2P0WA

Human histone acetyltransferase 1 (hat1)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
319
structure length
319
Chain Sequence
AEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEILRLLVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human histone acetyltransferase 1 (HAT1) in complex with acetylcoenzyme A and histone peptide H4
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone acetyltransferase type B catalytic subunit
total genus 93
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10394 Hat1_N Histone acetyl transferase HAT1 N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.390 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2p0wA03
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2p0wA02
3.90.360.10 Alpha Beta Alpha-Beta Complex Histone Acetyltransferase; domain 1 Histone acetyl transferase 1 (HAT1), N-terminal domain 2p0wA01
5CNPA 2Q0YA 2OH1A 4R3LA 2ZW7A 3S6KA 4LUAA 4II9A 3R96A 2G0BA 4PV6A 1I1DA 5DWMA 1Z4RA 4KOYA 1XE4A 1YX0A 2ZW6A 4KOTA 1NE9A 5HH1A 2PR1A 3K9UA 2ZPAA 1J4JA 1Q2DA 2B5GA 1IICA 4NSQA 4AG7A 4QBJA 1RXTA 4GS4A 3SXNA 2VZYA 4I49A 2D4OA 2FXFA 3FRMA 2Q04A 5F47A 5I0CA 3QAHA 2FCKA 2X7BA 3S6GA 1P4NA 3F0AA 4QUSA 4ORFA 2B4DB 4KORA 3OWCA 4JXQA 1KUVA 3S6FA 4JXRA 2GE3A 4XPDC 2BEIA 1MJ9A 3H4QA 4H6UA 2EUIA 4L8AA 1MJBA 1M1DA 2VI7A 2REEA 4M85A 1YGHA 2FIWA 1M44A 3G3SA 4FD5A 4KOSA 2G3TA 5EC4A 1Q2CA 4FD7A 3F5BA 4KUBA 2NMTA 1B87A 4KVME 4QC6A 2F5IA 3ZJ0A 2KCWA 1BOBA 4F6AA 2B3VA 4OLLA 1N71A 1U6MA 2K5TA 4KUAA 1RO5A 1MK4A 3E0KA 1OZPA 3R9GA 1BO4A 1I21A 3W91A 1S7LA 2BL1A 3CXQA 2BSWA 2PC1A 4KOWA 1K4JA 3EFAA 4PK2A 5J8CA 5H86A 1SQHA 2P6FA 1Y9KA 1YK3A 5F48A 2Q7BA 3N7ZA 3TOAA 4KOXA 2CNSA 2OZUA 1KZFA 3EO4A 1PUAA 1GHEA 1IYKA 1ON0A 3DR8A 2VQYA 1WK4A 4FD4A 4UA3A 3C26A 2GANA 1MJAA 4CAWA 4HKFA 4MHDA 4NF1A 3TO9A 4H6ZA 3TTHA 3PGPA 2D4PA 3V8IA 2VZZA 1VKCA 2JDCA 3I9SA 3R9EA 3CXPA 3S6HA 3F8KA 3B8GA 2RC4A 1NMTA 4CS0B 4MBUA 4NEXA 2B58A 2WPXA 1S5KA 3CXSA 2GIVA 3FB3A 2J8MA 4BMHA 2R8VA 4IUSA 4XPDB 1XIXA 4K30A 3T9YA 4HNWB 1YR0A 5C88A 1XF8A 2Z11A 4OADA 2PR8A 3TCVA 3VWDA 5E96A 4AB7A 4JJXA 2HV2A 3SHPA 4E8OA 2Q44A 4ZBGA 1S60A 2B4BA 2JDDA 1KUXA 4M3SA 3D2MA 3FIXA 2OZGA 2VXKA 1YVKA 3DNSA 4R87A 4PSWA 1S7FA 1Q2YA 3EXNA 4AVCA 2OB0A 2PSWA 5IB0A 5GCNA 3P2HA 4RI1A 2AJ6A 2EVNA 3KKWA 3UY5A 4XPKA 1CM0A 2Z10A 4U5YA 3DR6A 3EY5A 2WPWA 1M4GA 2PQ8A 2R7HA 2AE6A 2A4NA 4KVOE 3IGRA 1KUYA 4RS2A 3TO6A 4L89A 2IL4A 2REFA 2G3AA 2DXQA 5F49A 4XNHC 4R9MA 1R57A 1VHSA 4AG9A 1QSNA 4CRZB 4JD6A 4KOVA 4NCZA 4JWPA 2CNTA 2Q4VA 3IWGA 3RYOA 3NE7A 1YLEA 2P6EA 4DNCA 5C82A 5DWNA 3BLNA 4KVXA 2Y0MA 4YFJA 2HQYA 3W6XA 4HNYB 2JEVA 2Q4YA 4U9ZA 1M4IA 5KTAA 1M4DA 2FT0A 1XEBA 3VWEA 3SXOA 2J8NA 2ATRA 2ZW4A 4MY0A 3BJ7A 2Z0ZA 2FL4A 4JLYA 1S7KA 5HMNA 3GY9A 5FVJA 2ZXVA 3TT2A 2B4DA 4KLWA 4PK3A 5F46A 4Y49C 4CAVA 5J8FA 2CY2A 4AVAA 1S7NA 3EC4A 3D3SA 4UBRA 3P2FA 3TE4A 4QVTA 2B3UA 1QSMA 4HNXB 1WWZA 2I00A 2P6GA 3W6SA 4B5PA 3JVNA 5KTCA 3JUWA 4CAXA 1XMTA 4B5OA 4OAEA 2P0WA 1YREA 3R9FA 3PP9A 1Z9UA 2ZW5A 3FBUA 3LD2A 4MI4A 3GYAA 2H5MA 4F0YA 1QSOA 3WR7A 4Y49B 4NXYA 4UWJA 5KTDA 4XNHB 4R3KA 2FS5A 2JLMA 2FIAA 2OU2A 3T90A 2QMLA 4UWIA 3ZZIA 4QB9A 1CJWA 3MGDA 4YRHA 1QSRA 2FE7A 1Z4EA 4E2AA 2O28A 4MY3A 2CNMA 5EBVA 4IF5A 5JPHA 4X5KA 4R57A 3TO7A 2FSRA 3D8PA 3BJ8A 2R98A 4ONUA 4PSXA 4MJ8A 1YVOA 2R1IA 3FXTA 4XPLA 1Y9WA 4LX9A 1Y7RA 3TOBA 2J8RA 1PU9A 3TFYA 1UFHA 2VEZA 4B5PB 2C27A 4KOUA 5IV0A 2QECA 4AVBA 3FNCA 2HUZA 1IB1E 3G8WA 1IIDA 1S3ZA 4FD6A 4EVYA 1P0HA 1QSTA 4J3GA 3DSBA 4H89A 3GKRA 2PDOA 2I79A 3R1KA 1I12A 5JQ4A 5IX3A 5ISVA 4YGOA 2ARHA 1V0CA 2PRBA 2B5GB 5H84A 1LRZA 2VBQA 3FYNA 4E0AA 4CRYB 3LODA 2OZHA 4KLVA 1NSLA 4KZTA 1TIQA 3I3GA 1L0CA 3D2PA 3QB8A 4U9YA 3DDDA 1FY7A 1B6BA 1IYLA 2QIRA 2BUEA 3PZJA 3R95A
chains in the Genus database with same CATH superfamily
1ZH5A 2JSCA 3PNVA 4CYPA 1E3OC 2A5WA 4DYCA 3DU5A 1ZN2A 2E7XA 5GPCA 1O3SA 4XKCA 2OH1A 3GCMA 4LUAA 3TL4X 5FD5A 3R96A 3SJFA 1JKQC 4DOZA 3MRUA 4PV6A 1FNOA 4BBHA 3JTGA 3CCEI 1YX0A 1D5VA 4ZZLA 3QU6A 2DBBA 2ZW6A 3IWWA 3GLLA 4FX4A 3D68A 3E5QA 4BUPA 4KMFA 4ESJA 2PR1A 1FP2A 3PFIA 2CUFA 4EMEA 2W85A 1Q2DA 5LYDA 2LP0A 4IHSA 3PBBA 1X3WB 4MFKA 2QEXI 1RXTA 3OV8A 2CF4A 1JWQA 2VZYA 2CQKA 2O9LA 3IV5A 3CUOA 2IAIA 1R3NA 3JRIA 4L0YB 1U5TA 4J01A 1D0XA 2H8RA 3IJ3A 1X2MA 3L2VA 4MTDA 3RAMA 1G3YA 2ECCA 3OS2A 2CMPA 2V1XA 2DAOA 2FCKA 1JUPA 1SD6A 2X7BA 5JLXA 4OIDA 1OYWA 2XAHA 3ELKA 4QUSA 3GO5A 3KYDB 5GP9A 3F0AA 2VKDA 1ZLKA 1T56A 2L4MA 5EYRA 3JRGA 1HW2A 3S1RJ 5C44J 5AONA 2B4DB 4KORA 4UCMA 2LY1A 3OWCA 2V9PA 3KCCA 3HGYA 3LA3A 1G59A 2IEKA 2GE3A 4RB2C 4JXRA 3ONQA 3CT9A 1ULYA 1FTZA 3H8FA 3P9CA 3PO2J 4XPDC 2VC1A 4RAZA 4G7ZF 1BAVA 1I3AA 2BEIA 3WABA 1AKHA 2ZCWA 2H94A 1BA5A 3U9GA 3C18A 4JP0A 1W36D 4A30A 1MJBA 2VJ5A 5GTIC 2VI7A 1FOYA 2FOKA 3PUBA 4XN0A 1YGHA 2MC3A 2Y69H 4S05A 4RGSA 1MBJA 1HLVA 2A6HF 2FIWA 4KA4A 1YJNI 3PNYA 4G1PA 3ML6A 2ZBKA 4XLEA 5EC4A 3GW2A 4FE7A 2PX9A 2WBMA 2AQFA 2ZFUA 2KKOA 1VQNI 3HOVJ 4E7JA 1Y7EA 4R76A 4R8HA 2HOTA 1CP6A 1DPRA 2R7ZJ 1P92A 4KSIA 3RKYA 4KVME 3LSJA 1GXQA 2F5IA 3ZJ0A 4LGWA 3I0TA 5FB2A 5KAFC 2PJCA 4BJ5C 2JWTA 1WFXA 2KJBA 1VF9A 3FHNA 3QOPA 5CQGA 4OINF 4YFKF 3CO7C 2K5TA 2ECBA 1YG2A 4DQ2A 1CP7A 4PJ0C 1NH3A 2HYFA 2DMPA 4L9JA 4C9YA 1RO5A 1DPUA 1SFKA 3VARA 3E0KA 1UJ8A 1RETA 2K4JA 3B02A 2AFWA 3RSNA 3SZTA 3CQZJ 4LB5A 3JRBA 4HRIA 1Z8XA 1A5JA 1JUSA 2ODFA 4A6EA 2BL1A 3CDIA 2CRGA 2E36A 3OYLA 2PE3A 2FX0A 2XB5A 2R0QC 4PK4A 4KOWA 4IO9F 3RKQA 1VFCA 4A94A 3S14J 5GPAA 4WK8F 4PK2A 3BQYA 1R5HA 4MLOA 1ZR2A 1YOVB 2DLLA 3T8TA 3K70D 4CYCB 3BJAA 4CICA 5D29A 3QYEA 2OUMA 2FBKA 3BTLA 3CCMI 2WTEA 5DUIA 4YIIA 5E1ZB 3BZKA 3N7ZA 4M72A 2UWMA 3GX4X 1QZZA 5B5EC 4PUSA 4AC0A 4HPSA 3O2PE 1U2WA 1MMGA 3IO1A 2A6TA 2CU7A 1IYKA 2DU9A 2E35A 3PO3J 4W97A 3LFUA 4A3FJ 2C6GA 1IUYA 4MCPA 4H4KC 1KWMA 2E60A 3IH3A 1HDQA 2BW3A 2M8GX 2GANA 4I09A 1MJAA 2RNGA 4HKFA 4CAWA 1WHUA 1ZGWA 2DFIA 1I1SA 3W6VA 1IXCA 1F9NA 1FIPA 1HDPA 5TISC 3R0AA 2KP6A 3ZRGA 4B10A 3QQAA 3V8IA 1W5TA 3WE3A 3CD6I 1OQYA 4CO8A 1T8IA 1AWCA 2AFSA 1KQ8A 2Q43A 2Z16A 3IWZA 3DTKA 2E2JJ 3B35A 1R5GA 1S7OA 1BI0A 5IT3A 1AUGA 3I9SA 2DA2A 2BHZA 1XD7A 2BEOA 3E5XA 2W24A 1ONVA 5G21A 2ZXIA 3S6HA 2LD5A 2CXAA 2XSJC 2HNHA 5DCFA 4LLLA 3B8GA 4A31A 1DP3A 4Y13A 4BKXA 1DQUA 3E5UA 4KDPA 3ABKH 4BXFA 2YNCC 3OOPA 4CZCA 5GAHJ 3F8MA 1O3TA 5JH9A 1ELLP 3GEZA 5EGOB 3NEUA 1BW5A 3IWEA 3W2VA 3BR5A 4A3MJ 3JAMK 1FYLA 3TBIA 2WPXA 3N05A 2XRLA 2QENA 5TJJA 3LSMA 3M07A 3R0JA 3SDGA 2EH3A 5F27A 3CXSA 5IB9A 2IJLA 2K5CA 3WG9A 2NVXJ 2GIVA 3FB3A 2J8MA 4JX4A 1S72I 4GCVA 3N97A 4YIFA 5D8LB 1A04A 3H9QA 5EG0A 2PIZA 3HGGA 5M5YJ 5HNFA 1RRJA 4IK2A 4HNWB 2FNAA 2R7OA 3WTWC 1MNMC 4OMZA 4LB6B 1YR0A 3M8JA 3VSLA 4K2EA 4Y3OA 3H8GA 3MEXA 4OC2A 4Y52J 1R1VA 2VT3A 3EYYA 3NWTA 4A0XA 3ECHA 2Y9ZA 5JM6A 1JE8A 3TCVA 3G2BA 4WF2A 3R6SA 1T6SA 2HZDA 3MD2A 1Y0RA 1QPMA 2MC4A 3LA7A 5IT9Z 1BM9A 1IXRC 1QHHD 2JZYA 5E96A 8CPAA 4A3KJ 3HOSA 3G73A 3GIUA 4CYQA 1S9HA 4YELA 4CYCA 1ETQA 2WB1N 4E8OA 3KASA 5J4VA 2EFQA 4P9UA 3DEEA 1Z9CA 1H8AC 4JOMA 2JDDA 2DYSH 3WODF 5LRKA 4MEYF 4AD9A 2E7WA 3D2MA 4J00A 3HKZA 4P55A 4UIBA 5M3FJ 4GXOA 2OZGA 2G7HA 3V4GA 1PYTB 2I8DA 3M1CA 2WZNA 2XVCA 3QPLA 1HOMA 2LG4A 1Q2YA 3EXNA 4M9ZA 2OB0A 2PSWA 1YE9A 4AVPA 1D8KA 1W7PA 3WTUC 4A95A 1XMAA 1LAPA 2JRMA 1IRGA 3SEQA 5DS9A 2M4KA 2YX7A 4C7HA 2V9VA 5CBMA 1UCRA 5LLQA 3BP8A 1ODDA 2PJ8A 3EY5A 5ILUA 2DOAA 4FISA 2DTRA 1O4XA 1EH8A 1T95A 2ELHA 3CUQB 1LOKA 4G6TB 4Q47A 2A4NA 3BLYA 3QPTA 1RESA 4KVOE 2DA1A 3T1BA 3Q0UA 4RS2A 3RZAA 1QVUA 3AG2H 4PJNA 3CMYA 4UUVA 5I4MA 3CDHA 1QGPA 2HDCA 1LJ9A 3NRVA 2XGDA 2X6XA 1X4OA 1HQCA 4HZFA 5E79C 2R3SA 2DXQA 2XASA 2XF5A 4CGNA 3PIOF 2EILH 3A01A 4XNHC 2IA0A 5HVFA 1VHSA 1QSNA 2O5RA 4RBOA 4HBLA 4EGYA 1LDJA 5EZGA 2FE3A 4KOVA 1SMTA 1TKJA 1VQPI 2NRAC 2KPMA 5J1RA 2PI0A 2Z99A 2BBYA 3LSGA 3R61A 1HCRA 2ZJ2A 3ERMA 4JWPA 3BR3A 1QO0D 4M6XA 2A3SA 5BQTA 4Y4RA 2MD0A 1X58A 4ETSA 2QSFX 4LK1F 3FM5A 4YFNF 2R7WA 2G9DA 4OIPF 2P6EA 1X1AA 3RPUA 2DT7B 3ECOA 3BLNA 2HXOA 4AYBA 4CCOA 3HTUA 4E4HA 3GTOJ 2VXDA 4F9VA 3NQOA 3QYBA 4BQAA 1X1DA 2QCOA 5AIPA 2POKA 5HNHA 3H3VK 2CUEA 1Z91A 4ZJZA 4MFZA 2NNYA 1X1BA 3ZQLA 2C6YA 4HNYB 2JEVA 3D7DA 3WC5A 2IRFG 4K3NA 4RLQA 4A3DJ 4NGSA 1IN5A 2KIUA 1YLOA 4ZI6A 4KFCA 3OYFA 3K2AA 1VQMI 1P4XA 1Z6RA 2A05A 3VWEA 5K5RA 2PJAA 4UFWA 2VPLA 1YI2I 3PB4X 3GZNB 4OMEA 5DDGA 4FTHA 2FL4A 1YLFA 1HA8A 3CCSI 1S7KA 3CO6C 2DQLA 3P5JA 5CVIA 5CPAA 5F09A 4NGMA 2AFOA 3TT2A 1YYVA 1ZHFA 1FYMA 2YU9J 2JA7J 5A28A 2FQ3A 3SI0A 4KLWA 4B43A 2ZXJA 3CF5F 1JXSA 1V5EA 4Y49C 2JQ7A 5L3BA 1I1GA 2WAQN 2DN0A 2YR2A 4QPOA 4CGMA 4A33A 3TE4A 2OZ6A 4QVTA 4QIWN 3RZOJ 1MNEA 4V19K 3IAS2 1I6HJ 3GTPJ 1VQ5I 3MWMA 4G7HF 2AO9A 2LOOA 2O03A 2W57A 3I58A 5THWA 5K5QA 4B5PA 2MBFA 3WGHA 1KYZA 1XTAA 3ZMSA 3IWFA 3JUWA 4KJZA 2CQNA 2DOFA 3NA6A 2M5WA 2VL8A 5J40A 4DBQA 2VJJA 4Y33A 3WU1B 2P0WA 2PJ2A 1Y8RB 1BR4A 1Y1WJ 1ZREA 2ZMEA 1XS9A 1CQTA 2D5VA 2CTCA 1O3RA 3FBUA 1KU3A 5F0CA 4RM2A 4CCMA 2FA5A 3WR7A 1Y0YA 1MMSA 1ETKA 2P4WA 4XLCA 2XPUA 4MHGA 3TW6A 5J4YA 4XNHB 1S8NA 1XDUA 3B3SA 3KPHA 4JYKA 4ZDLA 1YO5C 2LFBA 4P9FA 3VYRB 1QQIA 2L9RA 2MLKA 2QZ8A 2OU2A 4KN4X 1IC8A 3DGVA 3ZMDA 4X6AJ 2QMLA 1D0YA 2F5DA 5CVRA 4UWIA 1MD0A 2O8KA 2V1DA 4LOCA 4OKOA 4ASNA 4YRHA 4KMUX 4EJVA 1PCAA 2FE7A 2VE9A 1Z4EA 1YW9A 3MMYB 1G3WA 1QMUA 5FRMA 4BH9A 2V8DA 1B72A 4MY3A 5EBVA 2EFPA 3OS1A 3U21A 4LQ6A 3KYCB 4X1EA 4AIHA 5F1RA 1DU6A 4JK1X 2LLKA 1FOWA 3CLOA 5A2QZ 3E97A 2EBIA 1RZ4A 1Z3XA 1ELMP 2VL1A 2VJ4A 2XIGA 3E6MA 4UV8A 3TDZC 3TO7A 2VKEA 4A0YA 4R57A 2FSRA 1BIAA 4EVIA 3QODA 1YRNA 2Q2EB 1XJOA 2BVMA 2GOXB 3I71A 4PSXA 4O6JA 3MAJA 3JRCA 1YVOA 3O3KA 1LFPA 4XPLA 4CCNA 3ABTA 2D2WA 2UV1A 2XAUA 1YHQI 5LGUA 4LX9A 3PJRA 1KYWA 1Y0NA 4CUGA 1SVMA 2MLGA 2IA2A 3BOQA 4RB1A 4CGZA 1PU9A 5D8KB 1SEUA 3FDYA 2DK8A 1TBXA 5H6QA 2VEZA 2NVQJ 1NG6A 5GAEJ 2PBIA 4B5PB 4S04A 2K27A 2WAFA 2M45A 3ZQHA 1JHHA 4BBRJ 2Y0SN 1T33A 3K1MA 4AVBA 4PZJA 3FNCA 1VZ0A 2H6BA 2VQGA 3FK6A 4DGWB 4ENKA 3G8WA 5C3EJ 1RUOA 3HOZJ 1Z7LA 5EMIA 3KP3A 1S3ZA 3DEUA 4DJLA 2J5OA 2ZSHB 2I3CA 3FZVA 3B3TA 2DEAA 4ON0A 3W2WA 4J3GA 3DSBA 4H89A 4PXDA 2VQCA 3ROUA 2LKXA 2FBHA 3D1NI 1XC5A 3D7HA 1F1ZA 2FXAA 2W4SA 3KE2A 5JVTA 1V5GA 2CV0A 3DKXA 2M1BA 5JQ4A 3FXMA 2HI3A 3S2HJ 3WTZA 4TNUA 3CJNA 1DDNA 2M7BA 5LFAA 2B0LA 2V8VA 5B1BH 2HDDA 3QOEA 1S29A 3FWEA 1ON1A 1WGXA 2D45A 2E2IJ 4OAZA 2ZOFA 4XLAA 4M3DA 5F0FA 5LHGA 2VBQA 2LF8A 3DP7A 4E0AA 5GTHC 3PSFA 1OKRA 3ZQ7A 2RB7A 3LODA 1W4MA 2XAGA 2AS5F 2HB6A 4KUMA 1QHGA 5FGMA 2HPIA 5LGNA 2FNPA 4C2UA 1X3ZB 1XPXA 4LG3A 2EZKA 4XRFA 1P9QC 4OIRF 5JHFA 4LG0B 1IYLA 1UWYA 2BUEA 1AU7A 1ZK8A 5FD6A 2A07F 2UXNA 4C30A 4BY1J 2MSYA 5K7ZA 4BE1A 4R3LA 2MD5A 3KZYA 2GXBA 3NARA 3BTCA 3S6KA 3HEFA 1WJFA 3HSRA 5CYVA 4XSZF 1TQPA 2G0BA 3KP4A 2BCOA 3FBIB 1Z4RA 2F7VA 4KOYA 2ADUA 5M3MJ 4IL6C 1XOVA 4IAVA 4LMYA 2X48A 2BO9A 3FKJA 5CPRB 2IT0A 2ZPAA 4M9SA 2B5GA 4NGRA 3BC8A 1FWZA 2EA4A 1IICA 3PQKA 4NSQA 4AG7A 1ZR4A 2FXFA 3FMQA 3I3LA 1MGTA 2P7VB 2ISZA 3ASNH 4KICA 1JTXA 5F47A 4EJWA 2BOLA 4JYWA 4XOTA 3OYGA 1XRYA 2GXGA 2R4GA 5HLTA 5IP6A 5HLHA 3S6GA 2NAZA 1W36C 4C2XA 1WJBA 4M6YA 4ORFA 2P8TA 4IHWA 4JXQA 3TC8A 2DJIA 1KUVA 3JW4A 4MHYA 1VQ4I 5KK1A 4XMYA 2N8GA 4M6GA 2EZHA 3B3WA 2VONA 2EIMH 2ME0A 3FXOA 3KZWA 2ZXHA 5KCMA 1MJ9A 4H6UA 2K7LA 1ZG1A 1EH6A 2EUIA 5J6XA 2CV2A 5CKTA 1M1DA 3CJQB 3OSGA 3VODA 1FNNA 3KLNA 1YW8A 2K9QA 2VIXA 4QWQA 3VSKA 2JMWA 3L2RA 3I9V2 1SFEA 2XRNA 