2P0WA

Human histone acetyltransferase 1 (hat1)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
319
structure length
319
Chain Sequence
AEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human histone acetyltransferase 1 (HAT1) in complex with acetylcoenzyme A and histone peptide H4
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone acetyltransferase type B catalytic subunit
total genus 93
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2p0wA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2p0wA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 2p0wA01
2OH1A 5JQ4A 4KLVA 4KOUA 1IIDA 4F0YA 2J8RA 4AVCA 4CAVA 2CNMA 3QB8A 4JXRA 1NE9A 2FE7A 4YRHA 1B87A 4AVBA 1Z9UA 4QUSA 3DR6A 5JPHA 1XMTA 1YLEA 2ARHA 2Z11A 3WR7A 2FIAA 3W6SA 3D8PA 2VI7A 5J8CA 1XF8A 2B5GB 2ZW4A 2FIWA 1GHEA 4PK3A 2FT0A 2RC4A 2G0BA 4E8OA 1N71A 4UWIA 3H4QA 5EC4A 3E0KA 1YK3A 2OZGA 4F6AA 4KOWA 2B4DA 5DWNA 3PGPA 1M1DA 2REFA 2G3AA 5C88A 2CNSA 4XNHC 1LRZA 4R9MA 4U9YA 3S6FA 4XPLA 3G8WA 3P2HA 1FY7A 1M4DA 4XPDC 2VXKA 3N7ZA 3PP9A 4CS0B 1I12A 4R87A 1S7FA 3B8GA 3K9UA 1Y7RA 2Q44A 1WWZA 3I3GA 4B5PB 3C26A 3EC4A 4KOYA 4M3SA 1S7KA 2J8MA 4MY0A 1S5KA 5F49A 4R57A 3SXNA 1M4GA 2ZW5A 1IYKA 3F0AA 1I1DA 4DNCA 3LODA 4OLLA 1S60A 1YVKA 3TCVA 1XIXA 4EVYA 1Z4RA 3TOBA 4FD4A 5IX3A 5HH1A 1TIQA 4HKFA 1Q2YA 4KUBA 2F5IA 3F5BA 2JLMA 4MI4A 1PUAA 4YFJA 2PR8A 3S6GA 4JD6A 2H5MA 2R8VA 4E0AA 4YGOA 2Q4VA 1CJWA 2R98A 1S7LA 4HNYB 5F46A 3CXSA 4AVAA 1NMTA 3SHPA 4QBJA 3EFAA 5F47A 3DNSA 1QSTA 1L0CA 2ZXVA 3EXNA 3R9FA 4NF1A 5H84A 1Q2DA 1CM0A 4R3KA 4XPDB 5ISVA 4Y49C 4R3LA 3F8KA 1IB1E 4UWJA 4XNHB 3D3SA 4U9ZA 5H86A 1MJ9A 2CY2A 2P0WA 2ZW6A 1SQHA 2OB0A 3JVNA 1B6BA 3GKRA 1XEBA 3R9GA 4MBUA 2QECA 5I0CA 2J8NA 2B58A 5IV0A 4LX9A 5HMNA 5C82A 3T9YA 2B4BA 3T90A 2KCWA 4JXQA 4B5PA 2I00A 2REEA 3FNCA 3PZJA 1YX0A 4KOSA 1QSRA 2PDOA 4KOVA 2P6EA 1KZFA 2QIRA 3FXTA 3R96A 2VZZA 1Y9KA 4MJ8A 2FCKA 2B3VA 4BMHA 5J8FA 4H6ZA 3BJ7A 1K4JA 4LUAA 1MJAA 4KORA 4KLWA 1BOBA 4NXYA 5E96A 2BUEA 5DWMA 4XPKA 3ZZIA 3V8IA 4MHDA 2I79A 1KUVA 1KUYA 2HQYA 4ZBGA 2BL1A 1BO4A 2VZYA 3TFYA 2JEVA 2Q0YA 2HUZA 5F48A 3RYOA 3LD2A 4J3GA 1IYLA 3DDDA 3FBUA 2WPWA 2DXQA 3P2FA 1QSOA 3GYAA 3TO6A 2D4OA 4OADA 3W6XA 3FRMA 2R1IA 2B3UA 4Y49B 1M4IA 3GY9A 1VKCA 2FL4A 3TTHA 3ZJ0A 4CRYB 1ON0A 1YVOA 3MGDA 3D2PA 2B4DB 4KOXA 4CAWA 3SXOA 4CRZB 2X7BA 3BJ8A 3R9EA 1P0HA 2A4NA 2AJ6A 4HNWB 2VBQA 2VQYA 3NE7A 4H89A 2R7HA 3EO4A 3FYNA 2G3TA 3W91A 4NCZA 1XE4A 2ZPAA 2OU2A 2PR1A 4PK2A 3TOAA 2Q7BA 2Y0MA 2B5GA 4K30A 1YREA 4NEXA 4QC6A 4PV6A 4KUAA 1J4JA 1YR0A 1M44A 1VHSA 4JJXA 2EVNA 1P4NA 2GE3A 2PSWA 1PU9A 3TT2A 1U6MA 1R57A 3S6HA 1MK4A 3TO9A 4PSWA 4RS2A 4QVTA 1MJBA 4IF5A 1KUXA 2D4PA 2CNTA 4NSQA 3UY5A 2Z0ZA 2K5TA 3I9SA 2C27A 3QAHA 1QSNA 5KTAA 2ZW7A 4M85A 2FS5A 2P6GA 2O28A 4II9A 4PSXA 3VWDA 2ATRA 2GANA 5CNPA 1Q2CA 3VWEA 4RI1A 3D2MA 1I21A 3EY5A 2P6FA 2OZHA 4MY3A 4ORFA 4JWPA 3G3SA 3CXPA 2Q04A 4KVOE 4AB7A 2JDDA 1S3ZA 2EUIA 4X5KA 4L8AA 2FXFA 4ONUA 5IB0A 4KZTA 1IICA 4B5OA 3JUWA 2QMLA 2Q4YA 1QSMA 3BLNA 5FVJA 2JDCA 2PQ8A 5EBVA 2IL4A 3CXQA 4UBRA 1S7NA 4FD7A 2AE6A 4H6UA 1OZPA 2PC1A 4GS4A 3TE4A 4HNXB 1NSLA 2BEIA 2OZUA 1YGHA 4QB9A 1RXTA 4AG9A 3DSBA 4IUSA 3KKWA 3R95A 3DR8A 1RO5A 3S6KA 3OWCA 2VEZA 4U5YA 4CAXA 4KVME 4I49A 2WPXA 1Y9WA 4KOTA 1Z4EA 2BSWA 5GCNA 2HV2A 4L89A 4UA3A 5KTDA 1UFHA 4JLYA 1V0CA 3IWGA 2NMTA 4E2AA 5KTCA 3R1KA 2FSRA 3FIXA 4OAEA 4AG7A 1WK4A 2GIVA 4KVXA 3TO7A 4FD6A 2PRBA 4FD5A 3FB3A 3IGRA 2Z10A
chains in the Genus database with same CATH superfamily
1PP8F 2LRDA 4CGZA 3F9KA 5JQ4A 3LA7A 4HBLA 4E70A 3PRTA 4KOUA 4F93B 3GMEA 2P5VA 1TLHB 3VDXA 2X1EA 4OU0A 3LOCA 1J75A 1WJCA 1VTNC 2YX7A 3ULQB 3OYFA 4E7JA 3T0YA 4Y52J 4C68A 3ASOH 2HXIA 4JXRA 4RBOA 2MLGA 4ZDLA 4A3CJ 3PIOF 1KU2A 5EJCA 2R93J 3LA3A 5JLXA 4AVBA 1ZLJA 4S0HB 2IS2A 1S7EA 2KIQA 5FKLA 2ARHA 3FEEA 2DOEA 4D0PA 2ZBKA 2LY2A 3CQZJ 2E1CA 3QPLA 1ORKA 4A0YA 1HXDA 1FOXA 3WGHA 4EM2A 1Z7UA 4QIWN 4A3JJ 4KS9A 4EMEA 5JH9A 4RLFA 5J8CA 5EZGA 1XF8A 3OYHA 4PXCA 2M45A 1ITYA 2ZW4A 2VJ4A 5E1ZB 4IXAA 3EQLF 4R76A 3HTUA 2KIFA 1BLLE 1ETQA 2CO5A 1WJAA 3ROUA 4CZZA 2UV1A 4M6HA 3HDDA 2CQQA 2ZEMA 3L2QA 3R0JA 4Z6YA 1GT0C 3S1QJ 2GXAA 2NS8A 4H2KA 1MD0A 1F9NA 3PJRA 2AFXA 2OZGA 2HQAA 4P5OA 5ICFA 1ZLKA 4NGNA 4PQAA 2XEFA 2IS1A 4HNUA 2B4DA 2HOEA 2Y69H 2EQRA 2V7FA 4XLAA 5LHGA 5K8PA 2BY2A 4B3XA 3WTTC 3CO6C 3DEWA 5C88A 3TQNA 1RR8C 2MYSA 1Y0RA 1JGSA 3A1YA 4I02A 2VQHA 2AXTC 4OC3A 3KX2A 3REOA 1UFMA 3AL0C 1J9IA 3G8WA 3PSFA 1ENHA 3P2HA 4LLNA 5DM6F 3N7ZA 4MEYF 1WFXA 2DMPA 5DCMB 4CS0B 4P4FA 3RYPA 2EFQA 3KP5A 4G1PA 3FKIJ 3K9UA 3OOPA 2ZNZA 4MLOA 2HB6A 3RIRA 3SI2A 3KYLA 1WWZA 4ENMA 4CUGA 2G7UA 2Q0OA 1IU8A 2OV7A 3OYNA 3S3MA 2LG4A 5HVQC 4I6ZA 4EM1A 3MVPA 2NNYA 4CA0A 2J8MA 4RS8A 3ISPA 4XOPA 4A95A 4P55A 4AM3A 3HOWJ 3MMYB 5CPAA 2GA1A 3L2WA 5J1QA 4WX9A 2DU9A 5F49A 5FFZA 2BZTA 2PMHA 1M4GA 2CUEA 2EWNA 1IYKA 4ENKA 2W00A 3JRCA 4DNCA 3BCAA 2WAQN 5AIQA 1MNMC 2L01A 4L5JA 4B3AA 3S1RJ 1TNTA 3TKYA 5LEKA 3EDPA 2R7QA 3JCUC 1TQPA 3JR9A 1V4RA 1O3TA 1D1AA 5K7FA 3FXOA 3IU1A 3KHZA 3BDDA 3K9TA 1DPRA 1Z4RA 3F8MA 1X1AA 2IGMA 2QYOA 2JUGA 1D3YA 4FD4A 1VIXA 1O7LA 3M1CA 4RAGA 1JI8A 3T8WA 1P92A 1QNTA 4P9UA 4L18B 3ABKH 2KMUA 2L4AA 1IY7A 3SYTA 1DU0A 4MI4A 4J00A 1IN4A 2EV6A 3FMRA 3GCMA 3PIPF 4C2ZA 5G20A 2NS7A 3S6GA 4RMNA 4JD6A 1HW5A 2E7XA 3K1PA 3F3XA 3BR2A 4KSIA 1WJ5A 4PK4A 3EUHC 4GXOA 3VB2A 2G9WA 2PJCA 1MSFC 2R98A 2MH9A 1JT0A 2ETHA 2NYXA 2VBXA 1IG7A 2M7BA 4G8XA 1MBHA 2HTSA 1O3SA 2AJ6A 3H5ZA 4AVAA 2HOSA 4IRGA 2XC7A 2F8HA 3DPLC 4JQFA 2YU3A 4NHJA 1NMTA 3CCRI 4LIVA 3GTLJ 1IXRC 5F47A 1LVKA 1OJLA 1ACIA 2BY1A 2ZXVA 2HR3A 3CLQA 4FE4A 3H8FA 4NF1A 3TP3A 5H84A 1CGPA 3D1NI 1ZGWA 5D5XB 4XPDB 4CYNA 4A2UA 5DS9A 2M30A 3WTXC 4Y17A 3FBNB 3M4OJ 3AL0B 2LSOA 4WF2A 3ECOA 1CPSA 3D4UA 3F8KA 1M1EB 2V1XA 4UWJA 4UFVA 3BG9A 2EBJA 3QU3A 5BNGA 4XNHB 2P8TA 3GZ5A 1HC8A 2WBMA 2YNEA 2COMA 4XL9A 1MJ9A 2L9SA 5HDGA 1Y6IA 2VI6A 4IQ4A 1HCRA 2M4KA 4Q4ZF 5H2FC 2ZEHA 1RPWA 1LFWA 3RJPA 1HF0A 2ZW6A 3JVNA 1S3JA 2F4OB 1G3WA 4PJ0C 1X1PA 2I8DA 5F27A 4ZI6A 2XSDC 4QSHA 3WODF 5B1AH 3FBIB 3B7IA 4MHNA 2ESNA 4F3QA 4Z2YA 3G2BA 5EG0B 4XORA 4LX9A 4FT8A 4BH9A 5HMNA 5C82A 1YX3A 4E7IA 4ZY2A 4X8IA 2R7DA 4B5PA 1BM9A 3OYJA 1T0FC 1IC8A 3GTOJ 2IEKA 3A01B 1TKHA 3K2KA 3EUHA 3IH3A 2LD5A 3HOVJ 2LR8A 2FBIA 2QVPA 3PZJA 2QENA 3EUAA 4BL0B 2VKHA 1QSRA 4YU9A 3PUBA 4KOVA 3K4LA 5DCMA 2QIRA 1ZHFA 2DLLA 5CVIA 3E0JB 1TF8A 1F43A 4J19A 3I64A 2LNBA 1T2KA 2CUFA 5K5QA 2AQFA 2Z3YA 2GWRA 2A07F 3GTKJ 2JK3A 3MEXA 3KZYA 3NWSA 3LSKA 3RPUA 3U9GA 1YLOA 2QGUA 2Y0SN 4F52A 4KDPA 2HVRA 4M3EA 4UCPA 4DYQA 5D8KB 3FVLA 4IPAA 1KQ9A 4H6ZA 1K4JA 3GO5A 1XMXA 5GAHJ 2FEZA 4AYBN 1WI3A 2WV1A 1Z3YA 2ZCWA 1ZG5A 3VYRB 5E96A 4DOZA 2Z3LA 5DWMA 1SVMA 4N9IA 1PDNC 3M8FA 4XK4A 4A3KJ 4HX7A 4A5NA 1V3FA 4XRFA 2JMWA 1RRJA 1S6LA 1KUVA 4LMYA 2FUG2 3IP4B 1KUYA 3FK7A 3JTGA 3HLPA 4ZBGA 1MW7A 2E19A 4RA2A 1JUSA 3WTVC 2VPLA 4DYRA 1ZG7A 4XBFA 1GLNA 3GB0A 3C2BA 3TFYA 1K6OA 3BY6A 2Q0YA 3B3VA 4XIDA 2V9VA 1FLIA 2OD5A 4BJTA 5F48A 1WH7A 4BXUA 4J3GA 5LHHA 2KZVA 3G4SI 2ZFWA 5EG0A 4EM0B 5JVGF 4BDZA 1WVRA 1L3LA 1D1BA 1KQ0A 4D5CA 3JRFA 2CTBA 3NE8A 3ZMDA 5HVFA 3QWLA 5M5XJ 2FNAA 2JA8J 4OADA 3BT9A 3FX6A 2XIGA 4OC0A 4NC6A 3GY9A 2EO8A 1FWZA 1P7IA 4L5EA 4BYYA 2FL4A 3LWFA 4CRYB 1N78A 1ON0A 4ON0A 2AHQA 1ODDA 2X6XA 4DZPA 5IT9Z 2WTEA 5IP9J 2B4DB 3CP8A 2X9DA 2FRHA 4C3HJ 1BC7C 1A36A 1UB9A 4ENNA 3BZKA 3PB8X 5HS7A 2VODA 1CP7A 3R9EA 2XAFA 1P0HA 2VBZA 2VBQA 2HXOA 2VQYA 4AD9A 2K9SA 5HNHA 4V2GA 1B72B 1B8IB 2CXAA 3IO1A 4H89A 2PJRB 3CUQB 4IEJA 1ETKA 1FSHA 1LAMA 2G3TA 4XMYA 4N4NB 4NCZA 1XE4A 4KN4X 2CV2A 2ZPAA 2ZSIB 2DA1A 4PK2A 4D1QA 2V1NA 4XRMA 1SANA 1YREA 1LFUP 2ZEOA 4NEXA 4XRSG 2A5YB 5H6QA 3L2NA 2XDVA 3ZQFA 5EF6A 3CPAA 1QGPA 3F8CA 1J4JA 1YR0A 3A4CA 1T08B 2ISYA 2ZJ2A 1FEXA 1PJRA 3KEYA 2PJBA 2PSWA 2L9NA 3DPTA 3RKYA 3SFZA 3TT2A 3V7ZA 1R57A 2JRTA 3M7GA 2DT7B 3VWBA 5KK1A 1Z9CA 1GHCA 1X1BA 5LGTA 3F0CA 2NVTJ 4RS2A 4QVTA 4S05A 5IOZA 3HHGA 3UR3C 4ZY0A 4C2YA 4IF5A 3K4JA 1BI3A 1HDDC 1IRZA 2D4PA 3MRUA 2QQBA 2CNTA 1SFEA 4PGGA 1OLTA 1RTQA 3UY5A 1R43A 3EUKL 2XEGA 1BA5A 3OIOA 3BTIA 5LLQA 3A9LA 3A0BC 4Q7AA 2VLAA 4OAYA 2W7NA 1XCVA 2H8RA 4BY7J 5IPAA 3V8KA 4GCVA 2QCOA 1QSNA 4M85A 3GFLA 2P6GA 3VARA 1QBJA 4II9A 3W2AA 4PGHA 2HQNA 3Q9SA 3K6GA 3ABMH 4A3LJ 1YRNA 3RBUA 5CNPA 2K3PA 1P9QC 4MCSA 1HKTA 2XKOA 3FHZA 3O3KA 5K7ZA 3KLNA 5IP6A 3HOXJ 2PJPA 3SEZA 2AFUA 2MG4A 1RUOA 2C6GA 3PBEA 3D2MA 3LWUA 4ONWA 1ULYA 3EY5A 2P6FA 2OPTA 4IRIA 4RGUA 2RFHA 1YQAA 3H3UA 4X1EA 4Q48A 2K85A 3JREA 4DYOA 5EEHA 3HGGA 3CXPA 3A0HC 1I3QJ 2ZEGA 3DF8A 2DMTA 2F6CA 2DF5A 2HZTA 1S3ZA 2VPRA 2F5FA 1IZ1A 1V5EA 2FXFA 4L8AA 2OA4A 3F8BA 2A3SA 1Y1VJ 4XN0A 4ZC3A 4BUPA 3JUWA 1YRNB 3NH8A 3BJ6A 2YSRA 1W36C 2Q4YA 2J5OA 5F6FA 2XAGA 5CPRB 1FBQA 4YIFA 1G2HA 3ZR8X 3KP7A 1XC5A 3FJUA 2IAIA 4OKOA 2LH9A 1WCMJ 2Z9OA 3VH9A 3GTQJ 1MH4A 1TWCJ 1I27A 2L2OA 4GDFA 3FHNA 5CVRA 4WWVA 2XHKA 3HSRA 4FD7A 1TZLA 1R49A 4CICA 2AE6A 2RDPA 3M9AA 1G59A 1OZPA 5ICCA 4TWEA 5LYLA 4XLCA 3ZQHA 1U9OA 4L9NA 4BS9A 2B7EA 3SZPA 1T39A 3NRVA 1HA8A 2V6CA 4I2OA 2BEIA 5TISC 4A3MJ 1U2WA 4B47A 1G4DA 5FFXA 3DSBA 5FKOA 3SQNA 3OYBA 3BR1A 5DDGA 3GLJA 3RKWA 1R71A 3KKWA 3E6MA 2V4JC 1B59A 4X0GA 1RO5A 2A6TA 3DXJF 4IVNA 3GWZA 4OAZA 5L3CA 4S04A 3OYIA 2FQ4A 2HGCA 4CGNA 3N4MA 4BACA 4KOTA 3GBGA 2VOOA 1ETXA 2RNGA 3K10A 2WSAA 4ZYGA 5GCNA 4XSXF 4AWXB 4L89A 4UA3A 1OYIA 3OYLA 4KNYA 2H6CA 1ERDA 4IX7A 1T0FA 4MMOA 1SD5A 4LFUA 1OCOH 2PMZN 4MIMA 3TW6A 2YU9J 2PX9A 4FBEA 1SMTA 4E2AA 4A3EJ 1AYEA 2W85A 4NQWA 1JE8A 1A6QA 4IHVA 4Q38A 2PJ7A 4J01A 2KFDA 3E7LA 4OAEA 1R4MB 3BZ6A 3OS0A 1N77A 4IHTA 2CTCA 5KHDA 2AFWA 5F0HA 3TO7A 2WAEA 4I99C 2JWTA 1IRXA 2H8WA 3GTGJ 3S32A 3FB3A 4C2TA 2XKPA 5DM7F 3ZP5A 4I98B 2OH1A 3CDXA 3WABA 2WADA 4QTRA 3GFIA 1OCCH 2GOXB 5B66C 1YSJA 5D5WB 2AFZA 2L54A 1YS7A 2JA2A 4JX4A 3G1MA 2Q1ZB 3AG2H 4MGRA 1W5SA 5FGMA 2GA2A 2HI3A 2X6OA 2CF4A 2FE7A 4TV7A 4CH7A 5B3SH 3OYDA 3QPHA 3J81K 1X10A 3KIOA 1Z9UA 4QUSA 2DN0A 3ZOBA 1FBSA 4PUSA 5J4VA 5E17F 4P4JA 1Z1DA 4ZZLA 1HEEA 4B11A 1XRYA 1SFUA 3D8PA 4NGMA 1NG6A 3HOZJ 2ZEFA 1PP7U 4BQNA 3H8GA 3VEPA 3E3VA 4OIWA 2X1DA 4IO9F 4GRIA 3RKQA 1W7PD 2DFHA 6PAXA 2JTVA 1FIPA 2FT0A 3D7DA 2D2WA 4LB6B 2R7OA 2G0BA 4C30A 2FVGA 3LNQA 4BBHA 4E8OA 2DBBA 1V5FA 2C6CA 1B8IA 2ZMEB 3RQ4A 4XLPF 1ETOA 1KU9A 4KSAA 2R7SA 4G6QA 1YJNI 1FOKA 2IA1A 4M6XA 1RUNA 2OZ6A 2NVXJ 3RI4A 2ZEDA 2R7TA 2XASA 5GADJ 2ELKA 1W0UA 1TNSA 3GW2A 3W2VA 4ZTJA 3GEZA 3K7AJ 4L9VA 1U3EM 3CPXA 3OYKA 2DDAA 4OIOF 3DV8A 4HOBA 2R5ZB 3K4KA 4HF1A 3KYCB 2AQEA 2XAUA 3SXYA 5HOOA 1OCTC 2MC4A 3G1OA 5IT3A 1KYZA 1S7AA 3MCZA 1LRZA 1TTYA 1TWHJ 2O3FA 4TNUA 5HVHA 4XPLA 3DPUA 2EK8A 3D0SA 4XICA 3BWGA 1XOVA 4Y33A 4C7IA 1GUUA 2R5YA 3GVAA 1YOVB 4EV0A 1S7FA 3Q9VA 3F21A 2GE3A 5J1RA 1DGWY 4HDVA 2EK5A 3CC4I 1Y7RA 2Q44A 2E60A 2I5UA 2P6SA 2ZKZA 3OR2C 1BI0A 1GXPA 3EC4A 4KOYA 1J2XA 4P1WA 2O4HA 5HDKA 4NGPA 3GX4X 4M3SA 1S7KA 2JSPA 1AMPA 3CJTB 4YIRX 2BGCA 2HZDA 2OBPA 2YUSA 5JLWA 4MY0A 2MABA 5FKMA 3BTLA 1CF7B 3H92A 2FMYA 2PRQA 3WU1B 4IZZA 4BDYA 1J59A 2BVLA 2DFFA 4BBSJ 3NE7A 1FMWA 3I59A 2LY1A 2XF7A 4U0VA 2ABZA 1I1DA 3WC5A 3CT9A 4RB3C 2YNCC 4XLEA 1BAVA 4BE2A 5CVJA 5LHIA 1D0ZA 4IHYA 5AG6A 2DOFA 3BCBA 2ZXIA 2KQRA 2D45A 5E8IA 1U5TC 1YX5A 5HVGA 1F57A 1YVKA 1XIXA 2ZB9A 2NRAC 2FX0A 1BW6A 2MD5A 4OC4A 5IX3A 4YWYA 4PJJA 5HH1A 2BEOA 4UIAA 1EE3P 4UB8C 4KUBA 3RDIA 3H35A 3L1PA 