA 1U6GA 2JA8J 4NC7A 5J4VA 4YU9A 4P4IA 2W24A 2IGMA 1B9NA 4O6JA 3Q9VA 3CT9A 2FX0A 1GXQA 2Z2SB 2WBMA 3H5ZA 2LLKA 3KGQA 5CQGA 3WT4A 3DKXA 3S2WA 3B8GA 4RA2A 5TRDA 2OTJI 1LDJA 3GFMA 4FQGA 3LOCA 2HZTA 3GZNB 3QODA 4LFUA 5K5RA 2DXIA 3PNYA 1O3SA 4GM5A 3I5UA 5LHIA 4LLLA 4I49A 2NYQA 2IVMA 3G3ZA 4IAVA 3C3WA 1IN5A 4CAXA 4OU0A 2NS8A 5FO5A 4ZDPA 3ZN0A 2EK9A 2VQYA 3CXSA 2QMLA 2ZEHA 1VQNI 2EILH 2E35A 3HG9A 4S04A 1M4GA 3IU2A 1VKCA 3KQXA 2LY2A 3H3VK 2C6GA 5DYMA 2MG4A 1LOKA 2OUMA 1M4LA 3CJRB 3DR8A 4KSAA 2DBBA 2WA0A 4B48A 4MHDA 1WJAA 2JQ7A 2OQRA 2NSMA 3IC1A 5D5UB 2YNCA 4KN4X 2COMA 2HB6A 3B73A 1STZA 3BWGA 4Q38A 1ZELA 2EFPA 3R95A 3BZ6A 4HPQA 1TWHJ 2F4MB 4AYBA 4M6HA 3K4LA 1S7OA 2PFBA 1WJEA 4IQ4A 2CH0A 4MFEA 3SZPA 3RPUD 3FMQA 2VBWA 1Y39A 2B0LA 1H89C 2A68F 5FFZA 2WADA 2YPRA 2CWEA 2X6WA 3SHFA 1N77A 5LGTA 2BSWA 5ICCA 2ZEEA 3RKQA 3LACA 3HM5A 3RJPA 3WTUC 3P5JA 3R9GA 3D1NI 1B8IA 4V2FA 1X2MA 2JRTA 3ZQ7A 4S0HB 2OU2A 2Z99A 3RQIA 3HOXJ 1GYTA 1ZLHA 2WB1N 2JN6A 4CHUA 4EQQA 2HVQA 3R9EA 1SMYF 1IV8A 2EBIA 2Q8KA 1IO2A 2W84A 1WFXA 4CA0A 1YIJI 1RR8C 4HRIA 3K9TA 2J8NA 2IJZA 4IF4A 3E6MA 4N0BA 3GLLA 5D6EA 3EO4A 4DUKA 1X1PA 3UNGC 3D67A 3OYAA 2NVYJ 3FWEA 5JHFA 4A3BJ 2G9WA 7CPAA 4A3EJ 2F5DA 3WC5A 2WPWA 2LK2A 3GTLJ 3L2UA 1QO0D 5EZHA 3I9SA 1K4TA 4QUSA 3EYIA 1ZARA 4U5YA 1S60A 2IJLA 1YX0A 1GVJA 4WXHA 1TW3A 2QCOA 2LTPA 4RAFA 5HNHA 2GOMA 3CDXA 3GLJA 1UJ8A 3JRGA 3CLOA 2FD5A 3R1KA 1OR7A 3B6CA 4NGSA 4B11A 2QZ8A 5HMNA 3PO3J 4YRHA 4F7ZA 4HAMA 5F1RA 1TWAJ 2M8EA 2XGDA 2PJAA 1X58A 2ME0A 5CQEA 4YIRX 2HQRA 3EYYA 1USSA 2RN7A 3OYLA 1ULYA 4LD5A 4PDKA 4LJZF 4Q47A 4FBEA 3VODA 2W48A 3TOBA 4DYRA 3A03A 3F8NA 1OCTC 1IB1E 3VARA 1Z4EA 3AG4H 3FECA 1SAXA 4XRMA 1W36C 4JX6A 5FVJA 1OZPA 3HL2A 4R1HA 2XGXA 3HJEA 4I7HA 1KYZA 2BE5F 3OIQA 3MZHA 3K10A 3KL9A 3LL7A 1IXCA 3M9AA 4AXVA 3M4OJ 4C2XA 2KJCA 3RAMA 2FJ1A 1ZHFA 3BR3A 1UCRA 5C82A 2G0EA 1LDKB 4ZX8A 3Q0UA 4RB0A 2V6EA
chains in the Genus database with same CATH topology
5DWMA 4DGWB 4Y49C 3KX2A 2CS3A 2JVHA 3VYUB 4F55A 5FRMA 2D4PA 3PZJA 4FD5A 4PK2A 2B4DA 5KTDA 4MFPA 4QB9A 3CP8A 4F6AA 4XOTA 2PSWA 4BMHA 4P5OA 2IS4A 4PJJA 4FETA 4UBRA 3SXNA 2FE7A 4LITA 2KL4A 4HKFA 3MKZA 4KORA 4A32A 4AVCA 2JUGA 2B4BA 4RI1A 1KONA 1W36D 3H35A 3OS2A 3ZZIA 4AG7A 4CGNA 4C9YA 3EXNA 4KVOE 2WUUA 4A30A 2FIWA 2IS2A 4ORFA 3RYOA 2XAUA 1QHGA 3OOUA 3D3SA 3TTHA 4CAVA 2ZXIA 1IICA 1YVOA 2GE3A 3JUWA 3KEYA 2LBFB 1SFKA 4D1QA 3U21A 4R3KA 2R7TA 5EBVA 2F5IA 4PSXA 4CUGA 5KHDA 2R7VA 3FIXA 2W82A 4K30A 2FSRA 3D5SC 3TE4A 2I8DA 1M4DA 2CXAA 2M4GA 1P0HA 3OYNA 1I12A 1KZFA 2NOJB 5LFAA 5KTCA 2L7KA 4NEXA 2IGOA 3VWEA 2Z1DA 2W7NA 2W00A 3OR2C 1OLTA 3ZCOA 4E7LA 4RLFA 3BG7A 2LBFA 2P6GA 2Q4YA 1XIXA 2GANA 3TL4X 1QSMA 4ZGYB 3LD2A 2DCEA 3GKRA 4BQQA 3IP4B 3K4NA 4XLEA 3I3GA 5AG7A 5F47A 2CW8A 4F3QA 2CNTA 4KSFA 4B14A 3DQVC 4F52A 4P1WA 3DNSA 3PUBA 3TT2A 5A27A 1Z7LA 3A1YA 2XSJC 4YELA 3DEEA 1YR0A 2FXFA 3H5RA 5LD2C 3P2FA 4KOSA 3EUKL 2R7XA 2Z3LA 3FRMA 2UUZA 3BLYA 2BW3B 3T9YA 3IAM2 3VYRB 5C88A 4NC8A 4CGMA 2V1NA 4BJ6C 2GOXB 1MNEA 2CFOA 4E7KA 5HNFA 4XKBA 4C2UA 2KP6A 4HNTA 5FRNA 2ZPAA 4JLYA 3TOAA 5CPRB 3DDDA 3ZXSA 1U0JA 1QSRA 3EUAA 2K3PA 5AGEA 2L9SA 4BXFA 1WK4A 4M3SA 3L2RA 2KRCA 3DPTA 4AU7A 3RTRA 2BW3A 4E7JA 2DPTA 5I0CA 4H6UA 4BQNA 4L89A 3PNTA 3OYEA 1LVKA 3LSGA 3ZRGA 3FBUA 2RQQA 3QYEA 4BEHA 4KLVA 4LIVA 1P4NA 1BR1A 4HNUA 4B5PB 4JQFA 1Q2DA 3IGRA 4CSWA 3KKWA 3HPHA 1X1CA 1D0YA 2QIRA 3LFUA 1MNDA 4OAYA 3BG6A 3TCVA 2GIVA 4R87A 1NG6A 1X1BA 2K9LA 4BE1A 3W91A 1S7LA 4MY3A 1B87A 2Z3NA 4XNHC 4PV6A 2QECA 3EC4A 4XLFA 5HLTA 2ARHA 3S3MA 2PRBA 1LFPA 1YGHA 5KTAA 2VXZA 2Q2EB 4HSRA 4XKWA 3W2VA 2O28A 4F91B 4BACA 4UA3A 2KLOA 4KITB 4BUPA 2LG4A 3L2VA 2W4SA 4BE0A 1U6MA 4FD4A 4XQFA 3AL0B 3K4MA 2PR1A 3F0AA 4RS2A 3DTKA 5F48A 3DPLC 1S3ZA 3N7ZA 2OZUA 3WR7A 2VBQA 3OYJA 3OYKA 4ITVA 3H4QA 4XR6A 3FHNA 3BJ8A 2KRHA 3DWLE 4XKCA 4U9YA 2YNEA 2JEVA 4E0AA 4UFWA 4NQWB 2PJRB 1MJAA 2AJ6A 1JI8A 1IYLA 2R1IA 4JJXA 2VEZA 5G20A 4DIQA 3PJRA 2QKLB 2YNDA 2H5MA 1CM0A 1XE4A 1UG0A 2REEA 4HG2A 3CF2A 3M1CA 1S7KA 4NNJA 2R7SA 4F0XA 2PDOA 2VJ5A 3QB8A 5CKTA 4LG3A 4C2ZA 2X6YA 4HNWB 4DBRA 5GCNA 3FBIB 3HKZA 3S6KA 5G1ZA 4FD7A 3IWGA 1S5KA 2V7FA 2ZXHA 3EPZA 2PJRA 2ZW6A 4C2YA 3GY9A 1D0ZA 2MABA 2WY8Q 2HV2A 2A4NA 3SHPA 2A6TA 4XKVA 2RREA 4J00A 3I9V2 2BUEA 2UWMA 1HA8A 2MFZA 3BCBA 4CYNA 4KZTA 1IRXA 1N71A 3AL0C 4PSWA 2QKMB 3NWSA 1D1CA 3SDBA 2KZVA 3OR1C 4F93B 2X1CA 4LIUA 3CJQB 3VSLA 3MKWB 2IS1A 3G8WA 4B43A 4XL9A 3E0KA 4MFLA 2R4GA 3K4KA 5H84A 3LMMA 4CS0B 1M44A 4CGPA 1PYVA 3A2KA 1Z9UA 2BOLA 2PMZA 3GYAA 4B13A 4C68A 2KMUA 4KLWA 2Q1ZB 4F0YA 2JVGA 4GS4A 4A33A 1V5GA 3CMMA 4C7IA 5IV0A 2OC6A 4KUAA 2WY7Q 4Y3OA 4AVAA 2XF7A 4MY0A 3SEZA 3OYBA 3MKYB 2WPXA 2CMPA 2CUZA 2VQGA 4BJTA 2LRDA 2XC7A 3CXPA 3W2WA 2KDOA 2VASA 2Z10A 4UFXA 1WJ5A 2R98A 5F49A 2KHMA 3S6FA 2KCWA 4CH7A 3PFYA 3R9FA 4QPOA 4PFOA 1TZLA 5JPHA 3BJ7A 4PK3A 4OAEA 3ZGKA 4IX7A 3K4CA 2LY1A 2HDWA 4CCNA 2WAEA 3K70C 4JXQA 1R6RA 2Z16A 2EUIA 4N4OB 4CCMA 3HUGB 3MD2A 4OWRB 1VZ0A 4OADA 1XEBA 4UWJA 2VI7A 3JVNA 4BBHA 2R7UA 3W3CA 4UCNA 3VYTB 2OZHA 1ZO0A 3DU5A 2X1EA 2MYSA 2ELJA 4KVME 4KS9A 3H9JA 5E96A 2R7HA 4CGLA 1ERDA 4X0GA 3SYTA 2BVLA 2NMTA 4XPKA 2X6XA 3VDXA 2IGNA 4QVTA 4BU2A 4E6KG 3H5NA 1BR4A 3E0JB 3IAS2 4ZTFA 3S3OA 2LOOA 3N05A 4KOTA 4XNHB 4JD6A 2HQYA 5IB0A 3ZR8X 1PJRA 1Y6IA 2DJIA 2LC2A 4XLAA 4BDYA 1VHSA 1TIQA 4ZJZA 3K9UA 2B5GB 3EUHC 4ZC3A 5HVQC 2JDDA 4EVYA 4KOYA 5ISVA 4DNCA 3DKYA 1MMGA 4B10A 4UFVA 3LSKA 3H9GA 3EY5A 1NE9A 4CYQA 2FUG2 1NSLA 5DWNA 2FIAA 2DXQA 3F9KA 4XN0A 2L5QA 2Z3PA 3TBIA 3K70D 1BO4A 3L2WA 2P6EA 4NF1A 4RMNA 4XN3A 3PL8A 3K6GA 3BCAA 1XMTA 1MMDA 3HXLA 4JOMA 2IXSA 2PC1A 2B5GA 3LSMA 2M3AA 4LUAA 3OYMA 2YGWA 4QBJA 1DP3A 3S3NA 3DSBA 3GBGA 3RSNA 2ZFUA 3LSIA 1B6BA 2MC4A 3RCOA 4YEJA 2G3TA 2LH9A 4YGOA 1Z3YA 3ONQA 3TO7A 3S8PA 4BL0B 1Z21A 1EA3A 2X85A 4CYOA 1MMNA 2O5RA 1DGRM 3IUOA 3OMYA 2JLMA 4ZYAA 1J4JA 2M0MA 3HC7A 2F4IA 3V8IA 2I00A 4H4KC 4QC6A 1V5FA 4XLHA 4U87A 2VXKA 4ONUA 1KUYA 3FXTA 2LYCA 2VL8A 4L8AA 4MJ8A 2YNCC 2A5WA 4OAZA 3OYIA 2L2OA 4IZZA 2BL1A 3C2GA 1SAUA 1Y9KA 1P9QC 2Q44A 4B5PA 3HPGA 2DT7B 1UAAA 1NG7A 2UV1A 4HSTA 2D4OA 3F5BA 4R57A 3W6XA 5BWAB 3K4JA 4ZDLA 3ZQQA 1MMAA 1WWZA 3QAHA 1GLNA 1LKXA 2DPSA 3TMOA 4C7HA 4AB7A 1D1BA 4BDZA 4B12A 2C27A 2VIXA 4II2A 2JSPA 2CW7A 4BQOA 1Y9WA 3SEQA 4E4HA 2AE6A 3CP2A 1E0EA 2X1DA 1MK4A 4PJMA 5A28A 2VXDA 1Y56A 5HOOA 4ZDOA 2VJ4A 2VQLA 1KUVA 2CY2A 4KVXA 3FDYA 1QU3A 4NCZA 3VWBA 4II3A 4Y33A 3PSIA 4F92B 2WAQA 3TO9A 2HUZA 1J09A 4C30A 4XOPA 3G3SA 3IWEA 2OH1A 2HPIA 3ZJ0A 4A2ZA 2VJJA 4DJAA 3A4CA 4ANJA 3OYFA 4B47A 4CAFA 1G8XA 3OIPA 2RC4A 2VQCA 2VZYA 4XLCA 4IKFA 2HNHA 2JA2A 1YREA 2Z3KA 4RM2A 3NE7A 2XF5A 3A9LA 1FMVA 2EVNA 2K5TA 2REFA 3AFHA 5J8CA 2OZGA 2Q04A 4CRZB 3CESA 4UCPA 4CYPA 2CNMA 3D2MA 4CCKA 3NWTA 3D2PA 2R7OA 3W2AA 4AG9A 2X7BA 2VQHA 1UELB 1AA7A 2M7BA 3SZGA 3HOSA 2IL4A 4R3LA 5EC4A 2HVSA 2IS6A 2B3UA 2R8VA 1OR7C 2FS5A 1T0FC 3D5RC 1T95A 3MGDA 3FNCA 3DPUA 4RM3A 2CV0A 4HNXB 4MFKA 4JXRA 2K5CA 3OYDA 3H5AA 5J8FA 4E7SA 1YK3A 1Q2YA 2XF6A 3QYFA 1YX5A 3FYNA 4UWIA 3R96A 4RLQA 3QYBA 2CUJA 2Y0SA 2R7WA 1ON0A 2B3VA 4LX9A 4X5KA 4II9A 5G21A 2XDVA 2P0WA 5HH1A 1FY7A 2BEIA 2E5NA 2E60A 3TO6A 2M4KA 4Y4RA 5TGTA 2G3AA 4CZCA 3VYSB 1Z4RA 4KOUA 3L2QA 4NC7A 2LREA 2R7RA 5F46A 1FMWA 4UCMA 4M85A 4MFZA 2IGMA 1MJ9A 3BLNA 2L9NA 1X4PA 4MI4A 4NXYA 2Z2SB 2WBMA 3F8KA 5G22A 2I79A 1LRZA 2V9KA 4BS9A 5KNLA 2Z0ZA 1IYKA 1DGWY 5CQGA 2PQ8A 3H5ZA 4N4NB 2J8RA 3PP9A 2CV1A 1D1AA 1Q2CA 3DKXA 1I1DA 4ZTJA 1S7FA 3H9QA 3B8GA 4D9JA 3IU1A 4KOXA 4A31A 3G2BA 2J8MA 3QODA 2W1OA 3DLAA 1X4OA 2DXIA 1R57A 4KUBA 3PNYA 2P6FA 2DT6A 4QPQA 4YRVA 4I49A 3FBNB 4IQJA 4PK4A 4B44A 4G6TB 4CAXA 4ZDPA 2VQYA 3OY9A 3CXSA 2QMLA 2V4JC 4CAWA 4BJ5C 3HG9A 2VPLA 1M4GA 3IU2A 4ZBGA 3OL3A 1VKCA 2LY2A 2HPMA 2MD0A 2JDCA 4E7IA 4CCOA 2OUMA 2E5ZA 3CJRB 3PNVA 3DR8A 3SXOA 2VKDA 2G0BA 3P2HA 4KSAA 4HNYB 4B48A 2WA0A 2ZW7A 2ZW5A 4MHDA 2Y0MA 1WJAA 2K9MA 4J01A 5AG5A 3C26A 2VJIA 3S93A 4FASD 2YNCA 4KJZA 2F6CA 1X1DA 3UY5A 