4EVYA

Crystal structure of aminoglycoside antibiotic 6'-n-acetyltransferase aac(6')-ig from acinetobacter haemolyticus in complex with tobramycin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
147
structure length
147
Chain Sequence
QGMNIKPASEASLKDWLELRNKLWSDSEASHLQEMHQLLAEKYALQLLAYSDHQAIAMLEASIRFEYVNGTETSPVGFLEGIYVLPAHRRSGVATMLIRQAEVWAKQFSCTEFASDAALDNVISHAMHRSLGFQETEKVVYFSKKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/antibiotic
molecule keywords Aminoglycoside N(6')-acetyltransferase type 1
publication title Structural and Biochemical Characterization of Acinetobacter spp. Aminoglycoside Acetyltransferases Highlights Functional and Evolutionary Variation among Antibiotic Resistance Enzymes.
pubmed doi rcsb
source organism Acinetobacter haemolyticus
total genus 39
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4evyA00
1YR0A 2CNSA 4FD4A 3CXPA 3FIXA 4PK3A 3D2PA 4Y49C 4KLWA 3R9GA 1Z4RA 1YVKA 3R1KA 1RXTA 3BJ8A 1S7KA 4KOXA 4JXQA 1Q2YA 4UWIA 3PP9A 4NEXA 2PR8A 4CAVA 4MI4A 4JLYA 2PR1A 3TFYA 3FNCA 4Y49B 2Z11A 2JLMA 4E0AA 2X7BA 4PK2A 4QBJA 3BJ7A 4UBRA 4ORFA 1VKCA 3TTHA 5J8FA 2OZHA 5HMNA 5HH1A 4QVTA 3IWGA 1YGHA 4B5PA 1IICA 2B5GA 2CNMA 3FYNA 3S6HA 3JVNA 2B3VA 4F0YA 2B4BA 1M4IA 2I79A 4HNXB 3P2HA 2R1IA 4KOYA 4CAWA 3F0AA 1S7LA 3TT2A 1NMTA 4RI1A 3TOBA 2G3AA 4DNCA 3TOAA 1M4GA 5F49A 2BUEA 1YK3A 1KUXA 4M85A 2CNTA 2REEA 2P0WA 3W91A 2K5TA 2R8VA 2CY2A 1YREA 3BLNA 1YX0A 1V0CA 5DWMA 3I3GA 4XPDC 4FD6A 2VEZA 3VWEA 2NMTA 5JQ4A 1Z4EA 4KVXA 4U9YA 2ZPAA 3W6SA 1SQHA 2Q4VA 4H6ZA 4CRZB 1Q2CA 1YLEA 2VZYA 1XEBA 2Q7BA 1J4JA 1XMTA 3TE4A 4AVCA 2VBQA 2PSWA 5IB0A 1S5KA 1QSMA 4XPDB 2J8RA 3EC4A 1Y7RA 3DR8A 2D4OA 3CXSA 4IUSA 2ZW4A 3DNSA 1CM0A 4AVAA 2JEVA 4XNHC 4MY3A 1KUYA 1CJWA 4HNYB 1I21A 2O28A 4BMHA 1K4JA 4KOWA 2FL4A 1IB1E 2ZW6A 4ONUA 1Z9UA 5E96A 1M44A 3D2MA 2VI7A 4AVBA 3FBUA 4XNHB 3F8KA 3TCVA 3TO9A 2Z0ZA 3FRMA 4UA3A 1B87A 4MHDA 4R87A 1U6MA 1I1DA 1XE4A 2J8NA 1R57A 1Y9WA 4NSQA 2I00A 4B5OA 3SHPA 1M1DA 1M4DA 1Y9KA 3GYAA 1I12A 4PSXA 4XPKA 1B6BA 2QIRA 2B4DB 4IF5A 3I9SA 3MGDA 1QSOA 4L89A 3RYOA 1S7NA 2PQ8A 4KUAA 4NCZA 3FB3A 2EVNA 2QMLA 2FE7A 5H84A 3R9EA 4QUSA 3H4QA 3P2FA 2ATRA 1BO4A 2AE6A 4KZTA 1GHEA 2P6EA 1BOBA 1OZPA 4FD5A 4YRHA 5EC4A 4YFJA 3CXQA 4LX9A 2REFA 5F47A 2A4NA 3C26A 4K30A 2ZW5A 4MJ8A 2OH1A 4KLVA 1ON0A 2ARHA 1FY7A 2BSWA 2GIVA 1QSTA 4QB9A 2VZZA 4ZBGA 4E2AA 2B4DA 4HNWB 3LD2A 3PGPA 3PZJA 3G8WA 1IYKA 1WWZA 2BL1A 3EO4A 3ZJ0A 3SXOA 4E8OA 2Q04A 4II9A 2HUZA 4KOVA 5J8CA 2G3TA 3S6FA 5KTAA 2PDOA 1QSRA 2JDDA 1YVOA 3GY9A 4PSWA 1KZFA 2ZW7A 3D3SA 1IIDA 1XIXA 4EVYA 3QB8A 3D8PA 3DR6A 4OAEA 3DDDA 2F5IA 4GS4A 2Z10A 4X5KA 4RS2A 2PRBA 1MK4A 2OB0A 2Y0MA 1MJAA 3QAHA 5C82A 5IX3A 3G3SA 2D4PA 2B58A 2EUIA 2QECA 1PUAA 2FIAA 5I0CA 2C27A 1VHSA 2B5GB 3UY5A 1LRZA 4KOTA 1Q2DA 4YGOA 4JWPA 4QC6A 5ISVA 4U5YA 3VWDA 4AG9A 2FT0A 4CRYB 3E0KA 4KUBA 2KCWA 1MJ9A 4KOUA 2OZGA 1N71A 3T9YA 1PU9A 3V8IA 4OLLA 5IV0A 2FCKA 4NF1A 4KVOE 4LUAA 2J8MA 1P4NA 4CS0B 3GKRA 2Q4YA 3F5BA 2BEIA 3N7ZA 4R3KA 5JPHA 1IYLA 1S60A 4JJXA 2JDCA 1TIQA 4KOSA 4FD7A 4NXYA 2FXFA 3B8GA 2R98A 4JD6A 3K9UA 3LODA 2P6FA 3TO6A 1S7FA 3JUWA 4R9MA 1P0HA 2PC1A 2FSRA 5KTCA 2Q0YA 4R3LA 3T90A 4PV6A 5F48A 1NE9A 1WK4A 2P6GA 2DXQA 3IGRA 1NSLA 4HKFA 4H89A 3W6XA 4CAXA 1S3ZA 3EFAA 2GE3A 2ZXVA 2R7HA 2IL4A 4JXRA 3R9FA 3KKWA 2Q44A 5F46A 5KTDA 2FS5A 2AJ6A 5H86A 5FVJA 2HQYA 2GANA 2OZUA 3SXNA 3TO7A 3WR7A 4I49A 2HV2A 2VQYA 3EY5A 4R57A 3FXTA 4XPLA 5CNPA 3S6KA 1UFHA 4UWJA 4AG7A 5DWNA 4L8AA 2B3UA 2RC4A 4AB7A 2WPWA 2VXKA 1RO5A 4J3GA 4M3SA 1L0CA 4MY0A 3NE7A 3S6GA 3R96A 2G0BA 5GCNA 4H6UA 3OWCA 4OADA 4MBUA 5C88A 1XF8A 1KUVA 3R95A 4F6AA 1MJBA 3DSBA 4U9ZA 5EBVA 4KVME 3EXNA 4B5PB 4KORA 2FIWA 3ZZIA 2OU2A 2H5MA 1QSNA 2WPXA
chains in the Genus database with same CATH superfamily