1SEUA 5FD5A 1A5JA 1O57A 2DEAA 4ZX9A 1YW9A 2F48A 3IKTA 2O53A 4O23A 1JGGA 4YFJA 1OCPA 3GUDA 3VYUB 5J1YA 4B09A 3H5AA 2R8VA 2X1CA 4E0AA 1XN7A 1F5TA 2ME0A 1DDNA 2E36A 2GXGA 4EGYA 1U5TB 1OYWA 2HNHA 1RC9A 2WAQA 2GM4A 1CJWA 4K2EA 1VQLI 3MKYB 1KONA 3KPHA 4RAZA 1IDYA 3DP7A 5EYRA 4ZYAA 2GZWA 2TRTA 5LFAA 7CPAA 4LG0A 3K4BA 1XD7A 3SHPA 4QBJA 3EFAA 2CMPA 4YFNF 4N9HA 3TMOA 3ERED 1WZ2A 5CQGA 5BMZA 1ZO0A 3DNSA 2FBHA 4M6YA 4A3IJ 1MDMA 4R3KA 4RM3A 1B9MA 1OFCX 5ISVA 4ESJA 1LQ1A 3WHBA 1D0XA 8CPAA 1FSEA 4D9JA 1NSAA 2PBIA 2UZKA 1NTCA 4IHWA 3D68A 2O8XA 1Y56A 3H9QA 3ZQQA 1YTYA 4JBAA 1IB1E 3N5FA 2GREA 1I1SA 2FU4A 2PVVA 3B3TA 2RKHA 2PJ4A 2MW8A 2LTPA 4KIBA 4B4CA 1H89C 3D3SA 4U9ZA 3F72A 4Y7NJ 4LQ6A 2BO9A 3H36A 1ZRDA 1UG0A 4BU2A 1W1WE 3H3VK 2CY2A 2RB7A 1H88C 2DYRH 1FX7A 1SFXA 2EK9A 1SQHA 3JRHA 5JM6A 2YGWA 1MZBA 2DXIA 4OIDA 2QECA 3KGQA 4CYCA 1HQCA 1MBGA 2K9MA 3G71I 4PCQA 3RAMA 5M5WJ 3FXQA 5FROA 4MQVA 3MQ0A 4MQ9F 3RZDJ 2KCWA 3PQJA 3KR4A 3DU5A 4NBQA 3HSFA 3D67A 2I00A 2REEA 1DU6A 1BN5A 4LB5A 2KZGA 2L9VA 1BOAA 4F9VA 1YX0A 1Q1HA 4RGXA 1D8JA 2OTJI 2R5YB 1ETYA 2AO9A 3VYTB 5GTIC 4HF0A 1IV6A 3RCOA 1TWAJ 5E3LA 2IXSA 1T8IA 2R92J 1BPNA 2AXLA 2A5WA 3IFEA 2FCKA 3CD6I 3VSKA 2HOAA 1QPIA 5A27A 2B3VA 3P5JA 4QWQA 1LAPA 1TXRA 3BXMA 2XB5A 2R7XA 4MFQA 3IH2A 1FNNA 2E1MC 3VYSB 2CV1A 3GXOA 1W5CC 5F0CA 4DJAA 1LE8A 1YW8A 3R0AA 1PYVA 3LSPA 2LF8A 3BJ7A 1TQIA 2ZOFA 4KORA 1K6YA 2TDXA 3FXUA 1IGBA 1E3PA 3Q0UA 1FP2A 5GTHC 1V5GA 1ONVA 2BUEA 4P4DA 3M1EA 3DGVA 2VL8A 4ZYQA 1HKSA 1X3UA 3H8EA 5G1ZA 1Y0YA 2PIZA 5D4SA 2QJ8A 2DFEA 3FWEA 3HUGB 2I79A 2ZEEA 3CMEI 5AG7A 1I50J 1L0OC 2PJ9A 1XMKA 4IKFA 2GQQA 5M5YJ 4R8FA 3NWTA 2Y2ZA 2C6YA 3QPSA 1DPUA 1TWGJ 4GM5A 5E3NA 3A01A 5CVVA 5F09A 3ESWB 5K8OA 3K69A 4C3IJ 3FEDA 4OP4A 5HLHA 2GFQA 3NH4A 1K7AA 3ZN1A 2FJ1A 1IYLA 3QYEA 5G22A 4ZYDA 3HRUA 2VE9A 1XMAA 3P2FA 3EPZA 4MTDA 3TO6A 3P7NA 1JQGA 3EYIA 3B2YA 1OQYA 1BI2A 2VC1A 3AFHA 3KP3A 4BE0A 2DYSH 3BG5A 3C2HA 3C3WA 3DTKA 1ELMP 1STZA 4D5FA 2L7KA 2IRFG 5HS8A 4I01A 2W1OA 2NOGA 3IEHA 1XX5A 4NGRA 4A3BJ 2WB1A 2HYGD 4A3FJ 2DCEA 4HV6A 3MGDA 1ZLIA 3PNYA 1KWMA 4CCOA 1XCBA 4FE7A 2Z3MA 4K3NA 3V7RA 4RDUA 3S17J 1FNOA 3QPTA 4OC5A 3KP2A 2NVYJ 3Q3SA 1E17A 1Q7LA 1P6RA 1A35A 4B1RA 2P4WA 1I1GA 3BJ8A 2Y48A 3Q5FA 2XUBA 2HQ5A 3LAJA 1Y0NA 3CCYA 1X2MA 5HS9A 5LGNA 1X4OA 2E1NA 2QSHX 3BI1A 1Y7EA 3R61A 5DD8A 2YX4A 3O8GA 3NA6A 2BVMA 5LD2C 4N4OB 3KE2A 4G7HF 1LNWA 1POGA 3TDZC 3ASNH 2YNDA 3WC6A 2OU2A 1IRGA 3PNTA 4HQMA 5L3GA 3OYCA 3G1LA 2L5QA 3BLYA 2HFHA 1YMEA 3LL7A 4K30A 2ZXJA 3L7WA 5K8MA 3QOEA 3D5RC 4QC6A 5IYBJ 5BOXA 1X2NA 2ME6A 1U5TA 2VJ5A 2E2HJ 2D1VA 3K1NA 3GTMJ 4JJXA 2VJIA 4ETSA 3LFKA 4KT6A 2YNCA 1CBXA 5TRDA 3TC8A 1PYTB 5D5VB 2K9QA 3RZOJ 4E7HA 2CIJA 1RNLA 5ILSA 4QPQA 1U6MA 5LRGA 2LY9A 3LSTA 3BZCA 3ERMA 1YFHA 3IAM2 4I76A 4MCRA 1M4LA 2ZNYA 3U1DA 5HLIA 4B43A 3TO9A 4PSWA 1RIOH 2PJ2A 3KR5A 2JRMA 2D5VA 3WTWC 2HPMA 2VQGA 4OINF 3IWFA 1SMYF 2XGDA 1A04A 5KAFC 1XGOA 1KUXA 3FMCA 2KPMA 2LYCA 3C18A 5CKTA 2CW8A 4JX5A 3S9NA 2H1KA 4O3MA 1K4TA 3GF2A 4ZX8A 2Z0ZA 5LRRA 2O7OA 2OAZA 2QUFA 3F8FA 4LJZF 3V7CA 4MHYA 2BOAA 2B0LA 4E7ZA 4MEXF 2XRLA 1NK3P 3S1MJ 5ICEA 2JVGA 2E2JJ 2XAJA 4ZTFA 2FS5A 2O28A 3RTRA 3MZYA 4BBRJ 3I55I 5IP7J 4UV9A 4MHPA 4R6TA 5DYMA 4AC0A 2Z33A 1J09A 2F7VA 2MC3A 4YFXF 4LLGF 2MSYA 3K2AA 1I6HJ 3KLOA 1HDPA 5LBQA 4HG2A 1XGSA 1EH7A 1Q2CA 2X6YA 1ZGAA 1XMBA 4R7MA 4M3BA 5K5RA 3VWEA 3RNZA 1Z8LA 1WJDA 4MO7A 4DZJA 3DFGA 4JX6A 2OZHA 4C2MJ 2XRNA 1ZR4A 5DTDA 5AIPA 3F23A 1FZPB 4JWPA 1GYTA 1XTAA 3KZIC 4MFKA 1UJ8A 4FX0A 2CJJA 2E1OA 2Q04A 1ZGJA 3ZCOA 4AB7A 1FBUA 2CFXA 1KGSA 2CW7A 4KA4A 2EUIA 1HW2A 2JDDA 3ML6A 3DBHB 2NSMA 2Y0SA 3HYIA 4IL6C 1EF4A 2ICWG 3HUGA 1U8RA 2VT3A 1ELLP 2V8DA 2IT0A 4NGTA 2F5DA 2W4SA 3IKVA 3TX8A 1P4XA 5EEGA 3SJXA 4P6YA 2VUMJ 4I0BA 4M6GA 4A38A 3PQKA 2DA6A 3QQAA 1TC3C 2L02A 3M07A 2Q2EB 4HW0A 3MD2A 2IL4A 4Y3OA 4ABZA 2E1MB 2XPWA 1S7NA 3FX3A 4MRIA 1BI1A 1LE8B 1C0WA 4UCMA 1KU7A 2Y75A 5HDNA 4CSWA 1J5YA 2Q2EA 2WAFA 4GS4A 1ZN2A 3JRBA 4HNXB 4ITVA 1VQOI 1NSLA 3HHHA 1F36A 1QVUA 2V1UA 4BINA 4A5MA 1WKMA 1UELB 2VQCA 1YGHA 4QB9A 4AG9A 4W1UA 1HOMA 3V8JA 2BE5F 2O0YA 2C6PA 3R95A 1S8NA 1USSA 2KIUA 4LK0F 4MHGA 3HL2A 2DT6A 3W6VA 1G3SA 1DQUA 1QVTA 3S6KA 1DP7P 5B1BH 1ZG3A 2VEZA 1UHWA 4CPAA 2XSJC 2XPUA 2BBYA 2H09A 4P10A 4I49A 3HPHA 3KEOA 2K3FA 5E1XA 2OQGA 2WPXA 3KQXA 4PXEA 2X51A 1D0YA 2NXNB 2IW5A 1H0MA 2P5LC 3DWLE 2BSWA 1JHHA 3IWZA 3NAUA 4U87A 1WPKA 2HC9A 3AG1H 5F1RA 4CYQA 1G8XA 5KTDA 1LOKA 5IOYA 2VBWA 3IU2A 4WCGA 4A3DJ 1T33A 2NMTA 3BG7A 4XKVA 1OPCA 2M8GX 2Z3KA 2F5CA 3FXJA 1MGTA 2QKMB 3HG9A 4XONA 1IUYA 1VHEA 3AKZA 1BL0A 4M3DA 2F4IA 4NGSA 1HW1A 1OISA 2P81A 3I3LA 1S72I 3BHXA 4EJUA 1X3WB 2BW3B 4UVCA 2DPUA 2HVSA 3WG7H 1WK4A 2GIVA 2AFOA 2GU2A 5EDNA 3BPXA 3B02A 5M3FJ 1K4SA 5E20A 2DQRA 1AU7A 5EZHA 4UUSA 4D7NA 4X3RA 2ZSHB 3T8RA 2LVSA 2H6BA 1MBEA 5FLVA 1BR2A 1ZARA 2FF4A 3CCQI 4A3GJ 3WC7A 2YS9A 2DJNA 3JRDA 1JTXA 2DPTA 2IVMA 4KLVA 1P4AA 4L5IA 1ZRCA 2V8GA 2HDCA 4F0YA 2J8RA 3RYRA 4AVCA 3B6CA 3O8HA 1MDMB 4GGGA 3PL8A 4KSFA 2P7VB 1NG7A 3K4CA 3SFIA 3HZJA 4HAMA 1XGMA 4LD5A 4QLCU 2CNMA 5FLXZ 1Z5RA 3DTIA 5CVUA 1U6GA 1R4NB 1MMGA 3K1MA 3H0DA 1NE9A 5E8GA 4M71A 3CCMI 1B87A 3OMYA 5D6EA 1EH6A 5C3EJ 4Q36A 3PFIA 3H3ZA 3QP5A 1Z8TA 2GLJA 2OC6A 3E6CC 3TGNA 3FXMA 3DLJA 4MFLA 1WGXA 4DUKA 5IB9A 3WR7A 1WQ2A 2M1BA 2EFWA 2FIAA 4CO8A 1VNDA 1VHOA 2R7FA 1FOYA 2VI7A 2CSOA 4ZGYB 2K9LA 4WXDA 2B5GB 3KCCA 2V6EA 3KL9A 2FIWA 2JN6A 5F08A 5K8NA 2JBKA 3B3WA 5GAEJ 4PK3A 3GFJA 5BWAB 2XF6A 4M3FA 2PMZA 3ABTA 4L9JA 4M74A 4BKXA 5E79C 3CUQC 1N71A 4MFZA 2K9NA 2L4MA 2FOKA 2JA6J 1IAWA 2DOAA 4U0WA 1BJAA 2LK2A 4CYDA 5LYDA 3DLAA 3HSEA 3R1KA 3BG3A 4G6TB 4IF4A 2JT1A 5FB2A 4F6AA 3DKYA 5DWNA 1M1DA 4V2FA 2REFA 4HSRA 2G3AA 1R5ID 4WJBA 4XKCA 3BR0A 3BOQA 1DP3A 4XNHC 2K40A 4EWTA 4R9MA 2PJAA 1AA7A 5ERIA 3S6FA 4EJOA 4CGMA 4WWCA 1A31A 1CG2A 2KRCA 4Q5SF 3KEQA 4A37A 4XPDC 4BQQA 2VXKA 4XLHA 4A6DA 3BJAA 2MLKA 2L7ZA 1MMDA 3S2WA 1W7PA 2UXXA 3PP9A 2XVCA 2BV6A 2MBFA 2GBYA 3S1NJ 4W9YA 2OJED 4ASNA 1B9NA 3KZWA 2ANPA 2IPQX 5FLMJ 2ECCA 4H0EA 2VL1A 3I3GA 2M0CA 3COAC 1FJLA 4HNWB 5AG4A 4PPZA 2E7WA 1UHMA 1KYWA 2M5WA 2DA4A 3DBRB 1TL8A 1O3QA 4LGWA 1S5KA 4U7DA 3OYAA 1ZAOA 2QQ8A 2L9RA 3SXNA 3UNGC 4OC2A 2BY3A 2FXAA 3ZGKA 2DPSA 3PO3J 2W25A 1R58A 3SI0A 3F0AA 3S2HJ 2FBKA 2ZENA 1YJWI 3ZQLA 5IT9K 3BR6A 3QYFA 4M9SA 2CUJA 3U1KA 4HF2A 2CYYA 5HLTA 4RB1A 1TW3A 3MN2A 4L9TA 3V7SA 4UCNA 5L3EA 4EVYA 3J7AO 2OQRA 4IOCF 3TOBA 1Y8QB 3QODA 2EPFA 2ZJPF 1TIQA 1RETA 4HKFA 2HYJA 1Q2YA 1XDUA 2DW4A 2VASA 1R1UA 2XROA 2W84A 4EQQA 2VBYA 3MKZA 2F5IA 1VQNI 2EIMH 3B6AA 3GLXA 3IRQA 5CQEA 1I6XA 3OS2A 3O6BB 1LUJB 4PJMA 1PUAA 2AS5F 4HQEA 1N25A 4WK8F 2HPIA 2XAQA 3GLLA 3KFWX 1BR4A 1R7JA 2HKXA 2KP6A 1IN5A 3T8TA 1YW4A 1T98A 1T56A 2ISZA 2ZO4A 2R7VA 3UKGA 3CXSA 4M6VA 1JJ6C 1LPQA 2ECBA 3LMSA 4ZY1A 3I56I 1O4XA 4CYCB 3CCLI 3CUQA 4FX4A 2PJRA 3LA2A 4KJZA 1QSTA 2IGNA 3V4GA 3OYGA 1VQ4I 4JK1X 1ZLHA 2JSCA 3IV5A 1Q2DA 3FM3A 5KAIC 2Z5UA 3TCVA 3WE2A 4R3LA 3E5XA 2YPRA 3HOSA 4EATA 3G3ZA 3W6JB 1R3NA 3CO7C 3F6VA 2DFIA 3FXRA 5EEAA 1FIAA 3OIPA 2WA0A 4UUSB 2PJ3A 2CFOA 4DYCA 5H86A 1Z0XA 2PJ0A 2CW0F 4XRSA 4JYKA 2W82A 4HNTA 5DCFA 2DMQA 1K78B 2A05A 3I59B 2NNNA 2P0WA 3BQYA 3SEQA 2O8KA 3FZVA 3JAMZ 2OB0A 1B6BA 1FP1D 1R36A 2RVCA 3GKRA 3ZMTA 5LEJA 5EMIA 4BHBA 1F4KA 3RPQA 2RGVA 3H5RA 3HOYJ 2DA2A 2R7WA 3I0TA 2J8NA 1JKOC 1Z8WA 1ZREA 2ZXWH 4CAFA 4OMZA 5J40A 2FMLA 3U2RA 5E18F 2VOPA 2IJLA 3NH5A 3ONQA 2R7RA 4MHZA 3T9YA 1KZHA 5D8LB 2B4BA 3T90A 3A2KA 5JVTA 2EA4A 3W6KB 4HV5A 1OR7C 2Z1DA 1FTTA 4I7HA 2AFMA 3D5SC 3FNCA 2RREA 1F2OA 4P4IA 2NS0A 4KOSA 2IS6A 1GV2A 2XEIA 2XPVA 5CBMA 2PDOA 3CZ6A 4RLQA 1SVLA 3SHFA 1KZFA 4CCLA 3IIBA 2OR4A 5D8NA 3R96A 1IJWC 5ED4A 1YI2I 1QO0D 3GUXA 1DTDA 5BPDA 2QYVA 1Y9KA 2DODA 2FSWA 3CMYA 2QBYB 4MJ8A 5E3OA 4P96A 4PFPA 4OMEA 1LVAA 3SI1A 2CRGA 1H9TA 4IAVA 4CYPA 4KYWA 3OSGA 5GP9A 5IY5H 1LEBA 1N75A 3KP6A 3DKXA 3QRFF 5J8FA 2PI0A 1LFPA 2XAHA 2R5ZA 3V42A 1H9GA 4HNVA 2PLYA 3PFYA 1OMIA 1SD7A 5BS6A 3F6OA 4OIRF 3B3CA 4LUAA 2HVQA 1JKPC 1OR7A 4E7KA 1IUFA 2EZIA 2R4GA 2EB7A 4NXYA 4OOIA 3ZN0A 1ETWA 1XPXA 5DUIA 4A6EA 4XPKA 4R79A 3V8IA 4PZJA 4MHDA 4FHTA 2HEOA 2PE3A 1JUMA 2B9SA 1BC8C 2HKOA 3JRAA 4DBRA 4AYBA 5J4YA 3ZQ7A 5B5EC 1IO2A 2V79A 1HKQA 1WJEA 3HJEA 5D5UB 3OSFA 2BL1A 2HQYA 5HXDA 3HKZA 4ESBA 4WXCA 4ZYHA 4ZDOA 3L2CA 3ECHA 2OUMA 4KMFA 2JEVA 1YO5C 3HIFA 1D5YA 2P7CB 2I10A 2HUZA 1P4WA 2XGEA 4L0ZB 3RYOA 2BHYA 1ARMA 4ZYEA 3LD2A 3DDDA 3FBUA 2WPWA 4II2A 2EFNA 3FF5A 3PB6X 2R0QC 1FT7A 2ZOGA 3IC1A 4JP0A 2RQQA 1LDJA 3GYAA 4X2TA 4E7SA 1TWFJ 1A2ZA 1F1ZA 1BIAA 2E5NA 4MFDA 4FTHA 2D4OA 1AHDP 3W6XA 4YG2F 2R1IA 3FRMA 4ANJA 1X4PA 4Y49B 1M4IA 3HOUJ 4HPQA 4AIDA 9ANTA 1VKCA 3CF2A 3S3NA 3TTHA 3ZJ0A 5J6XA 2ACJA 3ZXSA 1ZTRA 4BGDA 2M87A 3FXLA 1E3OC 4BQAA 3JRUA 2FOWA 4A69C 1Z67A 3EYYA 1E0EA 3CF5F 3SXOA 4CRZB 2LDUA 2EINH 2CGPA 2IGKA 3KYDB 3WE3A 2JUCA 2V8HA 4UFXA 2ELHA 4IJAA 3B35A 2M7AA 1S5LC 4CDGA 1OCRH 3J81Z 2RV8A 3S93A 1ZG1A 2EIJH 3GYHX 2DI3A 3FYNA 3W91A 4JYWA 1MBKA 4LG0B 4HX4A 3K70C 1QQIA 3A02A 3S8PA 1TKFA 1EJ9A 3M8EA 2Q7BA 3QU6A 4EJWA 2N8GA 4UNOA 4F0XA 2WY8Q 4XM3A 3PEIA 5EGOB 2Q43A 3ISXA 2B63J 2DTRA 1U0JA 4PV6A 5I4MA 2CQKA 1WHUA 2X6WA 3CCEI 3MZHA 1VHSA 3ISZA 2EVNA 3IRRA 1P4NA 4XKWA 1VQPI 3HRMA 2L7MP 1Z77A 2CUZA 1KU3A 3AG4H 1YIJI 4OIQF 2COBA 1R22A 2WB1N 3ABLH 1LB2A 4NUBA 1PU9A 2V1DA 3T5XA 4FASD 2RQPA 2X4HA 3S6HA 5LRKA 2LF7A 5THWA 4AIJA 2DQLA 2QKLB 1JT6A 1MJBA 2L7FP 2C1CA 4FCYA 1EV7A 1GV5A 1RKTA 2GIZA 1OYYA 2EZLA 3IC7A 4F9UA 4CCMA 4DW6A 2KT0A 2K5TA 4AVPA 4B48A 3I1UA 2C27A 3I9SA 2NAZA 3BTCA 3QAHA 2NVQJ 3QNVA 5KTAA 5K1YA 3CC2I 2ZW7A 1D1CA 4LQGA 1R1TA 3GTJJ 3H9JA 5JR3A 3LMMA 4QPOA 1QA6A 1AUGA 3VWDA 2ATRA 2GANA 1VQ5I 1YG2A 4A39A 1UMQA 1XSDA 4CZCA 3JAMK 5E3MA 4FQGA 2I3CA 2F5EA 3FM5A 3N05A 3Q0VA 1X1CA 3DLLF 3CDLA 3B3SA 3JTKA 2KJBA 4B8XA 2O9LA 3FXKA 2QM3A 4BY1J 3KI9A 5DV5A 5ILUA 1IXSB 2Y9ZA 1I3AA 3ZQCA 1Y8RB 2E2IJ 4PXBA 4IRHA 1QHGA 4MFJA 2HQRA 2M9HA 2L0KA 5HLGA 2LKXA 1PCAA 2QQ9A 1UAAA 3G3SA 1QRYA 2VN2A 3BP8A 4RAYA 4XKBA 3E6DA 5CJ9A 4KVOE 1W7PB 3E5QA 3IH4A 4X5KA 5JHUA 1ARLA 4N0BA 3FK6A 3F22A 3PB4X 1IICA 4KZTA 4ONUA 3OYMA 2HWVA 2VJJA 1TBXA 3LFUA 1UHSA 4C2XA 3ZQGA 3N97A 2KHMA 1Y0UA 2PMUA 3JTHA 1R1VA 2IJZA 2D1HA 3ZMUA 1JHFA 4JOMA 1PVEA 4IHXA 1RESA 2LLKA 1G3YA 3BLNA 2KL4A 3G73A 3FF3A 4HPSA 5EBVA 1VQKI 2ZEPA 4IHSA 3CXQA 1ZH5A 4UBRA 3VATA 1W5TA 3JRGA 4M6IA 3I54A 4PXDA 4BAYA 2PC1A 2Q4ZA 2PJ5A 1W36D 2K4BA 2KRHA 2X0LA 4ZJZA 1YYVA 3OR1C 4GYGA 4A0XA 5J3LA 4NNJA 2PVWA 2OZUA 3WTYC 1YE9A 3S14J 3CMAI 1YLFA 5F1JA 3L9FA 1BPMA 4MXUA 4XQFA 4LLLA 1R9TJ 1X12A 3FMQA 3MWMA 3BROA 5ELYA 3DR8A 3BR3A 1V54H 1AWCA 5LRSA 2BXYA 1YITI 1R5HA 5HODA 3FDYA 2KLOA 4KVME 5D6FA 4BXXJ 3JRIA 1FYKA 3CLOA 1WWXA 3J7ZI 3ZMZA 2HV2A 4KT5C 4BJ6C 2ID3A 3FISA 1GVJA 3PBBA 1HDUA 4BE1A 5GPCA 4ZDPA 3OL3A 4UUTA 1CPXA 5KTCA 2DPDA 2FSRA 3PB7X 2HDWA 3K70D 1WSUA 3I9V2 4CHUA 2DTZA 3MAJA 3OY9A 1NH3A 3FIXA 3JW4A 2CH0A 1B1BA 4AVZA 4EFDA 1VFCA 1XB4A 2A6HF 1HBXG 5G21A 2RN7A 4AG7A 5DEQA 3P9CA 2K5CA 3D66A 2IA2A 2PCUA 4XSZF 2MH2A 2DMUA 1KA8A 2KRFA 2VC0A 2EZKA 1YHQI 3I58A 4KICA 4KIGA 2V8VA 4XN3A 2Z16A 4IQJA 4KMUX 3RO0A 4CCJA 1QMUA 3V38A 4KN7X 4LG3A 1IIDA 1YQEA 4UVAA 5K7HA 5L3BA 1MH3A 3HBLA 1DGRM 2IQ6A 1FYLA 4CAVA 1IN7A 2X85A 3QB8A 1VF9A 1ZKGA 3CZXA 3QAYA 3S9LA 2PN6A 4GO1A 2CQ7A 3OOUA 3L2RA 2LBFB 4OC1A 1LDDA 1X1DA 4YRHA 4Z65A 2K86A 3DTEA 2R7ZJ 