2VKHA 4Q38A 2WB1A 1ZELA 2M7AA 1S9HA 2Q4VA 3R95A 2X51A 3LSHA 4HPQA 4AYBA 3M8JA 3K4LA 1WJEA 4IQ4A 2CH0A 1UFHA 2CNSA 3RPUD 2DOAA 3OWTA 2CV2A 2FCKA 3DR6A 2WADA 3BC8A 2X6WA 1CJWA 1TT0A 1N77A 3HOTA 2ZW4A 2AQEA 2BSWA 3LODA 4FD6A 2HZDA 3QOEA 3MMYB 4CCLA 1L0CA 2ATRA 3R9GA 1X19A 1QSOA 1N75A 4BEHB 3TFYA 5AG6A 4H6ZA 4J3GA 2OV7A 3T90A 2OU2A 1MW7A 4MBUA 3DU6A 3OYHA 4GRIA 2HVQA 3R9EA 5FROA 4PFPA 4OLLA 3S6HA 1WFXA 4CA0A 2J8NA 4HRIA 4R79A 1WJFA 4BGDA 3OS1A 1NMTA 4YFJA 2HQAA 4H89A 3K4BA 1X1AA 1YX3A 1QSNA 3EO4A 4XONA 4KOWA 2BVMA 2KPMA 2Q7BA 3UNGC 1WJDA 4E7HA 3OYAA 1YE9A 1M1DA 1WJCA 4PJNA 4XORA 4AVBA 5IX3A 4MFJA 1Z3XA 5JHFA 3UR3C 3JTKA 3DTIA 4B3XA 3OL4A 2FL4A 4CAEA 4PUSA 2WPWA 1QSTA 2Z3MA 3FKJA 4XPLA 3L2UA 1YLEA 3E1SA 2WAFA 2B58A 2PR8A 2Z11A 3I9SA 2OB0A 4QUSA 4NSQA 1PUAA 3PSFA 4U5YA 1S60A 1YX0A 1RO5A 3J7AY 3DTEA 2E1MB 1BOBA 4BE2A 2AQFA 4NUBA 3S32A 5HNHA 2GOMA 4U7BA 3RQ4A 4KISA 1S7NA 2WSAA 4CCJA 3OYGA 3W6SA 1QHHD 2R7QA 1V0CA 1MJBA 3R1KA 4XPDB 4MLOA 1PU9A 1I21A 4MFQA 2KQRA 4XM3A 4Q36A 1Y7RA 3AKZA 2ZXVA 4YRHA 4B11A 4E8OA 5HMNA 5KCMA 4B5OA 1N78A 2Q0YA 3PGPA 3VWDA 5H86A 1DQUA 1V5EA 3I3LA 4KOVA 4Y49B 4HEA2 5CQEA 1YVKA 3OYCA 3OS0A 3OYLA 2VLAA 2Z3OA 3V42A 3TOBA 2V26A 1IB1E 4R9MA 1Z4EA 4CRYB 2VB6A 2FT0A 3OWCA 3S6GA 1XF8A 4DOZA 4EATA 3FB3A 1W36C 4IUSA 1K4JA 5CNPA 5FVJA 3KYLA 3VSKA 1RXTA 3C2HA 2VZZA 2ZSIB 4E7ZA 4C2TA 1OZPA 1IIDA 1WJBA 3H0DA 3HL2A 1D0XA 4AVZA 1K6YA 2HVRA 1M4IA 4PJLA 3OIQA 4DBQA 3CXQA 3CZ6A 2ZSHB 2F5VA 3K10A 1BR2A 3LL7A 3EFAA 2E1MC 2B4DB 5JQ4A 4E2AA 4U9ZA 4C2XA 1KUXA 4IF5A 4CGOA 2RNGA 4XMYA 3D5LA 4XNFA 4XPDC 2HU9A 5C82A 4A95A 1LDKB 4JWPA 1GHEA 4KT6A 3D8PA 1G59A 5AG4A 2IGKA 2V6EA 1SQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DWM A;  4Y49 C;  3TO7 A;  5EBV A;  3PZJ A;  4PK2 A;  2D4P A;  4FD5 A;  5KTD A;  2B4D A;  4F6A A;  4QB9 A;  2PSW A;  4BMH A;  4UBR A;  3SXN A;  2FE7 A;  4HKF A;  4KOR A;  4AVC A;  2B4B A;  4RI1 A;  4AG7 A;  3ZZI A;  4KVO E;  3EXN A;  2FIW A;  4ORF A;  3TTH A;  3RYO A;  4CAV A;  3D3S A;  1IIC A;  1YVO A;  2GE3 A;  3JUW A;  4R3K A;  2F5I A;  4PSX A;  3FIX A;  4K30 A;  2FSR A;  3TE4 A;  1M4D A;  1P0H A;  1I12 A;  1KZF A;  5KTC A;  4NEX A;  3VWE A;  2NMT A;  2Q4Y A;  2P6G A;  1XIX A;  2GAN A;  1QSM A;  3LD2 A;  3GKR A;  3I3G A;  5F47 A;  2CNT A;  3DNS A;  3TT2 A;  1YR0 A;  2FXF A;  3P2F A;  4KOS A;  3T90 A;  3FRM A;  3T9Y A;  5C88 A;  2ZPA A;  4JLY A;  3TOA A;  3DDD A;  1QSR A;  1WK4 A;  4M3S A;  5I0C A;  4H6U A;  4L89 A;  3FBU A;  4KLV A;  1P4N A;  4B5P B;  1Q2D A;  3IGR A;  3KKW A;  2QIR A;  3TCV A;  2GIV A;  4R87 A;  3W91 A;  1S7L A;  4MY3 A;  1B87 A;  4XNH C;  4PV6 A;  2QEC A;  3EC4 A;  2ARH A;  2PRB A;  1YGH A;  5KTA A;  2O28 A;  4UA3 A;  5J8F A;  4KUB A;  4FD4 A;  1U6M A;  4RS2 A;  2PR1 A;  3F0A A;  5F48 A;  1S3Z A;  3N7Z A;  2OZU A;  3WR7 A;  2VBQ A;  3H4Q A;  3BJ8 A;  4U9Y A;  2JEV A;  4E0A A;  1MJA A;  2AJ6 A;  1IYL A;  2R1I A;  4JJX A;  2VEZ A;  2H5M A;  1CM0 A;  1XE4 A;  2REE A;  1S7K A;  2PDO A;  3QB8 A;  4HNW B;  5GCN A;  3S6K A;  4FD7 A;  3IWG A;  1S5K A;  2ZW6 A;  3GY9 A;  2HV2 A;  2A4N A;  3SHP A;  2BUE A;  4KZT A;  1N71 A;  4PSW A;  3G8W A;  3E0K A;  5H84 A;  4CS0 B;  1M44 A;  1Z9U A;  3GYA A;  4KLW A;  4F0Y A;  4GS4 A;  5IV0 A;  4KUA A;  4AVA A;  4MY0 A;  2WPX A;  3CXP A;  2Z10 A;  5F49 A;  2R98 A;  3S6F A;  2KCW A;  3R9F A;  5JPH A;  3BJ7 A;  4PK3 A;  4OAE A;  4JXQ A;  2EUI A;  4OAD A;  1XEB A;  4UWJ A;  2VI7 A;  3JVN A;  2OZH A;  4KVM E;  5E96 A;  2R7H A;  4XPK A;  4QVT A;  4KOT A;  4XNH B;  4JD6 A;  2HQY A;  5IB0 A;  1VHS A;  1TIQ A;  3K9U A;  2B5G B;  2JDD A;  4EVY A;  4KOY A;  5ISV A;  4DNC A;  3EY5 A;  1NE9 A;  1NSL A;  5DWN A;  2FIA A;  2DXQ A;  4NF1 A;  1BO4 A;  2P6E A;  1XMT A;  2PC1 A;  2B5G A;  4LUA A;  4QBJ A;  3DSB A;  1B6B A;  2G3T A;  4YGO A;  2JLM A;  1J4J A;  3V8I A;  2I00 A;  4QC6 A;  2VXK A;  4ONU A;  1KUY A;  3FXT A;  4L8A A;  4MJ8 A;  2BL1 A;  1Y9K A;  2Q44 A;  4B5P A;  4R57 A;  2D4O A;  3W6X A;  3F5B A;  1WWZ A;  3QAH A;  4AB7 A;  2C27 A;  1Y9W A;  2AE6 A;  1MK4 A;  1KUV A;  2CY2 A;  4KVX A;  4NCZ A;  3TO9 A;  2HUZ A;  3G3S A;  2OH1 A;  3ZJ0 A;  2RC4 A;  2VZY A;  3NE7 A;  1YRE A;  2K5T A;  2EVN A;  2REF A;  5J8C A;  2OZG A;  2Q04 A;  4CRZ B;  2CNM A;  3D2M A;  3D2P A;  4AG9 A;  2X7B A;  2IL4 A;  4R3L A;  5EC4 A;  2B3U A;  2R8V A;  2FS5 A;  3MGD A;  3FNC A;  4HNX B;  4JXR A;  1YK3 A;  1Q2Y A;  3FYN A;  4UWI A;  3R96 A;  2B3V A;  1ON0 A;  4X5K A;  4LX9 A;  4II9 A;  2P0W A;  5HH1 A;  1FY7 A;  2BEI A;  3TO6 A;  2G3A A;  1Z4R A;  4KOU A;  5F46 A;  4M85 A;  1MJ9 A;  3BLN A;  4MI4 A;  4NXY A;  3F8K A;  2I79 A;  1LRZ A;  2Z0Z A;  1IYK A;  2PQ8 A;  3PP9 A;  2J8R A;  1Q2C A;  1I1D A;  1S7F A;  4KOX A;  3B8G A;  2J8M A;  1R57 A;  2P6F A;  4I49 A;  4CAX A;  2VQY A;  3CXS A;  2QML A;  4CAW A;  1M4G A;  4ZBG A;  1VKC A;  2JDC A;  3DR8 A;  3SXO A;  3P2H A;  2G0B A;  4HNY B;  4MHD A;  2ZW7 A;  2ZW5 A;  2Y0M A;  3C26 A;  3UY5 A;  2Q4V A;  3R95 A;  2CNS A;  1UFH A;  2FCK A;  3DR6 A;  1CJW A;  2ZW4 A;  3LOD A;  4FD6 A;  2BSW A;  1L0C A;  2ATR A;  3R9G A;  1QSO A;  3TFY A;  4H6Z A;  4J3G A;  2OU2 A;  4MBU A;  3R9E A;  4OLL A;  3S6H A;  2J8N A;  1NMT A;  4YFJ A;  4H89 A;  1QSN A;  3EO4 A;  4KOW A;  2Q7B A;  1M1D A;  5IX3 A;  4AVB A;  2FL4 A;  2WPW A;  1QST A;  4XPL A;  1YLE A;  2B58 A;  2PR8 A;  2Z11 A;  3I9S A;  2OB0 A;  4QUS A;  4NSQ A;  1PUA A;  4U5Y A;  1S60 A;  1YX0 A;  1RO5 A;  1BOB A;  1S7N A;  3W6S A;  1V0C A;  1MJB A;  3R1K A;  4XPD B;  1PU9 A;  1I21 A;  4E8O A;  5HMN A;  1Y7R A;  2ZXV A;  4YRH A;  4B5O A;  3VWD A;  2Q0Y A;  3PGP A;  5H86 A;  4KOV A;  4Y49 B;  1YVK A;  3TOB A;  1IB1 E;  4R9M A;  1Z4E A;  4CRY B;  2FT0 A;  3OWC A;  3S6G A;  1XF8 A;  3FB3 A;  4IUS A;  1K4J A;  5CNP A;  5FVJ A;  2VZZ A;  1RXT A;  1OZP A;  1IID A;  1M4I A;  3CXQ A;  3EFA A;  5JQ4 A;  2B4D B;  4E2A A;  4U9Z A;  1KUX A;  4IF5 A;  4XPD C;  5C82 A;  4JWP A;  1GHE A;  3D8P A;  1SQH A; 
#chains in the Genus database with same CATH topology
 3FMR A;  4UUV A;  2CS3 A;  2D4P A;  1K79 A;  1R36 A;  2EPF A;  4P45 A;  2HOE A;  4XOT A;  2P5L C;  2IS4 A;  4AIJ A;  4UBR A;  4ABZ A;  4WX9 A;  3SXN A;  2E34 A;  3MKZ A;  4AVC A;  4RS8 A;  4RI1 A;  1FT9 A;  3OS2 A;  2A6H F;  4AM3 A;  1LAN A;  2GLJ A;  2ZME B;  3TTH A;  2M1B A;  1OBR A;  4XSX F;  2GE3 A;  3GEZ A;  3KEY A;  1SFK A;  1BW6 A;  1CP7 A;  2R7V A;  4CUG A;  5KHD A;  4U0Y A;  2GAU A;  4BY1 J;  1K83 J;  2EJR A;  1P0H A;  2AXT C;  3I1U A;  3TKY A;  3JSP A;  3PB7 X;  5LGU A;  2VI6 A;  3DKW A;  4HYE A;  2VL1 A;  1BL0 A;  5KTC A;  3FH4 A;  2OJE D;  2L7K A;  5CLS A;  1T8I A;  3SZT A;  4UNO A;  1XCB A;  1XS9 A;  4C2Y A;  2W7N A;  2NMT A;  2W00 A;  2Q4Y A;  4RLF A;  1OYW A;  3WGH A;  3TL4 X;  2NVX J;  2Y9Z A;  1QSM A;  1IRG A;  4JX5 A;  5F47 A;  4B14 A;  2CW8 A;  5FLX K;  4P1W A;  5EEA A;  1UHM A;  3ZQG A;  1BAV A;  4YEL A;  3T0Y A;  2PMH A;  3H5R A;  3BJA A;  3T90 A;  3FRM A;  5C4X J;  4MHY A;  2UUZ A;  4A31 A;  5K5O A;  2V1N A;  2VE9 A;  4CGM A;  4XKB A;  3F21 A;  3O2P E;  3TOA A;  1HDP A;  1R49 A;  1FSE A;  3SI2 A;  2Q0O A;  1ZRD A;  1QSR A;  2TRT A;  2PX9 A;  2DMQ A;  3I53 A;  5K7F A;  3FK7 A;  1IY7 A;  2VBY A;  1IF1 A;  3L2R A;  5DUI A;  4E7J A;  1Z5R A;  5I0C A;  3L1P A;  4Y13 A;  3HOZ J;  4H6U A;  4BQN A;  3PNT A;  1LVK A;  3FBU A;  2YX4 A;  1NK2 P;  1Z2L A;  3I54 A;  4JQF A;  3SJG A;  1ZG8 A;  2IEK A;  2DO7 A;  3IGR A;  4NGN A;  4NHJ A;  4MEY F;  1X1C A;  2QIR A;  4M73 A;  3KZW A;  2ANP A;  1ZGW A;  1KU2 A;  1BA5 A;  2JUC A;  4UVB A;  2E1C A;  4B09 A;  5E3M A;  1IGN A;  2QEC A;  5HLT A;  1LFP A;  3FX6 A;  4HSR A;  4XKW A;  4MNU A;  1VQ4 I;  1SD5 A;  1BI3 A;  5J8F A;  4UA3 A;  4BUP A;  2LG4 A;  4FD4 A;  2W4S A;  1U6M A;  2F5C A;  3K4M A;  2ME6 A;  3F0A A;  3DV8 A;  3PM1 A;  5F48 A;  3COA C;  2VBQ A;  2PJ8 A;  1MZB A;  2A6E F;  4ITV A;  4I76 