5LRKA 4EFDA 1YR0A 2CNSA 2C6GA 3CXPA 4FD4A 3FVLA 4P4IA 4PPZA 4DUKA 2C1CA 5AG5A 2RFHA 4C2ZA 3D67A 3FIXA 5LYFA 4Q36A 3H8FA 4PK3A 4R76A 3D2PA 4Y49C 2PRQA 4KLWA 2J9AA 4MHZA 1LOKA 3NA6A 3R9GA 1Z4RA 2Z3LA 1YVKA 1Y0YA 2QVPA 3R1KA 3NH8A 2V8HA 1RXTA 5F09A 3BJ8A 1S7KA 2ZEGA 4KOXA 1CP6A 4JXQA 1Q2YA 4NJQA 4UFXA 4UWIA 1Z8WA 4UIBA 3PP9A 4F9UA 1XJOA 1ZG8A 2AFOA 4NEXA 2PR8A 4CAVA 4MI4A 4JLYA 2PR1A 4OC4A 3FNCA 4CAFA 3TFYA 4GXHA 1TXRA 2JLMA 2Z11A 4Y49B 4E0AA 2X7BA 4PK2A 4QBJA 3BJ7A 4Q7AA 5K8MA 4UBRA 1HDUA 4ORFA 2F8HA 1VKCA 3TTHA 5J8FA 2OZHA 5HMNA 5HH1A 1BLLE 4QVTA 1YW6A 3FF3A 2PCUA 2WSAA 3D7GA 3IWGA 3PB8X 5THWA 5CBMA 1YGHA 4DJLA 4B5PA 4BINA 1BPMA 1IICA 2B5GA 2CNMA 3FYNA 3S6HA 1LCPA 3SJFA 3D7FA 3KASA 3JVNA 2ZEOA 3FEDA 2B3VA 2PE3A 4CAEA 4FUUA 4F0YA 2B4BA 3NE8A 1M4IA 4ZGYB 2I79A 3B2YA 4HNXB 4UEFA 3P2HA 2R1IA 4KOYA 5G22A 1ELMP 1EE3P 4CAWA 3F0AA 1S7LA 1Q7LA 3TT2A 1NMTA 4RI1A 5A27A 1Z8LA 3TOBA 2BOAA 2EK9A 2G3AA 4DNCA 4KSAA 3K9TA 3TOAA 5HXDA 4B10A 2JEWA 4A95A 2QJ8A 4LQ6A 1M4GA 4WJBA 2BUEA 3B3WA 4R8FA 5F49A 1YK3A 4C7HA 2DPTA 1ARLA 1KUXA 2PJBA 2OR4A 3FH4A 4M85A 4MFLA 2CNTA 4MHYA 1JQGA 2REEA 2P0WA 2ZELA 4KSFA 3H8GA 4FWUA 1IY7A 3D7DA 3W91A 2K5TA 3D66A 4B6ZA 2PJ7A 2POKA 2R8VA 2CY2A 1YREA 3BLNA 1YX0A 3ISXA 1V0CA 3FJUA 2V8DA 4A31A 4FAIA 1CBXA 5DWMA 3I3GA 3MN8A 4X8IA 4XPDC 4A39A 3RBUA 4FD6A 2VEZA 2AFXA 2NMTA 2PJ2A 4ZX8A 1Z4EA 4KVXA 3VWEA 2BCOA 5JQ4A 5LRGA 1DE4C 2EO8A 2ZPAA 2HB6A 3IC1A 1NSAA 2Z3MA 4U9YA 1SQHA 2Q4VA 3KR4A 4IAVA 4K3NA 3KGQA 3PB4X 4H6ZA 4CRZB 4OIDA 1Q2CA 1YLEA 2NYQA 3IU1A 3HLPA 4OIWA 1BAVA 2VZYA 3IO1A 1XEBA 4TNUA 2Q7BA 1J4JA 1XMTA 5K8NA 3TE4A 3BHXA 4NGSA 4AVCA 2VBQA 5JGFA 1M4LA 2GREA 2PSWA 5IB0A 3PRTA 2CF4A 4PXEA 3FEEA 1S5KA 1QSMA 4XPDB 4B13A 2J8RA 2ZENA 3EC4A 1Y7RA 3DR8A 2D4OA 5I4MA 3CXSA 1YMEA 4IUSA 2ZW4A 2PJ3A 1CM0A 3DNSA 2ANPA 4ONWA 5LRJA 4AVAA 3B3SA 3CPAA 2JEVA 3MRUA 4XNHC 4MY3A 1KUYA 1CJWA 3GIUA 3KI9A 4HNYB 1I21A 2O28A 4A37A 4BMHA 4CYOA 3T8WA 1K4JA 3CDXA 2FL4A 4KOWA 4R6TA 1FT7A 5HVHA 1IB1E 2ZW6A 4ONUA 1PYTB 1QMUA 1Z9UA 1XFOA 2Q43A 5E96A 3QNVA 4MCPA 4AXVA 4O23A 1DTDA 5A28A 4NGMA 3LACA 4EWTA 1M44A 3D2MA 2AFMA 2VI7A 2Q4ZA 4WWVA 2XEFA 4AVBA 3DGVA 3IWWA 3WABA 3FBUA 4XNHB 3F8KA 3TCVA 2GLJA 2AFSA 3TO9A 5LYDA 4C2XA 5K8OA 4NGPA 2QYVA 2Z0ZA 4C2YA 4A30A 3L2NA 2ZOFA 3B7IA 3FRMA 1Z5RA 2IQ6A 1B87A 1FNOA 4Q38A 2ZEHA 4UA3A 4MHDA 2F7VA 3PB6X 1PCAA 1U6MA 4R87A 1I1DA 1KWMA 1XRYA 4R7MA 1VHEA 3ISZA 1XE4A 2J8NA 1R57A 1Y9WA 4NSQA 4ZY2A 2I00A 4B5OA 3SHPA 2PVWA 1M1DA 1M4DA 1Y9KA 4MMOA 3GYAA 4P44A 1AUGA 4ZX9A 2DPSA 1I12A 2GFQA 2WUUA 4PSXA 4XPKA 2C6CA 4RUHA 1B6BA 2RB7A 3BI1A 2QIRA 2B4DB 5J1QA 3NH4A 3S9NA 4IF5A 3I9SA 3MGDA 1QSOA 4L89A 5CPAA 4MFZA 2V8VA 3D7HA 3RYOA 4C68A 2O4HA 1LAMA 3RO0A 3KR5A 1YSJA 5HVGA 1S7NA 2PJ5A 2PQ8A 4MCSA 3KZWA 3JTKA 4KUAA 4NCZA 2ZEPA 4IK2A 2I3CA 3FB3A 2ABZA 2EVNA 4GM5A 2QMLA 2FE7A 4A2ZA 2PJAA 1UWYA 2PJ8A 1VIXA 5H84A 4MHPA 3R9EA 4P4JA 4QUSA 4ZY1A 3KHXA 4MHNA 3H4QA 4UCNA 2IJZA 2AFZA 1XBUA 3P2FA 2ATRA 3SJXA 1BO4A 5D29A 1IOIA 1QQ9A 4EMEA 2AE6A 3I1UA 8CPAA 3LMSA 4KZTA 1GHEA 2P6EA 1ZG7A 4ZYQA 1BOBA 1OZPA 4FD5A 4YRHA 1XOVA 5EC4A 2Z3KA 3PEIA 4YFJA 2Q51A 3CT9A 1H8LA 3CXQA 2HC9A 4LX9A 2REFA 5AGEA 4OC0A 5F47A 4PQAA 4CGOA 3FX6A 2A4NA 1JWQA 4H2KA 5D8NA 3C26A 2YNCA 4OC1A 3RNZA 4BBHA 4K30A 2ZW5A 4MJ8A 3K2KA 2YGWA 2V77A 3SI2A 2OH1A 3PBEA 1ON0A 2ARHA 4KLVA 1FY7A 2BSWA 3FMCA 4P4DA 4F9VA 2GIVA 1OBRA 4YU9A 1QSTA 2JBJA 4UCMA 4PXCA 4QB9A 3TC8A 2VZZA 4ZBGA 4CGNA 4M6GA 4P45A 4E2AA 3TX8A 2B4DA 4HNWB 2PJ9A 4W9YA 3LD2A 4NFRA 3PGPA 2EWBA 3PZJA 4NGTA 4B11A 1YLOA 3G8WA 1IYKA 1WWZA 3PFOA 4P4EA 2BL1A 1TF9A 3EO4A 3WT4A 3ZJ0A 3IU2A 3SXOA 3V7ZA 4B12A 4NJRA 4E8OA 2Q04A 3KL9A 4LQGA 4II9A 3B3TA 4BD9A 3NFZA 2HUZA 4KOVA 4KSIA 5J8CA 2G3TA 3S6FA 4MCQA 2ZEMA 2PDOA 5AG6A 4OC3A 4CGPA 2BO9A 4CYQA 1QSRA 5KTAA 2Z3NA 4X2TA 2GU2A 3D4UA 3GLJA 1TKJA 2JDDA 1YVOA 3D68A 3GY9A 4PSWA 1KZFA 2ZW7A 2YNEA 3D3SA 1BPNA 1IIDA 1XIXA 4MFKA 2PJ4A 4IHMA 4EVYA 3QB8A 4MFPA 3D8PA 3B3VA 5EMIA 3DR6A 4OAEA 1IOFA 1ZG9A 2PVVA 2ZEEA 3DDDA 3WC7A 2F5IA 3GUXA 4GS4A 6CPAA 2Z10A 3VH9A 4X5KA 1R43A 4OP4A 3SJEA 3FECA 4RS2A 2PRBA 4UFVA 4CYPA 1MK4A 2OB0A 2Y0MA 1MJAA 3QAHA 2XEGA 5C82A 5G21A 4TWEA 5IX3A 2AFUA 2XEJA 3G3SA 2D4PA 2B58A 2EUIA 2QECA 3BI0A 1PUAA 2FIAA 5I0CA 5HVFA 4F0XA 5JH9A 2C27A 3VATA 1VHSA 1TKHA 1Y7EA 4NGQA 2B5GB 2PIZA 5AG4A 3UY5A 5G20A 1LRZA 1X10A 4KOTA 1Q2DA 4UFWA 4YGOA 1ELLP 1RTQA 