4EVYA

Crystal structure of aminoglycoside antibiotic 6'-n-acetyltransferase aac(6')-ig from acinetobacter haemolyticus in complex with tobramycin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
147
structure length
147
Chain Sequence
QGMNIKPASEASLKDWLELRNKLWSDSEASHLQEMHQLLAEKYALQLLAYSDHQAIAMLEASIRFEYVNGTETSPVGFLEGIYVLPAHRRSGVATMLIRQAEVWAKQFSCTEFASDAALDNVISHAMHRSLGFQETEKVVYFSKKID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside N(6')-acetyltransferase type 1
publication title Structural and Biochemical Characterization of Acinetobacter spp. Aminoglycoside Acetyltransferases Highlights Functional and Evolutionary Variation among Antibiotic Resistance Enzymes.
pubmed doi rcsb
source organism Acinetobacter haemolyticus
molecule tags Transferase/antibiotic
total genus 39
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature ec 2.3.1.82: Aminoglycoside 6'-N-acetyltransferase.
pdb deposition date 2012-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4evyA00
4HNXB 4ORFA 5J8CA 3I3GA 1IYKA 1M4GA 4KOVA 2J8RA 3IGRA 4CRYB 2VXKA 2REFA 3EO4A 1Y9KA 4AB7A 2Z10A 4KOXA 2BUEA 5F49A 1S7FA 5KTCA 4F0YA 4B5PB 3TCVA 2JEVA 4R3LA 3R9FA 3R96A 3P2HA 4JXRA 5KTAA 4AG9A 3R9GA 1I1DA 4CS0B 1NSLA 1MJAA 3MGDA 1N71A 1NMTA 1CJWA 2CNSA 3H4QA 4KVXA 3SXOA 1OZPA 1U6MA 5J8FA 4MHDA 2B5GB 4UWIA 4PSXA 4BMHA 2G3AA 3I9SA 3N7ZA 1S7NA 1S7LA 2ZPAA 2D4OA 4KUAA 5E96A 1L0CA 2J8NA 5C88A 1XIXA 2I79A 3CXPA 4QB9A 3V8IA 3P2FA 4R9MA 4B5PA 4R87A 1MJBA 3W6SA 4LUAA 4PSWA 5H84A 4KOYA 5H86A 3CXSA 5IX3A 5I0CA 1Q2DA 2OZHA 2C27A 4NSQA 3G3SA 1Q2CA 2G3TA 2WPWA 3FYNA 1PU9A 2RC4A 1YK3A 3DR6A 4KLVA 2JDDA 4CAXA 3WR7A 4B5OA 3QB8A 3TFYA 4U5YA 1TIQA 3R95A 2QIRA 4QVTA 4AVCA 2QMLA 3F5BA 3E0KA 3FRMA 1QSTA 4R57A 3W91A 1R57A 1IYLA 4LX9A 1BOBA 1VHSA 2Q04A 2QECA 2OU2A 1FY7A 3TO9A 1YVOA 5F46A 4U9ZA 3T9YA 1MJ9A 4JD6A 2VQYA 4KZTA 3D2PA 1XF8A 3FNCA 2CNMA 4MI4A 4JXQA 2GE3A 4UA3A 2ZW6A 2P0WA 2P6FA 2I00A 5EBVA 5JQ4A 3LODA 3IWGA 1KUVA 2CNTA 4FD4A 2HV2A 2FL4A 2B4DB 3GYAA 2FSRA 5ISVA 1M4IA 2Q0YA 5CNPA 3QAHA 4FD5A 4Y49B 1ON0A 4E0AA 5C82A 2Q4VA 3ZJ0A 1UFHA 4UBRA 3S6HA 1LRZA 3BLNA 1YLEA 3TOBA 3TT2A 2Y0MA 4JJXA 2JLMA 2PRBA 3CXQA 4KVME 3W6XA 3FXTA 3PZJA 1KUYA 1KUXA 4FD6A 3S6KA 1P0HA 1M4DA 1WWZA 1B6BA 2PR8A 1QSMA 2A4NA 2JDCA 4KVOE 3SHPA 2VZZA 2B4DA 2R7HA 4HNWB 1XE4A 5DWMA 4JLYA 4MBUA 4ZBGA 4H6UA 2K5TA 2WPXA 4AVAA 1P4NA 3VWDA 2PR1A 3B8GA 3EXNA 2NMTA 3S6GA 4KOWA 2FIWA 3GKRA 3KKWA 2HQYA 4CAVA 3D2MA 4OADA 4I49A 5HMNA 2B5GA 3F8KA 4H89A 3D3SA 2ATRA 3ZZIA 4XPKA 1S5KA 2D4PA 1S7KA 1V0CA 4KOSA 1K4JA 1YREA 2ZW5A 5DWNA 2AE6A 2VZYA 3TO6A 5F48A 4R3KA 4Y49C 1PUAA 2ARHA 4KOTA 2FE7A 4KORA 4YGOA 4XPDC 3VWEA 2OB0A 3T90A 3EFAA 3EC4A 2Q44A 1CM0A 4MY3A 2FCKA 4QUSA 3F0AA 1SQHA 2PDOA 4JWPA 1B87A 3GY9A 2VEZA 5FVJA 3OWCA 4CAWA 2PQ8A 4XPLA 2VI7A 4X5KA 5F47A 3TTHA 4NEXA 3TE4A 2HUZA 4KOUA 1Q2YA 1RO5A 5HH1A 4MJ8A 3SXNA 1GHEA 2B3UA 3DSBA 1Y9WA 1YX0A 1Y7RA 3PGPA 1IICA 1Z4RA 3FBUA 2P6GA 4MY0A 1Z9UA 4NXYA 5KTDA 3TO7A 1QSNA 2BEIA 4XPDB 3JVNA 1S60A 2PC1A 2FXFA 2J8MA 3DNSA 4RS2A 3D8PA 2Z0ZA 4RI1A 2Q7BA 4II9A 3UY5A 1S3ZA 3EY5A 3TOAA 3DR8A 1KZFA 1QSOA 1VKCA 4NF1A 4E8OA 4AG7A 3JUWA 1Z4EA 4KLWA 1YVKA 2O28A 4AVBA 2ZXVA 3K9UA 2AJ6A 4XNHC 4M85A 2Q4YA 4F6AA 1YR0A 2R1IA 2EUIA 4YFJA 1IIDA 4J3GA 1QSRA 2EVNA 4IUSA 3R1KA 1NE9A 1BO4A 4E2AA 2KCWA 2ZW7A 1I21A 2BL1A 1I12A 3FB3A 2REEA 5EC4A 1M44A 2OZGA 5GCNA 1WK4A 4PK2A 5JPHA 2B58A 4KUBA 4L8AA 3BJ7A 1J4JA 4OLLA 2X7BA 2OZUA 4HKFA 2R98A 3R9EA 3NE7A 3S6FA 2FIAA 4FD7A 4QC6A 2B4BA 2CY2A 4L89A 4UWJA 3LD2A 2VBQA 1RXTA 2B3VA 4GS4A 4QBJA 1XEBA 2FT0A 2R8VA 4XNHB 4M3SA 2OH1A 4U9YA 4CRZB 4OAEA 4EVYA 2IL4A 4PV6A 2P6EA 3RYOA 2GANA 4K30A 3BJ8A 3C26A 3FIXA 5IB0A 4NCZA 3DDDA 1IB1E 3G8WA 2DXQA 2FS5A 4IF5A 1XMTA 1M1DA 1MK4A 4YRHA 2BSWA 2PSWA 4HNYB 4DNCA 2H5MA 2GIVA 2Z11A 4H6ZA 1YGHA 4PK3A 2F5IA 3PP9A 5IV0A 2ZW4A 2G0BA 4ONUA
chains in the Genus database with same CATH superfamily