1F2PA 3CDIA 1VZ0A 3J7AY 1XMTA 4KISA 1YLEA 3DR6A 1YW6A 4MCQA 2HDDA 2Z11A 2VE8A 1IDZA 3MZ8A 3W6SA 1WH5A 3A03A 3WG9A 2K02A 1X3ZB 4F7ZA 1Z6TA 1WJFA 1PUEE 5H6RA 3H5NA 3I5UA 4HLXA 2E34A 1SAXA 3PFOA 3HGYA 2FNPA 2ZFUA 2ZJRF 1GHEA 2QQAA 4M9ZA 2RC4A 4E4HA 1VGYA 1AKHB 1WRJA 1Z05A 4BXFA 2CG4A 3LACA 3DKWA 1Z3XA 4A93J 1UWYA 1ZQ3P 4HA8A 3E97A 3KETA 3MFKA 4UWIA 2STWA 3C2GA 2JQ7A 4B14A 1SD6A 3H4QA 4BNCA 5EC4A 5J47A 2EBIA 2HOTA 1U8BA 1VQ6I 3E0KA 3L2UA 1S7OA 2DMNA 2Y30A 4RB2C 1YK3A 4P9FA 1VQ8I 1QZZA 4OWRB 2KJCA 3VOEA 4KOWA 2IA0A 4B12A 4YIIA 2ID6A 3SJMA 3PGPA 2A61A 2J5PA 3WGIA 2R3SA 2RAEA 3TEDA 1BW5A 2LKSA 3BTJA 4WXHA 2Z2SB 2M3AA 3S16J 4B10A 2GOMA 2CNSA 3DU6A 1MNDA 1RR7A 4R8HA 5K5OA 2JZYA 3SZGA 3R4KA 4ENJA 4U9YA 3J7YJ 1FMVA 2UWMA 2F2EA 4HX8A 5J1UA 1FY7A 2HS5A 1UCRA 3BPVA 5LYIA 1M4DA 1RI7A 1E3HA 2DA7A 4IK2A 2Q51A 1TW2A 1I12A 4R87A 4YEJA 3B8GA 2MFZA 3ZMVA 2UUZA 3EETA 2YR2A 3HC7A 2WWYA 1T6SA 3JSOA 3LSMA 4UXNA 3CJQB 4B5PB 3C26A 2KKOA 2ZC2A 4HYEA 1T95A 4BEHA 4NB5A 4A0ZA 4DIQA 3J80K 1VQ7I 3PM1A 2P5KA 4C9YA 4UFWA 1RKWA 2VXZA 2NOJB 3I4MJ 3U21A 1ZG8A 1Z6RA 4R57A 4B44A 2ZMEC 2DA3A 1BJZA 4Y15A 1KQ8A 2JPCA 3FECA 5M3MJ 3VFZA 2ZW5A 4AIKA 2GLOA 2QZ8A 2XGCA 1PUFA 4X6AJ 1K78A 4GFBA 3LODA 4OLLA 3ZPLA 1S9HA 1TT5B 4HZFA 4XLFA 1P2FA 5GPAA 5JFRA 1S60A 1YS6A 2H1LA 1VI0A 2JA7J 3LSJA 2QF7A 5KVRA 5KCMA 3LSRA 4E7LA 6CPAA 2K27A 2V9KA 3F8NA 5GAGJ 4A30A 1IV8A 1TF9A 1CQTA 3CMMA 2IMOA 2VQLA 2LP0A 2M4GA 3HKZN 4M9XA 5JHFA 1FYMA 2DJIA 2EFPA 1DE4C 3F5BA 3I4NJ 4BD9A 5JGFA 2L3DA 2JLMA 3IWWA 1LCPA 3MN8A 1BR1A 3W2WA 5C44J 2G0EA 2JVHA 2J9AA 2V77A 3SDGA 2JJ7A 2PR8A 4CXFA 3DQVC 4CAEA 2WC2A 2H5MA 2WYRA 4CGLA 4Q47A 1IXCA 2EA2A 1IRFA 4UB6C 1SFKA 5L3FA 2E35A 4YGOA 5EGOA 3D7HA 1QHHD 1S29A 3K4MA 2CQNA 4IOAF 3I71A 4I0AA 4UUVA 2Q4VA 3LAPA 1S7LA 4HEA2 4HNYB 1GVDA 3D7GA 5F46A 4GYIA 1ON1A 2JBJA 1APLC 1ZYRF 1HSJA 1LKXA 2Y31A 3HUVA 4G94A 4PJLA 2TCTA 5A2QZ 4UY8I 2OOTA 2IBDA 2O6GE 4ZZDA 1HLVA 1YIOA 1DUXC 1B72A 1L0CA 4UV8A 3EXNA 2QA4I 3R9FA 4MNUA 2F4MB 4R1HA 1CM0A 2Z99A 4NC8A 3X2QH 3V8LA 4Y49C 4B6ZA 1IN6A 2PFBA 1QPMA 4F91B 1LJ9A 4EJTA 2VXDA 4M72A 2AFSA 3OIQA 1JKRC 2KISA 2BYVE 4G9YA 4IHMA 4DBQA 3DEEA 4UVBA 1P7JA 3S3OA 2DDBA 1TKJA 3CUOA 1GXQA 2M34A 4BHPA 3VSLA 2BOLA 1FPQA 1B6AA 1OBRA 1IN8A 3RPUD 1PUFB 1OCZH 1H8LA 2QEXI 4Y4RA 2QLZA 2LMDA 2EFOA 2M2EA 3OL4A 4KFCA 3HRSA 1XEBA 3R9GA 4MBUA 2Q7SA 3HPGA 3G6EI 4DJLA 5I0CA 4G7ZF 1IOFA 3HRTA 2B58A 5IV0A 4RUHA 4A31A 4A32A 2UXNA 1USTA 1JJ8C 1MIJA 3KZZA 4JXQA 3BJOA 4G6DA 3LQQA 4P4BA 2WV0A 2Q8KA 5FRNA 4FETA 4UF4A 4W97A 5E1WA 3DCFA 4NC7A 2PIYA 3GFMA 1X58A 2K4JA 5FJ8J 1XSVA 2P6EA 1IGNA 3FXTA 2G9DA 2X48A 2VZZA 2DT5A 3WTSC 2R7UA 3CDHA 4A94A 2MA3A 4OMYA 1ZK8A 1ZR2A 2EV5A 3BG6A 4EJVA 4BMHA 1MBFA 2WY7Q 3L2VA 4ESFA 5TGTA 5D29A 2POKA 5FKNA 3H1CA 2DAOA 3WU0A 4CCNA 1JXSA 1SFOJ 1QQ9A 1MJAA 3LSHA 4KLWA 5AG5A 1X19A 3PFEA 1BOBA 4C3JJ 3FMSA 3CC7I 1E2XA 3IUOA 3LSIA 2IGOA 1MKMA 3WTZA 3LQRA 3IL2A 2VIXA 2GAUA 4G12A 5IYDJ 4YELA 1SC7A 3ZZIA 1ETVA 3OWTA 3H0GJ 3PUFA 2VT2A 3QYBA 2JA5J 3DBLB 1TT0A 2JPBA 2VONA 5L3DA 2ZMEA 2QBYA 5KNLA 3RKXA 4G7OF 1CF7A 2BXZA 2VKEA 5ILVA 2XB0X 1Z21A 5F04A 1AKHA 1ZRFA 1XFOA 1SD4A 3R60A 2MD0A 1I39A 2HTJA 3I53A 2E5ZA 1BO4A 3E5UA 4BEHB 1B4AA 2VZYA 1W0TA 4JZ0A 3WT4A 3NQOA 1K79A 2OF7A 4HRIA 1IF1A 4A33A 4FWUA 2EILH 2K7LA 2WZNA 4P45A 3TW7A 4OIPF 1H8AC 2PJ8A 2MGQA 3DEUA 1XBUA 4F55A 3Q0WA 2EWBA 2FQ3A 2EH3A 1EH8A 1XSXA 3TDUC 2DXQA 5JI6A 4XR6A 5DD4A 4AXVA 1QSOA 4EVIA 4DQ2A 3P9IA 3J80Z 2VKVA 4RGSA 4KUMA 3IAS2 4YRVA 3C7JA 3PNVA 2GXBA 3RSNA 4RN7A 1FC3A 1QZEA 2B3UA 2CU7A 3AG3H 3ZQIA 4AU7A 3KQZA 5D4RA 1FOWA 4XOTA 4UIBA 1TP4A 3CP2A 4CYOA 5C4JJ 2O61A 1YVOA 3O2PE 2ELJA 3SDBA 4EGZA 1U78A 1TQMA 3FKJA 3D2PA 1JTYA 1NK2P 3GTPJ 1QU3A 3CCUI 4Y13A 1LANA 4KOXA 2STTA 4RGRA 4CAWA 3FH4A 1Z7LA 4ZH4F 5FO5A 2EV0A 3RQIA 2GLFA 2X7BA 3PB9X 4CGOA 5CLSA 3QOPA 5FLXK 4UEZA 2A4NA 2BY0A 2VKDA 4XNFA 2EZHA 4FISA 3FIWA 3WTUC 2E71A 4HDUA 1IW7F 3OV8A 4NQWB 3BI0A 3HM5A 5FRMA 2QVOA 2R7HA 4M3GA 3EO4A 1Z2LA 2O03A 4FAIA 4H4KC 3CJRB 3BC8A 5F0FA 3WGGA 4II3A 4XLNF 3S2DJ 5ICGA 4CCKA 1HDQA 3TOAA 2G7HA 3CCJI 1Z8XA 2Y0MA 2PR1A 5JPHA 3T1BA 2B5GA 4BQOA 1K61A 4M73A 2P6TA 4D7MA 4HLYA 4V19K 2IS4A 2BHZA 4LOCA 4KUAA 1CX8A 2HU9A 1AOYA 1XJOA 1M44A 3ZMSA 1O7FA 1I5ZA 3HOTA 2QWWA 4PDKA 1WI9A 4EEFG 4PFOA 1ZG9A 2ESHA 3IWEA 2WUUA 3H9GA 1J0RA 2IP2A 1R00A 4P44A 2FE3A 2ODFA 2KDZA 5HNFA 4U88A 2BCOA 4LIUA 1MK4A 1Y1WJ 5A2QK 2EJRA 5LRJA 2PJ6A 3CESA 1V55H 4FUUA 3CJNA 1R23A 5DS0A 3B73A 1D5VA 1ON2A 3L00A 4MFPA 3HTSB 4NSQA 4EMSA 1MMAA 3GZNB 3KASA 1K83J 2CWEA 2LREA 5IYCJ 3OYEA 2W48A 1JKQC 5AGEA 2DK8A 4KITB 4GXHA 2Z3NA 2EIKH 1VQ9I 1XGNA 2V26A 1VQMI 2BW3A 1YW7A 3SJEA 1GDTA 3GIUA 4PSXA 4CGPA 1Z91A 4HSTA 4RAFA 4RB0A 5AONA 3TP0A 2PG4A 4PJNA 5FD6A 4NGQA 3I4PA 2KIMA 3ZRGA 2VB6A 4RI1A 3D5LA 3NARA 2XEJA 4O6JA 1I21A 4NFRA 2RNJA 4AUXA 1Q1VA 5BQTA 3AAFA 4MY3A 4BHCA 4ORFA 4I09A 1LEAA 1J7KA 3CCSI 3TBIA 2OCEA 2NVUB 1JWQA 1BBYA 3SZTA 4E6KG 3HEFA 3GZ6A 1WJBA 2M0MA 3ELKA 2ZELA 3IJ3A 4MTEA 5LYFA 3SJGA 2FA5A 1ZELA 3BR5A 3BQZA 2XGXA 2A6EF 1T38A 3K4NA 4O5VA 1IOIA 1HSTA 5IB0A 3CCVI 4NJQA 4NJRA 4U0YA 4B5OA 2KDOA 2QMLA 4UHTA 2F5VA 2H94A 2JEWA 2Z3PA 2CS3A 3QP6A 3S15J 1U9NA 3NEUA 4RM2A 2PEXA 5H20A 4F8ZA 1D8KA 3VODA 2ADUA 3IHUA 2W24A 1QSMA 5FVJA 5C4XJ 2JDCA 1MNEA 2PQ8A 3P9KA 2LOOA 4LK1F 4BJ5C 2DA5A 3VPRA 2HYFA 1G3TA 4B13A 4MFEA 3W3CA 2ZXHA 1Y39A 3KHXA 4C2UA 1MMNA 1XS9A 3ABUA 2LKPA 1NHAA 1MSEC 4H6UA 3TE4A 1RZ4A 5F64A 2CQXA 2LFBA 3TL4X 3M3YJ 4U7BA 3JSPA 3NFZA 1QZYA 1OKRA 4YFKF 1YJ9I 3SJFA 1A6IA 1EKEA 4MCPA 1RXTA 4A12A 1SAUA 1FT9A 1UG2A 2CV0A 4IUSA 1R5GA 4C7HA 1G6NA 2W57A 3M8JA 4F92B 2NYQA 2Y9YA 2Z3OA 4P4EA 5TJJA 1SVOA 3HXLA 3MKLA 1LDKB 3OWCA 5BPIA 1EA3A 3K2ZA 3WHCA 2QSGX 4U5YA 4CAXA 1JUPA 2V9PA 2O5RA 2A68F 1BIBA 1UZCA 2XV4S 1FTZA 1Y9WA 3C1DA 3K0LA 5CYVA 3S9MA 3HB9A 3MKWB 1Z4EA 3KP4A 3PSIA 1REPC 3L09A 2DO7A 2LC2A 3E1SA 1XDSA 2DK5A 3LSGA 4UEFA 5FKKA 2OCCH 1UFHA 3R6SA 3WU2C 4JLYA 1V0CA 2LBFA 4L0YB 4UEEA 2H27A 5A28A 1O3RA 1MBJA 1W4MA 3IWGA 5DUKA 2A69F 2M8EA 2FD5A 2PJ1A 1XG1A 4AIHA 3RZAA 4LITA 2QSFX 1LFBA 3CTAA 3E6BA 4A2ZA 2XF5A 1CP6A 3OS1A 5LGUA 4NDLA 4KVXA 1MMSA 3PO2J 4FD6A 4KIFA 2PRBA 4DGWB 4FD5A 3D7FA 2OTLI 1R6RA 3IGRA 2Z10A 2ZJQF
chains in the Genus database with same CATH topology
4IQJA 2OH1A 2LRDA 4CCJA 3F9KA 5JQ4A 2DPTA 2WADA 4KLVA 4LG3A 4KOUA 4F93B 1IIDA 4F0YA 2GOXB 3VDXA 2X1EA 2J8RA 4AVCA 4KSFA 1WJCA 3PL8A 1NG7A 1DGRM 3K4CA 4CAVA 2CNMA 2JA2A 2X85A 3OYFA 4E7JA 3QB8A 2Q1ZB 4C68A 4JXRA 3DTIA 3H0DA 4ZDLA 1MMGA 3OOUA 3L2RA 2LBFB 1NE9A 2FE7A 4YRHA 1X1DA 4CH7A 1B87A 3OYDA 3OMYA 4Q36A 1Z9UA 4QUSA 3DTEA 2IS2A 3DR6A 3J7AY 1VZ0A 4PUSA 1XMTA 1YLEA 2ARHA 2OC6A 5JPHA 4MFLA 2Z11A 2LY2A 3WR7A 4B11A 2FIAA 3W6SA 3D8PA 1NG6A 4KS9A 4BQNA 2VI7A 4ZGYB 2K9LA 4RLFA 4AVBA 5J8CA 1XF8A 2X1DA 2B5GB 1WJFA 4GRIA 3OYHA 2V6EA 3H5NA 2ZW4A 2FIWA 2VJ4A 1GHEA 2ZFUA 4PK3A 2FT0A 5BWAB 2RC4A 4E4HA 2XF6A 2R7OA 2G0BA 4C30A 4BBHA 4E8OA 2PMZA 4BXFA 1V5FA 1WJAA 1Z3XA 2UV1A 3RQ4A 1N71A 4B14A 4MFZA 4KSAA 4UWIA 2R7SA 3C2GA 3L2QA 3H4QA 5EC4A 2DOAA 2R7TA 3E0KA 3PJRA 3L2UA 3DLAA 1YK3A 3W2VA 2OZGA 2HQAA 4P5OA 4ZTJA 4OWRB 4G6TB 2IS1A 3DKYA 4HNUA 2B4DA 4KOWA 4B12A 4F6AA 2V7FA 5DWNA 4XLAA 3OYKA 3PGPA 4B3XA 1M1DA 2REFA 3K4KA 4HSRA 2G3AA 5C88A 2AQEA 2XAUA 5HOOA 4B10A 2MC4A 2M3AA 2Z2SB 4XKCA 2GOMA 2CNSA 3DU6A 1MNDA 1DP3A 2MYSA 4XNHC 3SZGA 1LRZA 3A1YA 1AA7A 4R9MA 4U9YA 1FMVA 2VQHA 3S6FA 2UWMA 4CGMA 3KX2A 4XPLA 3AL0C 3G8WA 3PSFA 3DPUA 3P2HA 2KRCA 1FY7A 1M4DA 4XPDC 4BQQA 2VXKA 4XLHA 3N7ZA 4Y33A 4C7IA 1WFXA 1MMDA 3PP9A 4CS0B 1I12A 4R87A 4YEJA 1S7FA 3B8GA 2MFZA 3K9UA 2UUZA 1DGWY 3HC7A 4MLOA 1Y7RA 2Q44A 2E60A 3KYLA 3LSMA 1WWZA 4CUGA 3CJQB 3OR2C 3I3GA 3C26A 3EC4A 4KOYA 4B5PB 2OV7A 4P1WA 3OYNA 1T95A 4BEHA 4M3SA 3S3MA 2LG4A 5HVQC 1S7KA 2JSPA 2J8MA 5AG4A 4CA0A 4DIQA 4XOPA 4A95A 4C9YA 2HZDA 4MY0A 2VXZA 2NOJB 3MMYB 2MABA 4UFWA 3U21A 1S5KA 3OYAA 3L2WA 5F49A 4R57A 3SXNA 4IZZA 3UNGC 4B44A 4BDYA 2BVLA 3ZGKA 1M4GA 2DPSA 2ZW5A 1FMWA 1IYKA 3F0AA 2LY1A 2XF7A 2W00A 1I1DA 4DNCA 3BCAA 2YNCC 3LODA 4OLLA 4XLEA 1S9HA 4BE2A 3QYFA 4XLFA 1D0ZA 2CUJA 5AG6A 5HLTA 3BCBA 2ZXIA 1S60A 2KQRA 2R7QA 1YX5A 4UCNA 4C2XA 1YVKA 3IU1A 1D1AA 3TCVA 1XIXA 5KCMA 4E7LA 1Z4RA 2V9KA 4EVYA 1X1AA 2IGMA 3TOBA 2JUGA 4FD4A 3QODA 4PJJA 5HH1A 4A30A 5IX3A 1TIQA 3CMMA 4HKFA 2VQLA 1Q2YA 2M4GA 2VASA 3M1CA 5JHFA 3H35A 1JI8A 4KUBA 2DJIA 3MKZA 2F5IA 2KMUA 3F5BA 5CQEA 3SYTA 2JLMA 3OS2A 4MI4A 4J00A 1BR1A 4PJMA 3W2WA 1PUAA 4YFJA 2JVHA 3VYUB 4C2ZA 5G20A 2PR8A 3S6GA 3DQVC 4RMNA 2HPIA 4JD6A 4CAEA 3H5AA 2H5MA 2R8VA 2X1CA 4CGLA 1BR4A 4E0AA 2KP6A 1SFKA 1WJ5A 2HNHA 4YGOA 4PK4A 3EUHC 1QHHD 2WAQA 3K4MA 2Q4VA 1CJWA 3MKYB 2R98A 2R7VA 1KONA 4HEA2 1S7LA 4HNYB 5F46A 3CXSA 2M7BA 4ZYAA 3H5ZA 5LFAA 1LKXA 4AVAA 2XC7A 3DPLC 4JQFA 3K4BA 4PJLA 1NMTA 3SHPA 4QBJA 3EFAA 4LIVA 2CMPA 3TMOA 2PJRA 1LVKA 5F47A 5CQGA 1ZO0A 3DNSA 4KJZA 1QSTA 1L0CA 2IGNA 2ZXVA 3EXNA 3R9FA 4NF1A 5H84A 3OYGA 1Q2DA 1CM0A 4RM3A 4R3KA 4XPDB 4CYNA 4NC8A 4PK2A 5ISVA 3FBNB 4Y49C 1D0XA 4D9JA 4R3LA 3AL0B 3HOSA 3F8KA 4EATA 1Y56A 3H9QA 2VXDA 3ZQQA 4F91B 3OIQA 1IB1E 4UWJA 4UFVA 4XNHB 3OIPA 4DBQA 2WA0A 2WBMA 2YNEA 2CFOA 3DEEA 3D3SA 4U9ZA 3S3OA 4XL9A 2L9SA 1MJ9A 5H86A 2W82A 1Y6IA 4HNTA 4IQ4A 2BOLA 3VSLA 2M4KA 3RPUD 1UG0A 4BU2A 2CY2A 2P0WA 3SEQA 2ZW6A 4Y4RA 1SQHA 3OL4A 1B6BA 2OB0A 2YGWA 3JVNA 3GKRA 2I8DA 1XEBA 3R9GA 2DXIA 3H5RA 4MBUA 2QECA 3HPGA 5I0CA 2R7WA 3FBIB 2J8NA 2B58A 5IV0A 4F3QA 4A31A 2K9MA 3G2BA 4A32A 4CAFA 4XORA 4LX9A 5HMNA 5C82A 1YX3A 3ONQA 5FROA 2R7RA 3T9YA 2B4BA 4E7IA 3T90A 3A2KA 2KCWA 4JXQA 4B5PA 3OYJA 1OR7C 2Z1DA 3DU5A 1T0FC 5FRNA 3D5SC 4FETA 2I00A 2REEA 3FNCA 2RREA 3PZJA 4NC7A 1YX0A 4KOSA 3EUAA 4BL0B 2VKHA 2IS6A 1QSRA 3PUBA 2PDOA 3CZ6A 4RLQA 4KOVA 3K4LA 2P6EA 1KZFA 4CCLA 2QIRA 3VYTB 3FXTA 3R96A 3E0JB 3RCOA 2VZZA 2IXSA 1Y9KA 2A5WA 4MJ8A 2FCKA 2R7UA 4PFPA 3VSKA 2AQFA 4CYPA 5A27A 2B3VA 3NWSA 3LSKA 1N75A 3BG6A 4BMHA 3DKXA 4F52A 2WY7Q 3L2VA 5J8FA 4MFQA 2R7XA 2HVRA 1LFPA 5TGTA 3V42A 2E1MC 4UCPA 3VYSB 2CV1A 3PFYA 4DJAA 4H6ZA 1PYVA 4CCNA 3BJ7A 1K4JA 4LUAA 2HVQA 3LSHA 1MJAA 4KLWA 4KORA 5AG5A 4E7KA 1X19A 1K6YA 1BOBA 2R4GA 1Z3YA 3IUOA 1V5GA 4NXYA 3LSIA 2IGOA 3VYRB 5E96A 2BUEA 4DOZA 2Z3LA 5DWMA 2VIXA 2VL8A 4YELA 4R79A 3QYBA 3OWTA 4MHDA 4XPKA 3V8IA 5G1ZA 3ZZIA 1TT0A 5KNLA 3HUGB 2I79A 5AG7A 1KUVA 1Z21A 2FUG2 4DBRA 4AYBA 3IP4B 1KUYA 2MD0A 1WJEA 4IKFA 2HQYA 2BL1A 1MW7A 2E5ZA 1BO4A 3HKZA 4BEHB 2VZYA 4ZBGA 3NWTA 2VPLA 4HRIA 3TFYA 1GLNA 4ZDOA 4A33A 2OUMA 2JEVA 2Q0YA 2HUZA 4BJTA 5F48A 3RYOA 3LD2A 4F55A 4J3GA 3TOAA 2KZVA 3QYEA 1IYLA 3DDDA 2WPWA 3FBUA 4II2A 5G22A 4BDZA 2DXQA 3P2FA 1D1BA 4XR6A 2RQQA 3EPZA 1QSOA 3GYAA 3TO6A 4E7SA 2E5NA 3IAS2 3AFHA 3PNVA 4YRVA 4BE0A 2D4OA 3RSNA 3DTKA 3C2HA 2R1IA 3FRMA 4OADA 4ANJA 3W6XA 1X4PA 2L7KA 2B3UA 4Y49B 1M4IA 2W1OA 4HPQA 4AU7A 3GY9A 4XOTA 1VKCA 2FL4A 3CF2A 3S3NA 3TTHA 2WB1A 3ZJ0A 3CP2A 4CYOA 4CRYB 2DCEA 3ZXSA 2ELJA 3SDBA 4BGDA 1N78A 3FKJA 1ON0A 2X6XA 3PNYA 3D2PA 4CCOA 2Z3MA 1QU3A 2B4DB 3CP8A 1E0EA 4KOXA 4CAWA 1Z7LA 3SXOA 4CRZB 2X7BA 4CGOA 3BJ8A 3R9EA 2IGKA 1P0HA 2VKDA 2A4NA 4XNFA 2AJ6A 4HNWB 2VBQA 1X4OA 2M7AA 4NQWB 2VQYA 5HNHA 5FRMA 2R7HA 3EO4A 2CXAA 3NE7A 3S93A 2PJRB 2G3TA 4H4KC 3FYNA 4UFXA 3W91A 2BVMA 3BC8A 3CJRB 4N4OB 4N4NB 4XMYA 5LD2C 1XE4A 4II3A 4NCZA 2CV2A 2ZPAA 2YNDA 2ZSIB 3K70C 2OU2A 3PNTA 4CCKA 3S8PA 2PR1A 4D1QA 