A;  2TDX A;  3HHG A;  4R76 A;  3M8E A;  2KRH A;  3DWL E;  4YG2 F;  3RZA A;  3CJT B;  3IJ3 A;  2QUF A;  3BXM A;  1R5G A;  4A3G J;  1YTY A;  3KAS A;  2V8D A;  3V7R A;  2VOP A;  1TP4 A;  5B3S H;  4U0W A;  5DM7 F;  3HOW J;  1CM0 A;  1XE4 A;  1UG0 A;  2DPD A;  2YND A;  3CF2 A;  4MCR A;  1SVL A;  4F0X A;  3LST A;  5LHG A;  4C2Z A;  2BY2 A;  5GCN A;  2M34 A;  4FD7 A;  2HYF A;  1YFH A;  1S5K A;  2IW5 A;  1MBJ A;  1D0Z A;  1OFC X;  1IXR C;  2DPU A;  2HV2 A;  3R0A A;  4GXO A;  1QVU A;  3HEF A;  2A6T A;  4J00 A;  2XRL A;  2L7F P;  3ZOB A;  2E19 A;  2BBY A;  4GGG A;  1TC3 C;  2NNN A;  4NGQ A;  5LYL A;  4EEF G;  4D7N A;  1GV5 A;  4PSW A;  2NNY A;  2R3S A;  1RRJ A;  1JJ8 C;  1ZR4 A;  3SI1 A;  1U9N A;  2WV1 A;  3CJQ B;  4LIU A;  3VSL A;  1RR7 A;  4ENM A;  4UIB A;  4B43 A;  2HYJ A;  3CCE I;  2FXA A;  2R4G A;  1P4W A;  3I58 A;  3SQN A;  1QA6 A;  4JYW A;  4LQ6 A;  4CS0 B;  4HDU A;  4OIP F;  1PYV A;  4U7D A;  1LQ1 A;  2BOL A;  1Z9U A;  2PMZ A;  3VAT A;  1NHA A;  3WE2 A;  3VH9 A;  3AG2 H;  4R6T A;  2KMU A;  4CYD A;  4KLW A;  4Q48 A;  5D8L B;  1Z6R A;  4FUU A;  3OV8 A;  1A04 A;  4F0Y A;  4C7I A;  5AON A;  3R4K A;  5IV0 A;  3IRQ A;  3IRR A;  2OC6 A;  1IAW A;  3E6D A;  2WY7 Q;  2ZOG A;  2R5Y B;  4AVA A;  3ASO H;  4MY0 A;  1JT6 A;  5LRR A;  3SEZ A;  2D45 A;  2CMP A;  1WI9 A;  2FNA A;  5FLM J;  2UXN A;  3MQ0 A;  3WG9 A;  1VQO I;  2Z10 A;  3TC8 A;  4UFX A;  1G3T A;  2P5K A;  1LAM A;  4CH7 A;  5CBM A;  1UFM A;  1TZL A;  2MW8 A;  4KMF A;  1F1Z A;  4CCN A;  2WAE A;  3K70 C;  2VOD A;  1OMI A;  2Z16 A;  5ILU A;  2EUI A;  4OWR B;  3MD2 A;  5C3E J;  2R5Y A;  4OAD A;  1XEB A;  4L5I A;  5M3M J;  2PIY A;  4BBH A;  1F2P A;  3W3C A;  5C44 J;  1U78 A;  5FLX Z;  3G73 A;  3KR5 A;  4IHX A;  4K3N A;  4KVM E;  4KS9 A;  2R7H A;  4CGL A;  5GAD J;  3WTV C;  3ECO A;  2F7V A;  4ESF A;  4BU2 A;  1Y7E A;  5ELY A;  3D7G A;  3E0J B;  4KOT A;  3GTQ J;  3BY6 A;  2OQG A;  2ZJR F;  1U8B A;  4BD9 A;  3ZR8 X;  4KMU X;  1YIT I;  3CCV I;  1TIQ A;  4ZJZ A;  3LA3 A;  6PAX A;  2VPR A;  1W5C C;  4D5C A;  1ITY A;  4B10 A;  3CMY A;  1ZRC A;  2EIJ H;  3LSK A;  4OC0 A;  3EY5 A;  4CYQ A;  1ACI A;  2DMT A;  2FIA A;  2E71 A;  5IYB J;  1Z9C A;  3FEE A;  1NK3 P;  2Z3P A;  1BO4 A;  2LKX A;  1F4K A;  4XN3 A;  2ZFW A;  1XMT A;  3K6G A;  1TLH B;  2PC1 A;  3CCQ I;  4UVC A;  3SFZ A;  1R5H A;  1Z7U A;  3DSB A;  3GBG A;  1N25 A;  1Z3Y A;  3ONQ A;  3S8P A;  4BL0 B;  1EA3 A;  4M6X A;  1MMN A;  2O5R A;  1DGR M;  3CTA A;  2F2E A;  2A07 F;  4ZYA A;  3HC7 A;  1ZN2 A;  2F4I A;  2I00 A;  3CO6 C;  1G6N A;  1FWZ A;  4L8A A;  1IZ1 A;  1JWQ A;  2K4B A;  2VL8 A;  2A5W A;  5H6R A;  4ESJ A;  1TNS A;  5BPD A;  1BI2 A;  1SAU A;  3E6B A;  5F6F A;  1Y9K A;  2M45 A;  2O9L A;  3HPG A;  2DT7 B;  1NG7 A;  2UV1 A;  4HST A;  2QF7 A;  4W9Y A;  2DYS H;  1WCM J;  4A0Y A;  1DTD A;  3M8F A;  1YIO A;  1WWZ A;  3KP6 A;  3KHZ A;  3M07 A;  4EGY A;  2W25 A;  4B12 A;  4OME A;  4II2 A;  5D5X B;  2CW7 A;  3I59 B;  4BQO A;  1MDM A;  5LYD A;  3GZ6 A;  4PJM A;  5GAE J;  5A28 A;  4G94 A;  3JW4 A;  1SVM A;  2VQL A;  4A3C J;  3ABT A;  1EE3 P;  2PEX A;  4MQ9 F;  4DZJ A;  1TNT A;  5ERI A;  2B63 J;  3FVL A;  3VWB A;  4NCZ A;  5LBQ A;  4O5V A;  1FTT A;  3PSI A;  2F8H A;  2WAQ A;  4CPA A;  2HUZ A;  2VC0 A;  2A5Y B;  2GBY A;  2YUS A;  2DK5 A;  4M9Z A;  3I59 A;  2HC9 A;  4B47 A;  1F43 A;  4OIW A;  4NQW A;  3RBU A;  1HEE A;  3CCL I;  4KN7 X;  3NE7 A;  2F4O B;  4UVA A;  4KIB A;  2REF A;  2PIZ A;  5J8C A;  2Q04 A;  3WC7 A;  4CRZ B;  4NGM A;  4XSZ F;  4CCK A;  2K86 A;  3FK6 A;  2V6C A;  3D2P A;  1R23 A;  1H88 C;  5H20 A;  2M7B A;  2BY0 A;  5DUK A;  3ELK A;  4M74 A;  4R3L A;  5JFR A;  2HVS A;  2R8V A;  3PFO A;  2GRE A;  3DBR B;  1QZY A;  2FS5 A;  1T95 A;  3MGD A;  1FYM A;  1D8J A;  3FNC A;  4L9T A;  4BHP A;  2CSO A;  2ZEL A;  1Y8Q B;  5J40 A;  3H5A A;  2EA4 A;  5LRS A;  4E7S A;  3KLN A;  1Q2Y A;  1HF0 A;  2RAE A;  4X1E A;  4EJO A;  4RLQ A;  2CUJ A;  2Y0S A;  3IH2 A;  3RPU A;  2C6C A;  3FXL A;  3SXY A;  5HS8 A;  4EGZ A;  3B3T A;  2Z9O A;  1CPS A;  1MIJ A;  5HH1 A;  1FY7 A;  4D0P A;  1LDD A;  3R6S A;  3JRA A;  1TWG J;  1EH8 A;  5E1W A;  3TO6 A;  2DA1 A;  2G3A A;  3WU0 A;  4OP4 A;  4KOU A;  3L2Q A;  2R7R A;  1YLF A;  1FMW A;  4UCM A;  5EF6 A;  5DS9 A;  1X4P A;  1XBU A;  2JEW A;  5I4M A;  4NC6 A;  4OIQ F;  2EO8 A;  3F8K A;  2FBI A;  5IP7 J;  5KAF C;  5KNL A;  2GWR A;  2PQ8 A;  4QIW N;  2JA7 J;  1IYK A;  4N4N B;  1TXR A;  3PP9 A;  4ONW A;  3CD6 I;  1D1A A;  2XAQ A;  1E3O C;  1W4M A;  4ZTJ A;  1S7F A;  1SD4 A;  2PG4 A;  3H9Q A;  4UF4 A;  5EYR A;  1XG1 A;  1X4O A;  2VE8 A;  2WV0 A;  4YRV A;  1TQM A;  1TF8 A;  3IO1 A;  4MHN A;  4IQJ A;  2RKH A;  2XV4 S;  4G6T B;  5JR3 A;  3KI9 A;  1SD7 A;  1GDT A;  2AFU A;  1XD7 A;  2DTZ A;  2V4J C;  3GME A;  2IA0 A;  1MMS A;  3Q5F A;  4HA8 A;  2E7W A;  2VPL A;  1Z1D A;  2HKO A;  3OL3 A;  1FOW A;  3PB4 X;  2HPM A;  3I4P A;  4ZH4 F;  2MD0 A;  3N4M A;  2JDC A;  4DZP A;  2E5Z A;  1EKE A;  1Q1H A;  2FNP A;  1PUF B;  2BCO A;  3LWU A;  3IC7 A;  1PP8 F;  1Z0X A;  3DGV A;  2DT5 A;  2VKD A;  3D0S A;  4HNY B;  1XMK A;  2DOF A;  3NFZ A;  2VJI A;  4CDG A;  4BHB A;  2KFD A;  5HDG A;  4FAS D;  3GTP J;  2F6C A;  2HXI A;  5HS9 A;  2XAJ A;  2VKH A;  4I01 A;  3KHX A;  2DA3 A;  2HTS A;  3LSH A;  4GFB A;  5A2Q K;  1QBJ A;  3MAJ A;  1UFH A;  2KDZ A;  4P6Y A;  5CVR A;  3V8L A;  4QSH A;  3HOT A;  5TJJ A;  2A3S A;  2OTL I;  3MMY B;  1L0C A;  1X19 A;  1XSX A;  2ELK A;  5E3L A;  2ZOF A;  4CIC A;  4BEH B;  3TFY A;  3ASN H;  3EDP A;  1G2H A;  3CCS I;  4PQA A;  3E5Q A;  1HXD A;  3DU6 A;  4MBU A;  4YFN F;  5FRO A;  1Z8L A;  3G6E I;  3RZO J;  3PB6 X;  4OLL A;  2ECC A;  3G71 I;  1ZGJ A;  2BOA A;  4FT8 A;  3S14 J;  4BGD A;  4AVP A;  4IJA A;  3DBH B;  3GTO J;  3K4B A;  1JHF A;  1YX3 A;  4XON A;  3FZV A;  3SJF A;  2BVM A;  2Q7B A;  4WWV A;  4E7H A;  1I27 A;  2V79 A;  3NAU A;  3ZMD A;  1M1D A;  4PJN A;  3D7H A;  4AVB A;  1YRN B;  3JRH A;  2HKX A;  3JTK A;  4ZY0 A;  3DTI A;  4PGH A;  3OL4 A;  3O8G A;  3S1Q J;  2FL4 A;  4PUS A;  2Z3M A;  2GLO A;  3J7A O;  3FKJ A;  4XPL A;  2DF5 A;  1P7J A;  2WAF A;  2JZY A;  4B6Z A;  3H36 A;  1FOK A;  4Z2Y A;  3QOP A;  3TW6 A;  3G1O A;  3ZQF A;  1UB9 A;  3DTE A;  4MCP A;  2E1M B;  1BOB A;  4KIS A;  3OIO A;  3P9C A;  1OCZ H;  2WSA A;  1YRN A;  1QHH D;  1MJB A;  2EIN H;  4MGR A;  1MSE C;  4MLO A;  3FXU A;  4E8O A;  4Q36 A;  2E1O A;  2J5O A;  1Y7R A;  2ZJ2 A;  3F3X A;  4YWY A;  2IBD A;  4FE7 A;  2O53 A;  3PGP A;  1IUF A;  3GUD A;  4KDP A;  1DQU A;  1Y1V J;  1ON2 A;  3CQZ J;  4Y49 B;  2P81 A;  1YW4 A;  5IP6 A;  1DP7 P;  4G12 A;  2ISZ A;  3OS0 A;  2J9A A;  5LRJ A;  2Z3O A;  3BPV A;  2DMP A;  5D8N A;  1BIB A;  2RDP A;  3IWF A;  1YI2 I;  3D66 A;  3WU2 C;  1MBE A;  4R9M A;  2FBK A;  4BKX A;  3K69 A;  2VB6 A;  5ICE A;  2FT0 A;  2ZEP A;  3OWC A;  1XF8 A;  3S6G A;  4LK0 F;  2EWB A;  2HEO A;  4M6I A;  1IRZ A;  4DOZ A;  4RGS A;  3FB3 A;  1IUY A;  3FXK A;  1Z8X A;  2VZZ A;  2OAZ A;  2FF4 A;  1RXT A;  1TKF A;  4A38 A;  4KIG A;  1PP7 U;  1WJB A;  1D0X A;  4S05 A;  4HQM A;  4DBQ A;  4AD9 A;  3CXQ A;  2ESH A;  2JJ7 A;  4DYQ A;  5EDN A;  2G9D A;  5JQ4 A;  3I0T A;  4E2A A;  4OOI A;  4LLG F;  2V9V A;  1OYI A;  3ZMV A;  2YX7 A;  1R71 A;  4CGO A;  1OCR H;  3IH4 A;  3REO A;  2HU9 A;  5FD6 A;  5FKM A;  4A95 A;  4F9V A;  3MZY A;  1CF7 B;  1DPU A;  2CUE A;  2BV6 A;  3S17 J;  1SQH A;  1VTN C;  1BC8 C;  2D5V A;  5DCM A;  2Y31 A;  5EBV A;  2JVH A;  3I56 I;  2YR2 A;  2GQQ A;  3CP8 A;  1CP6 A;  3PRT A;  3OOP A;  3FM5 A;  4QB9 A;  3CDL A;  2NRA C;  4BMH A;  1QMU A;  2G7U A;  3F6O A;  3BG9 A;  4PJJ A;  4FET A;  1VFC A;  2FE7 A;  2QQ8 A;  1ZLK A;  1RTQ A;  3WGI A;  1X3U A;  5F08 A;  1RIO H;  4HKF A;  4IO9 F;  3ZQL A;  5BS6 A;  3KZI C;  5L3E A;  2BXY A;  1CF7 A;  1QVT A;  3LFK A;  3S1M J;  4CGN A;  5FB2 A;  4C9Y A;  4G6Q A;  2QA4 I;  3EXN