2P0WA

Human histone acetyltransferase 1 (hat1)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
319
structure length
319
Chain Sequence
AEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Histone acetyltransferase type B catalytic subunit
publication title The crystal structure of human histone acetyltransferase 1 (HAT1) in complex with acetylcoenzyme A and histone peptide H4
rcsb
source organism Homo sapiens
total genus 93
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2p0wA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2p0wA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 2p0wA01
4L8AA 4MI4A 4MHDA 3V8IA 2RC4A 4XPKA 4JLYA 1SQHA 3R1KA 5HH1A 2D4OA 2REFA 2WPXA 3D3SA 1Z4RA 4NCZA 1I21A 2BSWA 1I12A 1CJWA 4CS0B 4ORFA 3FBUA 3DR6A 2P6FA 4PSXA 2Q44A 4EVYA 1KUXA 2J8MA 2AE6A 2H5MA 2ARHA 4R87A 1IYKA 2EUIA 2ZW7A 2DXQA 3EFAA 2PC1A 2FIWA 5F48A 4U9ZA 1NMTA 3R96A 4I49A 4OLLA 4AB7A 5GCNA 2KCWA 2Y0MA 2GE3A 4UA3A 1L0CA 2B4DB 4KOYA 5DWMA 1VHSA 4HNYB 3T9YA 3CXSA 2AJ6A 3GY9A 4ZBGA 4UWIA 1UFHA 4KVOE 2Q7BA 2K5TA 2FXFA 3FXTA 1QSMA 3DSBA 4XPDB 4M85A 3W91A 3ZZIA 2BL1A 4CAXA 3BJ8A 4K30A 4L89A 5ISVA 2B3UA 2HUZA 4R9MA 1QSNA 3K9UA 4B5PA 3DR8A 1YR0A 2JDCA 4H89A 2ATRA 3F0AA 2QMLA 2OZHA 4F0YA 1MJBA 1Y9WA 1S3ZA 3SXOA 2OB0A 4HKFA 2VXKA 3MGDA 3TTHA 3I3GA 2Q4YA 3TOAA 4LUAA 1YX0A 4XNHB 4KORA 2R8VA 3ZJ0A 3F5BA 3TO7A 2IL4A 4E8OA 3PGPA 4JD6A 4KOWA 4NXYA 4X5KA 4MY0A 4HNWB 1FY7A 2G3TA 3I9SA 3IWGA 4UWJA 2OZGA 1IYLA 2VZZA 4CAWA 5JQ4A 3P2FA 3D2MA 1KZFA 2PDOA 4MJ8A 4FD6A 5FVJA 2PRBA 3G8WA 5KTCA 2QIRA 2Q0YA 3IGRA 2FCKA 2OH1A 1M4GA 4Y49B 4PSWA 5IV0A 2VZYA 4FD4A 2JLMA 4MY3A 1B6BA 4RI1A 2D4PA 1OZPA 1XMTA 1VKCA 1YVOA 4NF1A 3NE7A 4NSQA 2VEZA 2C27A 5F49A 2X7BA 4KOVA 2GANA 4JXQA 3VWDA 3FYNA 3OWCA 1ON0A 2B58A 4CRZB 2G3AA 4YGOA 3VWEA 4XPDC 4H6UA 3KKWA 2R98A 3GYAA 5DWNA 3DDDA 1QSRA 2B4BA 5E96A 3D2PA 4U5YA 2Z11A 1XE4A 4CAVA 3EY5A 1WK4A 1BO4A 1KUVA 2B5GB 1V0CA 1RO5A 3EO4A 1CM0A 2A4NA 1P0HA 1S7KA 3E0KA 1M44A 3QB8A 3TCVA 4ONUA 2Z0ZA 1PUAA 2VQYA 4CRYB 2F5IA 4JXRA 4UBRA 2J8NA 4XNHC 5EC4A 2NMTA 2Z10A 4AVBA 4DNCA 4II9A 1M1DA 1IICA 2FT0A 2I00A 3F8KA 3LODA 2QECA 1Y9KA 1WWZA 1NE9A 4QB9A 4YRHA 1XF8A 3P2HA 2B4DA 1J4JA 4KUBA 2OZUA 1U6MA 4MBUA 5KTDA 2ZW4A 5EBVA 3TE4A 4PK2A 2O28A 2FL4A 1BOBA 4AVAA 1Q2YA 5CNPA 4Y49C 4F6AA 5HMNA 3JUWA 3N7ZA 1MK4A 4R57A 1P4NA 2R1IA 1M4IA 1YVKA 3PP9A 5C82A 1S7LA 3EXNA 3SXNA 2FSRA 3TO6A 3TOBA 1MJ9A 3T90A 4KLWA 2G0BA 4HNXB 3SHPA 2I79A 2BEIA 4YFJA 1QSTA 2JDDA 4KOUA 2B3VA 1N71A 1XEBA 2PSWA 4RS2A 4AVCA 3D8PA 1RXTA 2CNTA 4AG7A 2ZW6A 3JVNA 1Q2DA 4QBJA 2JEVA 1Q2CA 4KLVA 4IUSA 1S60A 1S7FA 4KZTA 1MJAA 4U9YA 3FRMA 1NSLA 2WPWA 4E2AA 2Q04A 1TIQA 4M3SA 3CXQA 3GKRA 5H86A 2EVNA 3LD2A 1XIXA 4NEXA 4R3LA 3S6KA 4B5PB 3FNCA 3FIXA 2PQ8A 3RYOA 3H4QA 4E0AA 3S6GA 2PR8A 4R3KA 5C88A 3EC4A 5JPHA 2OU2A 1YGHA 3S6FA 4PV6A 3B8GA 4H6ZA 1YLEA 3R9FA 3C26A 2Q4VA 4AG9A 3QAHA 4FD5A 3FB3A 2FS5A 2VI7A 5J8FA 3R95A 2GIVA 1GHEA 1Y7RA 4JWPA 3PZJA 5H84A 4KOXA 4KOTA 3W6XA 1R57A 1Z4EA 4OADA 4LX9A 3R9GA 1I1DA 3DNSA 1IIDA 1Z9UA 3TO9A 2CNMA 3R9EA 3BLNA 4XPLA 2FIAA 5KTAA 4KVXA 2ZPAA 4J3GA 4QUSA 4OAEA 5J8CA 5F46A 5IB0A 4KUAA 1B87A 4B5OA 5I0CA 5IX3A 1YK3A 2P6GA 4QVTA 1S5KA 1S7NA 3UY5A 3TFYA 2CY2A 1K4JA 4IF5A 2ZW5A 2VBQA 4GS4A 4PK3A 2HV2A 1M4DA 2P6EA 2B5GA 2HQYA 3G3SA 3BJ7A 4QC6A 2P0WA 1PU9A 1YREA 5F47A 4KOSA 3WR7A 2FE7A 1LRZA 2PR1A 2REEA 3TT2A 1KUYA 2J8RA 2BUEA 1IB1E 4KVME 4FD7A 3S6HA 3CXPA 2R7HA 4JJXA 4BMHA 3W6SA 1QSOA 2CNSA 2ZXVA
chains in the Genus database with same CATH superfamily
5LYDA 1LDDA 1FSEA 3DQVC 4IQ4A 3S2HJ 2RC4A 1Y56A 3ZN1A 1R9TJ 1PUFB 1I6HJ 3BHXA 3LWFA 4RMNA 2JRMA 2L3DA 3BR6A 4PJLA 3CMMA 1O3RA 1RESA 5CPRB 2KT0A 4BQOA 1MW7A 2Q1ZB 3P7NA 3CDIA 2K3FA 3D3SA 3PUBA 5HS8A 4EEFG 1M1EB 4GRIA 2ZEEA 3CC2I 2CF4A 2DJIA 3GO5A 1CJWA 2Y0SN 2P5KA 1OYIA 2ZKZA 3SXYA 3HYIA 3DR6A 2B0LA 2CQQA 3GFIA 2X4HA 2HVSA 4G9YA 2DMNA 1XFOA 3HUGB 1IAWA 3CCRI 3IHUA 3DTKA 1I1SA 2IQ6A 4R76A 1HA8A 1SC7A 1PYTB 1YMEA 3T8WA 3PB8X 4M3EA 1D8JA 2XAFA 2DOAA 3D1NI 4BH9A 2ARHA 2MGQA 5KCMA 4IZZA 4J00A 4XLEA 2V79A 3EFAA 2EV0A 3IKVA 1OCTC 5THWA 2XGEA 1AOYA 5ERIA 1U3EM 2IS1A 2DA1A 2WSAA 5EYRA 3NWSA 5FFXA 3H5ZA 4OLLA 4JYKA 4UV9A 4EM1A 3SZTA 2KCWA 2WV1A 3LSIA 2K85A 2L7KA 4S05A 3A4CA 1L0CA 4P10A 5E1ZB 4KMFA 4PFPA 4A69C 5D5UB 3OYCA 2QEXI 2XC7A 2F7VA 4PPZA 5J6XA 4HNYB 2KJCA 1JHHA 2BXYA 2O4HA 1WI9A 4CGZA 3IO1A 2F5CA 5HVQC 1PUFA 1IN6A 3WHCA 4FQGA 2UZKA 3W2VA 4KVOE 3S3NA 2IBDA 2CV0A 2Y48A 1MMNA 2V8GA 2MH2A 3FXTA 2OC6A 2QENA 2V1XA 2V6CA 4M6XA 2HR3A 2JA2A 4KN7X 3ZP5A 1GVJA 2CRGA 5ICGA 1IUYA 5LRRA 1RI7A 1TWCJ 2JA6J 5LGTA 2HGCA 2B7EA 5DCMB 3JSPA 1B72A 4CAXA 4IQJA 5ICEA 2NRAC 3A1YA 3FXMA 2PJ0A 3BJ8A 3V8LA 5ISVA 4ZZLA 2B3UA 4IRIA 2HUZA 2KFDA 2XAJA 3KYDB 3DR8A 2CV2A 1IXRC 3VYUB 2DN0A 1OQYA 3A2KA 3AL0C 1VQ8I 2DFHA 4LOCA 9ANTA 2ZOGA 4C2XA 3LOCA 4UHTA 1NK2P 3WTVC 2R7VA 3PSIA 3QU3A 3K2ZA 3HPGA 1FTTA 4P6YA 4HQEA 3D66A 1G3YA 2O8KA 3VEPA 3SXOA 2VODA 4NJQA 2JT1A 4L5IA 4BJ5C 1DU6A 2DA4A 2FQ4A 1BIAA 2PJ3A 4ESFA 5KHDA 1U8BA 3MGDA 3MEXA 3L2VA 2K9NA 2XKOA 4YFKF 1AYEA 1Z5RA 2Q4YA 3Q9VA 1YW6A 4M6GA 1OBRA 3CD6I 2AO9A 5DYMA 1K4SA 3ZPLA 1XD7A 3EYYA 3PBEA 4RB1A 3DWLE 2IL4A 1QBJA 2V26A 2VXDA 3GBGA 4NXYA 3K1PA 2C6YA 4X5KA 2OZ6A 3PFIA 2JWTA 2WA0A 2WV0A 1LB2A 4MY0A 2WWYA 2AFWA 5CVUA 4DYRA 5JH9A 3ISZA 2JEWA 2PJCA 3VFZA 1MKMA 3QOEA 2VOOA 3IWGA 5HDNA 2G7HA 2HPIA 3OIPA 2OZGA 1IYLA 5DCMA 5HLHA 4PXBA 2JJ7A 4BD9A 1E0EA 4HA8A 3HGYA 4RS8A 1OCRH 3W2WA 1KZFA 3JRHA 2PDOA 4CHUA 2FJ1A 2W85A 4FD6A 5FVJA 1MMDA 2VB6A 2VBYA 5E20A 1MBKA 5KTCA 3C3WA 3IGRA 1B9MA 4CCOA 4M9XA 5F04A 1M4GA 3PL8A 2QVOA 1FYLA 1R5ID 3E97A 1TWFJ 5D5VB 3IU2A 3NH4A 2JUGA 4UIAA 2Z3NA 4XSXF 3HOXJ 4BXXJ 3CJQB 2NVQJ 2EINH 2D4PA 1BBYA 3S32A 4XKWA 5LBQA 2YS9A 2DMTA 2VN2A 2PJ8A 4QIWN 1MSEC 5FLXK 4FWUA 3IRQA 4U0VA 3QNVA 2QKMB 4FASD 5C3EJ 4CYDA 1MNEA 2XSJC 2C6PA 4NSQA 4F7ZA 2MLGA 1EH8A 2YX4A 4YWYA 1T8IA 2X7BA 1S7EA 1N78A 2RN7A 2BHYA 2Y30A 4II2A 1UFMA 5CKTA 3OWCA 3RAMA 3VWDA 3S1NJ 4FBEA 4HF1A 1BIBA 3AG4H 4RB0A 2FVGA 2G3AA 3H9QA 1OKRA 5HDKA 1TWAJ 5K7HA 1FJLA 4A3MJ 4F0XA 2QQ9A 2R98A 3HOSA 1GHCA 2QYVA 1V3FA 2JSPA 1X4PA 4M74A 1QSRA 4UV8A 1OYYA 5EZHA 3LSKA 2OPTA 1TW2A 2VE9A 4Y13A 4OIRF 3QAYA 2LF8A 2Z3YA 1ZTRA 2V8VA 1QZZA 2O5RA 3H0DA 2CMPA 1NG7A 1MMGA 2VASA 4C9YA 2G0EA 2W00A 1ZG9A 2RV8A 2HXOA 3KZIC 1WRJA 1V0CA 1T38A 3F9KA 2HTSA 1CM0A 2NYQA 3CCUI 1A04A 2I10A 2IGKA 5M5WJ 4EWTA 4PK4A 5DM7F 2MFZA 2LKXA 4UVBA 1X3ZB 3OYBA 3LAPA 4G7ZF 3K4JA 4KUMA 3F72A 5A27A 4F92B 5FKNA 5LEKA 3CJTB 2ZXWH 3BJ6A 1PUAA 4NNJA 2ISYA 5J4VA 3KEQA 4YG2F 1RETA 2EFQA 4XONA 5FKLA 4BE1A 2EZIA 3IH4A 5FO5A 4II9A 2A69F 4IPAA 3ZQ7A 5K5QA 4UFWA 3F8KA 2ECCA 3J7YJ 4MLOA 1ONVA 2VKVA 3S1QJ 3U9GA 1WQ2A 1U78A 3LQQA 3JRUA 4ONWA 1Y1VJ 4NGTA 1WWZA 4RAZA 4B4CA 3MN8A 5FLXZ 2M4GA 3KP3A 3CDHA 4DZPA 5IT9K 4IK2A 2B4DA 4X3RA 4M72A 3IC7A 1H9TA 2BVMA 4KUBA 2UWMA 4B14A 1S7AA 3K4LA 4A37A 1ZO0A 1D8KA 4MBUA 1ZLKA 3FXOA 5KTDA 2E5NA 3HRSA 4BS9A 3D67A 3OIQA 2TRTA 4HEA2 2VKHA 3BPVA 1YRNB 2KISA 3FXUA 3V4GA 4PK2A 2E35A 2O28A 2YNCC 3R0JA 2FL4A 3ZQGA 2BVLA 4M6IA 2AFUA 4LLGF 1YS6A 1Q2YA 3KE2A 3CT9A 1NTCA 5CNPA 4KIGA 3V7SA 3WHBA 1XMKA 4KIFA 2Q7SA 4B09A 3JR9A 2IVMA 1EE3P 3N7ZA 1LFBA 3ROUA 2FU4A 4R57A 2P6SA 1MBGA 1WJ5A 2B9SA 2FMYA 4A38A 4XOPA 3S3MA 1Z7LA 1DU0A 1W4MA 1YVKA 1LJ9A 4IHYA 4Q7AA 4PXCA 4DUKA 3DU5A 3PP9A 1S7LA 3SXNA 4YIFA 3NARA 1IU8A 3JRGA 4H4KC 3TO6A 3PFYA 2KP6A 2XHKA 5ICCA 1MJ9A 4CUGA 1RTQA 3FEDA 1IRXA 4DGWB 3PQKA 3ZQIA 2DMPA 4WXHA 4XLFA 2VC1A 3PNVA 4KLWA 1USSA 5EGOB 2G0BA 2GA1A 1VQNI 3I4PA 1X4OA 1ARLA 1VF9A 2I79A 4C2TA 1OJLA 3KLOA 2ECBA 5EEAA 2L9NA 4I2OA 1JQGA 2DK5A 2I3CA 2HYFA 2PJAA 2ETHA 5LYLA 1X10A 2PSWA 5DTDA 4X2TA 1I3AA 2ANPA 3CMYA 4XQFA 1Y0UA 1S29A 1Q2DA 2VL8A 2JEVA 4P4BA 5CVVA 5HVHA 5HLTA 4FCYA 2VUMJ 2W1OA 5CVRA 4U9YA 3LQRA 5EG0B 3VPRA 4MIMA 3KQZA 3J81Z 4EFDA 2ZSIB 1XPXA 5HVFA 2XB0X 4HPSA 3GUDA 3GKRA 1BW6A 5TISC 4HAMA 3BCAA 2NSMA 5H86A 1X3UA 2C6GA 3HM5A 1XSDA 3CO6C 3MKLA 3BTLA 2EVNA 1XIXA 3LD2A 4R3LA 3GFLA 3S6KA 3B3TA 4MQ9F 3K70D 3FNCA 1W36D 3BR2A 2QZ8A 3S6GA 1K83J 1TQMA 2HQNA 3EUHA 4U0YA 3PB7X 2E60A 3K4BA 2ZMEB 3PUFA 3ZMSA 3D7DA 2OCCH 1IV8A 2W48A 1OCOH 3T5XA 4DBRA 2O7OA 3EC4A 2DA3A 2IJZA 3IIBA 3F6VA 3W3CA 5BS6A 1X19A 5BOXA 5IP6A 2XGCA 4CGMA 1REPC 1PP7U 5E3MA 2XB5A 4FTHA 3L2RA 2IJLA 1VQPI 2I5UA 4PV6A 4YFXF 1VQ7I 2JTVA 1I6XA 2F5EA 2BW3B 4AUXA 3H8EA 2ADUA 3R9FA 5L3CA 3F22A 2DODA 4PGHA 1PCAA 1TLHB 2Q4VA 3IEHA 4AG9A 2AFSA 1LE8B 2R5ZA 2KKOA 2COBA 3ZXSA 3M8FA 4H0EA 3RZAA 1YOVB 3FHZA 2YGWA 1GHEA 2W4SA 1MMSA 4OIDA 1ARMA 3MZYA 1P4XA 3O3KA 3RKQA 2QVPA 1ETOA 4JWPA 2XUBA 3IP4B 4J19A 2L4AA 1T56A 5H84A 4KOTA 2K7LA 2F6CA 2HQ5A 3FWEA 2HI3A 4BKXA 1WJCA 4KT5C 1H8AC 5TGTA 4UB6C 2R92J 1UMQA 1Z4EA 1FEXA 2ZFUA 5G20A 2ACJA 3WE3A 5EG0A 1TXRA 3MZ8A 4HF0A 2H94A 2PIYA 4LX9A 1YG2A 2OCEA 4XR6A 2X6OA 4A32A 4Q36A 5EEGA 1ZG5A 4F9VA 4IF4A 3H8FA 2XAGA 5IPAA 1IIDA 2Z1DA 1BI3A 5LYFA 3FK6A 5JR3A 1XMAA 2IW5A 2FIAA 2K02A 4BAYA 3LMSA 3EUHC 3LL7A 4EJWA 1D5YA 4KVXA 1J75A 5KTAA 4BACA 4OAEA 2BY1A 4ZH4F 4XICA 5IB0A 3S1MJ 5B1AH 2BY0A 4TNUA 3MKZA 3EUAA 2VQGA 4NDLA 1EA3A 2GBYA 3KZZA 3SQNA 3RKYA 1WZ2A 2ABZA 3GIUA 4I6ZA 5IX3A 2Q4ZA 3TP0A 1YX3A 4OAYA 4B3AA 3MKYB 4W1UA 3ZQQA 4E7LA 3SI2A 3TFYA 1U6GA 3CCYA 4L0YB 3VH9A 4JP0A 4L9NA 4G6QA 4FHTA 4P96A 3IWFA 4FX0A 1RRJA 2DDBA 3BT9A 2EH3A 3CLOA 5KVRA 2F2EA 3FMQA 2ME6A 2QWWA 1W7PD 1T0FA 4XKCA 4I76A 5KNLA 5D29A 4LIUA 1O3SA 7CPAA 2B5GA 4A94A 4D5FA 3H3ZA 1ORKA 1KYZA 2A3SA 1LE8A 4RUHA 2FE3A 3ECHA 3OR1C 3G3SA 1IY7A 2EK9A 4JX4A 3BJ7A 1MIJA 4QC6A 1WFXA 1J5YA 1P92A 2Y75A 2FMLA 4XLNF 3IU1A 5LD2C 2KIMA 4NJRA 2CUJA 5DS9A 5HDGA 4PCQA 4KSFA 2NVUB 2QBYB 2PR1A 4KISA 1J0RA 3KYCB 5KK1A 5JHUA 1IG7A 2BUEA 2CU7A 2EFOA 3H5RA 5FGMA 5JI6A 2ZXVA 4L8AA 3FBIB 4MHDA 3PB4X 3FF5A 4P44A 4FAIA 5FJ8J 4S04A 2E19A 1S72I 4HNUA 2OUMA 4JX6A 1Z8LA 1W5CC 1FYMA 3R1KA 3OYMA 5HH1A 4UCNA 2D4OA 2E1MB 2WPXA 2BGCA 4P5OA 1TT0A 4CYCB 1R5GA 1QQIA 3B6AA 4B6ZA 3G1LA 2VL1A 3UR3C 1F4KA 3CO7C 4XN0A 3V8JA 1I21A 1WWXA 5HNHA 4KT6A 2BSWA 3WTTC 5D5XB 2NNYA 1WPKA 4CS0B 4F93B 3OYKA 1OFCX 3OYJA 2VKDA 4D5CA 3WTWC 3CF5F 2WYRA 1IN4A 3SHFA 1XCVA 1IOIA 1TC3C 5EF6A 2KMUA 3GW2A 3F23A 4Q5SF 2QGUA 3CF2A 4I0AA 4E7HA 2Q44A 4M3GA 1GDTA 3BI0A 2J8MA 4C68A 4EVYA 3B7IA 1KU3A 2K40A 2IA2A 3LSJA 4X6AJ 2MSYA 2H5MA 2EWBA 4NB5A 2EPFA 3I0TA 4R87A 1LKXA 2POKA 2R7UA 1HXDA 3A01B 1OISA 3CMEI 4MEXF 2HYJA 1JUMA 3E5XA 5JLWA 4CZZA 5F48A 2MD5A 3F3XA 3JW4A 3OIOA 3R96A 4I49A 3GZ5A 3ML6A 3TMOA 2P81A 1MBHA 4AB7A 4LG3A 5GCNA 2XGXA 1JHFA 5IYCJ 2DCEA 1R7JA 3HKZN 4E7KA 1Z6RA 3GLJA 3OOPA 3IWZA 3WTYC 1ULYA 2EK5A 2X1EA 1DGWY 3KEYA 3A0HC 1VHSA 5DWMA 3ZQFA 3KR4A 3DEEA 4BEHA 1YJWI 3U21A 1JGSA 3DPLC 4MFZA 3GTMJ 3CXSA 2VIXA 3GY9A 2JVGA 1OMIA 4ZBGA 4UWIA 5D6EA 5JVGF 3CESA 3F0CA 2GWRA 3JCUC 2FXFA 1KU7A 4ZJZA 4DOZA 3WC5A 4HOBA 4BHCA 4BL0B 3LSPA 1NG6A 1QSMA 1E3HA 2NNNA 3K4CA 1F57A 2QUFA 2M3AA 1DP7P 4EM2A 4GM5A 1ZRDA 3ESWB 1Z1DA 1EKEA 2BL1A 2K27A 3SJFA 2KRCA 2Y9ZA 4HQMA 5LLQA 3QODA 4KNYA 4UUTA 2QJ8A 5JHFA 3ZCOA 3H92A 4LGWA 2LF7A 3SZPA 2AFZA 4P4IA 1ZHFA 2GU2A 3VDXA 2PMZA 3M7GA 2HDDA 1YR0A 2NS7A 3P5JA 1KU9A 1TQPA 4NGSA 1I1GA 3SDGA 3KX2A 1XG1A 3F0AA 1B6AA 1EV7A 2EV5A 3ABUA 5TRDA 1XDUA 2PIZA 1IRFA 6CPAA 2QMLA 3WTUC 3DCFA 1QZYA 4N9HA 2HOAA 3BDDA 1MJBA 2DJNA 3GTKJ 1Y9WA 4CSWA 4HSTA 3FIWA 3GLLA 1SFEA 1ETWA 2XPWA 