3BY6A 2NVYJ 3HXLA 4FD5A 2G3TA 3CMEI 3ZQCA 4HNUA 1H9GA 3I1UA 2O61A 1ZLIA 2CW8A 3F8CA 1RPWA 3LQRA 2GLJA 1J2XA 4M3FA 2WUUA 2NMTA 4KUBA 2WSAA 2TRTA 3RBUA 4NC8A 3SJXA 1K4TA 3LSPA 2VBZA 1IDZA 4F55A 1ZQ3P 2OJED 3GVAA 3LMSA 4HYEA 1F5TA 3FMCA 1IGNA 4A3CJ 4PJMA 3MZHA 4F92B 4A3GJ 2PMZN 4A93J 1BO4A 1WPKA 5E8IA 2YS9A 3QYFA 2LH9A 3W91A 4FUUA 2STTA 3VATA 2BSWA 2PC1A 3FXUA 3G3ZA 4O3MA 3PQJA 5G1ZA 1T39A 2XKOA 3OS0A 3D5RC 3Q3SA 1K4JA 2V6EA 3DPTA 2QQ9A 4NC7A 4BNCA 2JA6J 3DQVC 1YW6A 1MMNA 3M4OJ 3GZ5A 3EFAA 3CUQC 4NB5A 5J8CA 4BBSJ 1R4NB 3FX3A 2LBFB 4QTRA 4X2TA 5H86A 5HS8A 2DMTA 4MEXF 1ON2A 1OLTA 2X1EA 1YIOA 4MNUA 4ENNA 3PB8X 3Q9SA 3V8KA 4I6ZA 2YU3A 3D66A 1JJ8C 3TP3A 3BDDA 2VOPA 5CVJA 3TOAA 1RUNA 4NJQA 5CVUA 3HRUA 1CPSA 2GOMA 2XAFA 5HS9A 1VIXA 2OZUA 2HZTA 1OPCA 2HOAA 3VH9A 2R7TA 1BPMA 1OCTC 2E5NA 3BXMA 4GO1A 4XRMA 1PUAA 5M5XJ 2X1CA 1IV6A 4PXCA 1E17A 1K83J 3IC7A 3DR8A 2AFZA 1HXDA 4EM2A 5DM6F 4ZTFA 2VQYA 3RZDJ 4P1WA 1Z2LA 4EMSA 2IGNA 2KMUA 1G3SA 1ETVA 4MQ9F 2PRQA 3C26A 3B3VA 1U6GA 4G6QA 2GFQA 3L2NA 1I39A 3MZ8A 4IHVA 2Q4ZA 1MDMB 2HVQA 2ZFWA 3SDBA 5DD4A 3FEEA 3DCFA 4ZDOA 3B3CA 4B11A 4HV6A 3OL4A 3SXYA 2FU4A 2LK2A 2Q2EA 3PGPA 4PDKA 2D4PA 2EPFA 3IL2A 3DLLF 3AG1H 3O8HA 3BWGA 3WTSC 3H5NA 4EGZA 3SFZA 2CIJA 2DFEA 2F4MB 3TEDA 1JI8A 1IRZA 4AM3A 2XGCA 4A12A 3L7WA 5ILVA 2OTLI 2BOAA 3CXPA 3F8KA 2DFFA 5ICCA 2BY2A 1DGWY 2QQBA 3T8WA 4ZYAA 1OYIA 1Y56A 4JX6A 4QPQA 2E71A 1FJLA 1A6QA 5BPIA 4BE0A 3K1NA 3H3UA 1NMTA 4ZX9A 2CTBA 4MBUA 3CC7I 2Y0SA 4ZDPA 4UUSB 1X12A 1DUXC 1DGRM 2F6CA 3FECA 2DA4A 1YRNB 1TWGJ 1TT0A 3KZIC 3OIOA 4F9UA 2L9VA 4DZPA 2EV5A 2QSHX 1KU7A 4V2FA 1UB9A 2QYVA 4IPAA 3ZQIA 2KZGA 4UEFA 3F6VA 1R00A 2HC9A 3V8LA 3FXRA 4XPDB 3HLPA 3G1LA 1U8RA 1I50J 1FZPB 1JKPC 4M3GA 2OQRA 4ZYQA 2K9LA 2M34A 1D8JA 3GUDA 4BDYA 3KHZA 3PFOA 3F6OA 3J80K 2QSGX 1UFMA 3VYTB 3C1DA 5F08A 4C7IA 5IYDJ 1STZA 2DPUA 4OC1A 3WTYC 2I5UA 4DUKA 3VWDA 1GT0C 5BWAB 4AB7A 2XHKA 4JJXA 1BJAA 2XROA 2CS3A 2MA3A 2OOTA 2Q44A 3LOCA 1E2XA 1S60A 3S15J 4O23A 1N25A 2JRTA 3A0BC 1KUXA 2O7OA 1ARMA 2O53A 3FIXA 2R5YA 4G9YA 3DLJA 3OR2C 3LSHA 2JVGA 3DNSA 3HKZN 2ABZA 2QVOA 2XPVA 1GYTA 2X6YA 1E3HA 1HBXG 4Z2YA 1BOAA 5FFZA 2ZKZA 3J7AO 1AKHB 5IB0A 3JR9A 3CPXA 5GCNA 2VB6A 4G8XA 2Z3KA 2VQLA 4UFVA 4M71A 3VPRA 5D5UB 2PJ6A 2AJ6A 2AXTC 2DPTA 2EVNA 4UUTA 2XEJA 2VJIA 3AKZA 2KRHA 3BT9A 4AIKA 4XR6A 5JR3A 1U0JA 3A02A 3I59B 3NE8A 3DF8A 2WPWA 1M4GA 3HPGA 1Z77A 1G3TA 5HLIA 2ISYA 2PQ8A 1MKMA 5ERIA 5GADJ 3RI4A 2AHQA 3BPXA 1JT6A 1TKHA 1KUYA 2BXZA 3S17J 1ZG5A 4Q38A 5L3GA 2VN2A 1WH7A 3BG9A 2FD5A 2L0KA 2EFNA 3CJTB 1IDYA 4L89A 4LQGA 3JTKA 1FOXA 3JRDA 5HDNA 2BVLA 1O7FA 1ZGJA 2BYVE 3JSPA 3GFIA 3CC4I 5F49A 5F0HA 4L5EA 2QBYB 5ILSA 3RQIA 5FRNA 1HKSA 1JKRC 1BC7C 1K61A 2PJ0A 4JD6A 4YU9A 2Z1DA 1VQLI 4XLFA 4BGDA 2CNTA 2KISA 3GTGJ 2MFZA 1MH4A 1YX3A 2MH2A 4ZYDA 4EFDA 1MIJA 1H0MA 3QNVA 9ANTA 3FBNB 2ZEDA 1XX5A 2WY8Q 2ZNYA 2XF6A 2F8HA 4HNTA 2QA4I 1QQ9A 1F36A 2OF7A 1YLEA 4F7ZA 4FBEA 2Y0MA 1FMVA 3FMRA 3P9KA 4YFJA 4HW0A 2JPCA 3LSIA 4B1RA 1DU0A 2QQ8A 4OU0A 1D1BA 3CZ6A 2X0LA 4HA8A 1KONA 1VNDA 4HV5A 3W6XA 2STWA 5ICEA 3J81K 4I76A 2LNBA 2QVPA 3NFZA 1UZCA 3FISA 5IYBJ 4Z65A 4FQGA 2ZC2A 4PGHA 5IOYA 3MCZA 2NS7A 3QU3A 2VE8A 3ABLH 1V54H 3SEZA 4MY0A 2P7CB 2EB7A 3K4KA 1BJZA 2EFWA 2ZEGA 4L5JA 4JLYA 4FT8A 1G4DA 2IGOA 2PN6A 3UKGA 1Z67A 3TGNA 3BG6A 2JVHA 1K78A 3ZQGA 4KS9A 3H8EA 2V4JC 3S8PA 3IP4B 5F46A 3EETA 3WC7A 3FX6A 4CAVA 3K4BA 3GXOA 3DPLC 2PJBA 2K86A 2EV6A 4I0AA 4I01A 4V2GA 1VQ7I 3D3SA 2M8EA 3EC4A 1TNSA 3F8NA 2UZKA 5LEJA 1MSEC 2HS5A 3I5UA 1ARLA 3GLXA 1XGOA 2B3UA 4HNXB 1XB4A 1JGSA 1WWZA 4RGXA 4CCLA 2IW5A 4P4BA 3RYRA 4UB8C 1SVOA 1ZGAA 3I53A 1Z3YA 3JVNA 5DD8A 1D0ZA 1P7IA 2ZO4A 4F93B 4EM0B 5K1YA 2V1NA 4KITB 4D5CA 2E5ZA 3KFWX 3PM1A 2X51A 4U7DA 1YS7A 4XKBA 3BR0A 4NQWA 2DDBA 3PP9A 2IS6A 2EFOA 2P5LC 1J7KA 5FLXZ 3OSFA 2NS8A 2ZW5A 3LD2A 3BZ6A 1TW2A 4FHTA 2LTPA 4CZZA 4FX0A 1TTYA 3K4NA 3HL2A 2ESHA 5K7HA 2DA5A 4R79A 1FBUA 4R3KA 1I5ZA 4KIBA 4BE2A 3CMMA 4MQVA 3IRRA 4CDGA 4MCRA 4RMNA 1Z5RA 1SFXA 1ITYA 4CGOA 1MBGA 1LKXA 3DLAA 3IAM2 3V7SA 3MKWB 2IQ6A 5J47A 4QB9A 1CJWA 1TQIA 2UUZA 5EEAA 2PEXA 3J81Z 1FLIA 2X6OA 4E2AA 5HS7A 4HX4A 4E7IA 4WXHA 3ZMVA 2EV0A 2ID3A 1MBKA 5J3LA 5B1AH 2IGKA 3GTLJ 3H36A 3S93A 4JQFA 3OL3A 5EJCA 3TQNA 1QVTA 4D5FA 3IFEA 4IF5A 5JPHA 2LF7A 1LQ1A 2L7MP 3E1SA 2ESNA 4U0WA 4XL9A 2UXXA 4NDLA 4EJUA 2VXZA 2HYJA 3C2HA 4IHXA 1K79A 2FMYA 4WXCA 2R98A 1PUFB 2DPDA 1YQAA 4MIMA 3DBLB 3T5XA 1KU9A 4MJ8A 4UNOA 4M74A 2DQRA 3S3OA 1V55H 2VKVA 2R1IA 1T2KA 1S6LA 1TXRA 1Y39A 2DODA 2HVRA 3SI1A 3QP6A 4MFDA 2COBA 1FTTA 3VFZA 4DIQA 2RKHA 3TFYA 3VOEA 1TF8A 4KT6A 2Y30A 2FVGA 1XSVA 2HYGD 4P4FA 1Y8QB 3ABMH 3QWLA 1DTDA 1WJCA 1WRJA 2C27A 4KOUA 2TCTA 3HJEA 2DYRH 1K7AA 2XEGA 1ZYRF 1WJDA 5HODA 1YTYA 1HDUA 2HUZA 4LIUA 1IRXA 1IB1E 4LK0F 4AXVA 3FJUA 3PIPF 2QQAA 4XKVA 4C3JJ 4OC0A 4A32A 1QZYA 2G9WA 2MW8A 2HU9A 3OMYA 4XIDA 1P0HA 2VT2A 4MFJA 1GV2A 5ELYA 1BC8C 1B1BA 1P7JA 1PUEE 2IBDA 2DMQA 1QSTA 4CGPA 4L18B 2IP2A 3MKZA 1F4KA 3A01B 3S1MJ 2I79A 2BY3A 1E3PA 3KIOA 5H6RA 4RGRA 3X2QH 1B9MA 1OFCX 3ISXA 4HQEA 4IEJA 4D7NA 3GWZA 1YIJI 1LFWA 2PRBA 3F21A 5FLVA 3QP5A 5AIQA 1LRZA 4BU2A 3FYNA 4OAYA 2GREA 3PBEA 4OIOF 3F22A 3CUQA 3BTIA 4BHPA 2OZHA 2BGCA 3DTEA 1R49A 1L3LA 3S2DJ 4PQAA 4KLVA 5LRGA 3A9LA 3S9NA 3I3GA 1LE8A 2H1KA 2PMHA 2GA2A 3MVPA 4ANJA 3F0CA 3D2PA 3HZJA 5D6FA 4UCNA 3M9AA 1B6BA 2ZMEC 4Q7AA 1JUMA 1T98A 4DJAA 4P4DA 1CBXA 1R4MB 1XN7A 2Q0YA 2ZW7A 5LRJA 3J80Z 1NG7A 4CCKA 2G7UA 2RN7A 1XG1A 3OYDA 3V42A 3HRSA 4B4CA 1YQEA 5HVHA 4A5NA 1XE4A 1N75A 2LYCA 3KP2A 4KOTA 3GFMA 3OR1C 4B8XA 1NE9A 3FVLA 2XB0X 1SANA 2QLZA 5AG7A 5HH1A 3K9UA 2YNEA 1J5YA 4I2OA 1J4JA 2CQXA 3CPAA 4PPZA 4GS4A 4A3EJ 3SXNA 4I49A 5F6FA 2D4OA 2F5EA 1R7JA 3TP0A 4BQOA 1GHCA 3IEHA 5I0CA 1A31A 2XF7A 1F2OA 4A0ZA 3ZMUA 3VB2A 3L00A 4KSAA 2PJ4A 1WJEA 4OOIA 3V7CA 1J59A 4DBRA 2ZSIB 2IS1A 3K0LA 2E1NA 1XCVA 3S32A 1YSJA 2C6CA 4M6HA 3S6FA 1D3YA 1NSAA 3CCQI 2JBJA 5E3OA 5EEHA 4Q36A 2Q0OA 2O6GE 5E8GA 3JRAA 1Z7UA 4IZZA 4HF2A 2VODA 3BI1A 3H4QA 1MZBA 1IXSB 2EIJH 1NK3P 4G94A 4BS9A 3MN2A 4L8AA 2REEA 4M85A 2K9NA 3WU0A 4OC3A 1D1CA 1RR8C 2H6CA 2CWEA 3BQZA 3K2ZA 4B3AA 4KOSA 1QBJA 2PJPA 3LSRA 3LNQA 1IO2A 1V4RA 4IRIA 1MBFA 1S7EA 3H1CA 4RB3C 2V8GA 1OYYA 2R5ZA 3HHHA 7CPAA 4BEHB 2BY0A 2HR3A 5IY5H 3KGQA 4TWEA 4XLHA 2KCWA 2EJRA 4F6AA 5E1WA 5ICGA 5E3MA 3CP8A 3F8BA 2B3VA 1ZG8A 1TWHJ 2WADA 3Q9VA 1N71A 1U6MA 4OLLA 2HKOA 2K9SA 3CZXA 4L9VA 4I0BA 3WU2C 3ZR8X 1EE3P 1H89C 5LYLA 1MK4A 2PVVA 3L09A 1C0WA 4O5VA 4PCQA 2BW3B 3R4KA 1UHMA 3I4PA 2K4BA 4OP4A 4CSWA 4EJTA 2IS4A 3G71I 2Z3OA 1FEXA 3IU2A 1GUUA 4RAYA 2DA7A 3S16J 2JUGA 2L54A 2Z3YA 1CG2A 1WKMA 4AYBN 1D1AA 3K4JA 4A69C 1MMAA 4F8ZA 5FKLA 3ZN1A 2LKPA 2DK5A 1GDTA 2LY9A 3NWSA 4ENJA 1Y9KA 1B59A 2EZIA 2ZELA 2OBPA 4Q4ZF 1TWAJ 1AA7A 5E3LA 1WJAA 4XLPF 3IKVA 1HKTA 3HBLA 2EQRA 5D8NA 4KOXA 4MO7A 3C3WA 2CNSA 2PG4A 2A69F 4BJTA 1KZFA 1RTQA 1VI0A 3QAYA 5IYCJ 3M8FA 2VC0A 3GBGA 2XKPA 2AFXA 1WK4A 1G8XA 4RN7A 3EUHA 1VQ9I 3P7NA 5HDGA 2PMZA 3DBRB 5D5WB 3K7AJ 4HDVA 2VOOA 5E17F 1BLLE 3A4CA 4UA3A 2YPRA 5HOOA 3BZCA 3Q0VA 2MG4A 5FJ8J 4NF1A 2HQAA 1FOKA 1BI2A 1IUFA 2AXLA 4YFXF 1RKWA 4KYWA 1Z8TA 1ETXA 5LYIA 3S9MA 1FPQA 2O3FA 4H6ZA 3TTHA 1G6NA 3V7ZA 5EG0B 3MN8A 2VZZA 1IAWA 5D4SA 1OCPA 3W6KB 1VKCA 1R6RA 1J9IA 2KL4A 1X3UA 2PJ7A 4BD9A 4WWCA 3SHFA 2NOJB 4KNYA 3BI0A 2KIQA 1YS6A 2EO8A 3V8JA 3BCAA 2B9SA 3R9EA 1RI7A 4CAFA 3PEIA 3P9IA 4I98B 3KETA 3BR6A 2F4IA 3HOWJ 1SFOJ 4P44A 4R8FA 4UIAA 3K10A 4AU7A 1FMWA 5BS6A 1KU2A 3FXLA 2LKSA 2RC4A 1UHWA 4IRGA 5DM7F 3DBHB 3D7FA 4NEXA 2L5QA 2B58A 3HOUJ 4II2A 2IS2A 4N9IA 2GLFA 4NHJA 1LUJB 1W1WE 4FETA 4DZJA 3CMAI 3CCVI 4GFBA 3NH5A 2LVSA 2ICWG 4PFPA 1Q1VA 1YJWI 3VEPA 2HPMA 2CW0F 4UVAA 1IG7A 2DA3A 2FUG2 2M4GA 4BMHA 1B9NA 2M3AA 2OR4A 3E0JB 1R43A 3FKIJ 4K30A 5FLXK 4E6KG 1WQ2A 5F1JA 3SJMA 2HFHA 2FEZA 2YUSA 2X85A 1XF8A 1IRFA 2Z11A 1U3EM 2Z3PA 4MHPA 4P6YA 4LG0A 4UF4A 5K8NA 1R5ID 4CH7A 2IVMA 4ESBA 2RNJA 2XAQA 2PR8A 4NGTA 4PXEA 4HLXA 3U1DA 1ZRDA 2ZENA 2XDVA 3PFYA 4DW6A 3ZGKA 3H5RA 2KIMA 3QPSA 4H2KA 4ZYEA 4I99C 1XMXA 2ZJPF 4RM3A 4LLNA 3ERED 2EBJA 4KT5C 1R22A 4L0ZB 3CF2A 4L9TA 3RDIA 4RDUA 3WHCA 5JHUA 3GTJJ 2R7RA 4D7MA 2HKXA 1FBQA 3OYAA 4UB6C 2W82A 2XEFA 3I64A 2RFHA 1M4LA 1W0UA 2YNDA 3DKYA 2A68F 3BTJA 3CCJI 2VXKA 1YVKA 2F5FA 4R87A 3WTXC 3E3VA 3IRQA 4PSWA 2CV1A 1YITI 1U9OA 3C7JA 3ZXSA 2JSPA 2W00A 3DPUA 1BW6A 3DU6A 5A2QK 4HLYA 2ACJA 1GV5A 3HUGB 4NFRA 4C2YA 4RS8A 1EH7A 2JA2A 3PB9X 4HPQA 1W7PD 3H35A 3SJGA 2M0MA 3P2HA 1FBSA 4CCJA 2EZLA 4P5OA 2V1UA 2M87A 1IY7A 4RI1A 3KKWA 3L2UA 3KP5A 2XPWA 4XNFA 4XPKA 3CESA 1CM0A 1KQ9A 2Z10A 3DR6A 4U5YA 2QKMB 1SD7A 2CFOA 4MGRA 2P5KA 5BNGA 2BHYA 1WJ5A 1XMBA 4HSTA 4N4NB 2BE5F 2EK5A 2LR8A 3IGRA 3BG7A 2V9KA 4NUBA 2LBFA 3RIRA 4QLCU 1ERDA 3CCRI 3TO6A 4MXUA 3S3NA 4IXAA 3EDPA 4G12A 2IL4A 5G20A 4GYGA 2B63J 4W9YA 5ICFA 2RV8A 1G2HA 1F2PA 2L7FP 3Q5FA 4R9MA 1BL0A 3IH2A 4A2UA 1R57A 4AG9A 2DJNA 2KJCA 2K40A 2DF5A 3HPHA 3KX2A 3AG3H 1CGPA 3K6GA 5LBQA 5AG5A 3JRHA 4UV9A 4NCZA 4PFOA 1GVDA 2WB1A 3BJOA 1X1PA 2IMOA 3PRTA 2DW4A 2CQ7A 2K3PA 3MFKA 4G6DA 1VQ6I 4MFPA 1WH5A 5HLGA 3SJEA 1B72B 3AL0C 1O57A 4F52A 3NE7A 3KEQA 4H0EA 4E7LA 4B3XA 5C82A 5LGTA 1ACIA 4B12A 1PYVA 4Z6YA 4HDUA 5C4XJ 4HF0A 4CHUA 3HDDA 3E6DA 2EWBA 2HQYA 2M9HA 4Y17A 1SMYF 5LD2C 2I10A 4HG2A 4EQQA 1XGMA 1UG2A 2Q4YA 1S5LC 2C1CA 3KQZA 1USSA 3PUFA 3FK7A 4E7KA 2NVTJ 2Z3LA 3KL9A 2P6TA 2J9AA 1HW1A 1XEBA 1SVLA 1Q7LA 1TT5B 5EEGA 5EZHA 3LQQA 3BJ7A 2Z0ZA 2XGXA 1ZLHA 2YNCA 1LVAA 2MGQA 2Z2SB 3RCOA 1NK2P 2VUMJ 4B6ZA 4UY8I 4A37A 5HMNA 5FVJA 1Y0UA 3TMOA 3K4CA 4LFUA 3SQNA 3G4SI 5JVGF 2B4DA 4OC5A 4PK3A 3ZOBA 4IX7A 1I3QJ 2Y48A 4RGUA 3I4NJ 5DTDA 2KT0A 4RAGA 2WA0A 4XKWA 1Q1HA 2CY2A 4XOPA 4LIVA 4B09A 5L3DA 1S7NA 4UBRA 2V77A 2FBIA 1JTYA 1TZLA 3WHBA 1ZG9A 4CAEA 3FMSA 3HOTA 3LWUA 4GRIA 2I00A 3F8FA 3H92A 3W6SA 3S2WA 1VHOA 3HM5A 3CCLI 2GZWA 3SYTA 2O8XA 2WC2A 3GFJA 3LSTA 4U0VA 4ENMA 2JA8J 1B4AA 3FIWA 1L0OC 1WWXA 2L01A 1OCOH 3GMEA 4M9XA 5DV5A 2GAUA 3RJPA 3VYSB 3A0HC 1O7LA 4P4JA 1VHEA 2HTJA 2R5ZB 3M8EA 3BPVA 1I6XA 4OMYA 1XGNA 2CUZA 2NS0A 2XUBA 1HEEA 4R6TA 2ZEHA 2GQQA 2L9SA 2H5MA 2CH0A 1ZRFA 2CUJA 1QSOA 4Y49B 4Q48A 1J75A 3ABUA 4UWJA 5KTDA 2NSMA 3GB0A 4JBAA 1X4PA 2ELKA 3ZPLA 2FS5A 2E34A 3IIBA 3M3YJ 2ZXWH 4ZGYB 3T90A 5FKMA 3H0GJ 1AHDP 2DTZA 2VBWA 1IOFA 3M1EA 4BEHA 1RC9A 4X0GA 3ZZIA 1HSJA 5LRSA 3LA2A 5LHHA 3MGDA 2AFMA 3C2BA 4XN3A 5KVRA 2PLYA 3C2GA 2LC2A 2O28A 2E2HJ 1ZTRA 4ZY1A 4IHTA 5FROA 3AAFA 5L3CA 1N77A 1JHFA 1FYKA 2V79A 1XFOA 6CPAA 3HOYJ 1BI1A 4CXFA 3LSKA 1P4AA 3BG3A 3RTRA 1PUFA 2F5VA 1VGYA 4PJLA 3RKXA 1UHSA 2IPQX 4AUXA 2H8WA 3OYMA 2OCCH 2HOSA 2PCUA 4EV0A 1RIOH 2R93J 3CC2I 3FXTA 3PFEA 1Y9WA 1LANA 3V7RA 3QRFF 1IN6A 3U1KA 1UAAA 3U2RA 2IJZA 4MCSA 4LJZF 4BXXJ 2FRHA 3FXKA 4XICA 3J7AY 2Q1ZB 2O0YA 2F48A 2VKHA 5IP9J 2PJ3A 5K8PA 4N9HA 5CQEA 1W5SA 1Z8WA 1PVEA 5M5WJ 1F43A 2QECA 4GYIA 5DCMB 2VLAA 2OTJI 4LLGF 3PNTA 2Q8KA 5KHDA 5JGFA 4ONWA 2OPTA 4BQQA 3RPUD 4L9NA 3K4MA 2GXAA 3VDXA 2HEOA 4NBQA 4BJ6C 1IZ1A 3E7LA 1HC8A 5ED4A 2HTSA 2ID6A 4TV7A 2X9DA 2CJJA 1YW7A 1XMKA 2PDOA 4QSHA 1ZG7A 1AYEA 1LEAA 3R1KA 1P6RA 2OC6A 1I12A 4IJAA 3RNZA 1XGSA 4XM3A 1SD4A 2R5YB 1XBUA 5ISVA 3IC1A 4YGOA 2O4HA 4BHCA 2FQ4A 1IF1A 3K4LA 2M0CA 2B5GB 5H84A 3ESWB 4PGGA 2ZEEA 4UCPA 2KFDA 3F72A 4UVCA 5E20A 2EIKH 1XCBA 4ZYGA 4IOAF 3R60A 3ZQFA 2JPBA 5EGOA 2R92J 3KZZA 1QZEA 5KNLA 2NNNA 2ZMEB 3L2CA 1NSLA 4N0BA 2F4OB 3D67A 4C2ZA 1IN8A 1HKQA 