A;  1HDU A;  4A30 A;  2CQQ A;  2FIW A;  2IA1 A;  1LEA A;  4JP0 A;  1BPM A;  4ORF A;  3CC7 I;  2V9P A;  3WHC A;  3C18 A;  4OMY A;  4R3K A;  2R7T A;  2F5I A;  3S1R J;  3LQQ A;  2W82 A;  3C7J A;  3D5S C;  2R93 J;  1M4D A;  2QJ8 A;  3T8R A;  2BHZ A;  4WCG A;  3V7Z A;  4UUT A;  1I12 A;  1KZF A;  3H0G J;  2DFF A;  5LFA A;  3GVA A;  5HLG A;  1BI0 A;  5A2Q Z;  3ZMS A;  5DTD A;  2CTB A;  1Z91 A;  2Z1D A;  3VWE A;  2UXX A;  3HIF A;  3ZCO A;  3BG7 A;  2ID3 A;  1XIX A;  1K7A A;  4OID A;  1KU9 A;  3GKR A;  3CLQ A;  3I3G A;  1YO5 C;  3NQO A;  3LSP A;  5D29 A;  5CVI A;  3TT2 A;  4FHT A;  2XSJ C;  2FXF A;  5AIP A;  2LKP A;  5C88 A;  4L5J A;  2MSY A;  4NC8 A;  2GOX B;  4E7K A;  2ZPA A;  3KET A;  3H8G A;  2ZME C;  4HNT A;  2DTR A;  5FRN A;  4JLY A;  4MCQ A;  1CX8 A;  2HI3 A;  3DDD A;  1RUN A;  1HKS A;  3K0L A;  1FYK A;  4O3M A;  1K78 B;  1JGG A;  1FX7 A;  5F27 A;  1EJ9 A;  4OKO A;  3BR6 A;  2EV5 A;  4UV9 A;  5EJC A;  2RQP A;  4BXF A;  5E3O A;  1VGY A;  1U8R A;  1BJA A;  2DDA A;  3DPT A;  3RTR A;  2DYR H;  1E17 A;  1X3Z B;  2FU4 A;  4J19 A;  4L89 A;  3I4M J;  2BXZ A;  1ON1 A;  2RQQ A;  4IOC F;  3BZK A;  1BR1 A;  1FBS A;  4HNU A;  4EJU A;  3QU3 A;  1K78 A;  3HPH A;  4XLN F;  3D7F A;  1I39 A;  3H3U A;  3BJ6 A;  1MND A;  1W7P D;  5K8O A;  3T8T A;  1NG6 A;  4IRG A;  4R87 A;  1V3F A;  2K9L A;  3G1M A;  1ZGA A;  4XID A;  4HLY A;  4BE1 A;  4UHT A;  5JVG F;  2Z3N A;  4MY3 A;  4XNH C;  2LP0 A;  4A5M A;  4CO8 A;  4PV6 A;  2EZL A;  4BXX J;  4XLF A;  2ARH A;  3QWL A;  2CW0 F;  3QNV A;  1YGH A;  2Q2E B;  4L0Z B;  5HDK A;  1A31 A;  1VQL I;  3BI0 A;  4F91 B;  3JRB A;  3AL0 B;  4BIN A;  1QRY A;  3S15 J;  4KIC A;  3CDI A;  1ETQ A;  2HXO A;  1FLI A;  3TDZ C;  2KIM A;  3S2D J;  1BBY A;  2CGP A;  3H4Q A;  4RBO A;  4BAY A;  4AIH A;  3BJ8 A;  1W1W E;  1VQM I;  4PXC A;  4U9Y A;  5L3D A;  2JEV A;  1MBF A;  4BBR J;  4MQV A;  1QZZ A;  5K8P A;  3V4G A;  1JI8 A;  1IYL A;  2EFN A;  2R1I A;  2HOS A;  1MKM A;  2NS7 A;  1EF4 A;  2QKL B;  2V1U A;  4HG2 A;  1S7K A;  1UMQ A;  4NNJ A;  5BOX A;  3H8E A;  2PJC A;  3NH8 A;  2VJ5 A;  2ETH A;  2X6Y A;  4HNW B;  2DW4 A;  3AAF A;  1JUP A;  3HKZ A;  2GXA A;  4L9V A;  5G1Z A;  3IWG A;  3GLX A;  5E20 A;  4A3K J;  3EPZ A;  5IOZ A;  1CBX A;  2FSW A;  2H8W A;  3FJU A;  4ESB A;  3SHP A;  1OCP A;  1EH7 A;  1LVA A;  4XKV A;  3I9V 2;  4KUM A;  5ICG A;  2MFZ A;  1T98 A;  2QGU A;  3BTJ A;  3DXJ F;  3TP3 A;  5BNG A;  3NWS A;  3F22 A;  1B72 B;  3RKY A;  3OR1 C;  4F93 B;  3G8W A;  3V8K A;  1KQ8 A;  2P6S A;  5FJ8 J;  4XL9 A;  5B1A H;  5H84 A;  3LMM A;  3HHH A;  3GZ5 A;  2VON A;  1FJL A;  2PVV A;  4L9J A;  4ZYH A;  1XFO A;  3HLP A;  4WXC A;  2Q1Z B;  3BOQ A;  1RKW A;  1SC7 A;  1A35 A;  2XPW A;  2V8V A;  1W0T A;  2FBH A;  1B72 A;  5HVG A;  2L7Z A;  2XAH A;  2NOG A;  2XF7 A;  5KVR A;  3OYB A;  5IYC J;  1XC5 A;  2EH3 A;  2CUZ A;  2VQG A;  1BN5 A;  1O57 A;  2LRD A;  4M3B A;  4BJT A;  2JA6 J;  1R3N A;  2GZW A;  2KDO A;  2K3F A;  1TKH A;  3S6F A;  3RZD J;  1LPQ A;  1TKJ A;  3KIO A;  5FD5 A;  1MNM C;  4PFO A;  4PK3 A;  4MRI A;  4A3L J;  3RNZ A;  4JXQ A;  3ZP5 A;  4CCM A;  3HUG B;  2IRF G;  2L4M A;  4LB5 A;  4EM2 A;  2OD5 A;  1VHE A;  4UWJ A;  3JVN A;  2R7U A;  3VYT B;  2QQB A;  3L00 A;  1IOI A;  1ZO0 A;  2ZME A;  1W5S A;  2X1E A;  3DU5 A;  2IP2 A;  5LLQ A;  3H9J A;  2XGE A;  2PJ7 A;  1ERD A;  4X0G A;  2BVL A;  1OIS A;  4XRS G;  1Y0U A;  5HLH A;  3F23 A;  4EWT A;  4KIF A;  4QVT A;  3KPH A;  1UHS A;  4DYC A;  1OJL A;  4C3J J;  3HUG A;  3N05 A;  4ZTF A;  4XNH B;  2O7O A;  2HQY A;  4JD6 A;  2PBI A;  3O8H A;  1PJR A;  1Y6I A;  2Y48 A;  1S72 I;  3MN2 A;  1ELM P;  3QPH A;  4QTR A;  3K9U A;  2CQK A;  5L3B A;  2B5G B;  3D68 A;  4A2U A;  4KOY A;  2C1C A;  1ZG3 A;  3G4S I;  3DKY A;  1ZH5 A;  2EZK A;  4UFV A;  2XAG A;  2L3D A;  4U88 A;  3FM3 A;  1NE9 A;  1NSL A;  3IH3 A;  4HQE A;  3F9K A;  4XN0 A;  2HYG D;  2L5Q A;  3TBI A;  3L2W A;  1D5Y A;  4MHP A;  3BCA A;  2PJ0 A;  1MMD A;  3HXL A;  2L4A A;  4M72 A;  2B5G A;  4WK8 F;  4BNC A;  2M3A A;  5GP9 A;  1APL C;  5D8K B;  4OIO F;  2YGW A;  1DP3 A;  3J7Y J;  2KJB A;  5C4J J;  3S3N A;  4QBJ A;  1WSU A;  2Z3Y A;  1TW2 A;  3LSI A;  1TBX A;  4YEJ A;  4YGO A;  5FKL A;  1BOA A;  1JKQ C;  4UEE A;  2GA1 A;  2M9H A;  2X85 A;  4Z6Y A;  2JLM A;  3CPA A;  3K1N A;  4I98 B;  4F9U A;  2YSR A;  2AFS A;  5L3C A;  4QC6 A;  3GTM J;  2VXK A;  3IKV A;  5GPC A;  4OAZ A;  3LQR A;  2L2O A;  3C2G A;  4CXF A;  1P9Q C;  2ODF A;  5E17 F;  4AWX B;  2D4O A;  5BWA B;  2MGQ A;  3F5B A;  1M1E B;  4XBF A;  5J1R A;  3JCU C;  3ZQQ A;  4NB5 A;  4PXB A;  1MMA A;  3QAH A;  1GLN A;  1NSA A;  1TQI A;  4JK1 X;  3TMO A;  1WH5 A;  2OZ6 A;  1C0W A;  2OCE A;  2C27 A;  1ZTR A;  3BP8 A;  4P10 A;  4EME A;  2JSC A;  5LRK A;  1ZRE A;  3K7A J;  2K40 A;  1Y0R A;  4ENN A;  1JUS A;  4HF1 A;  2VXD A;  4I99 C;  4KVX A;  1K61 A;  3Q3S A;  1QU3 A;  3NRV A;  3F0C A;  4II3 A;  4Y33 A;  3BQZ A;  4Z65 A;  2XUB A;  1J09 A;  4Y52 J;  2OH1 A;  3GFL A;  2HPI A;  4BQA A;  4IHM A;  3ZJ0 A;  3A4C A;  3OYF A;  5M5W J;  3SJM A;  2DAO A;  5F64 A;  5E1Z B;  2ICW G;  2RC4 A;  2VQC A;  2VZY A;  4XLC A;  4IKF A;  2HNH A;  1ETV A;  3KCC A;  2PI0 A;  1FTZ A;  2XF5 A;  4RB1 A;  2Z33 A;  4HF0 A;  2CIJ A;  5M5Y J;  2DLL A;  2K85 A;  1FMV A;  2PMU A;  2K5T A;  5K5Q A;  1G3S A;  2JRM A;  3QPL A;  3HOU J;  2CNM A;  3D2M A;  3J81 K;  3BR2 A;  3NWT A;  3GB0 A;  1BJZ A;  2XAS A;  4AUX A;  4IVN A;  5EG0 B;  3J80 K;  2R7O A;  2GU2 A;  4NFR A;  2VQH A;  1FBQ A;  1UEL B;  4HLX A;  5F09 A;  3HOS A;  2IL4 A;  4I0A A;  3JTG A;  5EC4 A;  3E97 A;  1R7J A;  2ZJP F;  4GYI A;  3TGN A;  1SAN A;  1JKO C;  4IL6 C;  2VUM J;  1JQG A;  1UWY A;  5HVF A;  3LSJ A;  2KIQ A;  1Z67 A;  2HTJ A;  3PUF A;  1HBX G;  2B7E A;  1YK3 A;  5B66 C;  4XRF A;  4MTE A;  2XF6 A;  1WI3 A;  2OCC H;  1W0U A;  4UWI A;  2EFO A;  1VQK I;  1ON0 A;  2R7W A;  1RC9 A;  2H1L A;  1K6O A;  2DA6 A;  3ISZ A;  5G21 A;  1J0R A;  4EFD A;  2CUF A;  3LAJ A;  4H0E A;  2E60 A;  5TGT A;  1D5V A;  2FEZ A;  3VYS B;  4MCS A;  5F46 A;  3BTI A;  3MN8 A;  4MFZ A;  1MJ9 A;  3BLN A;  4MI4 A;  4MHZ A;  3WC6 A;  2ZED A;  2OF7 A;  5DV5 A;  3W6J B;  2CF4 A;  4HV6 A;  2Z0Z A;  5DDG A;  1XMA A;  2HFH A;  4A3I J;  2J8R A;  5KK1 A;  2PJ3 A;  5J1Q A;  3IU1 A;  4FX4 A;  3GUX A;  2HWV A;  2V1D A;  2W1O A;  3DLA A;  3ML6 A;  4Y17 A;  5DD8 A;  2P6F A;  3LNQ A;  3PB9 X;  1GV2 A;  3H1C A;  1PVE A;  2X48 A;  4KFC A;  2R92 J;  2AFW A;  5LYI A;  2OOT A;  1B4A A;  4CAW A;  4BJ5 C;  1FT7 A;  2EZI A;  2BY3 A;  4ZBG A;  3F8M A;  3MZ8 A;  4CCO A;  1QNT A;  4M71 A;  2AHQ A;  2ID6 A;  2EFW A;  4RGR A;  1VQ9 I;  1O7L A;  1KA8 A;  3PNV A;  3SXO A;  3QU6 A;  2G0B A;  1YHQ I;  5H2F C;  4ZYD A;  4Q4Z F;  2ZW7 A;  2Y0M A;  4FCY A;  4X6A J;  2K9M A;  1SD6 A;  3HSE A;  3S93 A;  1NH3 A;  1TTY A;  2R7F A;  5DD4 A;  3QRF F;  4I02 A;  2X0L A;  5CJ9 A;  5B1B H;  1X1D A;  3C2B A;  2JPB A;  2WB1 A;  2M7A A;  1WGX A;  3KLO A;  1MH4 A;  2X51 A;  1EV7 A;  1O3T A;  2STT A;  2DMU A;  3ROU A;  4GYG A;  2CNS A;  2F5E A;  3DBL B;  4HX7 A;  2DOA A;  1W5T A;  1R1U A;  3RPQ A;  1BLL E;  1S7A A;  2LFB A;  3F8C A;  1TT0 A;  4EV0 A;  1CJW A;  3LOD A;  3MWM A;  4IXA A;  5K8M A;  4Q7A A;  2HZD A;  1SMT A;  3B2Y A;  2M2E A;  1UHW A;  3ABK H;  1QSO A;  3SJX A;  3L7W A;  1U5T B;  1L0O C;  4J3G A;  3ZN1 A;  2LKS A;  1MW7 A;  3OYH A;  4AYB N;  4PFP A;  1ZK8 A;  4P4F A;  1UG2 A;  2QQA A;  3JRU A;  2Y2Z A;  1YQA A;  2JMW A;  4CZZ A;  1PUE E;  3CO7 C;  1MBK A;  1R58 A;  1NMT A;  1YW9 A;  4WWC A;  4H89 A;  2KIF A;  3ZMT A;  3AG3 H;  3ZMU A;  3NH5 A;  1YE9 A;  4PXD A;  3H8F A;  1XGO A;  5D4R A;  1F9N A;  2E7X A;  4M3E A;  2ZO4 A;  4CGZ A;  2IPQ X;  1XDU A;  4V19 K;  4RB3 C;  1YLE A;  1WH7 A;  1ETK A;  2CTC A;  1IU8 A;  1PUA A;  3PSF A;  4GDF A;  2O8K A;  1A36 A;  2O61 A;  5A27 A;  4UV8 A;  2IT0 A;  1RO5 A;  1LFW