4HNXB 4ORFA 2Z3KA 5J8CA 3I3GA 3B3TA 3VARA 1IYKA 1M4GA 3VATA 4KOVA 1OBRA 1ARLA 2J8RA 3IGRA 4MRIA 4CRYB 2OOTA 2VXKA 2REFA 2ZOFA 2Z3OA 2BOAA 3EO4A 1Y9KA 3FEEA 4CYOA 4AB7A 2Z10A 5AGEA 3CDXA 4KOXA 3KHZA 2BUEA 2EBJA 1LANA 2PJ5A 3KI9A 1S7FA 2ZEHA 3QNVA 5F49A 5AG4A 4A95A 4F0YA 2DF5A 2ZEPA 3KR4A 4B5PB 4BBHA 4FBEA 5KTCA 3SI1A 5LYLA 4DUKA 3TCVA 1LAMA 4A94A 2JEVA 1CPSA 1IGBA 4R3LA 3R9FA 3P2HA 4FWUA 3R96A 4JXRA 4RUHA 2YNDA 2XEGA 3PB4X 4R7MA 5D8NA 4B6ZA 4F0XA 5KTAA 3NA6A 4AG9A 3FX6A 3R9GA 5JM6A 1R43A 2C6PA 1I1DA 4CS0B 3IWWA 1NSLA 4C7IA 4TWEA 1MJAA 3MGDA 1N71A 1NMTA 3TC8A 3ISXA 1CJWA 4OKOA 2Q4ZA 2CNSA 4R6TA 1CPXA 3H4QA 4KVXA 3HUVA 3SXOA 5D29A 1OZPA 2AFOA 1U6MA 5J8FA 2EK8A 4MHDA 2DEAA 1CX8A 4P10A 2B5GB 4UWIA 4PSXA 4BMHA 2V8VA 1VHEA 2G3AA 4IK2A 3I9SA 3N7ZA 1S7NA 6CPAA 3V38A 1S7LA 2ZPAA 2D4OA 4KUAA 4CAFA 5E96A 1L0CA 2J8NA 5C88A 1XIXA 2I79A 3CXPA 5EMIA 4QB9A 1NSAA 3V8IA 4BD9A 3P2FA 4MHNA 4R9MA 1DTDA 4NJQA 1R3NA 4B5PA 4A37A 4NGMA 2PVWA 4MHYA 4WJBA 4R87A 3TX8A 2F8HA 1MJBA 2BO9A 1X10A 3W6SA 4B14A 4LUAA 4MXUA 3RO0A 4MMOA 4PSWA 3N5FA 5H84A 2NYQA 2RFHA 3NE8A 4A30A 4KOYA 5H86A 1A2ZA 3CXSA 4NGRA 2HB6A 3H5ZA 5IX3A 3K2KA 3H8GA 5I0CA 4UEEA 1Q2DA 5LRJA 4A39A 3CT9A 2OZHA 3CZXA 2C27A 5CPAA 4NSQA 3RZAA 2PJCA 3G3SA 4PXEA 4CYPA 7CPAA 5G20A 4MCRA 4DJLA 1Q2CA 2C6GA 1FT7A 1CG2A 2C1CA 2G3TA 2ZEEA 4OP4A 2ZEGA 2WPWA 3FYNA 1PU9A 2RC4A 2VL1A 1YK3A 3SJEA 2AFUA 3DR6A 1LOKA 2JDDA 3D7GA 3D7DA 2C6CA 4KLVA 4LQ6A 3B7IA 4CAXA 3WR7A 4B5OA 3IC1A 1XJOA 3QB8A 1F2OA 3TFYA 5LRGA 5A28A 4U5YA 1TIQA 3S9MA 3R95A 2QIRA 2WSAA 4OMEA 4QVTA 4AVCA 2XEFA 2PJ2A 2Z3LA 2QMLA 3F5BA 3E0KA 3FRMA 1QSTA 3PB7X 3B3CA 4R57A 3W91A 3BI1A 1RTQA 1R57A 4MFLA 4OC0A 3PEIA 1IYLA 2PJ4A 4LX9A 2DPSA 1BOBA 1VHSA 2CIJA 2Q04A 2QECA 4X3RA 2QYVA 2OU2A 1FY7A 4MFPA 5IB9A 3TO9A 1Z5RA 1YVOA 1FNOA 4U9ZA 5F46A 3T9YA 2POKA 1MJ9A 1DE4C 5CBMA 4UFWA 4MFQA 4JD6A 2NSMA 2VQYA 4KZTA 3D2PA 4NGPA 1XF8A 3FNCA 3IEHA 4B13A 4ZX8A 2EO8A 2CNMA 3D67A 4MI4A 4JXQA 4P6YA 3BXMA 2GE3A 4B12A 5LYFA 5G21A 3FVLA 4UA3A 2ZW6A 2P0WA 1TF9A 2P6FA 2I00A 3FEDA 4YWYA 5EBVA 3RNZA 4OC5A 3LODA 5JQ4A 3SJXA 3IWGA 2Z3MA 5LYDA 2QVPA 1KUVA 2CNTA 4FD4A 2HV2A 2FL4A 2B4DB 4OC3A 4F9UA 3WC6A 4O23A 3GYAA 2FSRA 5ISVA 1M4IA 2Q0YA 5CNPA 5K8NA 3QAHA 4P4EA 4FD5A 3JTKA 1GYTA 4Y49B 3WC7A 3KQZA 1ON0A 4E0AA 5C82A 4P4DA 2PJ9A 2Q4VA 3ZJ0A 1UFHA 4UBRA 3S6HA 1LRZA 3BLNA 4UEFA 1YLEA 3GUXA 3LACA 2RB7A 2GFQA 3KHXA 3TOBA 3TT2A 1UWYA 2Y0MA 4TNUA 4A33A 1Z8TA 3NH5A 4EMEA 4JJXA 4JYWA 2JLMA 4CGPA 4MCQA 4MFKA 2PRBA 1PYTB 1TF8A 4FAIA 2V77A 4PPZA 3SJGA 3CXQA 4PXCA 4KVME 4RN7A 1TKJA 4P4JA 1H8LA 3SI0A 3W6XA 2PE3A 4ZI6A 3FXTA 3BHXA 3PZJA 1KUYA 5K8MA 1KUXA 4FD6A 3S6KA 5F09A 1P0HA 1M4DA 1WWZA 1B6BA 2PR8A 3WABA 4CYNA 2PJBA 4BINA 3B2YA 4KSAA 2PJ0A 1QSMA 2A4NA 2JDCA 3H8FA 3WT4A 3D4UA 4KVOE 3SHPA 4ONWA 2VZZA 5AG5A 3BI0A 2B4DA 4C2ZA 2R7HA 4HNWB 1XE4A 4NGQA 3KR5A 3LWUA 2O4HA 5DWMA 3PFEA 4NGSA 4JLYA 4MBUA 1Y0RA 1HDQA 4ZBGA 4H6UA 3B35A 2K5TA 3PBBA 2IQ6A 2WPXA 4AVAA 1P4NA 4A2ZA 2YGWA 3VWDA 2AFWA 2PR1A 5AG7A 2JBKA 5BWAB 5I4MA 1ZLHA 3B8GA 2WUUA 1AMPA 1TKFA 4KSFA 3EXNA 2EK9A 3CPAA 3D66A 2NMTA 3S6GA 1BLLE 1IOIA 4KS9A 4KOWA 2FIWA 3GKRA 1BPMA 1YLOA 2ZOGA 2HQYA 2ZEMA 3KKWA 3PBEA 3PB8X 4CAVA 3D2MA 4UIBA 4F8ZA 4OADA 2PVVA 4I49A 4HPSA 1ZG7A 4K3NA 5HMNA 1Y0YA 2B5GA 2V8DA 3IU2A 3F8KA 4H89A 3D3SA 3S9NA 1F2PA 2ATRA 3ZZIA 2FVGA 4XPKA 1S5KA 2D4PA 5K8PA 1LFWA 1S7KA 1V0CA 3IJ3A 4IHMA 8CPAA 1XBUA 2ANPA 4KOSA 3DLJA 2GLJA 1Z8WA 1CBXA 3GLJA 1BAVA 1K4JA 1YREA 2ZW5A 5DWNA 2AFZA 2AE6A 2VZYA 3TO6A 5JGFA 5F48A 1ZLIA 4P4IA 4R3KA 4Y49C 1PUAA 4R76A 1LCPA 2IMOA 4Q7AA 2ARHA 4KOTA 2PIZA 2O53A 3CPXA 4CGOA 2FE7A 4KORA 1VHOA 3WC5A 1XMBA 4YGOA 4XPDC 3S9LA 1ZG8A 5AG6A 3VWEA 2OB0A 4C2YA 5G22A 3T90A 4NGNA 3EFAA 3EC4A 2Q44A 1CM0A 4MY3A 3MRUA 1YW6A 2BCOA 3FECA 2FCKA 2ZEDA 5G1ZA 2ZENA 2CXAA 3DGVA 4QUSA 3F0AA 1SQHA 3GIUA 4Z65A 3RBUA 2PDOA 4JWPA 1B87A 4F9VA 3GY9A 2VEZA 1IU8A 3JRUA 4C2XA 2J9AA 2PJ7A 4CGMA 5FVJA 3OWCA 1VGYA 4PXDA 4CAWA 1JQGA 4MFJA 2Q7SA 2PQ8A 3HLPA 4XPLA 2VI7A 1X12A 4ZY2A 3RAMA 4X5KA 5F47A 4B11A 4P45A 4UFVA 4Q38A 3TTHA 1LAPA 4B10A 4DYOA 2QJ8A 4ZX9A 3KASA 4NEXA 3TE4A 4MFZA 3ISZA 2AFXA 2HUZA 4KOUA 3NFZA 1Q2YA 1RO5A 1Y7EA 3FMCA 5HH1A 4MJ8A 3SXNA 2PJ1A 1GHEA 2B3UA 3DSBA 2Q51A 1Y9WA 2ODFA 2PJAA 4M6GA 3H8EA 1YX0A 