2OB0A 2E71A 4ZX9A 3BR5A 1HBXG 1YLFA 4HKFA 4MHYA 3IAM2 2VXKA 2M34A 2R5YB 3TTHA 4GXOA 2L7FP 3BCBA 4AYBN 3OS2A 4FETA 3N05A 3G4SI 2C6CA 4LUAA 1YX0A 4P4JA 3RPQA 4XNHB 2WB1A 1FMVA 3ZJ0A 4XBFA 2E1MC 4D7MA 4MFJA 4E8OA 4AM3A 4MEYF 2WY7Q 4C2MJ 3PFOA 3GX4X 2D1HA 1K78A 1A5JA 1FNOA 4M3DA 1JTXA 2ZEPA 1YW7A 4OIWA 4QTRA 1FY7A 1XRYA 3B3WA 4E70A 1F1ZA 1QGPA 2GLFA 4A6DA 4YFNF 2IMOA 2AFMA 4CPAA 2EA2A 1TF8A 4UWJA 1TP4A 1KGSA 3RYRA 4BUPA 1ZYRF 4CAWA 4CYOA 1DQUA 2HOEA 3DLJA 5K5OA 3K2KA 3P2FA 5K8NA 4A3BJ 3HOZJ 1G3WA 2A5YB 1R4NB 3LWUA 2Q2EB 1YQAA 2Y2ZA 1JT6A 2L7ZA 3QOPA 3CCSI 5F0HA 2PRBA 1VI0A 2PJ1A 1Y0NA 2GA2A 4ZI6A 3EYIA 2BV6A 4DW6A 4Y49B 4PSWA 2ZXHA 1D0XA 4FD4A 5C44J 2JLMA 4MY3A 3O2PE 5HS7A 1R4MB 1F2OA 1DTDA 2ESHA 2QLZA 2Y69H 4NBQA 1G2HA 4CCMA 2DFFA 4RI1A 3HBLA 4WX9A 1JKRC 1AUGA 2WTEA 1XMTA 2AXLA 3MKWB 2JVHA 4XRSA 3PIOF 1W0TA 1H9GA 5FKMA 1Y8RB 5E3NA 1YVOA 4KA4A 1CPSA 1H8LA 3K9TA 3NEUA 5LGNA 2EB7A 4ESBA 4XIDA 3NE7A 2L9RA 3FXLA 5FD5A 1XGNA 1LAPA 4ZY0A 1ETVA 3HOYJ 3H0GJ 3ZMVA 4M6VA 3ZQCA 5E3LA 2GOXB 4JXQA 1KQ0A 3COAC 4JYWA 1Y6IA 2V4JC 1ON0A 1R49A 3KP5A 5I4MA 2M9HA 1G3TA 4OINF 2LREA 2PJ9A 3JTGA 4IAVA 4YGOA 3ELKA 1BPNA 4CGLA 2R0QC 2M2EA 4BBHA 2EO8A 2ZC2A 3GFJA 4CCNA 5F0FA 4A3EJ 4NGRA 5J1YA 1F43A 3OYFA 5HLIA 1PYVA 3GUXA 1QPMA 4EMEA 3HRTA 4Y7NJ 5H2FC 3HUVA 2LY2A 5DWNA 3ASOH 4BU2A 3DDDA 2ZNYA 2YNDA 5FLMJ 1FTZA 4A0YA 2IAIA 5L3BA 1IRGA 3I56I 1TWGJ 3B35A 2L02A 2L4MA 3ABMH 3SZGA 2LSOA 3D2PA 4CCLA 3FXJA 2KRHA 1KA8A 4HW0A 2Z5UA 1HOMA 2M87A 1WK4A 4A3LJ 2ZJPF 4JK1X 2CIJA 3MZHA 2ICWG 1TWHJ 3ZMDA 1R5HA 2STTA 4OC4A 2JUCA 2E1NA 3RTRA 5JVTA 5IOZA 3CC7I 2A4NA 2WY8Q 2PX9A 3OYGA 1M44A 3QB8A 3TL4X 3HUGA 2IGMA 1B8IB 1MH3A 2M45A 2BO9A 4ONUA 4HSRA 2VQYA 4EMSA 2RNJA 1XB4A 4JXRA 2DA2A 3QP5A 1SAXA 3V38A 5IYBJ 3E5QA 2NMTA 2WAFA 4XNHC 1VQ9I 2QSHX 2Z10A 4IHVA 3WABA 2ISZA 2LDUA 4QSHA 4B12A 4UUSB 3P9IA 1QPIA 4F52A 3BG3A 5HVGA 4L18B 4DYOA 2I00A 2JA5J 5K5RA 2RFHA 1YO5C 4CCKA 3G71I 1QHHD 3HL2A 2L54A 2K86A 2BY2A 3F6OA 4MFLA 1NE9A 4A6EA 3OYLA 4LJZF 3MFKA 3SI1A 2G9DA 1WJAA 4GYIA 2E2IJ 4LK0F 4GDFA 2FSWA 3P2HA 1QVUA 4QB9A 4YRHA 3AAFA 4NQWB 2EIMH 2ZB9A 2FX0A 2HNHA 2XAUA 2AS5F 2OTLI 1S3JA 1U6MA 5A28A 2W24A 5LGUA 3LFUA 3RSNA 1FBUA 4HV6A 3R0AA 2JN6A 2XVCA 3ZMUA 4CYQA 1YW9A 2DLLA 1XTAA 4IKFA 4AVAA 1MSFC 3O8GA 3IC1A 4Y49C 1VQ4I 4F6AA 4EQQA 2DFEA 1RR8C 5HMNA 3BQZA 1QU3A 2LC2A 2ZEOA 3JUWA 3JAMK 5BQTA 3LFKA 3VOEA 3HRUA 4N4NB 1M4IA 1X3WB 2Y9YA 4ENKA 5D4SA 4AYBA 1SFOJ 4WK8F 2EK8A 1DPRA 4EM0B 4O5VA 5HS9A 3M3YJ 3BTJA 4JX5A 2NVYJ 3L1PA 4XM3A 3AG1H 4P55A 2VT3A 2GZWA 2VI6A 5GTHC 2CFXA 2X6XA 3R4KA 3L2WA 1VFCA 4OIPF 2V9VA 4EGYA 1R1UA 1VQ6I 5GAGJ 4ZDOA 3I5UA 3D5LA 3WC6A 2Y31A 4CYNA 3BZKA 2XASA 3I53A 3K4NA 2NXNB 3OS0A 2L9SA 1R43A 2DQLA 4KOUA 5IOYA 4UF4A 3K69A 5BPDA 3FMSA 4RS2A 3MWMA 4BE2A 1RXTA 3D8PA 4W9YA 3VARA 1UHMA 4BQQA 4EJTA 4QBJA 2D5VA 1R58A 4G12A 2FUG2 2PMHA 3K0LA 1JTYA 2X6WA 3J80K 1S60A 1BW5A 1S7FA 4KZTA 1MJAA 3FRMA 1NSLA 4ZX8A 2NOJB 2COMA 1SD7A 5FB2A 4AXVA 4AIKA 3K7AJ 1XCBA 4AU7A 1W5TA 4A0XA 1JT0A 2ZFWA 5K1YA 2VQCA 3GVAA 2HZTA 4Y17A 2Y0SA 2X1DA 3W2AA 5BWAB 3TX8A 4CDGA 1XC5A 4QWQA 4PUSA 4BXFA 2EFPA 2GIZA 2X6YA 4NEXA 4ZYEA 3WU2C 4B5PB 1BR2A 1BM9A 2W82A 3FIXA 2PQ8A 5AIPA 4D0PA 2CUEA 4X0GA 2YNEA 2ZSHB 1S7OA 2V9KA 3C2BA 2XEIA 2ZEMA 3M9AA 4YU9A 4RDUA 1ELMP 4R3KA 3OOUA 5C88A 2DMQA 1LAMA 2UV1A 4IHSA 1RPWA 1ZARA 1GYTA 4P4DA 1Z05A 1YGHA 1Y0YA 4CGOA 2V1NA 4MQVA 1FOXA 3DEUA 5JGFA 2YNCA 4KJZA 3JAMZ 2YR2A 2LLKA 2M4KA 2J9AA 3C26A 3VB2A 3DFGA 5CYVA 4UEFA 4PJNA 3B2YA 2VBWA 3D0SA 2VI7A 5C4JJ 3FB3A 4MFPA 4XLCA 3C18A 4A3KJ 2O8XA 1ZQ3P 4B13A 5M3FJ 3SFIA 2BY3A 2G9WA 2O9LA 2IS4A 2MYSA 2YU3A 3CCEI 3FF3A 4MCRA 4E7ZA 1BJAA 4CZCA 1UB9A 3VSKA 2JPBA 4AIHA 1OYWA 1IV6A 2M7AA 4P9FA 1BN5A 1HKQA 1O3TA 4UIBA 2ME0A 1LFUP 4UNOA 2ZXJA 2B63J 3WTXC 3JREA 2A6TA 2QCOA 3HZJA 3J81K 5D8LB 4YIRX 2OTJI 1D1BA 3CPAA 2QQ8A 1Z9UA 3SDBA 2FXAA 2CNMA 5DD4A 2AHQA 4F3QA 2I8DA 3GCMA 4O6JA 2L5QA 5JLXA 2ZPAA 4QUSA 3EQLF 3RQ4A 3QYBA 3ABKH 1SMTA 2NAZA 4M9SA 1N75A 5J8CA 2LMDA 3J80Z 2EBJA 2CWEA 2UXXA 3BY6A 1YS7A 3BR3A 3E6DA 1ETYA 3MD2A 4KUAA 2OJED 2QM3A 4WXDA 5LFAA 5I0CA 5BNGA 2HWVA 3Q0WA 3NE8A 3OYIA 1MGTA 2UUZA 1ZR4A 4FE4A 1BC7C 1RC9A 2P6GA 4C2UA 1FBSA 1S7NA 1GLNA 1Z8WA 3P9KA 4KMUX 3PQJA 4BINA 5CVJA 5CQGA 3DXJF 4RB3C 2VLAA 2DYRH 2HV2A 1TT5B 2DTZA 3K6GA 3CUQB 4B8XA 3EDPA 1CG2A 3F8NA 3HB9A 4XK4A 5H6QA 2F4MB 4UXNA 1ETKA 1MDMB 3E6BA 4DBQA 3BJAA 4QPOA 4Q47A 1UHWA 3B3VA 4M6HA 4ZYHA 4OC2A 4L9JA 2HYGD 1V5FA 3MVPA 2VJIA 3OV8A 3OWTA 1VGYA 4MGRA 1Q1VA 3VODA 2PLYA 1PU9A 1RUNA 5F47A 4KOSA 2V6EA 2PBIA 4ITVA 1JUPA 3TT2A 5M5XJ 4B48A 1NK3P 2J8RA 5J1RA 3T8RA 2VJ5A 4G6DA 4BQNA 3CCQI 3RBUA 3RZOJ 5F08A 4JJXA 1RR7A 3CJNA 4Y52J 1R1VA 4CRZB 3VWEA 4MI4A 1IGNA 4ZDPA 4S0HB 1CBXA 3TGNA 4IHTA 4EJOA 3C7JA 2ZO4A 3HOUJ 1PUEE 1SQHA 2E2JJ 4C30A 3PFEA 4D9JA 1Z6TA 3CPXA 3IL2A 2K9SA 4HX8A 1ZG1A 2LK2A 4PJJA 4BY7J 1HLVA 1Q7LA 3D7HA 2F5VA 4E7SA 5CLSA 2IS2A 1Z4RA 2W57A 3H5NA 2WUUA 4NCZA 1I12A 4ZZDA 2OD5A 1IUFA 1RKTA 2WAQN 4FISA 4OMEA 3S17J 3FBUA 3VSLA 3SFZA 2XROA 2HPMA 1NSAA 1YRNA 2HVRA 4A3CJ 4EGZA 2IT0A 4WXCA 5DUIA 3HHHA 3DBRB 1KUXA 4PQAA 2XF7A 1V55H 1BI2A 2ID3A 1P2FA 1YW4A 1MDMA 5GAEJ 1S8NA 2EBIA 2MBFA 2EUIA 1I27A 1SVLA 3FM3A 1TKFA 1Z67A 2RGVA 2IRFG 1W1WE 2XEGA 3A03A 2LFBA 4IHXA 1ZH5A 1LOKA 4B11A 2H8WA 3IH3A 4I7HA 1NMTA 1GUUA 2GXGA 4J01A 1LFPA 2IXSA 2FRHA 2Y0MA 1IW7F 2F48A 1YSJA 4BHPA 4JOMA 3DBLB 3SI0A 5CVIA 4RAFA 4ZYGA 1U2WA 2EQRA 5EGOA 2VJJA 4LG0B 2FNAA 3I54A 3PO2J 3FMRA 3S2DJ 4BJ6C 1CP6A 3DKXA 3FKIJ 2K4JA 3IRRA 4FX4A 2VOPA 3I71A 2ZEGA 3GTLJ 4CO8A 4CXFA 3T9YA 4PGGA 3OYDA 2CQNA 4ZY2A 1WJBA 3J7ZI 2MG4A 3QYEA 1L3LA 2P5VA 1UFHA 1SFXA 2HDCA 3LA2A 3SJEA 2Q7BA 3NRVA 2K5TA 2V1DA 3Q3SA 3ZGKA 3M1CA 4BDZA 2CV1A 2XAQA 1PJRA 1EH6A 1IRZA 2IGOA 1ETQA 4U88A 3P9CA 5H6RA 3HOVJ 1IOFA 4IHMA 2CTCA 3IH2A 2GAUA 3S1RJ 5EZGA 3FM5A 3DSBA 3H3VK 4XPDB 4M85A 3ZZIA 1Z21A 2QSFX 1KQ9A 4A2UA 1DDNA 3J7AO 2OR4A 1ZAOA 3D68A 4NGMA 3QYFA 2CQXA 3G6EI 3OMYA 1ON2A 3CUQC 4HZFA 4K30A 2Q51A 1QO0D 1QA6A 1SMYF 4Y33A 3D4UA 1XMXA 5K7ZA 3KQXA 1K6OA 3I58A 3OSFA 1IDZA 3K9UA 3MN2A 2XKPA 4PFOA 5GADJ 4MMOA 1J09A 4H89A 3R6SA 2ZCWA 3RJPA 2P7CB 2VKEA 2H8RA 1HC8A 1ACIA 1CGPA 4LD5A 2ZMEA 3GMEA 3WU1B 1KYWA 2OZHA 2DU9A 4B47A 4F0YA 5C4XJ 1HEEA 1ITYA 1SD5A 3BQYA 3S8PA 4BBSJ 3HXLA 1FP2A 1A36A 4UEEA 2X1CA 4N4OB 3VATA 4UY8I 5K7FA 2M5WA 4L5EA 2E7XA 4E6KG 4O3MA 2PJ6A 5H20A 4Q4ZF 3GTQJ 5F0CA 1JKOC 2BW3A 1ZN2A 1BI0A 2CW0F 5F27A 5A2QK 4I0BA 3TOAA 1F36A 2D45A 3FXQA 2JK3A 4KORA 2EZHA 3H9GA 5IB9A 3T8TA 2DPTA 2RB7A 3TO7A 1KWMA 3F5BA 3PEIA 4GO1A 4LB6B 1VQKI 3S16J 4JD6A 4KOWA 1K4TA 1G3SA 3DV8A 3ZQHA 3BPXA 3L00A 1D3YA 3ECOA 4HX4A 2O61A 1BA5A 2KZGA 4MRIA 4BBRJ 3EPZA 1VQMI 1K7AA 3QPLA 4C7HA 4ZYDA 2K4BA 3TW6A 2CW7A 4D7NA 4RGRA 2G3TA 3EUKL 4A3FJ 4B43A 2FNPA 4Z65A 5KAFC 1D1CA 3RKXA 1EF4A 3S3OA 3ERED 3E0JB 4ZC3A 3GTJJ 2VZZA 5ELYA 5JQ4A 3HTSB 3AKZA 5AIQA 3R61A 4OWRB 1MBJA 1FIAA 3G1MA 4OP4A 4C3IJ 4MJ8A 3D7GA 3FHNA 2R3SA 5D5WB 4Y4RA 2ZMEC 1RNLA 4KS9A 3Q9SA 4CICA 5LHHA 2Q0YA 1GT0C 3LMMA 5IV0A 4DYQA 2BCOA 1HF0A 5L3FA 3FECA 5G21A 1JXSA 2ID6A 4ZY1A 3RNZA 4XSZF 2EWNA 1TL8A 1OZPA 3KI9A 1K61A 1W7PB 5M3MJ 4BNCA 1GV5A 1HDQA 1VKCA 3KETA 4L9TA 1GXQA 1KU2A 4MHGA 2F5FA 2HEOA 1SFUA 1FX7A 4EV0A 3GLXA 2ZEDA 5J1QA 2C27A 2TCTA 3ASNH 5J40A 1VQ5I 5D4RA 2KDOA 1HQCA 2RDPA 2PJPA 5F49A 3ONQA 3G2BA 1Z8TA 3KLNA 2L0KA 4LIVA 2GANA 2PVVA 2PVWA 5HNFA 3FYNA 1KONA 1Z3XA 2LR8A 2WAQA 4KSIA 2OQGA 3SJXA 1YW8A 3F8BA 4WF2A 2R7DA 5CPAA 3FZVA 2QBYA 4XPDC 2LKPA 4XKVA 3HHGA 3KKWA 5A2QZ 2LD5A 2Z3KA 4XL9A 2ZBKA 2GXBA 2ELHA 3K10A 3VWBA 3OL4A 2IA0A 4ZGYB 3ZN0A 3CP8A 2CJJA 3L2CA 4UCPA 2RKHA 1RIOH 4OOIA 3TBIA 3NWTA 2ZENA 4BQAA 1LEAA 1WHUA 4XMYA 5E96A 2A61A 3WGIA 4U5YA 3I4NJ 1MBEA 3VYRB 1YE9A 4CYCA 1BR4A 1XE4A 4CAVA 4CCJA 3BG5A 5LHIA 2YUSA 4L5JA 2O03A 3EY5A 3WC7A 3NH5A 5E18F 4TV7A 1FT7A 1KUVA 5FROA 1RO5A 5D8KB 3EO4A 4G94A 1YI2I 2X48A 4HPQA 1AKHB 2VJ4A 3KZYA 3DPTA 2DA5A 2E2HJ 1STZA 4EVIA 5DUKA 1S7KA 2MABA 3DP7A 1J59A 1M4LA 1U5TB 2PJRB 3RPUA 2OV7A 1A31A 2V7FA 3TCVA 3PBBA 2LOOA 1JKPC 1R3NA 2QQAA 4CRYB 2F5IA 3I4MJ 2MC4A 2L2OA 2CH0A 3I59B 5EC4A 2DPUA 2J8NA 2L01A 4IO9F 3RCOA 4LMYA 3HEFA 1HW5A 1Z77A 4NGQA 4AVBA 4GXHA 1VNDA 1M1DA 5EMIA 2KHMA 1G4DA 3A01A 1IICA 5K8PA 1L0OC 3E3VA 1YYVA 2IGNA 3H8GA 3DKYA 4K2EA 1YTYA 3LODA 4DJAA 2DTRA 1WJEA 2QF7A 3DGVA 4FE7A 4G8XA 4HV5A 4BXUA 3OYAA 1HSTA 4A3IJ 1MBFA 3N5FA 1XMBA 5K8MA 2CQKA 1B4AA 2MW8A 3LSTA 4AIJA 2CQ7A 1XF8A 4ZYQA 1I5ZA 5D6FA 3OS1A 4IVNA 2Z3OA 5AG6A 3IJ3A 1J4JA 4ASNA 1ZREA 2CY2A 4M71A 5L3GA 3S9LA 2HZDA 3WU0A 2BHZA 3BI1A 2VQHA 1N77A 1IC8A 4RLQA 5G1ZA 4OMZA 2ZW4A 3TE4A 3CZ6A 1UG2A 2R7RA 2JA7J 3OR2C 1QHGA 3TKYA 3HG9A 3G1OA 4YIIA 2HS5A 3W6KB 1ZK8A 2D1VA 2K9LA 3REOA 5EEHA 1VQLI 1BLLE 2JSCA 3BP8A 5TJJA 2R7WA 2BEIA 3KGQA 1JE8A 1P4WA 1Z7UA 2ESNA 3M4OJ 2R1IA 4LK1F 4OIOF 5F1RA 3TC8A 2HOTA 2HU9A 1AKHA 1F2PA 2M8GX 4HYEA 3LACA 5CBMA 1AWCA 5C82A 1P9QC 3EXNA 2D2WA 4MHNA 1BJZA 1Q1HA 2C1CA 2FOWA 1U5TA 4NC7A 1Y8QB 4M6YA 2GFQA 5J1UA 2LY9A 2M0CA 5IP7J 5E8GA 1KQ8A 4YEJA 3LAJA 4HNVA 4IOCF 4HNXB 3SHPA 3H3UA 3JRDA 4N0BA 1R71A 2EIJH 5ED4A 4WWCA 1CP7A 2MC3A 4RAYA 2KIQA 4RLFA 4DZJA 4EJUA 2L7MP 4YFJA 1ZKGA 5FFZA 2DPSA 2ZNZA 5ICFA 2B3VA 3B3CA 2OAZA 1N71A 4R79A 1XGMA 2CGPA 3AG3H 1PVEA 2RVCA 2CNTA 3FVLA 2CUFA 3RDIA 2TDXA 1UWYA 2NVTJ 2UXNA 3RQIA 2DPDA 4R6TA 2R5YA 1SVOA 1WSUA 2AQFA 1D5VA 1W0UA 2E5ZA 4JZ0A 5IT3A 3ZMTA 1APLC 2Q04A 3JRAA 2PEXA 5DD8A 1B72B 4M3SA 3KHZA 3TDUC 3FK7A 4V19K 2IS6A 3CXQA 2FQ3A 4F55A 3RO0A 1FBQA 3M8EA 1SD6A 2LG4A 1DGRM 4CA0A 4YRVA 4DQ2A 4CGPA 2DA6A 2KIUA 3OY9A 1BI1A 1YJ9I 2ZEFA 2V8DA 3RYOA 1J7KA 1ZRFA 1P6RA 2VXZA 1R6RA 2P6TA 3NQOA 3FBNB 4HDVA 3DF8A 1SAUA 1U5TC 1XSVA 4B44A 2ZJ2A 3V7ZA 3CCLI 5JPHA 2XRLA 4Y3OA 1PP8F 5LRSA 2DFIA 4G7HF 2NVXJ 3S6FA 2Q2EA 5DEQA 1BL0A 1A2ZA 4UFVA 3M1EA 4H6ZA 4HX7A 2ELJA 1YLEA 1LUJB 2R7TA 5ILUA 1V5EA 2P7VB 1S6LA 4KYWA 2LYCA 3HKZA 2CG4A 2A68F 1TQIA 3KP7A 1I3QJ 3QAHA 2FS5A 3SYTA 3S9MA 3R95A 2KRFA 4OIQF 2DAOA 5GTIC 2GIVA 1Y7RA 1QQ9A 5DCFA 1LCPA 2IEKA 1ZELA 1T39A 2IP2A 2JPCA 2VBXA 1DPUA 4KFCA 3BR1A 2KLOA 3TQNA 3BG9A 4BDYA 2HXIA 2A07F 3BTCA 3O6BB 1LVAA 2DT5A 2K9QA 1KZHA 4OADA 1YIJI 5LEJA 3BG7A 2CW8A 3DTEA 1FYKA 1VZ0A 3ZR8X 3HDDA 4A2ZA 5M5YJ 4AC0A 1GVDA 1LQ1A 3X2QH 2FBHA 3R9GA 2Z3MA 1I1DA 3OYEA 3DNSA 1BAVA 4MCPA 2EZKA 1HW1A 1J2XA 3TDZC 3TO9A 1WCMJ 3R9EA 3BLNA 4XPLA 3ZRGA 3GEZA 4CAEA 1DUXC 5LRKA 5AGEA 4J3GA 2X0LA 1LDJA 2EFNA 2PI0A 3V8KA 2H27A 2HOSA 5F46A 3M8JA 4NGPA 2M1BA 3C1DA 1D1AA 3WT4A 3HSFA 3WTSC 1CF7B 3GF2A 4UCMA 4RAGA 3JRCA 4UVCA 2V1UA 4Z2YA 3AFHA 4QVTA 2GXAA 2Z9OA 2M8EA 1S5KA 4BE0A 2YSRA 4B1RA 3B3SA 3UY5A 3CMAI 2XEFA 4IF5A 3PNTA 4KICA 2ZW5A 1Y39A 2RQQA 4PK3A 4RGXA 4U7DA 1ETXA 2W84A 1O57A 4EATA 4FUUA 4MHPA 5E1XA 2GLOA 4NFRA 2E1OA 3BZCA 3UNGC 2XDVA 1E2XA 4BY1J 4OC5A 1T33A 2DT7B 3LSHA 3TW7A 2PFBA 4OKOA 3N4MA 4OAZA 1A6IA 4PDKA 2PJ5A 3BG6A 3L2NA 1Z8XA 3PIPF 2W7NA 1YFHA 3G73A 3QRFF 1QVTA 1UAAA 4XN3A 4RB2C 5ILSA 1TNTA 2ELKA 3TEDA 1B8IA 3WR7A 2VONA 3ZOBA 2FE7A 5E8IA 2KZVA 3FX3A 4AVPA 1LRZA 1VHEA 2PJBA 1KUYA 2EILH 1IXSB 4KVME 3S6HA 1T2KA 3K2AA 3PM1A 2DQRA 4UUSA 4OC3A 1WJFA 3K1MA 1QSOA 2CNSA 4PXEA 4I09A 2EIKH 3V8IA 2VPLA 1WKMA 2WBMA 4R8HA 2LKSA 2Z3LA 4ENJA 4JLYA 3GZNB 5J3LA 4XPKA 4PZJA 2LTPA 1X1PA 3SEZA 4I02A 1BC8C 1P4AA 1TKJA 1FMWA 2REFA 4ANJA 3KPHA 2X85A 3O8HA 1T6SA 2R4GA 1JJ6C 3U1KA 