A;  1T56 A;  1IDY A;  4IEJ A;  5JLW A;  4BE2 A;  2FVG A;  2CQX A;  4NUB A;  2D1H A;  3S32 A;  4U7B A;  3RQ4 A;  1S3J A;  3W6S A;  1HSJ A;  4CCJ A;  1AHD P;  2W57 A;  1Q1V A;  1V0C A;  4XPD B;  3KP3 A;  1I21 A;  1PU9 A;  4XM3 A;  4DW6 A;  3L09 A;  3J81 Z;  2L01 A;  5KCM A;  1N78 A;  1S8N A;  5K1Y A;  3J80 Z;  4WJB A;  3CME I;  1ZG5 A;  5FLV A;  1V5E A;  5H86 A;  3I3L A;  3JRC A;  4KOV A;  1YVK A;  3MFK A;  2X9D A;  4DJL A;  3RDI A;  3I4N J;  2ZEO A;  2FOW A;  5JVT A;  3ZQC A;  3RKX A;  3ZMZ A;  1ZQ3 P;  3V42 A;  3LSR A;  2V26 A;  5LEJ A;  5HS7 A;  3O6B B;  4R8H A;  2DA2 A;  1RPW A;  1MD0 A;  2XPV A;  1H8L A;  3B3S A;  1K4J A;  5CNP A;  4A39 A;  1ONV A;  3VSK A;  1IN8 A;  2ZSI B;  2NAZ A;  4C2T A;  3EQL F;  3HRT A;  4A3M J;  4G1P A;  4AVZ A;  1M4I A;  4PJL A;  2H6B A;  1UST A;  2HQ5 A;  2P6T A;  1F36 A;  4LQG A;  3LWF A;  1BR2 A;  3EFA A;  2E1M C;  3PO2 J;  1P4A A;  4U9Z A;  3V38 A;  2Q7S A;  4XMY A;  3ZQI A;  4XNF A;  1P7I A;  2L0K A;  2MLG A;  2ACJ A;  9ANT A;  2GXG A;  4JWP A;  1Y8R B;  4KT6 A;  2LDU A;  1G59 A;  3D8P A;  2IGK A;  1WQ2 A;  4G7Z F;  2NVT J;  4DGW B;  4Y49 C;  3VYU B;  3PZJ A;  4F55 A;  3MKL A;  2VN2 A;  3U9G A;  1W7P B;  1XSV A;  3VFZ A;  2WYR A;  2QEN A;  3HGG A;  5HVH A;  2MH2 A;  3NH4 A;  4LK1 F;  1JTX A;  4I0B A;  3K2Z A;  1LJ9 A;  4LIT A;  1KZH A;  2KL4 A;  4A32 A;  2JUG A;  2ZNY A;  3KEO A;  1KON A;  3KYD B;  1W36 D;  3U1K A;  2B4B A;  3VPR A;  3ZZI A;  1YYV A;  4PCQ A;  2V77 A;  4KVO E;  2WUU A;  1LFU P;  1Z8W A;  3P9K A;  3QP5 A;  2IS2 A;  3RYO A;  2XAU A;  1IIC A;  1YVO A;  1W7P A;  3JUW A;  2LBF B;  4D1Q A;  3FED A;  2HS5 A;  3U21 A;  1XJO A;  2QSH X;  2ZEN A;  1IG7 A;  3KFW X;  4PSX A;  3GF2 A;  3FIX A;  4K30 A;  5HXD A;  2ZJQ F;  2ESN A;  2CXA A;  2M4G A;  4O23 A;  2Y69 H;  4G9Y A;  3OYN A;  2IA2 A;  4P9F A;  2Y75 A;  1HKT A;  1T33 A;  4NEX A;  3HSR A;  1PYT B;  3OR2 C;  4E7L A;  2P6G A;  2PJ4 A;  2LBF A;  2EK8 A;  3A02 A;  1IRF A;  3QPS A;  2PJB A;  3U2R A;  1XTA A;  3LD2 A;  2DCE A;  4BQQ A;  3HTU A;  2KIS A;  1FBU A;  4F3Q A;  2CNT A;  1I1G A;  3DQV C;  4F52 A;  3V7S A;  3DNS A;  1PUF A;  4ZY2 A;  1HQC A;  1J7K A;  3DEE A;  4UB8 C;  1KYW A;  2JWT A;  3P2F A;  3KP7 A;  4KOS A;  4PXE A;  3S9M A;  3GFJ A;  2PRQ A;  2ZEF A;  3J7Z I;  3IHU A;  3IAM 2;  2AFZ A;  2BO9 A;  3LA7 A;  4BJ6 C;  1MNE A;  2PVW A;  1DE4 C;  4OC2 A;  2LY9 A;  5CPR B;  4EVI A;  2VT3 A;  3ZXS A;  1FP2 A;  2K27 A;  3HZJ A;  1QQ9 A;  3CZX A;  3DLL F;  3H3Z A;  1I5Z A;  3SJE A;  2CRG A;  2K3P A;  1HDD C;  2LNB A;  3BR0 A;  3PB8 X;  1WK4 A;  2D1V A;  2KRC A;  4AU7 A;  4BYY A;  2P7V B;  2L02 A;  2DMN A;  4H2K A;  3LSG A;  1OPC A;  4UXN A;  1WPK A;  3QYE A;  4KLV A;  1EH6 A;  2LF7 A;  4BEH A;  1P4N A;  4B5P B;  2BY1 A;  1AKH B;  1Q2D A;  1HCR A;  2M5W A;  1D0Y A;  5D5W B;  2R5Z B;  3BQY A;  4NGP A;  5CVV A;  3W91 A;  1S7L A;  1B87 A;  1FIA A;  5F04 A;  5HLI A;  1LFB A;  2CJJ A;  3HRU A;  4IOA F;  3EC4 A;  2L54 A;  5KTA A;  1TT5 B;  2QYO A;  3DP7 A;  3TW7 A;  3W2V A;  2B9S A;  1FYL A;  2KLO A;  4KIT B;  4KUB A;  4BE0 A;  2DA7 A;  3E5X A;  3HBL A;  3N97 A;  1MSF C;  4RS2 A;  2PLY A;  2XGC A;  1OCC H;  2R5Z A;  4UIA A;  3DTK A;  3ZQH A;  3V7C A;  4BBS J;  4A5N A;  2VKV A;  3N7Z A;  1I3A A;  3WR7 A;  3OYJ A;  3OYK A;  4NJR A;  4XR6 A;  3WTS C;  3IWZ A;  4NBQ A;  2M8G X;  3Q9S A;  3W6K B;  1QQI A;  4HF2 A;  3B3C A;  4XKC A;  4X3R A;  1DUX C;  5M5X J;  1R22 A;  3JAM K;  4UUS B;  4E0A A;  1ZG1 A;  2PJR B;  1IW7 F;  2FOK A;  4JJX A;  4A3F J;  2DQR A;  5G20 A;  3DEU A;  4DIQ A;  3PJR A;  3KR4 A;  4M9X A;  2REE A;  2WZN A;  5ICF A;  2DI3 A;  3M1C A;  2Q51 A;  5JM6 A;  1X3W B;  2EV0 A;  4ZYQ A;  3QB8 A;  4P96 A;  4LG3 A;  3CUQ C;  1XN7 A;  5CKT A;  3FBI B;  5EMI A;  2AO9 A;  3HSF A;  1T38 A;  1AOY A;  3QAY A;  4UUS A;  2ZXH A;  3TED A;  2VBX A;  1G4D A;  2CU7 A;  2LSO A;  1VQ7 I;  5E79 C;  2H1K A;  3GXO A;  2PJR A;  3GY9 A;  4U0V A;  1RET A;  4ETS A;  5CVU A;  2A4N A;  4FTH A;  4FWU A;  4C2M J;  1BC7 C;  3LA2 A;  1FPQ A;  2UWM A;  3PEI A;  4CYN A;  1IRX A;  1N71 A;  1YW7 A;  3AL0 C;  2QKM B;  2D2W A;  1D1C A;  4BH9 A;  4EM1 A;  3MKW B;  2X1C A;  1SFE A;  2PJP A;  2IS1 A;  1X2N A;  2V8H A;  1ZG7 A;  2EA2 A;  4MFL A;  3K4K A;  2H27 A;  2DDB A;  3K2K A;  3H92 A;  3MVP A;  5LYF A;  4CGP A;  2ELH A;  2BYV E;  3HOY J;  4Q5S F;  5FKO A;  4B13 A;  4RB2 C;  4C68 A;  2ZXJ A;  4YFX F;  1D3Y A;  1RI7 A;  4JBA A;  2JVG A;  4GS4 A;  4A33 A;  1V5G A;  3CMM A;  1RUO A;  5EEH A;  4M9S A;  2C6P A;  5DEQ A;  4Y3O A;  1JHH A;  5FGM A;  3MKY B;  2WPX A;  3FMS A;  1DPR A;  2XC7 A;  4AC0 A;  1ETX A;  1IN4 A;  2LMD A;  3FF5 A;  2KIU A;  5ED4 A;  2VAS A;  2JA5 J;  3CXP A;  1ODD A;  2EFQ A;  1Y0N A;  5F49 A;  2KHM A;  4ZI6 A;  2KCW A;  4P9U A;  2PMZ N;  2Q43 A;  4RGX A;  3HDD A;  5JI6 A;  1V54 H;  2JT1 A;  2AFO A;  1LE8 B;  2GLF A;  3BJ7 A;  5JPH A;  4IX7 A;  2R7D A;  3K4C A;  3R61 A;  2LY1 A;  2HDW A;  5GAG J;  4GXH A;  4M6G A;  1T2K A;  1GVD A;  1H9G A;  1A6I A;  2RNJ A;  3PBE A;  2M87 A;  3EUH A;  1VZ0 A;  3V8J A;  1R1T A;  3KE2 A;  2E2J J;  4A6D A;  2OR4 A;  3SFI A;  3L2C A;  1A6Q A;  1U3E M;  4G6D A;  4HOB A;  2BHY A;  2MA3 A;  2X4H A;  2ELJ A;  1F5T A;  1JTY A;  4XPK A;  2XRO A;  1LE8 A;  1Q7L A;  3VDX A;  4E6K G;  1BR4 A;  3IAS 2;  3S3O A;  1Z8T A;  1VQ6 I;  2ZBK A;  5IB0 A;  1YME A;  2LC2 A;  4OIN F;  1FSH A;  2XEI A;  5KAI C;  2FQ4 A;  1VHS A;  4ZC3 A;  1BI1 A;  3KEQ A;  2JDD A;  2IMO A;  3HUV A;  2CG4 A;  4YFK F;  2XB0 X;  3F72 A;  3F8B A;  4DNC A;  1MMG A;  1TF9 A;  2G7H A;  3H9G A;  2FUG 2;  3LAP A;  2GIZ A;  4NF1 A;  3K70 D;  1B8I B;  1HST A;  2P6E A;  4RMN A;  1ARM A;  2XVC A;  4JOM A;  3ULQ B;  1H9T A;  2IXS A;  2PJ9 A;  4MMO A;  3LSM A;  1HW5 A;  4LUA A;  3OYM A;  2NYX A;  1XB4 A;  1J59 A;  4WF2 A;  3RSN A;  5F1J A;  3E6C C;  1B6B A;  1R43 A;  2JTV A;  4JZ0 A;  2EK5 A;  2LH9 A;  2QQ9 A;  2XAF A;  1GT0 C;  3PFI A;  4D5F A;  3GWZ A;  1A5J A;  3CUQ B;  4P4E A;  2DQL A;  2M0M A;  4OC1 A;  3V8I A;  1X10 A;  2M30 A;  2RGV A;  4XLH A;  4U87 A;  5JH9 A;  3BJO A;  1KUY A;  2LYC A;  3IEH A;  4MJ8 A;  4CYC B;  3T5X A;  4ENK A;  4ZZD A;  1Y1W J;  2BL1 A;  3FHZ A;  1T08 B;  2Q44 A;  2ZKZ A;  1T6S A;  1UAA A;  3D4U A;  1JE8 A;  3RYR A;  3BTC A;  4UEZ A;  5CPA A;  3W6X A;  3JAM Z;  2CYY A;  3K4J A;  3VEP A;  1SFX A;  3CUQ A;  2DJN A;  2H8R A;  2HDD A;  1S5L C;  2E36 A;  3WE3 A;  2DPS A;  4ASN A;  4AB7 A;  4BDZ A;  4XRS A;  5E3N A;  4CYC A;  1ZLI A;  1R5I D;  3SEQ A;  4E4H A;  1E0E A;  1I1S A;  2AE6 A;  4IRI A;  2K9Q A;  1MK4 A;  2Q2E A;  2KT0 A;  3WTZ A;  2QVO A;  2H94 A;  4ZDO A;  5HOO A;  2CY2 A;  1R00 A;  2F48 A;  2VJ4 A;  2RB7 A;  4IHW A;  1QPM A;  2TCT A;  1E3P A;  2VC1 A;  3UKG A;  2QBY B;  4TV7 A;  4F92 B;  3TO9 A;  5LRG A;  2DA4 A;  4XOP A;  3IWE A;  4R8F A;  4GO1 A;  4DQ2 A;  2VJJ A;  2K9N A;  4ANJ A;  4LLN A;  4RUH A;  2DFI A;  1FC3 A;  1LNW A;  3MEX A;  1G8X A;  4Y15 A;  2O03 A;  1PDN C;  2Z3K A;  3KP5 A;  3E3V A;  4ZZL A;  2EZH A;  2PE3 A;  4LOC A;  1KQ9 A;  4C3I J;  2QBY A;  2EVN A;  1YS6 A;  4ON0 A;  1FZP B;  2OZG A;  2WAQ N;  4CYP A;  4UCP A;  1ELL P;  4A37 A;  2GA2 A;  2R7Z J;  2HDC A;  3W2A A;  4AG9 A;  2X7B A;  3RO0 A;  3SZG A;  2DU9 A;  2WWY A;  3B6A A;  1FOY A;  2IS6 A;  5IPA A;  2WTE A;  1T0F C;  1VF9 A;  1OCO H;  2ABZ A;  4TNU A;  5BMZ A;  2ZEG A;  4NDL A;  3FXJ A;  4JXR A;  1LAP A;  3OYD A;  1J9I A;  3GW2 A;  1ETW A;  3L9F A;  4RGU A;  5BPI A;  2KRF A;  3DFG A;  4LG0 B;  3QYF A;  3FYN A;  4II9 A;  3MRU A;  5D6F A;  2XDV A;  1XGS A;  5TIS C;  1DDN A;  1DU0 A;  2BEI A;  2BGC A;  1XMB A;  3PQK A;  2M4K A;  3KZZ A;  4Y4R A;  2JPC A;  1S29 A;  1Z4R A;  2LRE A;  3QPT A;  4M85 A;  4NXY A;  2L9N A;  3KP4 A;  4LG0 A;  4P4D A;  5G22 A;  2I79 A;  1LRZ A;  3BG5 A;  2V9K A;  4BS9 A;  3BZC A;  4A6E A;  1AU7 A;  1DGW Y;  2Y0S