4CAEA 3D7HA 1Y7RA 3PGPA 1IICA 3V7ZA 5HVHA 1Z4RA 3FJUA 4UCNA 3FBUA 1Z2LA 3IIBA 2P6GA 1XOVA 1Z9UA 2CF4A 3B3WA 4MCPA 1HEEA 1QSNA 4MY0A 4NXYA 2BEIA 4XPDB 3TO7A 3JVNA 4C68A 1S60A 2PC1A 3L2NA 2FXFA 4MHPA 3KGQA 4WWVA 3MN8A 4OIWA 3IWEA 3PB9X 2YNCC 1CP7A 2J8MA 3DNSA 4RS2A 1IY7A 2XEIA 5A27A 3D8PA 2F7VA 3PRTA 3T8WA 3D68A 2CTCA 2Z0ZA 1BPNA 4RI1A 3K9TA 4JZ0A 4CYQA 2Q7BA 4A38A 2GU2A 5J1QA 4II9A 3UY5A 1S3ZA 3EY5A 2GLFA 3TOAA 4PQAA 3DR8A 5LRKA 4Q36A 1KZFA 2IJZA 4IAVA 2ZEFA 1QSOA 1VKCA 4NF1A 4E8OA 1XRYA 1ELLP 4A32A 4AG7A 3JUWA 1Z4EA 2PIYA 4KLWA 1YVKA 4G1PA 2O28A 4ZYQA 4AVBA 2ZXVA 3K9UA 2AJ6A 2OR4A 2PRQA 4MCSA 4LQGA 4P44A 1KWMA 4XNHC 4M85A 4NJRA 2Q4YA 4F6AA 4CGLA 1YR0A 3IU1A 2R1IA 4EFDA 2EUIA 4YFJA 2DPTA 1IIDA 3NH4A 4GXHA 4J3GA 4X2TA 4P4FA 1QSRA 4H2KA 4ZY1A 1TKHA 5DS0A 2GREA 2EVNA 4IUSA 4M6IA 3R1KA 4PXBA 5JH9A 1NE9A 1BO4A 3FF3A 4E2AA 3A9LA 2KCWA 3I1UA 4UF4A 3SI2A 4CGNA 1PCAA 4UFXA 1AUGA 2ZW7A 1I21A 1ZG9A 2BL1A 4NFRA 1I12A 1QQ9A 1EE3P 2REEA 3FB3A 5EC4A 5HVFA 1M44A 2OZGA 5GCNA 1WK4A 4PK2A 4UCPA 5JPHA 2B58A 3KQXA 3B3VA 4KUBA 4KSIA 4L8AA 2JBJA 2I3CA 4EWTA 3BJ7A 1J4JA 2Z3PA 3IO1A 4OLLA 2X7BA 2OZUA 4P4BA 4HKFA 2R98A 2YNEA 3R9EA 1IOFA 4FUUA 4ZGYB 4AXVA 3D7FA 3NE7A 4UCMA 3S6FA 1XFOA 2FIAA 4FD7A 4QC6A 2ABZA 2B4BA 1QMUA 2CY2A 4MHZA 1YW4A 2G9DA 4L89A 4A31A 4OC4A 3B3SA 4UWJA 3LD2A 2VBQA 1RXTA 2B3VA 2PJ3A 1ELMP 4GS4A 5HVGA 4QBJA 1XEBA 2FT0A 2R8VA 4XNHB 4M3SA 4YU9A 4OC1A 3IFEA 2OH1A 4GM5A 3GB0A 3VH9A 5KTDA 5LYIA 5ELYA 3FH4A 4U9YA 4CRZB 4OAEA 3KL9A 2IL4A 4EVYA 1HDUA 4PV6A 2P6EA 3RYOA 2GANA 4K30A 1YSJA 3QAYA 1TXRA 4UIAA 1ARMA 4ZY0A 1CP6A 4ONUA 3BJ8A 5HXDA 1JWQA 5K8OA 4R8FA 2HC9A 1F57A 1AYEA 2WZNA 2WYRA 3C26A 3FIXA 3PB6X 4C7HA 4NCZA 1VIXA 3DDDA 5IB0A 1Q7LA 1IB1E 2Q43A 2YNCA 2Z3NA 2EWBA 2AFSA 3G8WA 3LMSA 1ZO0A 4OC2A 5THWA 2DXQA 2FS5A 2ZEOA 4IF5A 1XMTA 1M1DA 2V8HA 4X8IA 1MK4A 4CPAA 1Z8LA 2AFMA 3NH8A 4M6HA 2BSWA 2PSWA 2CTBA 4HNYB 1YQEA 4YRHA 4NGTA 3SJFA 2H5MA 2XEJA 3KZWA 4DNCA 2GIVA 2PJ8A 2Z11A 1YMEA 4H6ZA 3PFOA 2JEWA 1YGHA 2ZELA 4UEZA 2PJ6A 4PK3A 2F5IA 3PP9A 2V8GA 5IV0A 2ZW4A 2G0BA 2PCUA 4W9YA 4OIDA 1M4LA 1Z8XA
chains in the Genus database with same CATH topology
4HNXB 4ORFA 2Z3KA 5J8CA 3I3GA 1IYKA 1M4GA 4KOVA 2J8RA 3IGRA 4CRYB 2VXKA 2REFA 2Z3OA 3EO4A 1Y9KA 4CYOA 4AB7A 2Z10A 5AGEA 4KOXA 2BUEA 5AG4A 5F49A 1S7FA 4A95A 4F0YA 4BBHA 5KTCA 4B5PB 3TCVA 2JEVA 4R3LA 3R9FA 3R96A 3P2HA 4JXRA 2YNDA 4F0XA 5KTAA 4AG9A 3R9GA 1I1DA 4CS0B 1NSLA 4C7IA 1MJAA 3MGDA 1N71A 1NMTA 1CJWA 2CNSA 3H4QA 4KVXA 3SXOA 1OZPA 1U6MA 5J8FA 4MHDA 2B5GB 4UWIA 4PSXA 4BMHA 2G3AA 3I9SA 3N7ZA 1S7NA 1S7LA 2ZPAA 2D4OA 4KUAA 4CAFA 5E96A 1L0CA 2J8NA 5C88A 1XIXA 2I79A 3CXPA 4QB9A 3V8IA 3P2FA 4R9MA 4B5PA 4R87A 1MJBA 4B14A 3W6SA 4LUAA 4PSWA 5H84A 4A30A 4KOYA 5H86A 3CXSA 3H5ZA 5IX3A 5I0CA 1Q2DA 2OZHA 2C27A 4NSQA 3G3SA 4CYPA 5G20A 1Q2CA 2G3TA 2WPWA 3FYNA 1PU9A 2RC4A 1YK3A 3DR6A 4KLVA 2JDDA 4CAXA 3WR7A 4B5OA 3QB8A 3TFYA 5A28A 4U5YA 1TIQA 3R95A 2WSAA 2QIRA 4QVTA 4AVCA 2Z3LA 2QMLA 3F5BA 3E0KA 3FRMA 1QSTA 4R57A 3W91A 1R57A 4MFLA 1IYLA 4LX9A 2DPSA 1BOBA 1VHSA 2Q04A 2QECA 2OU2A 1FY7A 4MFPA 3TO9A 1YVOA 5F46A 4U9ZA 3T9YA 1MJ9A 4UFWA 4MFQA 4JD6A 2VQYA 4KZTA 3D2PA 4B13A 1XF8A 3FNCA 2CNMA 4MI4A 4JXQA 2GE3A 4B12A 5G21A 4UA3A 2ZW6A 2P0WA 2P6FA 2I00A 5EBVA 5JQ4A 3LODA 3IWGA 2Z3MA 1KUVA 2CNTA 4FD4A 2HV2A 2FL4A 2B4DB 3GYAA 2FSRA 5ISVA 1M4IA 2Q0YA 5CNPA 3QAHA 4FD5A 3JTKA 4Y49B 1ON0A 4E0AA 5C82A 2Q4VA 3ZJ0A 1UFHA 4UBRA 3S6HA 1LRZA 3BLNA 1YLEA 3TOBA 3TT2A 2Y0MA 4A33A 4JJXA 2JLMA 4CGPA 4MFKA 2PRBA 3CXQA 4KVME 3W6XA 3FXTA 3PZJA 1KUYA 1KUXA 4FD6A 3S6KA 1P0HA 1M4DA 1WWZA 1B6BA 2PR8A 4CYNA 4KSAA 1QSMA 2A4NA 2JDCA 4KVOE 3SHPA 2VZZA 5AG5A 2B4DA 4C2ZA 2R7HA 4HNWB 1XE4A 5DWMA 4JLYA 4MBUA 4ZBGA 4H6UA 2K5TA 2WPXA 4AVAA 1P4NA 2YGWA 3VWDA 2PR1A 5AG7A 5BWAB 3B8GA 2WUUA 4KSFA 3EXNA 2NMTA 3S6GA 4KS9A 4KOWA 2FIWA 3GKRA 3KKWA 2HQYA 4CAVA 3D2MA 4OADA 4I49A 5HMNA 2B5GA 3IU2A 3F8KA 4H89A 3D3SA 2ATRA 3ZZIA 4XPKA 1S5KA 2D4PA 1S7KA 1V0CA 4KOSA 1K4JA 1YREA 2ZW5A 5DWNA 2AE6A 2VZYA 3TO6A 5F48A 4R3KA 4Y49C 1PUAA 2ARHA 4KOTA 4CGOA 2FE7A 4KORA 4YGOA 4XPDC 5AG6A 3VWEA 2OB0A 