4C7IA

Leismania major n-myristoyltransferase in complex with a peptidomimetic (-oh) molecule
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Peptidomimetic Inhibitors of N-Myristoyltransferase from Human Malaria and Leishmaniasis Parasites.
pubmed doi rcsb
source organism Leishmania major
total genus 128
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4c7iA00
4A32A 4CGMA 4B14A 5G20A 4B12A 4A2ZA 2YNCA 4C7IA 5AG7A 4CYQA 2YNEA 2WUUA 3H5ZA 4UFVA 4UCPA 4A33A 4CGOA 4C2YA 4CYOA 4CGLA 4UFWA 4CGPA 4C2ZA 4B10A 4CYNA 3JTKA 4UCNA 5G22A 5AG4A 5A28A 2YNDA 4BBHA 5AG6A 5G1ZA 2YNCC 4C7HA 4CGNA 4CAFA 5AGEA 4C2XA 4B13A 5AG5A 3IU1A 4A31A 4A30A 4UCMA 4CYPA 3IWEA 2WSAA 5G21A 4A95A 4UFXA 4C68A 5A27A 4CAEA 4B11A 3IU2A
chains in the Genus database with same CATH superfamily
2IQ6A 2XEGA 4JJXA 2AFOA 1MJAA 3KR4A 1Z8XA 4CYQA 2CNTA 2CNMA 3IGRA 4P6YA 5HXDA 1Y9WA 1Y0RA 2GIVA 4CYOA 4MHNA 2PRQA 4KOSA 4HNYB 6CPAA 5EBVA 4AVCA 4OC1A 2ZEDA 3NH4A 4NCZA 2Q04A 4H6ZA 4A38A 4CYNA 5LYFA 2C6PA 4NJRA 5I4MA 8CPAA 3SXOA 1QSNA 2AFWA 4M3SA 2P0WA 4MXUA 4KOYA 2VL1A 4FAIA 3FVLA 1QQ9A 1M4GA 3IU1A 1PCAA 3D3SA 1OBRA 4JYWA 4TNUA 4OIDA 4P4BA 4B11A 5J1QA 1ZG7A 2B3VA 2FS5A 4WWVA 2Z3KA 4A32A 3EC4A 3L2NA 4MCPA 2EO8A 2ZEMA 4M85A 1B87A 1MK4A 3CDXA 1CG2A 2Z3PA 2PQ8A 2PJ5A 3VH9A 3FX6A 2I00A 3B3WA 4EVYA 1DTDA 5ISVA 3JRUA 1TKFA 4R6TA 4ZX9A 3D7DA 4ZY1A 4OC4A 4HPSA 1AYEA 4ONWA 4PK2A 3CXQA 2J9AA 3DSBA 1XBUA 4UCMA 2B58A 1YGHA 2GLJA 1QSTA 2V8VA 2OU2A 4MY0A 3S9MA 4CPAA 3FIXA 2ZEPA 5H84A 1YVKA 4R9MA 3I1UA 4B6ZA 2YNEA 4OAEA 1LOKA 1VHOA 3PB7X 1M4IA 2O4HA 4ZX8A 1Z4RA 3FEEA 4MFZA 2POKA 1TF8A 2AFMA 4UBRA 3IWWA 2AJ6A 1GYTA 2C6CA 5AG4A 3CXSA 4KVOE 4NGSA 2PJBA 4XPKA 4CRYB 1BAVA 2GLFA 3KI9A 4A39A 2YNDA 2Q4VA 4FD6A 3PBBA 1WK4A 2ZXVA 1PU9A 2EK9A 5J8FA 1J4JA 3S6KA 2FL4A 3JUWA 3WR7A 2PC1A 4LUAA 1JQGA 4NSQA 1R43A 3GUXA 1ZLHA 5F47A 1YK3A 4AVBA 4NEXA 3F0AA 1VKCA 1PUAA 4P4IA 5THWA 4C7IA 4FD4A 4G1PA 2B4BA 4K30A 4UWJA 1TKHA 2PJ8A 4NGNA 1YQEA 1F2OA 3LWUA 3RZAA 2ZOFA 4OIWA 2R98A 4NGRA 3GY9A 1YR0A 2VZYA 1A2ZA 4KOUA 4ZBGA 3IO1A 1NMTA 5LRJA 2ARHA 5D29A 3TO6A 2Q0YA 1HDUA 3H8GA 4AXVA 3B3SA 4IHMA 4AVAA 2P6FA 1KUVA 1M1DA 2B5GB 2P6GA 2ZELA 3RO0A 4ZYQA 2C6GA 3VWDA 4Z65A 1TKJA 4F9VA 5CBMA 1CX8A 1Q2CA 2D4PA 3PB6X 2OZGA 2VQYA 2VEZA 3DDDA 4MRIA 1UWYA 3S6FA 1XEBA 1Y9KA 4JWPA 4MCSA 2ZOGA 4F9UA 3BLNA 1CP6A 3DR8A 4M6GA 2R1IA 3BI0A 3E0KA 3KHZA 1S7NA 2Z10A 3QAHA 5ELYA 4AG9A 1WWZA 4NXYA 4QB9A 4CGOA 1XRYA 3G8WA 2PDOA 4R3KA 4RN7A 1S7FA 4QC6A 4GM5A 4R87A 3RBUA 3RNZA 4B10A 2BOAA 2BUEA 3LACA 3C26A 4NGMA 2NYQA 2WYRA 3WC7A 3FB3A 1LANA 1S5KA 3T90A 1RXTA 4MHZA 4EFDA 2CXAA 3BI1A 1YW6A 4KZTA 5K8NA 4B5PB 3PP9A 5HMNA 3GIUA 1ZG9A 3PRTA 4HNXB 1F2PA 1ELMP 2PJ9A 1H8LA 2ZW5A 3F8KA 3RYOA 2G9DA 3IIBA 3QNVA 4OADA 4YGOA 5HH1A 1VHEA 5K8MA 3A9LA 3NH8A 4X2TA 4KSFA 2QJ8A 3I9SA 4KSAA 1ELLP 4MFPA 2XEJA 5F49A 4B5OA 4OP4A 2YGWA 3WC5A 3TT2A 2WPXA 4KLWA 3B3VA 4BBHA 4Y49B 5IX3A 4L8AA 1AMPA 1QSRA 4UWIA 2C27A 2DPTA 1ZO0A 1Y7RA 4CYPA 3B8GA 3IWEA 3SXNA 3TCVA 3WT4A 4RS2A 4PXEA 4U5YA 1FY7A 5G21A 3CPAA 4MHDA 4XNHB 4YRHA 5KTDA 3DNSA 3I3GA 1XJOA 3T9YA 3R96A 2WPWA 1M4DA 1S7LA 1EE3P 5F46A 2EK8A 4CAVA 4PSXA 5C82A 3BJ8A 2PJCA 2R8VA 3B35A 2GREA 3QB8A 4Y49C 1KWMA 4QVTA 3SJXA 4F0XA 5IB9A 