N;  3CUO A;  4UB6 C;  3I64 A;  2R0Q C;  5K8N A;  2CV1 A;  4IHY A;  1Q2C A;  3WU1 B;  2EQR A;  2NXN B;  2MD5 A;  1I1D A;  2MH9 A;  4KOX A;  4D9J A;  2DN0 A;  2V1X A;  1IOF A;  3G2B A;  1FNN A;  2J8M A;  4A12 A;  1R57 A;  1LUJ B;  5CYV A;  4AIK A;  2DT6 A;  4QPQ A;  3A0B C;  3FBN B;  5K7Z A;  3OSF A;  2EBJ A;  4PK4 A;  4B44 A;  4FE4 A;  4MEX F;  4NJQ A;  4HNV A;  3OY9 A;  4C3H J;  3RI4 A;  3BHX A;  2N8G A;  3C1D A;  3K1P A;  1AWC A;  4FIS A;  3HRS A;  3PQJ A;  3B3W A;  1ZAO A;  4E7I A;  3ERM A;  5E18 F;  1ETO A;  4R7M A;  3P2H A;  3VOE A;  3IFE A;  4RAY A;  1JT0 A;  3A01 B;  2DEA A;  2ZW5 A;  2X6O A;  4J01 A;  5AG5 A;  2ECB A;  3C26 A;  1Y0Y A;  2P5V A;  2JBJ A;  1FIP A;  4KJZ A;  4V2G A;  3UY5 A;  2QLZ A;  2Q4V A;  1S9H A;  3GX4 X;  5F0C A;  3M8J A;  4M3G A;  5FFX A;  2QSG X;  3OWT A;  2FCK A;  2CV2 A;  3DR6 A;  3IL2 A;  4XIC A;  2ZEM A;  3BC8 A;  1R1V A;  4KA4 A;  4NGR A;  2ZW4 A;  4FD6 A;  2AQE A;  3FX3 A;  3A01 A;  3QOE A;  4L9N A;  4CCL A;  2E2H J;  2ATR A;  1O7F A;  1ZYR F;  4QWQ A;  1N75 A;  1XCV A;  2EWN A;  1FNO A;  2ISY A;  5AG6 A;  1G3Y A;  2QM3 A;  1X12 A;  3ABM H;  4H6Z A;  2OV7 A;  3BT9 A;  4LGW A;  4GRI A;  3CCU I;  4F8Z A;  1JUM A;  3DLJ A;  4PGG A;  3S6H A;  1S6L A;  2PJ6 A;  2QWW A;  2ZNZ A;  1WJF A;  3FXR A;  4R79 A;  3OS1 A;  1K4S A;  4YFJ A;  4I09 A;  2HQA A;  1P92 A;  1X1A A;  2JK3 A;  3R0J A;  4XLP F;  1QSN A;  4KOW A;  2KPM A;  2VKE A;  1WJD A;  3NEU A;  3PFE A;  1WJC A;  4XOR A;  5IX3 A;  3GIU A;  3TDU C;  4MFJ A;  3Q0V A;  1Z3X A;  2HOA A;  2LF8 A;  3UR3 C;  5J47 A;  4KYW A;  4B3X A;  3CPX A;  4CAE A;  3FKI J;  3BRO A;  2VOO A;  3WAB A;  5JGF A;  1QST A;  3WHB A;  5JLX A;  4KSI A;  3FIS A;  3E1S A;  2B58 A;  2PR8 A;  2Z11 A;  2OB0 A;  4RAZ A;  4NSQ A;  1IXS B;  2E2I J;  3HTS B;  3IWW A;  4A69 C;  3VB2 A;  2EIM H;  3CC2 I;  1XRY A;  3J7A Y;  4UY8 I;  2LVS A;  3ESW B;  3P9I A;  4MO7 A;  3NAR A;  4P55 A;  2H09 A;  2AQF A;  4JX4 A;  1S7N A;  2ZC2 A;  3OYG A;  1VND A;  4I6Z A;  2R7Q A;  5K7H A;  1IDZ A;  1U5T C;  3BDD A;  4Y7N J;  1T0F A;  1E3H A;  2KQR A;  1VHO A;  3B7I A;  3AKZ A;  2ZXV A;  1CGP A;  5B5E C;  3CF5 F;  5DS0 A;  2I5U A;  2VBZ A;  1O4X A;  2Q0Y A;  3VWD A;  3M1E A;  4B5O A;  1WKM A;  4HBL A;  3FMC A;  1BM9 A;  4HEA 2;  5J6X A;  1GUU A;  2DFE A;  2VT2 A;  3L2N A;  1TL8 A;  1G3W A;  3HGY A;  2NS0 A;  3HRM A;  3OYC A;  1JJ6 C;  2VLA A;  2DOD A;  3GTG J;  1WHU A;  4M6V A;  1F57 A;  4HX4 A;  4W97 A;  2POK A;  4XK4 A;  3IKT A;  4CRY B;  1POG A;  4EAT A;  4BY7 J;  4IUS A;  3KYL A;  1SEU A;  2EIK H;  2PJ2 A;  3C2H A;  4E7Z A;  3RKW A;  3HOV J;  4A0X A;  1CG2 A;  4MIM A;  1IID A;  4K2E A;  3H0D A;  2HVR A;  1K6Y A;  4ENJ A;  4G8X A;  4PPZ A;  3CZ6 A;  2ZSH B;  2F5V A;  2OA4 A;  1ZLJ A;  2OPT A;  5EG0 A;  3S9L A;  2B4D B;  2FA5 A;  3JRD A;  3Q0W A;  1KUX A;  4IF5 A;  2RNG A;  3D5L A;  5J1U A;  4EM0 B;  3G1L A;  1O3Q A;  1D8K A;  3JRF A;  4NGT A;  3ZPL A;  4XPD C;  3JTH A;  2O0Y A;  4MTD A;  3E5U A;  5IT9 K;  1GHC A;  1GHE A;  2M0C A;  2K9S A;  5AG4 A;  2E1N A;  4E70 A;  1R9T J;  5DWM A;  2GM4 A;  3HYI A;  2FE3 A;  2GFQ A;  3TO7 A;  3KX2 A;  3IIB A;  5KTD A;  1I50 J;  4G7H F;  5FRM A;  4FD5 A;  3FXM A;  3CCR I;  4PK2 A;  2B4D A;  3K2A A;  4MFP A;  4F6A A;  5L3F A;  3CCY A;  2FRH A;  4P5O A;  1ARL A;  1XOV A;  2PSW A;  4OC5 A;  4RN7 A;  5IB9 A;  4KOR A;  1O3R A;  2MLK A;  3H35 A;  4AG7 A;  2XB5 A;  3JSO A;  3OSG A;  4A3D J;  2PJ5 A;  1XX5 A;  2KKO A;  3ECH A;  1IN6 A;  5H6Q A;  1JXS A;  1QHG A;  3OOU A;  4G7O F;  3D3S A;  3TX8 A;  2ZXI A;  4CAV A;  1CQT A;  1LB2 A;  1R4M B;  3DF8 A;  2XSD C;  2ZXW H;  2Y30 A;  2FSR A;  3TE4 A;  2I8D A;  2GXB A;  2XHK A;  1ENH A;  1VIX A;  3FIW A;  1P4X A;  2NOJ B;  1YLO A;  2IGO A;  5GAH J;  2QSF X;  1OLT A;  4B3A A;  2GAN A;  3I71 A;  1ORK A;  4ZGY B;  2L7M P;  2DFH A;  3IP4 B;  3K4N A;  1HKQ A;  4XLE A;  1LEB A;  4ZYG A;  5AG7 A;  4KSF A;  1Z77 A;  2ADU A;  5IOY A;  2YU9 J;  1TWC J;  2XEF A;  3PUB A;  1ZR2 A;  5AIQ A;  1J5Y A;  2H6C A;  5CVJ A;  1Z7L A;  3A1Y A;  3F8F A;  1A2Z A;  2DK8 A;  4OIR F;  4RAG A;  1YR0 A;  2C6Y A;  5J3L A;  3GTJ J;  1F2O A;  5LD2 C;  3EUK L;  2R7X A;  2Z3L A;  2FML A;  2AXL A;  3BLY A;  2BW3 B;  2K7L A;  3T9Y A;  4JYK A;  3VYR B;  4GCV A;  3X2Q H;  2O3F A;  2CFO A;  5HNF A;  2UZK A;  4C2U A;  1JGS A;  1QGP A;  2KP6 A;  1XPX A;  1JKP C;  3PBB A;  4B4C A;  1H0M A;  1U0J A;  4EJW A;  3EUA A;  5THW A;  5GPA A;  1B6A A;  3AG1 H;  2L9S A;  2QVP A;  5AGE A;  4A94 A;  4M3S A;  1P6R A;  1TQP A;  3O3K A;  4HX8 A;  1WWX A;  2BW3 A;  3BG3 A;  4M6Y A;  3TP0 A;  3CC4 I;  2DPT A;  3OYE A;  2O4H A;  1ETY A;  3ZRG A;  2AFX A;  3CDH A;  4LIV A;  1YJN I;  1U5T A;  4IHV A;  3SI0 A;  1AUG A;  3BR5 A;  4CSW A;  3KKW A;  1DU6 A;  3LFU A;  4OAY A;  4BHC A;  3BG6 A;  3TCV A;  2GIV A;  1VQ8 I;  1YQE A;  1X1B A;  4A93 J;  3EET A;  3TQN A;  1QZE A;  5D4S A;  3WGG A;  3B02 A;  5IYD J;  3BI1 A;  1MDM B;  4RDU A;  3S3M A;  2PRB A;  4HDV A;  2PJ1 A;  2VXZ A;  3FXQ A;  2O28 A;  1HOM A;  1OYY A;  1MH3 A;  2XRN A;  4BAC A;  2P8T A;  3L2V A;  3T8W A;  2HOT A;  4XQF A;  2PR1 A;  2O8X A;  6CPA A;  1B1B A;  2P7C B;  1T39 A;  5JHU A;  3D7D A;  1V55 H;  3DPL C;  1S3Z A;  1J75 A;  2OZU A;  2IQ6 A;  4MFQ A;  4L0Y B;  3M3Y J;  2L9R A;  3FHN A;  1XDS A;  5LHH A;  1ZKG A;  3NA6 A;  2YNE A;  4EJT A;  1MBG A;  4UFW A;  1TWF J;  3DCF A;  1MJA A;  4NQW B;  1BW5 A;  2AJ6 A;  4FX0 A;  3ERE D;  4MXU A;  1KU3 A;  3E7L A;  2VEZ A;  1V4R A;  1YW8 A;  4ZY1 A;  4KNY A;  2H5M A;  4OC4 A;  5EGO B;  4MFD A;  2R7S A;  1XGN A;  1WRJ A;  2PDO A;  4DBR A;  3S6K A;  1I6X A;  3PIO F;  2V7F A;  2ZW6 A;  2MAB A;  2WY8 Q;  4OMZ A;  2P4W A;  4ZX9 A;  3CCJ I;  5IT9 Z;  2RRE A;  4PJ0 C;  3GTK J;  1IGB A;  2BUE A;  2MC3 A;  3WOD F;  3ABL H;  1HA8 A;  1MBH A;  2RV8 A;  4HV5 A;  5EGO A;  3BCB A;  3RIR A;  1JKR C;  2JBK A;  4IHS A;  4KZT A;  4P4B A;  4YIF A;  3B3V A;  1Z05 A;  3KZY A;  4N9I A;  1XMX A;  2KZV A;  5FKN A;  3SDB A;  5LGN A;  2Z5U A;  3HKZ N;  2F5F A;  1WVR A;  5L3G A;  1RES A;  1P2F A;  2HQN A;  3ISP A;  3GYH X;  1YSJ A;  3E0K A;  1M44 A;  3N5F A;  3WTW C;  5GTH C;  3S1N J;  1Z6T A;  3MCZ A;  3A2K A;  3JRE A;  3GYA A;  1KU7 A;  2HR3 A;  4OC3 A;  3F6V A;  2XPU A;  3LMS A;  1NTC A;  1YOV B;  1YJ9 I;  4TWE A;  1RNL A;  1AMP A;  2BZT A;  1J2X A;  1IV6 A;  3B35 A;  4DYO A;  2NVQ J;  4KUA A;  1AYE A;  2K4J A;  4M3D A;  3U1D A;  2QYV A;  2ZCW A;  4QLC U;  1U9O A;  1VQ5 I;  5DM6 F;  3JR9 A;  4AID A;  3W2W A;  1YS7 A;  5BQT A;  1WJ5 A;  2R98 A;  1R4N B;  2XKO A;  1RZ4 A;  5DCF A;  1FOX A;  3PFY A;  3R9F A;  4QPO A;  1SFU A;  2IAI A;  4IK2 A;  4IHT A;  5M3F J;  4OAE A;  3ZGK A;  1HLV A;  4P44 A;  1XSD A;  1R6R A;  4ZYE A;  4N4O B;  2DA5 A;  2O6G E;  4EMS A;  1B9M A;  2VI7 A;  3SDG A;  4UCN A;  1YG2 A;  2ZB9 A;  3BTL A;  1GXP A;  2OZH A;  2MYS A;  3T1B A;  5E96 A;  2EB7 A;  3SYT A;  1SVO A;  3BPX A;  2V8G A;  2X6X A;  5GTI C;  2IGN A;  2PCU A;  1KWM A;  4HW0 A;  3H5N A;  1FP1 D;  5ILS A;  2LOO A;  1E2X A;  2DJI A;  4XLA A;  4BDY A;  3HB9 A;  5E8I A;  4FAI A;  2YS9 A;  3EUH C;  5HVQ C;  3JRI A;  1H8A C;  1L3L A;  4EVY A;  3S9N A;  5ISV A;  3WTT C;  2XEJ A;  2LR8 A;  1YJW I;  2HGC A;  5DWN A;  1ZRF A;  2AFM A;  5EZG A;  2DXQ A;  3KP2 A;  1B59 A;  3IV5 A;  3PL8 A;  5ILV A;  1XGM A;  3S16 J;  4LB6 B;  2XIG A;  1FEX A;  2CQ7 A;  3KYC B;  3QP6 A;  4LMY A;  4EJV A;  2ZFU A;  1U2W A;  5HDN A;  2MC4 A;  1VI0 A;  2COB A;  2DOE A;  4YII A;  3RCO A;  4N9H A;  2G3T A;  3PIP F;  3ISX A;  1VQP I;  1Z21 A;  4CYO A;  2YU3 A;  3IUO A;  3OMY A;  4B1R A;  1SFO J;  4X2T A;  1J4J A;  1OKR A;  4H4K C;  4B8X A;  5J1Y A;  1V5F A;  3WTY C;  3GO5 A;  4ONU A;  3FXT A;  2Y9Y A;  1I3Q J;  3OYI A;  2YNC C;  4IZZ A;  4HPS A;  3K1M A;  3RYP A;  4KT5 C;  4L5E A;  4B5P A;  1AKH A;  2MBF A;  4R57 A;  5F0H A;  2A69 