4C2YA 5G22A 3T90A 3EFAA 3EC4A 2Q44A 1CM0A 4MY3A 2FCKA 5G1ZA 2CXAA 4QUSA 3F0AA 1SQHA 2PDOA 4JWPA 1B87A 3GY9A 2VEZA 4C2XA 4CGMA 5FVJA 3OWCA 4CAWA 4MFJA 2PQ8A 4B11A 4XPLA 2VI7A 4X5KA 5F47A 4UFVA 4Q38A 3TTHA 4B10A 4NEXA 3TE4A 4MFZA 2HUZA 4KOUA 1Q2YA 1RO5A 5HH1A 4MJ8A 3SXNA 1GHEA 2B3UA 3DSBA 1Y9WA 1YX0A 4CAEA 1Y7RA 3PGPA 1IICA 1Z4RA 4UCNA 3FBUA 2P6GA 4MY0A 1Z9UA 4NXYA 5KTDA 3TO7A 1QSNA 2BEIA 4XPDB 3JVNA 4C68A 1S60A 2PC1A 2FXFA 3IWEA 2YNCC 2J8MA 3DNSA 4RS2A 5A27A 3D8PA 2Z0ZA 4RI1A 4CYQA 2Q7BA 4II9A 3UY5A 1S3ZA 3EY5A 3TOAA 3DR8A 4Q36A 1KZFA 1QSOA 1VKCA 4NF1A 4E8OA 4A32A 4AG7A 3JUWA 1Z4EA 4KLWA 1YVKA 2O28A 4AVBA 2ZXVA 3K9UA 2AJ6A 4XNHC 4M85A 2Q4YA 4F6AA 4CGLA 1YR0A 3IU1A 2R1IA 2EUIA 4YFJA 2DPTA 1IIDA 4J3GA 1QSRA 2EVNA 4IUSA 3R1KA 1NE9A 1BO4A 4E2AA 3A9LA 2KCWA 4CGNA 4UFXA 2ZW7A 1I21A 2BL1A 1I12A 3FB3A 2REEA 5EC4A 1M44A 2OZGA 5GCNA 1WK4A 4PK2A 4UCPA 5JPHA 2B58A 4KUBA 4L8AA 3BJ7A 1J4JA 2Z3PA 4OLLA 2X7BA 2OZUA 4HKFA 2R98A 2YNEA 3R9EA 4ZGYB 3NE7A 4UCMA 3S6FA 2FIAA 4FD7A 4QC6A 2B4BA 2CY2A 4L89A 4A31A 4UWJA 3LD2A 2VBQA 1RXTA 2B3VA 4GS4A 4QBJA 1XEBA 2FT0A 2R8VA 4XNHB 4M3SA 2OH1A 4U9YA 4CRZB 4OAEA 4EVYA 2IL4A 4PV6A 2P6EA 3RYOA 2GANA 4K30A 3BJ8A 3C26A 3FIXA 5IB0A 4C7HA 4NCZA 3DDDA 1IB1E 2YNCA 2Z3NA 3G8WA 1ZO0A 2DXQA 2FS5A 4IF5A 1XMTA 1M1DA 1MK4A 4YRHA 2BSWA 2PSWA 4HNYB 4DNCA 2H5MA 2GIVA 2Z11A 4H6ZA 1YGHA 4PK3A 2F5IA 3PP9A 5IV0A 2ZW4A 2G0BA 4A2ZA 4ONUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HNX B;  4ORF A;  5J8C A;  3I3G A;  1IYK A;  1M4G A;  4KOV A;  2J8R A;  3IGR A;  4CRY B;  2VXK A;  2REF A;  3EO4 A;  1Y9K A;  4AB7 A;  2Z10 A;  4KOX A;  2BUE A;  5F49 A;  1S7F A;  5KTC A;  4F0Y A;  4B5P B;  3TCV A;  2JEV A;  4R3L A;  3R9F A;  3R96 A;  3P2H A;  4JXR A;  5KTA A;  4AG9 A;  3R9G A;  1I1D A;  4CS0 B;  1NSL A;  1MJA A;  3MGD A;  1N71 A;  1NMT A;  1CJW A;  2CNS A;  3H4Q A;  4KVX A;  3SXO A;  1OZP A;  1U6M A;  5J8F A;  4MHD A;  2B5G B;  4UWI A;  4PSX A;  4BMH A;  2G3A A;  3I9S A;  3N7Z A;  1S7N A;  1S7L A;  2ZPA A;  2D4O A;  4KUA A;  5E96 A;  1L0C A;  2J8N A;  5C88 A;  1XIX A;  2I79 A;  3CXP A;  4QB9 A;  3V8I A;  3P2F A;  4R9M A;  4B5P A;  4R87 A;  1MJB A;  3W6S A;  4LUA A;  4PSW A;  5H84 A;  4KOY A;  5H86 A;  3CXS A;  5IX3 A;  5I0C A;  1Q2D A;  2OZH A;  2C27 A;  4NSQ A;  3G3S A;  1Q2C A;  2G3T A;  2WPW A;  3FYN A;  1PU9 A;  2RC4 A;  1YK3 A;  3DR6 A;  4KLV A;  2JDD A;  4CAX A;  3WR7 A;  4B5O A;  3QB8 A;  3TFY A;  4U5Y A;  1TIQ A;  3R95 A;  2QIR A;  4QVT A;  4AVC A;  2QML A;  3F5B A;  3E0K A;  3FRM A;  1QST A;  4R57 A;  3W91 A;  1R57 A;  1IYL A;  4LX9 A;  1BOB A;  1VHS A;  2Q04 A;  2QEC A;  2OU2 A;  1FY7 A;  3TO9 A;  1YVO A;  5F46 A;  4U9Z A;  3T9Y A;  1MJ9 A;  4JD6 A;  2VQY A;  4KZT A;  3D2P A;  1XF8 A;  3FNC A;  2CNM A;  4MI4 A;  4JXQ A;  2GE3 A;  4UA3 A;  2ZW6 A;  2P0W A;  2P6F A;  2I00 A;  5EBV A;  5JQ4 A;  3LOD A;  3IWG A;  1KUV A;  2CNT A;  4FD4 A;  2HV2 A;  2FL4 A;  2B4D B;  3GYA A;  2FSR A;  5ISV A;  1M4I A;  2Q0Y A;  5CNP A;  3QAH A;  4FD5 A;  4Y49 B;  1ON0 A;  4E0A A;  5C82 A;  2Q4V A;  3ZJ0 A;  1UFH A;  4UBR A;  3S6H A;  1LRZ A;  3BLN A;  1YLE A;  3TOB A;  3TT2 A;  2Y0M A;  4JJX A;  2JLM A;  2PRB A;  3CXQ A;  4KVM E;  3W6X A;  3FXT A;  3PZJ A;  1KUY A;  1KUX A;  4FD6 A;  3S6K A;  1P0H A;  1M4D A;  1WWZ A;  1B6B A;  2PR8 A;  1QSM A;  2A4N A;  2JDC A;  4KVO E;  3SHP A;  2VZZ A;  2B4D A;  2R7H A;  4HNW B;  1XE4 A;  5DWM A;  4JLY A;  4MBU A;  4ZBG A;  4H6U A;  2K5T A;  2WPX A;  4AVA A;  1P4N A;  3VWD A;  2PR1 A;  3B8G A;  3EXN A;  2NMT A;  3S6G A;  4KOW A;  2FIW A;  3GKR A;  3KKW A;  2HQY A;  4CAV A;  3D2M A;  4OAD A;  4I49 A;  5HMN A;  2B5G A;  3F8K A;  4H89 A;  3D3S A;  2ATR A;  3ZZI A;  4XPK A;  1S5K A;  2D4P A;  1S7K A;  1V0C A;  4KOS A;  1K4J A;  1YRE A;  2ZW5 A;  5DWN A;  2AE6 A;  2VZY A;  3TO6 A;  5F48 A;  4R3K A;  4Y49 C;  1PUA A;  2ARH A;  4KOT A;  2FE7 A;  4KOR A;  4YGO A;  4XPD C;  3VWE A;  2OB0 A;  3T90 A;  3EFA A;  3EC4 A;  2Q44 A;  1CM0 A;  4MY3 A;  2FCK A;  4QUS A;  3F0A A;  1SQH A;  2PDO A;  4JWP A;  1B87 A;  3GY9 A;  2VEZ A;  