4MFLA 3SI2A 2B4DA 1FT7A 3V8IA 4MHYA 3D7GA 1LRZA 4UEZA 2P6EA 4XNHC 2Q4YA 3CZXA 4PPZA 1JWQA 2HUZA 3FJUA 3LMSA 1KUYA 2PJ0A 1BOBA 1YSJA 3P2HA 4E0AA 1CPXA 2ZEGA 2RB7A 4P44A 2DEAA 4AB7A 2ODFA 4H89A 4EWTA 4QBJA 2PJ2A 3DLJA 3R9GA 4CGMA 3SI1A 4PQAA 5HVGA 5IB0A 1V0CA 4OKOA 5G20A 2YNCA 5IV0A 3TFYA 1XMBA 1XOVA 3GYAA 4MFQA 2PCUA 4U9ZA 4C2YA 5LYDA 2PJ6A 4FD7A 4JLYA 4IUSA 3SHPA 4I49A 2ZEHA 3OWCA 3FYNA 1TIQA 1Z8TA 4A94A 3GKRA 3IWGA 4P4EA 5A28A 1VIXA 3T8WA 3FXTA 4A37A 2PRBA 1M4LA 1VGYA 2AFSA 3PBEA 3TO7A 5LRGA 2EWBA 4U9YA 4CGNA 4ONUA 3B3CA 1YW4A 1Q2DA 1LFWA 4A30A 4RUHA 2IJZA 2ZEFA 1Z2LA 1ZLIA 3RAMA 3SJEA 1F57A 3UY5A 4TWEA 3KQZA 2B3UA 4BINA 3P2FA 3TOBA 1R3NA 2ABZA 5JM6A 4JD6A 5AG7A 3H4QA 2DXQA 4A33A 4E2AA 5I0CA 3D68A 2JLMA 2Q4ZA 1IU8A 2WZNA 1XFOA 3EY5A 4KVXA 2OH1A 5F48A 4NGTA 5FVJA 4MJ8A 3PFOA 4R76A 3D66A 3TO9A 2AE6A 4KOXA 1Y7EA 4J3GA 1Z8LA 3CPXA 4CAXA 2PE3A 4P4FA 2CTBA 2ZEOA 4II9A 1IYKA 3KKWA 4UA3A 3NE8A 2NMTA 2HC9A 4GS4A 4C2XA 2J8RA 2I3CA 1IB1E 5KTAA 5K8OA 2WSAA 4C68A 5A27A 4CAEA 3S6HA 4BMHA 1P4NA 5H86A 1IOIA 4O23A 1I1DA 2Z3MA 1YMEA 4X8IA 1Y0YA 3KQXA 4M6IA 2VXKA 2Z3LA 4KUAA 3DR6A 3HUVA 1VHSA 2PJ3A 3IC1A 3PZJA 4KS9A 5DS0A 4CGLA 3S9NA 1HDQA 3R9EA 3VATA 1CM0A 2C1CA 2IMOA 3TTHA 1XE4A 3IFEA 2AFUA 5EMIA 5C88A 1YVOA 2EUIA 4YWYA 2AFXA 3FBUA 3LD2A 4KOVA 4R8FA 2Q7SA 4UEEA 2NSMA 1S3ZA 2REFA 4NF1A 5LRKA 4B13A 4UIAA 4UEFA 2XEIA 2OZUA 3MGDA 4HKFA 3GLJA 2ZW7A 4LQ6A 2PJAA 1U6MA 1NSAA 1L0CA 1CBXA 1RTQA 2PJ4A 2RC4A 1BPMA 1DE4C 2EBJA 3KR5A 2OOTA 3FMCA 5GCNA 2BSWA 2KCWA 3D2MA 3MN8A 4B12A 4A2ZA 4LQGA 3BXMA 1XIXA 4UCPA 1IICA 2ZW4A 1QSMA 2O53A 3B2YA 4CRZB 1I21A 2R7HA 2PVVA 5K8PA 2PSWA 2Q7BA 1YREA 1LCPA 2RFHA 3JTKA 5J8CA 4KVME 1NE9A 2CTCA 5JGFA 4H6UA 5JQ4A 3CXPA 4YU9A 1Q7LA 4KOWA 5AG6A 1YLEA 2V8GA 2Z3NA 1KUXA 2QVPA 2Y0MA 2F7VA 2ZEEA 4KUBA 2K5TA 2BO9A 4PXDA 4QUSA 4UIBA 5AGEA 3VWEA 2GFQA 4PXBA 5AG5A 4A31A 2Z0ZA 1M44A 1R57A 3K9TA 1XMTA 1QSOA 2FT0A 2I79A 1N71A 1YX0A 1B6BA 4F6AA 4BD9A 3D7FA 5F09A 3BJ7A 4OC0A 3IEHA 1TXRA 3PFEA 3DGVA 4AG7A 3W91A 1IOFA 4R7MA 2O28A 5JPHA 4UFWA 2PJ1A 1OZPA 2FXFA 2VBQA 3QAYA 1ZG8A 4NGQA 3PEIA 5G22A 1ARLA 3G3SA 4X3RA 1FNOA 2CIJA 1S7KA 4NGPA 5G1ZA 4F0YA 3R1KA 1CPSA 3S6GA 4OLLA 4KSIA 1Z5RA 2JDDA 2J8NA 3TOAA 3W6SA 5E96A 4KLVA 3D8PA 4UFXA 4Q38A 4IK2A 4M6HA 4GXHA 3K9UA 3R95A 3EXNA 4ZY0A 2JDCA 2JEWA 4FBEA 3D4UA 3D7HA 3GB0A 2G3AA 1TF9A 3H5ZA 4UFVA 3ZJ0A 5JH9A 1X12A 5HVHA 2V77A 1I12A 2CF4A 2ZPAA 2VZZA 1S60A 2ZW6A 4Q7AA 4C2ZA 4EMEA 4IAVA 1GHEA 3W6XA 3PB8X 2JBJA 3SJFA 3N7ZA 3N5FA 4PSWA 1Z8WA 5LYIA 4Q36A 2CY2A 3D2PA 3CT9A 4JXQA 1KZFA 1SQHA 2ATRA 3NE7A 3NH5A 4K3NA 3V38A 3ZZIA 4CAFA 1Z4EA 4YFJA 4ZGYB 2B5GA 3IJ3A 4IF5A 5HVFA 2BEIA 2QECA 2FSRA 2Q51A 3B7IA 4FUUA 2PIZA 1UFHA 2FIWA 4L89A 5DWMA 5EC4A 4DNCA 2BL1A 3NA6A 4KOTA 4F8ZA 4MCRA 2J8MA 3BHXA 3F5BA 2HQYA 1IY7A 1IIDA 3ISZA 4R57A 2HV2A 2WUUA 2ZENA 4CAWA 3S9LA 1YLOA 3ISXA 4MI4A 5KTCA 1BPNA 2QYVA 4OC5A 3R9FA 1AUGA 2GANA 2B4DB 3H8EA 3EO4A 4H2KA 2GE3A 2VI7A 2Q44A 2A4NA 3HLPA 4MY3A 4HNWB 4OMEA 3NFZA 4UCNA 4XPLA 3TC8A 3EFAA 2JBKA 3H8FA 3KGQA 2ANPA 3LODA 3TE4A 2FE7A 3WC6A 4ZY2A 2V8HA 1NSLA 3V7ZA 4ORFA 5CNPA 1RO5A 2FCKA 1MJ9A 2FVGA 3MRUA 4MCQA 4A95A 2PVWA 4NFRA 5BWAB 4ZI6A 1LAPA 4MFJA 4PK3A 3IU2A 1MJBA 3FRMA 4MMOA 4NJQA 1ARMA 1Z9UA 