3OYCA 2Y0MA 2L5QA 2V1NA 3BLYA 2B5GA 3LL7A 1YREA 4BQOA 4K30A 4NEXA 3QOEA 4F0XA 2WY8Q 4XM3A 3D5RC 2XDVA 4QC6A 2IS4A 4PV6A 4KUAA 1U0JA 2VJ5A 2HU9A 1J4JA 1YR0A 2X6WA 1M44A 3A4CA 1VHSA 4JJXA 2VJIA 3HOTA 2EVNA 1P4NA 1PJRA 3KEYA 4KT6A 4PFOA 2CUZA 4XKWA 4KISA 2GE3A 3H9GA 2PSWA 2WUUA 2YNCA 3IWEA 2L9NA 4E7HA 4NUBA 1PU9A 3DPTA 3TT2A 4QPQA 1U6MA 5HNFA 4FASD 1R57A 3S6HA 2DT7B 4LIUA 3IAM2 3VWBA 1MK4A 1X1BA 4B43A 3TO9A 4PSWA 4RS2A 2QKLB 2HPMA 2VQGA 4QVTA 3CESA 3UR3C 1MJBA 4C2YA 4IF5A 1KUXA 3K4JA 2KPMA 2LYCA 2D4PA 5CKTA 2CW8A 2CNTA 1OLTA 4MFPA 4NSQA 4CCMA 3UY5A 1MMAA 2Z0ZA 3MGDA 2LREA 3EUKL 2K5TA 3OYEA 4B48A 3I9SA 2C27A 3A9LA 5AGEA 2VLAA 4OAYA 4KITB 2W7NA 3QAHA 2Z3NA 1QSNA 5KTAA 4E7ZA 4H89A 2V26A 2ZW7A 2FS5A 2P6GA 2BW3A 1D1CA 2JVGA 4ZTFA 2O28A 4M85A 3RTRA 4II9A 3H9JA 4PSXA 3LMMA 4QPOA 3W2AA 3VWDA 4CGPA 2ATRA 3K6GA 4HSTA 1J09A 2GANA 5CNPA 2K3PA 1P9QC 4HG2A 4PJNA 4CZCA 1Q2CA 2X6YA 3ZRGA 3N05A 3VWEA 1X1CA 2VB6A 3SEZA 3D5LA 3JTKA 4RI1A 3D2MA 1I21A 1WJDA 3EY5A 2P6FA 2OZHA 4MY3A 1YVOA 4ORFA 1QHGA 4JWPA 4MFJA 3TBIA 4MFKA 3JUWA 1UAAA 4E6KG 3G3SA 1WJBA 2M0MA 4XKBA 3CXPA 2Q04A 1ZELA 4KVOE 4AB7A 3ZCOA 2F6CA 2CW7A 3K4NA 1S3ZA 2EUIA 2JDDA 4X5KA 1V5EA 2FXFA 4L8AA 4ONUA 5IB0A 4KZTA 1IICA 4B5OA 2Y0SA 3OYMA 4ZC3A 2KDOA 2VJJA 3LFUA 4XN0A 4BUPA 2F5VA 2QMLA 2Z3PA 1W36C 2CS3A 2KHMA 2Q4YA 2W4SA 4RM2A 5CPRB 1QSMA 3ZR8X 4JOMA 3BLNA 5FVJA 2JDCA 1MNEA 2KL4A 2LH9A 2LOOA 2PQ8A 4BJ5C 5EBVA 2L2OA 2IL4A 3CXQA 2Q2EB 4UBRA 3FHNA 3MD2A 4B13A 4Y3OA 3W3CA 2E1MB 1S7NA 2ZXHA 4FD7A 1TZLA 4C2UA 1MMNA 2AE6A 1G59A 4H6UA 4UCMA 4CSWA 1OZPA 2PC1A 2WAFA 4GS4A 3TE4A 4XLCA 4HNXB 4ITVA 1W36D 4BS9A 1NSLA 3TL4X 2KRHA 4ZJZA 4U7BA 3OR1C 1HA8A 4NNJA 2BEIA 2OZUA 2VQCA 1UELB 4B47A 1YGHA 4QB9A 1YE9A 1RXTA 4AG9A 1SAUA 2CV0A 3DSBA 4IUSA 4C7HA 4XQFA 3OYBA 3KKWA 3R95A 3M8JA 4F92B 2Z3OA 3HL2A 3DR8A 2DT6A 2V4JC 3HXLA 1DQUA 1LDKB 4X0GA 2A6TA 1RO5A 3OWCA 2VEZA 4OAZA 3OYIA 1EA3A 2Q7BA 4U5YA 4CAXA 2KLOA 2XSJC 3FDYA 4KVME 2O5RA 4I49A 3HPHA 4CGNA 2WPXA 1Y9WA 2X51A 4BACA 1D0YA 4KOTA 3GBGA 3MKWB 1Z4EA 2RNGA 3K10A 3DWLE 2BSWA 3PSIA 2HV2A 4BJ6C 2WSAA 5GCNA 4U87A 2LC2A 3E1SA 4L89A 4UA3A 3LSGA 1G8XA 3OYLA 4CYQA 5KTDA 1UFHA 1ERDA 4IX7A 4BE1A 3IU2A 4JLYA 4ZDPA 1V0CA 2LBFA 3OL3A 5A28A 3IWGA 2NMTA 4E2AA 3BG7A 4XKVA 5KTCA 3R1KA 2Z3KA 4XONA 2FSRA 2QKMB 3HG9A 4Q38A 2HDWA 3AKZA 3K70D 2F4IA 3I9V2 4J01A 3OY9A 3FIXA 4OAEA 2CH0A 3I3LA 4LITA 4AVZA 3OS0A 1N77A 2BW3B 2HVSA 5G21A 4AG7A 1WK4A 2GIVA 4A2ZA 2K5CA 2XF5A 5KHDA 3OS1A 4KVXA 3TO7A 2WAEA 4FD6A 1IRXA 2PRBA 4DGWB 3S32A 2ZSHB 4FD5A 3FB3A 3IGRA 1R6RA 4C2TA 2Z10A 1BR2A 3S6KA 4XN3A 2Z16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OH1 A;  5JQ4 A;  4KLV A;  4KOU A;  1IID A;  4F0Y A;  2J8R A;  4AVC A;  4CAV A;  2CNM A;  3QB8 A;  4JXR A;  1NE9 A;  2FE7 A;  4YRH A;  1B87 A;  4AVB A;  1Z9U A;  4QUS A;  3DR6 A;  5JPH A;  1XMT A;  1YLE A;  2ARH A;  2Z11 A;  3WR7 A;  2FIA A;  3W6S A;  3D8P A;  2VI7 A;  5J8C A;  1XF8 A;  2B5G B;  2ZW4 A;  2FIW A;  1GHE A;  4PK3 A;  2FT0 A;  2RC4 A;  2G0B A;  4E8O A;  1N71 A;  4UWI A;  3H4Q A;  5EC4 A;  3E0K A;  1YK3 A;  2OZG A;  4F6A A;  4KOW A;  2B4D A;  5DWN A;  3PGP A;  1M1D A;  2REF A;  2G3A A;  5C88 A;  2CNS A;  4XNH C;  1LRZ A;  4R9M A;  4U9Y A;  3S6F A;  4XPL A;  3G8W A;  3P2H A;  1FY7 A;  1M4D A;  4XPD C;  2VXK A;  3N7Z A;  3PP9 A;  4CS0 B;  1I12 A;  4R87 A;  1S7F A;  3B8G A;  3K9U A;  1Y7R A;  2Q44 A;  1WWZ A;  3I3G A;  4B5P B;  3C26 A;  3EC4 A;  4KOY A;  4M3S A;  1S7K A;  2J8M A;  4MY0 A;  1S5K A;  5F49 A;  4R57 A;  3SXN A;  1M4G A;  2ZW5 A;  1IYK A;  3F0A A;  1I1D A;  4DNC A;  3LOD A;  4OLL A;  1S60 A;  1YVK A;  3TCV A;  1XIX A;  4EVY A;  1Z4R A;  3TOB A;  4FD4 A;  5IX3 A;  5HH1 A;  1TIQ A;  4HKF A;  1Q2Y A;  4KUB A;  2F5I A;  3F5B A;  2JLM A;  4MI4 A;  1PUA A;  4YFJ A;  2PR8 A;  3S6G A;  4JD6 A;  2H5M A;  2R8V A;  4E0A A;  4YGO A;  2Q4V A;  1CJW A;  2R98 A;  1S7L A;  4HNY B;  5F46 A;  3CXS A;  4AVA A;  1NMT A;  3SHP A;  4QBJ A;  3EFA A;  5F47 A;  3DNS A;  1QST A;  1L0C A;  2ZXV A;  3EXN A;  3R9F A;  4NF1 A;  5H84 A;  1Q2D A;  1CM0 A;  4R3K A;  4XPD B;  5ISV A;  4Y49 C;  4R3L A;  3F8K A;  1IB1 E;  4UWJ A;  4XNH B;  3D3S A;  4U9Z A;  5H86 A;  1MJ9 A;  2CY2 A;  2P0W A;  2ZW6 A;  1SQH A;  2OB0 A;  3JVN A;  1B6B A;  3GKR A;  1XEB A;  3R9G A;  4MBU A;  2QEC A;  5I0C A;  2J8N A;  2B58 A;  5IV0 A;  4LX9 A;  5HMN A;  5C82 A;  3T9Y A;  2B4B A;  3T90 A;  2KCW A;  4JXQ A;  4B5P A;  2I00 A;  2REE A;  3FNC A;  3PZJ A;  1YX0 A;  4KOS A;  1QSR A;  2PDO A;  4KOV A;  2P6E A;  1KZF A;  2QIR A;  3FXT A;  3R96 A;  2VZZ A;  1Y9K A;  4MJ8 A;  2FCK A;  2B3V A;  4BMH A;  5J8F A;  4H6Z A;  3BJ7 A;  1K4J A;  4LUA A;  1MJA A;  4KOR A;  4KLW A;  1BOB A;  4NXY A;  5E96 A;  2BUE A;  5DWM A;  4XPK A;  3ZZI A;  3V8I A;  4MHD A;  2I79 A;  1KUV A;  1KUY A;  2HQY A;  4ZBG A;  2BL1 A;  1BO4 A;  2VZY A;  3TFY A;  2JEV A;  2Q0Y A;  2HUZ A;  5F48 A;  3RYO A;  3LD2 A;  4J3G A;  1IYL A;  3DDD A;  3FBU A;  2WPW A;  2DXQ A;  3P2F A;  1QSO A;  3GYA A;  3TO6 A;  2D4O A;  4OAD A;  3W6X A;  3FRM A;  2R1I A;  2B3U A;  4Y49 B;  1M4I A;  3GY9 A;  1VKC A;  2FL4 A;  3TTH A;  3ZJ0 A;  4CRY B;  1ON0 A;  1YVO A;  3MGD A;  3D2P A;  2B4D B;  4KOX A;  4CAW A;  3SXO A;  4CRZ B;  2X7B A;  3BJ8 A;  3R9E A;  1P0H A;  2A4N A;  2AJ6 A;  4HNW B;  2VBQ A;  2VQY A;  3NE7 A;  4H89 A;  2R7H A;  3EO4 A;  3FYN A;  2G3T A;  3W91 A;  4NCZ A;  1XE4 A;  2ZPA A;  2OU2 A;  2PR1 A;  4PK2 A;  3TOA A;  2Q7B A;  2Y0M A;  2B5G A;  4K30 A;  1YRE A;  4NEX A;  4QC6 A;  4PV6 A;  4KUA A;  1J4J A;  1YR0 A;  1M44 A;  1VHS A;  4JJX A;  2EVN A;  1P4N A;  2GE3 A;  2PSW A;  1PU9 A;  3TT2 A;  1U6M A;  1R57 A;  3S6H A;  1MK4 A;  3TO9 A;  4PSW A;  4RS2 A;  4QVT A;  1MJB A;  4IF5 A;  1KUX A;  2D4P A;  2CNT A;  4NSQ A;  3UY5 A;  2Z0Z A;  2K5T A;  3I9S A;  2C27 A;  3QAH A;  1QSN A;  5KTA A;  2ZW7 A;  4M85 A;  2FS5 A;  2P6G A;  2O28 A;  4II9 A;  4PSX A;  3VWD A;  2ATR A;  2GAN A;  5CNP A;  1Q2C A;  3VWE A;  4RI1 A;  3D2M A;  1I21 A;  3EY5 A;  2P6F A;  2OZH A;  4MY3 A;  4ORF A;  4JWP A;  3G3S A;  3CXP A;  2Q04 A;  4KVO E;  4AB7 A;  2JDD A;  1S3Z A;  2EUI A;  4X5K A;  4L8A A;  2FXF A;  4ONU A;  5IB0 A;  4KZT A;  1IIC A;  4B5O A;  3JUW A;  2QML A;  2Q4Y A;  1QSM A;  3BLN A;  5FVJ A;  2JDC A;  2PQ8 A;  5EBV A;  2IL4 A;  3CXQ A;  4UBR A;  1S7N A;  4FD7 A;  2AE6 A;  4H6U A;  1OZP A;  2PC1 A;  4GS4 A;  3TE4 A;  4HNX B;  1NSL A;  2BEI A;  2OZU A;  1YGH A;  4QB9 A;  1RXT A;  4AG9 A;  3DSB A;  4IUS A;  3KKW A;  3R95 A;  3DR8 A;  1RO5 A;  3S6K A;  3OWC A;  2VEZ A;  4U5Y A;  4CAX A;  4KVM E;  4I49 A;  2WPX A;  1Y9W A;  4KOT A;  1Z4E A;  2BSW A;  5GCN A;  2HV2 A;  4L89 A;  4UA3 A;  5KTD A;  1UFH A;  4JLY A;  1V0C A;  3IWG A;  2NMT A;  4E2A A;  5KTC A;  3R1K A;  2FSR A;  3FIX A;  4OAE A;  4AG7 A;  1WK4 A;  2GIV A;  4KVX A;  3TO7 A;  4FD6 A;  2PRB A;  4FD5 A;  3FB3 A;  3IGR A;  2Z10 A; 
#chains in the Genus database with same CATH topology
 1PP8 F;  2LRD A;  4CGZ A;  3F9K A;  5JQ4 A;  3LA7 A;  4HBL A;  4E70 A;  3PRT A;  4KOU A;  4F93 B;  3GME A;  2P5V A;  1TLH B;  3VDX A;  2X1E A;  4OU0 A;  3LOC A;  1J75 A;  1WJC A;  1VTN C;  2YX7 A;  3ULQ B;  3OYF A;  4E7J A;  3T0Y A;  4Y52 J;  4C68 A;  3ASO H;  2HXI A;  4JXR A;  4RBO A;  2MLG A;  4ZDL A;  4A3C J;  3PIO F;  1KU2 A;  5EJC A;  2R93 J;  3LA3 A;  5JLX A;  4AVB A;  1ZLJ A;  4S0H B;  2IS2 A;  1S7E A;  2KIQ A;  5FKL A;  2ARH A;  3FEE A;  2DOE A;  4D0P A;  2ZBK A;  2LY2 A;  3CQZ J;  2E1C A;  3QPL A;  1ORK A;  4A0Y A;  1HXD A;  1FOX A;  3WGH A;  4EM2 A;  1Z7U A;  4QIW N;  4A3J J;  4KS9 A;  4EME A;  5JH9 A;  4RLF A;  5J8C A;  5EZG A;  1XF8 A;  3OYH A;  4PXC A;  2M45 A;  1ITY A;  2ZW4 A;  2VJ4 A;  5E1Z B;  4IXA A;  3EQL F;  4R76 A;  3HTU A;  2KIF A;  1BLL E;  1ETQ A;  2CO5 A;  1WJA A;  3ROU A;  4CZZ A;  2UV1 A;  4M6H A;  3HDD A;  2CQQ A;  2ZEM A;  3L2Q A;  3R0J A;  4Z6Y A;  1GT0 C;  3S1Q J;  2GXA A;  2NS8 A;  4H2K A;  1MD0 A;  1F9N A;  3PJR A;  2AFX A;  2OZG A;  2HQA A;  4P5O A;  5ICF A;  1ZLK A;  4NGN A;  4PQA A;  2XEF A;  2IS1 A;  4HNU A;  2B4D A;  2HOE A;  2Y69 H;  2EQR A;  2V7F A;  4XLA A;  5LHG A;  5K8P A;  2BY2 A;  4B3X A;  3WTT C;  3CO6 C;  3DEW A;  5C88 A;  3TQN A;  1RR8 C;  2MYS A;  1Y0R A;  1JGS A;  3A1Y A;  4I02 A;  2VQH A;  2AXT C;  4OC3 A;  3KX2 A;  3REO A;  1UFM A;  3AL0 C;  1J9I A;  3G8W A;  3PSF A;  1ENH A;  3P2H A;  4LLN A;  5DM6 F;  3N7Z A;  4MEY F;  1WFX A;  2DMP A;  5DCM B;  4CS0 B;  4P4F A;  3RYP A;  2EFQ A;  3KP5 A;  4G1P A;  3FKI J;  3K9U A;  3OOP A;  2ZNZ A;  4MLO A;  2HB6 A;  3RIR A;  3SI2 A;  3KYL A;  1WWZ A;  4ENM A;  4CUG A;  2G7U A;  2Q0O A;  1IU8 A;  2OV7 A;  3OYN A;  3S3M A;  2LG4 A;  5HVQ C;  4I6Z A;  4EM1 A;  3MVP A;  2NNY A;  4CA0 A;  2J8M A;  4RS8 A;  3ISP A;  4XOP A;  4A95 A;  4P55 A;  4AM3 A;  3HOW J;  3MMY B;  5CPA A;  2GA1 A;  3L2W A;  5J1Q A;  4WX9 A;  2DU9 A;  5F49 A;  5FFZ A;  2BZT A;  2PMH A;  1M4G A;  2CUE A;  2EWN A;  1IYK A;  4ENK A;  2W00 A;  3JRC A;  4DNC A;  3BCA A;  2WAQ N;  5AIQ A;  1MNM C;  2L01 A;  4L5J A;  4B3A A;  3S1R J;  1TNT A;  3TKY A;  5LEK A;  3EDP A;  2R7Q A;  3JCU C;  1TQP A;  3JR9 A;  1V4R A;  1O3T A;  1D1A A;  5K7F A;  3FXO A;  3IU1 A;  3KHZ A;  3BDD A;  3K9T A;  1DPR A;  1Z4R A;  3F8M A;  1X1A A;  2IGM A;  2QYO A;  2JUG A;  1D3Y A;  4FD4 A;  1VIX A;  1O7L A;  3M1C A;  4RAG A;  1JI8 A;  3T8W A;  1P92 A;  1QNT A;  4P9U A;  4L18 B;  3ABK H;  2KMU A;  2L4A A;  1IY7 A;  3SYT A;  1DU0 A;  4MI4 A;  4J00 A;  1IN4 A;  2EV6 A;  3FMR A;  3GCM A;  3PIP F;  4C2Z A;  5G20 A;  2NS7 A;  3S6G A;  4RMN A;  4JD6 A;  1HW5 A;  2E7X A;  3K1P A;  3F3X A;  3BR2 A;  4KSI A;  1WJ5 A;  4PK4 A;  3EUH C;  4GXO A;  3VB2 A;  2G9W A;  2PJC A;  1MSF C;  2R98 A;  2MH9 A;  1JT0 A;  2ETH A;  2NYX A;  2VBX A;  1IG7 A;  2M7B A;  4G8X A;  1MBH A;  2HTS A;  1O3S A;  2AJ6 A;  3H5Z A;  4AVA A;  2HOS A;  4IRG A;  2XC7 A;  2F8H A;  3DPL C;  4JQF A;  2YU3 A;  4NHJ A;  1NMT A;  3CCR I;  4LIV A;  3GTL J;  1IXR C;  5F47 A;  1LVK A;  1OJL A;  1ACI A;  2BY1 A;  2ZXV A;  2HR3 A;  3CLQ A;  4FE4 A;  3H8F A;  4NF1 A;  3TP3 A;  5H84 A;  1CGP A;  3D1N I;  1ZGW A;  5D5X B;  4XPD B;  4CYN A;  4A2U A;  5DS9 A;  2M30 A;  3WTX C;  4Y17 A;  3FBN B;  3M4O J;  3AL0 B;  2LSO A;  4WF2 A;  3ECO A;  1CPS A;  3D4U A;  3F8K A;  1M1E B;  2V1X A;  4UWJ A;  4UFV A;  3BG9 A;  2EBJ A;  3QU3 A;  5BNG A;  4XNH B;  2P8T A;  3GZ5 A;  1HC8 A;  2WBM A;  2YNE A;  2COM A;  4XL9 A;  1MJ9 A;  2L9S A;  5HDG A;  1Y6I A;  2VI6 A;  4IQ4 A;  1HCR A;  2M4K A;  4Q4Z F;  5H2F C;  2ZEH A;  1RPW A;  1LFW A;  3RJP A;  1HF0 A;  2ZW6 A;  3JVN A;  1S3J A;  2F4O B;  1G3W A;  4PJ0 C;  1X1P A;  2I8D A;  5F27 A;  4ZI6 A;  2XSD C;  4QSH A;  3WOD F;  5B1A H;  3FBI B;  3B7I A;  4MHN A;  2ESN A;  4F3Q A;  4Z2Y A;  3G2B A;  5EG0 B;  4XOR A;  4LX9 A;  4FT8 A;  4BH9 A;  5HMN A;  5C82 A;  1YX3 A;  4E7I A;  4ZY2 A;  4X8I A;  2R7D A;  4B5P A;  1BM9 A;  3OYJ A;  1T0F C;  1IC8 A;  3GTO J;  2IEK A;  3A01 B;  1TKH A;  3K2K A;  3EUH A;  3IH3 A;  2LD5 A;  3HOV J;  2LR8 A;  2FBI A;  2QVP A;  3PZJ A;  2QEN A;  3EUA A;  4BL0 B;  2VKH A;  1QSR A;  4YU9 A;  3PUB A;  4KOV A;  3K4L A;  5DCM A;  2QIR A;  1ZHF A;  2DLL A;  5CVI A;  3E0J B;  1TF8 A;  1F43 A;  4J19 