4JWPA 4KS9A 4QC6A 1AMPA 1R3NA 5ISVA 2EK8A 5IB9A 1ZLHA 4U5YA 3QAYA 2EBJA 2AFWA 3VWDA 3W6SA 4AG9A 3PB7X 4UIAA 2FT0A 4CGLA 4CRYB 3CZXA 2PJ6A 1IU8A 2ZOGA 3SI1A 4CYNA 3E0KA 1A2ZA 2V8GA 5LYIA 4KUBA 1XMBA 2KCWA 1MJ9A 4YWYA 4NGRA 5LYLA 4RN7A 4ZI6A 1HEEA 4KOUA 2OZGA 5DS0A 1N71A 1CPXA 1Z8TA 3T9YA 4X3RA 1PU9A 3V8IA 4OLLA 2WYRA 1AYEA 5IV0A 5JM6A 1LFWA 2FCKA 4NF1A 4KVOE 3RAMA 4LUAA 2J8MA 1P4NA 4CS0B 2ODFA 3GKRA 4OMEA 2Q4YA 2ZEDA 3F5BA 2BEIA 2C6PA 3N7ZA 4R3KA 5JPHA 4NGNA 1IYLA 1S60A 3N5FA 4JJXA 4M6IA 5G1ZA 2JDCA 3S9LA 1GYTA 1F2PA 3NH5A 4MXUA 2G9DA 1CG2A 1TIQA 1VGYA 4KOSA 4FD7A 4NXYA 4C7IA 2ZEFA 3WC6A 3H5ZA 2FXFA 3B8GA 2R98A 4JD6A 3K9UA 3HUVA 4OKOA 3LODA 4A33A 3H8EA 3KHZA 1CX8A 3LWUA 2P6FA 1Z2LA 3KQXA 1CPSA 3IIBA 2CIJA 3TO6A 1S7FA 3JUWA 2NSMA 4R9MA 1P0HA 2DF5A 3RZAA 2Z3PA 2PC1A 2FSRA 2GLFA 5KTCA 2Q0YA 4G1PA 4R3LA 3T90A 4CPAA 4UEZA 4PV6A 5F48A 2VL1A 1NE9A 1WK4A 4P10A 2P6GA 1CP7A 1LAPA 2DXQA 1TF8A 3IGRA 1NSLA 4HKFA 4H89A 4M6HA 3W6XA 4CAXA 1S3ZA 2WZNA 3EFAA 2GE3A 5AG7A 2ZXVA 4UEEA 1YQEA 2R7HA 2IL4A 4JXRA 3R9FA 3GB0A 3SI0A 3KKWA 3SJGA 2Q44A 4P4BA 2XEIA 4P6YA 5F46A 1LANA 1HDQA 5KTDA 5K8PA 4Z65A 2FS5A 4CGMA 2AJ6A 2Z3OA 4MRIA 4PXDA 2PJ0A 5FVJA 2HQYA 2CTCA 3CPXA 4JYWA 5H86A 2GANA 3BXMA 3IEHA 3WC5A 2O53A 2OZUA 3SXNA 3TO7A 3WR7A 4B14A 4A94A 1TKFA 2DEAA 4I49A 2HV2A 2VQYA 3EY5A 2IMOA 3IWEA 3FXTA 4R57A 4XPLA 2CXAA 2JBKA 2YNDA 5CNPA 1F57A 3S6KA 1F2OA 4P4FA 1UFHA 4UWJA 3PB9X 4OC5A 4AG7A 5DWNA 4L8AA 2B3UA 2RC4A 1ZLIA 3JRUA 4AB7A 2WPWA 2VXKA 4OC2A 1RO5A 4J3GA 2Q7SA 4M3SA 1L0CA 4MY0A 3NE7A 3S6GA 3R96A 4HPSA 2PJ1A 4MFJA 5BWAB 4A38A 3B3CA 4UF4A 1ARMA 2G0BA 5GCNA 3PBBA 4H6UA 3B35A 3OWCA 4OADA 2PJCA 4MFQA 3IJ3A 3DLJA 3KQZA 4MBUA 1YW4A 5C88A 1XF8A 2FVGA 1KUVA 3R95A 2CTBA 3V38A 4F6AA 2OOTA 4MCRA 1MJBA 3DSBA 1X12A 4U9ZA 3S9MA 5EBVA 4DYOA 4FBEA 1VHOA 3IFEA 4KVME 4JZ0A 3VARA 3EXNA 3PFEA 4B5PB 4KORA 4ZY0A 2YNCC 2FIWA 3A9LA 2PIYA 1Z8XA 3ZZIA 1IGBA 2OU2A 4PXBA 4F8ZA 1ZO0A 2H5MA 7CPAA 1QSNA 4A32A 4UCPA 2WPXA 1Y0RA 5ELYA
chains in the Genus database with same CATH topology
1YR0A 2CNSA 4FD4A 3CXPA 5AG5A 4C2ZA 3FIXA 4Q36A 4PK3A 3D2PA 4Y49C 4KLWA 3R9GA 1Z4RA 2Z3LA 1YVKA 3R1KA 1RXTA 3BJ8A 1S7KA 4KOXA 4JXQA 1Q2YA 4UFXA 4UWIA 3PP9A 4NEXA 2PR8A 4CAVA 4MI4A 4JLYA 2PR1A 3TFYA 3FNCA 4CAFA 4Y49B 2Z11A 2JLMA 4E0AA 2X7BA 4PK2A 4QBJA 3BJ7A 4UBRA 4ORFA 1VKCA 3TTHA 5J8FA 2OZHA 5HMNA 5HH1A 4QVTA 2WSAA 3IWGA 1YGHA 4B5PA 1IICA 2B5GA 2CNMA 3FYNA 3S6HA 3JVNA 2B3VA 4CAEA 4F0YA 2B4BA 1M4IA 4ZGYB 2I79A 4HNXB 3P2HA 2R1IA 4KOYA 5G22A 4CAWA 3F0AA 1S7LA 3TT2A 1NMTA 4RI1A 5A27A 3TOBA 2G3AA 4DNCA 4KSAA 3TOAA 4B10A 4A95A 1M4GA 5F49A 2BUEA 1YK3A 4C7HA 2DPTA 1KUXA 4M85A 4MFLA 2CNTA 2REEA 2P0WA 4KSFA 3W91A 2K5TA 2R8VA 2CY2A 1YREA 3BLNA 1YX0A 1V0CA 4A31A 5DWMA 3I3GA 4XPDC 4FD6A 2VEZA 3VWEA 2NMTA 5JQ4A 1Z4EA 4KVXA 4U9YA 2ZPAA 3W6SA 2Z3MA 1SQHA 2Q4VA 4H6ZA 4CRZB 1Q2CA 1YLEA 3IU1A 2VZYA 1XEBA 2Q7BA 1J4JA 1XMTA 3TE4A 4AVCA 2VBQA 2PSWA 5IB0A 1S5KA 1QSMA 4XPDB 4B13A 2J8RA 3EC4A 1Y7RA 3DR8A 2D4OA 3CXSA 4IUSA 2ZW4A 3DNSA 1CM0A 4AVAA 2JEVA 4XNHC 4MY3A 1KUYA 1CJWA 4HNYB 1I21A 2O28A 4BMHA 4CYOA 1K4JA 4KOWA 2FL4A 1IB1E 2ZW6A 4ONUA 1Z9UA 5E96A 5A28A 1M44A 3D2MA 2VI7A 4AVBA 3FBUA 4XNHB 3F8KA 3TCVA 4C2XA 3TO9A 2Z0ZA 4C2YA 4A30A 3FRMA 4Q38A 4UA3A 1B87A 4MHDA 4R87A 1U6MA 1I1DA 1XE4A 2J8NA 1R57A 1Y9WA 4NSQA 2I00A 4B5OA 3SHPA 1M1DA 1M4DA 1Y9KA 3GYAA 2DPSA 1I12A 4PSXA 2WUUA 4XPKA 1B6BA 2QIRA 2B4DB 4IF5A 3I9SA 3MGDA 1QSOA 4L89A 3RYOA 4MFZA 4C68A 1S7NA 2PQ8A 4KUAA 3JTKA 4NCZA 3FB3A 2EVNA 2QMLA 2FE7A 4A2ZA 5H84A 3R9EA 4QUSA 3H4QA 4UCNA 3P2FA 2ATRA 1BO4A 2AE6A 4KZTA 1GHEA 2P6EA 1BOBA 1OZPA 4FD5A 4YRHA 5EC4A 2Z3KA 4YFJA 3CXQA 4LX9A 2REFA 5AGEA 5F47A 4CGOA 2A4NA 3C26A 2YNCA 4BBHA 4K30A 2ZW5A 4MJ8A 2YGWA 2OH1A 4KLVA 1ON0A 2ARHA 1FY7A 2BSWA 2GIVA 1QSTA 4UCMA 4QB9A 2VZZA 4ZBGA 4CGNA 4E2AA 2B4DA 4HNWB 3LD2A 3PGPA 3PZJA 4B11A 3G8WA 1IYKA 1WWZA 2BL1A 3EO4A 3ZJ0A 3IU2A 3SXOA 4B12A 4E8OA 2Q04A 4II9A 2HUZA 4KOVA 5J8CA 2G3TA 3S6FA 5AG6A 4CYQA 2PDOA 4CGPA 5KTAA 1QSRA 2Z3NA 2JDDA 1YVOA 3GY9A 4PSWA 1KZFA 2ZW7A 2YNEA 3D3SA 1IIDA 1XIXA 4MFKA 