1J0RA 4U9YA 2NOGA 2LY2A 2HWVA 1LE8B 1FY7A 1T08B 2KDZA 3KEOA 5LHIA 3R95A 2XAJA 1Y1VJ 3OYHA 1LFUP 2QIRA 3PZJA 3R9GA 2WYRA 4MRIA 4A3BJ 2IGMA 5CNPA 2P81A 4S0HB 2G0EA 2XV4S 5J1UA 1HF0A 3RQ4A 2L7KA 1OR7A 4L5IA 3REOA 4II9A 4OWRB 4NNJA 4KIGA 3EYIA 2GM4A 3FM3A 1TNTA 3OWTA 4YWYA 3WC6A 1PP7U 1ZARA 2JA5J 1HW5A 1I1DA 1ZAOA 4MFQA 4AIDA 5DWMA 2X6WA 2CW7A 3MKYB 3KEYA 4XORA 2JJ7A 1VQOI 2KRFA 1K6YA 4BINA 1P4WA 1LFBA 4HX8A 2NVUB 4EJOA 2FOWA 2GBYA 1AMPA 4QBJA 3K9TA 2DMNA 2KDOA 1EJ9A 5FLMJ 5DS0A 2Z9OA 3FRMA 3OYIA 3TX8A 4XLNF 4BAYA 3H0DA 2Q04A 4MFLA 2LREA 3QAHA 3ZP5A 3S1NJ 1IU8A 1FT9A 5D6EA 3ISPA 4A6DA 1R1TA 2LMDA 3BROA 1K4SA 2COMA 2DOEA 3AFHA 2YGWA 5K8MA 1P4NA 2IXSA 1OISA 2FF4A 3JRUA 1OCRH 5FO5A 4ZTJA 4UXNA 3MQ0A 5JI6A 3CLQA 3H3ZA 4Q5SF 5BMZA 5BPDA 2MABA 4RAFA 4II3A 3JSOA 1BR2A 1FX7A 2X1DA 4XK4A 1H8LA 1T0FA 3HSEA 3I4MJ 2QJ8A 3AL0B 4IVNA 1VTNC 1ZELA 3HUGA 2CYYA 2HGCA 3FF5A 4KN7X 5L3EA 1IOIA 1U5TB 2XSDC 1MNDA 3K69A 4M6VA 4B48A 4MCQA 3H9GA 3F23A 4ZZDA 4A3IJ 3AG4H 5FKKA 3IKTA 3KI9A 2A5YB 4D9JA 1M44A 4YRVA 1Z1DA 3G3SA 1SD5A 1YW4A 4U7BA 3K2KA 4AVZA 1WI9A 4HF1A 3CDXA 1IJWC 1Q2CA 2JBKA 1S7AA 1UG0A 1TL8A 4FD7A 3LWFA 1EKEA 3BHXA 3F5BA 2QYOA 1VQ8I 2R7FA 4NQWB 3W3CA 1EF4A 2LDUA 1B87A 1ZO0A 4QC6A 2D1HA 4FAIA 2BXYA 1K6OA 1CF7A 1BOBA 2Z3MA 1J09A 3LAJA 1MBHA 1U78A 1OJLA 3BG5A 3L2WA 3DTIA 3OYEA 5BOXA 3GTKJ 4C3HJ 2ZEPA 4KUAA 4E7SA 1SFUA 4RB0A 1HSTA 2BV6A 4M3BA 2E1OA 4IQJA 4CA0A 1PDNC 2K9MA 4M3EA 1OZPA 2CG4A 2KZVA 3ZCOA 1MW7A 2CSOA 4LD5A 1APLC 1OCZH 1QU3A 1W0TA 1I21A 1S7LA 2EA2A 3CXQA 2LRDA 2DXIA 4RA2A 4HAMA 5JFRA 1SAUA 4M6IA 5F04A 2X4HA 1A36A 1IV8A 3CCUI 2OQGA 1BI3A 5LYFA 5B66C 4P4IA 1JT0A 3KYLA 3G6EI 1SQHA 3W2AA 1TWCJ 2P6FA 3MKLA 1YX5A 2VASA 2H1LA 3KQXA 2RQPA 4KSFA 1YK3A 2B7EA 5F48A 2Q7BA 1XSXA 2KHMA 1AOYA 2JK3A 1WVRA 3KLOA 3OYBA 4NC6A 4C3IJ 3J7YJ 2KIFA 1JGGA 2DI3A 4F91B 4GDFA 2CGPA 2NYXA 2W25A 3WE2A 2WV0A 3JRFA 3EO4A 5TRDA 1GHEA 2GA1A 1ON0A 2NYQA 4A2ZA 3D5LA 1YFHA 3LAPA 1Z05A 3KP7A 4UFXA 4FD4A 3OYJA 1SAXA 4FCYA 4X3RA 2Z5UA 5JLWA 3DKWA 2HVSA 4BHBA 2BY1A 3TO9A 4MHDA 2JUCA 2K3FA 1Y6IA 2OD5A 3B73A 3HB9A 1FSHA 1FP1D 3B7IA 1BN5A 3G1MA 4BYYA 5IP7J 2JTVA 4KIFA 5HDKA 2WAEA 2ANPA 4R7MA 2YX4A 1FT7A 4RLFA 2K02A 2R7DA 1BIBA 4D0PA 5HXDA 5DUKA 4BL0B 2L7ZA 2JDCA 3HHGA 1UELB 3FXJA 3DXJF 3LL7A 3TDUC 2ZB9A 3EUAA 1TC3C 1X19A 2HDWA 2L9NA 3OYCA 2QBYA 3Q0WA 3LFKA 3COAC 1DP7P 2PJ5A 3EUHC 5TGTA 1ZLJA 4EEFG 4IHYA 2VBXA 4FE4A 4OIWA 5J1QA 4CS0B 4X8IA 5HVQC 3RPQA 4EATA 2Y2ZA 4AIJA 4XBFA 3ZMTA 3ZMZA 2H27A 5IPAA 4UEEA 1SC7A 2OV7A 5K5OA 1XSDA 2K85A 1S5KA 5D4RA 1OMIA 1LPQA 2PJ9A 4P96A 4IKFA 1IW7F 4GM5A 2DFHA 5H2FC 3BR1A 1BPNA 2R8VA 2FSWA 4BY7J 2HOEA 4IUSA 5J1YA 3PB6X 4IRHA 1XIXA 1FIAA 3T9YA 3SZPA 5IOZA 5E3NA 1WCMJ 4DYRA 3KR5A 1JJ6C 3B6AA 5C88A 1DE4C 2CO5A 2DA6A 4MFEA 3OYNA 2DDAA 1GLNA 4OADA 4ZY0A 1VQKI 2P5VA 3T0YA 5EF6A 1QRYA 4Y15A 3GLJA 3K70C 3M7GA 5B3SH 1A35A 4NJRA 4MMOA 2HQNA 4P10A 2KQRA 2HV2A 3SHPA 4FWUA 4ZBGA 2QM3A 2P6SA 4G7OF 1KA8A 3A1YA 3B2YA 4AWXB 2B4BA 4A3JJ 3A03A 1IN7A 2CFXA 4J19A 5FFXA 1CPXA 3RYPA 2OAZA 2V26A 4M3SA 2MH9A 1B8IA 4UVBA 5E1XA 1ORKA 2R7SA 3BR2A 3V38A 5LRRA 1S7FA 2J5PA 1NHAA 5DEQA 3OOUA 4AVCA 2E19A 1OR7C 4XONA 3ASOH 4KISA 1Z8LA 4W1UA 1REPC 1TQMA 1F57A 3N5FA 5IT9K 4NGPA 3T8RA 3O8GA 2VI6A 2DCEA 2PMUA 1OCCH 4F3QA 1O3QA 3DEWA 3HYIA 2VQHA 1W5CC 3UY5A 4F0XA 1Z6TA 1KZHA 3UR3C 4DYQA 1H9TA 3GF2A 2M30A 2R7HA 2WY7Q 1X10A 2AE6A 1ETOA 4HOBA 4YIRX 4CGLA 1T38A 1R1UA 1ENHA 1KQ0A 1WI3A 1NTCA 2VBYA 3K1PA 4WXDA 2Q7SA 3KR4A 4MHNA 1HDDC 2BZTA 4ZC3A 2QUFA 2REFA 2G3AA 3HG9A 2Y9YA 5K8OA 4U0YA 4OIQF 3FEDA 2ELJA 2YSRA 1IN4A 3H5AA 1RNLA 4XRSA 4M73A 2GLOA 5AGEA 4CRZB 4A3LJ 1U5TC 4BACA 1GVJA 4YEJA 3W6JB 2PVWA 2H09A 2XGEA 1ETWA 3PL8A 4RUHA 3LMMA 1N78A 4XSXF 4HEA2 4UUSA 2Q4VA 2Y31A 1T0FC 4MTEA 1UMQA 3HOXJ 3VWBA 3IWGA 3RYOA 4GXHA 4ZY2A 1IGBA 2E1MB 4UHTA 4IHMA 4NGQA 4HX7A 4A39A 4WX9A 3B6CA 3L9FA 1TF9A 3TKYA 5AG6A 4DNCA 4OC4A 2WAQA 3HIFA 3WTTC 2DMUA 3EUKL 5DWNA 4KVXA 3ZN0A 1MDMA 2PFBA 2RDPA 4C2MJ 3TW7A 2QWWA 2CQQA 3CP2A 4B13A 2LSOA 2EK9A 2V7FA 5E18F 4I02A 2W84A 1WZ2A 3D7GA 5AG4A 1CF7B 4HQMA 1A2ZA 5A27A 4C2TA 1TW3A 3DV8A 4JX5A 3OYKA 1B8IB 2PJ1A 1I27A 1U9NA 5KAIC 3FHZA 2R7VA 4E7HA 1M4IA 4U9ZA 4ZX8A 5KTAA 1M4DA 2Q51A 2FT0A 2M7AA 4CYDA 3SXOA 3HRMA 2J8NA 3DWLE 2ATRA 2ZW4A 3D5SC 1FC3A 4WWVA 1LEBA 1M1EB 3ZQQA 1JQGA 2Z3NA 4MHZA 2A6EF 4B44A 2EINH 3JAMZ 4A38A 2XC7A 3PSIA 4CPAA 3ULQB 1JKOC 3GY9A 4E7ZA 1OBRA 5EDNA 3F3XA 1V5FA 2ZXVA 4CYOA 3S3MA 3J7ZI 3E6CC 2ZNZA 3SFIA 3E6BA 4ESFA 5G22A 3CTAA 3GTQJ 3WT4A 2W7NA 5J8FA 3EPZA 3G1OA 2L3DA 4CYNA 2Y75A 2GU2A 4P4EA 4AVAA 3P2FA 5D5VB 3FH4A 3WGGA 3JTHA 2JT1A 1RKTA 1QSMA 2ZEOA 3SI2A 1QA6A 1U8BA 1BBYA 4ABZA 1FSEA 2AQEA 2P6GA 4B14A 2KLOA 2ZEMA 2DT5A 3EQLF 3L2QA 3WG7H 3BJ6A 5KTCA 4CAXA 1H88C 1XMTA 1Z21A 1X1CA 2QF7A 1R36A 2W1OA 3IH4A 1YMEA 4B5OA 4IQ4A 3VYUB 2DPSA 3S9LA 4Y7NJ 4OAEA 1WSUA 2C6PA 1Z0XA 1YREA 4XRSG 1S3JA 2L02A 5C4JJ 3R9FA 4ITVA 2PJRB 3IU1A 1TKFA 2V8HA 4FASD 1Z9UA 3CDLA 2KRCA 3F9KA 3I54A 4BQNA 3I55I 4MI4A 3GYAA 4F0YA 3FF3A 4BXUA 1BR1A 3NH4A 3OY9A 2XEIA 4NXYA 4A5MA 1P2FA 3PB7X 4HSRA 4IOCF 1TWFJ 3I59A 2OCEA 2JLMA 2WWYA 1POGA 1LDKB 3QPHA 2FIAA 2L2OA 2JEWA 2A61A 2MYSA 4P45A 3OIQA 5GAGJ 1LNWA 5LEKA 1B6AA 2E1CA 2FJ1A 1PP8F 5DYMA 3D0SA 4NGNA 1LVKA 6PAXA 1GXPA 1A6IA 3HC7A 2Z33A 1QSRA 1XDSA 2E1MC 1KGSA 1E0EA 2ZOGA 3S1QJ 4JZ0A 4B47A 4I7HA 5F64A 2ZJQF 2R7XA 2CNMA 5D5XB 3KHXA 1TLHB 3HSFA 1ZRCA 5FKNA 4U87A 2QKLB 4GGGA 1MSFC 1ZKGA 2IA1A 1CX8A 1MH3A 3SZGA 4WCGA 3HUVA 4X5KA 5DCMA 1LCPA 3IUOA 3ISZA 3IHUA 1QNTA 4N4OB 3RO0A 1EV7A 5FKOA 3D8PA 3H5ZA 3BJ8A 2F2EA 4XQFA 2GIZA 5CJ9A 4E70A 2ME6A 4D1QA 3GZ6A 4ONUA 2NXNB 3GYHX 4C68A 4PJJA 3NH8A 4YG2F 3GFLA 1Y7RA 3KP6A 3TOBA 2J8RA 2QGUA 3GUXA 5K7FA 1R23A 2DO7A 2V6CA 3JREA 2JN6A 2ZJRF 3A2KA 1LAMA 1W7PB 1UFHA 3I56I 4WJBA 2DT6A 4UEZA 3JCUC 1ZG3A 4LITA 2D1VA 5IV0A 2RVCA 3BCBA 1K78B 1PJRA 4IF4A 3WTVC 2ETHA 1R9TJ 1X2NA 2GWRA 2RQQA 3DFGA 3RKWA 2ZEFA 1MBEA 1IIDA 3HTSB 4EM1A 4FD6A 4EWTA 4EVYA 1ETYA 1R71A 4HNVA 1USTA 2EWNA 2OA4A 3NAUA 3L1PA 3D4UA 4ZH4F 5CVVA 1EA3A 2VPRA 5L3FA 1TP4A 3N4MA 3GKRA 4BDZA 1MMDA 5CLSA 2RAEA 1R58A 3HRTA 2R7UA 5IX3A 3H9JA 2HQ5A 4ZYHA 1D5YA 2ARHA 1V3FA 2F5CA 5H20A 1V0CA 2R7QA 2AFUA 4R1HA 2TDXA 2FMLA 1LB2A 1QPIA 3FXQA 4DYOA 4CRYB 1LDDA 2M2EA 2RREA 2RGVA 4U88A 3MZYA 2HQRA 3LACA 2PJRA 2WV1A 3CCYA 3OIPA 3CJRB 3UNGC 3WGIA 1L0CA 1TIQA 3QB8A 4KZTA 4PXBA 5HVGA 2HXIA 3DDDA 1RR7A 1YJ9I 2W48A 2EK8A 2L4AA 2PIYA 3O6BB 3GTMJ
chains in the Genus database with same CATH topology
4DJAA 4C30A 3PNVA 4CYPA 2IGMA 5CNPA 2A5WA 2Q0YA 3DU5A 4BE1A 2OH1A 4R3LA 4XKCA 2ZW7A 3RQ4A 2L7KA 3S6KA 1NG7A 4LUAA 4OWRB 4NNJA 3TL4X 1WJFA 4CCKA 4II9A 3R96A 3OYDA 3OWTA 4DOZA 2G0BA 4PV6A 3V42A 1I1DA 5DWMA 4MFQA 3FBIB 4BBHA 2X6WA 1Z4RA 2CW7A 4KOYA 3MKYB 1XE4A 1YX0A 1N75A 3KEYA 2ZW6A 4XORA 2LYCA 4KOTA 1NE9A 1K6YA 3OR1C 4BUPA 5AG7A 5HH1A 2PR1A 3K9UA 2YNEA 3FKJA 5CPRB 2ZPAA 1J4JA 1Q2DA 2B5GA 3BC8A 1IICA 4MFKA 4NSQA 4AG7A 2KDOA 1RXTA 4GS4A 4QBJA 3SXNA 2VZYA 4I49A 2D4OA 2FXFA 3I3LA 3FRMA 3OYIA 4BQOA 4J01A 1D0XA 3H0DA 2Q04A 4MFLA 2LREA 3QAHA 2BOLA 5F47A 5I0CA 4XOTA 3OYGA 3L2VA 2R4GA 2XF7A 5HLTA 3OS2A 2CMPA 2FCKA 2X7BA 3S6GA 5GCNA 1W36C 3AFHA 2YGWA 4KSAA 1P4NA 3F0AA 4QUSA 4C2XA 2IXSA 1WJEA 2VKDA 1WJBA 4ORFA 4DBRA 4ZTJA 2B4DB 4KORA 4UCMA 2ZSIB 2IS1A 2LY1A 3OWCA 4JXQA 2DJIA 3S32A 1KUVA 3S6FA 4JXRA 1G59A 2MABA 2GE3A 4II3A 3ONQA 1BR2A 2X1DA 4XPDC 4XMYA 4Q36A 3AL0B 4IZZA 2ZXHA 5KCMA 1ZELA 2BEIA 1MJ9A 3H4QA 4H6UA 2EUIA 1W36D 2CV2A 5CKTA 4BS9A 1MJBA 2VJ5A 4L8AA 1M1DA 3CJQB 4A30A 2VI7A 3PUBA 1MNDA 2REEA 4XN0A 4B48A 1YGHA 3H9GA 4M85A 3VSKA 2VIXA 1D1CA 3L2RA 3I9V2 2FIWA 4C2ZA 4D9JA 3PNYA 1M44A 4YRVA 3G3SA 3HXLA 4XLEA 4FD5A 4U7BA 4KOSA 2G3TA 4AVZA 5EC4A 4HNUA 1Q2CA 1UG0A 2WBMA 2AQFA 2ZFUA 4FD7A 2CW8A 4E7JA 3F5BA 2WUUA 4NQWB 3W3CA 2NMTA 4KUBA 2WSAA 1B87A 4KVME 1ZO0A 4QC6A 4BEHB 4NC8A 2F5IA 3ZJ0A 4XLHA 2KCWA 1BOBA 4F6AA 2Z3MA 1J09A 3CP8A 4BJ5C 3FHNA 1WFXA 5CQGA 4F55A 2WADA 1N71A 3L2WA 2B3VA 3DTIA 3OYEA 1U6MA 4OLLA 2K5TA 4KUAA 3ZR8X 4E7SA 4C9YA 4IQJA 1RO5A 1SFKA 1MK4A 3E0KA 4CA0A 2K9MA 1OZPA 4PJMA 2KZVA 4F92B 3R9GA 3ZCOA 1MW7A 3RSNA 1BO4A 3QYFA 1QU3A 4HRIA 2BW3B 2LH9A 1I21A 3W91A 1S7LA 2BL1A 2LRDA 2BSWA 2PC1A 3CXQA 2DXIA 3OYLA 4CSWA 2IS4A 1SAUA 2Z3OA 4PK4A 3IU2A 4KOWA 5G1ZA 3OS0A 3D5RC 1K4JA 2V6EA 3DPTA 4NC7A 3EFAA 3DQVC 1MMNA 2JUGA 4PK2A 5J8CA 5H86A 4MLOA 2LBFB 3KYLA 3K70D 1D1AA 1SQHA 1OLTA 3K4JA 2X1EA 1MMAA 3W2AA 2P6FA 3QYEA 1YX5A 2VASA 2OUMA 3NWSA 1Y9KA 4KSFA 1YK3A 5F48A 1AA7A 2Q7BA 1WJAA 1IYLA 2KHMA 3N7ZA 3TOAA 3OYBA 2UWMA 4KOXA 2CNSA 2GOMA 4PUSA 4F91B 2OZUA 4BJTA 1KZFA 3EO4A 1MMGA 2R7TA 2A6TA 2E5NA 1PUAA 1IYKA 1GHEA 1ON0A 2X1CA 4B13A 4A2ZA 3D5LA 3DR8A 3GBGA 2VQYA 4ZTFA 3LFUA 1WK4A 1G8XA 4P1WA 2IGNA 2KMUA 4UFXA 2PMZA 4H4KC 4FD4A 3OYJA 4UA3A 2E60A 3A4CA 3C26A 2BW3A 5HOOA 2HVSA 2GANA 1MJAA 2RNGA 4HKFA 4CAWA 4MHDA 4NF1A 3TO9A 2HVQA 1Y6IA 2HQAA 3SDBA 4ZDOA 4B11A 3OL4A 4H6ZA 3ZRGA 3TTHA 2KP6A 3PGPA 4B10A 2D4PA 3V8IA 2WAEA 2VZZA 1VKCA 1R6RA 3H5NA 2KL4A 4RLFA 2NOJB 2Z16A 4BL0B 3DTKA 1JI8A 3BCAA 2JDCA 3LL7A 1UELB 3I9SA 3R9EA 3EUAA 4CAFA 1X19A 2HDWA 5G21A 2L9NA 2ZXIA 3OYCA 3CXPA 2CXAA 3F8KA 2XSJC 2HNHA 3B8GA 3S6HA 4A31A 1DGWY 2F4IA 1DP3A 3EUHC 3K10A 4ZYAA 5TGTA 1Y56A 1FMWA 1DQUA 4AU7A 4QPQA 4BE0A 4BXFA 2RC4A 2YNCC 4CZCA 1NMTA 4CS0B 4MBUA 4NEXA 2Y0SA 4ZDPA 2L5QA 2B58A 5HVQC 4EATA 1DGRM 3IWEA 2F6CA 3W2VA 4II2A 2IS2A 3TBIA 2WPXA 1TT0A 3N05A 4FETA 3LSMA 2OV7A 1S5KA 3CXSA 2K5CA 4PFPA 2HPMA 2GIVA 4IKFA 2J8MA 2FUG2 2M4GA 3FB3A 2R8VA 3WR7A 4BMHA 4IUSA 2M3AA 4XPDB 3H9QA 1XIXA 3E0JB 5HNFA 4K30A 3T9YA 4E6KG 4HNWB 2R7OA 1YR0A 2K9LA 3M8JA 3VSLA 5C88A 2X85A 4Y3OA 1XF8A 2Z11A 3OYNA 4BDYA 2Z3PA 4OADA 1GLNA 3NWTA 4CH7A 3VYTB 2PR8A 3TCVA 3G2BA 4C7IA 2HZDA 3K70C 3MD2A 2XDVA 2KQRA 2MC4A 5E96A 3PFYA 3VWDA 3PZJA 5BWAB 1QHHD 3H5RA 3ZGKA 4AB7A 3HOSA 4JJXA 4CYQA 2HV2A 1S9HA 4RM3A 4YELA 2CS3A 3SHPA 4E8OA 2Q44A 4ZBGA 1S60A 3A1YA 3CF2A 3DEEA 2B4BA 2R7RA 4JOMA 2JDDA 3OYAA 1KUXA 2V26A 2W82A 4M3SA 3D2MA 4J00A 3FIXA 3HKZA 3OR2C 3LSHA 2JVGA 2OZGA 2YNDA 3DKYA 2VXKA 1YVKA 2I8DA 3M1CA 3DNSA 4F0XA 2R7SA 4R87A 2CV1A 4PSWA 1S7FA 2X6YA 2LG4A 1Q2YA 3EXNA 3OOUA 4AVCA 1OR7C 2JSPA 2W00A 3DPUA 3DU6A 4XONA 3ZXSA 4KISA 2OB0A 4C2YA 3HUGB 2PSWA 5IB0A 2JA2A 2VB6A 2Z3KA 1YE9A 2VQLA 3H35A 4HPQA 2M0MA 3P2HA 4UFVA 2DCEA 4A95A 4CCJA 4F3QA 4P5OA 2AJ6A 2DPTA 2EVNA 3SEQA 2VQHA 3KKWA 4RI1A 3L2UA 4XNFA 2M4KA 4C7HA 2VJIA 4XPKA 3UY5A 3CESA 3AKZA 2KRHA 1CM0A 2Z10A 3DR6A 2QKMB 2CFOA 4XR6A 2DOAA 3UR3C 3EY5A 4U5YA 1U0JA 1T95A 2WPWA 1M4GA 3HPGA 1WJ5A 2PQ8A 2R7HA 2WY7Q 4G6TB 2AE6A 2A4NA 4HSTA 3BLYA 4N4NB 4KVOE 3IGRA 1KUYA 3BG7A 2V9KA 4RS2A 4NUBA 2LBFA 4PJNA 4Q38A 4CGLA 1ERDA 3TO6A 4L89A 3S3NA 2IL4A 5G20A 3JTKA 4ZC3A 2X6XA 1X4OA 2G3AA 2REFA 3HG9A 2BVLA 2DXQA 5F49A 2XF5A 4CGNA 4XNHC 4R9MA 2ELJA 3H5AA 5FRNA 1R57A 1VHSA 4AG9A 1QSNA 2O5RA 5AGEA 4JD6A 4KOVA 3HPHA 3KX2A 4CRZB 2Z1DA 4BACA 3K6GA 5AG5A 4YEJA 2KPMA 4NCZA 3LSGA 3PL8A 3LMMA 4PFOA 1N78A 2WB1A 4HEA2 4XLFA 4JWPA 4BGDA 2CNTA 1T0FC 2Q4VA 3IWGA 3VWBA 3RYOA 1YX3A 2K3PA 2MFZA 4MFPA 4Y4RA 2E1MB 2MD0A 3FBNB 3AL0C 4F52A 3NE7A 2WY8Q 2XF6A 2R7WA 4HNTA 4E7LA 4B3XA 1YLEA 2P6EA 1X1AA 2WAQA 2DT7B 1PYVA 3EUKL 3BLNA 5AG6A 5DWNA 4AYBA 4KVXA 4CCOA 2Y0MA 4E4HA 1FMVA 2VXDA 3QYBA 4YFJA 1X1DA 3LSIA 3CP2A 2HQYA 1D1BA 3CZ6A 4ZJZA 2V7FA 1KONA 5HNHA 4MFZA 3W6XA 1X1BA 5LD2C 5AG4A 