4C7IA

Leismania major n-myristoyltransferase in complex with a peptidomimetic (-oh) molecule
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Peptidomimetic Inhibitors of N-Myristoyltransferase from Human Malaria and Leishmaniasis Parasites.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 128
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2013-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4c7iA00
4UFWA 4A32A 3H5ZA 5AG7A 5G22A 4CYQA 5AG6A 4A30A 5A28A 5AG5A 4UFXA 3JTKA 4BBHA 5AG4A 4C7HA 2WUUA 4C2YA 4C2ZA 4CYNA 2YNDA 5G1ZA 4C7IA 4C2XA 4CGLA 4B14A 3IU2A 2YNEA 4UCPA 3IWEA 4CAEA 4CAFA 4A2ZA 2YNCC 4CGNA 4B12A 4CYPA 4CGMA 2WSAA 4C68A 4B13A 4A31A 4CGPA 4CGOA 4A95A 2YNCA 4CYOA 5A27A 4UCNA 4UCMA 4UFVA 5G21A 4A33A 4B11A 3IU1A 4B10A 5AGEA 5G20A
chains in the Genus database with same CATH superfamily
3H5ZA 3NH4A 4HPSA 4L8AA 3SJGA 1X12A 3SJEA 4XNHC 2DEAA 3FX6A 3IJ3A 1TKJA 3QAHA 1XOVA 1KUYA 2FIAA 4JZ0A 2PVWA 4OC2A 1A2ZA 4NEXA 4R76A 2RC4A 5CNPA 5THWA 3TE4A 4R7MA 4Q38A 4IF5A 4PQAA 4LQGA 3DR6A 2KCWA 5HH1A 3S6GA 2BUEA 3SXNA 3TX8A 4AXVA 1OBRA 1CG2A 2AFMA 3I1UA 3PEIA 2PJ9A 1K4JA 4OC5A 3FMCA 4FD4A 1IIDA 1Z4EA 5LRKA 2D4PA 1YK3A 2IQ6A 3BJ8A 3PBEA 4CAWA 1XMBA 5A27A 5LYLA 2F8HA 2HQYA 2Z3NA 2Z3LA 4LUAA 2V77A 2IL4A 2XEGA 3ISZA 1DE4C 1MK4A 3E0KA 4OC0A 3NFZA 3G3SA 2C6CA 4KVME 2Z10A 3HUVA 3VATA 5HXDA 5AG5A 4QBJA 1V0CA 2POKA 4TWEA 1AUGA 4K30A 4EVYA 8CPAA 5DWNA 5K8PA 5G1ZA 2EWBA 1YSJA 2CNSA 1TF8A 1S7LA 4C7IA 4B14A 1QSOA 4Y49B 3H8EA 2PQ8A 2FL4A 2AFSA 3PB6X 1QSMA 2ABZA 2O4HA 4FD7A 4CYPA 6CPAA 4ZI6A 4CRZB 2WSAA 5ISVA 4XPLA 4NGRA 1B87A 2REFA 4F9UA 4B13A 5K8MA 4NGSA 3B3TA 4CGOA 3CXQA 4MFPA 3N5FA 5K8OA 4DNCA 1R43A 2PJ7A 3NE7A 5AGEA 2QVPA 3T8WA 1LFWA 2BSWA 4OC4A 1QSRA 4R8FA 3MGDA 3IIBA 5GCNA 1I21A 1VHOA 3L2NA 4M6IA 4AVCA 1FY7A 4C2YA 2Z0ZA 5F48A 2JDCA 2P6EA 2PE3A 1FT7A 5DS0A 1MJBA 3R9FA 3IU2A 1ARMA 3CXPA 4H89A 4K3NA 4A2ZA 2PJ8A 3IWWA 2J8MA 1LOKA 1BLLE 3PB9X 2HV2A 4M6HA 1ZLHA 4OC3A 2I79A 4P4EA 3DSBA 4XNHB 4UCMA 4PSWA 5BWAB 2PJBA 2Z3KA 1CP6A 4JYWA 4J3GA 2DPTA 1L0CA 1VGYA 4NSQA 4DJLA 2PIZA 4P4FA 1Z2LA 3PFOA 7CPAA 4HNYB 2B4DB 1ELMP 2ZEEA 3FVLA 3LWUA 1N71A 2WPXA 1VIXA 3D8PA 3FBUA 1CM0A 1KWMA 3LMSA 3OWCA 3D67A 1Z8LA 4H6ZA 4YFJA 1Z8WA 5F09A 1Q2YA 1S3ZA 1Y7EA 2PRBA 2VL1A 2ZOFA 2ZW7A 2C27A 3C26A 4R57A 4RI1A 1BO4A 2P0WA 2Q51A 3TTHA 1R3NA 3VH9A 2C6PA 3EFAA 1IU8A 2B4DA 4OMEA 2ZXVA 1U6MA 2GIVA 2ZEPA 5EMIA 3RNZA 4MMOA 3WC5A 4XPDC 4E0AA 3UY5A 1Z8TA 1YVOA 4OAEA 4A33A 2V8DA 2F5IA 1J4JA 2PJ2A 2GANA 3QAYA 5DWMA 4B5PA 5J1QA 4AVAA 5G22A 4A37A 1ZLIA 3V38A 3B3VA 1S60A 2VQYA 2PR1A 2YGWA 4UA3A 2GU2A 3PP9A 4F0YA 3S9NA 2CNMA 1F57A 2PC1A 5EBVA 2QYVA 4P44A 2Z3PA 4JWPA 3EXNA 4QVTA 2VI7A 1Y7RA 1OZPA 5CPAA 1NE9A 4H6UA 1YLEA 2JDDA 2ZEDA 1NSLA 3TC8A 4CRYB 4NFRA 4P45A 1F2PA 4MCSA 5JM6A 4ONUA 2EVNA 4OIDA 2DF5A 1QMUA 3D3SA 4P6YA 4R9MA 4KOVA 1IGBA 4WJBA 1P4NA 4E8OA 5K8NA 2ANPA 3WT4A 3PGPA 3TOBA 3VWDA 2QECA 1KUXA 4QUSA 1XF8A 4A32A 2PVVA 4Q36A 4PV6A 1I1DA 4IK2A 1IOFA 2EBJA 5LYDA 4DUKA 2GE3A 4OP4A 1GHEA 4ZBGA 5AG4A 4BBHA 4R87A 4AVBA 2J8NA 3GYAA 4KOUA 4NJQA 4C2XA 4KOWA 1CJWA 3KZWA 3TCVA 3JRUA 3K9UA 1XIXA 4TNUA 1CP7A 4YWYA 4BD9A 3B3SA 2ZOGA 5HVHA 2O28A 4A38A 3FRMA 2ZEGA 3I9SA 3JUWA 1M4DA 4E2AA 3BI1A 2OU2A 