4IX7A 2Z33A 5LRGA 1IO2A 2CYYA 3KIOA 4NQWA 1ZLIA 1CF7A 1UHSA 3FJUA 1SD4A 5E79C 1JJ8C 4A5NA 2ZJQF 3OSGA 3W6VA 2BEOA 2PJ4A 2BE5F 4ORFA 1TZLA 4IJAA 4FT8A 2P6FA 2OOTA 4PSXA 4Y15A 3HOTA 2AE6A 4A93J 5EDNA 2DK8A 2H1KA 4MO7A 2DOFA 1OLTA 2ZXIA 3BLYA 1ZLJA 3J7AY 3FXKA 1E3PA 3I55I 3VYSB 1IYKA 1VHOA 5B66C 2ZW7A 2DXQA 2A5WA 2PC1A 1E3OC 2FIWA 4P45A 4U9ZA 3JRFA 1D0YA 3TP3A 4A95A 3K4KA 1A35A 3KP4A 2J5PA 5FRNA 2XRNA 1TKHA 4NGNA 4HLXA 1XN7A 5IY5H 2GE3A 4ESJA 2QYOA 4UA3A 1XGOA 1B59A 3JRIA 1ON1A 2M0MA 2R93J 3RYPA 5EJCA 3S2WA 2B4DB 4KOYA 2FBIA 3CUOA 3I3LA 4IEJA 5LHGA 2DMUA 1Z3YA 3PSFA 2ODFA 3KP6A 3WG7H 1SEUA 2E36A 4I98B 3V42A 2NOGA 4ZYAA 5LYIA 2GOMA 2AJ6A 1IN5A 2P4WA 5F1JA 1WH7A 1HDPA 1LANA 4F9UA 3OYHA 2MD0A 2OF7A 2MLKA 3IKTA 4D1QA 2KPMA 1JUSA 4AWXB 1HDUA 2M30A 3WE2A 4XRFA 4LITA 1J9IA 3IFEA 5HXDA 3BWGA 4MCSA 4R8FA 3W91A 1QZEA 4C2ZA 2PMUA 3E1SA 1EJ9A 4OU0A 4V2FA 4U7BA 2HVQA 3DLLF 1LPQA 3MRUA 3GYHX 3GTGJ 1UJ8A 3SEQA 3CCJI 1MNMC 2AFXA 4L89A 3K1NA 4E7IA 4L0ZB 2V8HA 4P1WA 4N9IA 4HRIA 4R9MA 1QSNA 4KITB 4B5PA 2JDCA 3JSOA 3DTIA 2AQEA 4AD9A 4WCGA 3A9LA 3KZWA 2ATRA 4TWEA 2BXZA 3HC7A 4NUBA 1SFKA 5GP9A 4QLCU 1FC3A 1BR1A 3GB0A 2O53A 1GXPA 4NHJA 2RQPA 2XV4S 1NHAA 5JFRA 3JRBA 2P5LC 4V2GA 1QMUA 3NA6A 2E1CA 1S3ZA 4OC1A 3S93A 1HSJA 4AVZA 1DP3A 2OBPA 1TBXA 2BBYA 5HODA 3IAS2 1AHDP 3QQAA 3V7RA 1SVMA 1WGXA 3DPUA 3LA7A 5B5EC 4OC0A 1Y1WJ 1FPQA 3HSRA 1I39A 3I3GA 4A3JJ 4GGGA 3CDLA 1N25A 3ZMZA 2OQRA 1O4XA 5F64A 2R8VA 2PN6A 3GTOJ 2GQQA 3IWWA 5AG5A 2Z2SB 2IA1A 3PGPA 3MAJA 3T0YA 2XIGA 1WI3A 4LQ6A 2DW4A 3KP2A 1ZGWA 3WODF 4K3NA 3KEOA 4PXDA 4GYGA 4HNWB 1IN7A 1OCPA 2Q0OA 5ILVA 3WGHA 5GPAA 1X1AA 3VYTB 3WG9A 1Y7EA 2GLJA 3NH8A 2XF6A 3I9SA 1YITI 1OPCA 1Z0XA 1MNDA 1G59A 2V9PA 4UUVA 1H88C 2K3PA 2STWA 4A31A 2GM4A 1Z2LA 2DEAA 3LA3A 2F8HA 4HG2A 3DU6A 3R60A 3CJRB 5DDGA 3D2MA 3KASA 1JGGA 4JBAA 4P9UA 2PCUA 4BGDA 2PJ2A 3H36A 5L3EA 5FKOA 3G8WA 1VTNC 2QIRA 1SANA 3IWEA 1UELB 2FCKA 2OH1A 1K6YA 2R5ZB 5B1BH 2LH9A 2VZYA 2Z99A 2Q8KA 5J4YA 4HF2A 4BHBA 3KYLA 3H35A 1B6BA 1WJDA 3T1BA 2BYVE 3GFMA 2QA4I 4UB8C 3F8CA 2A6HF 1XBUA 2ZOFA 3CUQA 1XJOA 2BOAA 1ZGJA 3L2QA 3E5UA 3JTKA 4NF1A 1UG0A 2P8TA 4IHWA 2GREA 2CSOA 3ULQB 3SJGA 4WJBA 2VEZA 2FEZA 4BJTA 4DJLA 2RNGA 3ABTA 4XLAA 1FOKA 3ABLH 4KOVA 3BROA 2G7UA 2EV6A 5IP9J 4RA2A 1C0WA 2DDAA 2B58A 1CPXA 1W5SA 3OL3A 4IL6C 1X1BA 5IT9Z 1QNTA 4M9ZA 4H6UA 4RM3A 1IJWC 5E1WA 3A02A 2ZJRF 4M3FA 5JM6A 4I99C 3B73A 2KQRA 2NS8A 2R7OA 2K9MA 5E3OA 3GYAA 2CFOA 3QWLA 4LLNA 3HJEA 1GV2A 1MH4A 2HTJA 3WGGA 4MCQA 4UFXA 5G22A 5DV5A 3I9V2 2B4BA 2Z16A 3GTPJ 3CLQA 2DO7A 1IXCA 4IRHA 4X1EA 4G1PA 2QQBA 1XOVA 2Z11A 4WWVA 1FWZA 3S15J 2HB6A 1R00A 1BO4A 4ETSA 2XEJA 1WH5A 1ZLHA 2M7BA 1TF9A 2DF5A 1U9NA 1ZG3A 1HW2A 2B5GB 1E17A 4O23A 4MHZA 2JQ7A 5FLVA 3KHXA 2XF5A 4UVAA 1IF1A 3KR5A 3MQ0A 3FX6A 1P0HA 1RKWA 2HFHA 4C3HJ 1PDNC 1X2MA 2PMZN 3E0KA 1MZBA 1X1DA 2CXAA 2VBZA 1DE4C 1WVRA 2ZEHA 2XPVA 4RBOA 2Z0ZA 1X2NA 3EETA 3BC8A 2YU9J 2JRTA 2WAEA 3GZ6A 4YELA 1VIXA 1K79A 3CZXA 2FF4A 4UBRA 4Q48A 4RM2A 4DNCA 4DIQA 3IV5A 1OCCH 2HC9A 4RN7A 4C7IA 3PB6X 1XGSA 2MA3A 1ZRCA 4XOTA 2FT0A 2ZELA 2JZYA 2CS3A 3QPSA 4E4HA 1OR7A 3PJRA 1JI8A 4A3DJ 2QECA 1Y9KA 4M3BA 2BZTA 3NAUA 2HQRA 2JMWA 6PAXA 1HCRA 1RZ4A 5DM6F 2R7FA 4HDUA 3NFZA 4H2KA 2Q43A 2LRDA 4LG0A 4L9VA 1T98A 3FMCA 5D8NA 2WB1N 3CCMI 2Z3PA 4A3GJ 2QKLB 2NYXA 2OZUA 3N97A 2EFWA 2XGDA 2DBBA 1FZPB 1EH7A 2R7SA 2J5OA 5EBVA 2LBFB 4A30A 3V7CA 3PB9X 4EJVA 2HKOA 2DOEA 2AFOA 4P4FA 5DS0A 4XKBA 1NH3A 3S14J 3D7FA 3UKGA 1BOBA 2H6CA 4A5MA 3CDXA 2AXTC 2X9DA 1S9HA 1YQEA 3B6CA 3RPUD 4C3JJ 3BZ6A 1ZGAA 3F8FA 4PJ0C 3CCVI 1V4RA 4RGUA 1FNNA 1YIOA 1O7FA 2RREA 3BR0A 3RI4A 1MK4A 4II3A 2V77A 3CC4I 1P4NA 2O6GE 3KFWX 5BPIA 4ENMA 3BXMA 2EZLA 3FISA 4BYYA 1CX8A 4ABZA 2R7XA 1ODDA 3W6JB 4CYPA 2FD5A 3D5RC 3OYNA 3FXRA 2EJRA 3H1CA 4JQFA 2FSRA 3ISPA 1R1TA 1T95A 4CAFA 5KAIC 3TOBA 4LFUA 1HKSA 1ZG8A 2NS0A 3T90A 3E6MA 3QU6A 1BOAA 4KDPA 1Z91A 3ISXA 4M73A 1YHQI 4GFBA 1U8RA 5B3SH 4XRMA 3E7LA 2O0YA 1X1CA 2KJBA 1OR7C 2DT6A 4DYCA 2VT2A 4F91B 4A39A 2HQAA 1G6NA 3WTZA 3AG2H 4BEHB 1T08B 5CJ9A 3GXOA 2XSDC 3B02A 5GAHJ 1AU7A 1QSTA 5AG4A 4IOAF 2JDDA 1R23A 1LVKA 1XSXA 4HBLA 1IZ1A 2A6EF 2CO5A 3ZQLA 1XEBA 3DBHB 4AVCA 5AG7A 2YX7A 4MTEA 3BTIA 4XNFA 4AG7A 2ZW6A 3JVNA 3DLAA 1O3QA 1I50J 5GPCA 1LDKB 1Q2CA 4XRSG 2PRQA 4KLVA 5IYDJ 2MH9A 4IUSA 4ON0A 2OA4A 4PJMA 3I64A 5F09A 4ZDLA 2PJ7A 1POGA 1ZG7A 2LY1A 2O3FA 3HSEA 4Z6YA 3CTAA 2WPWA 1G8XA 2L9VA 3JTHA 4KSAA 4E2AA 3H5AA 2XAHA 1TIQA 1B9NA 1X58A 3Q0UA 1FSHA 1XDSA 2LNBA 1U0JA 1V54H 2LBFA 3FDYA 3QP6A 2PE3A 1AA7A 4P4EA 1T0FC 4RGSA 4XLHA 4ZTJA 1Y0RA 3KL9A 4R7MA 1XS9A 4Q38A 2F4IA 2KIFA 4B10A 2H6BA 4ENNA 1HDDC 2CTBA 3H4QA 4E0AA 2R7QA 1V5GA 1IN8A 2LP0A 4MFEA 4X8IA 2VE8A 4A12A 4U87A 2PR8A 2HDWA 3K70C 3Q0VA 1USTA 3HTUA 4KIBA 3F21A 3L7WA 2DA7A 4MNUA 1Z9CA 1W36C 4ZTFA 4MFDA 3M07A 3LSRA 2FBKA 5FRMA 3I1UA 4QPQA 2OU2A 3C2GA 1QRYA 3HGGA 2FA5A 1H0MA 4NC6A 1VQOI 3B8GA 1FOWA 3H9JA 4B3XA 2N8GA 5BMZA 1P7IA 1JWQA 5K8OA 3MCZA 3U2RA 3LSGA 2KDZA 1IGBA 5F6FA 4FD5A 2E34A 1AMPA 3HIFA 1HKTA 1R36A 5J8FA 3F8MA 3HPHA 1JKQC 1BPMA 4LQGA 1FT9A 3L09A 5HLGA 5HOOA 1H89C 2R7ZJ 1ELLP 1K78B 4MFQA 2JBJA 1W7PA 4R1HA 4UEZA 3HRMA 1TNSA 3PZJA 3DEWA 4KOXA 3W6XA 1LFWA 3PRTA 4IRGA 3L2UA 4I01A 1TTYA 1R57A 2JA8J 3FH4A 5FD6A 5AONA 4AIDA 1FLIA 2QSGX 3QPHA 3E6CC 1U9OA 1B1BA 1MD0A 2F5DA 1S5LC 1IDYA 4XLPF 3GWZA 2F4OB 3IUOA 1FIPA 3PNYA 1F9NA 1YX5A 4HNTA 4NC8A 4CH7A 4LLLA 5E17F 3LNQA 3D5SC 1P7JA 3FKJA 3FEEA 4MXUA 3BJOA 2K5CA 1YLOA 3L9FA 4C2YA 3C2HA 4MFKA 1X12A 2H09A 3CP2A 4W97A 2RAEA 2VQLA 1D0ZA 3MMYB 5J47A 1UCRA 2FOKA 1B87A 4B5OA 3KCCA 8CPAA 1YK3A 1FP1D 2XPUA 3LSMA 3QPTA 2DI3A 1FOYA 1UZCA 3CQZJ 4A0ZA 1F5TA 5FKKA 3HOWJ 1K4JA 1ENHA 5CQEA 2VBQA 4GS4A 2LVSA 2PG4A 4MTDA 1OCZH 2WADA 3A0BC 4KN4X 4XORA 2WZNA 1XX5A 1M4DA 2DXIA 2H1LA 3ERMA 3BOQA 4A33A 2KL4A 3K4MA 1MMAA 3HLPA 1O7LA 3SJMA 2YPRA 2P6EA 4IXAA 2CUZA 1LEBA 2HQYA 3RIRA 3G3ZA 2HKXA 5L3DA 2VPRA 3AL0B 4G6TB 4OMYA 4CGNA 1YJNI 3S9NA 2P0WA 3RKWA 1YREA 3PO3J 2DYSH 2X51A 3RZDJ 1RUOA 2PJRA 1R22A 4G7OF 3U1DA 4F8ZA 2VC0A 4LB5A 2JBKA 1ZR2A 2E7WA 1A6QA 2IPQX 1CQTA 2REEA 2EA4A 5LRJA 3I59A 2W25A 4GCVA 4E7JA 3Q5FA 4HLYA 1ERDA 1IB1E 4FD7A 1TW3A 2A05A 1LNWA 2R7HA 3CXPA 4BMHA 3W6SA 2BOLA 3DKWA 4U0WA 2WC2A
chains in the Genus database with same CATH topology
4L8AA 4MI4A 3FBIB 3DQVC 4MHDA 3V8IA 4IQ4A 2WBMA 2VPLA 2RC4A 1Y56A 4ZDPA 2Z3LA 4JLYA 4XPKA 1SQHA 4HNUA 4RMNA 2OUMA 3R1KA 4C30A 3SEZA 4PJLA 4D9JA 3OYMA 5HH1A 4UCNA 1FMWA 3CMMA 2D4OA 2REFA 2E1MB 5CPRB 4P5OA 2X85A 1TT0A 4BQOA 1MW7A 2Q1ZB 2R4GA 4ANJA 2WPXA 3UR3C 4PJJA 4IX7A 3D3SA 3PUBA 2F5VA 4E7SA 2IS2A 1Z4RA 4XN0A 1I21A 3H5NA 2WUUA 4GRIA 5HNHA 4KT6A 1I12A 2BSWA 4NCZA 2DJIA 1CJWA 4CS0B 4F93B 3OYKA 3OYJA 4ORFA 3FBUA 2VKDA 1TZLA 3VSLA 2HPMA 3DR6A 2HVRA 2P6FA 2HVSA 2KMUA 3CF2A 4PSXA 3HUGB 4E7HA 2Q44A 4EVYA 1KUXA 2J8MA 4C68A 2XF7A 3DTKA 3HOTA 2AE6A 1HA8A 1OLTA 2H5MA 2ZXIA 2DOAA 3BLYA 2ARHA 4R87A 5KCMA 4IZZA 3VYSB 1LKXA 1IYKA 2R7UA 2EUIA 4J00A 4XLEA 2DXQA 2ZW7A 3EFAA 2A5WA 2PC1A 2FIWA 5F48A 2IS1A 4U9ZA 4B11A 2WSAA 1NMTA 3R96A 3NWSA 3H5ZA 1D0YA 3TMOA 4I49A 4J01A 4OLLA 3K4KA 4LG3A 4A95A 4AB7A 1LFPA 5GCNA 2KCWA 2IXSA 5FRNA 2Y0MA 3LSIA 2GE3A 2L7KA 4JOMA 2DCEA 4UA3A 3A4CA 2M0MA 4E7KA 1L0CA 2VJJA 2X1EA 2B4DB 4KOYA 4PFPA 3I3LA 1DGWY 3KEYA 4BJ6C 3OYCA 1VHSA 5DWMA 1Z3YA 3DKXA 3PSFA 2XC7A 3DEEA 4BEHA 3U21A 3DPLC 4HNYB 4MFZA 3V42A 4ZYAA 3T9YA 2GOMA 2VIXA 2AJ6A 3CXSA 3OYDA 3GY9A 2JVGA 5HVQC 1WJBA 4ZBGA 3QYEA 3OYHA 4UWIA 3W2VA 1UFHA 4KVOE 3S3NA 2MD0A 3CESA 2CV0A 2Q7BA 2K5TA 2FXFA 3ZGKA 2KPMA 1MMNA 3M1CA 4DOZA 4ZJZA 4D1QA 4BDZA 2CV1A 2OC6A 3FXTA 1PJRA 2IGOA 4BL0B 1NG6A 2JA2A 1QSMA 3K4CA 4LITA 2M3AA 3DSBA 4XPDB 4C2ZA 4M85A 3W91A 1Z21A 3ZZIA 2BL1A 3E1SA 4U7BA 2HVQA 3QYFA 4CAXA 4IQJA 2KRCA 3A1YA 3OMYA 3SEQA 3BJ8A 3QODA 4K30A 4L89A 5KTAA 4E7IA 5JHFA 5ISVA 3ZCOA 2B3UA 2HUZA 4P1WA 4Y33A 4HRIA 4R9MA 3VDXA 1QSNA 2PMZA 4KITB 3K9UA 3DR8A 1YR0A 4B5PA 4PFOA 2CV2A 2JDCA 3DTIA 2AQEA 1J09A 3VYUB 3A9LA 4H89A 2ATRA 3F0AA 3KX2A 3A2KA 3AL0C 3HC7A 4NUBA 1SFKA 4C2XA 2QMLA 1BR1A 2OZHA 2R7VA 3PSIA 4B47A 4F0YA 1MJBA 1Y9WA 3HPGA 3S8PA 1S3ZA 4CSWA 3HXLA 4HSTA 3S93A 4AVZA 2X1CA 4N4OB 1DP3A 3SXOA 4BJ5C 4E6KG 3IAS2 2OB0A 4HKFA 3IAM2 5KHDA 2VXKA 3DPUA 3MGDA 2BW3A 3L2VA 3TTHA 3BCBA 3OS2A 3I3GA 4FETA 2Q4YA 3N05A 4LUAA 3TOAA 1YX0A 4XNHB 2WB1A 4KORA 2R8VA 1FMVA 3H9GA 3ZJ0A 2DPTA 3F5BA 3TO7A 2IL4A 2E1MC 3DWLE 2Z2SB 4MFJA 5AG5A 4E8OA 2V26A 2VXDA 2WY7Q 3GBGA 3PGPA 4JD6A 4KOWA 4NXYA 4X5KA 2WA0A 4MY0A 4HNWB 1FY7A 3EPZA 4C7HA 2CW7A 1X1AA 3VYTB 2G3TA 3EUKL 2XF6A 3QOEA 3I9SA 3IWGA 4B43A 1MNDA 1G59A 2K3PA 1D1CA 4UWJA 4A31A 3S3OA 2HPIA 3OIPA 2OZGA 3E0JB 4ZC3A 4BUPA 1IYLA 2VZZA 4CAWA 1DQUA 4CYOA 5JQ4A 4HG2A 3DU6A 3AKZA 3P2FA 3CJRB 4OWRB 3D2MA 3W2WA 1KZFA 2PDOA 4MJ8A 2Q2EB 3FHNA 4BGDA 4FD6A 4Y4RA 1MMDA 2VB6A 2PRBA 5FVJA 4KS9A 3G8WA 5KTCA 2QIRA 2Q0YA 3IGRA 3IWEA 1UELB 4CCOA 2FCKA 1M4GA 2OH1A 3PL8A 3LMMA 1K6YA 4PSWA 4Y49B 2ZXHA 5IV0A 1D0XA 2LH9A 2VZYA 2JLMA 3IU2A 4FD4A 4MY3A 5G21A 3KYLA 2JUGA 3H35A 1B6BA 1WJDA 2Z3NA 4CCMA 4RI1A 3CJQB 2D4PA 1OZPA 3S32A 1XMTA 4XKWA 1VKCA 3MKWB 2JVHA 1YVOA 5AGEA 3L2QA 3JTKA 4NF1A 1UG0A 2QKMB 4FASD 1MNEA 2XSJC 3NE7A 4NSQA 2VEZA 4BJTA 2C27A 2KDOA 2GOXB 5F49A 2RNGA 4XLAA 3ONQA 3G2BA 2X7BA 1N78A 4KOVA 4LIVA 2GANA 4JXQA 5CKTA 4II2A 5HNFA 3FYNA 1KONA 3OWCA 3VWDA 1Y6IA 2V4JC 1Z3XA 1ON0A 2WAQA 2B58A 4CRZB 2G3AA 3H9QA 3OL3A 2LREA 4YGOA 3VWEA 4XPDC 1X1BA 4CGLA 4XKVA 4H6UA 3KKWA 4RM3A 4BBHA 2Z3KA 4XL9A 4CCNA 3K10A 3VWBA 4CGPA 3OL4A 3OYFA 2KQRA 1PYVA 4F0XA 2R98A 4ZGYB 2R7OA 2K9MA 3HOSA 3GYAA 2LY2A 3CP8A 2CFOA 5DWNA 4UCPA 2JSPA 4BU2A 2YNDA 3DDDA 5G22A 1X4PA 4UFXA 1QSRA 3TBIA 3I9V2 3NWTA 2Z16A 2B4BA 3LSKA 4XMYA 5E96A 3SZGA 3D2PA 4U5YA 2Z11A 3VYRB 4CCLA 1YE9A 1XE4A 1BR4A 2KRHA 4CAVA 4CCJA 3EY5A 2O5RA 3H0DA 2CMPA 1NG7A 1MMGA 2VASA 1WK4A 4C9YA 1BO4A 2W00A 1KUVA 2M7BA 5FROA 2B5GB 1V0CA 1RO5A 3F9KA 1CM0A 3EO4A 2XF5A 4HPQA 2IGKA 3RTRA 2VJ4A 2A4NA 1P0HA 3DPTA 2WY8Q 4PK4A 2MFZA 1S7KA 3OYBA 3E0KA 3K4JA 3OYGA 2MABA 1X1DA 1M44A 3TL4X 3QB8A 2CXAA 2IGMA 4F92B 2PJRB 5A27A 2OV7A 2V7FA 3TCVA 4ONUA 2LOOA 4HSRA 4NNJA 1PUAA 2VQYA 2Z0ZA 4CRYB 3BC8A 2F5IA 4JXRA 2MC4A 2L2OA 2CH0A 4UBRA 2WAEA 2J8NA 4YELA 2NMTA 2WAFA 4XNHC 2Z10A 5EC4A 3RCOA 4XONA 4RM2A 4DIQA 4AVBA 4DNCA 4B12A 4BE1A 4C7IA 1M1DA 4F52A 4II9A 2KHMA 1IICA 2FT0A 4XOTA 2I00A 4UFWA 3F8KA 2IGNA 3DKYA 2CS3A 4MLOA 4E4HA 3LODA 3PJRA 4DJAA 1JI8A 1WJEA 4CCKA 2QECA 1QHHD 3HL2A 1Y9KA 1WWZA 3OYAA 4MFLA 1NE9A 3OYLA 2M4GA 1WJAA 4QB9A 1XF8A 4YRHA 3P2HA 2LRDA 3OS1A 2B4DA 2Z3OA 5AG6A 2Z3PA 1J4JA 2BVMA 2QKLB 2UWMA 4NQWB 4KUBA 4B14A 2HNHA 2XAUA 2OZUA 1U6MA 3K4LA 5A28A 1ZO0A 4MBUA 2HZDA 2R7SA 5KTDA 2E5NA 2VQHA 1N77A 3LFUA 4RLQA 4BS9A 5G1ZA 3RSNA 3OIQA 2ZW4A 5EBVA 4HEA2 2VKHA 2LBFB 4A30A 3TE4A 4PK2A 2O28A 4CYQA 2YNCC 4XKBA 3CZ6A 2R7RA 2FL4A 2BVLA 4IKFA 1BOBA 3OR2C 4AVAA 1QHGA 1Q2YA 5CNPA 3HG9A 4Y49C 1S9HA 4F6AA 2K9LA 5HMNA 3RPUD 1QU3A 2LC2A 3JUWA 2R7WA 3N7ZA 2RREA 1MK4A 4R57A 4II3A 4N4NB 1WJ5A 1P4NA 2R1IA 1M4IA 4XOPA 3S3MA 1Z7LA 2HU9A 2R7XA 4AYBA 1YVKA 4CYPA 3D5RC 3OYNA 3DU5A 3PP9A 5C82A 1P9QC 1S7LA 4JQFA 3EXNA 3SXNA 2FSRA 4XM3A 1T95A 4H4KC 3TO6A 3PFYA 2KP6A 3TOBA 3L2WA 4NC7A 4CUGA 3J7AY 1E0EA 2X6XA 1MJ9A 1IRXA 3T90A 4DGWB 4ZDOA 4XLFA 4KLWA 3PNVA 2G0BA 3D5LA 4YEJA 1X1CA 1X4OA 4HNXB 3SHPA 1OR7C 2DT6A 4F91B 3K4NA 