5FVJ A;  3OWC A;  4CAW A;  2PQ8 A;  4XPL A;  2VI7 A;  4X5K A;  5F47 A;  3TTH A;  4NEX A;  3TE4 A;  2HUZ A;  4KOU A;  1Q2Y A;  1RO5 A;  5HH1 A;  4MJ8 A;  3SXN A;  1GHE A;  2B3U A;  3DSB A;  1Y9W A;  1YX0 A;  1Y7R A;  3PGP A;  1IIC A;  1Z4R A;  3FBU A;  2P6G A;  4MY0 A;  1Z9U A;  4NXY A;  5KTD A;  3TO7 A;  1QSN A;  2BEI A;  4XPD B;  3JVN A;  1S60 A;  2PC1 A;  2FXF A;  2J8M A;  3DNS A;  4RS2 A;  3D8P A;  2Z0Z A;  4RI1 A;  2Q7B A;  4II9 A;  3UY5 A;  1S3Z A;  3EY5 A;  3TOA A;  3DR8 A;  1KZF A;  1QSO A;  1VKC A;  4NF1 A;  4E8O A;  4AG7 A;  3JUW A;  1Z4E A;  4KLW A;  1YVK A;  2O28 A;  4AVB A;  2ZXV A;  3K9U A;  2AJ6 A;  4XNH C;  4M85 A;  2Q4Y A;  4F6A A;  1YR0 A;  2R1I A;  2EUI A;  4YFJ A;  1IID A;  4J3G A;  1QSR A;  2EVN A;  4IUS A;  3R1K A;  1NE9 A;  1BO4 A;  4E2A A;  2KCW A;  2ZW7 A;  1I21 A;  2BL1 A;  1I12 A;  3FB3 A;  2REE A;  5EC4 A;  1M44 A;  2OZG A;  5GCN A;  1WK4 A;  4PK2 A;  5JPH A;  2B58 A;  4KUB A;  4L8A A;  3BJ7 A;  1J4J A;  4OLL A;  2X7B A;  2OZU A;  4HKF A;  2R98 A;  3R9E A;  3NE7 A;  3S6F A;  2FIA A;  4FD7 A;  4QC6 A;  2B4B A;  2CY2 A;  4L89 A;  4UWJ A;  3LD2 A;  2VBQ A;  1RXT A;  2B3V A;  4GS4 A;  4QBJ A;  1XEB A;  2FT0 A;  2R8V A;  4XNH B;  4M3S A;  2OH1 A;  4U9Y A;  4CRZ B;  4OAE A;  4EVY A;  2IL4 A;  4PV6 A;  2P6E A;  3RYO A;  2GAN A;  4K30 A;  3BJ8 A;  3C26 A;  3FIX A;  5IB0 A;  4NCZ A;  3DDD A;  1IB1 E;  3G8W A;  2DXQ A;  2FS5 A;  4IF5 A;  1XMT A;  1M1D A;  1MK4 A;  4YRH A;  2BSW A;  2PSW A;  4HNY B;  4DNC A;  2H5M A;  2GIV A;  2Z11 A;  4H6Z A;  1YGH A;  4PK3 A;  2F5I A;  3PP9 A;  5IV0 A;  2ZW4 A;  2G0B A;  4ONU A; 
#chains in the Genus database with same CATH topology
 4HNX B;  4ORF A;  2Z3K A;  5J8C A;  3I3G A;  3B3T A;  3VAR A;  1IYK A;  1M4G A;  3VAT A;  4KOV A;  1OBR A;  1ARL A;  2J8R A;  3IGR A;  4MRI A;  4CRY B;  2OOT A;  2VXK A;  2REF A;  2ZOF A;  2Z3O A;  2BOA A;  3EO4 A;  1Y9K A;  3FEE A;  4CYO A;  4AB7 A;  2Z10 A;  5AGE A;  3CDX A;  4KOX A;  3KHZ A;  2BUE A;  2EBJ A;  1LAN A;  2PJ5 A;  3KI9 A;  1S7F A;  2ZEH A;  3QNV A;  5F49 A;  5AG4 A;  4A95 A;  4F0Y A;  2DF5 A;  2ZEP A;  3KR4 A;  4B5P B;  4BBH A;  4FBE A;  5KTC A;  3SI1 A;  5LYL A;  4DUK A;  3TCV A;  1LAM A;  4A94 A;  2JEV A;  1CPS A;  1IGB A;  4R3L A;  3R9F A;  3P2H A;  4FWU A;  3R96 A;  4JXR A;  4RUH A;  2YND A;  2XEG A;  3PB4 X;  4R7M A;  5D8N A;  4B6Z A;  4F0X A;  5KTA A;  3NA6 A;  4AG9 A;  3FX6 A;  3R9G A;  5JM6 A;  1R43 A;  2C6P A;  1I1D A;  4CS0 B;  3IWW A;  1NSL A;  4C7I A;  4TWE A;  1MJA A;  3MGD A;  1N71 A;  1NMT A;  3TC8 A;  3ISX A;  1CJW A;  4OKO A;  2Q4Z A;  2CNS A;  4R6T A;  1CPX A;  3H4Q A;  4KVX A;  3HUV A;  3SXO A;  5D29 A;  1OZP A;  2AFO A;  1U6M A;  5J8F A;  2EK8 A;  4MHD A;  2DEA A;  1CX8 A;  4P10 A;  2B5G B;  4UWI A;  4PSX A;  4BMH A;  2V8V A;  1VHE A;  2G3A A;  4IK2 A;  3I9S A;  3N7Z A;  1S7N A;  6CPA A;  3V38 A;  1S7L A;  2ZPA A;  2D4O A;  4KUA A;  4CAF A;  5E96 A;  1L0C A;  2J8N A;  5C88 A;  1XIX A;  2I79 A;  3CXP A;  5EMI A;  4QB9 A;  1NSA A;  3V8I A;  4BD9 A;  3P2F A;  4MHN A;  4R9M A;  1DTD A;  4NJQ A;  1R3N A;  4B5P A;  4A37 A;  4NGM A;  2PVW A;  4MHY A;  4WJB A;  4R87 A;  3TX8 A;  2F8H A;  1MJB A;  2BO9 A;  1X10 A;  3W6S A;  4B14 A;  4LUA A;  4MXU A;  3RO0 A;  4MMO A;  4PSW A;  3N5F A;  5H84 A;  2NYQ A;  2RFH A;  3NE8 A;  4A30 A;  4KOY A;  5H86 A;  1A2Z A;  3CXS A;  4NGR A;  2HB6 A;  3H5Z A;  5IX3 A;  3K2K A;  3H8G A;  5I0C A;  4UEE A;  1Q2D A;  5LRJ A;  4A39 A;  3CT9 A;  2OZH A;  3CZX A;  2C27 A;  5CPA A;  4NSQ A;  3RZA A;  2PJC A;  3G3S A;  4PXE A;  4CYP A;  7CPA A;  5G20 A;  4MCR A;  4DJL A;  1Q2C A;  2C6G A;  1FT7 A;  1CG2 A;  2C1C A;  2G3T A;  2ZEE A;  4OP4 A;  2ZEG A;  2WPW A;  3FYN A;  1PU9 A;  2RC4 A;  2VL1 A;  1YK3 A;  3SJE A;  2AFU A;  3DR6 A;  1LOK A;  2JDD A;  3D7G A;  3D7D A;  2C6C A;  4KLV A;  4LQ6 A;  3B7I A;  4CAX A;  3WR7 A;  4B5O A;  3IC1 A;  1XJO A;  3QB8 A;  1F2O A;  3TFY A;  5LRG A;  5A28 A;  4U5Y A;  1TIQ A;  3S9M A;  3R95 A;  2QIR A;  2WSA A;  4OME A;  4QVT A;  4AVC A;  2XEF A;  2PJ2 A;  2Z3L A;  2QML A;  3F5B