4HNYB 4HG2A 5A27A 2JEVA 4C2TA 3OYKA 2Q4YA 4RLQA 4E7KA 2Z3LA 3OYFA 2R7VA 4E7HA 1M4IA 4U9ZA 5KTAA 1M4DA 2FT0A 1XEBA 2M7AA 3VWEA 3SXOA 2J8NA 3DWLE 2VPLA 3SEZA 2ATRA 3D5SC 2ZW4A 4MY0A 3BJ7A 2Z0ZA 4UFWA 2YNCA 5C82A 3K4KA 3ZQQA 2Z3NA 2FL4A 2Z2SB 3RCOA 4B44A 1HA8A 4JLYA 2IGOA 1S7KA 2XC7A 3PSIA 5HMNA 3GY9A 4E7ZA 5FVJA 3BG6A 2JVHA 1V5FA 3K4CA 3TMOA 2ZXVA 3TT2A 4CYOA 4KS9A 3S3MA 2B4DA 2V4JC 5A28A 3S8PA 4KLWA 3IP4B 4B43A 4PK3A 5F46A 4IX7A 5G22A 1V5EA 4Y49C 2W7NA 4CAVA 3EPZA 3K4BA 3DPLC 5J8FA 2WA0A 4XKWA 4CYNA 2CY2A 4AVAA 4XOPA 4LIVA 4QPOA 1S7NA 3EC4A 3D3SA 4UBRA 4CGMA 3P2FA 4A33A 3TE4A 1TZLA 4QVTA 4CAEA 2B3UA 1MNEA 1QSMA 3IAS2 3HOTA 4HNXB 1WWZA 4GRIA 2LOOA 2AQEA 4CCLA 2I00A 2P6GA 4B14A 2KLOA 3W6SA 3L2QA 4B5PA 1Z3YA 3JVNA 3SYTA 5KTCA 3JUWA 4CAXA 1D0ZA 4KJZA 1Z21A 1X1CA 1XMTA 2W1OA 4B5OA 4F93B 4IQ4A 3VYUB 2DPSA 2VL8A 2V1NA 4DBQA 4OAEA 2VJJA 4Y33A 4KITB 2P0WA 2E5ZA 3VYSB 1YREA 2X51A 4XKBA 3R9FA 4ITVA 1BR4A 2PJRB 3IU1A 3PP9A 2IS6A 4FASD 2CUZA 1Z9UA 2KRCA 3F9KA 4BQNA 2ZW5A 3FBUA 3LD2A 4MI4A 2L9SA 3GYAA 2H5MA 2CH0A 4F0YA 2CUJA 1BR1A 4RM2A 4CCMA 3OY9A 1QSOA 3K4NA 3HL2A 4NXYA 4Y49B 4XLCA 4UWJA 5KTDA 4XNHB 4HSRA 4R79A 1X4PA 4R3KA 2FS5A 2JLMA 4ZDLA 4BE2A 3CMMA 3VYRB 1LDKB 2FIAA 2L2OA 2OU2A 2MYSA 4ZGYB 4RMNA 3OIQA 3T90A 2QMLA 1D0YA 4UWIA 4BEHA 4CGOA 3IAM2 1LKXA 3DLAA 4X0GA 3MKWB 1LVKA 3ZZIA 4QB9A 1CJWA 2UUZA 3MGDA 3HC7A 4YRHA 1QSRA 2FE7A 2E1MC 1Z4EA 1E0EA 3MMYB 4E2AA 4XN3A 4B47A 3C2GA 2LC2A 4E7IA 5FRMA 2O28A 2R7XA 4MY3A 2CNMA 5EBVA 3OS1A 5FROA 2IGKA 3U21A 1N77A 3S93A 4JQFA 3OL3A 4IF5A 4U87A 2QKLB 5JPHA 4X5KA 3SZGA 1Z3XA 3E1SA 4XL9A 3IUOA 4N4OB 2VJ4A 4R57A 3TO7A 2VXZA 3LSKA 3RTRA 3C2HA 2FSRA 3D8PA 2F5VA 3H5ZA 3BJ8A 4XQFA 4PJLA 2R98A 3QODA 2Q2EB 2BVMA 2GOXB 4D1QA 3OYMA 4ONUA 4PSXA 4MJ8A 1YVOA 1LFPA 4C68A 3S3OA 4CCNA 4PJJA 1Y9WA 2R1IA 3FXTA 4XPLA 2UV1A 2XAUA 1UAAA 4LX9A 1Y7RA 2HVRA 3PJRA 3TOBA 3J7AY 2J8RA 4CUGA 1PU9A 2Q1ZB 4DIQA 3TFYA 2VKHA 3FDYA 4KT6A 1UFHA 3A2KA 2VEZA 1NG6A 5CQEA 2DT6A 4B5PB 2WAFA 1WJCA 4LITA 2C27A 4KOUA 5IV0A 2QECA 2VLAA 3BCBA 1PJRA 4AVBA 1WJDA 1VZ0A 3FNCA 2VQGA 4DGWB 2HUZA 3PNTA 1IRXA 2RQQA 4LIUA 5KHDA 1IB1E 3G8WA 1Z7LA 1IIDA 4XKVA 4BQQA 1S3ZA 3RPUD 3K4MA 3VDXA 4A32A 2ZSHB 4FD6A 3OMYA 2HU9A 4B12A 4EVYA 4BJ6C 1P0HA 4MFJA 3W2WA 1QSTA 4J3GA 3DSBA 4H89A 4CGPA 2VQCA 3GKRA 1EA3A 2PDOA 3MKZA 4BDZA 2W4SA 1MMDA 2CV0A 1V5GA 2I79A 2OC6A 3DKXA 1I12A 3R1KA 2R7UA 2QIRA 4XM3A 4DNCA 3H9JA 5IX3A 5JQ4A 5ISVA 2M7BA 4YGOA 5LFAA 2ARHA 3QOEA 1V0CA 2R7QA 3K4LA 2PRBA 4OAZA 2B5GB 5H84A 4XLAA 4UCPA 1LRZA 4BU2A 2VBQA 3FYNA 4E0AA 4OAYA 4CRYB 3PSFA 3LODA 2RREA 5KNLA 1QHGA 2PJRA 3DTEA 2OZHA 4KLVA 1NSLA 4KZTA 3OIPA 3CJRB 2HPIA 3UNGC 1L0CA 1TIQA 4ANJA 4C2UA 3A9LA 3D2PA 3I3GA 2LY2A 4LG3A 3DDDA 3QB8A 1FY7A 4U9YA 4UCNA 1P9QC 1B6BA 5JHFA 3OYHA 2BUEA 3R95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CNP A;  2Q0Y A;  2OH1 A;  4R3L A;  2ZW7 A;  3S6K A;  4LUA A;  4II9 A;  3R96 A;  2G0B A;  4PV6 A;  1I1D A;  5DWM A;  1Z4R A;  4KOY A;  1XE4 A;  1YX0 A;  2ZW6 A;  4KOT A;  1NE9 A;  5HH1 A;  2PR1 A;  3K9U A;  2ZPA A;  1J4J A;  1Q2D A;  2B5G A;  1IIC A;  4NSQ A;  4AG7 A;  4QBJ A;  1RXT A;  4GS4 A;  3SXN A;  2VZY A;  4I49 A;  2D4O A;  2FXF A;  3FRM A;  2Q04 A;  5F47 A;  5I0C A;  3QAH A;  2FCK A;  2X7B A;  3S6G A;  1P4N A;  3F0A A;  4QUS A;  4ORF A;  2B4D B;  4KOR A;  3OWC A;  4JXQ A;  1KUV A;  3S6F A;  4JXR A;  2GE3 A;  4XPD C;  2BEI A;  1MJ9 A;  3H4Q A;  4H6U A;  2EUI A;  4L8A A;  1MJB A;  1M1D A;  2VI7 A;  2REE A;  4M85 A;  1YGH A;  2FIW A;  1M44 A;  3G3S A;  4FD5 A;  4KOS A;  2G3T A;  5EC4 A;  1Q2C A;  4FD7 A;  3F5B A;  4KUB A;  2NMT A;  1B87 A;  4KVM E;  4QC6 A;  2F5I A;  3ZJ0 A;  2KCW A;  1BOB A;  4F6A A;  2B3V A;  4OLL A;  1N71 A;  1U6M A;  2K5T A;  4KUA A;  1RO5 A;  1MK4 A;  3E0K A;  1OZP A;  3R9G A;  1BO4 A;  1I21 A;  3W91 A;  1S7L A;  2BL1 A;  3CXQ A;  2BSW A;  2PC1 A;  4KOW A;  1K4J A;  3EFA A;  4PK2 A;  5J8C A;  5H86 A;  1SQH A;  2P6F A;  1Y9K A;  1YK3 A;  5F48 A;  2Q7B A;  3N7Z A;  3TOA A;  4KOX A;  2CNS A;  2OZU A;  1KZF A;  3EO4 A;  1PUA A;  1GHE A;  1IYK A;  1ON0 A;  3DR8 A;  2VQY A;  1WK4 A;  4FD4 A;  4UA3 A;  3C26 A;  2GAN A;  1MJA A;  4CAW A;  4HKF A;  4MHD A;  4NF1 A;  3TO9 A;  4H6Z A;  3TTH A;  3PGP A;  2D4P A;  3V8I A;  2VZZ A;  1VKC A;  2JDC A;  3I9S A;  3R9E A;  3CXP A;  3S6H A;  3F8K A;  3B8G A;  2RC4 A;  1NMT A;  4CS0 B;  4MBU A;  4NEX A;  2B58 A;  2WPX A;  1S5K A;  3CXS A;  2GIV A;  3FB3 A;  2J8M A;  4BMH A;  2R8V A;  4IUS A;  4XPD B;  1XIX A;  4K30 A;  3T9Y A;  4HNW B;  1YR0 A;  5C88 A;  1XF8 A;  2Z11 A;  4OAD A;  2PR8 A;  3TCV A;  3VWD A;  5E96 A;  4AB7 A;  4JJX A;  2HV2 A;  3SHP A;  4E8O A;  2Q44 A;  4ZBG A;  1S60 A;  2B4B A;  2JDD A;  1KUX A;  4M3S A;  3D2M A;  3FIX A;  2OZG A;  2VXK A;  1YVK A;  3DNS A;  4R87 A;  4PSW A;  1S7F A;  1Q2Y A;  3EXN A;  4AVC A;  2OB0 A;  2PSW A;  5IB0 A;  5GCN A;  3P2H A;  4RI1 A;  2AJ6 A;  2EVN A;  3KKW A;  3UY5 A;  4XPK A;  1CM0 A;  2Z10 A;  4U5Y A;  3DR6 A;  3EY5 A;  2WPW A;  1M4G A;  2PQ8 A;  2R7H A;  2AE6 A;  2A4N A;  4KVO E;  3IGR A;  1KUY A;  4RS2 A;  3TO6 A;  4L89 A;  2IL4 A;  2REF A;  2G3A A;  2DXQ A;  5F49 A;  4XNH C;  4R9M A;  1R57 A;  1VHS A;  4AG9 A;  1QSN A;  4CRZ B;  4JD6 A;  4KOV A;  4NCZ A;  4JWP A;  2CNT A;  2Q4V A;  3IWG A;  3RYO A;  3NE7 A;  1YLE A;  2P6E A;  4DNC A;  5C82 A;  5DWN A;  3BLN A;  4KVX A;  2Y0M A;  4YFJ A;  2HQY A;  3W6X A;  4HNY B;  2JEV A;  2Q4Y A;  4U9Z A;  1M4I A;  5KTA A;  1M4D A;  2FT0 A;  1XEB A;  3VWE A;  3SXO A;  2J8N A;  2ATR A;  2ZW4 A;  4MY0 A;  3BJ7 A;  2Z0Z A;  2FL4 A;  4JLY A;  1S7K A;  5HMN A;  3GY9 A;  5FVJ A;  2ZXV A;  3TT2 A;  2B4D A;  4KLW A;  4PK3 A;  5F46 A;  4Y49 C;  4CAV A;  5J8F A;  2CY2 A;  4AVA A;  1S7N A;  3EC4 A;  3D3S A;  4UBR A;  3P2F A;  3TE4 A;  4QVT A;  2B3U A;  1QSM A;  4HNX B;  1WWZ A;  2I00 A;  2P6G A;  3W6S A;  4B5P A;  3JVN A;  5KTC A;  3JUW A;  4CAX A;  1XMT A;  4B5O A;  4OAE A;  2P0W A;  1YRE A;  3R9F A;  3PP9 A;  1Z9U A;  2ZW5 A;  3FBU A;  3LD2 A;  4MI4 A;  3GYA A;  2H5M A;  4F0Y A;  1QSO A;  3WR7 A;  4Y49 B;  4NXY A;  4UWJ A;  5KTD A;  4XNH B;  4R3K A;  2FS5 A;  2JLM A;  2FIA A;  2OU2 A;  3T90 A;  2QML A;  4UWI A;  3ZZI A;  4QB9 A;  1CJW A;  3MGD A;  4YRH A;  1QSR A;  2FE7 A;  1Z4E A;  4E2A A;  2O28 A;  4MY3 A;  2CNM A;  5EBV A;  4IF5 A;  5JPH A;  4X5K A;  4R57 A;  3TO7 A;  2FSR A;  3D8P A;  3BJ8 A;  2R98 A;  4ONU A;  4PSX A;  4MJ8 A;  1YVO A;  2R1I A;  3FXT A;  4XPL A;  1Y9W A;  4LX9 A;  1Y7R A;  3TOB A;  2J8R A;  1PU9 A;  3TFY A;  1UFH A;  2VEZ A;  4B5P B;  2C27 A;  4KOU A;  5IV0 A;  2QEC A;  4AVB A;  3FNC A;  2HUZ A;  1IB1 E;  3G8W A;  1IID A;  1S3Z A;  4FD6 A;  4EVY A;  1P0H A;  1QST A;  4J3G A;  3DSB A;  4H89 A;  3GKR A;  2PDO A;  2I79 A;  3R1K A;  1I12 A;  5JQ4 A;  5IX3 A;  5ISV A;  4YGO A;  2ARH A;  1V0C A;  2PRB A;  2B5G B;  5H84 A;  1LRZ A;  2VBQ A;  3FYN A;  4E0A A;  4CRY B;  3LOD A;  2OZH A;  4KLV A;  1NSL A;  4KZT A;  1TIQ A;  3I3G A;  1L0C A;  3D2P A;  3QB8 A;  4U9Y A;  3DDD A;  1FY7 A;  1B6B A;  1IYL A;  2QIR A;  2BUE A;  3PZJ A;  3R95 A; 
#chains in the Genus database with same CATH topology
 1ZH5 A;  2JSC A;  3PNV A;  4CYP A;  1E3O C;  2A5W A;  4DYC A;  3DU5 A;  1ZN2 A;  2E7X A;  5GPC A;  1O3S A;  4XKC A;  2OH1 A;  3GCM A;  4LUA A;  3TL4 X;  5FD5 A;  3R96 A;  3SJF A;  1JKQ C;  4DOZ A;  3MRU A;  4PV6 A;  1FNO A;  4BBH A;  3JTG A;  3CCE I;  1YX0 A;  1D5V A;  4ZZL A;  3QU6 A;  2DBB A;  2ZW6 A;  3IWW A;  3GLL A;  4FX4 A;  3D68 A;  3E5Q A;  4BUP A;  4KMF A;  4ESJ A;  2PR1 A;  1FP2 A;  3PFI A;  2CUF A;  4EME A;  2W85 A;  1Q2D A;  5LYD A;  2LP0 A;  4IHS A;  3PBB A;  1X3W B;  4MFK A;  2QEX I;  1RXT A;  3OV8 A;  2CF4 A;  1JWQ A;  2VZY A;  2CQK A;  2O9L A;  3IV5 A;  3CUO A;  2IAI A;  1R3N A;  3JRI A;  4L0Y B;  1U5T A;  4J01 A;  1D0X A;  2H8R A;  3IJ3 A;  1X2M A;  3L2V A;  4MTD A;  3RAM A;  1G3Y A;  2ECC A;  3OS2 A;  2CMP A;  2V1X A;  2DAO A;  2FCK A;  1JUP A;  1SD6 A;  2X7B A;  5JLX A;  4OID A;  1OYW A;  2XAH A;  3ELK A;  4QUS A;  3GO5 A;  3KYD B;  5GP9 A;  3F0A A;  2VKD A;  1ZLK A;  1T56 A;  2L4M A;  5EYR A;  3JRG A;  1HW2 A;  3S1R J;  5C44 J;  5AON A;  2B4D B;  4KOR A;  4UCM A;  2LY1 A;  3OWC A;  2V9P A;  3KCC A;  3HGY A;  3LA3 A;  1G59 A;  2IEK A;  2GE3 A;  4RB2 C;  4JXR A;  3ONQ A;  3CT9 A;  1ULY A;  1FTZ A;  3H8F A;  3P9C A;  3PO2 J;  4XPD C;  2VC1 A;  4RAZ A;  4G7Z F;  1BAV A;  1I3A A;  2BEI A;  3WAB A;  1AKH A;  2ZCW A;  2H94 A;  1BA5 A;  3U9G A;  3C18 A;  4JP0 A;  1W36 D;  4A30 A;  1MJB A;  2VJ5 A;  5GTI C;  2VI7 A;  1FOY A;  2FOK A;  3PUB A;  4XN0 A;  1YGH A;  2MC3 A;  2Y69 H;  4S05 A;  4RGS A;  1MBJ A;  1HLV A;  2A6H F;  2FIW A;  4KA4 A;  1YJN I;  3PNY A;  4G1P A;  3ML6 A;  2ZBK A;  4XLE A;  5EC4 A;  3GW2 A;  4FE7 A;  2PX9 A;  2WBM A;  2AQF A;  2ZFU A;  2KKO A;  1VQN I;  3HOV J;  4E7J A;  1Y7E A;  4R76 A;  4R8H A;  2HOT A;  1CP6 A;  1DPR A;  2R7Z J;  1P92 A;  4KSI A;  3RKY A;  4KVM E;  3LSJ A;  1GXQ A;  2F5I A;  3ZJ0 A;  4LGW A;  3I0T A;  5FB2 A;  5KAF C;  2PJC A;  4BJ5 C;  2JWT A;  1WFX A;  2KJB A;  1VF9 A;  3FHN A;  3QOP A;  5CQG A;  4OIN F;  4YFK F;  3CO7 C;  2K5T A;  2ECB A;  1YG2 A;  4DQ2 A;  1CP7 A;  4PJ0 C;  1NH3 A;  2HYF A;  2DMP A;  4L9J A;  4C9Y A;  1RO5 A;  1DPU A;  1SFK A;  3VAR A;  3E0K A;  1UJ8 A;  1RET A;  2K4J A;  3B02 A;  2AFW A;  3RSN A;  3SZT A;  3CQZ J;  4LB5 A;  3JRB A;  4HRI A;  1Z8X A;  1A5J A;  1JUS A;  2ODF A;  4A6E A;  2BL1 A;  3CDI A;  2CRG A;  2E36 A;  3OYL A;  2PE3 A;  2FX0 A;  2XB5 A;  2R0Q C;  4PK4 A;  4KOW A;  4IO9 F;  3RKQ A;  1VFC A;  4A94 A;  3S14 J;  5GPA A;  4WK8 F;  4PK2 A;  3BQY A;  1R5H A;  4MLO A;  1ZR2 A;  1YOV B;  2DLL A;  3T8T A;  3K70 D;  4CYC B;  3BJA A;  4CIC A;  5D29 A;  3QYE A;  2OUM A;  2FBK A;  3BTL A;  3CCM I;  2WTE A;  5DUI A;  4YII A;  5E1Z B;  3BZK A;  3N7Z A;  4M72 A;  2UWM A;  3GX4 X;  1QZZ A;  5B5E C;  4PUS A;  4AC0 A;  4HPS A;  3O2P E;  1U2W A;  1MMG A;  3IO1 A;  2A6T A;  2CU7 A;  1IYK A;  2DU9 A;  2E35 A;  3PO3 J;  4W97 A;  3LFU A;  4A3F J;  2C6G A;  1IUY A;  4MCP A;  4H4K C;  1KWM A;  2E60 A;  3IH3 A;  1HDQ A;  2BW3 A;  2M8G X;  2GAN A;  4I09 A;  1MJA A;  2RNG A;  4HKF A;  4CAW A;  1WHU A;  1ZGW A;  2DFI A;  1I1S A;  3W6V A;  1IXC A;  1F9N A;  1FIP A;  1HDP A;  5TIS C;  3R0A A;  2KP6 A;  3ZRG A;  4B10 A;  3QQA A;  3V8I A;  1W5T A;  3WE3 A;  3CD6 I;  1OQY A;  4CO8 A;  1T8I A;  1AWC A;  2AFS A;  1KQ8 A;  2Q43 A;  2Z16 A;  3IWZ A;  3DTK A;  2E2J J;  3B35 A;  1R5G A;  1S7O A;  1BI0 A;  5IT3 A;  1AUG A;  3I9S A;  2DA2 A;  2BHZ A;  1XD7 A;  2BEO A;  3E5X A;  2W24 A;  1ONV A;  5G21 A;  2ZXI A;  3S6H A;  2LD5 A;  2CXA A;  2XSJ C;  2HNH A;  5DCF A;  4LLL A;  3B8G A;  4A31 A;  1DP3 A;  4Y13 A;  4BKX A;  1DQU A;  3E5U A;  4KDP A;  3ABK H;  4BXF A;  2YNC C;  3OOP A;  4CZC A;  5GAH J;  3F8M A;  1O3T A;  5JH9 A;  1ELL P;  3GEZ A;  5EGO B;  3NEU A;  1BW5 A;  3IWE A;  3W2V A;  3BR5 A;  4A3M J;  3JAM K;  1FYL A;  3TBI A;  2WPX A;  3N05 A;  2XRL A;  2QEN A;  5TJJ A;  3LSM A;  3M07 A;  3R0J A;  3SDG A;  2EH3 A;  5F27 A;  3CXS A;  5IB9 A;  2IJL A;  2K5C A;  3WG9 A;  2NVX J;  2GIV A;  3FB3 A;  2J8M A;  4JX4 A;  1S72 I;  4GCV A;  3N97 A;  4YIF A;  5D8L B;  1A04 A;  3H9Q A;  5EG0 A;  2PIZ A;  3HGG A;  5M5Y J;  