A;  3I64 A;  2LNB A;  1T2K A;  2CUF A;  5K5Q A;  2AQF A;  2Z3Y A;  2GWR A;  2A07 F;  3GTK J;  2JK3 A;  3MEX A;  3KZY A;  3NWS A;  3LSK A;  3RPU A;  3U9G A;  1YLO A;  2QGU A;  2Y0S N;  4F52 A;  4KDP A;  2HVR A;  4M3E A;  4UCP A;  4DYQ A;  5D8K B;  3FVL A;  4IPA A;  1KQ9 A;  4H6Z A;  1K4J A;  3GO5 A;  1XMX A;  5GAH J;  2FEZ A;  4AYB N;  1WI3 A;  2WV1 A;  1Z3Y A;  2ZCW A;  1ZG5 A;  3VYR B;  5E96 A;  4DOZ A;  2Z3L A;  5DWM A;  1SVM A;  4N9I A;  1PDN C;  3M8F A;  4XK4 A;  4A3K J;  4HX7 A;  4A5N A;  1V3F A;  4XRF A;  2JMW A;  1RRJ A;  1S6L A;  1KUV A;  4LMY A;  2FUG 2;  3IP4 B;  1KUY A;  3FK7 A;  3JTG A;  3HLP A;  4ZBG A;  1MW7 A;  2E19 A;  4RA2 A;  1JUS A;  3WTV C;  2VPL A;  4DYR A;  1ZG7 A;  4XBF A;  1GLN A;  3GB0 A;  3C2B A;  3TFY A;  1K6O A;  3BY6 A;  2Q0Y A;  3B3V A;  4XID A;  2V9V A;  1FLI A;  2OD5 A;  4BJT A;  5F48 A;  1WH7 A;  4BXU A;  4J3G A;  5LHH A;  2KZV A;  3G4S I;  2ZFW A;  5EG0 A;  4EM0 B;  5JVG F;  4BDZ A;  1WVR A;  1L3L A;  1D1B A;  1KQ0 A;  4D5C A;  3JRF A;  2CTB A;  3NE8 A;  3ZMD A;  5HVF A;  3QWL A;  5M5X J;  2FNA A;  2JA8 J;  4OAD A;  3BT9 A;  3FX6 A;  2XIG A;  4OC0 A;  4NC6 A;  3GY9 A;  2EO8 A;  1FWZ A;  1P7I A;  4L5E A;  4BYY A;  2FL4 A;  3LWF A;  4CRY B;  1N78 A;  1ON0 A;  4ON0 A;  2AHQ A;  1ODD A;  2X6X A;  4DZP A;  5IT9 Z;  2WTE A;  5IP9 J;  2B4D B;  3CP8 A;  2X9D A;  2FRH A;  4C3H J;  1BC7 C;  1A36 A;  1UB9 A;  4ENN A;  3BZK A;  3PB8 X;  5HS7 A;  2VOD A;  1CP7 A;  3R9E A;  2XAF A;  1P0H A;  2VBZ A;  2VBQ A;  2HXO A;  2VQY A;  4AD9 A;  2K9S A;  5HNH A;  4V2G A;  1B72 B;  1B8I B;  2CXA A;  3IO1 A;  4H89 A;  2PJR B;  3CUQ B;  4IEJ A;  1ETK A;  1FSH A;  1LAM A;  2G3T A;  4XMY A;  4N4N B;  4NCZ A;  1XE4 A;  4KN4 X;  2CV2 A;  2ZPA A;  2ZSI B;  2DA1 A;  4PK2 A;  4D1Q A;  2V1N A;  4XRM A;  1SAN A;  1YRE A;  1LFU P;  2ZEO A;  4NEX A;  4XRS G;  2A5Y B;  5H6Q A;  3L2N A;  2XDV A;  3ZQF A;  5EF6 A;  3CPA A;  1QGP A;  3F8C A;  1J4J A;  1YR0 A;  3A4C A;  1T08 B;  2ISY A;  2ZJ2 A;  1FEX A;  1PJR A;  3KEY A;  2PJB A;  2PSW A;  2L9N A;  3DPT A;  3RKY A;  3SFZ A;  3TT2 A;  3V7Z A;  1R57 A;  2JRT A;  3M7G A;  2DT7 B;  3VWB A;  5KK1 A;  1Z9C A;  1GHC A;  1X1B A;  5LGT A;  3F0C A;  2NVT J;  4RS2 A;  4QVT A;  4S05 A;  5IOZ A;  3HHG A;  3UR3 C;  4ZY0 A;  4C2Y A;  4IF5 A;  3K4J A;  1BI3 A;  1HDD C;  1IRZ A;  2D4P A;  3MRU A;  2QQB A;  2CNT A;  1SFE A;  4PGG A;  1OLT A;  1RTQ A;  3UY5 A;  1R43 A;  3EUK L;  2XEG A;  1BA5 A;  3OIO A;  3BTI A;  5LLQ A;  3A9L A;  3A0B C;  4Q7A A;  2VLA A;  4OAY A;  2W7N A;  1XCV A;  2H8R A;  4BY7 J;  5IPA A;  3V8K A;  4GCV A;  2QCO A;  1QSN A;  4M85 A;  3GFL A;  2P6G A;  3VAR A;  1QBJ A;  4II9 A;  3W2A A;  4PGH A;  2HQN A;  3Q9S A;  3K6G A;  3ABM H;  4A3L J;  1YRN A;  3RBU A;  5CNP A;  2K3P A;  1P9Q C;  4MCS A;  1HKT A;  2XKO A;  3FHZ A;  3O3K A;  5K7Z A;  3KLN A;  5IP6 A;  3HOX J;  2PJP A;  3SEZ A;  2AFU A;  2MG4 A;  1RUO A;  2C6G A;  3PBE A;  3D2M A;  3LWU A;  4ONW A;  1ULY A;  3EY5 A;  2P6F A;  2OPT A;  4IRI A;  4RGU A;  2RFH A;  1YQA A;  3H3U A;  4X1E A;  4Q48 A;  2K85 A;  3JRE A;  4DYO A;  5EEH A;  3HGG A;  3CXP A;  3A0H C;  1I3Q J;  2ZEG A;  3DF8 A;  2DMT A;  2F6C A;  2DF5 A;  2HZT A;  1S3Z A;  2VPR A;  2F5F A;  1IZ1 A;  1V5E A;  2FXF A;  4L8A A;  2OA4 A;  3F8B A;  2A3S A;  1Y1V J;  4XN0 A;  4ZC3 A;  4BUP A;  3JUW A;  1YRN B;  3NH8 A;  3BJ6 A;  2YSR A;  1W36 C;  2Q4Y A;  2J5O A;  5F6F A;  2XAG A;  5CPR B;  1FBQ A;  4YIF A;  1G2H A;  3ZR8 X;  3KP7 A;  1XC5 A;  3FJU A;  2IAI A;  4OKO A;  2LH9 A;  1WCM J;  2Z9O A;  3VH9 A;  3GTQ J;  1MH4 A;  1TWC J;  1I27 A;  2L2O A;  4GDF A;  3FHN A;  5CVR A;  4WWV A;  2XHK A;  3HSR A;  4FD7 A;  1TZL A;  1R49 A;  4CIC A;  2AE6 A;  2RDP A;  3M9A A;  1G59 A;  1OZP A;  5ICC A;  4TWE A;  5LYL A;  4XLC A;  3ZQH A;  1U9O A;  4L9N A;  4BS9 A;  2B7E A;  3SZP A;  1T39 A;  3NRV A;  1HA8 A;  2V6C A;  4I2O A;  2BEI A;  5TIS C;  4A3M J;  1U2W A;  4B47 A;  1G4D A;  5FFX A;  3DSB A;  5FKO A;  3SQN A;  3OYB A;  3BR1 A;  5DDG A;  3GLJ A;  3RKW A;  1R71 A;  3KKW A;  3E6M A;  2V4J C;  1B59 A;  4X0G A;  1RO5 A;  2A6T A;  3DXJ F;  4IVN A;  3GWZ A;  4OAZ A;  5L3C A;  4S04 A;  3OYI A;  2FQ4 A;  2HGC A;  4CGN A;  3N4M A;  4BAC A;  4KOT A;  3GBG A;  2VOO A;  1ETX A;  2RNG A;  3K10 A;  2WSA A;  4ZYG A;  5GCN A;  4XSX F;  4AWX B;  4L89 A;  4UA3 A;  1OYI A;  3OYL A;  4KNY A;  2H6C A;  1ERD A;  4IX7 A;  1T0F A;  4MMO A;  1SD5 A;  4LFU A;  1OCO H;  2PMZ N;  4MIM A;  3TW6 A;  2YU9 J;  2PX9 A;  4FBE A;  1SMT A;  4E2A A;  4A3E J;  1AYE A;  2W85 A;  4NQW A;  1JE8 A;  1A6Q A;  4IHV A;  4Q38 A;  2PJ7 A;  4J01 A;  2KFD A;  3E7L A;  4OAE A;  1R4M B;  3BZ6 A;  3OS0 A;  1N77 A;  4IHT A;  2CTC A;  5KHD A;  2AFW A;  5F0H A;  3TO7 A;  2WAE A;  4I99 C;  2JWT A;  1IRX A;  2H8W A;  3GTG J;  3S32 A;  3FB3 A;  4C2T A;  2XKP A;  5DM7 F;  3ZP5 A;  4I98 B;  2OH1 A;  3CDX A;  3WAB A;  2WAD A;  4QTR A;  3GFI A;  1OCC H;  2GOX B;  5B66 C;  1YSJ A;  5D5W B;  2AFZ A;  2L54 A;  1YS7 A;  2JA2 A;  4JX4 A;  3G1M A;  2Q1Z B;  3AG2 H;  4MGR A;  1W5S A;  5FGM A;  2GA2 A;  2HI3 A;  2X6O A;  2CF4 A;  2FE7 A;  4TV7 A;  4CH7 A;  5B3S H;  3OYD A;  3QPH A;  3J81 K;  1X10 A;  3KIO A;  1Z9U A;  4QUS A;  2DN0 A;  3ZOB A;  1FBS A;  4PUS A;  5J4V A;  5E17 F;  4P4J A;  1Z1D A;  4ZZL A;  1HEE A;  4B11 A;  1XRY A;  1SFU A;  3D8P A;  4NGM A;  1NG6 A;  3HOZ J;  2ZEF A;  1PP7 U;  4BQN A;  3H8G A;  3VEP A;  3E3V A;  4OIW A;  2X1D A;  4IO9 F;  4GRI A;  3RKQ A;  1W7P D;  2DFH A;  6PAX A;  2JTV A;  1FIP A;  2FT0 A;  3D7D A;  2D2W A;  4LB6 B;  2R7O A;  2G0B A;  4C30 A;  2FVG A;  3LNQ A;  4BBH A;  4E8O A;  2DBB A;  1V5F A;  2C6C A;  1B8I A;  2ZME B;  3RQ4 A;  4XLP F;  1ETO A;  1KU9 A;  4KSA A;  2R7S A;  4G6Q A;  1YJN I;  1FOK A;  2IA1 A;  4M6X A;  1RUN A;  2OZ6 A;  2NVX J;  3RI4 A;  2ZED A;  2R7T A;  2XAS A;  5GAD J;  2ELK A;  1W0U A;  1TNS A;  3GW2 A;  3W2V A;  4ZTJ A;  3GEZ A;  3K7A J;  4L9V A;  1U3E M;  3CPX A;  3OYK A;  2DDA A;  4OIO F;  3DV8 A;  4HOB A;  2R5Z B;  3K4K A;  4HF1 A;  3KYC B;  2AQE A;  2XAU A;  3SXY A;  5HOO A;  1OCT C;  2MC4 A;  3G1O A;  5IT3 A;  1KYZ A;  1S7A A;  3MCZ A;  1LRZ A;  1TTY A;  1TWH J;  2O3F A;  4TNU A;  5HVH A;  4XPL A;  3DPU A;  2EK8 A;  3D0S A;  4XIC A;  3BWG A;  1XOV A;  4Y33 A;  4C7I A;  1GUU A;  2R5Y A;  3GVA A;  1YOV B;  4EV0 A;  1S7F A;  3Q9V A;  3F21 A;  2GE3 A;  5J1R A;  1DGW Y;  4HDV A;  2EK5 A;  3CC4 I;  1Y7R A;  2Q44 A;  2E60 A;  2I5U A;  2P6S A;  2ZKZ A;  3OR2 C;  1BI0 A;  1GXP A;  3EC4 A;  4KOY A;  1J2X A;  4P1W A;  2O4H A;  5HDK A;  4NGP A;  3GX4 X;  4M3S A;  1S7K A;  2JSP A;  1AMP A;  3CJT B;  4YIR X;  2BGC A;  2HZD A;  2OBP A;  2YUS A;  5JLW A;  4MY0 A;  2MAB A;  5FKM A;  3BTL A;  1CF7 B;  3H92 A;  2FMY A;  2PRQ A;  3WU1 B;  4IZZ A;  4BDY A;  1J59 A;  2BVL A;  2DFF A;  4BBS J;  3NE7 A;  1FMW A;  3I59 A;  2LY1 A;  2XF7 A;  4U0V A;  2ABZ A;  1I1D A;  3WC5 A;  3CT9 A;  4RB3 C;  2YNC C;  4XLE A;  1BAV A;  4BE2 A;  5CVJ A;  5LHI A;  1D0Z A;  4IHY A;  5AG6 A;  2DOF A;  3BCB A;  2ZXI A;  2KQR A;  2D45 A;  5E8I A;  1U5T C;  1YX5 A;  5HVG A;  1F57 A;  1YVK A;  1XIX A;  2ZB9 A;  2NRA C;  2FX0 A;  1BW6 A;  2MD5 A;  4OC4 A;  5IX3 A;  4YWY A;  4PJJ A;  5HH1 A;  2BEO A;  4UIA A;  1EE3 P;  4UB8 C;  4KUB A;  3RDI A;  3H35 A;  3L1P A;  1SEU A;  5FD5 A;  1A5J A;  1O57 A;  2DEA A;  4ZX9 A;  1YW9 A;  2F48 A;  3IKT A;  2O53 A;  4O23 A;  1JGG A;  4YFJ A;  1OCP A;  3GUD A;  3VYU B;  5J1Y A;  4B09 A;  3H5A A;  2R8V A;  2X1C A;  4E0A A;  1XN7 A;  1F5T A;  2ME0 A;  1DDN A;  2E36 A;  2GXG A;  4EGY A;  1U5T B;  1OYW A;  2HNH A;  1RC9 A;  2WAQ A;  2GM4 A;  1CJW A;  4K2E A;  1VQL I;  3MKY B;  1KON A;  3KPH A;  4RAZ A;  1IDY A;  3DP7 A;  5EYR A;  4ZYA A;  2GZW A;  2TRT A;  5LFA A;  7CPA A;  4LG0 A;  3K4B A;  1XD7 A;  3SHP A;  4QBJ A;  3EFA A;  2CMP A;  4YFN F;  4N9H A;  3TMO A;  3ERE D;  1WZ2 A;  5CQG A;  5BMZ A;  1ZO0 A;  3DNS A;  2FBH A;  4M6Y A;  4A3I J;  1MDM A;  4R3K A;  4RM3 A;  1B9M A;  1OFC X;  5ISV A;  4ESJ A;  1LQ1 A;  3WHB A;  1D0X A;  8CPA A;  1FSE A;  4D9J A;  1NSA A;  2PBI A;  2UZK A;  1NTC A;  4IHW A;  3D68 A;  2O8X A;  1Y56 A;  3H9Q A;  3ZQQ A;  1YTY A;  4JBA A;  1IB1 E;  3N5F A;  2GRE A;  1I1S A;  2FU4 A;  2PVV A;  3B3T A;  2RKH A;  2PJ4 A;  2MW8 A;  2LTP A;  4KIB A;  4B4C A;  1H89 C;  3D3S A;  4U9Z A;  3F72 A;  4Y7N J;  4LQ6 A;  2BO9 A;  3H36 A;  1ZRD A;  1UG0 A;  4BU2 A;  1W1W E;  3H3V K;  2CY2 A;  2RB7 A;  1H88 C;  2DYR H;  1FX7 A;  1SFX A;  2EK9 A;  1SQH A;  3JRH A;  5JM6 A;  2YGW A;  1MZB A;  2DXI A;  4OID A;  2QEC A;  3KGQ A;  4CYC A;  1HQC A;  1MBG A;  2K9M A;  3G71 I;  4PCQ A;  3RAM A;  5M5W J;  3FXQ A;  5FRO A;  4MQV A;  3MQ0 A;  4MQ9 F;  3RZD J;  2KCW A;  3PQJ A;  3KR4 A;  3DU5 A;  4NBQ A;  3HSF A;  3D67 A;  2I00 A;  2REE A;  1DU6 A;  1BN5 A;  4LB5 A;  2KZG A;  2L9V A;  1BOA A;  4F9V A;  1YX0 A;  1Q1H A;  4RGX A;  1D8J A;  2OTJ I;  2R5Y B;  1ETY A;  2AO9 A;  3VYT B;  5GTI C;  4HF0 A;  1IV6 A;  3RCO A;  1TWA J;  5E3L A;  2IXS A;  1T8I A;  2R92 J;  1BPN A;  2AXL A;  2A5W A;  3IFE A;  2FCK A;  3CD6 I;  3VSK A;  2HOA A;  1QPI A;  5A27 A;  2B3V A;  3P5J A;  4QWQ A;  1LAP A;  1TXR A;  3BXM A;  2XB5 A;  2R7X A;  4MFQ A;  3IH2 A;  1FNN A;  2E1M C;  3VYS B;  2CV1 A;  3GXO A;  1W5C C;  5F0C A;  4DJA A;  1LE8 A;  1YW8 A;  3R0A A;  1PYV A;  3LSP A;  2LF8 A;  3BJ7 A;  1TQI A;  2ZOF A;  4KOR A;  1K6Y A;  2TDX A;  3FXU A;  1IGB A;  1E3P A;  3Q0U A;  1FP2 A;  5GTH C;  1V5G A;  1ONV A;  2BUE A;  4P4D A;  3M1E A;  3DGV A;  2VL8 A;  4ZYQ A;  1HKS A;  1X3U A;  3H8E A;  5G1Z A;  1Y0Y A;  2PIZ A;  5D4S A;  2QJ8 A;  2DFE A;  3FWE A;  3HUG B;  2I79 A;  2ZEE A;  3CME I;  5AG7 A;  1I50 J;  1L0O C;  2PJ9 A;  1XMK A;  4IKF A;  2GQQ A;  5M5Y J;  4R8F A;  3NWT A;  2Y2Z A;  2C6Y A;  3QPS A;  1DPU A;  1TWG J;  4GM5 A;  5E3N A;  3A01 A;  5CVV A;  5F09 A;  3ESW B;  5K8O A;  3K69 A;  4C3I J;  3FED A;  4OP4 A;  5HLH A;  2GFQ A;  3NH4 A;  1K7A A;  3ZN1 A;  2FJ1 A;  1IYL A;  3QYE A;  5G22 A;  4ZYD A;  3HRU A;  2VE9 A;  1XMA A;  3P2F A;  3EPZ A;  4MTD A;  3TO6 A;  3P7N A;  1JQG A;  3EYI A;  3B2Y A;  1OQY A;  1BI2 A;  2VC1 A;  3AFH A;  3KP3 A;  4BE0 A;  2DYS H;  3BG5 A;  3C2H A;  3C3W A;  3DTK A;  1ELM P;  1STZ A;  4D5F A;  2L7K A;  2IRF G;  5HS8 A;  4I01 A;  2W1O A;  2NOG A;  3IEH A;  1XX5 A;  4NGR A;  4A3B J;  2WB1 A;  2HYG D;  4A3F J;  2DCE A;  4HV6 A;  3MGD A;  1ZLI A;  3PNY A;  1KWM A;  4CCO A;  1XCB A;  4FE7 A;  2Z3M A;  4K3N A;  3V7R A;  4RDU A;  3S17 J;  1FNO A;  3QPT A;  4OC5 A;  3KP2 A;  2NVY J;  3Q3S A;  1E17 A;  1Q7L A;  1P6R A;  1A35 A;  4B1R A;  2P4W A;  1I1G A;  3BJ8 A;  2Y48 A;  3Q5F A;  2XUB A;  2HQ5 A;  3LAJ A;  1Y0N A;  3CCY A;  1X2M A;  5HS9 A;  5LGN A;  1X4O A;  2E1N A;  2QSH X;  3BI1 A;  1Y7E A;  3R61 A;  5DD8 A;  2YX4 A;  3O8G A;  3NA6 A;  2BVM A;  5LD2 C;  4N4O B;  3KE2 A;  4G7H F;  1LNW A;  1POG A;  3TDZ C;  3ASN H;  2YND A;  3WC6 A;  2OU2 A;  1IRG A;  3PNT A;  4HQM A;  5L3G A;  3OYC A;  3G1L A;  2L5Q A;  3BLY A;  2HFH A;  1YME A;  3LL7 A;  4K30 A;  2ZXJ A;  3L7W A;  5K8M A;  3QOE A;  3D5R C;  4QC6 A;  5IYB J;  5BOX A;  1X2N A;  2ME6 A;  1U5T A;  2VJ5 A;  2E2H J;  2D1V A;  3K1N A;  3GTM J;  4JJX A;  2VJI A;  