3BXMA 3TT2A 4CAXA 4MJ8A 3TFYA 3GUXA 1UFHA 3B3WA 4PK2A 3P2HA 3PRTA 2EK8A 3PB4X 5G21A 5H84A 1QQ9A 5FVJA 3FECA 1WK4A 3N7ZA 3P2FA 3EY5A 4M3SA 5IX3A 5JQ4A 3W6XA 4A30A 2VZYA 3W91A 1AMPA 4OLLA 1MJ9A 2V8VA 2PJ5A 2ZW4A 3FXTA 4X5KA 2FE7A 4ZYQA 4B6ZA 2CF4A 2JLMA 3KHZA 4BINA 5E96A 4PXBA 3K9TA 4LX9A 4PK3A 2V8GA 4EMEA 1QSTA 1IYLA 4XPDB 1LANA 3KI9A 4UWJA 3D66A 3V8IA 3WC7A 4F0XA 4ZX9A 4FBEA 1Z5RA 3DGVA 2B4BA 2DPSA 1MJAA 1Z8XA 3H8FA 3IC1A 2BL1A 3IO1A 1ZG9A 5HVFA 3B35A 3SI2A 3TOAA 4B11A 4KS9A 3NH5A 4HNWB 2GLFA 4UFWA 1XFOA 4FWUA 3CXSA 3A9LA 4P4IA 3TO6A 5A28A 3GB0A 3LD2A 3GLJA 2CY2A 1LAMA 2AFWA 4UFXA 1JWQA 5LYFA 3CPXA 4C7HA 1VHSA 2Y0MA 2G3TA 4MXUA 1M4GA 3GKRA 1YW4A 2Q04A 3BI0A 2NMTA 2PR8A 4ZX8A 1S5KA 2R8VA 2OB0A 4CAEA 1M1DA 3SXOA 4CS0B 2JBKA 3WC6A 1S7FA 5LYIA 1TIQA 4FD5A 3D7HA 4XPKA 2YNCA 4KOXA 2Q4VA 4UEEA 5F49A 4A94A 3IU1A 1HDUA 2CIJA 4AG7A 1BPNA 5AG7A 2VBQA 4JXRA 1YREA 2J9AA 3VARA 1S7NA 5IV0A 1ZG8A 2IMOA 4MCQA 3NH8A 3FEEA 2HB6A 3JTKA 2FS5A 1YVKA 1Y9KA 5I4MA 4AG9A 3KR5A 1LCPA 3CT9A 2IJZA 2CXAA 2ZEHA 1TF9A 4KOTA 3FJUA 3RO0A 2P6GA 4MHYA 3D4UA 4ONWA 4JJXA 1XJOA 2VXKA 2G0BA 1BPMA 4B5PB 2AJ6A 5I0CA 2HUZA 2JEVA 4KOYA 1ZO0A 5F46A 4A95A 2R98A 3R1KA 4GXHA 2QMLA 3D7FA 1Q2CA 4EFDA 1PUAA 3F5BA 3SI0A 3IGRA 5ELYA 5IB9A 2Q7SA 3S9LA 4MHZA 2P6FA 2DXQA 3CZXA 3KHXA 2B3UA 2NYQA 2PJ6A 4FAIA 5C88A 1CPXA 4F8ZA 2ZW5A 4JLYA 5JGFA 4B5OA 4OKOA 2R7HA 2B58A 2PJ4A 3KKWA 1CPSA 3DLJA 2YNCC 3FB3A 4U5YA 4CGMA 4C68A 3CDXA 2Q4ZA 1ARLA 1NSAA 5HMNA 4KLWA 3S6KA 1DTDA 4MHDA 5JPHA 3FNCA 3SI1A 1Y0YA 2HC9A 4GM5A 4L89A 1B6BA 2PIYA 2I3CA 1KUVA 4P10A 5H86A 2PJ0A 4ZGYB 3T90A 3QNVA 3S9MA 1WWZA 3LACA 3ZZIA 2ZEOA 4Z65A 1EE3P 1XBUA 2Q7BA 1YLOA 3H8GA 3NA6A 4OC1A 3KGQA 2K5TA 4CYNA 1X10A 4KSAA 2OZHA 3QB8A 4JXQA 2Q44A 2YNDA 2FSRA 3SHPA 1CX8A 4KUBA 1YR0A 2YNEA 3KQZA 1BAVA 4CAFA 2AFOA 3D2PA 2G9DA 3CPAA 3W6SA 2OZUA 4NCZA 1PYTB 1PU9A 3D7DA 1IB1E 1HDQA 4QC6A 2ZEFA 3PBBA 5KTCA 1ELLP 3IFEA 4MFLA 1M4IA 3B2YA 1Z4RA 3ISXA 2BOAA 3PFEA 4DYOA 1YX0A 4M6GA 3RZAA 4RUHA 5LRGA 2QJ8A 2FIWA 2EK9A 2Z3MA 4UEZA 1VKCA 4KOSA 3WABA 4MHNA 5KTAA 1YW6A 4R6TA 3EC4A 1LRZA 1JQGA 1CBXA 2J8RA 2VZZA 4WWVA 4CPAA 4AB7A 4KVXA 3VWEA 4ZY0A 1IOIA 1SQHA 4X2TA 2PCUA 4P4DA 5D8NA 3DR8A 2ZW6A 2ZENA 4G1PA 1YMEA 3R95A 1TKFA 4EWTA 3WR7A 1Q7LA 3F0AA 4UWIA 4PXEA 3RAMA 4UFVA 4OIWA 4MY3A 2FVGA 1M4LA 4U9YA 2CNTA 4MCRA 4NF1A 4NGPA 2OOTA 1Z9UA 3PZJA 5AG6A 3KL9A 4MBUA 1RXTA 1VHEA 4MRIA 4X8IA 2ODFA 3PB8X 2XEJA 4R3LA 2CTCA 2A4NA 1XEBA 1HEEA 1XE4A 2XEIA 3FH4A 4I49A 4P4JA 4UF4A 4YU9A 1GYTA 2PDOA 4RS2A 3DDDA 4OADA 1P0HA 2ARHA 3NE8A 1BOBA 2NSMA 3KASA 2PRQA 4NJRA 2PJAA 2GFQA 3K2KA 1RTQA 3KR4A 4BMHA 4KSIA 1YGHA 3FYNA 4PSXA 4PXCA 2BCOA 2ZELA 2ZPAA 2WYRA 4CYOA 3B7IA 3EO4A 1AYEA 1M44A 2CTBA 4R3KA 1TXRA 3SJFA 1IICA 2FCKA 2PSWA 4NGQA 4B10A 5G20A 2WPWA 4HNXB 1XRYA 1XMTA 2VEZA 2I00A 3GY9A 4KORA 3TO7A 3JVNA 3PB7X 5F47A 5J8FA 3D68A 4IAVA 2Q43A 4FD6A 2B5GB 3H4QA 1RO5A 3LODA 4NGTA 4ORFA 3R9EA 3GIUA 3MN8A 4UEFA 2BO9A 2OH1A 5EC4A 3G8WA 1YQEA 4CGLA 4MI4A 5C82A 4GS4A 4MFJA 4CGNA 2PJ3A 3D7GA 2RB7A 3KQXA 4KSFA 4II9A 3S6HA 4KVOE 2FT0A 2AFUA 3BLNA 3R9GA 3DNSA 2WZNA 2B5GA 3FF3A 2B3VA 2Q4YA 1H8LA 3FIXA 1Y9WA 2AE6A 2AFZA 4MFKA 4RN7A 1QSNA 1F2OA 1ON0A 2C1CA 2BEIA 4UBRA 5CBMA 4MFQA 2GREA 4MHPA 1TKHA 4KZTA 