4CYNA 2HQAA 4C2TA 2I79A 3OS0A 2BEIA 2L9SA 4RLFA 2L9NA 4BEHB 1QSTA 4YFJA 5AG4A 2DPSA 2JDDA 4KOUA 2B3VA 1LVKA 1N71A 4R79A 1XEBA 2PSWA 4RS2A 4AVCA 4BE2A 1RXTA 3D8PA 5AG7A 2CNTA 4XNFA 4BQQA 4XQFA 4AG7A 2ZW6A 3JVNA 1Q2DA 4QBJA 2VL8A 2JEVA 3DLAA 1Q2CA 1LDKB 4KLVA 1QSOA 2FUG2 4IUSA 2X6WA 5HLTA 4PJMA 1S60A 1S7FA 2AQFA 4ZDLA 4KZTA 1MJAA 2E5ZA 2W1OA 4U9YA 3FRMA 2LY1A 2WPWA 4KSAA 2NOJB 1NSLA 4E2AA 1G8XA 2Q04A 3H5AA 1TIQA 2ZSIB 4AU7A 4M3SA 2IS6A 3CXQA 2VQCA 3GKRA 4F55A 1U0JA 2LBFA 3BCAA 2Y0SA 2X1DA 3FDYA 3W2AA 5H86A 5BWAB 1AA7A 2LG4A 1DGRM 1T0FC 4PUSA 4XLHA 4BXFA 4CA0A 2X6YA 4YRVA 4ZTJA 3OY9A 1XIXA 2EVNA 3LD2A 4NEXA 4R3LA 3S6KA 1BR2A 4Q38A 4B5PB 2F4IA 2W82A 3K70D 3FNCA 3FIXA 1W36D 2PQ8A 3RYOA 4B10A 3H4QA 4E0AA 2R7QA 1V5GA 3S6GA 2VXZA 4X0GA 1R6RA 2ZSHB 2YNEA 2V9KA 2E60A 3K4BA 4U87A 2PR8A 2HDWA 3K70C 3FBNB 4R3KA 1SAUA 3OOUA 1W36C 5C88A 4B44A 4DBRA 4ZTFA 3EC4A 2UV1A 3W3CA 1X19A 5FRMA 5JPHA 4Y3OA 4CGMA 4QPQA 2OU2A 3C2GA 1YGHA 3S6FA 4CGOA 2V1NA 3L2RA 4PV6A 4UFVA 3B8GA 4H6ZA 3H9JA 4B3XA 2ELJA 4KJZA 1YLEA 2BW3B 2R7TA 2YNCA 1V5EA 3R9FA 2M4KA 3C26A 3LSGA 2LYCA 2Q4VA 4AG9A 3HKZA 4PJNA 3QAHA 4FD5A 3FB3A 2FS5A 2VI7A 4MFPA 4XLCA 3SYTA 5J8FA 3ZXSA 3HPHA 3R95A 4B13A 2IS4A 2GIVA 2MYSA 5HOOA 2W4SA 1GHEA 1Y7RA 2YGWA 4MFQA 4E7ZA 4JWPA 1ZELA 4CZCA 3PZJA 3IP4B 3VSKA 2KLOA 5H84A 4KOXA 4BDYA 2M7AA 4KOTA 3W6XA 2F6CA 3L2UA 1WJCA 1R57A 5TGTA 1Z4EA 4OADA 2ZFUA 3BG7A 5G20A 2CW8A 3DTEA 1VZ0A 2A6TA 3ZR8X 4LX9A 4A2ZA 4XR6A 4A32A 4Q36A 3R9GA 2Z3MA 3IUOA 1I1DA 1D1BA 3OYEA 3PNYA 1YX5A 1IIDA 2Z1DA 4HNTA 3DNSA 4NC8A 4CH7A 1Z9UA 3TO9A 3SDBA 2CNMA 3R9EA 3BLNA 4XPLA 3ZRGA 4F3QA 2I8DA 2FIAA 3D5SC 4CAEA 3EUHC 3LL7A 2L5QA 3FKJA 2ZPAA 4J3GA 2K5CA 3RQ4A 4KVXA 3QYBA 4BACA 4OAEA 4QUSA 4C2YA 1N75A 3C2HA 4MFKA 5F46A 5J8CA 3CP2A 5IB0A 3M8JA 2VQLA 1D0ZA 3MMYB 4KUAA 3MD2A 1D1AA 3MKZA 3EUAA 1B87A 4B5OA 5LFAA 2VQGA 5I0CA 1EA3A 4UCMA 3OYIA 2UUZA 5IX3A 1YK3A 2P6GA 1YX3A 3AFHA 4OAYA 3MKYB 4E7LA 3ZQQA 4C2UA 4BE0A 1S5KA 1S7NA 4QVTA 1GLNA 3LSMA 3UY5A 3TFYA 2CY2A 1K4JA 5CQGA 4IF5A 3PNTA 2VLAA 5CQEA 2ZW5A 2VBQA 2RQQA 4GS4A 4PK3A 2HV2A 4EATA 3K6GA 2WADA 4XORA 1M4DA 2DXIA 4A33A 3UNGC 4XKCA 2KL4A 2XDVA 1MMAA 3K4MA 4LIUA 4QPOA 4DBQA 5KNLA 2DT7B 3LSHA 2B5GA 2P6EA 4OAZA 2CUZA 2HQYA 1V5FA 3OR1C 3BG6A 3AL0B 3G3SA 4CGNA 4G6TB 2VJIA 3BJ7A 2W7NA 3OWTA 4QC6A 2P0WA 1WFXA 1PU9A 1UAAA 3IU1A 4XN3A 5LD2C 1YREA 5F47A 2X51A 2CUJA 2PJRA 4KOSA 3WR7A 2V6EA 4ITVA 2FE7A 4KSFA 2KZVA 1LRZA 2PR1A 2REEA 3TT2A 4KISA 4B48A 1KUYA 2J8RA 4E7JA 1ERDA 2BUEA 2VJ5A 1IB1E 4BQNA 4FD7A 4KVME 3S6HA 3CXPA 2R7HA 4JJXA 3H5RA 4BMHA 3W6SA 1WJFA 2BOLA 2CNSA 4CAFA 2ZXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L8A A;  4MI4 A;  4MHD A;  3V8I A;  2RC4 A;  4XPK A;  4JLY A;  1SQH A;  3R1K A;  5HH1 A;  2D4O A;  2REF A;  2WPX A;  3D3S A;  1Z4R A;  4NCZ A;  1I21 A;  2BSW A;  1I12 A;  1CJW A;  4CS0 B;  4ORF A;  3FBU A;  3DR6 A;  2P6F A;  4PSX A;  2Q44 A;  4EVY A;  1KUX A;  2J8M A;  2AE6 A;  2H5M A;  2ARH A;  4R87 A;  1IYK A;  2EUI A;  2ZW7 A;  2DXQ A;  3EFA A;  2PC1 A;  2FIW A;  5F48 A;  4U9Z A;  1NMT A;  3R96 A;  4I49 A;  4OLL A;  4AB7 A;  5GCN A;  2KCW A;  2Y0M A;  2GE3 A;  4UA3 A;  1L0C A;  2B4D B;  4KOY A;  5DWM A;  1VHS A;  4HNY B;  3T9Y A;  3CXS A;  2AJ6 A;  3GY9 A;  4ZBG A;  4UWI A;  1UFH A;  4KVO E;  2Q7B A;  2K5T A;  2FXF A;  3FXT A;  1QSM A;  3DSB A;  4XPD B;  4M85 A;  3W91 A;  3ZZI A;  2BL1 A;  4CAX A;  3BJ8 A;  4K30 A;  4L89 A;  5ISV A;  2B3U A;  2HUZ A;  4R9M A;  1QSN A;  3K9U A;  4B5P A;  3DR8 A;  1YR0 A;  2JDC A;  4H89 A;  2ATR A;  3F0A A;  2QML A;  2OZH A;  4F0Y A;  1MJB A;  1Y9W A;  1S3Z A;  3SXO A;  2OB0 A;  4HKF A;  2VXK A;  3MGD A;  3TTH A;  3I3G A;  2Q4Y A;  3TOA A;  4LUA A;  1YX0 A;  4XNH B;  4KOR A;  2R8V A;  3ZJ0 A;  3F5B A;  3TO7 A;  2IL4 A;  4E8O A;  3PGP A;  4JD6 A;  4KOW A;  4NXY A;  4X5K A;  4MY0 A;  4HNW B;  1FY7 A;  2G3T A;  3I9S A;  3IWG A;  4UWJ A;  2OZG A;  1IYL A;  2VZZ A;  4CAW A;  5JQ4 A;  3P2F A;  3D2M A;  1KZF A;  2PDO A;  4MJ8 A;  4FD6 A;  5FVJ A;  2PRB A;  3G8W A;  5KTC A;  2QIR A;  2Q0Y A;  3IGR A;  2FCK A;  2OH1 A;  1M4G A;  4Y49 B;  4PSW A;  5IV0 A;  2VZY A;  4FD4 A;  2JLM A;  4MY3 A;  1B6B A;  4RI1 A;  2D4P A;  1OZP A;  1XMT A;  1VKC A;  1YVO A;  4NF1 A;  3NE7 A;  4NSQ A;  2VEZ A;  2C27 A;  5F49 A;  2X7B A;  4KOV A;  2GAN A;  4JXQ A;  3VWD A;  3FYN A;  3OWC A;  1ON0 A;  2B58 A;  4CRZ B;  2G3A A;  4YGO A;  3VWE A;  4XPD C;  4H6U A;  3KKW A;  2R98 A;  3GYA A;  5DWN A;  3DDD A;  1QSR A;  2B4B A;  5E96 A;  3D2P A;  4U5Y A;  2Z11 A;  1XE4 A;  4CAV A;  3EY5 A;  1WK4 A;  1BO4 A;  1KUV A;  2B5G B;  1V0C A;  1RO5 A;  3EO4 A;  1CM0 A;  2A4N A;  1P0H A;  1S7K A;  3E0K A;  1M44 A;  3QB8 A;  3TCV A;  4ONU A;  2Z0Z A;  1PUA A;  2VQY A;  4CRY B;  2F5I A;  4JXR A;  4UBR A;  2J8N A;  4XNH C;  5EC4 A;  2NMT A;  2Z10 A;  4AVB A;  4DNC A;  4II9 A;  1M1D A;  1IIC A;  2FT0 A;  2I00 A;  3F8K A;  3LOD A;  2QEC A;  1Y9K A;  1WWZ A;  1NE9 A;  4QB9 A;  4YRH A;  1XF8 A;  3P2H A;  2B4D A;  1J4J A;  4KUB A;  2OZU A;  1U6M A;  4MBU A;  5KTD A;  2ZW4 A;  5EBV A;  3TE4 A;  4PK2 A;  2O28 A;  2FL4 A;  1BOB A;  4AVA A;  1Q2Y A;  5CNP A;  4Y49 C;  4F6A A;  5HMN A;  3JUW A;  3N7Z A;  1MK4 A;  4R57 A;  1P4N A;  2R1I A;  1M4I A;  1YVK A;  3PP9 A;  5C82 A;  1S7L A;  3EXN A;  3SXN A;  2FSR A;  3TO6 A;  3TOB A;  1MJ9 A;  3T90 A;  4KLW A;  2G0B A;  4HNX B;  3SHP A;  2I79 A;  2BEI A;  4YFJ A;  1QST A;  2JDD A;  4KOU A;  2B3V A;  1N71 A;  1XEB A;  2PSW A;  4RS2 A;  4AVC A;  3D8P A;  1RXT A;  2CNT A;  4AG7 A;  2ZW6 A;  3JVN A;  1Q2D A;  4QBJ A;  2JEV A;  1Q2C A;  4KLV A;  4IUS A;  1S60 A;  1S7F A;  4KZT A;  1MJA A;  4U9Y A;  3FRM A;  1NSL A;  2WPW A;  4E2A A;  2Q04 A;  1TIQ A;  4M3S A;  3CXQ A;  3GKR A;  5H86 A;  2EVN A;  3LD2 A;  1XIX A;  4NEX A;  4R3L A;  3S6K A;  4B5P B;  3FNC A;  3FIX A;  2PQ8 A;  3RYO A;  3H4Q A;  4E0A A;  3S6G A;  2PR8 A;  4R3K A;  5C88 A;  3EC4 A;  5JPH A;  2OU2 A;  1YGH A;  3S6F A;  4PV6 A;  3B8G A;  4H6Z A;  1YLE A;  3R9F A;  3C26 A;  2Q4V A;  4AG9 A;  3QAH A;  4FD5 A;  3FB3 A;  2FS5 A;  2VI7 A;  5J8F A;  3R95 A;  2GIV A;  1GHE A;  1Y7R A;  4JWP A;  3PZJ A;  5H84 A;  4KOX A;  4KOT A;  3W6X A;  1R57 A;  1Z4E A;  4OAD A;  4LX9 A;  3R9G A;  1I1D A;  3DNS A;  1IID A;  1Z9U A;  3TO9 A;  2CNM A;  3R9E A;  3BLN A;  4XPL A;  2FIA A;  5KTA A;  4KVX A;  2ZPA A;  4J3G A;  4QUS A;  4OAE A;  5J8C A;  5F46 A;  5IB0 A;  4KUA A;  1B87 A;  4B5O A;  5I0C A;  5IX3 A;  1YK3 A;  2P6G A;  4QVT A;  1S5K A;  1S7N A;  3UY5 A;  3TFY A;  2CY2 A;  1K4J A;  4IF5 A;  2ZW5 A;  2VBQ A;  4GS4 A;  4PK3 A;  2HV2 A;  1M4D A;  2P6E A;  2B5G A;  2HQY A;  3G3S A;  3BJ7 A;  4QC6 A;  2P0W A;  1PU9 A;  1YRE A;  5F47 A;  4KOS A;  3WR7 A;  2FE7 A;  1LRZ A;  2PR1 A;  2REE A;  3TT2 A;  1KUY A;  2J8R A;  2BUE A;  1IB1 E;  4KVM E;  4FD7 A;  3S6H A;  3CXP A;  2R7H A;  4JJX A;  4BMH A;  3W6S A;  1QSO A;  2CNS A;  2ZXV A; 
#chains in the Genus database with same CATH topology
 5LYD A;  1LDD A;  1FSE A;  3DQV C;  4IQ4 A;  3S2H J;  2RC4 A;  1Y56 A;  3ZN1 A;  1R9T J;  1PUF B;  1I6H J;  3BHX A;  3LWF A;  4RMN A;  2JRM A;  2L3D A;  3BR6 A;  4PJL A;  3CMM A;  1O3R A;  1RES A;  5CPR B;  2KT0 A;  4BQO A;  1MW7 A;  2Q1Z B;  3P7N A;  3CDI A;  2K3F A;  3D3S A;  3PUB A;  5HS8 A;  4EEF G;  1M1E B;  4GRI A;  2ZEE A;  3CC2 I;  2CF4 A;  2DJI A;  3GO5 A;  1CJW A;  2Y0S N;  2P5K A;  1OYI A;  2ZKZ A;  3SXY A;  3HYI A;  3DR6 A;  2B0L A;  2CQQ A;  3GFI A;  2X4H A;  2HVS A;  4G9Y A;  2DMN A;  1XFO A;  3HUG B;  1IAW A;  3CCR I;  3IHU A;  3DTK A;  1I1S A;  2IQ6 A;  4R76 A;  1HA8 A;  1SC7 A;  1PYT B;  1YME A;  3T8W A;  3PB8 X;  4M3E A;  1D8J A;  2XAF A;  2DOA A;  3D1N I;  4BH9 A;  2ARH A;  2MGQ A;  5KCM A;  4IZZ A;  4J00 A;  4XLE A;  2V79 A;  3EFA A;  2EV0 A;  3IKV A;  1OCT C;  5THW A;  2XGE A;  1AOY A;  5ERI A;  1U3E M;  2IS1 A;  2DA1 A;  2WSA A;  5EYR A;  3NWS A;  5FFX A;  3H5Z A;  4OLL A;  4JYK A;  4UV9 A;  4EM1 A;  3SZT A;  2KCW A;  2WV1 A;  3LSI A;  2K85 A;  2L7K A;  4S05 A;  3A4C A;  1L0C A;  4P10 A;  5E1Z B;  4KMF A;  4PFP A;  4A69 C;  5D5U B;  3OYC A;  2QEX I;  2XC7 A;  2F7V A;  4PPZ A;  5J6X A;  4HNY B;  2KJC A;  1JHH A;  2BXY A;  2O4H A;  1WI9 A;  4CGZ A;  3IO1 A;  2F5C A;  5HVQ C;  1PUF A;  1IN6 A;  3WHC A;  4FQG A;  2UZK A;  3W2V A;  4KVO E;  3S3N A;  2IBD A;  2CV0 A;  2Y48 A;  1MMN A;  2V8G A;  2MH2 A;  3FXT A;  2OC6 A;  2QEN A;  2V1X A;  2V6C A;  4M6X A;  2HR3 A;  2JA2 A;  4KN7 X;  3ZP5 A;  1GVJ A;  2CRG A;  5ICG A;  1IUY A;  5LRR A;  1RI7 A;  1TWC J;  2JA6 J;  5LGT A;  2HGC A;  2B7E A;  5DCM B;  3JSP A;  1B72 A;  4CAX A;  4IQJ A;  5ICE A;  2NRA C;  3A1Y A;  3FXM A;  2PJ0 A;  3BJ8 A;  3V8L A;  5ISV A;  4ZZL A;  2B3U A;  4IRI A;  2HUZ A;  2KFD A;  2XAJ A;  3KYD B;  3DR8 A;  2CV2 A;  1IXR C;  3VYU B;  2DN0 A;  1OQY A;  3A2K A;  3AL0 C;  1VQ8 I;  2DFH A;  4LOC A;  9ANT A;  2ZOG A;  4C2X A;  3LOC A;  4UHT A;  1NK2 P;  3WTV C;  2R7V A;  3PSI A;  3QU3 A;  3K2Z A;  3HPG A;  1FTT A;  4P6Y A;  4HQE A;  3D66 A;  1G3Y A;  2O8K A;  3VEP A;  3SXO A;  2VOD A;  4NJQ A;  2JT1 A;  4L5I A;  4BJ5 C;  1DU6 A;  2DA4 A;  2FQ4 A;  1BIA A;  2PJ3 A;  4ESF A;  5KHD A;  1U8B A;  3MGD A;  3MEX A;  3L2V A;  2K9N A;  2XKO A;  4YFK F;  1AYE A;  1Z5R A;  2Q4Y A;  3Q9V A;  1YW6 A;  4M6G A;  1OBR A;  3CD6 I;  2AO9 A;  5DYM A;  1K4S A;  3ZPL A;  1XD7 A;  3EYY A;  3PBE A;  4RB1 A;  3DWL E;  2IL4 A;  1QBJ A;  2V26 A;  2VXD A;  3GBG A;  4NXY A;  3K1P A;  2C6Y A;  4X5K A;  2OZ6 A;  3PFI A;  2JWT A;  2WA0 A;  2WV0 A;  1LB2 A;  4MY0 A;  2WWY A;  2AFW A;  5CVU A;  4DYR A;  5JH9 A;  3ISZ A;  2JEW A;  2PJC A;  3VFZ A;  1MKM A;  3QOE A;  2VOO A;  3IWG A;  5HDN A;  2G7H A;  2HPI A;  3OIP A;  2OZG A;  1IYL A;  5DCM A;  5HLH A;  4PXB A;  2JJ7 A;  4BD9 A;  1E0E A;  4HA8 A;  3HGY A;  4RS8 A;  1OCR H;  3W2W A;  1KZF A;  3JRH A;  2PDO A;  4CHU A;  2FJ1 A;  2W85 A;  4FD6 A;  5FVJ A;  1MMD A;  2VB6 A;  2VBY A;  5E20 A;  1MBK A;  5KTC A;  3C3W A;  3IGR A;  1B9M A;  4CCO A;  4M9X A;  5F04 A;  1M4G A;  3PL8 A;  2QVO A;  1FYL A;  1R5I D;  3E97 A;  1TWF J;  5D5V B;  3IU2 A;  3NH4 A;  2JUG A;  4UIA A;  2Z3N A;  4XSX F;  3HOX J;  4BXX J;  3CJQ B;  2NVQ J;  2EIN H;  2D4P A;  1BBY A;  3S32 A;  4XKW A;  5LBQ A;  2YS9 A;  2DMT A;  2VN2 A;  2PJ8 A;  4QIW N;  1MSE C;  5FLX K;  4FWU A;  3IRQ A;  4U0V A;  3QNV A;  2QKM B;  4FAS D;  5C3E J;  4CYD A;  1MNE A;  2XSJ C;  2C6P A;  4NSQ A;  4F7Z A;  2MLG A;  1EH8 A;  2YX4 A;  4YWY A;  1T8I A;  2X7B A;  1S7E A;  1N78 A;  2RN7 A;  2BHY A;  2Y30 A;  4II2 A;  1UFM A;  5CKT A;  3OWC A;  3RAM A;  3VWD A;  3S1N J;  4FBE A;  4HF1 A;  1BIB A;  3AG4 H;  4RB0 A;  2FVG A;  2G3A A;  3H9Q A;  1OKR A;  5HDK A;  1TWA J;  5K7H A;  1FJL A;  4A3M J;  4F0X A;  2QQ9 A;  2R98 A;  3HOS A;  1GHC A;  2QYV A;  1V3F A;  2JSP A;  1X4P A;  4M74 A;  1QSR A;  4UV8 A;  1OYY A;  5EZH A;  3LSK A;  2OPT A;  1TW2 A;  2VE9 A;  4Y13 A;  4OIR F;  3QAY A;  2LF8 A;  2Z3Y A;  1ZTR A;  2V8V A;  1QZZ A;  2O5R A;  3H0D A;  2CMP A;  1NG7 A;  1MMG A;  2VAS A;  4C9Y A;  2G0E A;  2W00 A;  1ZG9 A;  2RV8 A;  2HXO A;  3KZI C;  1WRJ A;  1V0C A;  1T38 A;  3F9K A;  2HTS A;  1CM0 A;  2NYQ A;  3CCU I;  1A04 A;  2I10 A;  2IGK A;  5M5W J;  4EWT A;  4PK4 A;  