4ETS A;  3LFK A;  4KT6 A;  2YNC A;  1CBX A;  5TRD A;  3TC8 A;  1PYT B;  5D5V B;  2K9Q A;  3RZO J;  4E7H A;  2CIJ A;  1RNL A;  5ILS A;  4QPQ A;  1U6M A;  5LRG A;  2LY9 A;  3LST A;  3BZC A;  3ERM A;  1YFH A;  3IAM 2;  4I76 A;  4MCR A;  1M4L A;  2ZNY A;  3U1D A;  5HLI A;  4B43 A;  3TO9 A;  4PSW A;  1RIO H;  2PJ2 A;  3KR5 A;  2JRM A;  2D5V A;  3WTW C;  2HPM A;  2VQG A;  4OIN F;  3IWF A;  1SMY F;  2XGD A;  1A04 A;  5KAF C;  1XGO A;  1KUX A;  3FMC A;  2KPM A;  2LYC A;  3C18 A;  5CKT A;  2CW8 A;  4JX5 A;  3S9N A;  2H1K A;  4O3M A;  1K4T A;  3GF2 A;  4ZX8 A;  2Z0Z A;  5LRR A;  2O7O A;  2OAZ A;  2QUF A;  3F8F A;  4LJZ F;  3V7C A;  4MHY A;  2BOA A;  2B0L A;  4E7Z A;  4MEX F;  2XRL A;  1NK3 P;  3S1M J;  5ICE A;  2JVG A;  2E2J J;  2XAJ A;  4ZTF A;  2FS5 A;  2O28 A;  3RTR A;  3MZY A;  4BBR J;  3I55 I;  5IP7 J;  4UV9 A;  4MHP A;  4R6T A;  5DYM A;  4AC0 A;  2Z33 A;  1J09 A;  2F7V A;  2MC3 A;  4YFX F;  4LLG F;  2MSY A;  3K2A A;  1I6H J;  3KLO A;  1HDP A;  5LBQ A;  4HG2 A;  1XGS A;  1EH7 A;  1Q2C A;  2X6Y A;  1ZGA A;  1XMB A;  4R7M A;  4M3B A;  5K5R A;  3VWE A;  3RNZ A;  1Z8L A;  1WJD A;  4MO7 A;  4DZJ A;  3DFG A;  4JX6 A;  2OZH A;  4C2M J;  2XRN A;  1ZR4 A;  5DTD A;  5AIP A;  3F23 A;  1FZP B;  4JWP A;  1GYT A;  1XTA A;  3KZI C;  4MFK A;  1UJ8 A;  4FX0 A;  2CJJ A;  2E1O A;  2Q04 A;  1ZGJ A;  3ZCO A;  4AB7 A;  1FBU A;  2CFX A;  1KGS A;  2CW7 A;  4KA4 A;  2EUI A;  1HW2 A;  2JDD A;  3ML6 A;  3DBH B;  2NSM A;  2Y0S A;  3HYI A;  4IL6 C;  1EF4 A;  2ICW G;  3HUG A;  1U8R A;  2VT3 A;  1ELL P;  2V8D A;  2IT0 A;  4NGT A;  2F5D A;  2W4S A;  3IKV A;  3TX8 A;  1P4X A;  5EEG A;  3SJX A;  4P6Y A;  2VUM J;  4I0B A;  4M6G A;  4A38 A;  3PQK A;  2DA6 A;  3QQA A;  1TC3 C;  2L02 A;  3M07 A;  2Q2E B;  4HW0 A;  3MD2 A;  2IL4 A;  4Y3O A;  4ABZ A;  2E1M B;  2XPW A;  1S7N A;  3FX3 A;  4MRI A;  1BI1 A;  1LE8 B;  1C0W A;  4UCM A;  1KU7 A;  2Y75 A;  5HDN A;  4CSW A;  1J5Y A;  2Q2E A;  2WAF A;  4GS4 A;  1ZN2 A;  3JRB A;  4HNX B;  4ITV A;  1VQO I;  1NSL A;  3HHH A;  1F36 A;  1QVU A;  2V1U A;  4BIN A;  4A5M A;  1WKM A;  1UEL B;  2VQC A;  1YGH A;  4QB9 A;  4AG9 A;  4W1U A;  1HOM A;  3V8J A;  2BE5 F;  2O0Y A;  2C6P A;  3R95 A;  1S8N A;  1USS A;  2KIU A;  4LK0 F;  4MHG A;  3HL2 A;  2DT6 A;  3W6V A;  1G3S A;  1DQU A;  1QVT A;  3S6K A;  1DP7 P;  5B1B H;  1ZG3 A;  2VEZ A;  1UHW A;  4CPA A;  2XSJ C;  2XPU A;  2BBY A;  2H09 A;  4P10 A;  4I49 A;  3HPH A;  3KEO A;  2K3F A;  5E1X A;  2OQG A;  2WPX A;  3KQX A;  4PXE A;  2X51 A;  1D0Y A;  2NXN B;  2IW5 A;  1H0M A;  2P5L C;  3DWL E;  2BSW A;  1JHH A;  3IWZ A;  3NAU A;  4U87 A;  1WPK A;  2HC9 A;  3AG1 H;  5F1R A;  4CYQ A;  1G8X A;  5KTD A;  1LOK A;  5IOY A;  2VBW A;  3IU2 A;  4WCG A;  4A3D J;  1T33 A;  2NMT A;  3BG7 A;  4XKV A;  1OPC A;  2M8G X;  2Z3K A;  2F5C A;  3FXJ A;  1MGT A;  2QKM B;  3HG9 A;  4XON A;  1IUY A;  1VHE A;  3AKZ A;  1BL0 A;  4M3D A;  2F4I A;  4NGS A;  1HW1 A;  1OIS A;  2P81 A;  3I3L A;  1S72 I;  3BHX A;  4EJU A;  1X3W B;  2BW3 B;  4UVC A;  2DPU A;  2HVS A;  3WG7 H;  1WK4 A;  2GIV A;  2AFO A;  2GU2 A;  5EDN A;  3BPX A;  3B02 A;  5M3F J;  1K4S A;  5E20 A;  2DQR A;  1AU7 A;  5EZH A;  4UUS A;  4D7N A;  4X3R A;  2ZSH B;  3T8R A;  2LVS A;  2H6B A;  1MBE A;  5FLV A;  1BR2 A;  1ZAR A;  2FF4 A;  3CCQ I;  4A3G J;  3WC7 A;  2YS9 A;  2DJN A;  3JRD A;  1JTX A;  2DPT A;  2IVM A;  4KLV A;  1P4A A;  4L5I A;  1ZRC A;  2V8G A;  2HDC A;  4F0Y A;  2J8R A;  3RYR A;  4AVC A;  3B6C A;  3O8H A;  1MDM B;  4GGG A;  3PL8 A;  4KSF A;  2P7V B;  1NG7 A;  3K4C A;  3SFI A;  3HZJ A;  4HAM A;  1XGM A;  4LD5 A;  4QLC U;  2CNM A;  5FLX Z;  1Z5R A;  3DTI A;  5CVU A;  1U6G A;  1R4N B;  1MMG A;  3K1M A;  3H0D A;  1NE9 A;  5E8G A;  4M71 A;  3CCM I;  1B87 A;  3OMY A;  5D6E A;  1EH6 A;  5C3E J;  4Q36 A;  3PFI A;  3H3Z A;  3QP5 A;  1Z8T A;  2GLJ A;  2OC6 A;  3E6C C;  3TGN A;  3FXM A;  3DLJ A;  4MFL A;  1WGX A;  4DUK A;  5IB9 A;  3WR7 A;  1WQ2 A;  2M1B A;  2EFW A;  2FIA A;  4CO8 A;  1VND A;  1VHO A;  2R7F A;  1FOY A;  2VI7 A;  2CSO A;  4ZGY B;  2K9L A;  4WXD A;  2B5G B;  3KCC A;  2V6E A;  3KL9 A;  2FIW A;  2JN6 A;  5F08 A;  5K8N A;  2JBK A;  3B3W A;  5GAE J;  4PK3 A;  3GFJ A;  5BWA B;  2XF6 A;  4M3F A;  2PMZ A;  3ABT A;  4L9J A;  4M74 A;  4BKX A;  5E79 C;  3CUQ C;  1N71 A;  4MFZ A;  2K9N A;  2L4M A;  2FOK A;  2JA6 J;  1IAW A;  2DOA A;  4U0W A;  1BJA A;  2LK2 A;  4CYD A;  5LYD A;  3DLA A;  3HSE A;  3R1K A;  3BG3 A;  4G6T B;  4IF4 A;  2JT1 A;  5FB2 A;  4F6A A;  3DKY A;  5DWN A;  1M1D A;  4V2F A;  2REF A;  4HSR A;  2G3A A;  1R5I D;  4WJB A;  4XKC A;  3BR0 A;  3BOQ A;  1DP3 A;  4XNH C;  2K40 A;  4EWT A;  4R9M A;  2PJA A;  1AA7 A;  5ERI A;  3S6F A;  4EJO A;  4CGM A;  4WWC A;  1A31 A;  1CG2 A;  2KRC A;  4Q5S F;  3KEQ A;  4A37 A;  4XPD C;  4BQQ A;  2VXK A;  4XLH A;  4A6D A;  3BJA A;  2MLK A;  2L7Z A;  1MMD A;  3S2W A;  1W7P A;  2UXX A;  3PP9 A;  2XVC A;  2BV6 A;  2MBF A;  2GBY A;  3S1N J;  4W9Y A;  2OJE D;  4ASN A;  1B9N A;  3KZW A;  2ANP A;  2IPQ X;  5FLM J;  2ECC A;  4H0E A;  2VL1 A;  3I3G A;  2M0C A;  3COA C;  1FJL A;  4HNW B;  5AG4 A;  4PPZ A;  2E7W A;  1UHM A;  1KYW A;  2M5W A;  2DA4 A;  3DBR B;  1TL8 A;  1O3Q A;  4LGW A;  1S5K A;  4U7D A;  3OYA A;  1ZAO A;  2QQ8 A;  2L9R A;  3SXN A;  3UNG C;  4OC2 A;  2BY3 A;  2FXA A;  3ZGK A;  2DPS A;  3PO3 J;  2W25 A;  1R58 A;  3SI0 A;  3F0A A;  3S2H J;  2FBK A;  2ZEN A;  1YJW I;  3ZQL A;  5IT9 K;  3BR6 A;  3QYF A;  4M9S A;  2CUJ A;  3U1K A;  4HF2 A;  2CYY A;  5HLT A;  4RB1 A;  1TW3 A;  3MN2 A;  4L9T A;  3V7S A;  4UCN A;  5L3E A;  4EVY A;  3J7A O;  2OQR A;  4IOC F;  3TOB A;  1Y8Q B;  3QOD A;  2EPF A;  2ZJP F;  1TIQ A;  1RET A;  4HKF A;  2HYJ A;  1Q2Y A;  1XDU A;  2DW4 A;  2VAS A;  1R1U A;  2XRO A;  2W84 A;  4EQQ A;  2VBY A;  3MKZ A;  2F5I A;  1VQN I;  2EIM H;  3B6A A;  3GLX A;  3IRQ A;  5CQE A;  1I6X A;  3OS2 A;  3O6B B;  1LUJ B;  4PJM A;  1PUA A;  2AS5 F;  4HQE A;  1N25 A;  4WK8 F;  2HPI A;  2XAQ A;  3GLL A;  3KFW X;  1BR4 A;  1R7J A;  2HKX A;  2KP6 A;  1IN5 A;  3T8T A;  1YW4 A;  1T98 A;  1T56 A;  2ISZ A;  2ZO4 A;  2R7V A;  3UKG A;  3CXS A;  4M6V A;  1JJ6 C;  1LPQ A;  2ECB A;  3LMS A;  4ZY1 A;  3I56 I;  1O4X A;  4CYC B;  3CCL I;  3CUQ A;  4FX4 A;  2PJR A;  3LA2 A;  4KJZ A;  1QST A;  2IGN A;  3V4G A;  3OYG A;  1VQ4 I;  4JK1 X;  1ZLH A;  2JSC A;  3IV5 A;  1Q2D A;  3FM3 A;  5KAI C;  2Z5U A;  3TCV A;  3WE2 A;  4R3L A;  3E5X A;  2YPR A;  3HOS A;  4EAT A;  3G3Z A;  3W6J B;  1R3N A;  3CO7 C;  3F6V A;  2DFI A;  3FXR A;  5EEA A;  1FIA A;  3OIP A;  2WA0 A;  4UUS B;  2PJ3 A;  2CFO A;  4DYC A;  5H86 A;  1Z0X A;  2PJ0 A;  2CW0 F;  4XRS A;  4JYK A;  2W82 A;  4HNT A;  5DCF A;  2DMQ A;  1K78 B;  2A05 A;  3I59 B;  2NNN A;  2P0W A;  3BQY A;  3SEQ A;  2O8K A;  3FZV A;  3JAM Z;  2OB0 A;  1B6B A;  1FP1 D;  1R36 A;  2RVC A;  3GKR A;  3ZMT A;  5LEJ A;  5EMI A;  4BHB A;  1F4K A;  3RPQ A;  2RGV A;  3H5R A;  3HOY J;  2DA2 A;  2R7W A;  3I0T A;  2J8N A;  1JKO C;  1Z8W A;  1ZRE A;  2ZXW H;  4CAF A;  4OMZ A;  5J40 A;  2FML A;  3U2R A;  5E18 F;  2VOP A;  2IJL A;  3NH5 A;  3ONQ A;  2R7R A;  4MHZ A;  3T9Y A;  1KZH A;  5D8L B;  2B4B A;  3T90 A;  3A2K A;  5JVT A;  2EA4 A;  3W6K B;  4HV5 A;  1OR7 C;  2Z1D A;  1FTT A;  4I7H A;  2AFM A;  3D5S C;  3FNC A;  2RRE A;  1F2O A;  4P4I A;  2NS0 A;  4KOS A;  2IS6 A;  1GV2 A;  2XEI A;  2XPV A;  5CBM A;  2PDO A;  3CZ6 A;  4RLQ A;  1SVL A;  3SHF A;  1KZF A;  4CCL A;  3IIB A;  2OR4 A;  5D8N A;  3R96 A;  1IJW C;  5ED4 A;  1YI2 I;  1QO0 D;  3GUX A;  1DTD A;  5BPD A;  2QYV A;  1Y9K A;  2DOD A;  2FSW A;  3CMY A;  2QBY B;  4MJ8 A;  5E3O A;  4P96 A;  4PFP A;  4OME A;  1LVA A;  3SI1 A;  2CRG A;  1H9T A;  4IAV A;  4CYP A;  4KYW A;  3OSG A;  5GP9 A;  5IY5 H;  1LEB A;  1N75 A;  3KP6 A;  3DKX A;  3QRF F;  5J8F A;  2PI0 A;  1LFP A;  2XAH A;  2R5Z A;  3V42 A;  1H9G A;  4HNV A;  2PLY A;  3PFY A;  1OMI A;  1SD7 A;  5BS6 A;  3F6O A;  4OIR F;  3B3C A;  4LUA A;  2HVQ A;  1JKP C;  1OR7 A;  4E7K A;  1IUF A;  2EZI A;  2R4G A;  2EB7 A;  4NXY A;  4OOI A;  3ZN0 A;  1ETW A;  1XPX A;  5DUI A;  4A6E A;  4XPK A;  4R79 A;  3V8I A;  4PZJ A;  4MHD A;  4FHT A;  2HEO A;  2PE3 A;  1JUM A;  2B9S A;  1BC8 C;  2HKO A;  3JRA A;  4DBR A;  4AYB A;  5J4Y A;  3ZQ7 A;  5B5E C;  1IO2 A;  2V79 A;  1HKQ A;  1WJE A;  3HJE A;  5D5U B;  3OSF A;  2BL1 A;  2HQY A;  5HXD A;  3HKZ A;  4ESB A;  4WXC A;  4ZYH A;  4ZDO A;  3L2C A;  3ECH A;  2OUM A;  4KMF A;  2JEV A;  1YO5 C;  3HIF A;  1D5Y A;  2P7C B;  2I10 A;  2HUZ A;  1P4W A;  2XGE A;  4L0Z B;  3RYO A;  2BHY A;  1ARM A;  4ZYE A;  3LD2 A;  3DDD A;  3FBU A;  2WPW A;  4II2 A;  2EFN A;  3FF5 A;  3PB6 X;  2R0Q C;  1FT7 A;  2ZOG A;  3IC1 A;  4JP0 A;  2RQQ A;  1LDJ A;  3GYA A;  4X2T A;  4E7S A;  1TWF J;  1A2Z A;  1F1Z A;  1BIA A;  2E5N A;  4MFD A;  4FTH A;  2D4O A;  1AHD P;  3W6X A;  4YG2 F;  2R1I A;  3FRM A;  4ANJ A;  1X4P A;  4Y49 B;  1M4I A;  3HOU J;  4HPQ A;  4AID A;  9ANT A;  1VKC A;  3CF2 A;  3S3N A;  3TTH A;  3ZJ0 A;  5J6X A;  2ACJ A;  3ZXS A;  1ZTR A;  4BGD A;  2M87 A;  3FXL A;  1E3O C;  4BQA A;  3JRU A;  2FOW A;  4A69 C;  1Z67 A;  3EYY A;  1E0E A;  3CF5 F;  3SXO A;  4CRZ B;  2LDU A;  2EIN H;  2CGP A;  2IGK A;  3KYD B;  3WE3 A;  2JUC A;  2V8H A;  4UFX A;  2ELH A;  4IJA A;  3B35 A;  2M7A A;  1S5L C;  4CDG A;  1OCR H;  3J81 Z;  2RV8 A;  3S93 A;  1ZG1 A;  2EIJ H;  3GYH X;  2DI3 A;  3FYN A;  3W91 A;  4JYW A;  1MBK A;  4LG0 B;  4HX4 A;  3K70 C;  1QQI A;  3A02 A;  3S8P A;  1TKF A;  1EJ9 A;  3M8E A;  2Q7B A;  3QU6 A;  4EJW A;  2N8G A;  4UNO A;  4F0X A;  2WY8 Q;  4XM3 A;  3PEI A;  5EGO B;  2Q43 A;  3ISX A;  2B63 J;  2DTR A;  1U0J A;  4PV6 A;  5I4M A;  2CQK A;  1WHU A;  2X6W A;  3CCE I;  3MZH A;  1VHS A;  3ISZ A;  2EVN A;  3IRR A;  1P4N A;  4XKW A;  1VQP I;  3HRM A;  2L7M P;  1Z77 A;  2CUZ A;  1KU3 A;  3AG4 H;  1YIJ I;  4OIQ F;  2COB A;  1R22 A;  2WB1 N;  3ABL H;  1LB2 A;  4NUB A;  1PU9 A;  2V1D A;  3T5X A;  4FAS D;  2RQP A;  2X4H A;  3S6H A;  5LRK A;  2LF7 A;  5THW A;  4AIJ A;  2DQL A;  2QKL B;  1JT6 A;  1MJB A;  2L7F P;  2C1C A;  4FCY A;  1EV7 A;  1GV5 A;  1RKT A;  2GIZ A;  1OYY A;  2EZL A;  3IC7 A;  4F9U A;  4CCM A;  4DW6 A;  2KT0 A;  2K5T A;  4AVP A;  4B48 A;  3I1U A;  2C27 A;  3I9S A;  2NAZ A;  3BTC A;  3QAH A;  2NVQ J;  3QNV A;  5KTA A;  5K1Y A;  3CC2 I;  2ZW7 A;  1D1C A;  4LQG A;  1R1T A;  3GTJ J;  3H9J A;  5JR3 A;  3LMM A;  4QPO A;  1QA6 A;  1AUG A;  3VWD A;  2ATR A;  2GAN A;  1VQ5 I;  1YG2 A;  4A39 A;  1UMQ A;  1XSD A;  4CZC A;  3JAM K;  5E3M A;  4FQG A;  2I3C A;  2F5E A;  3FM5 A;  3N05 A;  3Q0V A;  1X1C A;  3DLL F;  3CDL A;  3B3S A;  3JTK A;  2KJB A;  4B8X A;  2O9L A;  3FXK A;  2QM3 A;  4BY1 J;  3KI9 A;  5DV5 A;  5ILU A;  1IXS B;  2Y9Z A;  1I3A A;  3ZQC A;  1Y8R B;  2E2I J;  4PXB A;  4IRH A;  1QHG A;  4MFJ A;  2HQR A;  2M9H A;  2L0K A;  5HLG A;  2LKX A;  1PCA A;  2QQ9 A;  1UAA A;  3G3S A;  1QRY A;  2VN2 A;  3BP8 A;  4RAY A;  4XKB A;  3E6D A;  5CJ9 A;  4KVO E;  1W7P B;  3E5Q A;  3IH4 A;  4X5K A;  5JHU A;  1ARL A;  4N0B A;  3FK6 A;  3F22 A;  3PB4 X;  1IIC A;  4KZT A;  4ONU A;  3OYM A;  2HWV A;  2VJJ A;  1TBX A;  3LFU A;  1UHS A;  4C2X A;  3ZQG A;  3N97 A;  2KHM A;  1Y0U A;  2PMU A;  3JTH A;  1R1V A;  2IJZ A;  2D1H A;  3ZMU