4EVYA 3QB8A 4MFPA 3D8PA 3DR6A 4OAEA 3DDDA 2F5IA 4GS4A 2Z10A 4X5KA 4RS2A 2PRBA 4UFVA 4CYPA 1MK4A 2OB0A 2Y0MA 1MJAA 3QAHA 5C82A 5G21A 5IX3A 3G3SA 2D4PA 2B58A 2EUIA 2QECA 1PUAA 2FIAA 5I0CA 4F0XA 2C27A 1VHSA 5AG4A 2B5GB 3UY5A 5G20A 1LRZA 4KOTA 1Q2DA 4UFWA 4YGOA 4KS9A 4JWPA 4QC6A 5ISVA 4U5YA 3VWDA 4AG9A 2FT0A 4CGLA 4CRYB 4CYNA 3E0KA 4KUBA 2KCWA 1MJ9A 4KOUA 2OZGA 1N71A 3T9YA 1PU9A 3V8IA 4OLLA 5IV0A 2FCKA 4NF1A 4KVOE 4LUAA 2J8MA 1P4NA 4CS0B 3GKRA 2Q4YA 3F5BA 2BEIA 3N7ZA 4R3KA 5JPHA 1IYLA 1S60A 4JJXA 5G1ZA 2JDCA 1TIQA 4KOSA 4FD7A 4NXYA 4C7IA 3H5ZA 2FXFA 3B8GA 2R98A 4JD6A 3K9UA 3LODA 4A33A 2P6FA 3TO6A 1S7FA 3JUWA 4R9MA 1P0HA 2Z3PA 2PC1A 2FSRA 5KTCA 2Q0YA 4R3LA 3T90A 4PV6A 5F48A 1NE9A 1WK4A 2P6GA 2DXQA 3IGRA 1NSLA 4HKFA 4H89A 3W6XA 4CAXA 1S3ZA 5AG7A 3EFAA 2GE3A 2ZXVA 2R7HA 2IL4A 4JXRA 3R9FA 3KKWA 2Q44A 5F46A 5KTDA 2FS5A 4CGMA 2AJ6A 2Z3OA 5H86A 5FVJA 2HQYA 2GANA 2OZUA 3SXNA 3TO7A 3WR7A 4B14A 4I49A 2HV2A 2VQYA 3EY5A 3IWEA 4R57A 3FXTA 4XPLA 2CXAA 5CNPA 2YNDA 3S6KA 1UFHA 4UWJA 4AG7A 5DWNA 4L8AA 2B3UA 2RC4A 4AB7A 2WPWA 2VXKA 1RO5A 4J3GA 4M3SA 1L0CA 4MY0A 3NE7A 3S6GA 3R96A 4MFJA 5BWAB 2G0BA 5GCNA 4H6UA 3OWCA 4OADA 4MFQA 4MBUA 5C88A 1XF8A 1KUVA 3R95A 4F6AA 1MJBA 3DSBA 4U9ZA 5EBVA 4KVME 3EXNA 4B5PB 4KORA 2YNCC 2FIWA 3A9LA 3ZZIA 2OU2A 1ZO0A 2H5MA 1QSNA 4A32A 4UCPA 2WPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YR0 A;  2CNS A;  4FD4 A;  3CXP A;  3FIX A;  4PK3 A;  3D2P A;  4Y49 C;  4KLW A;  3R9G A;  1Z4R A;  1YVK A;  3R1K A;  1RXT A;  3BJ8 A;  1S7K A;  4KOX A;  4JXQ A;  1Q2Y A;  4UWI A;  3PP9 A;  4NEX A;  2PR8 A;  4CAV A;  4MI4 A;  4JLY A;  2PR1 A;  3TFY A;  3FNC A;  4Y49 B;  2Z11 A;  2JLM A;  4E0A A;  2X7B A;  4PK2 A;  4QBJ A;  3BJ7 A;  4UBR A;  4ORF A;  1VKC A;  3TTH A;  5J8F A;  2OZH A;  5HMN A;  5HH1 A;  4QVT A;  3IWG A;  1YGH A;  4B5P A;  1IIC A;  2B5G A;  2CNM A;  3FYN A;  3S6H A;  3JVN A;  2B3V A;  4F0Y A;  2B4B A;  1M4I A;  2I79 A;  4HNX B;  3P2H A;  2R1I A;  4KOY A;  4CAW A;  3F0A A;  1S7L A;  3TT2 A;  1NMT A;  4RI1 A;  3TOB A;  2G3A A;  4DNC A;  3TOA A;  1M4G A;  5F49 A;  2BUE A;  1YK3 A;  1KUX A;  4M85 A;  2CNT A;  2REE A;  2P0W A;  3W91 A;  2K5T A;  2R8V A;  2CY2 A;  1YRE A;  3BLN A;  1YX0 A;  1V0C A;  5DWM A;  3I3G A;  4XPD C;  4FD6 A;  2VEZ A;  3VWE A;  2NMT A;  5JQ4 A;  1Z4E A;  4KVX A;  4U9Y A;  2ZPA A;  3W6S A;  1SQH A;  2Q4V A;  4H6Z A;  4CRZ B;  1Q2C A;  1YLE A;  2VZY A;  1XEB A;  2Q7B A;  1J4J A;  1XMT A;  3TE4 A;  4AVC A;  2VBQ A;  2PSW A;  5IB0 A;  1S5K A;  1QSM A;  4XPD B;  2J8R A;  3EC4 A;  1Y7R A;  3DR8 A;  2D4O A;  3CXS A;  4IUS A;  2ZW4 A;  3DNS A;  1CM0 A;  4AVA A;  2JEV A;  4XNH C;  4MY3 A;  1KUY A;  1CJW A;  4HNY B;  1I21 A;  2O28 A;  4BMH A;  1K4J A;  4KOW A;  2FL4 A;  1IB1 E;  2ZW6 A;  4ONU A;  1Z9U A;  5E96 A;  1M44 A;  3D2M A;  2VI7 A;  4AVB A;  3FBU A;  4XNH B;  3F8K A;  3TCV A;  3TO9 A;  2Z0Z A;  3FRM A;  4UA3 A;  1B87 A;  4MHD A;  4R87 A;  1U6M A;  1I1D A;  1XE4 A;  2J8N A;  1R57 A;  1Y9W A;  4NSQ A;  2I00 A;  4B5O A;  3SHP A;  1M1D A;  1M4D A;  1Y9K A;  3GYA A;  1I12 A;  4PSX A;  4XPK A;  1B6B A;  2QIR A;  2B4D B;  4IF5 A;  3I9S A;  3MGD A;  1QSO A;  4L89 A;  3RYO A;  1S7N A;  2PQ8 A;  4KUA A;  4NCZ A;  3FB3 A;  2EVN A;  2QML A;  2FE7 A;  5H84 A;  3R9E A;  4QUS A;  3H4Q A;  3P2F A;  2ATR A;  1BO4 A;  2AE6 A;  4KZT A;  1GHE A;  2P6E A;  1BOB A;  1OZP A;  4FD5 A;  4YRH A;  5EC4 A;  4YFJ A;  3CXQ A;  4LX9 A;  2REF A;  5F47 A;  2A4N A;  3C26 A;  4K30 A;  2ZW5 A;  4MJ8 A;  2OH1 A;  4KLV A;  1ON0 A;  2ARH A;  1FY7 A;  2BSW A;  2GIV A;  1QST A;  4QB9 A;  2VZZ A;  4ZBG A;  4E2A A;  2B4D A;  4HNW B;  3LD2 A;  3PGP A;  3PZJ A;  3G8W A;  1IYK A;  1WWZ A;  2BL1 A;  3EO4 A;  3ZJ0 A;  3SXO A;  4E8O A;  2Q04 A;  4II9 A;  2HUZ A;  4KOV A;  5J8C A;  2G3T A;  3S6F A;  5KTA A;  2PDO A;  1QSR A;  2JDD A;  1YVO A;  3GY9 A;  4PSW A;  1KZF A;  2ZW7 A;  3D3S A;  1IID A;  1XIX A;  4EVY A;  3QB8 A;  3D8P A;  3DR6 A;  4OAE A;  3DDD A;  2F5I A;  4GS4 A;  2Z10 A;  4X5K A;  4RS2 A;  2PRB A;  1MK4 A;  2OB0 A;  2Y0M A;  1MJA