5HNF A;  1RRJ A;  4IK2 A;  4HNW B;  2FNA A;  2R7O A;  3WTW C;  1MNM C;  4OMZ A;  4LB6 B;  1YR0 A;  3M8J A;  3VSL A;  4K2E A;  4Y3O A;  3H8G A;  3MEX A;  4OC2 A;  4Y52 J;  1R1V A;  2VT3 A;  3EYY A;  3NWT A;  4A0X A;  3ECH A;  2Y9Z A;  5JM6 A;  1JE8 A;  3TCV A;  3G2B A;  4WF2 A;  3R6S A;  1T6S A;  2HZD A;  3MD2 A;  1Y0R A;  1QPM A;  2MC4 A;  3LA7 A;  5IT9 Z;  1BM9 A;  1IXR C;  1QHH D;  2JZY A;  5E96 A;  8CPA A;  4A3K J;  3HOS A;  3G73 A;  3GIU A;  4CYQ A;  1S9H A;  4YEL A;  4CYC A;  1ETQ A;  2WB1 N;  4E8O A;  3KAS A;  5J4V A;  2EFQ A;  4P9U A;  3DEE A;  1Z9C A;  1H8A C;  4JOM A;  2JDD A;  2DYS H;  3WOD F;  5LRK A;  4MEY F;  4AD9 A;  2E7W A;  3D2M A;  4J00 A;  3HKZ A;  4P55 A;  4UIB A;  5M3F J;  4GXO A;  2OZG A;  2G7H A;  3V4G A;  1PYT B;  2I8D A;  3M1C A;  2WZN A;  2XVC A;  3QPL A;  1HOM A;  2LG4 A;  1Q2Y A;  3EXN A;  4M9Z A;  2OB0 A;  2PSW A;  1YE9 A;  4AVP A;  1D8K A;  1W7P A;  3WTU C;  4A95 A;  1XMA A;  1LAP A;  2JRM A;  1IRG A;  3SEQ A;  5DS9 A;  2M4K A;  2YX7 A;  4C7H A;  2V9V A;  5CBM A;  1UCR A;  5LLQ A;  3BP8 A;  1ODD A;  2PJ8 A;  3EY5 A;  5ILU A;  2DOA A;  4FIS A;  2DTR A;  1O4X A;  1EH8 A;  1T95 A;  2ELH A;  3CUQ B;  1LOK A;  4G6T B;  4Q47 A;  2A4N A;  3BLY A;  3QPT A;  1RES A;  4KVO E;  2DA1 A;  3T1B A;  3Q0U A;  4RS2 A;  3RZA A;  1QVU A;  3AG2 H;  4PJN A;  3CMY A;  4UUV A;  5I4M A;  3CDH A;  1QGP A;  2HDC A;  1LJ9 A;  3NRV A;  2XGD A;  2X6X A;  1X4O A;  1HQC A;  4HZF A;  5E79 C;  2R3S A;  2DXQ A;  2XAS A;  2XF5 A;  4CGN A;  3PIO F;  2EIL H;  3A01 A;  4XNH C;  2IA0 A;  5HVF A;  1VHS A;  1QSN A;  2O5R A;  4RBO A;  4HBL A;  4EGY A;  1LDJ A;  5EZG A;  2FE3 A;  4KOV A;  1SMT A;  1TKJ A;  1VQP I;  2NRA C;  2KPM A;  5J1R A;  2PI0 A;  2Z99 A;  2BBY A;  3LSG A;  3R61 A;  1HCR A;  2ZJ2 A;  3ERM A;  4JWP A;  3BR3 A;  1QO0 D;  4M6X A;  2A3S A;  5BQT A;  4Y4R A;  2MD0 A;  1X58 A;  4ETS A;  2QSF X;  4LK1 F;  3FM5 A;  4YFN F;  2R7W A;  2G9D A;  4OIP F;  2P6E A;  1X1A A;  3RPU A;  2DT7 B;  3ECO A;  3BLN A;  2HXO A;  4AYB A;  4CCO A;  3HTU A;  4E4H A;  3GTO J;  2VXD A;  4F9V A;  3NQO A;  3QYB A;  4BQA A;  1X1D A;  2QCO A;  5AIP A;  2POK A;  5HNH A;  3H3V K;  2CUE A;  1Z91 A;  4ZJZ A;  4MFZ A;  2NNY A;  1X1B A;  3ZQL A;  2C6Y A;  4HNY B;  2JEV A;  3D7D A;  3WC5 A;  2IRF G;  4K3N A;  4RLQ A;  4A3D J;  4NGS A;  1IN5 A;  2KIU A;  1YLO A;  4ZI6 A;  4KFC A;  3OYF A;  3K2A A;  1VQM I;  1P4X A;  1Z6R A;  2A05 A;  3VWE A;  5K5R A;  2PJA A;  4UFW A;  2VPL A;  1YI2 I;  3PB4 X;  3GZN B;  4OME A;  5DDG A;  4FTH A;  2FL4 A;  1YLF A;  1HA8 A;  3CCS I;  1S7K A;  3CO6 C;  2DQL A;  3P5J A;  5CVI A;  5CPA A;  5F09 A;  4NGM A;  2AFO A;  3TT2 A;  1YYV A;  1ZHF A;  1FYM A;  2YU9 J;  2JA7 J;  5A28 A;  2FQ3 A;  3SI0 A;  4KLW A;  4B43 A;  2ZXJ A;  3CF5 F;  1JXS A;  1V5E A;  4Y49 C;  2JQ7 A;  5L3B A;  1I1G A;  2WAQ N;  2DN0 A;  2YR2 A;  4QPO A;  4CGM A;  4A33 A;  3TE4 A;  2OZ6 A;  4QVT A;  4QIW N;  3RZO J;  1MNE A;  4V19 K;  3IAS 2;  1I6H J;  3GTP J;  1VQ5 I;  3MWM A;  4G7H F;  2AO9 A;  2LOO A;  2O03 A;  2W57 A;  3I58 A;  5THW A;  5K5Q A;  4B5P A;  2MBF A;  3WGH A;  1KYZ A;  1XTA A;  3ZMS A;  3IWF A;  3JUW A;  4KJZ A;  2CQN A;  2DOF A;  3NA6 A;  2M5W A;  2VL8 A;  5J40 A;  4DBQ A;  2VJJ A;  4Y33 A;  3WU1 B;  2P0W A;  2PJ2 A;  1Y8R B;  1BR4 A;  1Y1W J;  1ZRE A;  2ZME A;  1XS9 A;  1CQT A;  2D5V A;  2CTC A;  1O3R A;  3FBU A;  1KU3 A;  5F0C A;  4RM2 A;  4CCM A;  2FA5 A;  3WR7 A;  1Y0Y A;  1MMS A;  1ETK A;  2P4W A;  4XLC A;  2XPU A;  4MHG A;  3TW6 A;  5J4Y A;  4XNH B;  1S8N A;  1XDU A;  3B3S A;  3KPH A;  4JYK A;  4ZDL A;  1YO5 C;  2LFB A;  4P9F A;  3VYR B;  1QQI A;  2L9R A;  2MLK A;  2QZ8 A;  2OU2 A;  4KN4 X;  1IC8 A;  3DGV A;  3ZMD A;  4X6A J;  2QML A;  1D0Y A;  2F5D A;  5CVR A;  4UWI A;  1MD0 A;  2O8K A;  2V1D A;  4LOC A;  4OKO A;  4ASN A;  4YRH A;  4KMU X;  4EJV A;  1PCA A;  2FE7 A;  2VE9 A;  1Z4E A;  1YW9 A;  3MMY B;  1G3W A;  1QMU A;  5FRM A;  4BH9 A;  2V8D A;  1B72 A;  4MY3 A;  5EBV A;  2EFP A;  3OS1 A;  3U21 A;  4LQ6 A;  3KYC B;  4X1E A;  4AIH A;  5F1R A;  1DU6 A;  4JK1 X;  2LLK A;  1FOW A;  3CLO A;  5A2Q Z;  3E97 A;  2EBI A;  1RZ4 A;  1Z3X A;  1ELM P;  2VL1 A;  2VJ4 A;  2XIG A;  3E6M A;  4UV8 A;  3TDZ C;  3TO7 A;  2VKE A;  4A0Y A;  4R57 A;  2FSR A;  1BIA A;  4EVI A;  3QOD A;  1YRN A;  2Q2E B;  1XJO A;  2BVM A;  2GOX B;  3I71 A;  4PSX A;  4O6J A;  3MAJ A;  3JRC A;  1YVO A;  3O3K A;  1LFP A;  4XPL A;  4CCN A;  3ABT A;  2D2W A;  2UV1 A;  2XAU A;  1YHQ I;  5LGU A;  4LX9 A;  3PJR A;  1KYW A;  1Y0N A;  4CUG A;  1SVM A;  2MLG A;  2IA2 A;  3BOQ A;  4RB1 A;  4CGZ A;  1PU9 A;  5D8K B;  1SEU A;  3FDY A;  2DK8 A;  1TBX A;  5H6Q A;  2VEZ A;  2NVQ J;  1NG6 A;  5GAE J;  2PBI A;  4B5P B;  4S04 A;  2K27 A;  2WAF A;  2M45 A;  3ZQH A;  1JHH A;  4BBR J;  2Y0S N;  1T33 A;  3K1M A;  4AVB A;  4PZJ A;  3FNC A;  1VZ0 A;  2H6B A;  2VQG A;  3FK6 A;  4DGW B;  4ENK A;  3G8W A;  5C3E J;  1RUO A;  3HOZ J;  1Z7L A;  5EMI A;  3KP3 A;  1S3Z A;  3DEU A;  4DJL A;  2J5O A;  2ZSH B;  2I3C A;  3FZV A;  3B3T A;  2DEA A;  4ON0 A;  3W2W A;  4J3G A;  3DSB A;  4H89 A;  4PXD A;  2VQC A;  3ROU A;  2LKX A;  2FBH A;  3D1N I;  1XC5 A;  3D7H A;  1F1Z A;  2FXA A;  2W4S A;  3KE2 A;  5JVT A;  1V5G A;  2CV0 A;  3DKX A;  2M1B A;  5JQ4 A;  3FXM A;  2HI3 A;  3S2H J;  3WTZ A;  4TNU A;  3CJN A;  1DDN A;  2M7B A;  5LFA A;  2B0L A;  2V8V A;  5B1B H;  2HDD A;  3QOE A;  1S29 A;  3FWE A;  1ON1 A;  1WGX A;  2D45 A;  2E2I J;  4OAZ A;  2ZOF A;  4XLA A;  4M3D A;  5F0F A;  5LHG A;  2VBQ A;  2LF8 A;  3DP7 A;  4E0A A;  5GTH C;  3PSF A;  1OKR A;  3ZQ7 A;  2RB7 A;  3LOD A;  1W4M A;  2XAG A;  2AS5 F;  2HB6 A;  4KUM A;  1QHG A;  5FGM A;  2HPI A;  5LGN A;  2FNP A;  4C2U A;  1X3Z B;  1XPX A;  4LG3 A;  2EZK A;  4XRF A;  1P9Q C;  4OIR F;  5JHF A;  4LG0 B;  1IYL A;  1UWY A;  2BUE A;  1AU7 A;  1ZK8 A;  5FD6 A;  2A07 F;  2UXN A;  4C30 A;  4BY1 J;  2MSY A;  5K7Z A;  4BE1 A;  4R3L A;  2MD5 A;  3KZY A;  2GXB A;  3NAR A;  3BTC A;  3S6K A;  3HEF A;  1WJF A;  3HSR A;  5CYV A;  4XSZ F;  1TQP A;  2G0B A;  3KP4 A;  2BCO A;  3FBI B;  1Z4R A;  2F7V A;  4KOY A;  2ADU A;  5M3M J;  4IL6 C;  1XOV A;  4IAV A;  4LMY A;  2X48 A;  2BO9 A;  3FKJ A;  5CPR B;  2IT0 A;  2ZPA A;  4M9S A;  2B5G A;  4NGR A;  3BC8 A;  1FWZ A;  2EA4 A;  1IIC A;  3PQK A;  4NSQ A;  4AG7 A;  1ZR4 A;  2FXF A;  3FMQ A;  3I3L A;  1MGT A;  2P7V B;  2ISZ A;  3ASN H;  4KIC A;  1JTX A;  5F47 A;  4EJW A;  2BOL A;  4JYW A;  4XOT A;  3OYG A;  1XRY A;  2GXG A;  2R4G A;  5HLT A;  5IP6 A;  5HLH A;  3S6G A;  2NAZ A;  1W36 C;  4C2X A;  1WJB A;  4M6Y A;  4ORF A;  2P8T A;  4IHW A;  4JXQ A;  3TC8 A;  2DJI A;  1KUV A;  3JW4 A;  4MHY A;  1VQ4 I;  5KK1 A;  4XMY A;  2N8G A;  4M6G A;  2EZH A;  3B3W A;  2VON A;  2EIM H;  2ME0 A;  3FXO A;  3KZW A;  2ZXH A;  5KCM A;  1MJ9 A;  4H6U A;  2K7L A;  1ZG1 A;  1EH6 A;  2EUI A;  5J6X A;  2CV2 A;  5CKT A;  1M1D A;  3CJQ B;  3OSG A;  3VOD A;  1FNN A;  3KLN A;  1YW8 A;  2K9Q A;  2VIX A;  4QWQ A;  3VSK A;  2JMW A;  3L2R A;  3I9V 2;  1SFE A;  2XRN A;  3BY6 A;  2NVY J;  3HXL A;  4FD5 A;  2G3T A;  3CME I;  3ZQC A;  4HNU A;  1H9G A;  3I1U A;  2O61 A;  1ZLI A;  2CW8 A;  3F8C A;  1RPW A;  3LQR A;  2GLJ A;  1J2X A;  4M3F A;  2WUU A;  2NMT A;  4KUB A;  2WSA A;  2TRT A;  3RBU A;  4NC8 A;  3SJX A;  1K4T A;  3LSP A;  2VBZ A;  1IDZ A;  4F55 A;  1ZQ3 P;  2OJE D;  3GVA A;  3LMS A;  4HYE A;  1F5T A;  3FMC A;  1IGN A;  4A3C J;  4PJM A;  3MZH A;  4F92 B;  4A3G J;  2PMZ N;  4A93 J;  1BO4 A;  1WPK A;  5E8I A;  2YS9 A;  3QYF A;  2LH9 A;  3W91 A;  4FUU A;  2STT A;  3VAT A;  2BSW A;  2PC1 A;  3FXU A;  3G3Z A;  4O3M A;  3PQJ A;  5G1Z A;  1T39 A;  2XKO A;  3OS0 A;  3D5R C;  3Q3S A;  1K4J A;  2V6E A;  3DPT A;  2QQ9 A;  4NC7 A;  4BNC A;  2JA6 J;  3DQV C;  1YW6 A;  1MMN A;  3M4O J;  3GZ5 A;  3EFA A;  3CUQ C;  4NB5 A;  5J8C A;  4BBS J;  1R4N B;  3FX3 A;  2LBF B;  4QTR A;  4X2T A;  5H86 A;  5HS8 A;  2DMT A;  4MEX F;  1ON2 A;  1OLT A;  2X1E A;  1YIO A;  4MNU A;  4ENN A;  3PB8 X;  3Q9S A;  3V8K A;  4I6Z A;  2YU3 A;  3D66 A;  1JJ8 C;  3TP3 A;  3BDD A;  2VOP A;  5CVJ A;  3TOA A;  1RUN A;  4NJQ A;  5CVU A;  3HRU A;  1CPS A;  2GOM A;  2XAF A;  5HS9 A;  1VIX A;  2OZU A;  2HZT A;  1OPC A;  2HOA A;  3VH9 A;  2R7T A;  1BPM A;  1OCT C;  2E5N A;  3BXM A;  4GO1 A;  4XRM A;  1PUA A;  5M5X J;  2X1C A;  1IV6 A;  4PXC A;  1E17 A;  1K83 J;  3IC7 A;  3DR8 A;  2AFZ A;  1HXD A;  4EM2 A;  5DM6 F;  4ZTF A;  2VQY A;  3RZD J;  4P1W A;  1Z2L A;  4EMS A;  2IGN A;  2KMU A;  1G3S A;  1ETV A;  4MQ9 F;  2PRQ A;  3C26 A;  3B3V A;  1U6G A;  4G6Q A;  2GFQ A;  3L2N A;  1I39 A;  3MZ8 A;  4IHV A;  2Q4Z A;  1MDM B;  2HVQ A;  2ZFW A;  3SDB A;  5DD4 A;  3FEE A;  3DCF A;  4ZDO A;  3B3C A;  4B11 A;  4HV6 A;  3OL4 A;  3SXY A;  2FU4 A;  2LK2 A;  2Q2E A;  3PGP A;  4PDK A;  2D4P A;  2EPF A;  3IL2 A;  3DLL F;  3AG1 H;  3O8H A;  3BWG A;  3WTS C;  3H5N A;  4EGZ A;  3SFZ A;  2CIJ A;  2DFE A;  2F4M B;  3TED A;  1JI8 A;  1IRZ A;  4AM3 A;  2XGC A;  4A12 A;  3L7W A;  5ILV A;  2OTL I;  2BOA A;  3CXP A;  3F8K A;  2DFF A;  5ICC A;  2BY2 A;  1DGW Y;  2QQB A;  3T8W A;  4ZYA A;  1OYI A;  1Y56 A;  4JX6 A;  4QPQ A;  2E71 A;  1FJL A;  1A6Q A;  5BPI A;  4BE0 A;  3K1N A;  3H3U A;  1NMT A;  4ZX9 A;  2CTB A;  4MBU A;  3CC7 I;  2Y0S A;  4ZDP A;  4UUS B;  1X12 A;  1DUX C;  1DGR M;  2F6C A;  3FEC A;  2DA4 A;  1YRN B;  1TWG J;  1TT0 A;  3KZI C;  3OIO A;  4F9U A;  2L9V A;  4DZP A;  2EV5 A;  2QSH X;  1KU7 A;  4V2F A;  1UB9 A;  2QYV A;  4IPA A;  3ZQI A;  2KZG A;  4UEF A;  3F6V A;  1R00 A;  2HC9 A;  3V8L A;  3FXR A;  4XPD B;  3HLP A;  3G1L A;  1U8R A;  1I50 J;  1FZP B;  1JKP C;  4M3G A;  2OQR A;  4ZYQ A;  2K9L A;  2M34 A;  1D8J A;  3GUD A;  4BDY A;  3KHZ A;  3PFO A;  3F6O A;  3J80 K;  2QSG X;  1UFM A;  3VYT B;  3C1D A;  5F08 A;  4C7I A;  5IYD J;  1STZ A;  2DPU A;  4OC1 A;  3WTY C;  2I5U A;  4DUK A;  3VWD A;  1GT0 C;  5BWA B;  4AB7 A;  2XHK A;  4JJX A;  1BJA A;  2XRO A;  2CS3 A;  2MA3 A;  2OOT A;  2Q44 A;  3LOC A;  1E2X A;  1S60 A;  3S15 J;  4O23 A;  1N25 A;  2JRT A;  3A0B C;  1KUX A;  2O7O A;  1ARM A;  2O53 A;  3FIX A;  2R5Y A;  4G9Y A;  3DLJ A;  3OR2 C;  3LSH A;  2JVG A;  3DNS A;  3HKZ N;  2ABZ A;  2QVO A;  2XPV A;  1GYT A;  2X6Y A;  1E3H A;  1HBX G;  4Z2Y A;  1BOA A;  5FFZ A;  2ZKZ A;  3J7A O;  1AKH B;  5IB0 A;  3JR9 A;  3CPX A;  5GCN A;  2VB6 A;  4G8X A;  2Z3K A;  2VQL A;  4UFV A;  4M71 A;  3VPR A;  5D5U B;  2PJ6 A;  2AJ6 A;  2AXT C;  2DPT A;  2EVN A;  4UUT A;  2XEJ A;  2VJI A;  3AKZ A;  2KRH A;  3BT9 A;  4AIK A;  4XR6 A;  5JR3 A;  1U0J A;  3A02 A;  3I59 B;  3NE8 A;  3DF8 A;  2WPW A;  1M4G A;  3HPG A;  1Z77 A;  1G3T A;  5HLI A;  2ISY A;  2PQ8 A;  1MKM A;  5ERI A;  5GAD J;  3RI4 A;  2AHQ A;  3BPX A;  1JT6 A;  1TKH A;  1KUY A;  2BXZ A;  3S17 J;  1ZG5 A;  4Q38 A;  5L3G A;  2VN2 A;  1WH7 A;  3BG9 A;  2FD5 A;  2L0K A;  2EFN A;  3CJT B;  1IDY A;  4L89 A;  4LQG A;  3JTK A;  1FOX A;  3JRD A;  5HDN A;  2BVL A;  1O7F A;  1ZGJ A;  2BYV E;  3JSP A;  3GFI A;  3CC4 I;  5F49 A;  5F0H A;  4L5E A;  2QBY B;  5ILS A;  3RQI A;  5FRN A;  1HKS A;  1JKR C;  1BC7 C;  1K61 A;  2PJ0 A;  4JD6 A;  4YU9 A;  2Z1D A;  1VQL I;  4XLF A;  4BGD A;  2CNT A;  2KIS A;  3GTG J;  2MFZ A;  1MH4 A;  1YX3 A;  2MH2 A;  4ZYD A;  4EFD A;  1MIJ A;  1H0M A;  3QNV A;  9ANT A;  3FBN B;  2ZED A;  1XX5 A;  2WY8 Q;  2ZNY A;  2XF6 A;  2F8H A;  4HNT A;  2QA4 I;  1QQ9 A;  1F36 A;  2OF7 A;  1YLE A;  4F7Z A;  4FBE A;  2Y0M A;  1FMV A;  3FMR A;  3P9K A;  4YFJ A;  4HW0 A;  2JPC A;  3LSI A;  4B1R A;  1DU0 A;  2QQ8 A;  4OU0 A;  1D1B A;  3CZ6 A;  2X0L A;  4HA8 A;  1KON A;  1VND A;  4HV5 A;  3W6X A;  2STW A;  5ICE A;  3J81 K;  4I76 A;  2LNB A;  2QVP A;  3NFZ A;  1UZC A;  3FIS A;  5IYB J;  4Z65 A;  4FQG A;  2ZC2 A;  4PGH A;  5IOY A;  3MCZ A;  2NS7 A;  3QU3 A;  2VE8 A;  3ABL H;  1V54 H;  3SEZ A;  4MY0 A;  2P7C B;  2EB7 A;  3K4K A;  1BJZ A;  2EFW A;  2ZEG A;  4L5J A;  4JLY A;  4FT8 A;  1G4D A;  2IGO A;  2PN6 A;  3UKG A;  1Z67 A;  3TGN A;  3BG6 A;  2JVH A;  1K78 A;  3ZQG A;  4KS9 A;  3H8E A;  2V4J C;  3S8P A;  3IP4 B;  5F46 A;  3EET A;  3WC7 A;  3FX6 A;  4CAV A;  3K4B A;  3GXO A;  3DPL C;  2PJB A;  2K86 A;  2EV6 A;  4I0A A;  4I01 A;  4V2G A;  1VQ7 I;  3D3S A;  2M8E A;  3EC4 A;  1TNS A;  3F8N A;  2UZK A;  5LEJ A;  1MSE C;  2HS5 A;  3I5U A;  1ARL A;  3GLX A;  1XGO A;  2B3U A;  4HNX B;  1XB4 A;  1JGS A;  1WWZ A;  4RGX A;  4CCL A;  2IW5 A;  4P4B A;  3RYR A;  4UB8 C;  1SVO A;  1ZGA A;  3I53 A;  1Z3Y A;  3JVN A;  5DD8 A;  1D0Z A;  1P7I A;  2ZO4 A;  4F93 B;  4EM0 B;  5K1Y A;  2V1N A;  4KIT B;  4D5C A;  2E5Z A;  3KFW X;  3PM1 A;  2X51 A;  4U7D A;  1YS7 A;  4XKB A;  3BR0 A;  4NQW A;  2DDB A;  3PP9 A;  2IS6 A;  2EFO A;  2P5L C;  1J7K A;  5FLX Z;  3OSF A;  2NS8 A;  2ZW5 A;  3LD2 A;  3BZ6 A;  1TW2 A;  4FHT A;  2LTP A;  4CZZ A;  4FX0 A;  1TTY A;  3K4N A;  3HL2 A;  2ESH A;  5K7H A;  2DA5 A;  4R79 A;  1FBU A;  4R3K A;  1I5Z A;  4KIB A;  4BE2 A;  3CMM A;  4MQV A;  3IRR A;  4CDG A;  4MCR A;  4RMN A;  1Z5R A;  1SFX A;  1ITY A;  4CGO A;  1MBG A;  1LKX A;  3DLA A;  3IAM 2;  3V7S A;  3MKW B;  2IQ6 A;  5J47 A;  4QB9 A;  1CJW A;  1TQI A;  2UUZ A;  5EEA A;  2PEX A;  3J81 Z;  1FLI A;  2X6O A;  4E2A A;  5HS7 A;  4HX4 A;  4E7I A;  4WXH A;  3ZMV A;  2EV0 A;  2ID3 A;  1MBK A;  5J3L A;  5B1A H;  2IGK A;  3GTL J;  3H36 A;  3S93 A;  4JQF A;  3OL3 A;  5EJC A;  3TQN A;  1QVT A;  4D5F A;  3IFE A;  4IF5 A;  5JPH A;  2LF7 A;  1LQ1 A;  2L7M P;  3E1S A;  2ESN A;  4U0W A;  4XL9 A;  2UXX A;  4NDL A;  4EJU A;  2VXZ A;  2HYJ A;  3C2H A;  4IHX A;  1K79 A;  2FMY A;  4WXC A;  2R98 A;  1PUF B;  2DPD A;  1YQA A;  4MIM A;  3DBL B;  3T5X A;  1KU9 A;  4MJ8 A;  4UNO A;  4M74 A;  2DQR A;  3S3O A;  1V55 H;  2VKV A;  2R1I A;  1T2K A;  1S6L A;  1TXR A;  1Y39 A;  2DOD A;  2HVR A;  3SI1 A;  3QP6 A;  4MFD A;  2COB A;  1FTT A;  3VFZ A;  4DIQ A;  2RKH A;  3TFY A;  3VOE A;  1TF8 A;  4KT6 A;  2Y30 A;  2FVG A;  1XSV A;  2HYG D;  4P4F A;  1Y8Q B;  3ABM H;  3QWL A;  1DTD A;  1WJC A;  1WRJ A;  2C27 A;  4KOU A;  2TCT A;  3HJE A;  2DYR H;  1K7A A;  2XEG A;  1ZYR F;  1WJD A;  5HOD A;  1YTY A;  1HDU A;  2HUZ A;  4LIU A;  1IRX A;  1IB1 E;  4LK0 F;  4AXV A;  3FJU A;  3PIP F;  2QQA A;  4XKV A;  4C3J J;  4OC0 A;  4A32 A;  1QZY A;  2G9W A;  2MW8 A;  2HU9 A;  3OMY A;  4XID A;  1P0H A;  2VT2 A;  4MFJ A;  1GV2 A;  5ELY A;  1BC8 C;  1B1B A;  1P7J A;  1PUE E;  2IBD A;  2DMQ A;  1QST A;  4CGP A;  4L18 B;  2IP2 A;  3MKZ A;  1F4K A;  3A01 B;  3S1M J;  2I79 A;  2BY3 A;  1E3P A;  3KIO A;  5H6R A;  4RGR A;  3X2Q H;  1B9M A;  1OFC X;  3ISX A;  4HQE A;  4IEJ A;  4D7N A;  3GWZ A;  1YIJ I;  1LFW A;  2PRB A;  3F21 A;  5FLV A;  3QP5 A;  5AIQ A;  1LRZ A;  4BU2 A;  3FYN A;  4OAY A;  2GRE A;  3PBE A;  4OIO F;  3F22 A;  3CUQ A;  3BTI A;  4BHP A;  2OZH A;  2BGC A;  3DTE A;  1R49 A;  1L3L A;  3S2D J;  4PQA A;  4KLV A;  5LRG A;  3A9L A;  3S9N A;  3I3G A;  1LE8 A;  2H1K A;  2PMH A;  2GA2 A;  3MVP A;  4ANJ A;  3F0C A;  3D2P A;  3HZJ A;  5D6F A;  4UCN A;  3M9A A;  1B6B A;  2ZME C;  4Q7A A;  1JUM A;  1T98 A;  4DJA A;  4P4D A;  1CBX A;  1R4M B;  1XN7 A;  2Q0Y A;  2ZW7 A;  5LRJ A;  3J80 Z;  1NG7 A;  4CCK A;  2G7U A;  2RN7 A;  1XG1 A;  3OYD A;  3V42 A;  3HRS A;  4B4C A;  1YQE A;  5HVH A;  4A5N A;  1XE4 A;  1N75 A;  2LYC A;  3KP2 A;  4KOT A;  3GFM A;  3OR1 C;  4B8X A;  1NE9 A;  3FVL A;  2XB0 X;  1SAN A;  2QLZ A;  5AG7 A;  5HH1 A;  3K9U A;  2YNE A;  1J5Y A;  4I2O A;  1J4J A;  2CQX A;  3CPA A;  4PPZ A;  4GS4 A;  4A3E J;  3SXN A;  4I49 A;  5F6F A;  2D4O A;  2F5E A;  1R7J A;  3TP0 A;  4BQO A;  1GHC A;  3IEH A;  5I0C A;  1A31 A;  2XF7 A;  1F2O A;  4A0Z A;  3ZMU A;  3VB2 A;  3L00 A;  4KSA A;  2PJ4 A;  1WJE A;  4OOI A;  3V7C A;  1J59 A;  4DBR A;  2ZSI B;  2IS1 A;  3K0L A;  2E1N A;  1XCV A;  3S32 A;  1YSJ A;  2C6C A;  4M6H A;  3S6F A;  1D3Y A;  1NSA A;  3CCQ I;  2JBJ A;  5E3O A;  5EEH A;  4Q36 A;  2Q0O A;  2O6G E;  5E8G A;  3JRA A;  1Z7U A;  4IZZ A;  4HF2 A;  2VOD A;  3BI1 A;  3H4Q A;  1MZB A;  1IXS B;  2EIJ H;  1NK3 P;  4G94 A;  4BS9 A;  3MN2 A;  4L8A A;  2REE A;  4M85 A;  2K9N A;  3WU0 A;  4OC3 A;  1D1C A;  1RR8 C;  2H6C A;  2CWE A;  3BQZ A;  3K2Z A;  4B3A A;  4KOS A;  1QBJ A;  2PJP A;  3LSR A;  3LNQ A;  1IO2 A;  1V4R A;  4IRI A;  1MBF A;  1S7E A;  3H1C A;  4RB3 C;  2V8G A;  1OYY A;  2R5Z A;  3HHH A;  7CPA A;  4BEH B;  2BY0 A;  2HR3 A;  5IY5 H;  3KGQ A;  4TWE A;  4XLH A;  2KCW A;  2EJR A;  4F6A A;  5E1W A;  5ICG A;  5E3M A;  3CP8 A;  3F8B A;  2B3V A;  1ZG8 A;  1TWH J;  2WAD A;  3Q9V A;  1N71 A;  1U6M A;  4OLL A;  2HKO A;  2K9S A;  3CZX A;  4L9V A;  4I0B A;  3WU2 C;  3ZR8 X;  1EE3 P;  1H89 C;  5LYL A;  1MK4 A;  2PVV A;  3L09 A;  1C0W A;  4O5V A;  4PCQ A;  2BW3 B;  3R4K A;  1UHM A;  3I4P A;  2K4B A;  4OP4 A;  4CSW A;  4EJT A;  2IS4 A;  3G71 I;  2Z3O A;  1FEX A;  3IU2 A;  1GUU A;  4RAY A;  2DA7 A;  3S16 J;  2JUG A;  2L54 A;  2Z3Y A;  1CG2 A;  1WKM A;  4AYB N;  1D1A A;  3K4J A;  4A69 C;  1MMA A;  4F8Z A;  5FKL A;  3ZN1 A;  2LKP A;  2DK5 A;  1GDT A;  2LY9 A;  3NWS A;  4ENJ A;  1Y9K A;  1B59 A;  2EZI A;  2ZEL A;  2OBP A;  4Q4Z F;  1TWA J;  1AA7 A;  5E3L A;  1WJA A;  4XLP F;  3IKV A;  1HKT A;  3HBL A;  2EQR A;  5D8N A;  4KOX A;  4MO7 A;  3C3W A;  2CNS A;  2PG4 A;  2A69 F;  4BJT A;  1KZF A;  1RTQ A;  1VI0 A;  3QAY A;  5IYC J;  3M8F A;  2VC0 A;  3GBG A;  2XKP A;  2AFX A;  1WK4 A;  1G8X A;  4RN7 A;  3EUH A;  1VQ9 I;  3P7N A;  5HDG A;  2PMZ A;  3DBR B;  5D5W B;  3K7A J;  4HDV A;  2VOO A;  5E17 F;  1BLL E;  3A4C A;  4UA3 A;  2YPR A;  5HOO A;  3BZC A;  3Q0V A;  2MG4 A;  5FJ8 J;  4NF1 A;  2HQA A;  1FOK A;  1BI2 A;  1IUF A;  2AXL A;  4YFX F;  1RKW A;  4KYW A;  1Z8T A;  1ETX A;  5LYI A;  3S9M A;  1FPQ A;  2O3F A;  4H6Z A;  3TTH A;  1G6N A;  3V7Z A;  5EG0 B;  3MN8 A;  2VZZ A;  1IAW A;  5D4S A;  1OCP A;  3W6K B;  1VKC A;  1R6R A;  1J9I A;  2KL4 A;  1X3U A;  2PJ7 A;  4BD9 A;  4WWC A;  3SHF A;  2NOJ B;  4KNY A;  3BI0 A;  2KIQ A;  1YS6 A;  2EO8 A;  3V8J A;  3BCA A;  2B9S A;  3R9E A;  1RI7 A;  4CAF A;  3PEI A;  3P9I A;  4I98 B;  3KET A;  3BR6 A;  2F4I A;  3HOW J;  1SFO J;  4P44 A;  4R8F A;  4UIA A;  3K10 A;  4AU7 A;  1FMW A;  5BS6 A;  1KU2 A;  3FXL A;  2LKS A;  2RC4 A;  1UHW A;  4IRG A;  5DM7 F;  3DBH B;  3D7F A;  4NEX A;  2L5Q A;  2B58 A;  3HOU J;  4II2 A;  2IS2 A;  4N9I A;  2GLF A;  4NHJ A;  1LUJ B;  1W1W E;  4FET A;  4DZJ A;  3CMA I;  3CCV I;  4GFB A;  3NH5 A;  2LVS A;  2ICW G;  4PFP A;  1Q1V A;  1YJW I;  3VEP A;  2HPM A;  2CW0 F;  4UVA A;  1IG7 A;  2DA3 A;  2FUG 2;  2M4G A;  4BMH A;  1B9N A;  2M3A A;  2OR4 A;  3E0J B;  1R43 A;  3FKI J;  4K30 A;  5FLX K;  4E6K G;  1WQ2 A;  5F1J A;  3SJM A;  2HFH A;  2FEZ A;  2YUS A;  2X85 A;  1XF8 A;  1IRF A;  2Z11 A;  1U3E M;  2Z3P A;  4MHP A;  4P6Y A;  4LG0 A;  4UF4 A;  5K8N A;  1R5I D;  4CH7 A;  2IVM A;  4ESB A;  2RNJ A;  2XAQ A;  2PR8 A;  4NGT A;  4PXE A;  4HLX A;  3U1D A;  1ZRD A;  2ZEN A;  2XDV A;  3PFY A;  4DW6 A;  3ZGK A;  3H5R A;  2KIM A;  3QPS A;  4H2K A;  4ZYE A;  4I99 C;  1XMX A;  2ZJP F;  4RM3 A;  4LLN A;  3ERE D;  2EBJ A;  4KT5 C;  1R22 A;  4L0Z B;  3CF2 A;  4L9T A;  3RDI A;  4RDU A;  3WHC A;  5JHU A;  3GTJ J;  2R7R A;  4D7M A;  2HKX A;  1FBQ A;  3OYA A;  4UB6 C;  2W82 A;  2XEF A;  3I64 A;  2RFH A;  1M4L A;  1W0U A;  2YND A;  3DKY A;  2A68 F;  3BTJ A;  3CCJ I;  2VXK A;  1YVK A;  2F5F A;  4R87 A;  3WTX C;  3E3V A;  3IRQ A;  4PSW A;  2CV1 A;  1YIT I;  1U9O A;  3C7J A;  3ZXS A;  2JSP A;  2W00 A;  3DPU A;  1BW6 A;  3DU6 A;  5A2Q K;  4HLY A;  2ACJ A;  1GV5 A;  3HUG B;  4NFR A;  4C2Y A;  4RS8 A;  1EH7 A;  2JA2 A;  3PB9 X;  4HPQ A;  1W7P D;  3H35 A;  3SJG A;  2M0M A;  3P2H A;  1FBS A;  4CCJ A;  2EZL A;  4P5O A;  2V1U A;  2M87 A;  1IY7 A;  4RI1 A;  3KKW A;  3L2U A;  3KP5 A;  2XPW A;  4XNF A;  4XPK A;  3CES A;  1CM0 A;  1KQ9 A;  2Z10 A;  3DR6 A;  4U5Y A;  2QKM B;  1SD7 A;  2CFO A;  4MGR A;  2P5K A;  5BNG A;  2BHY A;  1WJ5 A;  1XMB A;  4HST A;  4N4N B;  2BE5 F;  2EK5 A;  2LR8 A;  3IGR A;  3BG7 A;  2V9K A;  4NUB A;  2LBF A;  3RIR A;  4QLC U;  1ERD A;  3CCR I;  3TO6 A;  4MXU A;  3S3N A;  4IXA A;  3EDP A;  4G12 A;  2IL4 A;  5G20 A;  4GYG A;  2B63 J;  4W9Y A;  5ICF A;  2RV8 A;  1G2H A;  1F2P A;  2L7F P;  3Q5F A;  4R9M A;  1BL0 A;  3IH2 A;  4A2U A;  1R57 A;  4AG9 A;  2DJN A;  2KJC A;  2K40 A;  2DF5 A;  3HPH A;  3KX2 A;  3AG3 H;  1CGP A;  3K6G A;  5LBQ A;  5AG5 A;  3JRH A;  4UV9 A;  4NCZ A;  4PFO A;  1GVD A;  2WB1 A;  3BJO A;  1X1P A;  2IMO A;  3PRT A;  2DW4 A;  2CQ7 A;  2K3P A;  3MFK A;  4G6D A;  1VQ6 I;  4MFP A;  1WH5 A;  5HLG A;  3SJE A;  1B72 B;  3AL0 C;  1O57 A;  4F52 A;  3NE7 A;  3KEQ A;  4H0E A;  4E7L A;  4B3X A;  5C82 A;  5LGT A;  1ACI A;  4B12 A;  1PYV A;  4Z6Y A;  4HDU A;  5C4X J;  4HF0 A;  4CHU A;  3HDD A;  3E6D A;  2EWB A;  2HQY A;  2M9H A;  4Y17 A;  1SMY F;  5LD2 C;  2I10 A;  4HG2 A;  4EQQ A;  1XGM A;  1UG2 A;  2Q4Y A;  1S5L C;  2C1C A;  3KQZ A;  1USS A;  3PUF A;  3FK7 A;  4E7K A;  2NVT J;  2Z3L A;  3KL9 A;  2P6T A;  2J9A A;  1HW1 A;  1XEB A;  1SVL A;  1Q7L A;  1TT5 B;  5EEG A;  5EZH A;  3LQQ A;  3BJ7 A;  2Z0Z A;  2XGX A;  1ZLH A;  2YNC A;  1LVA A;  2MGQ A;  2Z2S B;  3RCO A;  1NK2 P;  2VUM J;  4B6Z A;  4UY8 I;  4A37 A;  5HMN A;  5FVJ A;  1Y0U A;  3TMO A;  3K4C A;  4LFU A;  3SQN A;  3G4S I;  5JVG F;  2B4D A;  4OC5 A;  4PK3 A;  3ZOB A;  4IX7 A;  1I3Q J;  2Y48 A;  4RGU A;  3I4N J;  5DTD A;  2KT0 A;  4RAG A;  2WA0 A;  4XKW A;  1Q1H A;  2CY2 A;  4XOP A;  4LIV A;  4B09 A;  5L3D A;  1S7N A;  4UBR A;  2V77 A;  2FBI A;  1JTY A;  1TZL A;  3WHB A;  1ZG9 A;  4CAE A;  3FMS A;  3HOT A;  3LWU A;  4GRI A;  2I00 A;  3F8F A;  3H92 A;  3W6S A;  3S2W A;  1VHO A;  3HM5 A;  3CCL I;  2GZW A;  3SYT A;  2O8X A;  2WC2 A;  3GFJ A;  3LST A;  4U0V A;  4ENM A;  2JA8 J;  1B4A A;  3FIW A;  1L0O C;  1WWX A;  2L01 A;  1OCO H;  3GME A;  4M9X A;  5DV5 A;  2GAU A;  3RJP A;  3VYS B;  3A0H C;  1O7L A;  4P4J A;  1VHE A;  2HTJ A;  2R5Z B;  3M8E A;  3BPV A;  1I6X A;  4OMY A;  1XGN A;  2CUZ A;  2NS0 A;  2XUB A;  1HEE A;  4R6T A;  2ZEH A;  2GQQ A;  2L9S A;  2H5M A;  2CH0 A;  1ZRF A;  2CUJ A;  1QSO A;  4Y49 B;  4Q48 A;  1J75 A;  3ABU A;  4UWJ A;  5KTD A;  2NSM A;  3GB0 A;  4JBA A;  1X4P A;  2ELK A;  3ZPL A;  2FS5 A;  2E34 A;  3IIB A;  3M3Y J;  2ZXW H;  4ZGY B;  3T90 A;  5FKM A;  3H0G J;  1AHD P;  2DTZ A;  2VBW A;  1IOF A;  3M1E A;  4BEH A;  1RC9 A;  4X0G A;  3ZZI A;  1HSJ A;  5LRS A;  3LA2 A;  5LHH A;  3MGD A;  2AFM A;  3C2B A;  4XN3 A;  5KVR A;  2PLY A;  3C2G A;  2LC2 A;  2O28 A;  2E2H J;  1ZTR A;  4ZY1 A;  4IHT A;  5FRO A;  3AAF A;  5L3C A;  1N77 