A;  1JHF A;  4JOM A;  1PVE A;  4IHX A;  1RES A;  2LLK A;  1G3Y A;  3BLN A;  2KL4 A;  3G73 A;  3FF3 A;  4HPS A;  5EBV A;  1VQK I;  2ZEP A;  4IHS A;  3CXQ A;  1ZH5 A;  4UBR A;  3VAT A;  1W5T A;  3JRG A;  4M6I A;  3I54 A;  4PXD A;  4BAY A;  2PC1 A;  2Q4Z A;  2PJ5 A;  1W36 D;  2K4B A;  2KRH A;  2X0L A;  4ZJZ A;  1YYV A;  3OR1 C;  4GYG A;  4A0X A;  5J3L A;  4NNJ A;  2PVW A;  2OZU A;  3WTY C;  1YE9 A;  3S14 J;  3CMA I;  1YLF A;  5F1J A;  3L9F A;  1BPM A;  4MXU A;  4XQF A;  4LLL A;  1R9T J;  1X12 A;  3FMQ A;  3MWM A;  3BRO A;  5ELY A;  3DR8 A;  3BR3 A;  1V54 H;  1AWC A;  5LRS A;  2BXY A;  1YIT I;  1R5H A;  5HOD A;  3FDY A;  2KLO A;  4KVM E;  5D6F A;  4BXX J;  3JRI A;  1FYK A;  3CLO A;  1WWX A;  3J7Z I;  3ZMZ A;  2HV2 A;  4KT5 C;  4BJ6 C;  2ID3 A;  3FIS A;  1GVJ A;  3PBB A;  1HDU A;  4BE1 A;  5GPC A;  4ZDP A;  3OL3 A;  4UUT A;  1CPX A;  5KTC A;  2DPD A;  2FSR A;  3PB7 X;  2HDW A;  3K70 D;  1WSU A;  3I9V 2;  4CHU A;  2DTZ A;  3MAJ A;  3OY9 A;  1NH3 A;  3FIX A;  3JW4 A;  2CH0 A;  1B1B A;  4AVZ A;  4EFD A;  1VFC A;  1XB4 A;  2A6H F;  1HBX G;  5G21 A;  2RN7 A;  4AG7 A;  5DEQ A;  3P9C A;  2K5C A;  3D66 A;  2IA2 A;  2PCU A;  4XSZ F;  2MH2 A;  2DMU A;  1KA8 A;  2KRF A;  2VC0 A;  2EZK A;  1YHQ I;  3I58 A;  4KIC A;  4KIG A;  2V8V A;  4XN3 A;  2Z16 A;  4IQJ A;  4KMU X;  3RO0 A;  4CCJ A;  1QMU A;  3V38 A;  4KN7 X;  4LG3 A;  1IID A;  1YQE A;  4UVA A;  5K7H A;  5L3B A;  1MH3 A;  3HBL A;  1DGR M;  2IQ6 A;  1FYL A;  4CAV A;  1IN7 A;  2X85 A;  3QB8 A;  1VF9 A;  1ZKG A;  3CZX A;  3QAY A;  3S9L A;  2PN6 A;  4GO1 A;  2CQ7 A;  3OOU A;  3L2R A;  2LBF B;  4OC1 A;  1LDD A;  1X1D A;  4YRH A;  4Z65 A;  2K86 A;  3DTE A;  2R7Z J;  1F2P A;  3CDI A;  1VZ0 A;  3J7A Y;  1XMT A;  4KIS A;  1YLE A;  3DR6 A;  1YW6 A;  4MCQ A;  2HDD A;  2Z11 A;  2VE8 A;  1IDZ A;  3MZ8 A;  3W6S A;  1WH5 A;  3A03 A;  3WG9 A;  2K02 A;  1X3Z B;  4F7Z A;  1Z6T A;  1WJF A;  1PUE E;  5H6R A;  3H5N A;  3I5U A;  4HLX A;  2E34 A;  1SAX A;  3PFO A;  3HGY A;  2FNP A;  2ZFU A;  2ZJR F;  1GHE A;  2QQA A;  4M9Z A;  2RC4 A;  4E4H A;  1VGY A;  1AKH B;  1WRJ A;  1Z05 A;  4BXF A;  2CG4 A;  3LAC A;  3DKW A;  1Z3X A;  4A93 J;  1UWY A;  1ZQ3 P;  4HA8 A;  3E97 A;  3KET A;  3MFK A;  4UWI A;  2STW A;  3C2G A;  2JQ7 A;  4B14 A;  1SD6 A;  3H4Q A;  4BNC A;  5EC4 A;  5J47 A;  2EBI A;  2HOT A;  1U8B A;  1VQ6 I;  3E0K A;  3L2U A;  1S7O A;  2DMN A;  2Y30 A;  4RB2 C;  1YK3 A;  4P9F A;  1VQ8 I;  1QZZ A;  4OWR B;  2KJC A;  3VOE A;  4KOW A;  2IA0 A;  4B12 A;  4YII A;  2ID6 A;  3SJM A;  3PGP A;  2A61 A;  2J5P A;  3WGI A;  2R3S A;  2RAE A;  3TED A;  1BW5 A;  2LKS A;  3BTJ A;  4WXH A;  2Z2S B;  2M3A A;  3S16 J;  4B10 A;  2GOM A;  2CNS A;  3DU6 A;  1MND A;  1RR7 A;  4R8H A;  5K5O A;  2JZY A;  3SZG A;  3R4K A;  4ENJ A;  4U9Y A;  3J7Y J;  1FMV A;  2UWM A;  2F2E A;  4HX8 A;  5J1U A;  1FY7 A;  2HS5 A;  1UCR A;  3BPV A;  5LYI A;  1M4D A;  1RI7 A;  1E3H A;  2DA7 A;  4IK2 A;  2Q51 A;  1TW2 A;  1I12 A;  4R87 A;  4YEJ A;  3B8G A;  2MFZ A;  3ZMV A;  2UUZ A;  3EET A;  2YR2 A;  3HC7 A;  2WWY A;  1T6S A;  3JSO A;  3LSM A;  4UXN A;  3CJQ B;  4B5P B;  3C26 A;  2KKO A;  2ZC2 A;  4HYE A;  1T95 A;  4BEH A;  4NB5 A;  4A0Z A;  4DIQ A;  3J80 K;  1VQ7 I;  3PM1 A;  2P5K A;  4C9Y A;  4UFW A;  1RKW A;  2VXZ A;  2NOJ B;  3I4M J;  3U21 A;  1ZG8 A;  1Z6R A;  4R57 A;  4B44 A;  2ZME C;  2DA3 A;  1BJZ A;  4Y15 A;  1KQ8 A;  2JPC A;  3FEC A;  5M3M J;  3VFZ A;  2ZW5 A;  4AIK A;  2GLO A;  2QZ8 A;  2XGC A;  1PUF A;  4X6A J;  1K78 A;  4GFB A;  3LOD A;  4OLL A;  3ZPL A;  1S9H A;  1TT5 B;  4HZF A;  4XLF A;  1P2F A;  5GPA A;  5JFR A;  1S60 A;  1YS6 A;  2H1L A;  1VI0 A;  2JA7 J;  3LSJ A;  2QF7 A;  5KVR A;  5KCM A;  3LSR A;  4E7L A;  6CPA A;  2K27 A;  2V9K A;  3F8N A;  5GAG J;  4A30 A;  1IV8 A;  1TF9 A;  1CQT A;  3CMM A;  2IMO A;  2VQL A;  2LP0 A;  2M4G A;  3HKZ N;  4M9X A;  5JHF A;  1FYM A;  2DJI A;  2EFP A;  1DE4 C;  3F5B A;  3I4N J;  4BD9 A;  5JGF A;  2L3D A;  2JLM A;  3IWW A;  1LCP A;  3MN8 A;  1BR1 A;  3W2W A;  5C44 J;  2G0E A;  2JVH A;  2J9A A;  2V77 A;  3SDG A;  2JJ7 A;  2PR8 A;  4CXF A;  3DQV C;  4CAE A;  2WC2 A;  2H5M A;  2WYR A;  4CGL A;  4Q47 A;  1IXC A;  2EA2 A;  1IRF A;  4UB6 C;  1SFK A;  5L3F A;  2E35 A;  4YGO A;  5EGO A;  3D7H A;  1QHH D;  1S29 A;  3K4M A;  2CQN A;  4IOA F;  3I71 A;  4I0A A;  4UUV A;  2Q4V A;  3LAP A;  1S7L A;  4HEA 2;  4HNY B;  1GVD A;  3D7G A;  5F46 A;  4GYI A;  1ON1 A;  2JBJ A;  1APL C;  1ZYR F;  1HSJ A;  1LKX A;  2Y31 A;  3HUV A;  4G94 A;  4PJL A;  2TCT A;  5A2Q Z;  4UY8 I;  2OOT A;  2IBD A;  2O6G E;  4ZZD A;  1HLV A;  1YIO A;  1DUX C;  1B72 A;  1L0C A;  4UV8 A;  3EXN A;  2QA4 I;  3R9F A;  4MNU A;  2F4M B;  4R1H A;  1CM0 A;  2Z99 A;  4NC8 A;  3X2Q H;  3V8L A;  4Y49 C;  4B6Z A;  1IN6 A;  2PFB A;  1QPM A;  4F91 B;  1LJ9 A;  4EJT A;  2VXD A;  4M72 A;  2AFS A;  3OIQ A;  1JKR C;  2KIS A;  2BYV E;  4G9Y A;  4IHM A;  4DBQ A;  3DEE A;  4UVB A;  1P7J A;  3S3O A;  2DDB A;  1TKJ A;  3CUO A;  1GXQ A;  2M34 A;  4BHP A;  3VSL A;  2BOL A;  1FPQ A;  1B6A A;  1OBR A;  1IN8 A;  3RPU D;  1PUF B;  1OCZ H;  1H8L A;  2QEX I;  4Y4R A;  2QLZ A;  2LMD A;  2EFO A;  2M2E A;  3OL4 A;  4KFC A;  3HRS A;  1XEB A;  3R9G A;  4MBU A;  2Q7S A;  3HPG A;  3G6E I;  4DJL A;  5I0C A;  4G7Z F;  1IOF A;  3HRT A;  2B58 A;  5IV0 A;  4RUH A;  4A31 A;  4A32 A;  2UXN A;  1UST A;  1JJ8 C;  1MIJ A;  3KZZ A;  4JXQ A;  3BJO A;  4G6D A;  3LQQ A;  4P4B A;  2WV0 A;  2Q8K A;  5FRN A;  4FET A;  4UF4 A;  4W97 A;  5E1W A;  3DCF A;  4NC7 A;  2PIY A;  3GFM A;  1X58 A;  2K4J A;  5FJ8 J;  1XSV A;  2P6E A;  1IGN A;  3FXT A;  2G9D A;  2X48 A;  2VZZ A;  2DT5 A;  3WTS C;  2R7U A;  3CDH A;  4A94 A;  2MA3 A;  4OMY A;  1ZK8 A;  1ZR2 A;  2EV5 A;  3BG6 A;  4EJV A;  4BMH A;  1MBF A;  2WY7 Q;  3L2V A;  4ESF A;  5TGT A;  5D29 A;  2POK A;  5FKN A;  3H1C A;  2DAO A;  3WU0 A;  4CCN A;  1JXS A;  1SFO J;  1QQ9 A;  1MJA A;  3LSH A;  4KLW A;  5AG5 A;  1X19 A;  3PFE A;  1BOB A;  4C3J J;  3FMS A;  3CC7 I;  1E2X A;  3IUO A;  3LSI A;  2IGO A;  1MKM A;  3WTZ A;  3LQR A;  3IL2 A;  2VIX A;  2GAU A;  4G12 A;  5IYD J;  4YEL A;  1SC7 A;  3ZZI A;  1ETV A;  3OWT A;  3H0G J;  3PUF A;  2VT2 A;  3QYB A;  2JA5 J;  3DBL B;  1TT0 A;  2JPB A;  2VON A;  5L3D A;  2ZME A;  2QBY A;  5KNL A;  3RKX A;  4G7O F;  1CF7 A;  2BXZ A;  2VKE A;  5ILV A;  2XB0 X;  1Z21 A;  5F04 A;  1AKH A;  1ZRF A;  1XFO A;  1SD4 A;  3R60 A;  2MD0 A;  1I39 A;  2HTJ A;  3I53 A;  2E5Z A;  1BO4 A;  3E5U A;  4BEH B;  1B4A A;  2VZY A;  1W0T A;  4JZ0 A;  3WT4 A;  3NQO A;  1K79 A;  2OF7 A;  4HRI A;  1IF1 A;  4A33 A;  4FWU A;  2EIL H;  2K7L A;  2WZN A;  4P45 A;  3TW7 A;  4OIP F;  1H8A C;  2PJ8 A;  2MGQ A;  3DEU A;  1XBU A;  4F55 A;  3Q0W A;  2EWB A;  2FQ3 A;  2EH3 A;  1EH8 A;  1XSX A;  3TDU C;  2DXQ A;  5JI6 A;  4XR6 A;  5DD4 A;  4AXV A;  1QSO A;  4EVI A;  4DQ2 A;  3P9I A;  3J80 Z;  2VKV A;  4RGS A;  4KUM A;  3IAS 2;  4YRV A;  3C7J A;  3PNV A;  2GXB A;  3RSN A;  4RN7 A;  1FC3 A;  1QZE A;  2B3U A;  2CU7 A;  3AG3 H;  3ZQI A;  4AU7 A;  3KQZ A;  5D4R A;  1FOW A;  4XOT A;  4UIB A;  1TP4 A;  3CP2 A;  4CYO A;  5C4J J;  2O61 A;  1YVO A;  3O2P E;  2ELJ A;  3SDB A;  4EGZ A;  1U78 A;  1TQM A;  3FKJ A;  3D2P A;  1JTY A;  1NK2 P;  3GTP J;  1QU3 A;  3CCU I;  4Y13 A;  1LAN A;  4KOX A;  2STT A;  4RGR A;  4CAW A;  3FH4 A;  1Z7L A;  4ZH4 F;  5FO5 A;  2EV0 A;  3RQI A;  2GLF A;  2X7B A;  3PB9 X;  4CGO A;  5CLS A;  3QOP A;  5FLX K;  4UEZ A;  2A4N A;  2BY0 A;  2VKD A;  4XNF A;  2EZH A;  4FIS A;  3FIW A;  3WTU C;  2E71 A;  4HDU A;  1IW7 F;  3OV8 A;  4NQW B;  3BI0 A;  3HM5 A;  5FRM A;  2QVO A;  2R7H A;  4M3G A;  3EO4 A;  1Z2L A;  2O03 A;  4FAI A;  4H4K C;  3CJR B;  3BC8 A;  5F0F A;  3WGG A;  4II3 A;  4XLN F;  3S2D J;  5ICG A;  4CCK A;  1HDQ A;  3TOA A;  2G7H A;  3CCJ I;  1Z8X A;  2Y0M A;  2PR1 A;  5JPH A;  3T1B A;  2B5G A;  4BQO A;  1K61 A;  4M73 A;  2P6T A;  4D7M A;  4HLY A;  4V19 K;  2IS4 A;  2BHZ A;  4LOC A;  4KUA A;  1CX8 A;  2HU9 A;  1AOY A;  1XJO A;  1M44 A;  3ZMS A;  1O7F A;  1I5Z A;  3HOT A;  2QWW A;  4PDK A;  1WI9 A;  4EEF G;  4PFO A;  1ZG9 A;  2ESH A;  3IWE A;  2WUU A;  3H9G A;  1J0R A;  2IP2 A;  1R00 A;  4P44 A;  2FE3 A;  2ODF A;  2KDZ A;  5HNF A;  4U88 A;  2BCO A;  4LIU A;  1MK4 A;  1Y1W J;  5A2Q K;  2EJR A;  5LRJ A;  2PJ6 A;  3CES A;  1V55 H;  4FUU A;  3CJN A;  1R23 A;  5DS0 A;  3B73 A;  1D5V A;  1ON2 A;  3L00 A;  4MFP A;  3HTS B;  4NSQ A;  4EMS A;  1MMA A;  3GZN B;  3KAS A;  1K83 J;  2CWE A;  2LRE A;  5IYC J;  3OYE A;  2W48 A;  1JKQ C;  5AGE A;  2DK8 A;  4KIT B;  4GXH A;  2Z3N A;  2EIK H;  1VQ9 I;  1XGN A;  2V26 A;  1VQM I;  2BW3 A;  1YW7 A;  3SJE A;  1GDT A;  3GIU A;  4PSX A;  4CGP A;  1Z91 A;  4HST A;  4RAF A;  4RB0 A;  5AON A;  3TP0 A;  2PG4 A;  4PJN A;  5FD6 A;  4NGQ A;  3I4P A;  2KIM A;  3ZRG A;  2VB6 A;  4RI1 A;  3D5L A;  3NAR A;  2XEJ A;  4O6J A;  1I21 A;  4NFR A;  2RNJ A;  4AUX A;  1Q1V A;  5BQT A;  3AAF A;  4MY3 A;  4BHC A;  4ORF A;  4I09 A;  1LEA A;  1J7K A;  3CCS I;  3TBI A;  2OCE A;  2NVU B;  1JWQ A;  1BBY A;  3SZT A;  4E6K G;  3HEF A;  3GZ6 A;  1WJB A;  2M0M A;  3ELK A;  2ZEL A;  3IJ3 A;  4MTE A;  5LYF A;  3SJG A;  2FA5 A;  1ZEL A;  3BR5 A;  3BQZ A;  2XGX A;  2A6E F;  1T38 A;  3K4N A;  4O5V A;  1IOI A;  1HST A;  5IB0 A;  3CCV I;  4NJQ A;  4NJR A;  4U0Y A;  4B5O A;  2KDO A;  2QML A;  4UHT A;  2F5V A;  2H94 A;  2JEW A;  2Z3P A;  2CS3 A;  3QP6 A;  3S15 J;  1U9N A;  3NEU A;  4RM2 A;  2PEX A;  5H20 A;  4F8Z A;  1D8K A;  3VOD A;  2ADU A;  3IHU A;  2W24 A;  1QSM A;  5FVJ A;  5C4X J;  2JDC A;  1MNE A;  2PQ8 A;  3P9K A;  2LOO A;  4LK1 F;  4BJ5 C;  2DA5 A;  3VPR A;  2HYF A;  1G3T A;  4B13 A;  4MFE A;  3W3C A;  2ZXH A;  1Y39 A;  3KHX A;  4C2U A;  1MMN A;  1XS9 A;  3ABU A;  2LKP A;  1NHA A;  1MSE C;  4H6U A;  3TE4 A;  1RZ4 A;  5F64 A;  2CQX A;  2LFB A;  3TL4 X;  3M3Y J;  4U7B A;  3JSP A;  3NFZ A;  1QZY A;  1OKR A;  4YFK F;  1YJ9 I;  3SJF A;  1A6I A;  1EKE A;  4MCP A;  1RXT A;  4A12 A;  1SAU A;  1FT9 A;  1UG2 A;  2CV0 A;  4IUS A;  1R5G A;  4C7H A;  1G6N A;  2W57 A;  3M8J A;  4F92 B;  2NYQ A;  2Y9Y A;  2Z3O A;  4P4E A;  5TJJ A;  1SVO A;  3HXL A;  3MKL A;  1LDK B;  3OWC A;  5BPI A;  1EA3 A;  3K2Z A;  3WHC A;  2QSG X;  4U5Y A;  4CAX A;  1JUP A;  2V9P A;  2O5R A;  2A68 F;  1BIB A;  1UZC A;  2XV4 S;  1FTZ A;  1Y9W A;  3C1D A;  3K0L A;  5CYV A;  3S9M A;  3HB9 A;  3MKW B;  1Z4E A;  3KP4 A;  3PSI A;  1REP C;  3L09 A;  2DO7 A;  2LC2 A;  3E1S A;  1XDS A;  2DK5 A;  3LSG A;  4UEF A;  5FKK A;  2OCC H;  1UFH A;  3R6S A;  3WU2 C;  4JLY A;  1V0C A;  2LBF A;  4L0Y B;  4UEE A;  2H27 A;  5A28 A;  1O3R A;  1MBJ A;  1W4M A;  3IWG A;  5DUK A;  2A69 F;  2M8E A;  2FD5 A;  2PJ1 A;  1XG1 A;  4AIH A;  3RZA A;  4LIT A;  2QSF X;  1LFB A;  3CTA A;  3E6B A;  4A2Z A;  2XF5 A;  1CP6 A;  3OS1 A;  5LGU A;  4NDL A;  4KVX A;  1MMS A;  3PO2 J;  4FD6 A;  4KIF A;  2PRB A;  4DGW B;  4FD5 A;  3D7F A;  2OTL I;  1R6R A;  3IGR A;  2Z10 A;  2ZJQ F; 
#chains in the Genus database with same CATH homology