A;  3E0K A;  3FRM A;  1QST A;  3PB7 X;  3B3C A;  4R57 A;  3W91 A;  3BI1 A;  1RTQ A;  1R57 A;  4MFL A;  4OC0 A;  3PEI A;  1IYL A;  2PJ4 A;  4LX9 A;  2DPS A;  1BOB A;  1VHS A;  2CIJ A;  2Q04 A;  2QEC A;  4X3R A;  2QYV A;  2OU2 A;  1FY7 A;  4MFP A;  5IB9 A;  3TO9 A;  1Z5R A;  1YVO A;  1FNO A;  4U9Z A;  5F46 A;  3T9Y A;  2POK A;  1MJ9 A;  1DE4 C;  5CBM A;  4UFW A;  4MFQ A;  4JD6 A;  2NSM A;  2VQY A;  4KZT A;  3D2P A;  4NGP A;  1XF8 A;  3FNC A;  3IEH A;  4B13 A;  4ZX8 A;  2EO8 A;  2CNM A;  3D67 A;  4MI4 A;  4JXQ A;  4P6Y A;  3BXM A;  2GE3 A;  4B12 A;  5LYF A;  5G21 A;  3FVL A;  4UA3 A;  2ZW6 A;  2P0W A;  1TF9 A;  2P6F A;  2I00 A;  3FED A;  4YWY A;  5EBV A;  3RNZ A;  4OC5 A;  3LOD A;  5JQ4 A;  3SJX A;  3IWG A;  2Z3M A;  5LYD A;  2QVP A;  1KUV A;  2CNT A;  4FD4 A;  2HV2 A;  2FL4 A;  2B4D B;  4OC3 A;  4F9U A;  3WC6 A;  4O23 A;  3GYA A;  2FSR A;  5ISV A;  1M4I A;  2Q0Y A;  5CNP A;  5K8N A;  3QAH A;  4P4E A;  4FD5 A;  3JTK A;  1GYT A;  4Y49 B;  3WC7 A;  3KQZ A;  1ON0 A;  4E0A A;  5C82 A;  4P4D A;  2PJ9 A;  2Q4V A;  3ZJ0 A;  1UFH A;  4UBR A;  3S6H A;  1LRZ A;  3BLN A;  4UEF A;  1YLE A;  3GUX A;  3LAC A;  2RB7 A;  2GFQ A;  3KHX A;  3TOB A;  3TT2 A;  1UWY A;  2Y0M A;  4TNU A;  4A33 A;  1Z8T A;  3NH5 A;  4EME A;  4JJX A;  4JYW A;  2JLM A;  4CGP A;  4MCQ A;  4MFK A;  2PRB A;  1PYT B;  1TF8 A;  4FAI A;  2V77 A;  4PPZ A;  3SJG A;  3CXQ A;  4PXC A;  4KVM E;  4RN7 A;  1TKJ A;  4P4J A;  1H8L A;  3SI0 A;  3W6X A;  2PE3 A;  4ZI6 A;  3FXT A;  3BHX A;  3PZJ A;  1KUY A;  5K8M A;  1KUX A;  4FD6 A;  3S6K A;  5F09 A;  1P0H A;  1M4D A;  1WWZ A;  1B6B A;  2PR8 A;  3WAB A;  4CYN A;  2PJB A;  4BIN A;  3B2Y A;  4KSA A;  2PJ0 A;  1QSM A;  2A4N A;  2JDC A;  3H8F A;  3WT4 A;  3D4U A;  4KVO E;  3SHP A;  4ONW A;  2VZZ A;  5AG5 A;  3BI0 A;  2B4D A;  4C2Z A;  2R7H A;  4HNW B;  1XE4 A;  4NGQ A;  3KR5 A;  3LWU A;  2O4H A;  5DWM A;  3PFE A;  4NGS A;  4JLY A;  4MBU A;  1Y0R A;  1HDQ A;  4ZBG A;  4H6U A;  3B35 A;  2K5T A;  3PBB A;  2IQ6 A;  2WPX A;  4AVA A;  1P4N A;  4A2Z A;  2YGW A;  3VWD A;  2AFW A;  2PR1 A;  5AG7 A;  2JBK A;  5BWA B;  5I4M A;  1ZLH A;  3B8G A;  2WUU A;  1AMP A;  1TKF A;  4KSF A;  3EXN A;  2EK9 A;  3CPA A;  3D66 A;  2NMT A;  3S6G A;  1BLL E;  1IOI A;  4KS9 A;  4KOW A;  2FIW A;  3GKR A;  1BPM A;  1YLO A;  2ZOG A;  2HQY A;  2ZEM A;  3KKW A;  3PBE A;  3PB8 X;  4CAV A;  3D2M A;  4UIB A;  4F8Z A;  4OAD A;  2PVV A;  4I49 A;  4HPS A;  1ZG7 A;  4K3N A;  5HMN A;  1Y0Y A;  2B5G A;  2V8D A;  3IU2 A;  3F8K A;  4H89 A;  3D3S A;  3S9N A;  1F2P A;  2ATR A;  3ZZI A;  2FVG A;  4XPK A;  1S5K A;  2D4P A;  5K8P A;  1LFW A;  1S7K A;  1V0C A;  3IJ3 A;  4IHM A;  8CPA A;  1XBU A;  2ANP A;  4KOS A;  3DLJ A;  2GLJ A;  1Z8W A;  1CBX A;  3GLJ A;  1BAV A;  1K4J A;  1YRE A;  2ZW5 A;  5DWN A;  2AFZ A;  2AE6 A;  2VZY A;  3TO6 A;  5JGF A;  5F48 A;  1ZLI A;  4P4I A;  4R3K A;  4Y49 C;  1PUA A;  4R76 A;  1LCP A;  2IMO A;  4Q7A A;  2ARH A;  4KOT A;  2PIZ A;  2O53 A;  3CPX A;  4CGO A;  2FE7 A;  4KOR A;  1VHO A;  3WC5 A;  1XMB A;  4YGO A;  4XPD C;  3S9L A;  1ZG8 A;  5AG6 A;  3VWE A;  2OB0 A;  4C2Y A;  5G22 A;  3T90 A;  4NGN A;  3EFA A;  3EC4 A;  2Q44 A;  1CM0 A;  4MY3 A;  3MRU A;  1YW6 A;  2BCO A;  3FEC A;  2FCK A;  2ZED A;  5G1Z A;  2ZEN A;  2CXA A;  3DGV A;  4QUS A;  3F0A A;  1SQH A;  3GIU A;  4Z65 A;  3RBU A;  2PDO A;  4JWP A;  1B87 A;  4F9V A;  3GY9 A;  2VEZ A;  1IU8 A;  3JRU A;  4C2X A;  2J9A A;  2PJ7 A;  4CGM A;  5FVJ A;  3OWC A;  1VGY A;  4PXD A;  4CAW A;  1JQG A;  4MFJ A;  2Q7S A;  2PQ8 A;  3HLP A;  4XPL A;  2VI7 A;  1X12 A;  4ZY2 A;  3RAM A;  4X5K A;  5F47 A;  4B11 A;  4P45 A;  4UFV A;  4Q38 A;  3TTH A;  1LAP A;  4B10 A;  4DYO A;  2QJ8 A;  4ZX9 A;  3KAS A;  4NEX A;  3TE4 A;  4MFZ A;  3ISZ A;  2AFX A;  2HUZ A;  4KOU A;  3NFZ A;  1Q2Y A;  1RO5 A;  1Y7E A;  3FMC A;  5HH1 A;  4MJ8 A;  3SXN A;  2PJ1 A;  1GHE A;  2B3U A;  3DSB A;  2Q51 A;  1Y9W A;  2ODF A;  2PJA A;  4M6G A;  3H8E A;  1YX0 A;  4CAE A;  3D7H A;  1Y7R A;  3PGP A;  1IIC A;  3V7Z A;  5HVH A;  1Z4R A;  3FJU A;  4UCN A;  3FBU A;  1Z2L A;  