4MHPA 4OC3A 3SI0A 4P10A 2HB6A 2F8HA 2GU2A 4B5PA 3PB9X 4B14A 2OR4A 7CPAA 1BO4A 2DF5A 4OC2A 4P4DA 1QMUA 4FWUA 4LX9A 2OB0A 1XF8A 4JXRA 2V8DA 3D67A 4PXCA 3KZWA 4FD5A 2JEVA 4P4JA 2CNSA 2OZHA 4CS0B 2AFZA 2EVNA 4KORA 2YNCC 4C7HA 3KL9A 1IGBA 2PR1A 2FIAA 4R3LA 5CPAA 1X10A 4UF4A 4MFKA 3FNCA 2D4OA 1P0HA 4DJLA 4W9YA 4JZ0A 1K4JA 3KHXA 5LYLA 3FH4A 3FF3A 2BCOA 1HEEA 4X5KA 3KASA 1CJWA 3SJGA 3VARA 4XPDB 4MBUA 4E8OA 4PV6A 1Q2YA 3JVNA 2Z11A 2XEFA 4CGPA 3B3TA 2G3TA 2X7BA 1ON0A 3FECA 2IL4A 1LAMA 2F5IA 2PIYA 4P45A 4RI1A 2Q43A 2PJ7A 2Z3OA 2PR8A 3K2KA 2G0BA 2H5MA 3PGPA 3PB4X 1IYLA 3FEDA 4DYOA 2QMLA 5DWNA 3WABA 4DUKA 3TX8A 2REEA 2QIRA 1PYTB 4XPDC 2DPSA 5D8NA 1CP7A 1BLLE 4WJBA
chains in the Genus database with same CATH topology
4JJXA 1MJAA 4CYQA 2CNTA 2CNMA 3IGRA 1Y9WA 2GIVA 4CYOA 4KOSA 4HNYB 5EBVA 4AVCA 4NCZA 4CYNA 2Q04A 4H6ZA 3SXOA 1QSNA 4M3SA 2P0WA 4KOYA 1M4GA 3IU1A 3D3SA 4B11A 2B3VA 2FS5A 2Z3KA 4A32A 3EC4A 4M85A 1B87A 1MK4A 2Z3PA 2PQ8A 2I00A 4EVYA 5ISVA 4PK2A 3CXQA 3DSBA 4UCMA 2B58A 1YGHA 1QSTA 2OU2A 4MY0A 3FIXA 5H84A 1YVKA 4R9MA 2YNEA 4OAEA 1M4IA 1Z4RA 4MFZA 4UBRA 2AJ6A 5AG4A 3CXSA 4KVOE 4XPKA 4CRYB 2YNDA 2Q4VA 4FD6A 1WK4A 2ZXVA 1PU9A 5J8FA 1J4JA 3S6KA 2FL4A 3JUWA 3WR7A 2PC1A 4LUAA 4NSQA 5F47A 4AVBA 1YK3A 4NEXA 3F0AA 1VKCA 1PUAA 4C7IA 4FD4A 2B4BA 4K30A 4UWJA 2R98A 3SHPA 3GY9A 1YR0A 2VZYA 4KOUA 4ZBGA 1NMTA 2ARHA 2Q0YA 4AVAA 2P6FA 1KUVA 1M1DA 2B5GB 2P6GA 3VWDA 2D4PA 1Q2CA 2OZGA 2VQYA 2VEZA 3DDDA 3S6FA 1XEBA 1Y9KA 4JWPA 3BLNA 3DR8A 2R1IA 3E0KA 1S7NA 2Z10A 3QAHA 4AG9A 1WWZA 4NXYA 4QB9A 4CGOA 3G8WA 2PDOA 4R3KA 1S7FA 4QC6A 4R87A 4B10A 2BUEA 3C26A 3FB3A 1S5KA 3T90A 1RXTA 2CXAA 4KZTA 4B5PB 3PP9A 5HMNA 4HNXB 2ZW5A 3F8KA 3RYOA 4OADA 4YGOA 5HH1A 3A9LA 4KSFA 3I9SA 4KSAA 4MFPA 5F49A 4B5OA 2YGWA 3TT2A 2WPXA 4KLWA 4BBHA 4Y49B 5IX3A 4L8AA 1QSRA 4UWIA 2C27A 2DPTA 1ZO0A 1Y7RA 4CYPA 3B8GA 3IWEA 3SXNA 3TCVA 4RS2A 4U5YA 5G21A 1FY7A 4MHDA 4XNHB 4YRHA 5KTDA 3DNSA 3I3GA 3T9YA 3R96A 2WPWA 1M4DA 1S7LA 5F46A 4CAVA 4PSXA 5C82A 3BJ8A 2R8VA 3QB8A 4Y49C 4F0XA 4QVTA 4MFLA 3V8IA 2B4DA 1LRZA 2P6EA 4XNHC 2Q4YA 2HUZA 1KUYA 1BOBA 3P2HA 4E0AA 4AB7A 4H89A 4QBJA 4CGMA 3R9GA 5IB0A 3TFYA 1V0CA 5G20A 5IV0A 2YNCA 3GYAA 4MFQA 4U9ZA 4C2YA 4FD7A 4JLYA 4IUSA 4I49A 3OWCA 3FYNA 1TIQA 3GKRA 3IWGA 5A28A 3FXTA 2PRBA 4U9YA 4CGNA 4ONUA 1Q2DA 4A30A 2B3UA 3P2FA 3TOBA 4JD6A 5AG7A 3H4QA 2DXQA 4A33A 4E2AA 5I0CA 2JLMA 3EY5A 4KVXA 2OH1A 5F48A 5FVJA 4MJ8A 3TO9A 2AE6A 4KOXA 4J3GA 4CAXA 4II9A 1IYKA 3KKWA 4UA3A 2NMTA 4GS4A 4C2XA 2J8RA 1IB1E 5KTAA 2WSAA 4C68A 5A27A 4CAEA 3S6HA 4BMHA 1P4NA 5H86A 1I1DA 2Z3MA 2VXKA 2Z3LA 4KUAA 3DR6A 1VHSA 3PZJA 4KS9A 4CGLA 3R9EA 1CM0A 3TTHA 1XE4A 5C88A 1YVOA 2EUIA 3FBUA 3LD2A 4KOVA 1S3ZA 2REFA 4NF1A 4B13A 4HKFA 2OZUA 3MGDA 2ZW7A 1U6MA 3UY5A 1L0CA 3TO7A 2RC4A 5GCNA 2BSWA 2KCWA 3D2MA 4B12A 4A2ZA 1XIXA 4UCPA 1IICA 2ZW4A 1QSMA 4CRZB 1I21A 2R7HA 2PSWA 2Q7BA 1YREA 3JTKA 5J8CA 4KVME 1NE9A 4H6UA 5JQ4A 3CXPA 4KOWA 5AG6A 1YLEA 2Z3NA 4KUBA 1KUXA 2Y0MA 4QUSA 3TO6A 2K5TA 5AGEA 3VWEA 5AG5A 4A31A 2Z0ZA 1M44A 1R57A 1XMTA 1QSOA 2FT0A 2I79A 1N71A 1YX0A 1B6BA 4F6AA 3BJ7A 4AG7A 3W91A 2O28A 5JPHA 4UFWA 1OZPA 2FXFA 2VBQA 5G22A 3G3SA 1S7KA 4F0YA 5G1ZA 3R1KA 3S6GA 4OLLA 3TOAA 2JDDA 2J8NA 3W6SA 5E96A 4KLVA 3D8PA 4UFXA 