5DM7 F;  2MFZ A;  2LKX A;  4UVB A;  1X3Z B;  3OYB A;  3LAP A;  4G7Z F;  3K4J A;  4KUM A;  3F72 A;  5A27 A;  4F92 B;  5FKN A;  5LEK A;  3CJT B;  2ZXW H;  3BJ6 A;  1PUA A;  4NNJ A;  2ISY A;  5J4V A;  3KEQ A;  4YG2 F;  1RET A;  2EFQ A;  4XON A;  5FKL A;  4BE1 A;  2EZI A;  3IH4 A;  5FO5 A;  4II9 A;  2A69 F;  4IPA A;  3ZQ7 A;  5K5Q A;  4UFW A;  3F8K A;  2ECC A;  3J7Y J;  4MLO A;  1ONV A;  2VKV A;  3S1Q J;  3U9G A;  1WQ2 A;  1U78 A;  3LQQ A;  3JRU A;  4ONW A;  1Y1V J;  4NGT A;  1WWZ A;  4RAZ A;  4B4C A;  3MN8 A;  5FLX Z;  2M4G A;  3KP3 A;  3CDH A;  4DZP A;  5IT9 K;  4IK2 A;  2B4D A;  4X3R A;  4M72 A;  3IC7 A;  1H9T A;  2BVM A;  4KUB A;  2UWM A;  4B14 A;  1S7A A;  3K4L A;  4A37 A;  1ZO0 A;  1D8K A;  4MBU A;  1ZLK A;  3FXO A;  5KTD A;  2E5N A;  3HRS A;  4BS9 A;  3D67 A;  3OIQ A;  2TRT A;  4HEA 2;  2VKH A;  3BPV A;  1YRN B;  2KIS A;  3FXU A;  3V4G A;  4PK2 A;  2E35 A;  2O28 A;  2YNC C;  3R0J A;  2FL4 A;  3ZQG A;  2BVL A;  4M6I A;  2AFU A;  4LLG F;  1YS6 A;  1Q2Y A;  3KE2 A;  3CT9 A;  1NTC A;  5CNP A;  4KIG A;  3V7S A;  3WHB A;  1XMK A;  4KIF A;  2Q7S A;  4B09 A;  3JR9 A;  2IVM A;  1EE3 P;  3N7Z A;  1LFB A;  3ROU A;  2FU4 A;  4R57 A;  2P6S A;  1MBG A;  1WJ5 A;  2B9S A;  2FMY A;  4A38 A;  4XOP A;  3S3M A;  1Z7L A;  1DU0 A;  1W4M A;  1YVK A;  1LJ9 A;  4IHY A;  4Q7A A;  4PXC A;  4DUK A;  3DU5 A;  3PP9 A;  1S7L A;  3SXN A;  4YIF A;  3NAR A;  1IU8 A;  3JRG A;  4H4K C;  3TO6 A;  3PFY A;  2KP6 A;  2XHK A;  5ICC A;  1MJ9 A;  4CUG A;  1RTQ A;  3FED A;  1IRX A;  4DGW B;  3PQK A;  3ZQI A;  2DMP A;  4WXH A;  4XLF A;  2VC1 A;  3PNV A;  4KLW A;  1USS A;  5EGO B;  2G0B A;  2GA1 A;  1VQN I;  3I4P A;  1X4O A;  1ARL A;  1VF9 A;  2I79 A;  4C2T A;  1OJL A;  3KLO A;  2ECB A;  5EEA A;  2L9N A;  4I2O A;  1JQG A;  2DK5 A;  2I3C A;  2HYF A;  2PJA A;  2ETH A;  5LYL A;  1X10 A;  2PSW A;  5DTD A;  4X2T A;  1I3A A;  2ANP A;  3CMY A;  4XQF A;  1Y0U A;  1S29 A;  1Q2D A;  2VL8 A;  2JEV A;  4P4B A;  5CVV A;  5HVH A;  5HLT A;  4FCY A;  2VUM J;  2W1O A;  5CVR A;  4U9Y A;  3LQR A;  5EG0 B;  3VPR A;  4MIM A;  3KQZ A;  3J81 Z;  4EFD A;  2ZSI B;  1XPX A;  5HVF A;  2XB0 X;  4HPS A;  3GUD A;  3GKR A;  1BW6 A;  5TIS C;  4HAM A;  3BCA A;  2NSM A;  5H86 A;  1X3U A;  2C6G A;  3HM5 A;  1XSD A;  3CO6 C;  3MKL A;  3BTL A;  2EVN A;  1XIX A;  3LD2 A;  4R3L A;  3GFL A;  3S6K A;  3B3T A;  4MQ9 F;  3K70 D;  3FNC A;  1W36 D;  3BR2 A;  2QZ8 A;  3S6G A;  1K83 J;  1TQM A;  2HQN A;  3EUH A;  4U0Y A;  3PB7 X;  2E60 A;  3K4B A;  2ZME B;  3PUF A;  3ZMS A;  3D7D A;  2OCC H;  1IV8 A;  2W48 A;  1OCO H;  3T5X A;  4DBR A;  2O7O A;  3EC4 A;  2DA3 A;  2IJZ A;  3IIB A;  3F6V A;  3W3C A;  5BS6 A;  1X19 A;  5BOX A;  5IP6 A;  2XGC A;  4CGM A;  1REP C;  1PP7 U;  5E3M A;  2XB5 A;  4FTH A;  3L2R A;  2IJL A;  1VQP I;  2I5U A;  4PV6 A;  4YFX F;  1VQ7 I;  2JTV A;  1I6X A;  2F5E A;  2BW3 B;  4AUX A;  3H8E A;  2ADU A;  3R9F A;  5L3C A;  3F22 A;  2DOD A;  4PGH A;  1PCA A;  1TLH B;  2Q4V A;  3IEH A;  4AG9 A;  2AFS A;  1LE8 B;  2R5Z A;  2KKO A;  2COB A;  3ZXS A;  3M8F A;  4H0E A;  3RZA A;  1YOV B;  3FHZ A;  2YGW A;  1GHE A;  2W4S A;  1MMS A;  4OID A;  1ARM A;  3MZY A;  1P4X A;  3O3K A;  3RKQ A;  2QVP A;  1ETO A;  4JWP A;  2XUB A;  3IP4 B;  4J19 A;  2L4A A;  1T56 A;  5H84 A;  4KOT A;  2K7L A;  2F6C A;  2HQ5 A;  3FWE A;  2HI3 A;  4BKX A;  1WJC A;  4KT5 C;  1H8A C;  5TGT A;  4UB6 C;  2R92 J;  1UMQ A;  1Z4E A;  1FEX A;  2ZFU A;  5G20 A;  2ACJ A;  3WE3 A;  5EG0 A;  1TXR A;  3MZ8 A;  4HF0 A;  2H94 A;  2PIY A;  4LX9 A;  1YG2 A;  2OCE A;  4XR6 A;  2X6O A;  4A32 A;  4Q36 A;  5EEG A;  1ZG5 A;  4F9V A;  4IF4 A;  3H8F A;  2XAG A;  5IPA A;  1IID A;  2Z1D A;  1BI3 A;  5LYF A;  3FK6 A;  5JR3 A;  1XMA A;  2IW5 A;  2FIA A;  2K02 A;  4BAY A;  3LMS A;  3EUH C;  3LL7 A;  4EJW A;  1D5Y A;  4KVX A;  1J75 A;  5KTA A;  4BAC A;  4OAE A;  2BY1 A;  4ZH4 F;  4XIC A;  5IB0 A;  3S1M J;  5B1A H;  2BY0 A;  4TNU A;  3MKZ A;  3EUA A;  2VQG A;  4NDL A;  1EA3 A;  2GBY A;  3KZZ A;  3SQN A;  3RKY A;  1WZ2 A;  2ABZ A;  3GIU A;  4I6Z A;  5IX3 A;  2Q4Z A;  3TP0 A;  1YX3 A;  4OAY A;  4B3A A;  3MKY B;  4W1U A;  3ZQQ A;  4E7L A;  3SI2 A;  3TFY A;  1U6G A;  3CCY A;  4L0Y B;  3VH9 A;  4JP0 A;  4L9N A;  4G6Q A;  4FHT A;  4P96 A;  3IWF A;  4FX0 A;  1RRJ A;  2DDB A;  3BT9 A;  2EH3 A;  3CLO A;  5KVR A;  2F2E A;  3FMQ A;  2ME6 A;  2QWW A;  1W7P D;  1T0F A;  4XKC A;  4I76 A;  5KNL A;  5D29 A;  4LIU A;  1O3S A;  7CPA A;  2B5G A;  4A94 A;  4D5F A;  3H3Z A;  1ORK A;  1KYZ A;  2A3S A;  1LE8 A;  4RUH A;  2FE3 A;  3ECH A;  3OR1 C;  3G3S A;  1IY7 A;  2EK9 A;  4JX4 A;  3BJ7 A;  1MIJ A;  4QC6 A;  1WFX A;  1J5Y A;  1P92 A;  2Y75 A;  2FML A;  4XLN F;  3IU1 A;  5LD2 C;  2KIM A;  4NJR A;  2CUJ A;  5DS9 A;  5HDG A;  4PCQ A;  4KSF A;  2NVU B;  2QBY B;  2PR1 A;  4KIS A;  1J0R A;  3KYC B;  5KK1 A;  5JHU A;  1IG7 A;  2BUE A;  2CU7 A;  2EFO A;  3H5R A;  5FGM A;  5JI6 A;  2ZXV A;  4L8A A;  3FBI B;  4MHD A;  3PB4 X;  3FF5 A;  4P44 A;  4FAI A;  5FJ8 J;  4S04 A;  2E19 A;  1S72 I;  4HNU A;  2OUM A;  4JX6 A;  1Z8L A;  1W5C C;  1FYM A;  3R1K A;  3OYM A;  5HH1 A;  4UCN A;  2D4O A;  2E1M B;  2WPX A;  2BGC A;  4P5O A;  1TT0 A;  4CYC B;  1R5G A;  1QQI A;  3B6A A;  4B6Z A;  3G1L A;  2VL1 A;  3UR3 C;  1F4K A;  3CO7 C;  4XN0 A;  3V8J A;  1I21 A;  1WWX A;  5HNH A;  4KT6 A;  2BSW A;  3WTT C;  5D5X B;  2NNY A;  1WPK A;  4CS0 B;  4F93 B;  3OYK A;  1OFC X;  3OYJ A;  2VKD A;  4D5C A;  3WTW C;  3CF5 F;  2WYR A;  1IN4 A;  3SHF A;  1XCV A;  1IOI A;  1TC3 C;  5EF6 A;  2KMU A;  3GW2 A;  3F23 A;  4Q5S F;  2QGU A;  3CF2 A;  4I0A A;  4E7H A;  2Q44 A;  4M3G A;  1GDT A;  3BI0 A;  2J8M A;  4C68 A;  4EVY A;  3B7I A;  1KU3 A;  2K40 A;  2IA2 A;  3LSJ A;  4X6A J;  2MSY A;  2H5M A;  2EWB A;  4NB5 A;  2EPF A;  3I0T A;  4R87 A;  1LKX A;  2POK A;  2R7U A;  1HXD A;  3A01 B;  1OIS A;  3CME I;  4MEX F;  2HYJ A;  1JUM A;  3E5X A;  5JLW A;  4CZZ A;  5F48 A;  2MD5 A;  3F3X A;  3JW4 A;  3OIO A;  3R96 A;  4I49 A;  3GZ5 A;  3ML6 A;  3TMO A;  2P81 A;  1MBH A;  4AB7 A;  4LG3 A;  5GCN A;  2XGX A;  1JHF A;  5IYC J;  2DCE A;  1R7J A;  3HKZ N;  4E7K A;  1Z6R A;  3GLJ A;  3OOP A;  3IWZ A;  3WTY C;  1ULY A;  2EK5 A;  2X1E A;  1DGW Y;  3KEY A;  3A0H C;  1VHS A;  5DWM A;  3ZQF A;  3KR4 A;  3DEE A;  4BEH A;  1YJW I;  3U21 A;  1JGS A;  3DPL C;  4MFZ A;  3GTM J;  3CXS A;  2VIX A;  3GY9 A;  2JVG A;  1OMI A;  4ZBG A;  4UWI A;  5D6E A;  5JVG F;  3CES A;  3F0C A;  2GWR A;  3JCU C;  2FXF A;  1KU7 A;  4ZJZ A;  4DOZ A;  3WC5 A;  4HOB A;  4BHC A;  4BL0 B;  3LSP A;  1NG6 A;  1QSM A;  1E3H A;  2NNN A;  3K4C A;  1F57 A;  2QUF A;  2M3A A;  1DP7 P;  4EM2 A;  4GM5 A;  1ZRD A;  3ESW B;  1Z1D A;  1EKE A;  2BL1 A;  2K27 A;  3SJF A;  2KRC A;  2Y9Z A;  4HQM A;  5LLQ A;  3QOD A;  4KNY A;  4UUT A;  2QJ8 A;  5JHF A;  3ZCO A;  3H92 A;  4LGW A;  2LF7 A;  3SZP A;  2AFZ A;  4P4I A;  1ZHF A;  2GU2 A;  3VDX A;  2PMZ A;  3M7G A;  2HDD A;  1YR0 A;  2NS7 A;  3P5J A;  1KU9 A;  1TQP A;  4NGS A;  1I1G A;  3SDG A;  3KX2 A;  1XG1 A;  3F0A A;  1B6A A;  1EV7 A;  2EV5 A;  3ABU A;  5TRD A;  1XDU A;  2PIZ A;  1IRF A;  6CPA A;  2QML A;  3WTU C;  3DCF A;  1QZY A;  4N9H A;  2HOA A;  3BDD A;  1MJB A;  2DJN A;  3GTK J;  1Y9W A;  4CSW A;  4HST A;  3FIW A;  3GLL A;  1SFE A;  1ETW A;  2XPW A;  2OB0 A;  2E71 A;  4ZX9 A;  3BR5 A;  1HBX G;  1YLF A;  4HKF A;  4MHY A;  3IAM 2;  2VXK A;  2M34 A;  2R5Y B;  3TTH A;  4GXO A;  2L7F P;  3BCB A;  4AYB N;  3OS2 A;  4FET A;  3N05 A;  3G4S I;  2C6C A;  4LUA A;  1YX0 A;  4P4J A;  3RPQ A;  4XNH B;  2WB1 A;  1FMV A;  3ZJ0 A;  4XBF A;  2E1M C;  4D7M A;  4MFJ A;  4E8O A;  4AM3 A;  4MEY F;  2WY7 Q;  4C2M J;  3PFO A;  3GX4 X;  2D1H A;  1K78 A;  1A5J A;  1FNO A;  4M3D A;  1JTX A;  2ZEP A;  1YW7 A;  4OIW A;  4QTR A;  1FY7 A;  1XRY A;  3B3W A;  4E70 A;  1F1Z A;  1QGP A;  2GLF A;  4A6D A;  4YFN F;  2IMO A;  2AFM A;  4CPA A;  2EA2 A;  1TF8 A;  4UWJ A;  1TP4 A;  1KGS A;  3RYR A;  4BUP A;  1ZYR F;  4CAW A;  4CYO A;  1DQU A;  2HOE A;  3DLJ A;  5K5O A;  3K2K A;  3P2F A;  5K8N A;  4A3B J;  3HOZ J;  1G3W A;  2A5Y B;  1R4N B;  3LWU A;  2Q2E B;  1YQA A;  2Y2Z A;  1JT6 A;  2L7Z A;  3QOP A;  3CCS I;  5F0H A;  2PRB A;  1VI0 A;  2PJ1 A;  1Y0N A;  2GA2 A;  4ZI6 A;  3EYI A;  2BV6 A;  4DW6 A;  4Y49 B;  4PSW A;  2ZXH A;  1D0X A;  4FD4 A;  5C44 J;  2JLM A;  4MY3 A;  3O2P E;  5HS7 A;  1R4M B;  1F2O A;  1DTD A;  2ESH A;  2QLZ A;  2Y69 H;  4NBQ A;  1G2H A;  4CCM A;  2DFF A;  4RI1 A;  3HBL A;  4WX9 A;  1JKR C;  1AUG A;  2WTE A;  1XMT A;  2AXL A;  3MKW B;  2JVH A;  4XRS A;  3PIO F;  1W0T A;  1H9G A;  5FKM A;  1Y8R B;  5E3N A;  1YVO A;  4KA4 A;  1CPS A;  1H8L A;  3K9T A;  3NEU A;  5LGN A;  2EB7 A;  4ESB A;  4XID A;  3NE7 A;  2L9R A;  3FXL A;  5FD5 A;  1XGN A;  1LAP A;  4ZY0 A;  1ETV A;  3HOY J;  3H0G J;  3ZMV A;  4M6V A;  3ZQC A;  5E3L A;  2GOX B;  4JXQ A;  1KQ0 A;  3COA C;  4JYW A;  1Y6I A;  2V4J C;  1ON0 A;  1R49 A;  3KP5 A;  5I4M A;  2M9H A;  1G3T A;  4OIN F;  2LRE A;  2PJ9 A;  3JTG A;  4IAV A;  4YGO A;  3ELK A;  1BPN A;  4CGL A;  2R0Q C;  2M2E A;  4BBH A;  2EO8 A;  2ZC2 A;  3GFJ A;  4CCN A;  5F0F A;  4A3E J;  4NGR A;  5J1Y A;  1F43 A;  3OYF A;  5HLI A;  1PYV A;  3GUX A;  1QPM A;  4EME A;  3HRT A;  4Y7N J;  5H2F C;  3HUV A;  2LY2 A;  5DWN A;  3ASO H;  4BU2 A;  3DDD A;  2ZNY A;  2YND A;  5FLM J;  1FTZ A;  4A0Y A;  2IAI A;  5L3B A;  1IRG A;  3I56 I;  1TWG J;  3B35 A;  2L02 A;  2L4M A;  3ABM H;  3SZG A;  2LSO A;  3D2P A;  4CCL A;  3FXJ A;  2KRH A;  1KA8 A;  4HW0 A;  2Z5U A;  1HOM A;  2M87 A;  1WK4 A;  4A3L J;  2ZJP F;  4JK1 X;  2CIJ A;  3MZH A;  2ICW G;  1TWH J;  3ZMD A;  1R5H A;  2STT A;  4OC4 A;  2JUC A;  2E1N A;  3RTR A;  5JVT A;  5IOZ A;  3CC7 I;  2A4N A;  2WY8 Q;  2PX9 A;  3OYG A;  1M44 A;  3QB8 A;  3TL4 X;  3HUG A;  2IGM A;  1B8I B;  1MH3 A;  2M45 A;  2BO9 A;  4ONU A;  4HSR A;  2VQY A;  4EMS A;  2RNJ A;  1XB4 A;  4JXR A;  2DA2 A;  3QP5 A;  1SAX A;  3V38 A;  5IYB J;  3E5Q A;  2NMT A;  2WAF A;  4XNH C;  1VQ9 I;  2QSH X;  2Z10 A;  4IHV A;  3WAB A;  2ISZ A;  2LDU A;  4QSH A;  4B12 A;  4UUS B;  3P9I A;  1QPI A;  4F52 A;  3BG3 A;  5HVG A;  4L18 B;  4DYO A;  2I00 A;  2JA5 J;  5K5R A;  2RFH A;  1YO5 C;  4CCK A;  3G71 I;  1QHH D;  3HL2 A;  2L54 A;  2K86 A;  2BY2 A;  3F6O A;  4MFL A;  1NE9 A;  4A6E A;  3OYL A;  4LJZ F;  3MFK A;  3SI1 A;  2G9D A;  1WJA A;  4GYI A;  2E2I J;  4LK0 F;  4GDF A;  2FSW A;  3P2H A;  1QVU A;  4QB9 A;  4YRH A;  3AAF A;  4NQW B;  2EIM H;  2ZB9 A;  2FX0 A;  2HNH A;  2XAU A;  2AS5 F;  2OTL I;  1S3J A;  1U6M A;  5A28 A;  2W24 A;  5LGU A;  3LFU A;  3RSN A;  1FBU A;  4HV6 A;  3R0A A;  2JN6 A;  2XVC A;  3ZMU A;  4CYQ A;  1YW9 A;  2DLL A;  1XTA A;  4IKF A;  4AVA A;  1MSF C;  3O8G A;  3IC1 A;  4Y49 C;  1VQ4 I;  4F6A A;  4EQQ A;  2DFE A;  1RR8 C;  5HMN A;  3BQZ A;  1QU3 A;  2LC2 A;  2ZEO A;  3JUW A;  3JAM K;  5BQT A;  3LFK A;  3VOE A;  3HRU A;  4N4N B;  1M4I A;  1X3W B;  2Y9Y A;  4ENK A;  5D4S A;  4AYB A;  1SFO J;  4WK8 F;  2EK8 A;  1DPR A;  4EM0 B;  4O5V A;  5HS9 A;  3M3Y J;  3BTJ A;  4JX5 A;  2NVY J;  3L1P A;  4XM3 A;  3AG1 H;  4P55 A;  2VT3 A;  2GZW A;  2VI6 A;  5GTH C;  2CFX A;  2X6X A;  3R4K A;  3L2W A;  1VFC A;  4OIP F;  2V9V A;  4EGY A;  1R1U A;  1VQ6 I;  5GAG J;  4ZDO A;  