4U9ZA 1I12A 5D29A 2H5MA 1NMTA 3I3GA 1LAPA 4CAVA 4C2ZA 5LRJA 3IWGA 4IHMA 4NGNA 3T9YA 5JH9A 4UIBA 1IYKA 4PPZA 4O23A 1S7KA 4UCPA 2F7VA 5HVGA 3RBUA 1FNOA 4A39A 4B12A 2C6GA 3HLPA 2PJ1A 4P4BA 3F8KA 4Y49C 4FUUA 4A31A 3FEDA 4H2KA 4QB9A 3MRUA 2JBJA 1PCAA 2AFXA 2OZGA 2G3AA 2FXFA 2R1IA 2JEWA 2REEA 4NXYA 4F9VA 2V8HA 4ZY2A 3ZJ0A 4UIAA 4CYQA 1Y0RA 5J8CA 4PXDA 2QIRA 1KZFA 2D4OA 2Z3OA 3BJ7A 2OR4A 1UWYA 3BHXA 4LQ6A 3S6FA 3R96A 5IB0A 1IY7A 2WUUA 4IUSA 2EO8A 5KTDA 4Q7AA 4X3RA 4YRHA 3B3CA 4KLVA 4JD6A 3TO9A 1Q2DA 3B8GA 2XEFA 3IWEA 4MY0A 4MFZA 2PJCA 4YGOA 4M85A 3SJXA 2RFHA 2ATRA 1R57A 2O53A 2ZEMA 4NGMA 4KUAA 3RYOA 4F6AA 4W9YA 4ZY1A 4CGPA 2EUIA 2Z11A 2Q0YA 4UCNA 4MCPA 2X7BA 3IEHA 4HKFA 1ZG7A 3V7ZA 3D2MA 2GLJA
chains in the Genus database with same CATH topology
3H5ZA 4L8AA 4XNHC 3QAHA 1KUYA 2FIAA 4NEXA 2RC4A 5CNPA 3TE4A 4Q38A 4IF5A 3DR6A 2KCWA 5HH1A 3S6GA 2BUEA 3SXNA 1K4JA 4FD4A 1IIDA 1Z4EA 2D4PA 1YK3A 3BJ8A 4CAWA 5A27A 2HQYA 2Z3NA 2Z3LA 4LUAA 2IL4A 1MK4A 3E0KA 3G3SA 4KVME 2Z10A 5AG5A 4QBJA 1V0CA 4K30A 4EVYA 5DWNA 5G1ZA 2CNSA 4C7IA 1S7LA 4B14A 1QSOA 4Y49B 2PQ8A 2FL4A 4FD7A 1QSMA 4CYPA 5ISVA 4CRZB 2WSAA 4XPLA 1B87A 2REFA 4B13A 4CGOA 3CXQA 4MFPA 4DNCA 3NE7A 5AGEA 2BSWA 1QSRA 3MGDA 5GCNA 1I21A 4AVCA 1FY7A 4C2YA 2Z0ZA 5F48A 2JDCA 2P6EA 1MJBA 3R9FA 3IU2A 3CXPA 4H89A 4A2ZA 2J8MA 2HV2A 2I79A 3DSBA 4XNHB 4UCMA 4PSWA 5BWAB 2Z3KA 4J3GA 2DPTA 1L0CA 4NSQA 4HNYB 2B4DB 1N71A 2WPXA 3D8PA 3FBUA 1CM0A 3OWCA 4YFJA 4H6ZA 3C26A 1Q2YA 1S3ZA 2PRBA 2ZW7A 4R57A 4F0YA 2C27A 4RI1A 3TTHA 1BO4A 2P0WA 3EFAA 2B4DA 2ZXVA 1U6MA 2GIVA 4XPDC 4E0AA 3UY5A 1YVOA 4OAEA 4A33A 2F5IA 1J4JA 2GANA 5DWMA 4B5PA 4AVAA 5G22A 1S60A 2VQYA 2PR1A 2YGWA 4UA3A 3PP9A 2CNMA 2PC1A 5EBVA 2Z3PA 4JWPA 3EXNA 4QVTA 2VI7A 1Y7RA 1OZPA 1NE9A 4H6UA 1YLEA 2JDDA 1NSLA 4CRYB 4ONUA 2EVNA 3D3SA 4R9MA 4KOVA 4E8OA 1P4NA 3PGPA 3TOBA 3VWDA 2QECA 1KUXA 4QUSA 1XF8A 4A32A 4Q36A 4PV6A 1I1DA 2GE3A 1GHEA 4ZBGA 5AG4A 4BBHA 4R87A 4AVBA 2J8NA 3GYAA 4KOUA 4C2XA 4KOWA 1CJWA 3TCVA 3K9UA 1XIXA 2O28A 3FRMA 3I9SA 3JUWA 1M4DA 4E2AA 2OU2A 3TT2A 4CAXA 4MJ8A 3TFYA 1UFHA 4PK2A 3P2HA 5H84A 5G21A 5FVJA 1WK4A 3N7ZA 3P2FA 3EY5A 4M3SA 5IX3A 5JQ4A 3W6XA 4A30A 2VZYA 3W91A 4OLLA 1MJ9A 3FXTA 2ZW4A 4X5KA 2FE7A 2JLMA 5E96A 4LX9A 4PK3A 1QSTA 1IYLA 4XPDB 4UWJA 3V8IA 4F0XA 2B4BA 2DPSA 1MJAA 2BL1A 3TOAA 4B11A 4KS9A 4HNWB 4UFWA 3CXSA 3A9LA 3TO6A 5A28A 3LD2A 2CY2A 4UFXA 4C7HA 1VHSA 2Y0MA 2G3TA 1M4GA 3GKRA 2Q04A 2NMTA 2PR8A 1S5KA 2R8VA 2OB0A 4CAEA 1M1DA 3SXOA 4CS0B 1S7FA 1TIQA 4FD5A 4XPKA 2YNCA 4KOXA 2Q4VA 5F49A 3IU1A 4AG7A 5AG7A 2VBQA 4JXRA 1YREA 1S7NA 5IV0A 3JTKA 2FS5A 1YVKA 1Y9KA 4AG9A 2CXAA 4KOTA 2P6GA 4JJXA 2VXKA 2G0BA 4B5PB 2AJ6A 5I0CA 2HUZA 2JEVA 4KOYA 1ZO0A 5F46A 4A95A 2R98A 3R1KA 2QMLA 1Q2CA 1PUAA 3F5BA 3IGRA 2P6FA 2DXQA 2B3UA 5C88A 2ZW5A 4JLYA 4B5OA 2R7HA 2B58A 3KKWA 3FB3A 2YNCC 4U5YA 4CGMA 4C68A 5HMNA 4KLWA 3S6KA 4MHDA 5JPHA 3FNCA 4L89A 1B6BA 1KUVA 4ZGYB 5H86A 3T90A 1WWZA 3ZZIA 2Q7BA 2K5TA 4CYNA 4KSAA 2OZHA 3QB8A 4JXQA 2Q44A 2YNDA 2FSRA 3SHPA 4KUBA 1YR0A 2YNEA 4CAFA 3D2PA 3W6SA 2OZUA 4NCZA 1PU9A 1IB1E 4QC6A 5KTCA 4MFLA 1M4IA 1Z4RA 1YX0A 2FIWA 2Z3MA 1VKCA 4KOSA 5KTAA 3EC4A 1LRZA 2VZZA 2J8RA 4AB7A 4KVXA 3VWEA 1SQHA 3DR8A 2ZW6A 3R95A 3WR7A 4UWIA 3F0AA 4UFVA 4MY3A 