4Q38A 3K9UA 3R95A 3EXNA 2JDCA 2G3AA 3H5ZA 4UFVA 3ZJ0A 1I12A 2ZPAA 2VZZA 1S60A 2ZW6A 4C2ZA 3W6XA 1GHEA 3N7ZA 4PSWA 4Q36A 2CY2A 3D2PA 4JXQA 1KZFA 1SQHA 2ATRA 3NE7A 3ZZIA 4CAFA 1Z4EA 4YFJA 4ZGYB 2B5GA 4IF5A 2BEIA 2QECA 2FSRA 1UFHA 2FIWA 4L89A 5DWMA 5EC4A 4DNCA 2BL1A 4KOTA 2J8MA 3F5BA 2HQYA 1IIDA 4R57A 2HV2A 2WUUA 4CAWA 4MI4A 5KTCA 3R9FA 2GANA 2B4DB 3EO4A 2GE3A 2VI7A 2Q44A 2A4NA 4MY3A 4HNWB 4UCNA 4XPLA 3EFAA 3LODA 3TE4A 2FE7A 1NSLA 4ORFA 5CNPA 1RO5A 2FCKA 1MJ9A 4A95A 5BWAB 4MFJA 4PK3A 3IU2A 1MJBA 3FRMA 1Z9UA 4B14A 4B5PA 1BO4A 4LX9A 2OB0A 1XF8A 4JXRA 4FD5A 2JEVA 2CNSA 2OZHA 4CS0B 2EVNA 4KORA 2YNCC 4C7HA 2PR1A 2FIAA 4R3LA 4MFKA 3FNCA 2D4OA 1P0HA 1K4JA 4X5KA 1CJWA 4XPDB 4MBUA 4E8OA 4PV6A 1Q2YA 3JVNA 2Z11A 4CGPA 2G3TA 2X7BA 1ON0A 4RI1A 2IL4A 2F5IA 2Z3OA 2PR8A 2G0BA 2H5MA 3PGPA 1IYLA 2QMLA 5DWNA 2REEA 2QIRA 4XPDC 2DPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A32 A;  4CGM A;  4B14 A;  5G20 A;  4B12 A;  4A2Z A;  2YNC A;  4C7I A;  5AG7 A;  4CYQ A;  2YNE A;  2WUU A;  3H5Z A;  4UFV A;  4UCP A;  4A33 A;  4CGO A;  4C2Y A;  4CYO A;  4CGL A;  4UFW A;  4CGP A;  4C2Z A;  4B10 A;  4CYN A;  3JTK A;  4UCN A;  5G22 A;  5AG4 A;  5A28 A;  2YND A;  4BBH A;  5AG6 A;  5G1Z A;  2YNC C;  4C7H A;  4CGN A;  4CAF A;  5AGE A;  4C2X A;  4B13 A;  5AG5 A;  3IU1 A;  4A31 A;  4A30 A;  4UCM A;  4CYP A;  3IWE A;  2WSA A;  5G21 A;  4A95 A;  4UFX A;  4C68 A;  5A27 A;  4CAE A;  4B11 A;  3IU2 A; 
#chains in the Genus database with same CATH topology
 2IQ6 A;  2XEG A;  4JJX A;  2AFO A;  1MJA A;  3KR4 A;  1Z8X A;  4CYQ A;  2CNT A;  2CNM A;  3IGR A;  4P6Y A;  5HXD A;  1Y9W A;  1Y0R A;  2GIV A;  4CYO A;  4MHN A;  2PRQ A;  4KOS A;  4HNY B;  6CPA A;  5EBV A;  4AVC A;  4OC1 A;  2ZED A;  3NH4 A;  4NCZ A;  2Q04 A;  4H6Z A;  4A38 A;  4CYN A;  5LYF A;  2C6P A;  4NJR A;  5I4M A;  8CPA A;  3SXO A;  1QSN A;  2AFW A;  4M3S A;  2P0W A;  4MXU A;  4KOY A;  2VL1 A;  4FAI A;  3FVL A;  1QQ9 A;  1M4G A;  3IU1 A;  1PCA A;  3D3S A;  1OBR A;  4JYW A;  4TNU A;  4OID A;  4P4B A;  4B11 A;  5J1Q A;  1ZG7 A;  2B3V A;  2FS5 A;  4WWV A;  2Z3K A;  4A32 A;  3EC4 A;  3L2N A;  4MCP A;  2EO8 A;  2ZEM A;  4M85 A;  1B87 A;  1MK4 A;  3CDX A;  1CG2 A;  2Z3P A;  2PQ8 A;  2PJ5 A;  3VH9 A;  3FX6 A;  2I00 A;  3B3W A;  4EVY A;  1DTD A;  5ISV A;  3JRU A;  1TKF A;  4R6T A;  4ZX9 A;  3D7D A;  4ZY1 A;  4OC4 A;  4HPS A;  1AYE A;  4ONW A;  4PK2 A;  3CXQ A;  2J9A A;  3DSB A;  1XBU A;  4UCM A;  2B58 A;  1YGH A;  2GLJ A;  1QST A;  2V8V A;  2OU2 A;  4MY0 A;  3S9M A;  4CPA A;  3FIX A;  2ZEP A;  5H84 A;  1YVK A;  4R9M A;  3I1U A;  4B6Z A;  2YNE A;  4OAE A;  1LOK A;  1VHO A;  3PB7 X;  1M4I A;  2O4H A;  4ZX8 A;  1Z4R A;  3FEE A;  4MFZ A;  2POK A;  1TF8 A;  2AFM A;  4UBR A;  3IWW A;  2AJ6 A;  1GYT A;  2C6C A;  5AG4 A;  3CXS A;  4KVO E;  4NGS A;  2PJB A;  4XPK A;  4CRY B;  1BAV A;  2GLF A;  3KI9 A;  4A39 A;  2YND A;  2Q4V A;  4FD6 A;  3PBB A;  1WK4 A;  2ZXV A;  1PU9 A;  2EK9 A;  5J8F A;  1J4J A;  3S6K A;  2FL4 A;  3JUW A;  3WR7 A;  2PC1 A;  4LUA A;  1JQG A;  4NSQ A;  1R43 A;  3GUX A;  1ZLH A;  5F47 A;  1YK3 A;  4AVB A;  4NEX A;  3F0A A;  1VKC A;  1PUA A;  4P4I A;  5THW A;  4C7I A;  4FD4 A;  4G1P A;  2B4B A;  4K30 A;  4UWJ A;  1TKH