F;  4MHG A;  3NE8 A;  4L18 B;  2KZG A;  3I55 I;  4ZDL A;  5D5V B;  5F0F A;  2PN6 A;  1LKX A;  3M7G A;  4C7H A;  1D1B A;  1OQY A;  5J4Y A;  2VIX A;  3CMA I;  1KGS A;  2JSP A;  1CPX A;  1Y9W A;  1YW6 A;  3P7N A;  3FF3 A;  3CP2 A;  2X1D A;  3GCM A;  1ZG9 A;  1LCP A;  3A0H C;  1KUV A;  1Y56 A;  2QEX I;  4UEF A;  1QPI A;  3FDY A;  4X8I A;  4A3J J;  4WXD A;  5EEG A;  3DEW A;  3R60 A;  3GFI A;  4C30 A;  3QQA A;  3G3S A;  2FQ3 A;  2Q4Z A;  3KQZ A;  4DJA A;  4A2Z A;  1BPN A;  1MGT A;  2K02 A;  4CAF A;  3OIP A;  2I3C A;  1YRE A;  2JA2 A;  4RM2 A;  2CQN A;  3A9L A;  3WG7 H;  3AFH A;  1RKT A;  2A61 A;  3CJN A;  2L9V A;  2OBP A;  2AS5 F;  3CES A;  1HW2 A;  5IP9 J;  2XEG A;  2FMY A;  3W6V A;  1WZ2 A;  2RFH A;  2A05 A;  2J5P A;  2WC2 A;  3ABU A;  1AA7 A;  2XKP A;  1HDQ A;  5HOD A;  2CO5 A;  2BEO A;  8CPA A;  2B3U A;  1HW1 A;  1OR7 C;  2W85 A;  3FXO A;  4HZF A;  4IPA A;  4D7M A;  1I6H J;  3D5R C;  5E1X A;  3DPU A;  4RM3 A;  2CV0 A;  3S2H J;  1IJW C;  2EV6 A;  2NVU B;  4HNX B;  4MFK A;  2K5C A;  3BR1 A;  1HC8 A;  1BIA A;  5DCM B;  1S7E A;  2RVC A;  3CCM I;  1IC8 A;  1YX5 A;  4M3F A;  1UZC A;  2I10 A;  3R96 A;  4BXU A;  3QYB A;  2B3V A;  4X5K A;  4LX9 A;  3WTX C;  5IY5 H;  1REP C;  5IT3 A;  2P0W A;  2CFX A;  4PZJ A;  4W1U A;  5FKK A;  1PCA A;  4A0Z A;  5E8G A;  2STW A;  5LEK A;  2E5N A;  4P4J A;  2LD5 A;  1KQ0 A;  4I2O A;  4CZC A;  1IN7 A;  4IRH A;  1U6G A;  2JA8 J;  4NC7 A;  5J4V A;  4YU9 A;  4P4I A;  2W24 A;  2IGM A;  1B9N A;  4O6J A;  3Q9V A;  3CT9 A;  2FX0 A;  1GXQ A;  2Z2S B;  2WBM A;  3H5Z A;  2LLK A;  3KGQ A;  5CQG A;  3WT4 A;  3DKX A;  3S2W A;  3B8G A;  4RA2 A;  5TRD A;  2OTJ I;  1LDJ A;  3GFM A;  4FQG A;  3LOC A;  2HZT A;  3GZN B;  3QOD A;  4LFU A;  5K5R A;  2DXI A;  3PNY A;  1O3S A;  4GM5 A;  3I5U A;  5LHI A;  4LLL A;  4I49 A;  2NYQ A;  2IVM A;  3G3Z A;  4IAV A;  3C3W A;  1IN5 A;  4CAX A;  4OU0 A;  2NS8 A;  5FO5 A;  4ZDP A;  3ZN0 A;  2EK9 A;  2VQY A;  3CXS A;  2QML A;  2ZEH A;  1VQN I;  2EIL H;  2E35 A;  3HG9 A;  4S04 A;  1M4G A;  3IU2 A;  1VKC A;  3KQX A;  2LY2 A;  3H3V K;  2C6G A;  5DYM A;  2MG4 A;  1LOK A;  2OUM A;  1M4L A;  3CJR B;  3DR8 A;  4KSA A;  2DBB A;  2WA0 A;  4B48 A;  4MHD A;  1WJA A;  2JQ7 A;  2OQR A;  2NSM A;  3IC1 A;  5D5U B;  2YNC A;  4KN4 X;  2COM A;  2HB6 A;  3B73 A;  1STZ A;  3BWG A;  4Q38 A;  1ZEL A;  2EFP A;  3R95 A;  3BZ6 A;  4HPQ A;  1TWH J;  2F4M B;  4AYB A;  4M6H A;  3K4L A;  1S7O A;  2PFB A;  1WJE A;  4IQ4 A;  2CH0 A;  4MFE A;  3SZP A;  3RPU D;  3FMQ A;  2VBW A;  1Y39 A;  2B0L A;  1H89 C;  2A68 F;  5FFZ A;  2WAD A;  2YPR A;  2CWE A;  2X6W A;  3SHF A;  1N77 A;  5LGT A;  2BSW A;  5ICC A;  2ZEE A;  3RKQ A;  3LAC A;  3HM5 A;  3RJP A;  3WTU C;  3P5J A;  3R9G A;  3D1N I;  1B8I A;  4V2F A;  1X2M A;  2JRT A;  3ZQ7 A;  4S0H B;  2OU2 A;  2Z99 A;  3RQI A;  3HOX J;  1GYT A;  1ZLH A;  2WB1 N;  2JN6 A;  4CHU A;  4EQQ A;  2HVQ A;  3R9E A;  1SMY F;  1IV8 A;  2EBI A;  2Q8K A;  1IO2 A;  2W84 A;  1WFX A;  4CA0 A;  1YIJ I;  1RR8 C;  4HRI A;  3K9T A;  2J8N A;  2IJZ A;  4IF4 A;  3E6M A;  4N0B A;  3GLL A;  5D6E A;  3EO4 A;  4DUK A;  1X1P A;  3UNG C;  3D67 A;  3OYA A;  2NVY J;  3FWE A;  5JHF A;  4A3B J;  2G9W A;  7CPA A;  4A3E J;  2F5D A;  3WC5 A;  2WPW A;  2LK2 A;  3GTL J;  3L2U A;  1QO0 D;  5EZH A;  3I9S A;  1K4T A;  4QUS A;  3EYI A;  1ZAR A;  4U5Y A;  1S60 A;  2IJL A;  1YX0 A;  1GVJ A;  4WXH A;  1TW3 A;  2QCO A;  2LTP A;  4RAF A;  5HNH A;  2GOM A;  3CDX A;  3GLJ A;  1UJ8 A;  3JRG A;  3CLO A;  2FD5 A;  3R1K A;  1OR7 A;  3B6C A;  4NGS A;  4B11 A;  2QZ8 A;  5HMN A;  3PO3 J;  4YRH A;  4F7Z A;  4HAM A;  5F1R A;  1TWA J;  2M8E A;  2XGD A;  2PJA A;  1X58 A;  2ME0 A;  5CQE A;  4YIR X;  2HQR A;  3EYY A;  1USS A;  2RN7 A;  3OYL A;  1ULY A;  4LD5 A;  4PDK A;  4LJZ F;  4Q47 A;  4FBE A;  3VOD A;  2W48 A;  3TOB A;  4DYR A;  3A03 A;  3F8N A;  1OCT C;  1IB1 E;  3VAR A;  1Z4E A;  3AG4 H;  3FEC A;  1SAX A;  4XRM A;  1W36 C;  4JX6 A;  5FVJ A;  1OZP A;  3HL2 A;  4R1H A;  2XGX A;  3HJE A;  4I7H A;  1KYZ A;  2BE5 F;  3OIQ A;  3MZH A;  3K10 A;  3KL9 A;  3LL7 A;  1IXC A;  3M9A A;  4AXV A;  3M4O J;  4C2X A;  2KJC A;  3RAM A;  2FJ1 A;  1ZHF A;  3BR3 A;  1UCR A;  5C82 A;  2G0E A;  1LDK B;  4ZX8 A;  3Q0U A;  4RB0 A;  2V6E A; 
#chains in the Genus database with same CATH homology
 5DWM A;  4DGW B;  4Y49 C;  3KX2 A;  2CS3 A;  2JVH A;  3VYU B;  4F55 A;  5FRM A;  2D4P A;  3PZJ A;  4FD5 A;  4PK2 A;  2B4D A;  5KTD A;  4MFP A;  4QB9 A;  3CP8 A;  4F6A A;  4XOT A;  2PSW A;  4BMH A;  4P5O A;  2IS4 A;  4PJJ A;  4FET A;  4UBR A;  3SXN A;  2FE7 A;  4LIT A;  2KL4 A;  4HKF A;  3MKZ A;  4KOR A;  4A32 A;  4AVC A;  2JUG A;  2B4B A;  4RI1 A;  1KON A;  1W36 D;  3H35 A;  3OS2 A;  3ZZI A;  4AG7 A;  4CGN A;  4C9Y A;  3EXN A;  4KVO E;  2WUU A;  4A30 A;  2FIW A;  2IS2 A;  4ORF A;  3RYO A;  2XAU A;  1QHG A;  3OOU A;  3D3S A;  3TTH A;  4CAV A;  2ZXI A;  1IIC A;  1YVO A;  2GE3 A;  3JUW A;  3KEY A;  2LBF B;  1SFK A;  4D1Q A;  3U21 A;  4R3K A;  2R7T A;  5EBV A;  2F5I A;  4PSX A;  4CUG A;  5KHD A;  2R7V A;  3FIX A;  2W82 A;  4K30 A;  2FSR A;  3D5S C;  3TE4 A;  2I8D A;  1M4D A;  2CXA A;  2M4G A;  1P0H A;  3OYN A;  1I12 A;  1KZF A;  2NOJ B;  5LFA A;  5KTC A;  2L7K A;  4NEX A;  2IGO A;  3VWE A;  2Z1D A;  2W7N A;  2W00 A;  3OR2 C;  1OLT A;  3ZCO A;  4E7L A;  4RLF A;  3BG7 A;  2LBF A;  2P6G A;  2Q4Y A;  1XIX A;  2GAN A;  3TL4 X;  1QSM A;  4ZGY B;  3LD2 A;  2DCE A;  3GKR A;  4BQQ A;  3IP4 B;  3K4N A;  4XLE A;  3I3G A;  5AG7 A;  5F47 A;  2CW8 A;  4F3Q A;  2CNT A;  4KSF A;  4B14 A;  3DQV C;  4F52 A;  4P1W A;  3DNS A;  3PUB A;  3TT2 A;  5A27 A;  1Z7L A;  3A1Y A;  2XSJ C;  4YEL A;  3DEE A;  1YR0 A;  2FXF A;  3H5R A;  5LD2 C;  3P2F A;  4KOS A;  3EUK L;  2R7X A;  2Z3L A;  3FRM A;  2UUZ A;  3BLY A;  2BW3 B;  3T9Y A;  3IAM 2;  3VYR B;  5C88 A;  4NC8 A;  4CGM A;  2V1N A;  4BJ6 C;  2GOX B;  1MNE A;  2CFO A;  4E7K A;  5HNF A;  4XKB A;  4C2U A;  2KP6 A;  4HNT A;  5FRN A;  2ZPA A;  4JLY A;  3TOA A;  5CPR B;  3DDD A;  3ZXS A;  1U0J A;  1QSR A;  3EUA A;  2K3P A;  5AGE A;  2L9S A;  4BXF A;  1WK4 A;  4M3S A;  3L2R A;  2KRC A;  3DPT A;  4AU7 A;  3RTR A;  2BW3 A;  4E7J A;  2DPT A;  5I0C A;  4H6U A;  4BQN A;  4L89 A;  3PNT A;  3OYE A;  1LVK A;  3LSG A;  3ZRG A;  3FBU A;  2RQQ A;  3QYE A;  4BEH A;  4KLV A;  4LIV A;  1P4N A;  1BR1 A;  4HNU A;  4B5P B;  4JQF A;  1Q2D A;  3IGR A;  4CSW A;  3KKW A;  3HPH A;  1X1C A;  1D0Y A;  2QIR A;  3LFU A;  1MND A;  4OAY A;  3BG6 A;  3TCV A;  2GIV A;  4R87 A;  1NG6 A;  1X1B A;  2K9L A;  4BE1 A;  3W91 A;  1S7L A;  4MY3 A;  1B87 A;  2Z3N A;  4XNH C;  4PV6 A;  2QEC A;  3EC4 A;  4XLF A;  5HLT A;  2ARH A;  3S3M A;  2PRB A;  1LFP A;  1YGH A;  5KTA A;  2VXZ A;  2Q2E B;  4HSR A;  4XKW A;  3W2V A;  2O28 A;  4F91 B;  4BAC A;  4UA3 A;  2KLO A;  4KIT B;  4BUP A;  2LG4 A;  3L2V A;  2W4S A;  4BE0 A;  1U6M A;  4FD4 A;  4XQF A;  3AL0 B;  3K4M A;  2PR1 A;  3F0A A;  4RS2 A;  3DTK A;  5F48 A;  3DPL C;  1S3Z A;  3N7Z A;  2OZU A;  3WR7 A;  2VBQ A;  3OYJ A;  3OYK A;  4ITV A;  3H4Q A;  4XR6 A;  3FHN A;  3BJ8 A;  2KRH A;  3DWL E;  4XKC A;  4U9Y A;  2YNE A;  2JEV A;  4E0A A;  4UFW A;  4NQW B;  2PJR B;  1MJA A;  2AJ6 A;  1JI8 A;  1IYL A;  2R1I A;  4JJX A;  2VEZ A;  5G20 A;  4DIQ A;  3PJR A;  2QKL B;  2YND A;  2H5M A;  1CM0 A;  1XE4 A;  1UG0 A;  2REE A;  4HG2 A;  3CF2 A;  3M1C A;  1S7K A;  4NNJ A;  2R7S A;  4F0X A;  2PDO A;  2VJ5 A;  3QB8 A;  5CKT A;  4LG3 A;  4C2Z A;  2X6Y A;  4HNW B;  4DBR A;  5GCN A;  3FBI B;  3HKZ A;  3S6K A;  5G1Z A;  4FD7 A;  3IWG A;  1S5K A;  2V7F A;  2ZXH A;  3EPZ A;  2PJR A;  2ZW6 A;  4C2Y A;  3GY9 A;  1D0Z A;  2MAB A;  2WY8 Q;  2HV2 A;  2A4N A;  3SHP A;  2A6T A;  4XKV A;  2RRE A;  4J00 A;  3I9V 2;  2BUE A;  2UWM A;  1HA8 A;  2MFZ A;  3BCB A;  4CYN A;  4KZT A;  1IRX A;  1N71 A;  3AL0 C;  4PSW A;  2QKM B;  3NWS A;  1D1C A;  3SDB A;  2KZV A;  3OR1 C;  4F93 B;  2X1C A;  4LIU A;  3CJQ B;  3VSL A;  3MKW B;  2IS1 A;  3G8W A;  4B43 A;  4XL9 A;  3E0K A;  4MFL A;  2R4G A;  3K4K A;  5H84 A;  3LMM A;  4CS0 B;  1M44 A;  4CGP A;  1PYV A;  3A2K A;  1Z9U A;  2BOL A;  2PMZ A;  3GYA A;  4B13 A;  4C68 A;  2KMU A;  4KLW A;  2Q1Z B;  4F0Y A;  2JVG A;  4GS4 A;  4A33 A;  1V5G A;  3CMM A;  4C7I A;  5IV0 A;  2OC6 A;  4KUA A;  2WY7 Q;  4Y3O A;  4AVA A;  2XF7 A;  4MY0 A;  3SEZ A;  3OYB A;  3MKY B;  2WPX A;  2CMP A;  2CUZ A;  2VQG A;  4BJT A;  2LRD A;  2XC7 A;  3CXP A;  3W2W A;  2KDO A;  2VAS A;  2Z10 A;  4UFX A;  1WJ5 A;  2R98 A;  5F49 A;  2KHM A;  3S6F A;  2KCW A;  4CH7 A;  3PFY A;  3R9F A;  4QPO A;  4PFO A;  1TZL A;  5JPH A;  3BJ7 A;  4PK3 A;  4OAE A;  3ZGK A;  4IX7 A;  3K4C A;  2LY1 A;  2HDW A;  4CCN A;  2WAE A;  3K70 C;  4JXQ A;  1R6R A;  2Z16 A;  2EUI A;  4N4O B;  4CCM A;  3HUG B;  3MD2 A;  4OWR B;  1VZ0 A;  4OAD A;  1XEB A;  4UWJ A;  2VI7 A;  3JVN A;  4BBH A;  2R7U A;  3W3C A;  4UCN A;  3VYT B;  2OZH A;  1ZO0 A;  3DU5 A;  2X1E A;  2MYS A;  2ELJ A;  4KVM E;  4KS9 A;  3H9J A;  5E96 A;  2R7H A;  4CGL A;  1ERD A;  4X0G A;  3SYT A;  2BVL A;  2NMT A;  4XPK A;  2X6X A;  3VDX A;  2IGN A;  4QVT A;  4BU2 A;  4E6K G;  3H5N A;  1BR4 A;  3E0J B;  3IAS 2;  4ZTF A;  3S3O A;  2LOO A;  3N05 A;  4KOT A;  4XNH B;  4JD6 A;  2HQY A;  5IB0 A;  3ZR8 X;  1PJR A;  1Y6I A;  2DJI A;  2LC2 A;  4XLA A;  4BDY A;  1VHS A;  1TIQ A;  4ZJZ A;  3K9U A;  2B5G B;  3EUH C;  4ZC3 A;  5HVQ C;  2JDD A;  4EVY A;  4KOY A;  5ISV A;  4DNC A;  3DKY A;  1MMG A;  4B10 A;  4UFV A;  3LSK A;  3H9G A;  3EY5 A;  1NE9 A;  4CYQ A;  2FUG 2;  1NSL A;  5DWN A;  2FIA A;  2DXQ A;  3F9K A;  4XN0 A;  2L5Q A;  2Z3P A;  3TBI A;  3K70 D;  1BO4 A;  3L2W A;  2P6E A;  4NF1 A;  4RMN A;  4XN3 A;  3PL8 A;  3K6G A;  3BCA A;  1XMT A;  1MMD A;  3HXL A;  4JOM A;  2IXS A;  2PC1 A;  2B5G A;  3LSM A;  2M3A A;  4LUA A;  3OYM A;  2YGW A;  4QBJ A;  1DP3 A;  3S3N A;  3DSB A;  3GBG A;  3RSN A;  2ZFU A;  3LSI A;  1B6B A;  2MC4 A;  3RCO A;  4YEJ A;  2G3T A;  2LH9 A;  4YGO A;  1Z3Y A;  3ONQ A;  3TO7 A;  3S8P A;  4BL0 B;  1Z21 A;  1EA3 A;  2X85 A;  4CYO A;  1MMN A;  2O5R A;  1DGR M;  3IUO A;  3OMY A;  2JLM A;  4ZYA A;  1J4J A;  2M0M A;  3HC7 A;  2F4I A;  3V8I A;  2I00 A;  4H4K C;  4QC6 A;  1V5F A;  4XLH A;  4U87 A;  2VXK A;  4ONU A;  1KUY A;  3FXT A;  2LYC A;  2VL8 A;  4L8A A;  4MJ8 A;  2YNC C;  2A5W A;  4OAZ A;  3OYI A;  2L2O A;  4IZZ A;  2BL1 A;  3C2G A;  1SAU A;  1Y9K A;  1P9Q C;  2Q44 A;  4B5P A;  3HPG A;  2DT7 B;  1UAA A;  1NG7 A;  2UV1 A;  4HST A;  2D4O A;  3F5B A;  4R57 A;  3W6X A;  5BWA B;  3K4J A;  4ZDL A;  3ZQQ A;  1MMA A;  1WWZ A;  3QAH A;  1GLN A;  1LKX A;  2DPS A;  3TMO A;  4C7H A;  4AB7 A;  1D1B A;  4BDZ A;  4B12 A;  2C27 A;  2VIX A;  4II2 A;  2JSP A;  2CW7 A;  4BQO A;  1Y9W A;  3SEQ A;  4E4H A;  2AE6 A;  3CP2 A;  1E0E A;  2X1D A;  1MK4 A;  4PJM A;  5A28 A;  2VXD A;  1Y56 A;  5HOO A;  4ZDO A;  2VJ4 A;  2VQL A;  1KUV A;  2CY2 A;  4KVX A;  3FDY A;  1QU3 A;  4NCZ A;  3VWB A;  4II3 A;  4Y33 A;  3PSI A;  4F92 B;  2WAQ A;  3TO9 A;  2HUZ A;  1J09 A;  4C30 A;  4XOP A;  3G3S A;  3IWE A;  2OH1 A;  2HPI A;  3ZJ0 A;  4A2Z A;  2VJJ A;  4DJA A;  3A4C A;  4ANJ A;  3OYF A;  4B47 A;  4CAF A;  1G8X A;  3OIP A;  2RC4 A;  2VQC A;  2VZY A;  4XLC A;  4IKF A;  2HNH A;  2JA2 A;  1YRE A;  2Z3K A;  4RM2 A;  3NE7 A;  2XF5 A;  3A9L A;  1FMV A;  2EVN A;  2K5T A;  2REF A;  3AFH A;  5J8C A;  2OZG A;  2Q04 A;  4CRZ B;  3CES A;  4UCP A;  4CYP A;  2CNM A;  3D2M A;  4CCK A;  3NWT A;  3D2P A;  2R7O A;  3W2A A;  4AG9 A;  2X7B A;  2VQH A;  1UEL B;  1AA7 A;  2M7B A;  3SZG A;  3HOS A;  2IL4 A;  4R3L A;  5EC4 A;  2HVS A;  2IS6 A;  2B3U A;  2R8V A;  1OR7 C;  2FS5 A;  1T0F C;  3D5R C;  1T95 A;  3MGD A;  3FNC A;  3DPU A;  4RM3 A;  2CV0 A;  4HNX B;  4MFK A;  4JXR A;  2K5C A;  3OYD A;  3H5A A;  5J8F A;  4E7S A;  1YK3 A;  1Q2Y A;  2XF6 A;  3QYF A;  1YX5 A;  3FYN A;  4UWI A;  3R96 A;  4RLQ A;  3QYB A;  2CUJ A;  2Y0S A;  2R7W A;  1ON0 A;  2B3V A;  4LX9 A;  4X5K A;  4II9 A;  5G21 A;  2XDV A;  2P0W A;  5HH1 A;  1FY7 A;  2BEI A;  2E5N A;  2E60 A;  3TO6 A;  2M4K A;  4Y4R A;  5TGT A;  2G3A A;  4CZC A;  3VYS B;  1Z4R A;  4KOU A;  3L2Q A;  4NC7 A;  2LRE A;  2R7R A;  5F46 A;  1FMW A;  4UCM A;  4M85 A;  4MFZ A;  2IGM A;  1MJ9 A;  3BLN A;  2L9N A;  1X4P A;  4MI4 A;  4NXY A;  2Z2S B;  2WBM A;  3F8K A;  5G22 A;  2I79 A;  1LRZ A;  2V9K A;  4BS9 A;  5KNL A;  2Z0Z A;  1IYK A;  1DGW Y;  5CQG A;  2PQ8 A;  3H5Z A;  4N4N B;  2J8R A;  3PP9 A;  2CV1 A;  1D1A A;  1Q2C A;  3DKX A;  1I1D A;  4ZTJ A;  1S7F A;  3H9Q A;  3B8G A;  4D9J A;  3IU1 A;  4KOX A;  4A31 A;  3G2B A;  2J8M A;  3QOD A;  2W1O A;  3DLA A;  1X4O A;  2DXI A;  1R57 A;  4KUB A;  3PNY A;  2P6F A;  2DT6 A;  4QPQ A;  4YRV A;  4I49 A;  3FBN B;  4IQJ A;  4PK4 A;  4B44 A;  4G6T B;  4CAX A;  4ZDP A;  2VQY A;  3OY9 A;  3CXS A;  2QML A;  2V4J C;  4CAW A;  4BJ5 C;  3HG9 A;  2VPL A;  1M4G A;  3IU2 A;  4ZBG A;  3OL3 A;  1VKC A;  2LY2 A;  2HPM A;  2MD0 A;  2JDC A;  4E7I A;  4CCO A;  2OUM A;  2E5Z A;  3CJR B;  3PNV A;  3DR8 A;  3SXO A;  2VKD A;  2G0B A;  3P2H A;  4KSA A;  4HNY B;  4B48 A;  2WA0 A;  2ZW7 A;  2ZW5 A;  4MHD A;  2Y0M A;  1WJA A;  2K9M A;  4J01 A;  5AG5 A;  3C26 A;  2VJI A;  3S93 A;  4FAS D;  2YNC A;  4KJZ A;  2F6C A;  1X1D A;  3UY5 A;  2VKH A;  4Q38 A;  2WB1 A;  1ZEL A;  2M7A A;  1S9H A;  2Q4V A;  3R95 A;  2X51 A;  3LSH A;  4HPQ A;  4AYB A;  3M8J A;  3K4L A;  1WJE A;  4IQ4 A;  2CH0 A;  1UFH A;  2CNS A;  3RPU D;  2DOA A;  3OWT A;  2CV2 A;  2FCK A;  3DR6 A;  2WAD A;  3BC8 A;  2X6W A;  1CJW A;  1TT0 A;  1N77 A;  3HOT A;  2ZW4 A;  2AQE A;  2BSW A;  3LOD A;  4FD6 A;  2HZD A;  3QOE A;  3MMY B;  4CCL A;  1L0C A;  2ATR A;  3R9G A;  1X19 A;  1QSO A;  1N75 A;  4BEH B;  3TFY A;  5AG6 A;  4H6Z A;  4J3G A;  2OV7 A;  3T90 A;  2OU2 A;  1MW7 A;  4MBU A;  3DU6 A;  3OYH A;  4GRI A;  2HVQ A;  3R9E A;  5FRO A;  4PFP A;  4OLL A;  3S6H A;  1WFX A;  4CA0 A;  2J8N A;  4HRI A;  4R79 A;  1WJF A;  4BGD A;  3OS1 A;  1NMT A;  4YFJ A;  2HQA A;  4H89 A;  3K4B A;  1X1A A;  1YX3 A;  1QSN A;  3EO4 A;  4XON A;  4KOW A;  2BVM A;  2KPM A;  2Q7B A;  3UNG C;  1WJD A;  4E7H A;  3OYA A;  1YE9 A;  1M1D A;  1WJC A;  4PJN A;  4XOR A;  4AVB A;  5IX3 A;  4MFJ A;  1Z3X A;  5JHF A;  3UR3 C;  3JTK A;  3DTI A;  4B3X A;  3OL4 A;  2FL4 A;  4CAE A;  4PUS A;  2WPW A;  1QST A;  2Z3M A;  3FKJ A;  4XPL A;  3L2U A;  1YLE A;  3E1S A;  2WAF A;  2B58 A;  2PR8 A;  2Z11 A;  3I9S A;  2OB0 A;  4QUS A;  4NSQ A;  1PUA A;  3PSF A;  4U5Y A;  1S60 A;  1YX0 A;  1RO5 A;  3J7A Y;  3DTE A;  2E1M B;  1BOB A;  4BE2 A;  2AQF A;  4NUB A;  3S32 A;  5HNH A;  2GOM A;  4U7B A;  3RQ4 A;  4KIS A;  1S7N A;  2WSA A;  4CCJ A;  3OYG A;  3W6S A;  1QHH D;  2R7Q A;  1V0C A;  1MJB A;  3R1K A;  4XPD B;  4MLO A;  1PU9 A;  1I21 A;  4MFQ A;  2KQR A;  4XM3 A;  4Q36 A;  1Y7R A;  3AKZ A;  2ZXV A;  4YRH A;  4B11 A;  4E8O A;  5HMN A;  5KCM A;  4B5O A;  1N78 A;  2Q0Y A;  3PGP A;  3VWD A;  5H86 A;  1DQU A;  1V5E A;  3I3L A;  4KOV A;  4Y49 B;  4HEA 2;  5CQE A;  1YVK A;  3OYC A;  3OS0 A;  3OYL A;  2VLA A;  2Z3O A;  3V42 A;  3TOB A;  2V26 A;  1IB1 E;  4R9M A;  1Z4E A;  4CRY B;  2VB6 A;  2FT0 A;  3OWC A;  3S6G A;  1XF8 A;  4DOZ A;  4EAT A;  3FB3 A;  1W36 C;  4IUS A;  1K4J A;  5CNP A;  5FVJ A;  3KYL A;  3VSK A;  1RXT A;  3C2H A;  2VZZ A;  2ZSI B;  4E7Z A;  4C2T A;  1OZP A;  1IID A;  1WJB A;  3H0D A;  3HL2 A;  1D0X A;  4AVZ A;  1K6Y A;  2HVR A;  1M4I A;  4PJL A;  3OIQ A;  4DBQ A;  3CXQ A;  3CZ6 A;  2ZSH B;  2F5V A;  3K10 A;  1BR2 A;  3LL7 A;  3EFA A;  2E1M C;  2B4D B;  5JQ4 A;  4E2A A;  4U9Z A;  4C2X A;  1KUX A;  4IF5 A;  4CGO A;  2RNG A;  4XMY A;  3D5L A;  4XNF A;  4XPD C;  2HU9 A;  5C82 A;  4A95 A;  1LDK B;  4JWP A;  1GHE A;  4KT6 A;  3D8P A;  1G59 A;  5AG4 A;  2IGK A;  2V6E A;  1SQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...