4U9YA 2CNTA 4NF1A 1Z9UA 3PZJA 5AG6A 4MBUA 1RXTA 4R3LA 2A4NA 1XEBA 1XE4A 4I49A 2PDOA 4RS2A 3DDDA 4OADA 1P0HA 2ARHA 1BOBA 4BMHA 1YGHA 3FYNA 4PSXA 2ZPAA 4CYOA 3EO4A 1M44A 4R3KA 4B10A 1IICA 2FCKA 2PSWA 5G20A 2WPWA 4HNXB 1XMTA 2VEZA 2I00A 3GY9A 4KORA 3TO7A 3JVNA 5J8FA 5F47A 4FD6A 2B5GB 3H4QA 1RO5A 3LODA 4ORFA 3R9EA 2OH1A 5EC4A 3G8WA 4CGLA 4MI4A 5C82A 4GS4A 4MFJA 4CGNA 4KSFA 4II9A 3S6HA 4KVOE 2FT0A 3BLNA 3R9GA 3DNSA 2B5GA 2B3VA 2Q4YA 3FIXA 1Y9WA 2AE6A 4MFKA 1QSNA 1ON0A 2BEIA 4UBRA 4MFQA 4KZTA 4U9ZA 1I12A 2H5MA 1NMTA 3I3GA 4CAVA 4C2ZA 3IWGA 3T9YA 1IYKA 1S7KA 4UCPA 4B12A 3F8KA 4Y49C 4A31A 4QB9A 2OZGA 2G3AA 2FXFA 2R1IA 2REEA 4NXYA 3ZJ0A 4CYQA 5J8CA 2QIRA 1KZFA 2D4OA 2Z3OA 3BJ7A 3S6FA 3R96A 5IB0A 2WUUA 4IUSA 5KTDA 4YRHA 4KLVA 4JD6A 3TO9A 1Q2DA 3B8GA 3IWEA 4MY0A 4MFZA 4YGOA 4M85A 2ATRA 1R57A 4F6AA 4KUAA 3RYOA 4CGPA 2EUIA 2Z11A 2Q0YA 4UCNA 2X7BA 4HKFA 3D2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UFW A;  4A32 A;  3H5Z A;  5AG7 A;  5G22 A;  4CYQ A;  5AG6 A;  4A30 A;  5A28 A;  5AG5 A;  4UFX A;  3JTK A;  4BBH A;  5AG4 A;  4C7H A;  2WUU A;  4C2Y A;  4C2Z A;  4CYN A;  2YND A;  5G1Z A;  4C7I A;  4C2X A;  4CGL A;  4B14 A;  3IU2 A;  2YNE A;  4UCP A;  3IWE A;  4CAE A;  4CAF A;  4A2Z A;  2YNC C;  4CGN A;  4B12 A;  4CYP A;  4CGM A;  2WSA A;  4C68 A;  4B13 A;  4A31 A;  4CGP A;  4CGO A;  4A95 A;  2YNC A;  4CYO A;  5A27 A;  4UCN A;  4UCM A;  4UFV A;  5G21 A;  4A33 A;  4B11 A;  3IU1 A;  4B10 A;  5AGE A;  5G20 A; 
#chains in the Genus database with same CATH topology
 3H5Z A;  3NH4 A;  4HPS A;  4L8A A;  3SJG A;  1X12 A;  3SJE A;  4XNH C;  2DEA A;  3FX6 A;  3IJ3 A;  1TKJ A;  3QAH A;  1XOV A;  1KUY A;  2FIA A;  4JZ0 A;  2PVW A;  4OC2 A;  1A2Z A;  4NEX A;  4R76 A;  2RC4 A;  5CNP A;  5THW A;  3TE4 A;  4R7M A;  4Q38 A;  4IF5 A;  4PQA A;  4LQG A;  3DR6 A;  2KCW A;  5HH1 A;  3S6G A;  2BUE A;  3SXN A;  3TX8 A;  4AXV A;  1OBR A;  1CG2 A;  2AFM A;  3I1U A;  3PEI A;  2PJ9 A;  1K4J A;  4OC5 A;  3FMC A;  4FD4 A;  1IID A;  1Z4E A;  5LRK A;  2D4P A;  1YK3 A;  2IQ6 A;  3BJ8 A;  3PBE A;  4CAW A;  1XMB A;  5A27 A;  5LYL A;  2F8H A;  2HQY A;  2Z3N A;  2Z3L A;  4LUA A;  2V77 A;  2IL4 A;  2XEG A;  3ISZ A;  1DE4 C;  1MK4 A;  3E0K A;  4OC0 A;  3NFZ A;  3G3S A;  2C6C A;  4KVM E;  2Z10 A;  3HUV A;  3VAT A;  5HXD A;  5AG5 A;  4QBJ A;  1V0C A;  2POK A;  4TWE A;  1AUG A;  4K30 A;  4EVY A;  8CPA A;  5DWN A;  5K8P A;  5G1Z A;  2EWB A;  1YSJ A;  2CNS A;  1TF8 A;  1S7L A;  4C7I A;  4B14 A;  1QSO A;  4Y49 B;  3H8E A;  2PQ8 A;  2FL4 A;  2AFS A;  3PB6 X;  1QSM A;  2ABZ A;  2O4H A;  4FD7 A;  4CYP A;  6CPA A;  4ZI6 A;  4CRZ B;  2WSA A;  5ISV A;  4XPL A;  4NGR A;  1B87 A;  2REF A;  4F9U A;  4B13 A;  5K8M A;  4NGS A;  3B3T A;  4CGO A;  3CXQ A;  4MFP A;  3N5F A;  5K8O A;  4DNC A;  1R43 A;  2PJ7 A;  3NE7 A;  5AGE A;  2QVP A;  3T8W A;  1LFW A;  2BSW A;  4OC4 A;  1QSR A;  4R8F A;  3MGD A;  3IIB A;  5GCN A;  1I21 A;  1VHO A;  3L2N A;  4M6I A;  4AVC A;  1FY7 A;  4C2Y A;  2Z0Z A;  5F48 A;  2JDC A;  2P6E A;  2PE3 A;  1FT7 A;  5DS0 A;  1MJB A;  3R9F A;  3IU2 A;  1ARM A;  3CXP A;  4H89 A;  4K3N A;  4A2Z A;  2PJ8 A;  3IWW A;  2J8M A;  1LOK A;  1BLL E;  3PB9 X;  2HV2 A;  4M6H A;  1ZLH A;  4OC3 A;  2I79 A;  4P4E A;  