A;  2PJ8 A;  4NGN A;  1YQE A;  1F2O A;  3LWU A;  3RZA A;  2ZOF A;  4OIW A;  2R98 A;  4NGR A;  3GY9 A;  1YR0 A;  2VZY A;  1A2Z A;  4KOU A;  4ZBG A;  3IO1 A;  1NMT A;  5LRJ A;  2ARH A;  5D29 A;  3TO6 A;  2Q0Y A;  1HDU A;  3H8G A;  4AXV A;  3B3S A;  4IHM A;  4AVA A;  2P6F A;  1KUV A;  1M1D A;  2B5G B;  2P6G A;  2ZEL A;  3RO0 A;  4ZYQ A;  2C6G A;  3VWD A;  4Z65 A;  1TKJ A;  4F9V A;  5CBM A;  1CX8 A;  1Q2C A;  2D4P A;  3PB6 X;  2OZG A;  2VQY A;  2VEZ A;  3DDD A;  4MRI A;  1UWY A;  3S6F A;  1XEB A;  1Y9K A;  4JWP A;  4MCS A;  2ZOG A;  4F9U A;  3BLN A;  1CP6 A;  3DR8 A;  4M6G A;  2R1I A;  3BI0 A;  3E0K A;  3KHZ A;  1S7N A;  2Z10 A;  3QAH A;  5ELY A;  4AG9 A;  1WWZ A;  4NXY A;  4QB9 A;  4CGO A;  1XRY A;  3G8W A;  2PDO A;  4R3K A;  4RN7 A;  1S7F A;  4QC6 A;  4GM5 A;  4R87 A;  3RBU A;  3RNZ A;  4B10 A;  2BOA A;  2BUE A;  3LAC A;  3C26 A;  4NGM A;  2NYQ A;  2WYR A;  3WC7 A;  3FB3 A;  1LAN A;  1S5K A;  3T90 A;  1RXT A;  4MHZ A;  4EFD A;  2CXA A;  3BI1 A;  1YW6 A;  4KZT A;  5K8N A;  4B5P B;  3PP9 A;  5HMN A;  3GIU A;  1ZG9 A;  3PRT A;  4HNX B;  1F2P A;  1ELM P;  2PJ9 A;  1H8L A;  2ZW5 A;  3F8K A;  3RYO A;  2G9D A;  3IIB A;  3QNV A;  4OAD A;  4YGO A;  5HH1 A;  1VHE A;  5K8M A;  3A9L A;  3NH8 A;  4X2T A;  4KSF A;  2QJ8 A;  3I9S A;  4KSA A;  1ELL P;  4MFP A;  2XEJ A;  5F49 A;  4B5O A;  4OP4 A;  2YGW A;  3WC5 A;  3TT2 A;  2WPX A;  4KLW A;  3B3V A;  4BBH A;  4Y49 B;  5IX3 A;  4L8A A;  1AMP A;  1QSR A;  4UWI A;  2C27 A;  2DPT A;  1ZO0 A;  1Y7R A;  4CYP A;  3B8G A;  3IWE A;  3SXN A;  3TCV A;  3WT4 A;  4RS2 A;  4PXE A;  4U5Y A;  1FY7 A;  5G21 A;  3CPA A;  4MHD A;  4XNH B;  4YRH A;  5KTD A;  3DNS A;  3I3G A;  1XJO A;  3T9Y A;  3R96 A;  2WPW A;  1M4D A;  1S7L A;  1EE3 P;  5F46 A;  2EK8 A;  4CAV A;  4PSX A;  5C82 A;  3BJ8 A;  2PJC A;  2R8V A;  3B35 A;  2GRE A;  3QB8 A;  4Y49 C;  1KWM A;  4QVT A;  3SJX A;  4F0X A;  5IB9 A;  4MFL A;  3SI2 A;  2B4D A;  1FT7 A;  3V8I A;  4MHY A;  3D7G A;  1LRZ A;  4UEZ A;  2P6E A;  4XNH C;  2Q4Y A;  3CZX A;  4PPZ A;  1JWQ A;  2HUZ A;  3FJU A;  3LMS A;  1KUY A;  2PJ0 A;  1BOB A;  1YSJ A;  3P2H A;  4E0A A;  1CPX A;  2ZEG A;  2RB7 A;  4P44 A;  2DEA A;  4AB7 A;  2ODF A;  4H89 A;  4EWT A;  4QBJ A;  2PJ2 A;  3DLJ A;  3R9G A;  4CGM A;  3SI1 A;  4PQA A;  5HVG A;  5IB0 A;  1V0C A;  4OKO A;  5G20 A;  2YNC A;  5IV0 A;  3TFY A;  1XMB A;  1XOV A;  3GYA A;  4MFQ A;  2PCU A;  4U9Z A;  4C2Y A;  5LYD A;  2PJ6 A;  4FD7 A;  4JLY A;  4IUS A;  3SHP A;  4I49 A;  2ZEH A;  3OWC A;  3FYN A;  1TIQ A;  1Z8T A;  4A94 A;  3GKR A;  3IWG A;  4P4E A;  5A28 A;  1VIX A;  3T8W A;  3FXT A;  4A37 A;  2PRB A;  1M4L A;  1VGY A;  2AFS A;  3PBE A;  3TO7 A;  5LRG A;  2EWB A;  4U9Y A;  4CGN A;  4ONU A;  3B3C A;  1YW4 A;  1Q2D A;  1LFW A;  4A30 A;  4RUH A;  2IJZ A;  2ZEF A;  1Z2L A;  1ZLI A;  3RAM A;  3SJE A;  1F57 A;  3UY5 A;  4TWE A;  3KQZ A;  2B3U A;  4BIN A;  3P2F A;  3TOB A;  1R3N A;  2ABZ A;  5JM6 A;  4JD6 A;  5AG7 A;  3H4Q A;  2DXQ A;  4A33 A;  4E2A A;  5I0C A;  3D68 A;  2JLM A;  2Q4Z A;  1IU8 A;  2WZN A;  1XFO A;  3EY5 A;  4KVX A;  2OH1 A;  5F48 A;  4NGT A;  5FVJ A;  4MJ8 A;  3PFO A;  4R76 A;  3D66 A;  3TO9 A;  2AE6 A;  4KOX A;  1Y7E A;  4J3G A;  1Z8L A;  3CPX A;  4CAX