3IIB A;  2P6G A;  1XOV A;  1Z9U A;  2CF4 A;  3B3W A;  4MCP A;  1HEE A;  1QSN A;  4MY0 A;  4NXY A;  2BEI A;  4XPD B;  3TO7 A;  3JVN A;  4C68 A;  1S60 A;  2PC1 A;  3L2N A;  2FXF A;  4MHP A;  3KGQ A;  4WWV A;  3MN8 A;  4OIW A;  3IWE A;  3PB9 X;  2YNC C;  1CP7 A;  2J8M A;  3DNS A;  4RS2 A;  1IY7 A;  2XEI A;  5A27 A;  3D8P A;  2F7V A;  3PRT A;  3T8W A;  3D68 A;  2CTC A;  2Z0Z A;  1BPN A;  4RI1 A;  3K9T A;  4JZ0 A;  4CYQ A;  2Q7B A;  4A38 A;  2GU2 A;  5J1Q A;  4II9 A;  3UY5 A;  1S3Z A;  3EY5 A;  2GLF A;  3TOA A;  4PQA A;  3DR8 A;  5LRK A;  4Q36 A;  1KZF A;  2IJZ A;  4IAV A;  2ZEF A;  1QSO A;  1VKC A;  4NF1 A;  4E8O A;  1XRY A;  1ELL P;  4A32 A;  4AG7 A;  3JUW A;  1Z4E A;  2PIY A;  4KLW A;  1YVK A;  4G1P A;  2O28 A;  4ZYQ A;  4AVB A;  2ZXV A;  3K9U A;  2AJ6 A;  2OR4 A;  2PRQ A;  4MCS A;  4LQG A;  4P44 A;  1KWM A;  4XNH C;  4M85 A;  4NJR A;  2Q4Y A;  4F6A A;  4CGL A;  1YR0 A;  3IU1 A;  2R1I A;  4EFD A;  2EUI A;  4YFJ A;  2DPT A;  1IID A;  3NH4 A;  4GXH A;  4J3G A;  4X2T A;  4P4F A;  1QSR A;  4H2K A;  4ZY1 A;  1TKH A;  5DS0 A;  2GRE A;  2EVN A;  4IUS A;  4M6I A;  3R1K A;  4PXB A;  5JH9 A;  1NE9 A;  1BO4 A;  3FF3 A;  4E2A A;  3A9L A;  2KCW A;  3I1U A;  4UF4 A;  3SI2 A;  4CGN A;  1PCA A;  4UFX A;  1AUG A;  2ZW7 A;  1I21 A;  1ZG9 A;  2BL1 A;  4NFR A;  1I12 A;  1QQ9 A;  1EE3 P;  2REE A;  3FB3 A;  5EC4 A;  5HVF A;  1M44 A;  2OZG A;  5GCN A;  1WK4 A;  4PK2 A;  4UCP A;  5JPH A;  2B58 A;  3KQX A;  3B3V A;  4KUB A;  4KSI A;  4L8A A;  2JBJ A;  2I3C A;  4EWT A;  3BJ7 A;  1J4J A;  2Z3P A;  3IO1 A;  4OLL A;  2X7B A;  2OZU A;  4P4B A;  4HKF A;  2R98 A;  2YNE A;  3R9E A;  1IOF A;  4FUU A;  4ZGY B;  4AXV A;  3D7F A;  3NE7 A;  4UCM A;  3S6F A;  1XFO A;  2FIA A;  4FD7 A;  4QC6 A;  2ABZ A;  2B4B A;  1QMU A;  2CY2 A;  4MHZ A;  1YW4 A;  2G9D A;  4L89 A;  4A31 A;  4OC4 A;  3B3S A;  4UWJ A;  3LD2 A;  2VBQ A;  1RXT A;  2B3V A;  2PJ3 A;  1ELM P;  4GS4 A;  5HVG A;  4QBJ A;  1XEB A;  2FT0 A;  2R8V A;  4XNH B;  4M3S A;  4YU9 A;  4OC1 A;  3IFE A;  2OH1 A;  4GM5 A;  3GB0 A;  3VH9 A;  5KTD A;  5LYI A;  5ELY A;  3FH4 A;  4U9Y A;  4CRZ B;  4OAE A;  3KL9 A;  2IL4 A;  4EVY A;  1HDU A;  4PV6 A;  2P6E A;  3RYO A;  2GAN A;  4K30 A;  1YSJ A;  3QAY A;  1TXR A;  4UIA A;  1ARM A;  4ZY0 A;  1CP6 A;  4ONU A;  3BJ8 A;  5HXD A;  1JWQ A;  5K8O A;  4R8F A;  2HC9 A;  1F57 A;  1AYE A;  2WZN A;  2WYR A;  3C26 A;  3FIX A;  3PB6 X;  4C7H A;  4NCZ A;  1VIX A;  3DDD A;  5IB0 A;  1Q7L A;  1IB1 E;  2Q43 A;  2YNC A;  2Z3N A;  2EWB A;  2AFS A;  3G8W A;  3LMS A;  1ZO0 A;  4OC2 A;  5THW A;  2DXQ A;  2FS5 A;  2ZEO A;  4IF5 A;  1XMT A;  1M1D A;  2V8H A;  4X8I A;  1MK4 A;  4CPA A;  1Z8L A;  2AFM A;  3NH8 A;  4M6H A;  2BSW A;  2PSW A;  2CTB A;  4HNY B;  1YQE A;  4YRH A;  4NGT A;  3SJF A;  2H5M A;  2XEJ A;  3KZW A;  4DNC A;  2GIV A;  2PJ8 A;  2Z11 A;  1YME A;  4H6Z A;  3PFO A;  2JEW A;  1YGH A;  2ZEL A;  4UEZ A;  2PJ6 A;  4PK3 A;  2F5I A;  3PP9 A;  2V8G A;  5IV0 A;  2ZW4 A;  2G0B A;  2PCU A;  4W9Y A;  4OID A;  1M4L A;  1Z8X A; 
#chains in the Genus database with same CATH homology
 4HNX B;  4ORF A;  2Z3K A;  5J8C A;  3I3G A;  1IYK A;  1M4G A;  4KOV A;  2J8R A;  3IGR A;  4CRY B;  2VXK A;  2REF A;  2Z3O A;  3EO4 A;  1Y9K A;  4CYO A;  4AB7 A;  2Z10 A;  5AGE A;  4KOX A;  2BUE A;  5AG4 A;  5F49 A;  1S7F A;  4A95 A;  4F0Y A;  4BBH A;  5KTC A;  4B5P B;  3TCV A;  2JEV A;  4R3L A;  3R9F A;  3R96 A;  3P2H A;  4JXR A;  2YND A;  4F0X A;  5KTA A;  4AG9 A;  3R9G A;  1I1D A;  4CS0 B;  1NSL A;  4C7I A;  1MJA A;  3MGD A;  1N71 A;  1NMT A;  1CJW A;  2CNS A;  3H4Q A;  4KVX A;  3SXO A;  1OZP A;  1U6M A;  5J8F A;  4MHD A;  2B5G B;  4UWI A;  4PSX A;  4BMH A;  2G3A A;  3I9S A;  3N7Z A;  1S7N A;  1S7L A;  2ZPA A;  2D4O A;  4KUA A;  4CAF A;  5E96 A;  1L0C A;  2J8N A;  5C88 A;  1XIX A;  2I79 A;  3CXP A;  4QB9 A;  3V8I A;  3P2F A;  4R9M A;  4B5P A;  4R87 A;  1MJB A;  4B14 A;  3W6S A;  4LUA A;  4PSW A;  5H84 A;  4A30 A;  4KOY A;  5H86 A;  3CXS A;  3H5Z A;  5IX3 A;  5I0C A;  1Q2D A;  2OZH A;  2C27 A;  4NSQ A;  3G3S A;  4CYP A;  5G20 A;  