 4IQJ A;  2OH1 A;  2LRD A;  4CCJ A;  3F9K A;  5JQ4 A;  2DPT A;  2WAD A;  4KLV A;  4LG3 A;  4KOU A;  4F93 B;  1IID A;  4F0Y A;  2GOX B;  3VDX A;  2X1E A;  2J8R A;  4AVC A;  4KSF A;  1WJC A;  3PL8 A;  1NG7 A;  1DGR M;  3K4C A;  4CAV A;  2CNM A;  2JA2 A;  2X85 A;  3OYF A;  4E7J A;  3QB8 A;  2Q1Z B;  4C68 A;  4JXR A;  3DTI A;  3H0D A;  4ZDL A;  1MMG A;  3OOU A;  3L2R A;  2LBF B;  1NE9 A;  2FE7 A;  4YRH A;  1X1D A;  4CH7 A;  1B87 A;  3OYD A;  3OMY A;  4Q36 A;  1Z9U A;  4QUS A;  3DTE A;  2IS2 A;  3DR6 A;  3J7A Y;  1VZ0 A;  4PUS A;  1XMT A;  1YLE A;  2ARH A;  2OC6 A;  5JPH A;  4MFL A;  2Z11 A;  2LY2 A;  3WR7 A;  4B11 A;  2FIA A;  3W6S A;  3D8P A;  1NG6 A;  4KS9 A;  4BQN A;  2VI7 A;  4ZGY B;  2K9L A;  4RLF A;  4AVB A;  5J8C A;  1XF8 A;  2X1D A;  2B5G B;  1WJF A;  4GRI A;  3OYH A;  2V6E A;  3H5N A;  2ZW4 A;  2FIW A;  2VJ4 A;  1GHE A;  2ZFU A;  4PK3 A;  2FT0 A;  5BWA B;  2RC4 A;  4E4H A;  2XF6 A;  2R7O A;  2G0B A;  4C30 A;  4BBH A;  4E8O A;  2PMZ A;  4BXF A;  1V5F A;  1WJA A;  1Z3X A;  2UV1 A;  3RQ4 A;  1N71 A;  4B14 A;  4MFZ A;  4KSA A;  4UWI A;  2R7S A;  3C2G A;  3L2Q A;  3H4Q A;  5EC4 A;  2DOA A;  2R7T A;  3E0K A;  3PJR A;  3L2U A;  3DLA A;  1YK3 A;  3W2V A;  2OZG A;  2HQA A;  4P5O A;  4ZTJ A;  4OWR B;  4G6T B;  2IS1 A;  3DKY A;  4HNU A;  2B4D A;  4KOW A;  4B12 A;  4F6A A;  2V7F A;  5DWN A;  4XLA A;  3OYK A;  3PGP A;  4B3X A;  1M1D A;  2REF A;  3K4K A;  4HSR A;  2G3A A;  5C88 A;  2AQE A;  2XAU A;  5HOO A;  4B10 A;  2MC4 A;  2M3A A;  2Z2S B;  4XKC A;  2GOM A;  2CNS A;  3DU6 A;  1MND A;  1DP3 A;  2MYS A;  4XNH C;  3SZG A;  1LRZ A;  3A1Y A;  1AA7 A;  4R9M A;  4U9Y A;  1FMV A;  2VQH A;  3S6F A;  2UWM A;  4CGM A;  3KX2 A;  4XPL A;  3AL0 C;  3G8W A;  3PSF A;  3DPU A;  3P2H A;  2KRC A;  1FY7 A;  1M4D A;  4XPD C;  4BQQ A;  2VXK A;  4XLH A;  3N7Z A;  4Y33 A;  4C7I A;  1WFX A;  1MMD A;  3PP9 A;  4CS0 B;  1I12 A;  4R87 A;  4YEJ A;  1S7F A;  3B8G A;  2MFZ A;  3K9U A;  2UUZ A;  1DGW Y;  3HC7 A;  4MLO A;  1Y7R A;  2Q44 A;  2E60 A;  3KYL A;  3LSM A;  1WWZ A;  4CUG A;  3CJQ B;  3OR2 C;  3I3G A;  3C26 A;  3EC4 A;  4KOY A;  4B5P B;  2OV7 A;  4P1W A;  3OYN A;  1T95 A;  4BEH A;  4M3S A;  3S3M A;  2LG4 A;  5HVQ C;  1S7K A;  2JSP A;  2J8M A;  5AG4 A;  4CA0 A;  4DIQ A;  4XOP A;  4A95 A;  4C9Y A;  2HZD A;  4MY0 A;  2VXZ A;  2NOJ B;  3MMY B;  2MAB A;  4UFW A;  3U21 A;  1S5K A;  3OYA A;  3L2W A;  5F49 A;  4R57 A;  3SXN A;  4IZZ A;  3UNG C;  4B44 A;  4BDY A;  2BVL A;  3ZGK A;  1M4G A;  2DPS A;  2ZW5 A;  1FMW A;  1IYK A;  3F0A A;  2LY1 A;  2XF7 A;  2W00 A;  1I1D A;  4DNC A;  3BCA A;  2YNC C;  3LOD A;  4OLL A;  4XLE A;  1S9H A;  4BE2 A;  3QYF A;  4XLF A;  1D0Z A;  2CUJ A;  5AG6 A;  5HLT A;  3BCB A;  2ZXI A;  1S60 A;  2KQR A;  2R7Q A;  1YX5 A;  4UCN A;  4C2X A;  1YVK A;  3IU1 A;  1D1A A;  3TCV A;  1XIX A;  5KCM A;  4E7L A;  1Z4R A;  2V9K A;  4EVY A;  1X1A A;  2IGM A;  3TOB A;  2JUG A;  4FD4 A;  3QOD A;  4PJJ A;  5HH1 A;  4A30 A;  5IX3 A;  1TIQ A;  3CMM A;  4HKF A;  2VQL A;  1Q2Y A;  2M4G A;  2VAS A;  3M1C A;  5JHF A;  3H35 A;  1JI8 A;  4KUB A;  2DJI A;  3MKZ A;  2F5I A;  2KMU A;  3F5B A;  5CQE A;  3SYT A;  2JLM A;  3OS2 A;  4MI4 A;  4J00 A;  1BR1 A;  4PJM A;  3W2W A;  1PUA A;  4YFJ A;  2JVH A;  3VYU B;  4C2Z A;  5G20 A;  2PR8 A;  3S6G A;  3DQV C;  4RMN A;  2HPI A;  4JD6 A;  4CAE A;  3H5A A;  2H5M A;  2R8V A;  2X1C A;  4CGL A;  1BR4 A;  4E0A A;  2KP6 A;  1SFK A;  1WJ5 A;  2HNH A;  4YGO A;  4PK4 A;  3EUH C;  1QHH D;  2WAQ A;  3K4M A;  2Q4V A;  1CJW A;  3MKY B;  2R98 A;  2R7V A;  1KON A;  4HEA 2;  1S7L A;  4HNY B;  5F46 A;  3CXS A;  2M7B A;  4ZYA A;  3H5Z A;  5LFA A;  1LKX A;  4AVA A;  2XC7 A;  3DPL C;  4JQF A;  3K4B A;  4PJL A;  1NMT A;  3SHP A;  4QBJ A;  3EFA A;  4LIV A;  2CMP A;  3TMO A;  2PJR A;  1LVK A;  5F47 A;  5CQG A;  1ZO0 A;  3DNS A;  4KJZ A;  1QST A;  1L0C A;  2IGN A;  2ZXV A;  3EXN A;  3R9F A;  4NF1 A;  5H84 A;  3OYG A;  1Q2D A;  1CM0 A;  4RM3 A;  4R3K A;  4XPD B;  4CYN A;  4NC8 A;  4PK2 A;  5ISV A;  3FBN B;  4Y49 C;  1D0X A;  4D9J A;  4R3L A;  3AL0 B;  3HOS A;  3F8K A;  4EAT A;  1Y56 A;  3H9Q A;  2VXD A;  3ZQQ A;  4F91 B;  3OIQ A;  1IB1 E;  4UWJ A;  4UFV A;  4XNH B;  3OIP A;  4DBQ A;  2WA0 A;  2WBM A;  2YNE A;  2CFO A;  3DEE A;  3D3S A;  4U9Z A;  3S3O A;  4XL9 A;  2L9S A;  1MJ9 A;  5H86 A;  2W82 A;  1Y6I A;  4HNT A;  4IQ4 A;  2BOL A;  3VSL A;  2M4K A;  3RPU D;  1UG0 A;  4BU2 A;  2CY2 A;  2P0W A;  3SEQ A;  2ZW6 A;  4Y4R A;  1SQH A;  3OL4 A;  1B6B A;  2OB0 A;  2YGW A;  3JVN A;  3GKR A;  2I8D A;  1XEB A;  3R9G A;  2DXI A;  3H5R A;  4MBU A;  2QEC A;  3HPG A;  5I0C A;  2R7W A;  3FBI B;  2J8N A;  2B58 A;  5IV0 A;  4F3Q A;  4A31 A;  2K9M A;  3G2B A;  4A32 A;  4CAF A;  4XOR A;  4LX9 A;  5HMN A;  5C82 A;  1YX3 A;  3ONQ A;  5FRO A;  2R7R A;  3T9Y A;  2B4B A;  4E7I A;  3T90 A;  3A2K A;  2KCW A;  4JXQ A;  4B5P A;  3OYJ A;  1OR7 C;  2Z1D A;  3DU5 A;  1T0F C;  5FRN A;  3D5S C;  4FET A;  2I00 A;  2REE A;  3FNC A;  2RRE A;  3PZJ A;  4NC7 A;  1YX0 A;  4KOS A;  3EUA A;  4BL0 B;  2VKH A;  2IS6 A;  1QSR A;  3PUB A;  2PDO A;  3CZ6 A;  4RLQ A;  4KOV A;  3K4L A;  2P6E A;  1KZF A;  4CCL A;  2QIR A;  3VYT B;  3FXT A;  3R96 A;  3E0J B;  3RCO A;  2VZZ A;  2IXS A;  1Y9K A;  2A5W A;  4MJ8 A;  2FCK A;  2R7U A;  4PFP A;  3VSK A;  2AQF A;  4CYP A;  5A27 A;  2B3V A;  3NWS A;  3LSK A;  1N75 A;  3BG6 A;  4BMH A;  3DKX A;  4F52 A;  2WY7 Q;  3L2V A;  5J8F A;  4MFQ A;  2R7X A;  2HVR A;  1LFP A;  5TGT A;  3V42 A;  2E1M C;  4UCP A;  3VYS B;  2CV1 A;  3PFY A;  4DJA A;  4H6Z A;  1PYV A;  4CCN A;  3BJ7 A;  1K4J A;  4LUA A;  2HVQ A;  3LSH A;  1MJA A;  4KLW A;  4KOR A;  5AG5 A;  4E7K A;  1X19 A;  1K6Y A;  1BOB A;  2R4G A;  1Z3Y A;  3IUO A;  1V5G A;  4NXY A;  3LSI A;  2IGO A;  3VYR B;  5E96 A;  2BUE A;  4DOZ A;  2Z3L A;  5DWM A;  2VIX A;  2VL8 A;  4YEL A;  4R79 A;  3QYB A;  3OWT A;  4MHD A;  4XPK A;  3V8I A;  5G1Z A;  3ZZI A;  1TT0 A;  5KNL A;  3HUG B;  2I79 A;  5AG7 A;  1KUV A;  1Z21 A;  2FUG 2;  4DBR A;  4AYB A;  3IP4 B;  1KUY A;  2MD0 A;  1WJE A;  4IKF A;  2HQY A;  2BL1 A;  1MW7 A;  2E5Z A;  1BO4 A;  3HKZ A;  4BEH B;  2VZY A;  4ZBG A;  3NWT A;  2VPL A;  4HRI A;  3TFY A;  1GLN A;  4ZDO A;  4A33 A;  2OUM A;  2JEV A;  2Q0Y A;  2HUZ A;  4BJT A;  5F48 A;  3RYO A;  3LD2 A;  4F55 A;  4J3G A;  3TOA A;  2KZV A;  3QYE A;  1IYL A;  3DDD A;  2WPW A;  3FBU A;  4II2 A;  5G22 A;  4BDZ A;  2DXQ A;  3P2F A;  1D1B A;  4XR6 A;  2RQQ A;  3EPZ A;  1QSO A;  3GYA A;  3TO6 A;  4E7S A;  2E5N A;  3IAS 2;  3AFH A;  3PNV A;  4YRV A;  4BE0 A;  2D4O A;  3RSN A;  3DTK A;  3C2H A;  2R1I A;  3FRM A;  4OAD A;  4ANJ A;  3W6X A;  1X4P A;  2L7K A;  2B3U A;  4Y49 B;  1M4I A;  2W1O A;  4HPQ A;  4AU7 A;  3GY9 A;  4XOT A;  1VKC A;  2FL4 A;  3CF2 A;  3S3N A;  3TTH A;  2WB1 A;  3ZJ0 A;  3CP2 A;  4CYO A;  4CRY B;  2DCE A;  3ZXS A;  2ELJ A;  3SDB A;  4BGD A;  1N78 A;  3FKJ A;  1ON0 A;  2X6X A;  3PNY A;  3D2P A;  4CCO A;  2Z3M A;  1QU3 A;  2B4D B;  3CP8 A;  1E0E A;  4KOX A;  4CAW A;  1Z7L A;  3SXO A;  4CRZ B;  2X7B A;  4CGO A;  3BJ8 A;  3R9E A;  2IGK A;  1P0H A;  2VKD A;  2A4N A;  4XNF A;  2AJ6 A;  4HNW B;  2VBQ A;  1X4O A;  2M7A A;  4NQW B;  2VQY A;  5HNH A;  5FRM A;  2R7H A;  3EO4 A;  2CXA A;  3NE7 A;  3S93 A;  2PJR B;  2G3T A;  4H4K C;  3FYN A;  4UFX A;  3W91 A;  2BVM A;  3BC8 A;  3CJR B;  4N4O B;  4N4N B;  4XMY A;  5LD2 C;  1XE4 A;  4II3 A;  4NCZ A;  2CV2 A;  2ZPA A;  2YND A;  2ZSI B;  3K70 C;  2OU2 A;  3PNT A;  4CCK A;  3S8P A;  2PR1 A;  4D1Q A;  3OYC A;  2Y0M A;  2L5Q A;  2V1N A;  3BLY A;  2B5G A;  3LL7 A;  1YRE A;  4BQO A;  4K30 A;  4NEX A;  3QOE A;  4F0X A;  2WY8 Q;  4XM3 A;  3D5R C;  2XDV A;  4QC6 A;  2IS4 A;  4PV6 A;  4KUA A;  1U0J A;  2VJ5 A;  2HU9 A;  1J4J A;  1YR0 A;  2X6W A;  1M44 A;  3A4C A;  1VHS A;  4JJX A;  2VJI A;  3HOT A;  2EVN A;  1P4N A;  1PJR A;  3KEY A;  4KT6 A;  4PFO A;  2CUZ A;  4XKW A;  4KIS A;  2GE3 A;  3H9G A;  2PSW A;  2WUU A;  2YNC A;  3IWE A;  2L9N A;  4E7H A;  4NUB A;  1PU9 A;  3DPT A;  3TT2 A;  4QPQ A;  1U6M A;  5HNF A;  4FAS D;  1R57 A;  3S6H A;  2DT7 B;  4LIU A;  3IAM 2;  3VWB A;  1MK4 A;  1X1B A;  4B43 A;  3TO9 A;  4PSW A;  4RS2 A;  2QKL B;  2HPM A;  2VQG A;  4QVT A;  3CES A;  3UR3 C;  1MJB A;  4C2Y A;  4IF5 A;  1KUX A;  3K4J A;  2KPM A;  2LYC A;  2D4P A;  5CKT A;  2CW8 A;  2CNT A;  1OLT A;  4MFP A;  4NSQ A;  4CCM A;  3UY5 A;  1MMA A;  2Z0Z A;  3MGD A;  2LRE A;  3EUK L;  2K5T A;  3OYE A;  4B48 A;  3I9S A;  2C27 A;  3A9L A;  5AGE A;  2VLA A;  4OAY A;  4KIT B;  2W7N A;  3QAH A;  2Z3N A;  1QSN A;  5KTA A;  4E7Z A;  4H89 A;  2V26 A;  2ZW7 A;  2FS5 A;  2P6G A;  2BW3 A;  1D1C A;  2JVG A;  4ZTF A;  2O28 A;  4M85 A;  3RTR A;  4II9 A;  3H9J A;  4PSX A;  3LMM A;  4QPO A;  3W2A A;  3VWD A;  4CGP A;  2ATR A;  3K6G A;  4HST A;  1J09 A;  2GAN A;  5CNP A;  2K3P A;  1P9Q C;  4HG2 A;  4PJN A;  4CZC A;  1Q2C A;  2X6Y A;  3ZRG A;  3N05 A;  3VWE A;  1X1C A;  2VB6 A;  3SEZ A;  3D5L A;  3JTK A;  4RI1 A;  3D2M A;  1I21 A;  1WJD A;  3EY5 A;  2P6F A;  2OZH A;  4MY3 A;  1YVO A;  4ORF A;  1QHG A;  4JWP A;  4MFJ A;  3TBI A;  4MFK A;  3JUW A;  1UAA A;  4E6K G;  3G3S A;  1WJB A;  2M0M A;  4XKB A;  3CXP A;  2Q04 A;  1ZEL A;  4KVO E;  4AB7 A;  3ZCO A;  2F6C A;  2CW7 A;  3K4N A;  1S3Z A;  2EUI A;  2JDD A;  4X5K A;  1V5E A;  2FXF A;  4L8A A;  4ONU A;  5IB0 A;  4KZT A;  1IIC A;  4B5O A;  2Y0S A;  3OYM A;  4ZC3 A;  2KDO A;  2VJJ A;  3LFU A;  4XN0 A;  4BUP A;  2F5V A;  2QML A;  2Z3P A;  1W36 C;  2CS3 A;  2KHM A;  2Q4Y A;  2W4S A;  4RM2 A;  5CPR B;  1QSM A;  3ZR8 X;  4JOM A;  3BLN A;  5FVJ A;  2JDC A;  1MNE A;  2KL4 A;  2LH9 A;  2LOO A;  2PQ8 A;  4BJ5 C;  5EBV A;  2L2O A;  2IL4 A;  3CXQ A;  2Q2E B;  4UBR A;  3FHN A;  3MD2 A;  4B13 A;  4Y3O A;  3W3C A;  2E1M B;  1S7N A;  2ZXH A;  4FD7 A;  1TZL A;  4C2U A;  1MMN A;  2AE6 A;  1G59 A;  4H6U A;  4UCM A;  4CSW A;  1OZP A;  2PC1 A;  2WAF A;  4GS4 A;  3TE4 A;  4XLC A;  4HNX B;  4ITV A;  1W36 D;  4BS9 A;  1NSL A;  3TL4 X;  2KRH A;  4ZJZ A;  4U7B A;  3OR1 C;  1HA8 A;  4NNJ A;  2BEI A;  2OZU A;  2VQC A;  1UEL B;  4B47 A;  1YGH A;  4QB9 A;  1YE9 A;  1RXT A;  4AG9 A;  1SAU A;  2CV0 A;  3DSB A;  4IUS A;  4C7H A;  4XQF A;  3OYB A;  3KKW A;  3R95 A;  3M8J A;  4F92 B;  2Z3O A;  3HL2 A;  3DR8 A;  2DT6 A;  2V4J C;  3HXL A;  1DQU A;  1LDK B;  4X0G A;  2A6T A;  1RO5 A;  3OWC A;  2VEZ A;  4OAZ A;  3OYI A;  1EA3 A;  2Q7B A;  4U5Y A;  4CAX A;  2KLO A;  2XSJ C;  3FDY A;  4KVM E;  2O5R A;  4I49 A;  3HPH A;  4CGN A;  2WPX A;  1Y9W A;  2X51 A;  4BAC A;  1D0Y A;  4KOT A;  3GBG A;  3MKW B;  1Z4E A;  2RNG A;  3K10 A;  3DWL E;  2BSW A;  3PSI A;  2HV2 A;  4BJ6 C;  2WSA A;  5GCN A;  4U87 A;  2LC2 A;  3E1S A;  4L89 A;  4UA3 A;  3LSG A;  1G8X A;  3OYL A;  4CYQ A;  5KTD A;  1UFH A;  1ERD A;  4IX7 A;  4BE1 A;  3IU2 A;  4JLY A;  4ZDP A;  1V0C A;  2LBF A;  3OL3 A;  5A28 A;  3IWG A;  2NMT A;  4E2A A;  3BG7 A;  4XKV A;  5KTC A;  3R1K A;  2Z3K A;  4XON A;  2FSR A;  2QKM B;  3HG9 A;  4Q38 A;  2HDW A;  3AKZ A;  3K70 D;  2F4I A;  3I9V 2;  4J01 A;  3OY9 A;  3FIX A;  4OAE A;  2CH0 A;  3I3L A;  4LIT A;  4AVZ A;  3OS0 A;  1N77 A;  2BW3 B;  2HVS A;  5G21 A;  4AG7 A;  1WK4 A;  2GIV A;  4A2Z A;  2K5C A;  2XF5 A;  5KHD A;  3OS1 A;  4KVX A;  3TO7 A;  2WAE A;  4FD6 A;  1IRX A;  2PRB A;  4DGW B;  3S32 A;  2ZSH B;  4FD5 A;  3FB3 A;  3IGR A;  1R6R A;  4C2T A;  2Z10 A;  1BR2 A;  3S6K A;  4XN3 A;  2Z16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...