3DSB A;  4XNH B;  4UCM A;  4PSW A;  5BWA B;  2PJB A;  2Z3K A;  1CP6 A;  4JYW A;  4J3G A;  2DPT A;  1L0C A;  1VGY A;  4NSQ A;  4DJL A;  2PIZ A;  4P4F A;  1Z2L A;  3PFO A;  7CPA A;  4HNY B;  2B4D B;  1ELM P;  2ZEE A;  3FVL A;  3LWU A;  1N71 A;  2WPX A;  1VIX A;  3D8P A;  3FBU A;  1CM0 A;  1KWM A;  3LMS A;  3OWC A;  3D67 A;  1Z8L A;  4H6Z A;  4YFJ A;  1Z8W A;  5F09 A;  1Q2Y A;  1S3Z A;  1Y7E A;  2PRB A;  2VL1 A;  2ZOF A;  2ZW7 A;  2C27 A;  3C26 A;  4R57 A;  4RI1 A;  1BO4 A;  2P0W A;  2Q51 A;  3TTH A;  1R3N A;  3VH9 A;  2C6P A;  3EFA A;  1IU8 A;  2B4D A;  4OME A;  2ZXV A;  1U6M A;  2GIV A;  2ZEP A;  5EMI A;  3RNZ A;  4MMO A;  3WC5 A;  4XPD C;  4E0A A;  3UY5 A;  1Z8T A;  1YVO A;  4OAE A;  4A33 A;  2V8D A;  2F5I A;  1J4J A;  2PJ2 A;  2GAN A;  3QAY A;  5DWM A;  4B5P A;  5J1Q A;  4AVA A;  5G22 A;  4A37 A;  1ZLI A;  3V38 A;  3B3V A;  1S60 A;  2VQY A;  2PR1 A;  2YGW A;  4UA3 A;  2GU2 A;  3PP9 A;  4F0Y A;  3S9N A;  2CNM A;  1F57 A;  2PC1 A;  5EBV A;  2QYV A;  4P44 A;  2Z3P A;  4JWP A;  3EXN A;  4QVT A;  2VI7 A;  1Y7R A;  1OZP A;  5CPA A;  1NE9 A;  4H6U A;  1YLE A;  2JDD A;  2ZED A;  1NSL A;  3TC8 A;  4CRY B;  4NFR A;  4P45 A;  1F2P A;  4MCS A;  5JM6 A;  4ONU A;  2EVN A;  4OID A;  2DF5 A;  1QMU A;  3D3S A;  4P6Y A;  4R9M A;  4KOV A;  1IGB A;  4WJB A;  1P4N A;  4E8O A;  5K8N A;  2ANP A;  3WT4 A;  3PGP A;  3TOB A;  3VWD A;  2QEC A;  1KUX A;  4QUS A;  1XF8 A;  4A32 A;  2PVV A;  4Q36 A;  4PV6 A;  1I1D A;  4IK2 A;  1IOF A;  2EBJ A;  5LYD A;  4DUK A;  2GE3 A;  4OP4 A;  1GHE A;  4ZBG A;  5AG4 A;  4BBH A;  4R87 A;  4AVB A;  2J8N A;  3GYA A;  4KOU A;  4NJQ A;  4C2X A;  4KOW A;  1CJW A;  3KZW A;  3TCV A;  3JRU A;  3K9U A;  1XIX A;  4TNU A;  1CP7 A;  4YWY A;  4BD9 A;  3B3S A;  2ZOG A;  5HVH A;  2O28 A;  4A38 A;  3FRM A;  2ZEG A;  3I9S A;  3JUW A;  1M4D A;  4E2A A;  3BI1 A;  2OU2 A;  3BXM A;  3TT2 A;  4CAX A;  4MJ8 A;  3TFY A;  3GUX A;  1UFH A;  3B3W A;  4PK2 A;  3P2H A;  3PRT A;  2EK8 A;  3PB4 X;  5G21 A;  5H84 A;  1QQ9 A;  5FVJ A;  3FEC A;  1WK4 A;  3N7Z A;  3P2F A;  3EY5 A;  4M3S A;  5IX3 A;  5JQ4 A;  3W6X A;  4A30 A;  2VZY A;  3W91 A;  1AMP A;  4OLL A;  1MJ9 A;  2V8V A;  2PJ5 A;  2ZW4 A;  3FXT A;  4X5K A;  2FE7 A;  4ZYQ A;  4B6Z A;  2CF4 A;  2JLM A;  3KHZ A;  4BIN A;  5E96 A;  4PXB A;  3K9T A;  4LX9 A;  4PK3 A;  2V8G A;  4EME A;  1QST A;  1IYL A;  4XPD B;  1LAN A;  3KI9 A;  4UWJ A;  3D66 A;  3V8I A;  3WC7 A;  4F0X A;  4ZX9 A;  4FBE A;  1Z5R A;  3DGV A;  2B4B A;  2DPS A;  1MJA A;  1Z8X A;  3H8F A;  3IC1 A;  2BL1 A;  3IO1 A;  1ZG9 A;  5HVF A;  3B35 A;  3SI2 A;  3TOA A;  4B11 A;  4KS9 A;  3NH5 A;  4HNW B;  2GLF A;  4UFW A;  1XFO A;  4FWU A;  3CXS A;  3A9L A;  4P4I A;  3TO6 A;  5A28 A;  3GB0 A;  3LD2 A;  3GLJ A;  2CY2 A;  1LAM A;  2AFW A;  4UFX A;  1JWQ A;  5LYF A;  3CPX A;  4C7H A;  1VHS A;  2Y0M A;  2G3T A;  4MXU A;  1M4G A;  3GKR A;  1YW4 A;  2Q04 A;  3BI0 A;  2NMT A;  2PR8 A;  4ZX8 A;  1S5K A;  2R8V A;  2OB0 A;  4CAE A;  1M1D A;  3SXO A;  4CS0 B;  2JBK A;  3WC6 A;  1S7F A;  5LYI A;  1TIQ A;  4FD5 A;  3D7H A;  4XPK A;  2YNC A;  4KOX A;  2Q4V A;  4UEE A;  5F49 A;  4A94 A;  3IU1 A;  1HDU A;  2CIJ A;  4AG7 A;  1BPN A;  5AG7 A;  2VBQ A;  4JXR A;  1YRE A;  2J9A A;  3VAR