A;  3QAH A;  5C82 A;  5IX3 A;  3G3S A;  2D4P A;  2B58 A;  2EUI A;  2QEC A;  1PUA A;  2FIA A;  5I0C A;  2C27 A;  1VHS A;  2B5G B;  3UY5 A;  1LRZ A;  4KOT A;  1Q2D A;  4YGO A;  4JWP A;  4QC6 A;  5ISV A;  4U5Y A;  3VWD A;  4AG9 A;  2FT0 A;  4CRY B;  3E0K A;  4KUB A;  2KCW A;  1MJ9 A;  4KOU A;  2OZG A;  1N71 A;  3T9Y A;  1PU9 A;  3V8I A;  4OLL A;  5IV0 A;  2FCK A;  4NF1 A;  4KVO E;  4LUA A;  2J8M A;  1P4N A;  4CS0 B;  3GKR A;  2Q4Y A;  3F5B A;  2BEI A;  3N7Z A;  4R3K A;  5JPH A;  1IYL A;  1S60 A;  4JJX A;  2JDC A;  1TIQ A;  4KOS A;  4FD7 A;  4NXY A;  2FXF A;  3B8G A;  2R98 A;  4JD6 A;  3K9U A;  3LOD A;  2P6F A;  3TO6 A;  1S7F A;  3JUW A;  4R9M A;  1P0H A;  2PC1 A;  2FSR A;  5KTC A;  2Q0Y A;  4R3L A;  3T90 A;  4PV6 A;  5F48 A;  1NE9 A;  1WK4 A;  2P6G A;  2DXQ A;  3IGR A;  1NSL A;  4HKF A;  4H89 A;  3W6X A;  4CAX A;  1S3Z A;  3EFA A;  2GE3 A;  2ZXV A;  2R7H A;  2IL4 A;  4JXR A;  3R9F A;  3KKW A;  2Q44 A;  5F46 A;  5KTD A;  2FS5 A;  2AJ6 A;  5H86 A;  5FVJ A;  2HQY A;  2GAN A;  2OZU A;  3SXN A;  3TO7 A;  3WR7 A;  4I49 A;  2HV2 A;  2VQY A;  3EY5 A;  4R57 A;  3FXT A;  4XPL A;  5CNP A;  3S6K A;  1UFH A;  4UWJ A;  4AG7 A;  5DWN A;  4L8A A;  2B3U A;  2RC4 A;  4AB7 A;  2WPW A;  2VXK A;  1RO5 A;  4J3G A;  4M3S A;  1L0C A;  4MY0 A;  3NE7 A;  3S6G A;  3R96 A;  2G0B A;  5GCN A;  4H6U A;  3OWC A;  4OAD A;  4MBU A;  5C88 A;  1XF8 A;  1KUV A;  3R95 A;  4F6A A;  1MJB A;  3DSB A;  4U9Z A;  5EBV A;  4KVM E;  3EXN A;  4B5P B;  4KOR A;  2FIW A;  3ZZI A;  2OU2 A;  2H5M A;  1QSN A;  2WPX A; 
#chains in the Genus database with same CATH topology
 5LRK A;  4EFD A;  1YR0 A;  2CNS A;  2C6G A;  3CXP A;  4FD4 A;  3FVL A;  4P4I A;  4PPZ A;  4DUK A;  2C1C A;  5AG5 A;  2RFH A;  4C2Z A;  3D67 A;  3FIX A;  5LYF A;  4Q36 A;  3H8F A;  4PK3 A;  4R76 A;  3D2P A;  4Y49 C;  2PRQ A;  4KLW A;  2J9A A;  4MHZ A;  1LOK A;  3NA6 A;  3R9G A;  1Z4R A;  2Z3L A;  1YVK A;  1Y0Y A;  2QVP A;  3R1K A;  3NH8 A;  2V8H A;  1RXT A;  5F09 A;  3BJ8 A;  1S7K A;  2ZEG A;  4KOX A;  1CP6 A;  4JXQ A;  1Q2Y A;  4NJQ A;  4UFX A;  4UWI A;  1Z8W A;  4UIB A;  3PP9 A;  4F9U A;  1XJO A;  1ZG8 A;  2AFO A;  4NEX A;  2PR8 A;  4CAV A;  4MI4 A;  4JLY A;  2PR1 A;  4OC4 A;  3FNC A;  4CAF A;  3TFY A;  4GXH A;  1TXR A;  2JLM A;  2Z11 A;  4Y49 B;  4E0A A;  2X7B A;  4PK2 A;  4QBJ A;  3BJ7 A;  4Q7A A;  5K8M A;  4UBR A;  1HDU A;  4ORF A;  2F8H A;  1VKC A;  3TTH A;  5J8F A;  2OZH A;  5HMN A;  5HH1 A;  1BLL E;  4QVT A;  1YW6 A;  3FF3 A;  2PCU A;  2WSA A;  3D7G A;  3IWG A;  3PB8 X;  5THW A;  5CBM A;  1YGH A;  4DJL A;  4B5P A;  4BIN A;  1BPM A;  1IIC A;  2B5G A;  2CNM A;  3FYN A;  3S6H A;  1LCP A;  3SJF A;  3D7F A;  3KAS A;  3JVN A;  2ZEO A;  3FED A;  2B3V A;  2PE3 A;  4CAE A;  4FUU A;  4F0Y A;  2B4B A;  3NE8 A;  1M4I A;  4ZGY B;  2I79 A;  3B2Y A;  4HNX B;  4UEF A;  3P2H A;  2R1I A;  4KOY A;  5G22 A;  1ELM P;  1EE3 P;  4CAW A;  3F0A A;  1S7L A;  1Q7L A;  3TT2 A;  1NMT A;  4RI1 A;  5A27 A;  1Z8L A;  3TOB A;  2BOA A;  2EK9 A;  2G3A A;  4DNC A;  4KSA A;  3K9T A;  3TOA A;  5HXD A;  4B10 A;  2JEW A;  4A95 A;  2QJ8 A;  4LQ6 A;  1M4G A;  4WJB A;  2BUE A;  3B3W A;  4R8F A;  5F49 A;  1YK3 A;  4C7H A;  2DPT A;  1ARL A;  1KUX A;  2PJB A;  2OR4 A;  3FH4 A;  4M85 A;  4MFL A;  2CNT A;  4MHY A;  1JQG A;  2REE A;  2P0W A;  2ZEL A;  4KSF A;  3H8G A;  4FWU A;  1IY7 A;  3D7D A;  3W91 A;  2K5T A;  3D66 A;  4B6Z A;  2PJ7 A;  2POK A;  2R8V A;  2CY2 A;  1YRE A;  3BLN A;  1YX0 A;  3ISX A;  1V0C A;  3FJU A;  2V8D A;  4A31 A;  4FAI A;  1CBX A;  5DWM A;  3I3G A;  3MN8 A;  4X8I A;  4XPD C;  4A39 A;  3RBU A;  4FD6 A;  2VEZ A;  2AFX A;  2NMT A;  2PJ2 A;  4ZX8 A;  1Z4E A;  4KVX A;  3VWE A;  2BCO A;  5JQ4 A;  5LRG A;  1DE4 C;  2EO8 A;  2ZPA A;  2HB6 A;  3IC1 A;  1NSA A;  2Z3M A;  4U9Y A;  1SQH A;  2Q4V A;  3KR4 A;  4IAV A;  4K3N A;  3KGQ A;  3PB4 X;  4H6Z A;  4CRZ B;  4OID A;  1Q2C A;  1YLE A;  2NYQ A;  3IU1 A;  3HLP A;  4OIW A;  1BAV A;  2VZY A;  3IO1 A;  1XEB A;  4TNU A;  2Q7B A;  1J4J A;  1XMT A;  5K8N A;  3TE4 A;  3BHX A;  4NGS A;  4AVC A;  