A;  1JHF A;  1FYK A;  2V79 A;  1XFO A;  6CPA A;  3HOY J;  1BI1 A;  4CXF A;  3LSK A;  1P4A A;  3BG3 A;  3RTR A;  1PUF A;  2F5V A;  1VGY A;  4PJL A;  3RKX A;  1UHS A;  2IPQ X;  4AUX A;  2H8W A;  3OYM A;  2OCC H;  2HOS A;  2PCU A;  4EV0 A;  1RIO H;  2R93 J;  3CC2 I;  3FXT A;  3PFE A;  1Y9W A;  1LAN A;  3V7R A;  3QRF F;  1IN6 A;  3U1K A;  1UAA A;  3U2R A;  2IJZ A;  4MCS A;  4LJZ F;  4BXX J;  2FRH A;  3FXK A;  4XIC A;  3J7A Y;  2Q1Z B;  2O0Y A;  2F48 A;  2VKH A;  5IP9 J;  2PJ3 A;  5K8P A;  4N9H A;  5CQE A;  1W5S A;  1Z8W A;  1PVE A;  5M5W J;  1F43 A;  2QEC A;  4GYI A;  5DCM B;  2VLA A;  2OTJ I;  4LLG F;  3PNT A;  2Q8K A;  5KHD A;  5JGF A;  4ONW A;  2OPT A;  4BQQ A;  3RPU D;  4L9N A;  3K4M A;  2GXA A;  3VDX A;  2HEO A;  4NBQ A;  4BJ6 C;  1IZ1 A;  3E7L A;  1HC8 A;  5ED4 A;  2HTS A;  2ID6 A;  4TV7 A;  2X9D A;  2CJJ A;  1YW7 A;  1XMK A;  2PDO A;  4QSH A;  1ZG7 A;  1AYE A;  1LEA A;  3R1K A;  1P6R A;  2OC6 A;  1I12 A;  4IJA A;  3RNZ A;  1XGS A;  4XM3 A;  1SD4 A;  2R5Y B;  1XBU A;  5ISV A;  3IC1 A;  4YGO A;  2O4H A;  4BHC A;  2FQ4 A;  1IF1 A;  3K4L A;  2M0C A;  2B5G B;  5H84 A;  3ESW B;  4PGG A;  2ZEE A;  4UCP A;  2KFD A;  3F72 A;  4UVC A;  5E20 A;  2EIK H;  1XCB A;  4ZYG A;  4IOA F;  3R60 A;  3ZQF A;  2JPB A;  5EGO A;  2R92 J;  3KZZ A;  1QZE A;  5KNL A;  2NNN A;  2ZME B;  3L2C A;  1NSL A;  4N0B A;  2F4O B;  3D67 A;  4C2Z A;  1IN8 A;  1HKQ A;  1J0R A;  4U9Y A;  2NOG A;  2LY2 A;  2HWV A;  1LE8 B;  1FY7 A;  1T08 B;  2KDZ A;  3KEO A;  5LHI A;  3R95 A;  2XAJ A;  1Y1V J;  3OYH A;  1LFU P;  2QIR A;  3PZJ A;  3R9G A;  2WYR A;  4MRI A;  4A3B J;  2IGM A;  5CNP A;  2P81 A;  4S0H B;  2G0E A;  2XV4 S;  5J1U A;  1HF0 A;  3RQ4 A;  2L7K A;  1OR7 A;  4L5I A;  3REO A;  4II9 A;  4OWR B;  4NNJ A;  4KIG A;  3EYI A;  2GM4 A;  3FM3 A;  1TNT A;  3OWT A;  4YWY A;  3WC6 A;  1PP7 U;  1ZAR A;  2JA5 J;  1HW5 A;  1I1D A;  1ZAO A;  4MFQ A;  4AID A;  5DWM A;  2X6W A;  2CW7 A;  3MKY B;  3KEY A;  4XOR A;  2JJ7 A;  1VQO I;  2KRF A;  1K6Y A;  4BIN A;  1P4W A;  1LFB A;  4HX8 A;  2NVU B;  4EJO A;  2FOW A;  2GBY A;  1AMP A;  4QBJ A;  3K9T A;  2DMN A;  2KDO A;  1EJ9 A;  5FLM J;  5DS0 A;  2Z9O A;  3FRM A;  3OYI A;  3TX8 A;  4XLN F;  4BAY A;  3H0D A;  2Q04 A;  4MFL A;  2LRE A;  3QAH A;  3ZP5 A;  3S1N J;  1IU8 A;  1FT9 A;  5D6E A;  3ISP A;  4A6D A;  1R1T A;  2LMD A;  3BRO A;  1K4S A;  2COM A;  2DOE A;  3AFH A;  2YGW A;  5K8M A;  1P4N A;  2IXS A;  1OIS A;  2FF4 A;  3JRU A;  1OCR H;  5FO5 A;  4ZTJ A;  4UXN A;  3MQ0 A;  5JI6 A;  3CLQ A;  3H3Z A;  4Q5S F;  5BMZ A;  5BPD A;  2MAB A;  4RAF A;  4II3 A;  3JSO A;  1BR2 A;  1FX7 A;  2X1D A;  4XK4 A;  1H8L A;  1T0F A;  3HSE A;  3I4M J;  2QJ8 A;  3AL0 B;  4IVN A;  1VTN C;  1ZEL A;  3HUG A;  2CYY A;  2HGC A;  3FF5 A;  4KN7 X;  5L3E A;  1IOI A;  1U5T B;  2XSD C;  1MND A;  3K69 A;  4M6V A;  4B48 A;  4MCQ A;  3H9G A;  3F23 A;  4ZZD A;  4A3I J;  3AG4 H;  5FKK A;  3IKT A;  3KI9 A;  2A5Y B;  4D9J A;  1M44 A;  4YRV A;  1Z1D A;  3G3S A;  1SD5 A;  1YW4 A;  4U7B A;  3K2K A;  4AVZ A;  1WI9 A;  4HF1 A;  3CDX A;  1IJW C;  1Q2C A;  2JBK A;  1S7A A;  1UG0 A;  1TL8 A;  4FD7 A;  3LWF A;  1EKE A;  3BHX A;  3F5B A;  2QYO A;  1VQ8 I;  2R7F A;  4NQW B;  3W3C A;  1EF4 A;  2LDU A;  1B87 A;  1ZO0 A;  4QC6 A;  2D1H A;  4FAI A;  2BXY A;  1K6O A;  1CF7 A;  1BOB A;  2Z3M A;  1J09 A;  3LAJ A;  1MBH A;  1U78 A;  1OJL A;  3BG5 A;  3L2W A;  3DTI A;  3OYE A;  5BOX A;  3GTK J;  4C3H J;  2ZEP A;  4KUA A;  4E7S A;  1SFU A;  4RB0 A;  1HST A;  2BV6 A;  4M3B A;  2E1O A;  4IQJ A;  4CA0 A;  1PDN C;  2K9M A;  4M3E A;  1OZP A;  2CG4 A;  2KZV A;  3ZCO A;  1MW7 A;  2CSO A;  4LD5 A;  1APL C;  1OCZ H;  1QU3 A;  1W0T A;  1I21 A;  1S7L A;  2EA2 A;  3CXQ A;  2LRD A;  2DXI A;  4RA2 A;  4HAM A;  5JFR A;  1SAU A;  4M6I A;  5F04 A;  2X4H A;  1A36 A;  1IV8 A;  3CCU I;  2OQG A;  1BI3 A;  5LYF A;  5B66 C;  4P4I A;  1JT0 A;  3KYL A;  3G6E I;  1SQH A;  3W2A A;  1TWC J;  2P6F A;  3MKL A;  1YX5 A;  2VAS A;  2H1L A;  3KQX A;  2RQP A;  4KSF A;  1YK3 A;  2B7E A;  5F48 A;  2Q7B A;  1XSX A;  2KHM A;  1AOY A;  2JK3 A;  1WVR A;  3KLO A;  3OYB A;  4NC6 A;  4C3I J;  3J7Y J;  2KIF A;  1JGG A;  2DI3 A;  4F91 B;  4GDF A;  2CGP A;  2NYX A;  2W25 A;  3WE2 A;  2WV0 A;  3JRF A;  3EO4 A;  5TRD A;  1GHE A;  2GA1 A;  1ON0 A;  2NYQ A;  4A2Z A;  3D5L A;  1YFH A;  3LAP A;  1Z05 A;  3KP7 A;  4UFX A;  4FD4 A;  3OYJ A;  1SAX A;  4FCY A;  4X3R A;  2Z5U A;  5JLW A;  3DKW A;  2HVS A;  4BHB A;  2BY1 A;  3TO9 A;  4MHD A;  2JUC A;  2K3F A;  1Y6I A;  2OD5 A;  3B73 A;  3HB9 A;  1FSH A;  1FP1 D;  3B7I A;  1BN5 A;  3G1M A;  4BYY A;  5IP7 J;  2JTV A;  4KIF A;  5HDK A;  2WAE A;  2ANP A;  4R7M A;  2YX4 A;  1FT7 A;  4RLF A;  2K02 A;  2R7D A;  1BIB A;  4D0P A;  5HXD A;  5DUK A;  4BL0 B;  2L7Z A;  2JDC A;  3HHG A;  1UEL B;  3FXJ A;  3DXJ F;  3LL7 A;  3TDU C;  2ZB9 A;  3EUA A;  1TC3 C;  1X19 A;  2HDW A;  2L9N A;  3OYC A;  2QBY A;  3Q0W A;  3LFK A;  3COA C;  1DP7 P;  2PJ5 A;  3EUH C;  5TGT A;  1ZLJ A;  4EEF G;  4IHY A;  2VBX A;  4FE4 A;  4OIW A;  5J1Q A;  4CS0 B;  4X8I A;  5HVQ C;  3RPQ A;  4EAT A;  2Y2Z A;  4AIJ A;  4XBF A;  3ZMT A;  3ZMZ A;  2H27 A;  5IPA A;  4UEE A;  1SC7 A;  2OV7 A;  5K5O A;  1XSD A;  2K85 A;  1S5K A;  5D4R A;  1OMI A;  1LPQ A;  2PJ9 A;  4P96 A;  4IKF A;  1IW7 F;  4GM5 A;  2DFH A;  5H2F C;  3BR1 A;  1BPN A;  2R8V A;  2FSW A;  4BY7 J;  2HOE A;  4IUS A;  5J1Y A;  3PB6 X;  4IRH A;  1XIX A;  1FIA A;  3T9Y A;  3SZP A;  5IOZ A;  5E3N A;  1WCM J;  4DYR A;  3KR5 A;  1JJ6 C;  3B6A A;  5C88 A;  1DE4 C;  2CO5 A;  2DA6 A;  4MFE A;  3OYN A;  2DDA A;  1GLN A;  4OAD A;  4ZY0 A;  1VQK I;  2P5V A;  3T0Y A;  5EF6 A;  1QRY A;  4Y15 A;  3GLJ A;  3K70 C;  3M7G A;  5B3S H;  1A35 A;  4NJR A;  4MMO A;  2HQN A;  4P10 A;  2KQR A;  2HV2 A;  3SHP A;  4FWU A;  4ZBG A;  2QM3 A;  2P6S A;  4G7O F;  1KA8 A;  3A1Y A;  3B2Y A;  4AWX B;  2B4B A;  4A3J J;  3A03 A;  1IN7 A;  2CFX A;  4J19 A;  5FFX A;  1CPX A;  3RYP A;  2OAZ A;  2V26 A;  4M3S A;  2MH9 A;  1B8I A;  4UVB A;  5E1X A;  1ORK A;  2R7S A;  3BR2 A;  3V38 A;  5LRR A;  1S7F A;  2J5P A;  1NHA A;  5DEQ A;  3OOU A;  4AVC A;  2E19 A;  1OR7 C;  4XON A;  3ASO H;  4KIS A;  1Z8L A;  4W1U A;  1REP C;  1TQM A;  1F57 A;  3N5F A;  5IT9 K;  4NGP A;  3T8R A;  3O8G A;  2VI6 A;  2DCE A;  2PMU A;  1OCC H;  4F3Q A;  1O3Q A;  3DEW A;  3HYI A;  2VQH A;  1W5C C;  3UY5 A;  4F0X A;  1Z6T A;  1KZH A;  3UR3 C;  4DYQ A;  1H9T A;  3GF2 A;  2M30 A;  2R7H A;  2WY7 Q;  1X10 A;  2AE6 A;  1ETO A;  4HOB A;  4YIR X;  4CGL A;  1T38 A;  1R1U A;  1ENH A;  1KQ0 A;  1WI3 A;  1NTC A;  2VBY A;  3K1P A;  4WXD A;  2Q7S A;  3KR4 A;  4MHN A;  1HDD C;  2BZT A;  4ZC3 A;  2QUF A;  2REF A;  2G3A A;  3HG9 A;  2Y9Y A;  5K8O A;  4U0Y A;  4OIQ F;  3FED A;  2ELJ A;  2YSR A;  1IN4 A;  3H5A A;  1RNL A;  4XRS A;  4M73 A;  2GLO A;  5AGE A;  4CRZ B;  4A3L J;  1U5T C;  4BAC A;  1GVJ A;  4YEJ A;  3W6J B;  2PVW A;  2H09 A;  2XGE A;  1ETW A;  3PL8 A;  4RUH A;  3LMM A;  1N78 A;  4XSX F;  4HEA 2;  4UUS A;  2Q4V A;  2Y31 A;  1T0F C;  4MTE A;  1UMQ A;  3HOX J;  3VWB A;  3IWG A;  3RYO A;  4GXH A;  4ZY2 A;  1IGB A;  2E1M B;  4UHT A;  4IHM A;  4NGQ A;  4HX7 A;  4A39 A;  4WX9 A;  3B6C A;  3L9F A;  1TF9 A;  3TKY A;  5AG6 A;  4DNC A;  4OC4 A;  2WAQ A;  3HIF A;  3WTT C;  2DMU A;  3EUK L;  5DWN A;  4KVX A;  3ZN0 A;  1MDM A;  2PFB A;  2RDP A;  4C2M J;  3TW7 A;  2QWW A;  2CQQ A;  3CP2 A;  4B13 A;  2LSO A;  2EK9 A;  2V7F A;  5E18 F;  4I02 A;  2W84 A;  1WZ2 A;  3D7G A;  5AG4 A;  1CF7 B;  4HQM A;  1A2Z A;  5A27 A;  4C2T A;  1TW3 A;  3DV8 A;  4JX5 A;  3OYK A;  1B8I B;  2PJ1 A;  1I27 A;  1U9N A;  5KAI C;  3FHZ A;  2R7V A;  4E7H A;  1M4I A;  4U9Z A;  4ZX8 A;  5KTA A;  1M4D A;  2Q51 A;  2FT0 A;  2M7A A;  4CYD A;  3SXO A;  3HRM A;  2J8N A;  3DWL E;  2ATR A;  2ZW4 A;  3D5S C;  1FC3 A;  4WWV A;  1LEB A;  1M1E B;  3ZQQ A;  1JQG A;  2Z3N A;  4MHZ A;  2A6E F;  4B44 A;  2EIN H;  3JAM Z;  4A38 A;  2XC7 A;  3PSI A;  4CPA A;  3ULQ B;  1JKO C;  3GY9 A;  4E7Z A;  1OBR A;  5EDN A;  3F3X A;  1V5F A;  2ZXV A;  4CYO A;  3S3M A;  3J7Z I;  3E6C C;  2ZNZ A;  3SFI A;  3E6B A;  4ESF A;  5G22 A;  3CTA A;  3GTQ J;  3WT4 A;  2W7N A;  5J8F A;  3EPZ A;  3G1O A;  2L3D A;  4CYN A;  2Y75 A;  2GU2 A;  4P4E A;  4AVA A;  3P2F A;  5D5V B;  3FH4 A;  3WGG A;  3JTH A;  2JT1 A;  1RKT A;  1QSM A;  2ZEO A;  3SI2 A;  1QA6 A;  1U8B A;  1BBY A;  4ABZ A;  1FSE A;  2AQE A;  2P6G A;  4B14 A;  2KLO A;  2ZEM A;  2DT5 A;  3EQL F;  3L2Q A;  3WG7 H;  3BJ6 A;  5KTC A;  4CAX A;  1H88 C;  1XMT A;  1Z21 A;  1X1C A;  2QF7 A;  1R36 A;  2W1O A;  3IH4 A;  1YME A;  4B5O A;  4IQ4 A;  3VYU B;  2DPS A;  3S9L A;  4Y7N J;  4OAE A;  1WSU A;  2C6P A;  1Z0X A;  1YRE A;  4XRS G;  1S3J A;  2L02 A;  5C4J J;  3R9F A;  4ITV A;  2PJR B;  3IU1 A;  1TKF A;  2V8H A;  4FAS D;  1Z9U A;  3CDL A;  2KRC A;  3F9K A;  3I54 A;  4BQN A;  3I55 I;  4MI4 A;  3GYA A;  4F0Y A;  3FF3 A;  4BXU A;  1BR1 A;  3NH4 A;  3OY9 A;  2XEI A;  4NXY A;  4A5M A;  1P2F A;  3PB7 X;  4HSR A;  4IOC F;  1TWF J;  3I59 A;  2OCE A;  2JLM A;  2WWY A;  1POG A;  1LDK B;  3QPH A;  2FIA A;  2L2O A;  2JEW A;  2A61 A;  2MYS A;  4P45 A;  3OIQ A;  5GAG J;  1LNW A;  5LEK A;  1B6A A;  2E1C A;  2FJ1 A;  1PP8 F;  5DYM A;  3D0S A;  4NGN A;  1LVK A;  6PAX A;  1GXP A;  1A6I A;  3HC7 A;  2Z33 A;  1QSR A;  1XDS A;  2E1M C;  1KGS A;  1E0E A;  2ZOG A;  3S1Q J;  4JZ0 A;  4B47 A;  4I7H A;  5F64 A;  2ZJQ F;  2R7X A;  2CNM A;  5D5X B;  3KHX A;  1TLH B;  3HSF A;  1ZRC A;  5FKN A;  4U87 A;  2QKL B;  4GGG A;  1MSF C;  1ZKG A;  2IA1 A;  1CX8 A;  1MH3 A;  3SZG A;  4WCG A;  3HUV A;  4X5K A;  5DCM A;  1LCP A;  3IUO A;  3ISZ A;  3IHU A;  1QNT A;  4N4O B;  3RO0 A;  1EV7 A;  5FKO A;  3D8P A;  3H5Z A;  3BJ8 A;  2F2E A;  4XQF A;  2GIZ A;  5CJ9 A;  4E70 A;  2ME6 A;  4D1Q A;  3GZ6 A;  4ONU A;  2NXN B;  3GYH X;  4C68 A;  4PJJ A;  3NH8 A;  4YG2 F;  3GFL A;  1Y7R A;  3KP6 A;  3TOB A;  2J8R A;  2QGU A;  3GUX A;  5K7F A;  1R23 A;  2DO7 A;  2V6C A;  3JRE A;  2JN6 A;  2ZJR F;  3A2K A;  1LAM A;  1W7P B;  1UFH A;  3I56 I;  4WJB A;  2DT6 A;  4UEZ A;  3JCU C;  1ZG3 A;  4LIT A;  2D1V A;  5IV0 A;  2RVC A;  3BCB A;  1K78 B;  1PJR A;  4IF4 A;  3WTV C;  2ETH A;  1R9T J;  1X2N A;  2GWR A;  2RQQ A;  3DFG A;  3RKW A;  2ZEF A;  1MBE A;  1IID A;  3HTS B;  4EM1 A;  4FD6 A;  4EWT A;  4EVY A;  1ETY A;  1R71 A;  4HNV A;  1UST A;  2EWN A;  2OA4 A;  3NAU A;  3L1P A;  3D4U A;  4ZH4 F;  5CVV A;  1EA3 A;  2VPR A;  5L3F A;  1TP4 A;  3N4M A;  3GKR A;  4BDZ A;  1MMD A;  5CLS A;  2RAE A;  1R58 A;  3HRT A;  2R7U A;  5IX3 A;  3H9J A;  2HQ5 A;  4ZYH A;  1D5Y A;  2ARH A;  1V3F A;  2F5C A;  5H20 A;  1V0C A;  2R7Q A;  2AFU A;  4R1H A;  2TDX A;  2FML A;  1LB2 A;  1QPI A;  3FXQ A;  4DYO A;  4CRY B;  1LDD A;  2M2E A;  2RRE A;  2RGV A;  4U88 A;  3MZY A;  2HQR A;  3LAC A;  2PJR A;  2WV1 A;  3CCY A;  3OIP A;  3CJR B;  3UNG C;  3WGI A;  1L0C A;  1TIQ A;  3QB8 A;  4KZT A;  4PXB A;  5HVG A;  2HXI A;  3DDD A;  1RR7 A;  1YJ9 I;  2W48 A;  2EK8 A;  2L4A A;  2PIY A;  3O6B B;  3GTM J; 
#chains in the Genus database with same CATH homology