A;  1S7N A;  5IV0 A;  1ZG8 A;  2IMO A;  4MCQ A;  3NH8 A;  3FEE A;  2HB6 A;  3JTK A;  2FS5 A;  1YVK A;  1Y9K A;  5I4M A;  4AG9 A;  3KR5 A;  1LCP A;  3CT9 A;  2IJZ A;  2CXA A;  2ZEH A;  1TF9 A;  4KOT A;  3FJU A;  3RO0 A;  2P6G A;  4MHY A;  3D4U A;  4ONW A;  4JJX A;  1XJO A;  2VXK A;  2G0B A;  1BPM A;  4B5P B;  2AJ6 A;  5I0C A;  2HUZ A;  2JEV A;  4KOY A;  1ZO0 A;  5F46 A;  4A95 A;  2R98 A;  3R1K A;  4GXH A;  2QML A;  3D7F A;  1Q2C A;  4EFD A;  1PUA A;  3F5B A;  3SI0 A;  3IGR A;  5ELY A;  5IB9 A;  2Q7S A;  3S9L A;  4MHZ A;  2P6F A;  2DXQ A;  3CZX A;  3KHX A;  2B3U A;  2NYQ A;  2PJ6 A;  4FAI A;  5C88 A;  1CPX A;  4F8Z A;  2ZW5 A;  4JLY A;  5JGF A;  4B5O A;  4OKO A;  2R7H A;  2B58 A;  2PJ4 A;  3KKW A;  1CPS A;  3DLJ A;  2YNC C;  3FB3 A;  4U5Y A;  4CGM A;  4C68 A;  3CDX A;  2Q4Z A;  1ARL A;  1NSA A;  5HMN A;  4KLW A;  3S6K A;  1DTD A;  4MHD A;  5JPH A;  3FNC A;  3SI1 A;  1Y0Y A;  2HC9 A;  4GM5 A;  4L89 A;  1B6B A;  2PIY A;  2I3C A;  1KUV A;  4P10 A;  5H86 A;  2PJ0 A;  4ZGY B;  3T90 A;  3QNV A;  3S9M A;  1WWZ A;  3LAC A;  3ZZI A;  2ZEO A;  4Z65 A;  1EE3 P;  1XBU A;  2Q7B A;  1YLO A;  3H8G A;  3NA6 A;  4OC1 A;  3KGQ A;  2K5T A;  4CYN A;  1X10 A;  4KSA A;  2OZH A;  3QB8 A;  4JXQ A;  2Q44 A;  2YND A;  2FSR A;  3SHP A;  1CX8 A;  4KUB A;  1YR0 A;  2YNE A;  3KQZ A;  1BAV A;  4CAF A;  2AFO A;  3D2P A;  2G9D A;  3CPA A;  3W6S A;  2OZU A;  4NCZ A;  1PYT B;  1PU9 A;  3D7D A;  1IB1 E;  1HDQ A;  4QC6 A;  2ZEF A;  3PBB A;  5KTC A;  1ELL P;  3IFE A;  4MFL A;  1M4I A;  3B2Y A;  1Z4R A;  3ISX A;  2BOA A;  3PFE A;  4DYO A;  1YX0 A;  4M6G A;  3RZA A;  4RUH A;  5LRG A;  2QJ8 A;  2FIW A;  2EK9 A;  2Z3M A;  4UEZ A;  1VKC A;  4KOS A;  3WAB A;  4MHN A;  5KTA A;  1YW6 A;  4R6T A;  3EC4 A;  1LRZ A;  1JQG A;  1CBX A;  2J8R A;  2VZZ A;  4WWV A;  4CPA A;  4AB7 A;  4KVX A;  3VWE A;  4ZY0 A;  1IOI A;  1SQH A;  4X2T A;  2PCU A;  4P4D A;  5D8N A;  3DR8 A;  2ZW6 A;  2ZEN A;  4G1P A;  1YME A;  3R95 A;  1TKF A;  4EWT A;  3WR7 A;  1Q7L A;  3F0A A;  4UWI A;  4PXE A;  3RAM A;  4UFV A;  4OIW A;  4MY3 A;  2FVG A;  1M4L A;  4U9Y A;  2CNT A;  4MCR A;  4NF1 A;  4NGP A;  2OOT A;  1Z9U A;  3PZJ A;  5AG6 A;  3KL9 A;  4MBU A;  1RXT A;  1VHE A;  4MRI A;  4X8I A;  2ODF A;  3PB8 X;  2XEJ A;  4R3L A;  2CTC A;  2A4N A;  1XEB A;  1HEE A;  1XE4 A;  2XEI A;  3FH4 A;  4I49 A;  4P4J A;  4UF4 A;  4YU9 A;  1GYT A;  2PDO A;  4RS2 A;  3DDD A;  4OAD A;  1P0H A;  2ARH A;  3NE8 A;  1BOB A;  2NSM A;  3KAS A;  2PRQ A;  4NJR A;  2PJA A;  2GFQ A;  3K2K A;  1RTQ A;  3KR4 A;  4BMH A;  4KSI A;  1YGH A;  3FYN A;  4PSX A;  4PXC A;  2BCO A;  2ZEL A;  2ZPA A;  2WYR A;  4CYO A;  3B7I A;  3EO4 A;  1AYE A;  1M44 A;  2CTB A;  4R3K A;  1TXR A;  3SJF A;  1IIC A;  2FCK A;  2PSW A;  4NGQ A;  4B10 A;  5G20 A;  2WPW A;  4HNX B;  1XRY A;  1XMT A;  2VEZ A;  2I00 A;  3GY9 A;  4KOR A;  3TO7 A;  3JVN A;  3PB7 X;  5F47 A;  5J8F A;  3D68 A;  4IAV A;  2Q43 A;  4FD6 A;  2B5G B;  3H4Q A;  1RO5 A;  3LOD A;  4NGT A;  4ORF A;  3R9E A;  3GIU A;  3MN8 A;  4UEF A;  2BO9 A;  2OH1 A;  5EC4 A;  3G8W A;  1YQE A;  4CGL A;  4MI4 A;  5C82 A;  4GS4 A;  4MFJ A;  4CGN A;  2PJ3 A;  3D7G A;  2RB7 A;  3KQX A;  4KSF A;  4II9 A;  3S6H A;  4KVO E;  2FT0 A;  2AFU