2VBQ A;  5JGF A;  1M4L A;  2GRE A;  2PSW A;  5IB0 A;  3PRT A;  2CF4 A;  4PXE A;  3FEE A;  1S5K A;  1QSM A;  4XPD B;  4B13 A;  2J8R A;  2ZEN A;  3EC4 A;  1Y7R A;  3DR8 A;  2D4O A;  5I4M A;  3CXS A;  1YME A;  4IUS A;  2ZW4 A;  2PJ3 A;  1CM0 A;  3DNS A;  2ANP A;  4ONW A;  5LRJ A;  4AVA A;  3B3S A;  3CPA A;  2JEV A;  3MRU A;  4XNH C;  4MY3 A;  1KUY A;  1CJW A;  3GIU A;  3KI9 A;  4HNY B;  1I21 A;  2O28 A;  4A37 A;  4BMH A;  4CYO A;  3T8W A;  1K4J A;  3CDX A;  2FL4 A;  4KOW A;  4R6T A;  1FT7 A;  5HVH A;  1IB1 E;  2ZW6 A;  4ONU A;  1PYT B;  1QMU A;  1Z9U A;  1XFO A;  2Q43 A;  5E96 A;  3QNV A;  4MCP A;  4AXV A;  4O23 A;  1DTD A;  5A28 A;  4NGM A;  3LAC A;  4EWT A;  1M44 A;  3D2M A;  2AFM A;  2VI7 A;  2Q4Z A;  4WWV A;  2XEF A;  4AVB A;  3DGV A;  3IWW A;  3WAB A;  3FBU A;  4XNH B;  3F8K A;  3TCV A;  2GLJ A;  2AFS A;  3TO9 A;  5LYD A;  4C2X A;  5K8O A;  4NGP A;  2QYV A;  2Z0Z A;  4C2Y A;  4A30 A;  3L2N A;  2ZOF A;  3B7I A;  3FRM A;  1Z5R A;  2IQ6 A;  1B87 A;  1FNO A;  4Q38 A;  2ZEH A;  4UA3 A;  4MHD A;  2F7V A;  3PB6 X;  1PCA A;  1U6M A;  4R87 A;  1I1D A;  1KWM A;  1XRY A;  4R7M A;  1VHE A;  3ISZ A;  1XE4 A;  2J8N A;  1R57 A;  1Y9W A;  4NSQ A;  4ZY2 A;  2I00 A;  4B5O A;  3SHP A;  2PVW A;  1M1D A;  1M4D A;  1Y9K A;  4MMO A;  3GYA A;  4P44 A;  1AUG A;  4ZX9 A;  2DPS A;  1I12 A;  2GFQ A;  2WUU A;  4PSX A;  4XPK A;  2C6C A;  4RUH A;  1B6B A;  2RB7 A;  3BI1 A;  2QIR A;  2B4D B;  5J1Q A;  3NH4 A;  3S9N A;  4IF5 A;  3I9S A;  3MGD A;  1QSO A;  4L89 A;  5CPA A;  4MFZ A;  2V8V A;  3D7H A;  3RYO A;  4C68 A;  2O4H A;  1LAM A;  3RO0 A;  3KR5 A;  1YSJ A;  5HVG A;  1S7N A;  2PJ5 A;  2PQ8 A;  4MCS A;  3KZW A;  3JTK A;  4KUA A;  4NCZ A;  2ZEP A;  4IK2 A;  2I3C A;  3FB3 A;  2ABZ A;  2EVN A;  4GM5 A;  2QML A;  2FE7 A;  4A2Z A;  2PJA A;  1UWY A;  2PJ8 A;  1VIX A;  5H84 A;  4MHP A;  3R9E A;  4P4J A;  4QUS A;  4ZY1 A;  3KHX A;  4MHN A;  3H4Q A;  4UCN A;  2IJZ A;  2AFZ A;  1XBU A;  3P2F A;  2ATR A;  3SJX A;  1BO4 A;  5D29 A;  1IOI A;  1QQ9 A;  4EME A;  2AE6 A;  3I1U A;  8CPA A;  3LMS A;  4KZT A;  1GHE A;  2P6E A;  1ZG7 A;  4ZYQ A;  1BOB A;  1OZP A;  4FD5 A;  4YRH A;  1XOV A;  5EC4 A;  2Z3K A;  3PEI A;  4YFJ A;  2Q51 A;  3CT9 A;  1H8L A;  3CXQ A;  2HC9 A;  4LX9 A;  2REF A;  5AGE A;  4OC0 A;  5F47 A;  4PQA A;  4CGO A;  3FX6 A;  2A4N A;  1JWQ A;  4H2K A;  5D8N A;  3C26 A;  2YNC A;  4OC1 A;  3RNZ A;  4BBH A;  4K30 A;  2ZW5 A;  4MJ8 A;  3K2K A;  2YGW A;  2V77 A;  3SI2 A;  2OH1 A;  3PBE A;  1ON0 A;  2ARH A;  4KLV A;  1FY7 A;  2BSW A;  3FMC A;  4P4D A;  4F9V A;  2GIV A;  1OBR A;  4YU9 A;  1QST A;  2JBJ A;  4UCM A;  4PXC A;  4QB9 A;  3TC8 A;  2VZZ A;  4ZBG A;  4CGN A;  4M6G A;  4P45 A;  4E2A A;  3TX8 A;  2B4D A;  4HNW B;  2PJ9 A;  4W9Y A;  3LD2 A;  4NFR A;  3PGP A;  2EWB A;  3PZJ A;  4NGT A;  4B11 A;  1YLO A;  3G8W A;  1IYK A;  1WWZ A;  3PFO A;  4P4E A;  2BL1 A;  1TF9 A;  3EO4 A;  3WT4 A;  3ZJ0 A;  3IU2 A;  3SXO A;  3V7Z A;  4B12 A;  4NJR A;  4E8O A;  2Q04 A;  3KL9 A;  4LQG A;  4II9 A;  3B3T A;  4BD9 A;  3NFZ A;  2HUZ A;  4KOV A;  4KSI A;  5J8C A;  2G3T A;  3S6F A;  4MCQ A;  2ZEM A;  2PDO A;  5AG6 A;  4OC3 A;  4CGP A;  2BO9 A;  4CYQ A;  1QSR A;  5KTA A;  2Z3N A;  4X2T A;  2GU2 A;  3D4U A;  3GLJ A;  1TKJ A;  2JDD A;  1YVO A;  3D68 A;  3GY9 A;  4PSW A;  1KZF A;  2ZW7 A;  2YNE A;  3D3S A;  1BPN A;  1IID A;  1XIX A;  4MFK A;  2PJ4 A;  4IHM A;  4EVY A;  3QB8 A;  4MFP A;  3D8P A;  3B3V A;  5EMI A;  3DR6 A;  4OAE A;  1IOF A;  1ZG9 A;  2PVV A;  2ZEE A;  3DDD A;  3WC7 A;  2F5I A;  3GUX A;  4GS4 A;  6CPA A;  2Z10 A;  3VH9 A;  4X5K A;  1R43 A;  4OP4 A;  3SJE A;  3FEC A;  4RS2 A;  2PRB A;  4UFV A;  4CYP A;  1MK4 A;  2OB0 A;  2Y0M A;  1MJA A;  3QAH A;  2XEG A;  5C82 A;  5G21 A;  4TWE A;  5IX3 A;  2AFU A;  2XEJ A;  3G3S A;  2D4P A;  2B58 A;  2EUI A;  2QEC A;  3BI0 A;  1PUA A;  2FIA A;  5I0C A;  5HVF A;  4F0X A;  5JH9 A;  2C27 A;  3VAT A;  1VHS A;  1TKH A;  1Y7E A;  4NGQ A;  2B5G B;  2PIZ A;  5AG4 A;  3UY5 A;  5G20 A;  1LRZ A;  1X10 A;  4KOT A;  1Q2D A;  4UFW A;  4YGO A;  1ELL