A;  2PE3 A;  4P4F A;  2CTB A;  2ZEO A;  4II9 A;  1IYK A;  3KKW A;  4UA3 A;  3NE8 A;  2NMT A;  2HC9 A;  4GS4 A;  4C2X A;  2J8R A;  2I3C A;  1IB1 E;  5KTA A;  5K8O A;  2WSA A;  4C68 A;  5A27 A;  4CAE A;  3S6H A;  4BMH A;  1P4N A;  5H86 A;  1IOI A;  4O23 A;  1I1D A;  2Z3M A;  1YME A;  4X8I A;  1Y0Y A;  3KQX A;  4M6I A;  2VXK A;  2Z3L A;  4KUA A;  3DR6 A;  3HUV A;  1VHS A;  2PJ3 A;  3IC1 A;  3PZJ A;  4KS9 A;  5DS0 A;  4CGL A;  3S9N A;  1HDQ A;  3R9E A;  3VAT A;  1CM0 A;  2C1C A;  2IMO A;  3TTH A;  1XE4 A;  3IFE A;  2AFU A;  5EMI A;  5C88 A;  1YVO A;  2EUI A;  4YWY A;  2AFX A;  3FBU A;  3LD2 A;  4KOV A;  4R8F A;  2Q7S A;  4UEE A;  2NSM A;  1S3Z A;  2REF A;  4NF1 A;  5LRK A;  4B13 A;  4UIA A;  4UEF A;  2XEI A;  2OZU A;  3MGD A;  4HKF A;  3GLJ A;  2ZW7 A;  4LQ6 A;  2PJA A;  1U6M A;  1NSA A;  1L0C A;  1CBX A;  1RTQ A;  2PJ4 A;  2RC4 A;  1BPM A;  1DE4 C;  2EBJ A;  3KR5 A;  2OOT A;  3FMC A;  5GCN A;  2BSW A;  2KCW A;  3D2M A;  3MN8 A;  4B12 A;  4A2Z A;  4LQG A;  3BXM A;  1XIX A;  4UCP A;  1IIC A;  2ZW4 A;  1QSM A;  2O53 A;  3B2Y A;  4CRZ B;  1I21 A;  2R7H A;  2PVV A;  5K8P A;  2PSW A;  2Q7B A;  1YRE A;  1LCP A;  2RFH A;  3JTK A;  5J8C A;  4KVM E;  1NE9 A;  2CTC A;  5JGF A;  4H6U A;  5JQ4 A;  3CXP A;  4YU9 A;  1Q7L A;  4KOW A;  5AG6 A;  1YLE A;  2V8G A;  2Z3N A;  1KUX A;  2QVP A;  2Y0M A;  2F7V A;  2ZEE A;  4KUB A;  2K5T A;  2BO9 A;  4PXD A;  4QUS A;  4UIB A;  5AGE A;  3VWE A;  2GFQ A;  4PXB A;  5AG5 A;  4A31 A;  2Z0Z A;  1M44 A;  1R57 A;  3K9T A;  1XMT A;  1QSO A;  2FT0 A;  2I79 A;  1N71 A;  1YX0 A;  1B6B A;  4F6A A;  4BD9 A;  3D7F A;  5F09 A;  3BJ7 A;  4OC0 A;  3IEH A;  1TXR A;  3PFE A;  3DGV A;  4AG7 A;  3W91 A;  1IOF A;  4R7M A;  2O28 A;  5JPH A;  4UFW A;  2PJ1 A;  1OZP A;  2FXF A;  2VBQ A;  3QAY A;  1ZG8 A;  4NGQ A;  3PEI A;  5G22 A;  1ARL A;  3G3S A;  4X3R A;  1FNO A;  2CIJ A;  1S7K A;  4NGP A;  5G1Z A;  4F0Y A;  3R1K A;  1CPS A;  3S6G A;  4OLL A;  4KSI A;  1Z5R A;  2JDD A;  2J8N A;  3TOA A;  3W6S A;  5E96 A;  4KLV A;  3D8P A;  4UFX A;  4Q38 A;  4IK2 A;  4M6H A;  4GXH A;  3K9U A;  3R95 A;  3EXN A;  4ZY0 A;  2JDC A;  2JEW A;  4FBE A;  3D4U A;  3D7H A;  3GB0 A;  2G3A A;  1TF9 A;  3H5Z A;  4UFV A;  3ZJ0 A;  5JH9 A;  1X12 A;  5HVH A;  2V77 A;  1I12 A;  2CF4 A;  2ZPA A;  2VZZ A;  1S60 A;  2ZW6 A;  4Q7A A;  4C2Z A;  4EME A;  4IAV A;  1GHE A;  3W6X A;  3PB8 X;  2JBJ A;  3SJF A;  3N7Z A;  3N5F A;  4PSW A;  1Z8W A;  5LYI A;  4Q36 A;  2CY2 A;  3D2P A;  3CT9 A;  4JXQ A;  1KZF A;  1SQH A;  2ATR A;  3NE7 A;  3NH5 A;  4K3N A;  3V38 A;  3ZZI A;  4CAF A;  1Z4E A;  4YFJ A;  4ZGY B;  2B5G A;  3IJ3 A;  4IF5 A;  5HVF A;  2BEI A;  2QEC A;  2FSR A;  2Q51 A;  3B7I A;  4FUU A;  2PIZ A;  1UFH A;  2FIW A;  4L89 A;  5DWM A;  5EC4 A;  4DNC A;  2BL1 A;  3NA6 A;  4KOT A;  4F8Z A;  4MCR A;  2J8M A;  3BHX A;  3F5B A;  2HQY A;  1IY7 A;  1IID A;  3ISZ A;  4R57 A;  2HV2 A;  2WUU A;  2ZEN A;  4CAW A;  3S9L A;  1YLO A;  3ISX A;  4MI4 A;  5KTC A;  1BPN A;  2QYV A;  4OC5 A;  3R9F A;  1AUG A;  2GAN A;  2B4D B;  3H8E A;  3EO4 A;  4H2K A;  2GE3 A;  2VI7 A;  2Q44 A;  2A4N A;  3HLP A;  4MY3 A;  4HNW B;  4OME A;  3NFZ A;  4UCN A;  4XPL A;  3TC8 A;  3EFA A;  2JBK A;  3H8F A;  3KGQ A;  