A;  3BLN A;  3R9G A;  3DNS A;  2WZN A;  2B5G A;  3FF3 A;  2B3V A;  2Q4Y A;  1H8L A;  3FIX A;  1Y9W A;  2AE6 A;  2AFZ A;  4MFK A;  4RN7 A;  1QSN A;  1F2O A;  1ON0 A;  2C1C A;  2BEI A;  4UBR A;  5CBM A;  4MFQ A;  2GRE A;  4MHP A;  1TKH A;  4KZT A;  4U9Z A;  1I12 A;  5D29 A;  2H5M A;  1NMT A;  3I3G A;  1LAP A;  4CAV A;  4C2Z A;  5LRJ A;  3IWG A;  4IHM A;  4NGN A;  3T9Y A;  5JH9 A;  4UIB A;  1IYK A;  4PPZ A;  4O23 A;  1S7K A;  4UCP A;  2F7V A;  5HVG A;  3RBU A;  1FNO A;  4A39 A;  4B12 A;  2C6G A;  3HLP A;  2PJ1 A;  4P4B A;  3F8K A;  4Y49 C;  4FUU A;  4A31 A;  3FED A;  4H2K A;  4QB9 A;  3MRU A;  2JBJ A;  1PCA A;  2AFX A;  2OZG A;  2G3A A;  2FXF A;  2R1I A;  2JEW A;  2REE A;  4NXY A;  4F9V A;  2V8H A;  4ZY2 A;  3ZJ0 A;  4UIA A;  4CYQ A;  1Y0R A;  5J8C A;  4PXD A;  2QIR A;  1KZF A;  2D4O A;  2Z3O A;  3BJ7 A;  2OR4 A;  1UWY A;  3BHX A;  4LQ6 A;  3S6F A;  3R96 A;  5IB0 A;  1IY7 A;  2WUU A;  4IUS A;  2EO8 A;  5KTD A;  4Q7A A;  4X3R A;  4YRH A;  3B3C A;  4KLV A;  4JD6 A;  3TO9 A;  1Q2D A;  3B8G A;  2XEF A;  3IWE A;  4MY0 A;  4MFZ A;  2PJC A;  4YGO A;  4M85 A;  3SJX A;  2RFH A;  2ATR A;  1R57 A;  2O53 A;  2ZEM A;  4NGM A;  4KUA A;  3RYO A;  4F6A A;  4W9Y A;  4ZY1 A;  4CGP A;  2EUI A;  2Z11 A;  2Q0Y A;  4UCN A;  4MCP A;  2X7B A;  3IEH A;  4HKF A;  1ZG7 A;  3V7Z A;  3D2M A;  2GLJ A; 
#chains in the Genus database with same CATH homology
 3H5Z A;  4L8A A;  4XNH C;  3QAH A;  1KUY A;  2FIA A;  4NEX A;  2RC4 A;  5CNP A;  3TE4 A;  4Q38 A;  4IF5 A;  3DR6 A;  2KCW A;  5HH1 A;  3S6G A;  2BUE A;  3SXN A;  1K4J A;  4FD4 A;  1IID A;  1Z4E A;  2D4P A;  1YK3 A;  3BJ8 A;  4CAW A;  5A27 A;  2HQY A;  2Z3N A;  2Z3L A;  4LUA A;  2IL4 A;  1MK4 A;  3E0K A;  3G3S A;  4KVM E;  2Z10 A;  5AG5 A;  4QBJ A;  1V0C A;  4K30 A;  4EVY A;  5DWN A;  5G1Z A;  2CNS A;  4C7I A;  1S7L A;  4B14 A;  1QSO A;  4Y49 B;  2PQ8 A;  2FL4 A;  4FD7 A;  1QSM A;  4CYP A;  5ISV A;  4CRZ B;  2WSA A;  4XPL A;  1B87 A;  2REF A;  4B13 A;  4CGO A;  3CXQ A;  4MFP A;  4DNC A;  3NE7 A;  5AGE A;  2BSW A;  1QSR A;  3MGD A;  5GCN A;  1I21 A;  4AVC A;  1FY7 A;  4C2Y A;  2Z0Z A;  5F48 A;  2JDC A;  2P6E A;  1MJB A;  3R9F A;  3IU2 A;  3CXP A;  4H89 A;  4A2Z A;  2J8M A;  2HV2 A;  2I79 A;  3DSB A;  4XNH B;  4UCM A;  4PSW A;  5BWA B;  2Z3K A;  4J3G A;  2DPT A;  1L0C A;  4NSQ A;  4HNY B;  2B4D B;  1N71 A;  2WPX A;  3D8P A;  3FBU A;  1CM0 A;  3OWC A;  4YFJ A;  4H6Z A;  3C26 A;  1Q2Y A;  1S3Z A;  2PRB A;  2ZW7 A;  4R57 A;  4F0Y A;  2C27 A;  4RI1 A;  3TTH A;  1BO4 A;  2P0W A;  3EFA A;  2B4D A;  2ZXV A;  1U6M A;  2GIV A;  4XPD C;  4E0A A;  3UY5 A;  1YVO A;  4OAE A;  4A33 A;  2F5I A;  1J4J A;  2GAN A;  5DWM A;  4B5P A;  4AVA A;  5G22 A;  1S60 A;  2VQY A;  2PR1 A;  2YGW A;  4UA3 A;  3PP9 A;  2CNM A;  2PC1 A;  5EBV A;  2Z3P A;  4JWP A;  3EXN A;  4QVT A;  2VI7 A;  1Y7R A;  1OZP A;  1NE9 A;  4H6U A;  1YLE A;  2JDD A;  1NSL A;  4CRY B;  4ONU A;  2EVN A;  3D3S A;  4R9M A;  4KOV A;  4E8O A;  1P4N A;  3PGP A;  3TOB A;  3VWD A;  2QEC A;  1KUX A;  4QUS A;  1XF8 A;  4A32 A;  4Q36 A;  4PV6 A;  1I1D A;  2GE3 A;  1GHE A;  4ZBG A;  5AG4 A;  4BBH A;  4R87 A;  4AVB A;  2J8N A;  3GYA A;  4KOU A;  4C2X A;  4KOW A;  1CJW A;  3TCV A;  3K9U A;  1XIX A;  