P;  1RTQ A;  4JWP A;  4KS9 A;  4QC6 A;  1AMP A;  1R3N A;  5ISV A;  2EK8 A;  5IB9 A;  1ZLH A;  4U5Y A;  3QAY A;  2EBJ A;  2AFW A;  3VWD A;  3W6S A;  4AG9 A;  3PB7 X;  4UIA A;  2FT0 A;  4CGL A;  4CRY B;  3CZX A;  2PJ6 A;  1IU8 A;  2ZOG A;  3SI1 A;  4CYN A;  3E0K A;  1A2Z A;  2V8G A;  5LYI A;  4KUB A;  1XMB A;  2KCW A;  1MJ9 A;  4YWY A;  4NGR A;  5LYL A;  4RN7 A;  4ZI6 A;  1HEE A;  4KOU A;  2OZG A;  5DS0 A;  1N71 A;  1CPX A;  1Z8T A;  3T9Y A;  4X3R A;  1PU9 A;  3V8I A;  4OLL A;  2WYR A;  1AYE A;  5IV0 A;  5JM6 A;  1LFW A;  2FCK A;  4NF1 A;  4KVO E;  3RAM A;  4LUA A;  2J8M A;  1P4N A;  4CS0 B;  2ODF A;  3GKR A;  4OME A;  2Q4Y A;  2ZED A;  3F5B A;  2BEI A;  2C6P A;  3N7Z A;  4R3K A;  5JPH A;  4NGN A;  1IYL A;  1S60 A;  3N5F A;  4JJX A;  4M6I A;  5G1Z A;  2JDC A;  3S9L A;  1GYT A;  1F2P A;  3NH5 A;  4MXU A;  2G9D A;  1CG2 A;  1TIQ A;  1VGY A;  4KOS A;  4FD7 A;  4NXY A;  4C7I A;  2ZEF A;  3WC6 A;  3H5Z A;  2FXF A;  3B8G A;  2R98 A;  4JD6 A;  3K9U A;  3HUV A;  4OKO A;  3LOD A;  4A33 A;  3H8E A;  3KHZ A;  1CX8 A;  3LWU A;  2P6F A;  1Z2L A;  3KQX A;  1CPS A;  3IIB A;  2CIJ A;  3TO6 A;  1S7F A;  3JUW A;  2NSM A;  4R9M A;  1P0H A;  2DF5 A;  3RZA A;  2Z3P A;  2PC1 A;  2FSR A;  2GLF A;  5KTC A;  2Q0Y A;  4G1P A;  4R3L A;  3T90 A;  4CPA A;  4UEZ A;  4PV6 A;  5F48 A;  2VL1 A;  1NE9 A;  1WK4 A;  4P10 A;  2P6G A;  1CP7 A;  1LAP A;  2DXQ A;  1TF8 A;  3IGR A;  1NSL A;  4HKF A;  4H89 A;  4M6H A;  3W6X A;  4CAX A;  1S3Z A;  2WZN A;  3EFA A;  2GE3 A;  5AG7 A;  2ZXV A;  4UEE A;  1YQE A;  2R7H A;  2IL4 A;  4JXR A;  3R9F A;  3GB0 A;  3SI0 A;  3KKW A;  3SJG A;  2Q44 A;  4P4B A;  2XEI A;  4P6Y A;  5F46 A;  1LAN A;  1HDQ A;  5KTD A;  5K8P A;  4Z65 A;  2FS5 A;  4CGM A;  2AJ6 A;  2Z3O A;  4MRI A;  4PXD A;  2PJ0 A;  5FVJ A;  2HQY A;  2CTC A;  3CPX A;  4JYW A;  5H86 A;  2GAN A;  3BXM A;  3IEH A;  3WC5 A;  2O53 A;  2OZU A;  3SXN A;  3TO7 A;  3WR7 A;  4B14 A;  4A94 A;  1TKF A;  2DEA A;  4I49 A;  2HV2 A;  2VQY A;  3EY5 A;  2IMO A;  3IWE A;  3FXT A;  4R57 A;  4XPL A;  2CXA A;  2JBK A;  2YND A;  5CNP A;  1F57 A;  3S6K A;  1F2O A;  4P4F A;  1UFH A;  4UWJ A;  3PB9 X;  4OC5 A;  4AG7 A;  5DWN A;  4L8A A;  2B3U A;  2RC4 A;  1ZLI A;  3JRU A;  4AB7 A;  2WPW A;  2VXK A;  4OC2 A;  1RO5 A;  4J3G A;  2Q7S A;  4M3S A;  1L0C A;  4MY0 A;  3NE7 A;  3S6G A;  3R96 A;  4HPS A;  2PJ1 A;  4MFJ A;  5BWA B;  4A38 A;  3B3C A;  4UF4 A;  1ARM A;  2G0B A;  5GCN A;  3PBB A;  4H6U A;  3B35 A;  3OWC A;  4OAD A;  2PJC A;  4MFQ A;  3IJ3 A;  3DLJ A;  3KQZ A;  4MBU A;  1YW4 A;  5C88 A;  1XF8 A;  2FVG A;  1KUV A;  3R95 A;  2CTB A;  3V38 A;  4F6A A;  2OOT A;  4MCR A;  1MJB A;  3DSB A;  1X12 A;  4U9Z A;  3S9M A;  5EBV A;  4DYO A;  4FBE A;  1VHO A;  3IFE A;  4KVM E;  4JZ0 A;  3VAR A;  3EXN A;  3PFE A;  4B5P B;  4KOR A;  4ZY0 A;  2YNC C;  2FIW A;  3A9L A;  2PIY A;  1Z8X A;  3ZZI A;  1IGB A;  2OU2 A;  4PXB A;  4F8Z A;  1ZO0 A;  2H5M A;  7CPA A;  1QSN A;  4A32 A;  4UCP A;  2WPX A;  1Y0R A;  5ELY A; 
#chains in the Genus database with same CATH homology
 1YR0 A;  2CNS A;  4FD4 A;  3CXP A;  5AG5 A;  4C2Z A;  3FIX A;  4Q36 A;  4PK3 A;  3D2P A;  4Y49 C;  4KLW A;  3R9G A;  1Z4R A;  2Z3L A;  1YVK A;  3R1K A;  1RXT A;  3BJ8 A;  1S7K A;  4KOX A;  4JXQ A;  1Q2Y A;  4UFX A;  4UWI A;  3PP9 A;  4NEX A;  2PR8 A;  4CAV A;  4MI4 A;  4JLY A;  2PR1 A;  3TFY A;  3FNC A;  4CAF A;  4Y49 B;  2Z11 A;  2JLM A;  4E0A A;  2X7B A;  4PK2 A;  4QBJ A;  3BJ7 A;  4UBR A;  4ORF A;  1VKC A;  3TTH A;  5J8F A;  2OZH A;  5HMN A;  5HH1 A;  4QVT A;  2WSA A;  3IWG A;  1YGH A;  4B5P A;  1IIC A;  2B5G A;  2CNM A;  3FYN A;  3S6H A;  3JVN A;  2B3V A;  4CAE A;  4F0Y A;  2B4B A;  1M4I A;  4ZGY B;  2I79 A;  4HNX B;  3P2H A;  2R1I A;  4KOY A;  5G22 A;  4CAW A;  3F0A A;  1S7L A;  3TT2 A;  1NMT A;  4RI1 A;  5A27 A;  3TOB A;  2G3A A;  4DNC A;  4KSA A;  3TOA A;  4B10 A;  4A95 A;  1M4G A;  5F49 A;  2BUE A;  1YK3 A;  4C7H A;  2DPT A;  1KUX A;  4M85 A;  4MFL A;  2CNT A;  2REE A;  2P0W A;  4KSF A;  3W91 A;  2K5T A;  2R8V A;  2CY2 A;  1YRE A;  3BLN A;  