2ANP A;  3LOD A;  3TE4 A;  2FE7 A;  3WC6 A;  4ZY2 A;  2V8H A;  1NSL A;  3V7Z A;  4ORF A;  5CNP A;  1RO5 A;  2FCK A;  1MJ9 A;  2FVG A;  3MRU A;  4MCQ A;  4A95 A;  2PVW A;  4NFR A;  5BWA B;  4ZI6 A;  1LAP A;  4MFJ A;  4PK3 A;  3IU2 A;  1MJB A;  3FRM A;  4MMO A;  4NJQ A;  1ARM A;  1Z9U A;  4MHP A;  4OC3 A;  3SI0 A;  4P10 A;  2HB6 A;  2F8H A;  2GU2 A;  4B5P A;  3PB9 X;  4B14 A;  2OR4 A;  7CPA A;  1BO4 A;  2DF5 A;  4OC2 A;  4P4D A;  1QMU A;  4FWU A;  4LX9 A;  2OB0 A;  1XF8 A;  4JXR A;  2V8D A;  3D67 A;  4PXC A;  3KZW A;  4FD5 A;  2JEV A;  4P4J A;  2CNS A;  2OZH A;  4CS0 B;  2AFZ A;  2EVN A;  4KOR A;  2YNC C;  4C7H A;  3KL9 A;  1IGB A;  2PR1 A;  2FIA A;  4R3L A;  5CPA A;  1X10 A;  4UF4 A;  4MFK A;  3FNC A;  2D4O A;  1P0H A;  4DJL A;  4W9Y A;  4JZ0 A;  1K4J A;  3KHX A;  5LYL A;  3FH4 A;  3FF3 A;  2BCO A;  1HEE A;  4X5K A;  3KAS A;  1CJW A;  3SJG A;  3VAR A;  4XPD B;  4MBU A;  4E8O A;  4PV6 A;  1Q2Y A;  3JVN A;  2Z11 A;  2XEF A;  4CGP A;  3B3T A;  2G3T A;  2X7B A;  1ON0 A;  3FEC A;  2IL4 A;  1LAM A;  2F5I A;  2PIY A;  4P45 A;  4RI1 A;  2Q43 A;  2PJ7 A;  2Z3O A;  2PR8 A;  3K2K A;  2G0B A;  2H5M A;  3PGP A;  3PB4 X;  1IYL A;  3FED A;  4DYO A;  2QML A;  5DWN A;  3WAB A;  4DUK A;  3TX8 A;  2REE A;  2QIR A;  1PYT B;  4XPD C;  2DPS A;  5D8N A;  1CP7 A;  1BLL E;  4WJB A; 
#chains in the Genus database with same CATH homology
 4JJX A;  1MJA A;  4CYQ A;  2CNT A;  2CNM A;  3IGR A;  1Y9W A;  2GIV A;  4CYO A;  4KOS A;  4HNY B;  5EBV A;  4AVC A;  4NCZ A;  4CYN A;  2Q04 A;  4H6Z A;  3SXO A;  1QSN A;  4M3S A;  2P0W A;  4KOY A;  1M4G A;  3IU1 A;  3D3S A;  4B11 A;  2B3V A;  2FS5 A;  2Z3K A;  4A32 A;  3EC4 A;  4M85 A;  1B87 A;  1MK4 A;  2Z3P A;  2PQ8 A;  2I00 A;  4EVY A;  5ISV A;  4PK2 A;  3CXQ A;  3DSB A;  4UCM A;  2B58 A;  1YGH A;  1QST A;  2OU2 A;  4MY0 A;  3FIX A;  5H84 A;  1YVK A;  4R9M A;  2YNE A;  4OAE A;  1M4I A;  1Z4R A;  4MFZ A;  4UBR A;  2AJ6 A;  5AG4 A;  3CXS A;  4KVO E;  4XPK A;  4CRY B;  2YND A;  2Q4V A;  4FD6 A;  1WK4 A;  2ZXV A;  1PU9 A;  5J8F A;  1J4J A;  3S6K A;  2FL4 A;  3JUW A;  3WR7 A;  2PC1 A;  4LUA A;  4NSQ A;  5F47 A;  4AVB A;  1YK3 A;  4NEX A;  3F0A A;  1VKC A;  1PUA A;  4C7I A;  4FD4 A;  2B4B A;  4K30 A;  4UWJ A;  2R98 A;  3SHP A;  3GY9 A;  1YR0 A;  2VZY A;  4KOU A;  4ZBG A;  1NMT A;  2ARH A;  2Q0Y A;  4AVA A;  2P6F A;  1KUV A;  1M1D A;  2B5G B;  2P6G A;  3VWD A;  2D4P A;  1Q2C A;  2OZG A;  2VQY A;  2VEZ A;  3DDD A;  3S6F A;  1XEB A;  1Y9K A;  4JWP A;  3BLN A;  3DR8 A;  2R1I A;  3E0K A;  1S7N A;  2Z10 A;  3QAH A;  4AG9 A;  1WWZ A;  4NXY A;  4QB9 A;  4CGO A;  3G8W A;  2PDO A;  4R3K A;  1S7F A;  4QC6 A;  4R87 A;  4B10 A;  2BUE A;  3C26 A;  3FB3 A;  1S5K A;  3T90 A;  1RXT A;  2CXA A;  4KZT A;  4B5P B;  3PP9 A;  5HMN A;  4HNX B;  2ZW5 A;  3F8K A;  3RYO A;  4OAD A;  4YGO A;  5HH1 A;  3A9L A;  4KSF A;  3I9S A;  4KSA A;  4MFP A;  5F49 A;  4B5O A;  2YGW A;  3TT2 A;  2WPX A;  4KLW A;  4BBH A;  4Y49 B;  5IX3 A;  4L8A A;  1QSR A;  4UWI A;  2C27 A;  2DPT A;  1ZO0 A;  1Y7R A;  4CYP A;  3B8G A;  3IWE A;  3SXN A;  3TCV A;  4RS2 A;  4U5Y A;  5G21 A;  1FY7 A;  4MHD A;  4XNH B;  4YRH A;  5KTD A;  3DNS A;  3I3G A;  3T9Y A;  3R96 A;  2WPW A;  1M4D A;  1S7L A;  