3I5U A;  3D5L A;  3WC6 A;  2Y31 A;  4CYN A;  3BZK A;  2XAS A;  3I53 A;  3K4N A;  2NXN B;  3OS0 A;  2L9S A;  1R43 A;  2DQL A;  4KOU A;  5IOY A;  4UF4 A;  3K69 A;  5BPD A;  3FMS A;  4RS2 A;  3MWM A;  4BE2 A;  1RXT A;  3D8P A;  4W9Y A;  3VAR A;  1UHM A;  4BQQ A;  4EJT A;  4QBJ A;  2D5V A;  1R58 A;  4G12 A;  2FUG 2;  2PMH A;  3K0L A;  1JTY A;  2X6W A;  3J80 K;  1S60 A;  1BW5 A;  1S7F A;  4KZT A;  1MJA A;  3FRM A;  1NSL A;  4ZX8 A;  2NOJ B;  2COM A;  1SD7 A;  5FB2 A;  4AXV A;  4AIK A;  3K7A J;  1XCB A;  4AU7 A;  1W5T A;  4A0X A;  1JT0 A;  2ZFW A;  5K1Y A;  2VQC A;  3GVA A;  2HZT A;  4Y17 A;  2Y0S A;  2X1D A;  3W2A A;  5BWA B;  3TX8 A;  4CDG A;  1XC5 A;  4QWQ A;  4PUS A;  4BXF A;  2EFP A;  2GIZ A;  2X6Y A;  4NEX A;  4ZYE A;  3WU2 C;  4B5P B;  1BR2 A;  1BM9 A;  2W82 A;  3FIX A;  2PQ8 A;  5AIP A;  4D0P A;  2CUE A;  4X0G A;  2YNE A;  2ZSH B;  1S7O A;  2V9K A;  3C2B A;  2XEI A;  2ZEM A;  3M9A A;  4YU9 A;  4RDU A;  1ELM P;  4R3K A;  3OOU A;  5C88 A;  2DMQ A;  1LAM A;  2UV1 A;  4IHS A;  1RPW A;  1ZAR A;  1GYT A;  4P4D A;  1Z05 A;  1YGH A;  1Y0Y A;  4CGO A;  2V1N A;  4MQV A;  1FOX A;  3DEU A;  5JGF A;  2YNC A;  4KJZ A;  3JAM Z;  2YR2 A;  2LLK A;  2M4K A;  2J9A A;  3C26 A;  3VB2 A;  3DFG A;  5CYV A;  4UEF A;  4PJN A;  3B2Y A;  2VBW A;  3D0S A;  2VI7 A;  5C4J J;  3FB3 A;  4MFP A;  4XLC A;  3C18 A;  4A3K J;  2O8X A;  1ZQ3 P;  4B13 A;  5M3F J;  3SFI A;  2BY3 A;  2G9W A;  2O9L A;  2IS4 A;  2MYS A;  2YU3 A;  3CCE I;  3FF3 A;  4MCR A;  4E7Z A;  1BJA A;  4CZC A;  1UB9 A;  3VSK A;  2JPB A;  4AIH A;  1OYW A;  1IV6 A;  2M7A A;  4P9F A;  1BN5 A;  1HKQ A;  1O3T A;  4UIB A;  2ME0 A;  1LFU P;  4UNO A;  2ZXJ A;  2B63 J;  3WTX C;  3JRE A;  2A6T A;  2QCO A;  3HZJ A;  3J81 K;  5D8L B;  4YIR X;  2OTJ I;  1D1B A;  3CPA A;  2QQ8 A;  1Z9U A;  3SDB A;  2FXA A;  2CNM A;  5DD4 A;  2AHQ A;  4F3Q A;  2I8D A;  3GCM A;  4O6J A;  2L5Q A;  5JLX A;  2ZPA A;  4QUS A;  3EQL F;  3RQ4 A;  3QYB A;  3ABK H;  1SMT A;  2NAZ A;  4M9S A;  1N75 A;  5J8C A;  2LMD A;  3J80 Z;  2EBJ A;  2CWE A;  2UXX A;  3BY6 A;  1YS7 A;  3BR3 A;  3E6D A;  1ETY A;  3MD2 A;  4KUA A;  2OJE D;  2QM3 A;  4WXD A;  5LFA A;  5I0C A;  5BNG A;  2HWV A;  3Q0W A;  3NE8 A;  3OYI A;  1MGT A;  2UUZ A;  1ZR4 A;  4FE4 A;  1BC7 C;  1RC9 A;  2P6G A;  4C2U A;  1FBS A;  1S7N A;  1GLN A;  1Z8W A;  3P9K A;  4KMU X;  3PQJ A;  4BIN A;  5CVJ A;  5CQG A;  3DXJ F;  4RB3 C;  2VLA A;  2DYR H;  2HV2 A;  1TT5 B;  2DTZ A;  3K6G A;  3CUQ B;  4B8X A;  3EDP A;  1CG2 A;  3F8N A;  3HB9 A;  4XK4 A;  5H6Q A;  2F4M B;  4UXN A;  1ETK A;  1MDM B;  3E6B A;  4DBQ A;  3BJA A;  4QPO A;  4Q47 A;  1UHW A;  3B3V A;  4M6H A;  4ZYH A;  4OC2 A;  4L9J A;  2HYG D;  1V5F A;  3MVP A;  2VJI A;  3OV8 A;  3OWT A;  1VGY A;  4MGR A;  1Q1V A;  3VOD A;  2PLY A;  1PU9 A;  1RUN A;  5F47 A;  4KOS A;  2V6E A;  2PBI A;  4ITV A;  1JUP A;  3TT2 A;  5M5X J;  4B48 A;  1NK3 P;  2J8R A;  5J1R A;  3T8R A;  2VJ5 A;  4G6D A;  4BQN A;  3CCQ I;  3RBU A;  3RZO J;  5F08 A;  4JJX A;  1RR7 A;  3CJN A;  4Y52 J;  1R1V A;  4CRZ B;  3VWE A;  4MI4 A;  1IGN A;  4ZDP A;  4S0H B;  1CBX A;  3TGN A;  4IHT A;  4EJO A;  3C7J A;  2ZO4 A;  3HOU J;  1PUE E;  1SQH A;  2E2J J;  4C30 A;  3PFE A;  4D9J A;  1Z6T A;  3CPX A;  3IL2 A;  2K9S A;  4HX8 A;  1ZG1 A;  2LK2 A;  4PJJ A;  4BY7 J;  1HLV A;  1Q7L A;  3D7H A;  2F5V A;  4E7S A;  5CLS A;  2IS2 A;  1Z4R A;  2W57 A;  3H5N A;  2WUU A;  4NCZ A;  1I12 A;  4ZZD A;  2OD5 A;  1IUF A;  1RKT A;  2WAQ N;  4FIS A;  4OME A;  3S17 J;  3FBU A;  3VSL A;  3SFZ A;  2XRO A;  2HPM A;  1NSA A;  1YRN A;  2HVR A;  4A3C J;  4EGZ A;  2IT0 A;  4WXC A;  5DUI A;  3HHH A;  3DBR B;  1KUX A;  4PQA A;  2XF7 A;  1V55 H;  1BI2 A;  2ID3 A;  1P2F A;  1YW4 A;  1MDM A;  5GAE J;  1S8N A;  2EBI A;  2MBF A;  2EUI A;  1I27 A;  1SVL A;  3FM3 A;  1TKF A;  1Z67 A;  2RGV A;  2IRF G;  1W1W E;  2XEG A;  3A03 A;  2LFB A;  4IHX A;  1ZH5 A;  1LOK A;  4B11 A;  2H8W A;  3IH3 A;  4I7H A;  1NMT A;  1GUU A;  2GXG A;  4J01 A;  1LFP A;  2IXS A;  2FRH A;  2Y0M A;  1IW7 F;  2F48 A;  1YSJ A;  4BHP A;  4JOM A;  3DBL B;  3SI0 A;  5CVI A;  4RAF A;  4ZYG A;  1U2W A;  2EQR A;  5EGO A;  2VJJ A;  4LG0 B;  2FNA A;  3I54 A;  3PO2 J;  3FMR A;  3S2D J;  4BJ6 C;  1CP6 A;  3DKX A;  3FKI J;  2K4J A;  3IRR A;  4FX4 A;  2VOP A;  3I71 A;  2ZEG A;  3GTL J;  4CO8 A;  4CXF A;  3T9Y A;  4PGG A;  3OYD A;  2CQN A;  4ZY2 A;  1WJB A;  3J7Z I;  2MG4 A;  3QYE A;  1L3L A;  2P5V A;  1UFH A;  1SFX A;  2HDC A;  3LA2 A;  3SJE A;  2Q7B A;  3NRV A;  2K5T A;  2V1D A;  3Q3S A;  3ZGK A;  3M1C A;  4BDZ A;  2CV1 A;  2XAQ A;  1PJR A;  1EH6 A;  1IRZ A;  2IGO A;  1ETQ A;  4U88 A;  3P9C A;  5H6R A;  3HOV J;  1IOF A;  4IHM A;  2CTC A;  3IH2 A;  2GAU A;  3S1R J;  5EZG A;  3FM5 A;  3DSB A;  3H3V K;  4XPD B;  4M85 A;  3ZZI A;  1Z21 A;  2QSF X;  1KQ9 A;  4A2U A;  1DDN A;  3J7A O;  2OR4 A;  1ZAO A;  3D68 A;  4NGM A;  3QYF A;  2CQX A;  3G6E I;  3OMY A;  1ON2 A;  3CUQ C;  4HZF A;  4K30 A;  2Q51 A;  1QO0 D;  1QA6 A;  1SMY F;  4Y33 A;  3D4U A;  1XMX A;  5K7Z A;  3KQX A;  1K6O A;  3I58 A;  3OSF A;  1IDZ A;  3K9U A;  3MN2 A;  2XKP A;  4PFO A;  5GAD J;  4MMO A;  1J09 A;  4H89 A;  3R6S A;  2ZCW A;  3RJP A;  2P7C B;  2VKE A;  2H8R A;  1HC8 A;  1ACI A;  1CGP A;  4LD5 A;  2ZME A;  3GME A;  3WU1 B;  1KYW A;  2OZH A;  2DU9 A;  4B47 A;  4F0Y A;  5C4X J;  1HEE A;  1ITY A;  1SD5 A;  3BQY A;  3S8P A;  4BBS J;  3HXL A;  1FP2 A;  1A36 A;  4UEE A;  2X1C A;  4N4O B;  3VAT A;  4UY8 I;  5K7F A;  2M5W A;  4L5E A;  2E7X A;  4E6K G;  4O3M A;  2PJ6 A;  5H20 A;  4Q4Z F;  3GTQ J;  5F0C A;  1JKO C;  2BW3 A;  1ZN2 A;  1BI0 A;  2CW0 F;  5F27 A;  5A2Q K;  4I0B A;  3TOA A;  1F36 A;  2D45 A;  3FXQ A;  2JK3 A;  4KOR A;  2EZH A;  3H9G A;  5IB9 A;  3T8T A;  2DPT A;  2RB7 A;  3TO7 A;  1KWM A;  3F5B A;  3PEI A;  4GO1 A;  4LB6 B;  1VQK I;  3S16 J;  4JD6 A;  4KOW A;  1K4T A;  1G3S A;  3DV8 A;  3ZQH A;  3BPX A;  3L00 A;  1D3Y A;  3ECO A;  4HX4 A;  2O61 A;  1BA5 A;  2KZG A;  4MRI A;  4BBR J;  3EPZ A;  1VQM I;  1K7A A;  3QPL A;  4C7H A;  4ZYD A;  2K4B A;  3TW6 A;  2CW7 A;  4D7N A;  4RGR A;  2G3T A;  3EUK L;  4A3F J;  4B43 A;  2FNP A;  4Z65 A;  5KAF C;  1D1C A;  3RKX A;  1EF4 A;  3S3O A;  3ERE D;  3E0J B;  4ZC3 A;  3GTJ J;  2VZZ A;  5ELY A;  5JQ4 A;  3HTS B;  3AKZ A;  5AIQ A;  3R61 A;  4OWR B;  1MBJ A;  1FIA A;  3G1M A;  4OP4 A;  4C3I J;  4MJ8 A;  3D7G A;  3FHN A;  2R3S A;  5D5W B;  4Y4R A;  2ZME C;  1RNL A;  4KS9 A;  3Q9S A;  4CIC A;  5LHH A;  2Q0Y A;  1GT0 C;  3LMM A;  5IV0 A;  4DYQ A;  2BCO A;  1HF0 A;  5L3F A;  3FEC A;  5G21 A;  1JXS A;  2ID6 A;  4ZY1 A;  3RNZ A;  4XSZ F;  2EWN A;  1TL8 A;  1OZP A;  3KI9 A;  1K61 A;  1W7P B;  5M3M J;  4BNC A;  1GV5 A;  1HDQ A;  1VKC A;  3KET A;  4L9T A;  1GXQ A;  1KU2 A;  4MHG A;  2F5F A;  2HEO A;  1SFU A;  1FX7 A;  4EV0 A;  3GLX A;  2ZED A;  5J1Q A;  2C27 A;  2TCT A;  3ASN H;  5J40 A;  1VQ5 I;  5D4R A;  2KDO A;  1HQC A;  2RDP A;  2PJP A;  5F49 A;  3ONQ A;  3G2B A;  1Z8T A;  3KLN A;  2L0K A;  4LIV A;  2GAN A;  2PVV A;  2PVW A;  5HNF A;  3FYN A;  1KON A;  1Z3X A;  2LR8 A;  2WAQ A;  4KSI A;  2OQG A;  3SJX A;  1YW8 A;  3F8B A;  4WF2 A;  2R7D A;  5CPA A;  3FZV A;  2QBY A;  4XPD C;  2LKP A;  4XKV A;  3HHG A;  3KKW A;  5A2Q Z;  2LD5 A;  2Z3K A;  4XL9 A;  2ZBK A;  2GXB A;  2ELH A;  3K10 A;  3VWB A;  3OL4 A;  2IA0 A;  4ZGY B;  3ZN0 A;  3CP8 A;  2CJJ A;  3L2C A;  4UCP A;  2RKH A;  1RIO H;  4OOI A;  3TBI A;  3NWT A;  2ZEN A;  4BQA A;  1LEA A;  1WHU A;  4XMY A;  5E96 A;  2A61 A;  3WGI A;  4U5Y A;  3I4N J;  1MBE A;  3VYR B;  1YE9 A;  4CYC A;  1BR4 A;  1XE4 A;  4CAV A;  4CCJ A;  3BG5 A;  5LHI A;  2YUS A;  4L5J A;  2O03 A;  3EY5 A;  3WC7 A;  3NH5 A;  5E18 F;  4TV7 A;  1FT7 A;  1KUV A;  5FRO A;  1RO5 A;  5D8K B;  3EO4 A;  4G94 A;  1YI2 I;  2X48 A;  4HPQ A;  1AKH B;  2VJ4 A;  3KZY A;  3DPT A;  2DA5 A;  2E2H J;  1STZ A;  4EVI A;  5DUK A;  1S7K A;  2MAB A;  3DP7 A;  1J59 A;  1M4L A;  1U5T B;  2PJR B;  3RPU A;  2OV7 A;  1A31 A;  2V7F A;  3TCV A;  3PBB A;  2LOO A;  1JKP C;  1R3N A;  2QQA A;  4CRY B;  2F5I A;  3I4M J;  2MC4 A;  2L2O A;  2CH0 A;  3I59 B;  5EC4 A;  2DPU A;  2J8N A;  2L01 A;  4IO9 F;  3RCO A;  4LMY A;  3HEF A;  1HW5 A;  1Z77 A;  4NGQ A;  4AVB A;  4GXH A;  1VND A;  1M1D A;  5EMI A;  2KHM A;  1G4D A;  3A01 A;  1IIC A;  5K8P A;  1L0O C;  3E3V A;  1YYV A;  2IGN A;  3H8G A;  3DKY A;  4K2E A;  1YTY A;  3LOD A;  4DJA A;  2DTR A;  1WJE A;  2QF7 A;  3DGV A;  4FE7 A;  4G8X A;  4HV5 A;  4BXU A;  3OYA A;  1HST A;  4A3I J;  1MBF A;  3N5F A;  1XMB A;  5K8M A;  2CQK A;  1B4A A;  2MW8 A;  3LST A;  4AIJ A;  2CQ7 A;  1XF8 A;  4ZYQ A;  1I5Z A;  5D6F A;  3OS1 A;  4IVN A;  2Z3O A;  5AG6 A;  3IJ3 A;  1J4J A;  4ASN A;  1ZRE A;  2CY2 A;  4M71 A;  5L3G A;  3S9L A;  2HZD A;  3WU0 A;  2BHZ A;  3BI1 A;  2VQH A;  1N77 A;  1IC8 A;  4RLQ A;  5G1Z A;  4OMZ A;  2ZW4 A;  3TE4 A;  3CZ6 A;  1UG2 A;  2R7R A;  2JA7 J;  3OR2 C;  1QHG A;  3TKY A;  3HG9 A;  3G1O A;  4YII A;  2HS5 A;  3W6K B;  1ZK8 A;  2D1V A;  2K9L A;  3REO A;  5EEH A;  1VQL I;  1BLL E;  2JSC A;  3BP8 A;  5TJJ A;  2R7W A;  2BEI A;  3KGQ A;  1JE8 A;  1P4W A;  1Z7U A;  2ESN A;  3M4O J;  2R1I A;  4LK1 F;  4OIO F;  5F1R A;  3TC8 A;  2HOT A;  2HU9 A;  1AKH A;  1F2P A;  2M8G X;  4HYE A;  3LAC A;  5CBM A;  1AWC A;  5C82 A;  1P9Q C;  3EXN A;  2D2W A;  4MHN A;  1BJZ A;  1Q1H A;  2C1C A;  2FOW A;  1U5T A;  4NC7 A;  1Y8Q B;  4M6Y A;  2GFQ A;  5J1U A;  2LY9 A;  2M0C A;  5IP7 J;  5E8G A;  1KQ8 A;  4YEJ A;  3LAJ A;  4HNV A;  4IOC F;  4HNX B;  3SHP A;  3H3U A;  3JRD A;  4N0B A;  1R71 A;  2EIJ H;  5ED4 A;  4WWC A;  1CP7 A;  2MC3 A;  4RAY A;  2KIQ A;  4RLF A;  4DZJ A;  4EJU A;  2L7M P;  4YFJ A;  1ZKG A;  5FFZ A;  2DPS A;  2ZNZ A;  5ICF A;  2B3V A;  3B3C A;  2OAZ A;  1N71 A;  4R79 A;  1XGM A;  2CGP A;  3AG3 H;  1PVE A;  2RVC A;  2CNT A;  3FVL A;  2CUF A;  3RDI A;  2TDX A;  1UWY A;  2NVT J;  2UXN A;  3RQI A;  2DPD A;  4R6T A;  2R5Y A;  1SVO A;  1WSU A;  2AQF A;  1D5V A;  1W0U A;  2E5Z A;  4JZ0 A;  5IT3 A;  3ZMT A;  1APL C;  2Q04 A;  3JRA A;  2PEX A;  5DD8 A;  1B72 B;  4M3S A;  3KHZ A;  3TDU C;  3FK7 A;  4V19 K;  2IS6 A;  3CXQ A;  2FQ3 A;  4F55 A;  3RO0 A;  1FBQ A;  3M8E A;  1SD6 A;  2LG4 A;  1DGR M;  4CA0 A;  4YRV A;  4DQ2 A;  4CGP A;  2DA6 A;  2KIU A;  3OY9 A;  1BI1 A;  1YJ9 I;  2ZEF A;  2V8D A;  3RYO A;  1J7K A;  1ZRF A;  1P6R A;  2VXZ A;  1R6R A;  2P6T A;  3NQO A;  3FBN B;  4HDV A;  3DF8 A;  1SAU A;  1U5T C;  1XSV A;  4B44 A;  2ZJ2 A;  3V7Z A;  3CCL I;  5JPH A;  2XRL A;  4Y3O A;  1PP8 F;  5LRS A;  2DFI A;  4G7H F;  2NVX J;  3S6F A;  2Q2E A;  5DEQ A;  1BL0 A;  1A2Z A;  4UFV A;  3M1E A;  4H6Z A;  4HX7 A;  2ELJ A;  1YLE A;  1LUJ B;  2R7T A;  5ILU A;  1V5E A;  2P7V B;  1S6L A;  4KYW A;  2LYC A;  3HKZ A;  2CG4 A;  2A68 F;  1TQI A;  3KP7 A;  1I3Q J;  3QAH A;  2FS5 A;  3SYT A;  3S9M A;  3R95 A;  2KRF A;  4OIQ F;  2DAO A;  5GTI C;  2GIV A;  1Y7R A;  1QQ9 A;  5DCF A;  1LCP A;  2IEK A;  1ZEL A;  1T39 A;  2IP2 A;  2JPC A;  2VBX A;  1DPU A;  4KFC A;  3BR1 A;  2KLO A;  3TQN A;  3BG9 A;  4BDY A;  2HXI A;  2A07 F;  3BTC A;  3O6B B;  1LVA A;  2DT5 A;  2K9Q A;  1KZH A;  4OAD A;  1YIJ I;  5LEJ A;  3BG7 A;  2CW8 A;  3DTE A;  1FYK A;  1VZ0 A;  3ZR8 X;  3HDD A;  4A2Z A;  5M5Y J;  