 4DJA A;  4C30 A;  3PNV A;  4CYP A;  2IGM A;  5CNP A;  2A5W A;  2Q0Y A;  3DU5 A;  4BE1 A;  2OH1 A;  4R3L A;  4XKC A;  2ZW7 A;  3RQ4 A;  2L7K A;  3S6K A;  1NG7 A;  4LUA A;  4OWR B;  4NNJ A;  3TL4 X;  1WJF A;  4CCK A;  4II9 A;  3R96 A;  3OYD A;  3OWT A;  4DOZ A;  2G0B A;  4PV6 A;  3V42 A;  1I1D A;  5DWM A;  4MFQ A;  3FBI B;  4BBH A;  2X6W A;  1Z4R A;  2CW7 A;  4KOY A;  3MKY B;  1XE4 A;  1YX0 A;  1N75 A;  3KEY A;  2ZW6 A;  4XOR A;  2LYC A;  4KOT A;  1NE9 A;  1K6Y A;  3OR1 C;  4BUP A;  5AG7 A;  5HH1 A;  2PR1 A;  3K9U A;  2YNE A;  3FKJ A;  5CPR B;  2ZPA A;  1J4J A;  1Q2D A;  2B5G A;  3BC8 A;  1IIC A;  4MFK A;  4NSQ A;  4AG7 A;  2KDO A;  1RXT A;  4GS4 A;  4QBJ A;  3SXN A;  2VZY A;  4I49 A;  2D4O A;  2FXF A;  3I3L A;  3FRM A;  3OYI A;  4BQO A;  4J01 A;  1D0X A;  3H0D A;  2Q04 A;  4MFL A;  2LRE A;  3QAH A;  2BOL A;  5F47 A;  5I0C A;  4XOT A;  3OYG A;  3L2V A;  2R4G A;  2XF7 A;  5HLT A;  3OS2 A;  2CMP A;  2FCK A;  2X7B A;  3S6G A;  5GCN A;  1W36 C;  3AFH A;  2YGW A;  4KSA A;  1P4N A;  3F0A A;  4QUS A;  4C2X A;  2IXS A;  1WJE A;  2VKD A;  1WJB A;  4ORF A;  4DBR A;  4ZTJ A;  2B4D B;  4KOR A;  4UCM A;  2ZSI B;  2IS1 A;  2LY1 A;  3OWC A;  4JXQ A;  2DJI A;  3S32 A;  1KUV A;  3S6F A;  4JXR A;  1G59 A;  2MAB A;  2GE3 A;  4II3 A;  3ONQ A;  1BR2 A;  2X1D A;  4XPD C;  4XMY A;  4Q36 A;  3AL0 B;  4IZZ A;  2ZXH A;  5KCM A;  1ZEL A;  2BEI A;  1MJ9 A;  3H4Q A;  4H6U A;  2EUI A;  1W36 D;  2CV2 A;  5CKT A;  4BS9 A;  1MJB A;  2VJ5 A;  4L8A A;  1M1D A;  3CJQ B;  4A30 A;  2VI7 A;  3PUB A;  1MND A;  2REE A;  4XN0 A;  4B48 A;  1YGH A;  3H9G A;  4M85 A;  3VSK A;  2VIX A;  1D1C A;  3L2R A;  3I9V 2;  2FIW A;  4C2Z A;  4D9J A;  3PNY A;  1M44 A;  4YRV A;  3G3S A;  3HXL A;  4XLE A;  4FD5 A;  4U7B A;  4KOS A;  2G3T A;  4AVZ A;  5EC4 A;  4HNU A;  1Q2C A;  1UG0 A;  2WBM A;  2AQF A;  2ZFU A;  4FD7 A;  2CW8 A;  4E7J A;  3F5B A;  2WUU A;  4NQW B;  3W3C A;  2NMT A;  4KUB A;  2WSA A;  1B87 A;  4KVM E;  1ZO0 A;  4QC6 A;  4BEH B;  4NC8 A;  2F5I A;  3ZJ0 A;  4XLH A;  2KCW A;  1BOB A;  4F6A A;  2Z3M A;  1J09 A;  3CP8 A;  4BJ5 C;  3FHN A;  1WFX A;  5CQG A;  4F55 A;  2WAD A;  1N71 A;  3L2W A;  2B3V A;  3DTI A;  3OYE A;  1U6M A;  4OLL A;  2K5T A;  4KUA A;  3ZR8 X;  4E7S A;  4C9Y A;  4IQJ A;  1RO5 A;  1SFK A;  1MK4 A;  3E0K A;  4CA0 A;  2K9M A;  1OZP A;  4PJM A;  2KZV A;  4F92 B;  3R9G A;  3ZCO A;  1MW7 A;  3RSN A;  1BO4 A;  3QYF A;  1QU3 A;  4HRI A;  2BW3 B;  2LH9 A;  1I21 A;  3W91 A;  1S7L A;  2BL1 A;  2LRD A;  2BSW A;  2PC1 A;  3CXQ A;  2DXI A;  3OYL A;  4CSW A;  2IS4 A;  1SAU A;  2Z3O A;  4PK4 A;  3IU2 A;  4KOW A;  5G1Z A;  3OS0 A;  3D5R C;  1K4J A;  2V6E A;  3DPT A;  4NC7 A;  3EFA A;  3DQV C;  1MMN A;  2JUG A;  4PK2 A;  5J8C A;  5H86 A;  4MLO A;  2LBF B;  3KYL A;  3K70 D;  1D1A A;  1SQH A;  1OLT A;  3K4J A;  2X1E A;  1MMA A;  3W2A A;  2P6F A;  3QYE A;  1YX5 A;  2VAS A;  2OUM A;  3NWS A;  1Y9K A;  4KSF A;  1YK3 A;  5F48 A;  1AA7 A;  2Q7B A;  1WJA A;  1IYL A;  2KHM A;  3N7Z A;  3TOA A;  3OYB A;  2UWM A;  4KOX A;  2CNS A;  2GOM A;  4PUS A;  4F91 B;  2OZU A;  4BJT A;  1KZF A;  3EO4 A;  1MMG A;  2R7T A;  2A6T A;  2E5N A;  1PUA A;  1IYK A;  1GHE A;  1ON0 A;  2X1C A;  4B13 A;  4A2Z A;  3D5L A;  3DR8 A;  3GBG A;  2VQY A;  4ZTF A;  3LFU A;  1WK4 A;  1G8X A;  4P1W A;  2IGN A;  2KMU A;  4UFX A;  2PMZ A;  4H4K C;  4FD4 A;  3OYJ A;  4UA3 A;  2E60 A;  3A4C A;  3C26 A;  2BW3 A;  5HOO A;  2HVS A;  2GAN A;  1MJA A;  2RNG A;  4HKF A;  4CAW A;  4MHD A;  4NF1 A;  3TO9 A;  2HVQ A;  1Y6I A;  2HQA A;  3SDB A;  4ZDO A;  4B11 A;  3OL4 A;  4H6Z A;  3ZRG A;  3TTH A;  2KP6 A;  3PGP A;  4B10 A;  2D4P A;  3V8I A;  2WAE A;  2VZZ A;  1VKC A;  1R6R A;  3H5N A;  2KL4 A;  4RLF A;  2NOJ B;  2Z16 A;  4BL0 B;  3DTK A;  1JI8 A;  3BCA A;  2JDC A;  3LL7 A;  1UEL B;  3I9S A;  3R9E A;  3EUA A;  4CAF A;  1X19 A;  2HDW A;  5G21 A;  2L9N A;  2ZXI A;  3OYC A;  3CXP A;  2CXA A;  3F8K A;  2XSJ C;  2HNH A;  3B8G A;  3S6H A;  4A31 A;  1DGW Y;  2F4I A;  1DP3 A;  3EUH C;  3K10 A;  4ZYA A;  5TGT A;  1Y56 A;  1FMW A;  1DQU A;  4AU7 A;  4QPQ A;  4BE0 A;  4BXF A;  2RC4 A;  2YNC C;  4CZC A;  1NMT A;  4CS0 B;  4MBU A;  4NEX A;  2Y0S A;  4ZDP A;  2L5Q A;  2B58 A;  5HVQ C;  4EAT A;  1DGR M;  3IWE A;  2F6C A;  3W2V A;  4II2 A;  2IS2 A;  3TBI A;  2WPX A;  1TT0 A;  3N05 A;  4FET A;  3LSM A;  2OV7 A;  1S5K A;  3CXS A;  2K5C A;  4PFP A;  2HPM A;  2GIV A;  4IKF A;  2J8M A;  2FUG 2;  2M4G A;  3FB3 A;  2R8V A;  3WR7 A;  4BMH A;  4IUS A;  2M3A A;  4XPD B;  3H9Q A;  1XIX A;  3E0J B;  5HNF A;  4K30 A;  3T9Y A;  4E6K G;  4HNW B;  2R7O A;  1YR0 A;  2K9L A;  3M8J A;  3VSL A;  5C88 A;  2X85 A;  4Y3O A;  1XF8 A;  2Z11 A;  3OYN A;  4BDY A;  2Z3P A;  4OAD A;  1GLN A;  3NWT A;  4CH7 A;  3VYT B;  2PR8 A;  3TCV A;  3G2B A;  4C7I A;  2HZD A;  3K70 C;  3MD2 A;  2XDV A;  2KQR A;  2MC4 A;  5E96 A;  3PFY A;  3VWD A;  3PZJ A;  5BWA B;  1QHH D;  3H5R A;  3ZGK A;  4AB7 A;  3HOS A;  4JJX A;  4CYQ A;  2HV2 A;  1S9H A;  4RM3 A;  4YEL A;  2CS3 A;  3SHP A;  4E8O A;  2Q44 A;  4ZBG A;  1S60 A;  3A1Y A;  3CF2 A;  3DEE A;  2B4B A;  2R7R A;  4JOM A;  2JDD A;  3OYA A;  1KUX A;  2V26 A;  2W82 A;  4M3S A;  3D2M A;  4J00 A;  3FIX A;  3HKZ A;  3OR2 C;  3LSH A;  2JVG A;  2OZG A;  2YND A;  3DKY A;  2VXK A;  1YVK A;  2I8D A;  3M1C A;  3DNS A;  4F0X A;  2R7S A;  4R87 A;  2CV1 A;  4PSW A;  1S7F A;  2X6Y A;  2LG4 A;  1Q2Y A;  3EXN A;  3OOU A;  4AVC A;  1OR7 C;  2JSP A;  2W00 A;  3DPU A;  3DU6 A;  4XON A;  3ZXS A;  4KIS A;  2OB0 A;  4C2Y A;  3HUG B;  2PSW A;  5IB0 A;  2JA2 A;  2VB6 A;  2Z3K A;  1YE9 A;  2VQL A;  3H35 A;  4HPQ A;  2M0M A;  3P2H A;  4UFV A;  2DCE A;  4A95 A;  4CCJ A;  4F3Q A;  4P5O A;  2AJ6 A;  2DPT A;  2EVN A;  3SEQ A;  2VQH A;  3KKW A;  4RI1 A;  3L2U A;  4XNF A;  2M4K A;  4C7H A;  2VJI A;  4XPK A;  3UY5 A;  3CES A;  3AKZ A;  2KRH A;  1CM0 A;  2Z10 A;  3DR6 A;  2QKM B;  2CFO A;  4XR6 A;  2DOA A;  3UR3 C;  3EY5 A;  4U5Y A;  1U0J A;  1T95 A;  2WPW A;  1M4G A;  3HPG A;  1WJ5 A;  2PQ8 A;  2R7H A;  2WY7 Q;  4G6T B;  2AE6 A;  2A4N A;  4HST A;  3BLY A;  4N4N B;  4KVO E;  3IGR A;  1KUY A;  3BG7 A;  2V9K A;  4RS2 A;  4NUB A;  2LBF A;  4PJN A;  4Q38 A;  4CGL A;  1ERD A;  3TO6 A;  4L89 A;  3S3N A;  2IL4 A;  5G20 A;  3JTK A;  4ZC3 A;  2X6X A;  1X4O A;  2G3A A;  2REF A;  3HG9 A;  2BVL A;  2DXQ A;  5F49 A;  2XF5 A;  4CGN A;  4XNH C;  4R9M A;  2ELJ A;  3H5A A;  5FRN A;  1R57 A;  1VHS A;  4AG9 A;  1QSN A;  2O5R A;  5AGE A;  4JD6 A;  4KOV A;  3HPH A;  3KX2 A;  4CRZ B;  2Z1D A;  4BAC A;  3K6G A;  5AG5 A;  4YEJ A;  2KPM A;  4NCZ A;  3LSG A;  3PL8 A;  3LMM A;  4PFO A;  1N78 A;  2WB1 A;  4HEA 2;  4XLF A;  4JWP A;  4BGD A;  2CNT A;  1T0F C;  2Q4V A;  3IWG A;  3VWB A;  3RYO A;  1YX3 A;  2K3P A;  2MFZ A;  4MFP A;  4Y4R A;  2E1M B;  2MD0 A;  3FBN B;  3AL0 C;  4F52 A;  3NE7 A;  2WY8 Q;  2XF6 A;  2R7W A;  4HNT A;  4E7L A;  4B3X A;  1YLE A;  2P6E A;  1X1A A;  2WAQ A;  2DT7 B;  1PYV A;  3EUK L;  3BLN A;  5AG6 A;  5DWN A;  4AYB A;  4KVX A;  4CCO A;  2Y0M A;  4E4H A;  1FMV A;  2VXD A;  3QYB A;  4YFJ A;  1X1D A;  3LSI A;  3CP2 A;  2HQY A;  1D1B A;  3CZ6 A;  4ZJZ A;  2V7F A;  1KON A;  5HNH A;  4MFZ A;  3W6X A;  1X1B A;  5LD2 C;  5AG4 A;  4HNY B;  4HG2 A;  5A27 A;  2JEV A;  4C2T A;  3OYK A;  2Q4Y A;  4RLQ A;  4E7K A;  2Z3L A;  3OYF A;  2R7V A;  4E7H A;  1M4I A;  4U9Z A;  5KTA A;  1M4D A;  2FT0 A;  1XEB A;  2M7A A;  3VWE A;  3SXO A;  2J8N A;  3DWL E;  2VPL A;  3SEZ A;  2ATR A;  3D5S C;  2ZW4 A;  4MY0 A;  3BJ7 A;  2Z0Z A;  4UFW A;  2YNC A;  5C82 A;  3K4K A;  3ZQQ A;  2Z3N A;  2FL4 A;  2Z2S B;  3RCO A;  4B44 A;  1HA8 A;  4JLY A;  2IGO A;  1S7K A;  2XC7 A;  3PSI A;  5HMN A;  3GY9 A;  4E7Z A;  5FVJ A;  3BG6 A;  2JVH A;  1V5F A;  3K4C A;  3TMO A;  2ZXV A;  3TT2 A;  4CYO A;  4KS9 A;  3S3M A;  2B4D A;  2V4J C;  5A28 A;  3S8P A;  4KLW A;  3IP4 B;  4B43 A;  4PK3 A;  5F46 A;  4IX7 A;  5G22 A;  1V5E A;  4Y49 C;  2W7N A;  4CAV A;  3EPZ A;  3K4B A;  3DPL C;  5J8F A;  2WA0 A;  4XKW A;  4CYN A;  2CY2 A;  4AVA A;  4XOP A;  4LIV A;  4QPO A;  1S7N A;  3EC4 A;  3D3S A;  4UBR A;  4CGM A;  3P2F A;  4A33 A;  3TE4 A;  1TZL A;  4QVT A;  4CAE A;  2B3U A;  1MNE A;  1QSM A;  3IAS 2;  3HOT A;  4HNX B;  1WWZ A;  4GRI A;  2LOO A;  2AQE A;  4CCL A;  2I00 A;  2P6G A;  4B14 A;  2KLO A;  3W6S A;  3L2Q A;  4B5P A;  1Z3Y A;  3JVN A;  3SYT A;  5KTC A;  3JUW A;  4CAX A;  1D0Z A;  4KJZ A;  1Z21 A;  1X1C A;  1XMT A;  2W1O A;  4B5O A;  4F93 B;  4IQ4 A;  3VYU B;  2DPS A;  2VL8 A;  2V1N A;  4DBQ A;  4OAE A;  2VJJ A;  4Y33 A;  4KIT B;  2P0W A;  2E5Z A;  3VYS B;  1YRE A;  2X51 A;  4XKB A;  3R9F A;  4ITV A;  1BR4 A;  2PJR B;  3IU1 A;  3PP9 A;  2IS6 A;  4FAS D;  2CUZ A;  1Z9U A;  2KRC A;  3F9K A;  4BQN A;  2ZW5 A;  3FBU A;  3LD2 A;  4MI4 A;  2L9S A;  3GYA A;  2H5M A;  2CH0 A;  4F0Y A;  2CUJ A;  1BR1 A;  4RM2 A;  4CCM A;  3OY9 A;  1QSO A;  3K4N A;  3HL2 A;  4NXY A;  4Y49 B;  4XLC A;  4UWJ A;  5KTD A;  4XNH B;  4HSR A;  4R79 A;  1X4P A;  4R3K A;  2FS5 A;  2JLM A;  4ZDL A;  4BE2 A;  3CMM A;  3VYR B;  1LDK B;  2FIA A;  2L2O A;  2OU2 A;  2MYS A;  4ZGY B;  4RMN A;  3OIQ A;  3T90 A;  2QML A;  1D0Y A;  4UWI A;  4BEH A;  4CGO A;  3IAM 2;  1LKX A;  3DLA A;  4X0G A;  3MKW B;  1LVK A;  3ZZI A;  4QB9 A;  1CJW A;  2UUZ A;  3MGD A;  3HC7 A;  4YRH A;  1QSR A;  2FE7 A;  2E1M C;  1Z4E A;  1E0E A;  3MMY B;  4E2A A;  4XN3 A;  4B47 A;  3C2G A;  2LC2 A;  4E7I A;  5FRM A;  2O28 A;  2R7X A;  4MY3 A;  2CNM A;  5EBV A;  3OS1 A;  5FRO A;  2IGK A;  3U21 A;  1N77 A;  3S93 A;  4JQF A;  3OL3 A;  4IF5 A;  4U87 A;  2QKL B;  5JPH A;  4X5K A;  3SZG A;  1Z3X A;  3E1S A;  4XL9 A;  3IUO A;  4N4O B;  2VJ4 A;  4R57 A;  3TO7 A;  2VXZ A;  3LSK A;  3RTR A;  3C2H A;  2FSR A;  3D8P A;  2F5V A;  3H5Z A;  3BJ8 A;  4XQF A;  4PJL A;  2R98 A;  3QOD A;  2Q2E B;  2BVM A;  2GOX B;  4D1Q A;  3OYM A;  4ONU A;  4PSX A;  4MJ8 A;  1YVO A;  1LFP A;  4C68 A;  3S3O A;  4CCN A;  4PJJ A;  1Y9W A;  2R1I A;  3FXT A;  4XPL A;  2UV1 A;  2XAU A;  1UAA A;  4LX9 A;  1Y7R A;  2HVR A;  3PJR A;  3TOB A;  3J7A Y;  2J8R A;  4CUG A;  1PU9 A;  2Q1Z B;  4DIQ A;  3TFY A;  2VKH A;  3FDY A;  4KT6 A;  1UFH A;  3A2K A;  2VEZ A;  1NG6 A;  5CQE A;  2DT6 A;  4B5P B;  2WAF A;  1WJC A;  4LIT A;  2C27 A;  4KOU A;  5IV0 A;  2QEC A;  2VLA A;  3BCB A;  1PJR A;  4AVB A;  1WJD A;  1VZ0 A;  3FNC A;  2VQG A;  4DGW B;  2HUZ A;  3PNT A;  1IRX A;  2RQQ A;  4LIU A;  5KHD A;  1IB1 E;  3G8W A;  1Z7L A;  1IID A;  4XKV A;  4BQQ A;  1S3Z A;  3RPU D;  3K4M A;  3VDX A;  4A32 A;  2ZSH B;  4FD6 A;  3OMY A;  2HU9 A;  4B12 A;  4EVY A;  4BJ6 C;  1P0H A;  4MFJ A;  3W2W A;  1QST A;  4J3G A;  3DSB A;  4H89 A;  4CGP A;  2VQC A;  3GKR A;  1EA3 A;  2PDO A;  3MKZ A;  4BDZ A;  2W4S A;  1MMD A;  2CV0 A;  1V5G A;  2I79 A;  2OC6 A;  3DKX A;  1I12 A;  3R1K A;  2R7U A;  2QIR A;  4XM3 A;  4DNC A;  3H9J A;  5IX3 A;  5JQ4 A;  5ISV A;  2M7B A;  4YGO A;  5LFA A;  2ARH A;  3QOE A;  1V0C A;  2R7Q A;  3K4L A;  2PRB A;  4OAZ A;  2B5G B;  5H84 A;  4XLA A;  4UCP A;  1LRZ A;  4BU2 A;  2VBQ A;  3FYN A;  4E0A A;  4OAY A;  4CRY B;  3PSF A;  3LOD A;  2RRE A;  5KNL A;  1QHG A;  2PJR A;  3DTE A;  2OZH A;  4KLV A;  1NSL A;  4KZT A;  3OIP A;  3CJR B;  2HPI A;  3UNG C;  1L0C A;  1TIQ A;  4ANJ A;  4C2U A;  3A9L A;  3D2P A;  3I3G A;  2LY2 A;  4LG3 A;  3DDD A;  3QB8 A;  1FY7 A;  4U9Y A;  4UCN A;  1P9Q C;  1B6B A;  5JHF A;  3OYH A;  2BUE A;  3R95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...