1YX0 A;  1V0C A;  4A31 A;  5DWM A;  3I3G A;  4XPD C;  4FD6 A;  2VEZ A;  3VWE A;  2NMT A;  5JQ4 A;  1Z4E A;  4KVX A;  4U9Y A;  2ZPA A;  3W6S A;  2Z3M A;  1SQH A;  2Q4V A;  4H6Z A;  4CRZ B;  1Q2C A;  1YLE A;  3IU1 A;  2VZY A;  1XEB A;  2Q7B A;  1J4J A;  1XMT A;  3TE4 A;  4AVC A;  2VBQ A;  2PSW A;  5IB0 A;  1S5K A;  1QSM A;  4XPD B;  4B13 A;  2J8R A;  3EC4 A;  1Y7R A;  3DR8 A;  2D4O A;  3CXS A;  4IUS A;  2ZW4 A;  3DNS A;  1CM0 A;  4AVA A;  2JEV A;  4XNH C;  4MY3 A;  1KUY A;  1CJW A;  4HNY B;  1I21 A;  2O28 A;  4BMH A;  4CYO A;  1K4J A;  4KOW A;  2FL4 A;  1IB1 E;  2ZW6 A;  4ONU A;  1Z9U A;  5E96 A;  5A28 A;  1M44 A;  3D2M A;  2VI7 A;  4AVB A;  3FBU A;  4XNH B;  3F8K A;  3TCV A;  4C2X A;  3TO9 A;  2Z0Z A;  4C2Y A;  4A30 A;  3FRM A;  4Q38 A;  4UA3 A;  1B87 A;  4MHD A;  4R87 A;  1U6M A;  1I1D A;  1XE4 A;  2J8N A;  1R57 A;  1Y9W A;  4NSQ A;  2I00 A;  4B5O A;  3SHP A;  1M1D A;  1M4D A;  1Y9K A;  3GYA A;  2DPS A;  1I12 A;  4PSX A;  2WUU A;  4XPK A;  1B6B A;  2QIR A;  2B4D B;  4IF5 A;  3I9S A;  3MGD A;  1QSO A;  4L89 A;  3RYO A;  4MFZ A;  4C68 A;  1S7N A;  2PQ8 A;  4KUA A;  3JTK A;  4NCZ A;  3FB3 A;  2EVN A;  2QML A;  2FE7 A;  4A2Z A;  5H84 A;  3R9E A;  4QUS A;  3H4Q A;  4UCN A;  3P2F A;  2ATR A;  1BO4 A;  2AE6 A;  4KZT A;  1GHE A;  2P6E A;  1BOB A;  1OZP A;  4FD5 A;  4YRH A;  5EC4 A;  2Z3K A;  4YFJ A;  3CXQ A;  4LX9 A;  2REF A;  5AGE A;  5F47 A;  4CGO A;  2A4N A;  3C26 A;  2YNC A;  4BBH A;  4K30 A;  2ZW5 A;  4MJ8 A;  2YGW A;  2OH1 A;  4KLV A;  1ON0 A;  2ARH A;  1FY7 A;  2BSW A;  2GIV A;  1QST A;  4UCM A;  4QB9 A;  2VZZ A;  4ZBG A;  4CGN A;  4E2A A;  2B4D A;  4HNW B;  3LD2 A;  3PGP A;  3PZJ A;  4B11 A;  3G8W A;  1IYK A;  1WWZ A;  2BL1 A;  3EO4 A;  3ZJ0 A;  3IU2 A;  3SXO A;  4B12 A;  4E8O A;  2Q04 A;  4II9 A;  2HUZ A;  4KOV A;  5J8C A;  2G3T A;  3S6F A;  5AG6 A;  4CYQ A;  2PDO A;  4CGP A;  5KTA A;  1QSR A;  2Z3N A;  2JDD A;  1YVO A;  3GY9 A;  4PSW A;  1KZF A;  2ZW7 A;  2YNE A;  3D3S A;  1IID A;  1XIX A;  4MFK A;  4EVY A;  3QB8 A;  4MFP A;  3D8P A;  3DR6 A;  4OAE A;  3DDD A;  2F5I A;  4GS4 A;  2Z10 A;  4X5K A;  4RS2 A;  2PRB A;  4UFV A;  4CYP A;  1MK4 A;  2OB0 A;  2Y0M A;  1MJA A;  3QAH A;  5C82 A;  5G21 A;  5IX3 A;  3G3S A;  2D4P A;  2B58 A;  2EUI A;  2QEC A;  1PUA A;  2FIA A;  5I0C A;  4F0X A;  2C27 A;  1VHS A;  5AG4 A;  2B5G B;  3UY5 A;  5G20 A;  1LRZ A;  4KOT A;  1Q2D A;  4UFW A;  4YGO A;  4KS9 A;  4JWP A;  4QC6 A;  5ISV A;  4U5Y A;  3VWD A;  4AG9 A;  2FT0 A;  4CGL A;  4CRY B;  4CYN A;  3E0K A;  4KUB A;  2KCW A;  1MJ9 A;  4KOU A;  2OZG A;  1N71 A;  3T9Y A;  1PU9 A;  3V8I A;  4OLL A;  5IV0 A;  2FCK A;  4NF1 A;  4KVO E;  4LUA A;  2J8M A;  1P4N A;  4CS0 B;  3GKR A;  2Q4Y A;  3F5B A;  2BEI A;  3N7Z A;  4R3K A;  5JPH A;  1IYL A;  1S60 A;  4JJX A;  5G1Z A;  2JDC A;  1TIQ A;  4KOS A;  4FD7 A;  4NXY A;  4C7I A;  3H5Z A;  2FXF A;  3B8G A;  2R98 A;  4JD6 A;  3K9U A;  3LOD A;  4A33 A;  2P6F A;  3TO6 A;  1S7F A;  3JUW A;  4R9M A;  1P0H A;  2Z3P A;  2PC1 A;  2FSR A;  5KTC A;  2Q0Y A;  4R3L A;  3T90 A;  4PV6 A;  5F48 A;  1NE9 A;  1WK4 A;  2P6G A;  2DXQ A;  3IGR A;  1NSL A;  4HKF A;  4H89 A;  3W6X A;  4CAX A;  1S3Z A;  5AG7 A;  3EFA A;  2GE3 A;  2ZXV A;  2R7H A;  2IL4 A;  4JXR A;  3R9F A;  3KKW A;  2Q44 A;  5F46 A;  5KTD A;  2FS5 A;  4CGM A;  2AJ6 A;  2Z3O A;  5H86 A;  5FVJ A;  2HQY A;  2GAN A;  2OZU A;  3SXN A;  3TO7 A;  3WR7 A;  4B14 A;  4I49 A;  2HV2 A;  2VQY A;  3EY5 A;  3IWE A;  4R57 A;  3FXT A;  4XPL A;  2CXA A;  5CNP A;  2YND A;  3S6K A;  1UFH A;  4UWJ A;  4AG7 A;  5DWN A;  4L8A A;  2B3U A;  2RC4 A;  4AB7 A;  2WPW A;  2VXK A;  1RO5 A;  4J3G A;  4M3S A;  1L0C A;  4MY0 A;  3NE7 A;  3S6G A;  3R96 A;  4MFJ A;  5BWA B;  2G0B A;  5GCN A;  4H6U A;  3OWC A;  4OAD A;  4MFQ A;  4MBU A;  5C88 A;  1XF8 A;  1KUV A;  3R95 A;  4F6A A;  1MJB A;  3DSB A;  4U9Z A;  5EBV A;  4KVM E;  3EXN A;  4B5P B;  4KOR A;  2YNC C;  2FIW A;  3A9L A;  3ZZI A;  2OU2 A;  1ZO0 A;  2H5M A;  1QSN A;  4A32 A;  4UCP A;  2WPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...