2O28 A;  3FRM A;  3I9S A;  3JUW A;  1M4D A;  4E2A A;  2OU2 A;  3TT2 A;  4CAX A;  4MJ8 A;  3TFY A;  1UFH A;  4PK2 A;  3P2H A;  5H84 A;  5G21 A;  5FVJ A;  1WK4 A;  3N7Z A;  3P2F A;  3EY5 A;  4M3S A;  5IX3 A;  5JQ4 A;  3W6X A;  4A30 A;  2VZY A;  3W91 A;  4OLL A;  1MJ9 A;  3FXT A;  2ZW4 A;  4X5K A;  2FE7 A;  2JLM A;  5E96 A;  4LX9 A;  4PK3 A;  1QST A;  1IYL A;  4XPD B;  4UWJ A;  3V8I A;  4F0X A;  2B4B A;  2DPS A;  1MJA A;  2BL1 A;  3TOA A;  4B11 A;  4KS9 A;  4HNW B;  4UFW A;  3CXS A;  3A9L A;  3TO6 A;  5A28 A;  3LD2 A;  2CY2 A;  4UFX A;  4C7H A;  1VHS A;  2Y0M A;  2G3T A;  1M4G A;  3GKR A;  2Q04 A;  2NMT A;  2PR8 A;  1S5K A;  2R8V A;  2OB0 A;  4CAE A;  1M1D A;  3SXO A;  4CS0 B;  1S7F A;  1TIQ A;  4FD5 A;  4XPK A;  2YNC A;  4KOX A;  2Q4V A;  5F49 A;  3IU1 A;  4AG7 A;  5AG7 A;  2VBQ A;  4JXR A;  1YRE A;  1S7N A;  5IV0 A;  3JTK A;  2FS5 A;  1YVK A;  1Y9K A;  4AG9 A;  2CXA A;  4KOT A;  2P6G A;  4JJX A;  2VXK A;  2G0B A;  4B5P B;  2AJ6 A;  5I0C A;  2HUZ A;  2JEV A;  4KOY A;  1ZO0 A;  5F46 A;  4A95 A;  2R98 A;  3R1K A;  2QML A;  1Q2C A;  1PUA A;  3F5B A;  3IGR A;  2P6F A;  2DXQ A;  2B3U A;  5C88 A;  2ZW5 A;  4JLY A;  4B5O A;  2R7H A;  2B58 A;  3KKW A;  3FB3 A;  2YNC C;  4U5Y A;  4CGM A;  4C68 A;  5HMN A;  4KLW A;  3S6K A;  4MHD A;  5JPH A;  3FNC A;  4L89 A;  1B6B A;  1KUV A;  4ZGY B;  5H86 A;  3T90 A;  1WWZ A;  3ZZI A;  2Q7B A;  2K5T A;  4CYN A;  4KSA A;  2OZH A;  3QB8 A;  4JXQ A;  2Q44 A;  2YND A;  2FSR A;  3SHP A;  4KUB A;  1YR0 A;  2YNE A;  4CAF A;  3D2P A;  3W6S A;  2OZU A;  4NCZ A;  1PU9 A;  1IB1 E;  4QC6 A;  5KTC A;  4MFL A;  1M4I A;  1Z4R A;  1YX0 A;  2FIW A;  2Z3M A;  1VKC A;  4KOS A;  5KTA A;  3EC4 A;  1LRZ A;  2VZZ A;  2J8R A;  4AB7 A;  4KVX A;  3VWE A;  1SQH A;  3DR8 A;  2ZW6 A;  3R95 A;  3WR7 A;  4UWI A;  3F0A A;  4UFV A;  4MY3 A;  4U9Y A;  2CNT A;  4NF1 A;  1Z9U A;  3PZJ A;  5AG6 A;  4MBU A;  1RXT A;  4R3L A;  2A4N A;  1XEB A;  1XE4 A;  4I49 A;  2PDO A;  4RS2 A;  3DDD A;  4OAD A;  1P0H A;  2ARH A;  1BOB A;  4BMH A;  1YGH A;  3FYN A;  4PSX A;  2ZPA A;  4CYO A;  3EO4 A;  1M44 A;  4R3K A;  4B10 A;  1IIC A;  2FCK A;  2PSW A;  5G20 A;  2WPW A;  4HNX B;  1XMT A;  2VEZ A;  2I00 A;  3GY9 A;  4KOR A;  3TO7 A;  3JVN A;  5J8F A;  5F47 A;  4FD6 A;  2B5G B;  3H4Q A;  1RO5 A;  3LOD A;  4ORF A;  3R9E A;  2OH1 A;  5EC4 A;  3G8W A;  4CGL A;  4MI4 A;  5C82 A;  4GS4 A;  4MFJ A;  4CGN A;  4KSF A;  4II9 A;  3S6H A;  4KVO E;  2FT0 A;  3BLN A;  3R9G A;  3DNS A;  2B5G A;  2B3V A;  2Q4Y A;  3FIX A;  1Y9W A;  2AE6 A;  4MFK A;  1QSN A;  1ON0 A;  2BEI A;  4UBR A;  4MFQ A;  4KZT A;  4U9Z A;  1I12 A;  2H5M A;  1NMT A;  3I3G A;  4CAV A;  4C2Z A;  3IWG A;  3T9Y A;  1IYK A;  1S7K A;  4UCP A;  4B12 A;  3F8K A;  4Y49 C;  4A31 A;  4QB9 A;  2OZG A;  2G3A A;  2FXF A;  2R1I A;  2REE A;  4NXY A;  3ZJ0 A;  4CYQ A;  5J8C A;  2QIR A;  1KZF A;  2D4O A;  2Z3O A;  3BJ7 A;  3S6F A;  3R96 A;  5IB0 A;  2WUU A;  4IUS A;  5KTD A;  4YRH A;  4KLV A;  4JD6 A;  3TO9 A;  1Q2D A;  3B8G A;  3IWE A;  4MY0 A;  4MFZ A;  4YGO A;  4M85 A;  2ATR A;  1R57 A;  4F6A A;  4KUA A;  3RYO A;  4CGP A;  2EUI A;  2Z11 A;  2Q0Y A;  4UCN A;  2X7B A;  4HKF A;  3D2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...