5F46 A;  4CAV A;  4PSX A;  5C82 A;  3BJ8 A;  2R8V A;  3QB8 A;  4Y49 C;  4F0X A;  4QVT A;  4MFL A;  3V8I A;  2B4D A;  1LRZ A;  2P6E A;  4XNH C;  2Q4Y A;  2HUZ A;  1KUY A;  1BOB A;  3P2H A;  4E0A A;  4AB7 A;  4H89 A;  4QBJ A;  4CGM A;  3R9G A;  5IB0 A;  3TFY A;  1V0C A;  5G20 A;  5IV0 A;  2YNC A;  3GYA A;  4MFQ A;  4U9Z A;  4C2Y A;  4FD7 A;  4JLY A;  4IUS A;  4I49 A;  3OWC A;  3FYN A;  1TIQ A;  3GKR A;  3IWG A;  5A28 A;  3FXT A;  2PRB A;  4U9Y A;  4CGN A;  4ONU A;  1Q2D A;  4A30 A;  2B3U A;  3P2F A;  3TOB A;  4JD6 A;  5AG7 A;  3H4Q A;  2DXQ A;  4A33 A;  4E2A A;  5I0C A;  2JLM A;  3EY5 A;  4KVX A;  2OH1 A;  5F48 A;  5FVJ A;  4MJ8 A;  3TO9 A;  2AE6 A;  4KOX A;  4J3G A;  4CAX A;  4II9 A;  1IYK A;  3KKW A;  4UA3 A;  2NMT A;  4GS4 A;  4C2X A;  2J8R A;  1IB1 E;  5KTA A;  2WSA A;  4C68 A;  5A27 A;  4CAE A;  3S6H A;  4BMH A;  1P4N A;  5H86 A;  1I1D A;  2Z3M A;  2VXK A;  2Z3L A;  4KUA A;  3DR6 A;  1VHS A;  3PZJ A;  4KS9 A;  4CGL A;  3R9E A;  1CM0 A;  3TTH A;  1XE4 A;  5C88 A;  1YVO A;  2EUI A;  3FBU A;  3LD2 A;  4KOV A;  1S3Z A;  2REF A;  4NF1 A;  4B13 A;  4HKF A;  2OZU A;  3MGD A;  2ZW7 A;  1U6M A;  3UY5 A;  1L0C A;  3TO7 A;  2RC4 A;  5GCN A;  2BSW A;  2KCW A;  3D2M A;  4B12 A;  4A2Z A;  1XIX A;  4UCP A;  1IIC A;  2ZW4 A;  1QSM A;  4CRZ B;  1I21 A;  2R7H A;  2PSW A;  2Q7B A;  1YRE A;  3JTK A;  5J8C A;  4KVM E;  1NE9 A;  4H6U A;  5JQ4 A;  3CXP A;  4KOW A;  5AG6 A;  1YLE A;  2Z3N A;  4KUB A;  1KUX A;  2Y0M A;  4QUS A;  3TO6 A;  2K5T A;  5AGE A;  3VWE A;  5AG5 A;  4A31 A;  2Z0Z A;  1M44 A;  1R57 A;  1XMT A;  1QSO A;  2FT0 A;  2I79 A;  1N71 A;  1YX0 A;  1B6B A;  4F6A A;  3BJ7 A;  4AG7 A;  3W91 A;  2O28 A;  5JPH A;  4UFW A;  1OZP A;  2FXF A;  2VBQ A;  5G22 A;  3G3S A;  1S7K A;  4F0Y A;  5G1Z A;  3R1K A;  3S6G A;  4OLL A;  3TOA A;  2JDD A;  2J8N A;  3W6S A;  5E96 A;  4KLV A;  3D8P A;  4UFX A;  4Q38 A;  3K9U A;  3R95 A;  3EXN A;  2JDC A;  2G3A A;  3H5Z A;  4UFV A;  3ZJ0 A;  1I12 A;  2ZPA A;  2VZZ A;  1S60 A;  2ZW6 A;  4C2Z A;  3W6X A;  1GHE A;  3N7Z A;  4PSW A;  4Q36 A;  2CY2 A;  3D2P A;  4JXQ A;  1KZF A;  1SQH A;  2ATR A;  3NE7 A;  3ZZI A;  4CAF A;  1Z4E A;  4YFJ A;  4ZGY B;  2B5G A;  4IF5 A;  2BEI A;  2QEC A;  2FSR A;  1UFH A;  2FIW A;  4L89 A;  5DWM A;  5EC4 A;  4DNC A;  2BL1 A;  4KOT A;  2J8M A;  3F5B A;  2HQY A;  1IID A;  4R57 A;  2HV2 A;  2WUU A;  4CAW A;  4MI4 A;  5KTC A;  3R9F A;  2GAN A;  2B4D B;  3EO4 A;  2GE3 A;  2VI7 A;  2Q44 A;  2A4N A;  4MY3 A;  4HNW B;  4UCN A;  4XPL A;  3EFA A;  3LOD A;  3TE4 A;  2FE7 A;  1NSL A;  4ORF A;  5CNP A;  1RO5 A;  2FCK A;  1MJ9 A;  4A95 A;  5BWA B;  4MFJ A;  4PK3 A;  3IU2 A;  1MJB A;  3FRM A;  1Z9U A;  4B14 A;  4B5P A;  1BO4 A;  4LX9 A;  2OB0 A;  1XF8 A;  4JXR A;  4FD5 A;  2JEV A;  2CNS A;  2OZH A;  4CS0 B;  2EVN A;  4KOR A;  2YNC C;  4C7H A;  2PR1 A;  2FIA A;  4R3L A;  4MFK A;  3FNC A;  2D4O A;  1P0H A;  1K4J A;  4X5K A;  1CJW A;  4XPD B;  4MBU A;  4E8O A;  4PV6 A;  1Q2Y A;  3JVN A;  2Z11 A;  4CGP A;  2G3T A;  2X7B A;  1ON0 A;  4RI1 A;  2IL4 A;  2F5I A;  2Z3O A;  2PR8 A;  2G0B A;  2H5M A;  3PGP A;  1IYL A;  2QML A;  5DWN A;  2REE A;  2QIR A;  4XPD C;  2DPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...