4AC0 A;  1GVD A;  1LQ1 A;  3X2Q H;  2FBH A;  3R9G A;  2Z3M A;  1I1D A;  3OYE A;  3DNS A;  1BAV A;  4MCP A;  2EZK A;  1HW1 A;  1J2X A;  3TDZ C;  3TO9 A;  1WCM J;  3R9E A;  3BLN A;  4XPL A;  3ZRG A;  3GEZ A;  4CAE A;  1DUX C;  5LRK A;  5AGE A;  4J3G A;  2X0L A;  1LDJ A;  2EFN A;  2PI0 A;  3V8K A;  2H27 A;  2HOS A;  5F46 A;  3M8J A;  4NGP A;  2M1B A;  3C1D A;  1D1A A;  3WT4 A;  3HSF A;  3WTS C;  1CF7 B;  3GF2 A;  4UCM A;  4RAG A;  3JRC A;  4UVC A;  2V1U A;  4Z2Y A;  3AFH A;  4QVT A;  2GXA A;  2Z9O A;  2M8E A;  1S5K A;  4BE0 A;  2YSR A;  4B1R A;  3B3S A;  3UY5 A;  3CMA I;  2XEF A;  4IF5 A;  3PNT A;  4KIC A;  2ZW5 A;  1Y39 A;  2RQQ A;  4PK3 A;  4RGX A;  4U7D A;  1ETX A;  2W84 A;  1O57 A;  4EAT A;  4FUU A;  4MHP A;  5E1X A;  2GLO A;  4NFR A;  2E1O A;  3BZC A;  3UNG C;  2XDV A;  1E2X A;  4BY1 J;  4OC5 A;  1T33 A;  2DT7 B;  3LSH A;  3TW7 A;  2PFB A;  4OKO A;  3N4M A;  4OAZ A;  1A6I A;  4PDK A;  2PJ5 A;  3BG6 A;  3L2N A;  1Z8X A;  3PIP F;  2W7N A;  1YFH A;  3G73 A;  3QRF F;  1QVT A;  1UAA A;  4XN3 A;  4RB2 C;  5ILS A;  1TNT A;  2ELK A;  3TED A;  1B8I A;  3WR7 A;  2VON A;  3ZOB A;  2FE7 A;  5E8I A;  2KZV A;  3FX3 A;  4AVP A;  1LRZ A;  1VHE A;  2PJB A;  1KUY A;  2EIL H;  1IXS B;  4KVM E;  3S6H A;  1T2K A;  3K2A A;  3PM1 A;  2DQR A;  4UUS A;  4OC3 A;  1WJF A;  3K1M A;  1QSO A;  2CNS A;  4PXE A;  4I09 A;  2EIK H;  3V8I A;  2VPL A;  1WKM A;  2WBM A;  4R8H A;  2LKS A;  2Z3L A;  4ENJ A;  4JLY A;  3GZN B;  5J3L A;  4XPK A;  4PZJ A;  2LTP A;  1X1P A;  3SEZ A;  4I02 A;  1BC8 C;  1P4A A;  1TKJ A;  1FMW A;  2REF A;  4ANJ A;  3KPH A;  2X85 A;  3O8H A;  1T6S A;  2R4G A;  1JJ6 C;  3U1K A;  4IX7 A;  2Z33 A;  5LRG A;  1IO2 A;  2CYY A;  3KIO A;  4NQW A;  1ZLI A;  1CF7 A;  1UHS A;  3FJU A;  1SD4 A;  5E79 C;  1JJ8 C;  4A5N A;  2ZJQ F;  3OSG A;  3W6V A;  2BEO A;  2PJ4 A;  2BE5 F;  4ORF A;  1TZL A;  4IJA A;  4FT8 A;  2P6F A;  2OOT A;  4PSX A;  4Y15 A;  3HOT A;  2AE6 A;  4A93 J;  5EDN A;  2DK8 A;  2H1K A;  4MO7 A;  2DOF A;  1OLT A;  2ZXI A;  3BLY A;  1ZLJ A;  3J7A Y;  3FXK A;  1E3P A;  3I55 I;  3VYS B;  1IYK A;  1VHO A;  5B66 C;  2ZW7 A;  2DXQ A;  2A5W A;  2PC1 A;  1E3O C;  2FIW A;  4P45 A;  4U9Z A;  3JRF A;  1D0Y A;  3TP3 A;  4A95 A;  3K4K A;  1A35 A;  3KP4 A;  2J5P A;  5FRN A;  2XRN A;  1TKH A;  4NGN A;  4HLX A;  1XN7 A;  5IY5 H;  2GE3 A;  4ESJ A;  2QYO A;  4UA3 A;  1XGO A;  1B59 A;  3JRI A;  1ON1 A;  2M0M A;  2R93 J;  3RYP A;  5EJC A;  3S2W A;  2B4D B;  4KOY A;  2FBI A;  3CUO A;  3I3L A;  4IEJ A;  5LHG A;  2DMU A;  1Z3Y A;  3PSF A;  2ODF A;  3KP6 A;  3WG7 H;  1SEU A;  2E36 A;  4I98 B;  3V42 A;  2NOG A;  4ZYA A;  5LYI A;  2GOM A;  2AJ6 A;  1IN5 A;  2P4W A;  5F1J A;  1WH7 A;  1HDP A;  1LAN A;  4F9U A;  3OYH A;  2MD0 A;  2OF7 A;  2MLK A;  3IKT A;  4D1Q A;  2KPM A;  1JUS A;  4AWX B;  1HDU A;  2M30 A;  3WE2 A;  4XRF A;  4LIT A;  1J9I A;  3IFE A;  5HXD A;  3BWG A;  4MCS A;  4R8F A;  3W91 A;  1QZE A;  4C2Z A;  2PMU A;  3E1S A;  1EJ9 A;  4OU0 A;  4V2F A;  4U7B A;  2HVQ A;  3DLL F;  1LPQ A;  3MRU A;  3GYH X;  3GTG J;  1UJ8 A;  3SEQ A;  3CCJ I;  1MNM C;  2AFX A;  4L89 A;  3K1N A;  4E7I A;  4L0Z B;  2V8H A;  4P1W A;  4N9I A;  4HRI A;  4R9M A;  1QSN A;  4KIT B;  4B5P A;  2JDC A;  3JSO A;  3DTI A;  2AQE A;  4AD9 A;  4WCG A;  3A9L A;  3KZW A;  2ATR A;  4TWE A;  2BXZ A;  3HC7 A;  4NUB A;  1SFK A;  5GP9 A;  4QLC U;  1FC3 A;  1BR1 A;  3GB0 A;  2O53 A;  1GXP A;  4NHJ A;  2RQP A;  2XV4 S;  1NHA A;  5JFR A;  3JRB A;  2P5L C;  4V2G A;  1QMU A;  3NA6 A;  2E1C A;  1S3Z A;  4OC1 A;  3S93 A;  1HSJ A;  4AVZ A;  1DP3 A;  2OBP A;  1TBX A;  2BBY A;  5HOD A;  3IAS 2;  1AHD P;  3QQA A;  3V7R A;  1SVM A;  1WGX A;  3DPU A;  3LA7 A;  5B5E C;  4OC0 A;  1Y1W J;  1FPQ A;  3HSR A;  1I39 A;  3I3G A;  4A3J J;  4GGG A;  3CDL A;  1N25 A;  3ZMZ A;  2OQR A;  1O4X A;  5F64 A;  2R8V A;  2PN6 A;  3GTO J;  2GQQ A;  3IWW A;  5AG5 A;  2Z2S B;  2IA1 A;  3PGP A;  3MAJ A;  3T0Y A;  2XIG A;  1WI3 A;  4LQ6 A;  2DW4 A;  3KP2 A;  1ZGW A;  3WOD F;  4K3N A;  3KEO A;  4PXD A;  4GYG A;  4HNW B;  1IN7 A;  1OCP A;  2Q0O A;  5ILV A;  3WGH A;  5GPA A;  1X1A A;  3VYT B;  3WG9 A;  1Y7E A;  2GLJ A;  3NH8 A;  2XF6 A;  3I9S A;  1YIT I;  1OPC A;  1Z0X A;  1MND A;  1G59 A;  2V9P A;  4UUV A;  1H88 C;  2K3P A;  2STW A;  4A31 A;  2GM4 A;  1Z2L A;  2DEA A;  3LA3 A;  2F8H A;  4HG2 A;  3DU6 A;  3R60 A;  3CJR B;  5DDG A;  3D2M A;  3KAS A;  1JGG A;  4JBA A;  4P9U A;  2PCU A;  4BGD A;  2PJ2 A;  3H36 A;  5L3E A;  5FKO A;  3G8W A;  1VTN C;  2QIR A;  1SAN A;  3IWE A;  1UEL B;  2FCK A;  2OH1 A;  1K6Y A;  2R5Z B;  5B1B H;  2LH9 A;  2VZY A;  2Z99 A;  2Q8K A;  5J4Y A;  4HF2 A;  4BHB A;  3KYL A;  3H35 A;  1B6B A;  1WJD A;  3T1B A;  2BYV E;  3GFM A;  2QA4 I;  4UB8 C;  3F8C A;  2A6H F;  1XBU A;  2ZOF A;  3CUQ A;  1XJO A;  2BOA A;  1ZGJ A;  3L2Q A;  3E5U A;  3JTK A;  4NF1 A;  1UG0 A;  2P8T A;  4IHW A;  2GRE A;  2CSO A;  3ULQ B;  3SJG A;  4WJB A;  2VEZ A;  2FEZ A;  4BJT A;  4DJL A;  2RNG A;  3ABT A;  4XLA A;  1FOK A;  3ABL H;  4KOV A;  3BRO A;  2G7U A;  2EV6 A;  5IP9 J;  4RA2 A;  1C0W A;  2DDA A;  2B58 A;  1CPX A;  1W5S A;  3OL3 A;  4IL6 C;  1X1B A;  5IT9 Z;  1QNT A;  4M9Z A;  4H6U A;  4RM3 A;  1IJW C;  5E1W A;  3A02 A;  2ZJR F;  4M3F A;  5JM6 A;  4I99 C;  3B73 A;  2KQR A;  2NS8 A;  2R7O A;  2K9M A;  5E3O A;  3GYA A;  2CFO A;  3QWL A;  4LLN A;  3HJE A;  1GV2 A;  1MH4 A;  2HTJ A;  3WGG A;  4MCQ A;  4UFX A;  5G22 A;  5DV5 A;  3I9V 2;  2B4B A;  2Z16 A;  3GTP J;  3CLQ A;  2DO7 A;  1IXC A;  4IRH A;  4X1E A;  4G1P A;  2QQB A;  1XOV A;  2Z11 A;  4WWV A;  1FWZ A;  3S15 J;  2HB6 A;  1R00 A;  1BO4 A;  4ETS A;  2XEJ A;  1WH5 A;  1ZLH A;  2M7B A;  1TF9 A;  2DF5 A;  1U9N A;  1ZG3 A;  1HW2 A;  2B5G B;  1E17 A;  4O23 A;  4MHZ A;  2JQ7 A;  5FLV A;  3KHX A;  2XF5 A;  4UVA A;  1IF1 A;  3KR5 A;  3MQ0 A;  3FX6 A;  1P0H A;  1RKW A;  2HFH A;  4C3H J;  1PDN C;  1X2M A;  2PMZ N;  3E0K A;  1MZB A;  1X1D A;  2CXA A;  2VBZ A;  1DE4 C;  1WVR A;  2ZEH A;  2XPV A;  4RBO A;  2Z0Z A;  1X2N A;  3EET A;  3BC8 A;  2YU9 J;  2JRT A;  2WAE A;  3GZ6 A;  4YEL A;  1VIX A;  1K79 A;  3CZX A;  2FF4 A;  4UBR A;  4Q48 A;  4RM2 A;  4DNC A;  4DIQ A;  3IV5 A;  1OCC H;  2HC9 A;  4RN7 A;  4C7I A;  3PB6 X;  1XGS A;  2MA3 A;  1ZRC A;  4XOT A;  2FT0 A;  2ZEL A;  2JZY A;  2CS3 A;  3QPS A;  4E4H A;  1OR7 A;  3PJR A;  1JI8 A;  4A3D J;  2QEC A;  1Y9K A;  4M3B A;  2BZT A;  3NAU A;  2HQR A;  2JMW A;  6PAX A;  1HCR A;  1RZ4 A;  5DM6 F;  2R7F A;  4HDU A;  3NFZ A;  4H2K A;  2Q43 A;  2LRD A;  4LG0 A;  4L9V A;  1T98 A;  3FMC A;  5D8N A;  2WB1 N;  3CCM I;  2Z3P A;  4A3G J;  2QKL B;  2NYX A;  2OZU A;  3N97 A;  2EFW A;  2XGD A;  2DBB A;  1FZP B;  1EH7 A;  2R7S A;  2J5O A;  5EBV A;  2LBF B;  4A30 A;  3V7C A;  3PB9 X;  4EJV A;  2HKO A;  2DOE A;  2AFO A;  4P4F A;  5DS0 A;  4XKB A;  1NH3 A;  3S14 J;  3D7F A;  3UKG A;  1BOB A;  2H6C A;  4A5M A;  3CDX A;  2AXT C;  2X9D A;  1S9H A;  1YQE A;  3B6C A;  3RPU D;  4C3J J;  3BZ6 A;  1ZGA A;  3F8F A;  4PJ0 C;  3CCV I;  1V4R A;  4RGU A;  1FNN A;  1YIO A;  1O7F A;  2RRE A;  3BR0 A;  3RI4 A;  1MK4 A;  4II3 A;  2V77 A;  3CC4 I;  1P4N A;  2O6G E;  3KFW X;  5BPI A;  4ENM A;  3BXM A;  2EZL A;  3FIS A;  4BYY A;  1CX8 A;  4ABZ A;  2R7X A;  1ODD A;  3W6J B;  4CYP A;  2FD5 A;  3D5R C;  3OYN A;  3FXR A;  2EJR A;  3H1C A;  4JQF A;  2FSR A;  3ISP A;  1R1T A;  1T95 A;  4CAF A;  5KAI C;  3TOB A;  4LFU A;  1HKS A;  1ZG8 A;  2NS0 A;  3T90 A;  3E6M A;  3QU6 A;  1BOA A;  4KDP A;  1Z91 A;  3ISX A;  4M73 A;  1YHQ I;  4GFB A;  1U8R A;  5B3S H;  4XRM A;  3E7L A;  2O0Y A;  1X1C A;  2KJB A;  1OR7 C;  2DT6 A;  4DYC A;  2VT2 A;  4F91 B;  4A39 A;  2HQA A;  1G6N A;  3WTZ A;  3AG2 H;  4BEH B;  1T08 B;  5CJ9 A;  3GXO A;  2XSD C;  3B02 A;  5GAH J;  1AU7 A;  1QST A;  5AG4 A;  4IOA F;  2JDD A;  1R23 A;  1LVK A;  1XSX A;  4HBL A;  1IZ1 A;  2A6E F;  2CO5 A;  3ZQL A;  1XEB A;  3DBH B;  4AVC A;  5AG7 A;  2YX7 A;  4MTE A;  3BTI A;  4XNF A;  4AG7 A;  2ZW6 A;  3JVN A;  3DLA A;  1O3Q A;  1I50 J;  5GPC A;  1LDK B;  1Q2C A;  4XRS G;  2PRQ A;  4KLV A;  5IYD J;  2MH9 A;  4IUS A;  4ON0 A;  2OA4 A;  4PJM A;  3I64 A;  5F09 A;  4ZDL A;  2PJ7 A;  1POG A;  1ZG7 A;  2LY1 A;  2O3F A;  3HSE A;  4Z6Y A;  3CTA A;  2WPW A;  1G8X A;  2L9V A;  3JTH A;  4KSA A;  4E2A A;  3H5A A;  2XAH A;  1TIQ A;  1B9N A;  1X58 A;  3Q0U A;  1FSH A;  1XDS A;  2LNB A;  1U0J A;  1V54 H;  2LBF A;  3FDY A;  3QP6 A;  2PE3 A;  1AA7 A;  4P4E A;  1T0F C;  4RGS A;  4XLH A;  4ZTJ A;  1Y0R A;  3KL9 A;  4R7M A;  1XS9 A;  4Q38 A;  2F4I A;  2KIF A;  4B10 A;  2H6B A;  4ENN A;  1HDD C;  2CTB A;  3H4Q A;  4E0A A;  2R7Q A;  1V5G A;  1IN8 A;  2LP0 A;  4MFE A;  4X8I A;  2VE8 A;  4A12 A;  4U87 A;  2PR8 A;  2HDW A;  3K70 C;  3Q0V A;  1UST A;  3HTU A;  4KIB A;  3F21 A;  3L7W A;  2DA7 A;  4MNU A;  1Z9C A;  1W36 C;  4ZTF A;  4MFD A;  3M07 A;  3LSR A;  2FBK A;  5FRM A;  3I1U A;  4QPQ A;  2OU2 A;  3C2G A;  1QRY A;  3HGG A;  2FA5 A;  1H0M A;  4NC6 A;  1VQO I;  3B8G A;  1FOW A;  3H9J A;  4B3X A;  2N8G A;  5BMZ A;  1P7I A;  1JWQ A;  5K8O A;  3MCZ A;  3U2R A;  3LSG A;  2KDZ A;  1IGB A;  5F6F A;  4FD5 A;  2E34 A;  1AMP A;  3HIF A;  1HKT A;  1R36 A;  5J8F A;  3F8M A;  3HPH A;  1JKQ C;  1BPM A;  4LQG A;  1FT9 A;  3L09 A;  5HLG A;  5HOO A;  1H89 C;  2R7Z J;  1ELL P;  1K78 B;  4MFQ A;  2JBJ A;  1W7P A;  4R1H A;  4UEZ A;  3HRM A;  1TNS A;  3PZJ A;  3DEW A;  4KOX A;  3W6X A;  1LFW A;  3PRT A;  4IRG A;  3L2U A;  4I01 A;  1TTY A;  1R57 A;  2JA8 J;  3FH4 A;  5FD6 A;  5AON A;  4AID A;  1FLI A;  2QSG X;  3QPH A;  3E6C C;  1U9O A;  1B1B A;  1MD0 A;  2F5D A;  1S5L C;  1IDY A;  4XLP F;  3GWZ A;  2F4O B;  3IUO A;  1FIP A;  3PNY A;  1F9N A;  1YX5 A;  4HNT A;  4NC8 A;  4CH7 A;  4LLL A;  5E17 F;  3LNQ A;  3D5S C;  1P7J A;  3FKJ A;  3FEE A;  4MXU A;  3BJO A;  2K5C A;  1YLO A;  3L9F A;  4C2Y A;  3C2H A;  4MFK A;  1X12 A;  2H09 A;  3CP2 A;  4W97 A;  2RAE A;  2VQL A;  1D0Z A;  3MMY B;  5J47 A;  1UCR A;  2FOK A;  1B87 A;  4B5O A;  3KCC A;  8CPA A;  1YK3 A;  1FP1 D;  2XPU A;  3LSM A;  3QPT A;  2DI3 A;  1FOY A;  1UZC A;  3CQZ J;  4A0Z A;  1F5T A;  5FKK A;  3HOW J;  1K4J A;  1ENH A;  5CQE A;  2VBQ A;  4GS4 A;  2LVS A;  2PG4 A;  4MTD A;  1OCZ H;  2WAD A;  3A0B C;  4KN4 X;  4XOR A;  2WZN A;  1XX5 A;  1M4D A;  2DXI A;  2H1L A;  3ERM A;  3BOQ A;  4A33 A;  2KL4 A;  3K4M A;  1MMA A;  3HLP A;  1O7L A;  3SJM A;  2YPR A;  2P6E A;  4IXA A;  2CUZ A;  1LEB A;  2HQY A;  3RIR A;  3G3Z A;  2HKX A;  5L3D A;  2VPR A;  3AL0 B;  4G6T B;  4OMY A;  4CGN A;  1YJN I;  3S9N A;  2P0W A;  3RKW A;  1YRE A;  3PO3 J;  2DYS H;  2X51 A;  3RZD J;  1RUO A;  2PJR A;  1R22 A;  4G7O F;  3U1D A;  4F8Z A;  2VC0 A;  4LB5 A;  2JBK A;  1ZR2 A;  2E7W A;  1A6Q A;  2IPQ X;  1CQT A;  2REE A;  2EA4 A;  5LRJ A;  3I59 A;  2W25 A;  4GCV A;  4E7J A;  3Q5F A;  4HLY A;  1ERD A;  1IB1 E;  4FD7 A;  1TW3 A;  2A05 A;  1LNW A;  2R7H A;  3CXP A;  4BMH A;  3W6S A;  2BOL A;  3DKW A;  4U0W A;  2WC2 A; 
#chains in the Genus database with same CATH homology