1Q2C A;  2G3T A;  2WPW A;  3FYN A;  1PU9 A;  2RC4 A;  1YK3 A;  3DR6 A;  4KLV A;  2JDD A;  4CAX A;  3WR7 A;  4B5O A;  3QB8 A;  3TFY A;  5A28 A;  4U5Y A;  1TIQ A;  3R95 A;  2WSA A;  2QIR A;  4QVT A;  4AVC A;  2Z3L A;  2QML A;  3F5B A;  3E0K A;  3FRM A;  1QST A;  4R57 A;  3W91 A;  1R57 A;  4MFL A;  1IYL A;  4LX9 A;  2DPS A;  1BOB A;  1VHS A;  2Q04 A;  2QEC A;  2OU2 A;  1FY7 A;  4MFP A;  3TO9 A;  1YVO A;  5F46 A;  4U9Z A;  3T9Y A;  1MJ9 A;  4UFW A;  4MFQ A;  4JD6 A;  2VQY A;  4KZT A;  3D2P A;  4B13 A;  1XF8 A;  3FNC A;  2CNM A;  4MI4 A;  4JXQ A;  2GE3 A;  4B12 A;  5G21 A;  4UA3 A;  2ZW6 A;  2P0W A;  2P6F A;  2I00 A;  5EBV A;  5JQ4 A;  3LOD A;  3IWG A;  2Z3M A;  1KUV A;  2CNT A;  4FD4 A;  2HV2 A;  2FL4 A;  2B4D B;  3GYA A;  2FSR A;  5ISV A;  1M4I A;  2Q0Y A;  5CNP A;  3QAH A;  4FD5 A;  3JTK A;  4Y49 B;  1ON0 A;  4E0A A;  5C82 A;  2Q4V A;  3ZJ0 A;  1UFH A;  4UBR A;  3S6H A;  1LRZ A;  3BLN A;  1YLE A;  3TOB A;  3TT2 A;  2Y0M A;  4A33 A;  4JJX A;  2JLM A;  4CGP A;  4MFK A;  2PRB A;  3CXQ A;  4KVM E;  3W6X A;  3FXT A;  3PZJ A;  1KUY A;  1KUX A;  4FD6 A;  3S6K A;  1P0H A;  1M4D A;  1WWZ A;  1B6B A;  2PR8 A;  4CYN A;  4KSA A;  1QSM A;  2A4N A;  2JDC A;  4KVO E;  3SHP A;  2VZZ A;  5AG5 A;  2B4D A;  4C2Z A;  2R7H A;  4HNW B;  1XE4 A;  5DWM A;  4JLY A;  4MBU A;  4ZBG A;  4H6U A;  2K5T A;  2WPX A;  4AVA A;  1P4N A;  2YGW A;  3VWD A;  2PR1 A;  5AG7 A;  5BWA B;  3B8G A;  2WUU A;  4KSF A;  3EXN A;  2NMT A;  3S6G A;  4KS9 A;  4KOW A;  2FIW A;  3GKR A;  3KKW A;  2HQY A;  4CAV A;  3D2M A;  4OAD A;  4I49 A;  5HMN A;  2B5G A;  3IU2 A;  3F8K A;  4H89 A;  3D3S A;  2ATR A;  3ZZI A;  4XPK A;  1S5K A;  2D4P A;  1S7K A;  1V0C A;  4KOS A;  1K4J A;  1YRE A;  2ZW5 A;  5DWN A;  2AE6 A;  2VZY A;  3TO6 A;  5F48 A;  4R3K A;  4Y49 C;  1PUA A;  2ARH A;  4KOT A;  4CGO A;  2FE7 A;  4KOR A;  4YGO A;  4XPD C;  5AG6 A;  3VWE A;  2OB0 A;  4C2Y A;  5G22 A;  3T90 A;  3EFA A;  3EC4 A;  2Q44 A;  1CM0 A;  4MY3 A;  2FCK A;  5G1Z A;  2CXA A;  4QUS A;  3F0A A;  1SQH A;  2PDO A;  4JWP A;  1B87 A;  3GY9 A;  2VEZ A;  4C2X A;  4CGM A;  5FVJ A;  3OWC A;  4CAW A;  4MFJ A;  2PQ8 A;  4B11 A;  4XPL A;  2VI7 A;  4X5K A;  5F47 A;  4UFV A;  4Q38 A;  3TTH A;  4B10 A;  4NEX A;  3TE4 A;  4MFZ A;  2HUZ A;  4KOU A;  1Q2Y A;  1RO5 A;  5HH1 A;  4MJ8 A;  3SXN A;  1GHE A;  2B3U A;  3DSB A;  1Y9W A;  1YX0 A;  4CAE A;  1Y7R A;  3PGP A;  1IIC A;  1Z4R A;  4UCN A;  3FBU A;  2P6G A;  4MY0 A;  1Z9U A;  4NXY A;  5KTD A;  3TO7 A;  1QSN A;  2BEI A;  4XPD B;  3JVN A;  4C68 A;  1S60 A;  2PC1 A;  2FXF A;  3IWE A;  2YNC C;  2J8M A;  3DNS A;  4RS2 A;  5A27 A;  3D8P A;  2Z0Z A;  4RI1 A;  4CYQ A;  2Q7B A;  4II9 A;  3UY5 A;  1S3Z A;  3EY5 A;  3TOA A;  3DR8 A;  4Q36 A;  1KZF A;  1QSO A;  1VKC A;  4NF1 A;  4E8O A;  4A32 A;  4AG7 A;  3JUW A;  1Z4E A;  4KLW A;  1YVK A;  2O28 A;  4AVB A;  2ZXV A;  3K9U A;  2AJ6 A;  4XNH C;  4M85 A;  2Q4Y A;  4F6A A;  4CGL A;  1YR0 A;  3IU1 A;  2R1I A;  2EUI A;  4YFJ A;  2DPT A;  1IID A;  4J3G A;  1QSR A;  2EVN A;  4IUS A;  3R1K A;  1NE9 A;  1BO4 A;  4E2A A;  3A9L A;  2KCW A;  4CGN A;  4UFX A;  2ZW7 A;  1I21 A;  2BL1 A;  1I12 A;  3FB3 A;  2REE A;  5EC4 A;  1M44 A;  2OZG A;  5GCN A;  1WK4 A;  4PK2 A;  4UCP A;  5JPH A;  2B58 A;  4KUB A;  4L8A A;  3BJ7 A;  1J4J A;  2Z3P A;  4OLL A;  2X7B A;  2OZU A;  4HKF A;  2R98 A;  2YNE A;  3R9E A;  4ZGY B;  3NE7 A;  4UCM A;  3S6F A;  2FIA A;  4FD7 A;  4QC6 A;  2B4B A;  2CY2 A;  4L89 A;  4A31 A;  4UWJ A;  3LD2 A;  2VBQ A;  1RXT A;  2B3V A;  4GS4 A;  4QBJ A;  1XEB A;  2FT0 A;  2R8V A;  4XNH B;  4M3S A;  2OH1 A;  4U9Y A;  4CRZ B;  4OAE A;  4EVY A;  2IL4 A;  4PV6 A;  2P6E A;  3RYO A;  2GAN A;  4K30 A;  3BJ8 A;  3C26 A;  3FIX A;  5IB0 A;  4C7H A;  4NCZ A;  3DDD A;  1IB1 E;  2YNC A;  2Z3N A;  3G8W A;  1ZO0 A;  2DXQ A;  2FS5 A;  4IF5 A;  1XMT A;  1M1D A;  1MK4 A;  4YRH A;  2BSW A;  2PSW A;  4HNY B;  4DNC A;  2H5M A;  2GIV A;  2Z11 A;  4H6Z A;  1YGH A;  4PK3 A;  2F5I A;  3PP9 A;  5IV0 A;  2ZW4 A;  2G0B A;  4A2Z A;  4ONU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...