 4L8A A;  4MI4 A;  3FBI B;  3DQV C;  4MHD A;  3V8I A;  4IQ4 A;  2WBM A;  2VPL A;  2RC4 A;  1Y56 A;  4ZDP A;  2Z3L A;  4JLY A;  4XPK A;  1SQH A;  4HNU A;  4RMN A;  2OUM A;  3R1K A;  4C30 A;  3SEZ A;  4PJL A;  4D9J A;  3OYM A;  5HH1 A;  4UCN A;  1FMW A;  3CMM A;  2D4O A;  2REF A;  2E1M B;  5CPR B;  4P5O A;  2X85 A;  1TT0 A;  4BQO A;  1MW7 A;  2Q1Z B;  2R4G A;  4ANJ A;  2WPX A;  3UR3 C;  4PJJ A;  4IX7 A;  3D3S A;  3PUB A;  2F5V A;  4E7S A;  2IS2 A;  1Z4R A;  4XN0 A;  1I21 A;  3H5N A;  2WUU A;  4GRI A;  5HNH A;  4KT6 A;  1I12 A;  2BSW A;  4NCZ A;  2DJI A;  1CJW A;  4CS0 B;  4F93 B;  3OYK A;  3OYJ A;  4ORF A;  3FBU A;  2VKD A;  1TZL A;  3VSL A;  2HPM A;  3DR6 A;  2HVR A;  2P6F A;  2HVS A;  2KMU A;  3CF2 A;  4PSX A;  3HUG B;  4E7H A;  2Q44 A;  4EVY A;  1KUX A;  2J8M A;  4C68 A;  2XF7 A;  3DTK A;  3HOT A;  2AE6 A;  1HA8 A;  1OLT A;  2H5M A;  2ZXI A;  2DOA A;  3BLY A;  2ARH A;  4R87 A;  5KCM A;  4IZZ A;  3VYS B;  1LKX A;  1IYK A;  2R7U A;  2EUI A;  4J00 A;  4XLE A;  2DXQ A;  2ZW7 A;  3EFA A;  2A5W A;  2PC1 A;  2FIW A;  5F48 A;  2IS1 A;  4U9Z A;  4B11 A;  2WSA A;  1NMT A;  3R96 A;  3NWS A;  3H5Z A;  1D0Y A;  3TMO A;  4I49 A;  4J01 A;  4OLL A;  3K4K A;  4LG3 A;  4A95 A;  4AB7 A;  1LFP A;  5GCN A;  2KCW A;  2IXS A;  5FRN A;  2Y0M A;  3LSI A;  2GE3 A;  2L7K A;  4JOM A;  2DCE A;  4UA3 A;  3A4C A;  2M0M A;  4E7K A;  1L0C A;  2VJJ A;  2X1E A;  2B4D B;  4KOY A;  4PFP A;  3I3L A;  1DGW Y;  3KEY A;  4BJ6 C;  3OYC A;  1VHS A;  5DWM A;  1Z3Y A;  3DKX A;  3PSF A;  2XC7 A;  3DEE A;  4BEH A;  3U21 A;  3DPL C;  4HNY B;  4MFZ A;  3V42 A;  4ZYA A;  3T9Y A;  2GOM A;  2VIX A;  2AJ6 A;  3CXS A;  3OYD A;  3GY9 A;  2JVG A;  5HVQ C;  1WJB A;  4ZBG A;  3QYE A;  3OYH A;  4UWI A;  3W2V A;  1UFH A;  4KVO E;  3S3N A;  2MD0 A;  3CES A;  2CV0 A;  2Q7B A;  2K5T A;  2FXF A;  3ZGK A;  2KPM A;  1MMN A;  3M1C A;  4DOZ A;  4ZJZ A;  4D1Q A;  4BDZ A;  2CV1 A;  2OC6 A;  3FXT A;  1PJR A;  2IGO A;  4BL0 B;  1NG6 A;  2JA2 A;  1QSM A;  3K4C A;  4LIT A;  2M3A A;  3DSB A;  4XPD B;  4C2Z A;  4M85 A;  3W91 A;  1Z21 A;  3ZZI A;  2BL1 A;  3E1S A;  4U7B A;  2HVQ A;  3QYF A;  4CAX A;  4IQJ A;  2KRC A;  3A1Y A;  3OMY A;  3SEQ A;  3BJ8 A;  3QOD A;  4K30 A;  4L89 A;  5KTA A;  4E7I A;  5JHF A;  5ISV A;  3ZCO A;  2B3U A;  2HUZ A;  4P1W A;  4Y33 A;  4HRI A;  4R9M A;  3VDX A;  1QSN A;  2PMZ A;  4KIT B;  3K9U A;  3DR8 A;  1YR0 A;  4B5P A;  4PFO A;  2CV2 A;  2JDC A;  3DTI A;  2AQE A;  1J09 A;  3VYU B;  3A9L A;  4H89 A;  2ATR A;  3F0A A;  3KX2 A;  3A2K A;  3AL0 C;  3HC7 A;  4NUB A;  1SFK A;  4C2X A;  2QML A;  1BR1 A;  2OZH A;  2R7V A;  3PSI A;  4B47 A;  4F0Y A;  1MJB A;  1Y9W A;  3HPG A;  3S8P A;  1S3Z A;  4CSW A;  3HXL A;  4HST A;  3S93 A;  4AVZ A;  2X1C A;  4N4O B;  1DP3 A;  3SXO A;  4BJ5 C;  4E6K G;  3IAS 2;  2OB0 A;  4HKF A;  3IAM 2;  5KHD A;  2VXK A;  3DPU A;  3MGD A;  2BW3 A;  3L2V A;  3TTH A;  3BCB A;  3OS2 A;  3I3G A;  4FET A;  2Q4Y A;  3N05 A;  4LUA A;  3TOA A;  1YX0 A;  4XNH B;  2WB1 A;  4KOR A;  2R8V A;  1FMV A;  3H9G A;  3ZJ0 A;  2DPT A;  3F5B A;  3TO7 A;  2IL4 A;  2E1M C;  3DWL E;  2Z2S B;  4MFJ A;  5AG5 A;  4E8O A;  2V26 A;  2VXD A;  2WY7 Q;  3GBG A;  3PGP A;  4JD6 A;  4KOW A;  4NXY A;  4X5K A;  2WA0 A;  4MY0 A;  4HNW B;  1FY7 A;  3EPZ A;  4C7H A;  2CW7 A;  1X1A A;  3VYT B;  2G3T A;  3EUK L;  2XF6 A;  3QOE A;  3I9S A;  3IWG A;  4B43 A;  1MND A;  1G59 A;  2K3P A;  1D1C A;  4UWJ A;  4A31 A;  3S3O A;  2HPI A;  3OIP A;  2OZG A;  3E0J B;  4ZC3 A;  4BUP A;  1IYL A;  2VZZ A;  4CAW A;  1DQU A;  4CYO A;  5JQ4 A;  4HG2 A;  3DU6 A;  3AKZ A;  3P2F A;  3CJR B;  4OWR B;  3D2M A;  3W2W A;  1KZF A;  2PDO A;  4MJ8 A;  2Q2E B;  3FHN A;  4BGD A;  4FD6 A;  4Y4R A;  1MMD A;  2VB6 A;  2PRB A;  5FVJ A;  4KS9 A;  3G8W A;  5KTC A;  2QIR A;  2Q0Y A;  3IGR A;  3IWE A;  1UEL B;  4CCO A;  2FCK A;  1M4G A;  2OH1 A;  3PL8 A;  3LMM A;  1K6Y A;  4PSW A;  4Y49 B;  2ZXH A;  5IV0 A;  1D0X A;  2LH9 A;  2VZY A;  2JLM A;  3IU2 A;  4FD4 A;  4MY3 A;  5G21 A;  3KYL A;  2JUG A;  3H35 A;  1B6B A;  1WJD A;  2Z3N A;  4CCM A;  4RI1 A;  3CJQ B;  2D4P A;  1OZP A;  3S32 A;  1XMT A;  4XKW A;  1VKC A;  3MKW B;  2JVH A;  1YVO A;  5AGE A;  3L2Q A;  3JTK A;  4NF1 A;  1UG0 A;  2QKM B;  4FAS D;  1MNE A;  2XSJ C;  3NE7 A;  4NSQ A;  2VEZ A;  4BJT A;  2C27 A;  2KDO A;  2GOX B;  5F49 A;  2RNG A;  4XLA A;  3ONQ A;  3G2B A;  2X7B A;  1N78 A;  4KOV A;  4LIV A;  2GAN A;  4JXQ A;  5CKT A;  4II2 A;  5HNF A;  3FYN A;  1KON A;  3OWC A;  3VWD A;  1Y6I A;  2V4J C;  1Z3X A;  1ON0 A;  2WAQ A;  2B58 A;  4CRZ B;  2G3A A;  3H9Q A;  3OL3 A;  2LRE A;  4YGO A;  3VWE A;  4XPD C;  1X1B A;  4CGL A;  4XKV A;  4H6U A;  3KKW A;  4RM3 A;  4BBH A;  2Z3K A;  4XL9 A;  4CCN A;  3K10 A;  3VWB A;  4CGP A;  3OL4 A;  3OYF A;  2KQR A;  1PYV A;  4F0X A;  2R98 A;  4ZGY B;  2R7O A;  2K9M A;  3HOS A;  3GYA A;  2LY2 A;  3CP8 A;  2CFO A;  5DWN A;  4UCP A;  2JSP A;  4BU2 A;  2YND A;  3DDD A;  5G22 A;  1X4P A;  4UFX A;  1QSR A;  3TBI A;  3I9V 2;  3NWT A;  2Z16 A;  2B4B A;  3LSK A;  4XMY A;  5E96 A;  3SZG A;  3D2P A;  4U5Y A;  2Z11 A;  3VYR B;  4CCL A;  1YE9 A;  1XE4 A;  1BR4 A;  2KRH A;  4CAV A;  4CCJ A;  3EY5 A;  2O5R A;  3H0D A;  2CMP A;  1NG7 A;  1MMG A;  2VAS A;  1WK4 A;  4C9Y A;  1BO4 A;  2W00 A;  1KUV A;  2M7B A;  5FRO A;  2B5G B;  1V0C A;  1RO5 A;  3F9K A;  1CM0 A;  3EO4 A;  2XF5 A;  4HPQ A;  2IGK A;  3RTR A;  2VJ4 A;  2A4N A;  1P0H A;  3DPT A;  2WY8 Q;  4PK4 A;  2MFZ A;  1S7K A;  3OYB A;  3E0K A;  3K4J A;  3OYG A;  2MAB A;  1X1D A;  1M44 A;  3TL4 X;  3QB8 A;  2CXA A;  2IGM A;  4F92 B;  2PJR B;  5A27 A;  2OV7 A;  2V7F A;  3TCV A;  4ONU A;  2LOO A;  4HSR A;  4NNJ A;  1PUA A;  2VQY A;  2Z0Z A;  4CRY B;  3BC8 A;  2F5I A;  4JXR A;  2MC4 A;  2L2O A;  2CH0 A;  4UBR A;  2WAE A;  2J8N A;  4YEL A;  2NMT A;  2WAF A;  4XNH C;  2Z10 A;  5EC4 A;  3RCO A;  4XON A;  4RM2 A;  4DIQ A;  4AVB A;  4DNC A;  4B12 A;  4BE1 A;  4C7I A;  1M1D A;  4F52 A;  4II9 A;  2KHM A;  1IIC A;  2FT0 A;  4XOT A;  2I00 A;  4UFW A;  3F8K A;  2IGN A;  3DKY A;  2CS3 A;  4MLO A;  4E4H A;  3LOD A;  3PJR A;  4DJA A;  1JI8 A;  1WJE A;  4CCK A;  2QEC A;  1QHH D;  3HL2 A;  1Y9K A;  1WWZ A;  3OYA A;  4MFL A;  1NE9 A;  3OYL A;  2M4G A;  1WJA A;  4QB9 A;  1XF8 A;  4YRH A;  3P2H A;  2LRD A;  3OS1 A;  2B4D A;  2Z3O A;  5AG6 A;  2Z3P A;  1J4J A;  2BVM A;  2QKL B;  2UWM A;  4NQW B;  4KUB A;  4B14 A;  2HNH A;  2XAU A;  2OZU A;  1U6M A;  3K4L A;  5A28 A;  1ZO0 A;  4MBU A;  2HZD A;  2R7S A;  5KTD A;  2E5N A;  2VQH A;  1N77 A;  3LFU A;  4RLQ A;  4BS9 A;  5G1Z A;  3RSN A;  3OIQ A;  2ZW4 A;  5EBV A;  4HEA 2;  2VKH A;  2LBF B;  4A30 A;  3TE4 A;  4PK2 A;  2O28 A;  4CYQ A;  2YNC C;  4XKB A;  3CZ6 A;  2R7R A;  2FL4 A;  2BVL A;  4IKF A;  1BOB A;  3OR2 C;  4AVA A;  1QHG A;  1Q2Y A;  5CNP A;  3HG9 A;  4Y49 C;  1S9H A;  4F6A A;  2K9L A;  5HMN A;  3RPU D;  1QU3 A;  2LC2 A;  3JUW A;  2R7W A;  3N7Z A;  2RRE A;  1MK4 A;  4R57 A;  4II3 A;  4N4N B;  1WJ5 A;  1P4N A;  2R1I A;  1M4I A;  4XOP A;  3S3M A;  1Z7L A;  2HU9 A;  2R7X A;  4AYB A;  1YVK A;  4CYP A;  3D5R C;  3OYN A;  3DU5 A;  3PP9 A;  5C82 A;  1P9Q C;  1S7L A;  4JQF A;  3EXN A;  3SXN A;  2FSR A;  4XM3 A;  1T95 A;  4H4K C;  3TO6 A;  3PFY A;  2KP6 A;  3TOB A;  3L2W A;  4NC7 A;  4CUG A;  3J7A Y;  1E0E A;  2X6X A;  1MJ9 A;  1IRX A;  3T90 A;  4DGW B;  4ZDO A;  4XLF A;  4KLW A;  3PNV A;  2G0B A;  3D5L A;  4YEJ A;  1X1C A;  1X4O A;  4HNX B;  3SHP A;  1OR7 C;  2DT6 A;  4F91 B;  3K4N A;  4CYN A;  2HQA A;  4C2T A;  2I79 A;  3OS0 A;  2BEI A;  2L9S A;  4RLF A;  2L9N A;  4BEH B;  1QST A;  4YFJ A;  5AG4 A;  2DPS A;  2JDD A;  4KOU A;  2B3V A;  1LVK A;  1N71 A;  4R79 A;  1XEB A;  2PSW A;  4RS2 A;  4AVC A;  4BE2 A;  1RXT A;  3D8P A;  5AG7 A;  2CNT A;  4XNF A;  4BQQ A;  4XQF A;  4AG7 A;  2ZW6 A;  3JVN A;  1Q2D A;  4QBJ A;  2VL8 A;  2JEV A;  3DLA A;  1Q2C A;  1LDK B;  4KLV A;  1QSO A;  2FUG 2;  4IUS A;  2X6W A;  5HLT A;  4PJM A;  1S60 A;  1S7F A;  2AQF A;  4ZDL A;  4KZT A;  1MJA A;  2E5Z A;  2W1O A;  4U9Y A;  3FRM A;  2LY1 A;  2WPW A;  4KSA A;  2NOJ B;  1NSL A;  4E2A A;  1G8X A;  2Q04 A;  3H5A A;  1TIQ A;  2ZSI B;  4AU7 A;  4M3S A;  2IS6 A;  3CXQ A;  2VQC A;  3GKR A;  4F55 A;  1U0J A;  2LBF A;  3BCA A;  2Y0S A;  2X1D A;  3FDY A;  3W2A A;  5H86 A;  5BWA B;  1AA7 A;  2LG4 A;  1DGR M;  1T0F C;  4PUS A;  4XLH A;  4BXF A;  4CA0 A;  2X6Y A;  4YRV A;  4ZTJ A;  3OY9 A;  1XIX A;  2EVN A;  3LD2 A;  4NEX A;  4R3L A;  3S6K A;  1BR2 A;  4Q38 A;  4B5P B;  2F4I A;  2W82 A;  3K70 D;  3FNC A;  3FIX A;  1W36 D;  2PQ8 A;  3RYO A;  4B10 A;  3H4Q A;  4E0A A;  2R7Q A;  1V5G A;  3S6G A;  2VXZ A;  4X0G A;  1R6R A;  2ZSH B;  2YNE A;  2V9K A;  2E60 A;  3K4B A;  4U87 A;  2PR8 A;  2HDW A;  3K70 C;  3FBN B;  4R3K A;  1SAU A;  3OOU A;  1W36 C;  5C88 A;  4B44 A;  4DBR A;  4ZTF A;  3EC4 A;  2UV1 A;  3W3C A;  1X19 A;  5FRM A;  5JPH A;  4Y3O A;  4CGM A;  4QPQ A;  2OU2 A;  3C2G A;  1YGH A;  3S6F A;  4CGO A;  2V1N A;  3L2R A;  4PV6 A;  4UFV A;  3B8G A;  4H6Z A;  3H9J A;  4B3X A;  2ELJ A;  4KJZ A;  1YLE A;  2BW3 B;  2R7T A;  2YNC A;  1V5E A;  3R9F A;  2M4K A;  3C26 A;  3LSG A;  2LYC A;  2Q4V A;  4AG9 A;  3HKZ A;  4PJN A;  3QAH A;  4FD5 A;  3FB3 A;  2FS5 A;  2VI7 A;  4MFP A;  4XLC A;  3SYT A;  5J8F A;  3ZXS A;  3HPH A;  3R95 A;  4B13 A;  2IS4 A;  2GIV A;  2MYS A;  5HOO A;  2W4S A;  1GHE A;  1Y7R A;  2YGW A;  4MFQ A;  4E7Z A;  4JWP A;  1ZEL A;  4CZC A;  3PZJ A;  3IP4 B;  3VSK A;  2KLO A;  5H84 A;  4KOX A;  4BDY A;  2M7A A;  4KOT A;  3W6X A;  2F6C A;  3L2U A;  1WJC A;  1R57 A;  5TGT A;  1Z4E A;  4OAD A;  2ZFU A;  3BG7 A;  5G20 A;  2CW8 A;  3DTE A;  1VZ0 A;  2A6T A;  3ZR8 X;  4LX9 A;  4A2Z A;  4XR6 A;  4A32 A;  4Q36 A;  3R9G A;  2Z3M A;  3IUO A;  1I1D A;  1D1B A;  3OYE A;  3PNY A;  1YX5 A;  1IID A;  2Z1D A;  4HNT A;  3DNS A;  4NC8 A;  4CH7 A;  1Z9U A;  3TO9 A;  3SDB A;  2CNM A;  3R9E A;  3BLN A;  4XPL A;  3ZRG A;  4F3Q A;  2I8D A;  2FIA A;  3D5S C;  4CAE A;  3EUH C;  3LL7 A;  2L5Q A;  3FKJ A;  2ZPA A;  4J3G A;  2K5C A;  3RQ4 A;  4KVX A;  3QYB A;  4BAC A;  4OAE A;  4QUS A;  4C2Y A;  1N75 A;  3C2H A;  4MFK A;  5F46 A;  5J8C A;  3CP2 A;  5IB0 A;  3M8J A;  2VQL A;  1D0Z A;  3MMY B;  4KUA A;  3MD2 A;  1D1A A;  3MKZ A;  3EUA A;  1B87 A;  4B5O A;  5LFA A;  2VQG A;  5I0C A;  1EA3 A;  4UCM A;  3OYI A;  2UUZ A;  5IX3 A;  1YK3 A;  2P6G A;  1YX3 A;  3AFH A;  4OAY A;  3MKY B;  4E7L A;  3ZQQ A;  4C2U A;  4BE0 A;  1S5K A;  1S7N A;  4QVT A;  1GLN A;  3LSM A;  3UY5 A;  3TFY A;  2CY2 A;  1K4J A;  5CQG A;  4IF5 A;  3PNT A;  2VLA A;  5CQE A;  2ZW5 A;  2VBQ A;  2RQQ A;  4GS4 A;  4PK3 A;  2HV2 A;  4EAT A;  3K6G A;  2WAD A;  4XOR A;  1M4D A;  2DXI A;  4A33 A;  3UNG C;  4XKC A;  2KL4 A;  2XDV A;  1MMA A;  3K4M A;  4LIU A;  4QPO A;  4DBQ A;  5KNL A;  2DT7 B;  3LSH A;  2B5G A;  2P6E A;  4OAZ A;  2CUZ A;  2HQY A;  1V5F A;  3OR1 C;  3BG6 A;  3AL0 B;  3G3S A;  4CGN A;  4G6T B;  2VJI A;  3BJ7 A;  2W7N A;  3OWT A;  4QC6 A;  2P0W A;  1WFX A;  1PU9 A;  1UAA A;  3IU1 A;  4XN3 A;  5LD2 C;  1YRE A;  5F47 A;  2X51 A;  2CUJ A;  2PJR A;  4KOS A;  3WR7 A;  2V6E A;  4ITV A;  2FE7 A;  4KSF A;  2KZV A;  1LRZ A;  2PR1 A;  2REE A;  3TT2 A;  4KIS A;  4B48 A;  1KUY A;  2J8R A;  4E7J A;  1ERD A;  2BUE A;  2VJ5 A;  1IB1 E;  4BQN A;  4FD7 A;  4KVM E;  3S6H A;  3CXP A;  2R7H A;  4JJX A;  3H5R A;  4BMH A;  3W6S A;  1WJF A;  2BOL A;  2CNS A;  4CAF A;  2ZXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...