3R9GA

Crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with coenzyme a and processed microcin c7 antibiotic
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
180
Chain Sequence
DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Microcin C7 Inactivation by the MccE Acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transferase inhibitor
molecule keywords MccE protein
total genus 55
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3r9gA00
3JVNA 4FD4A 4KORA 3FNCA 4AVBA 3PP9A 3F5BA 3CXSA 2ZW5A 3TO7A 3H4QA 4KLVA 5I0CA 2QECA 2B3UA 2EUIA 1XEBA 4KUBA 1KUVA 4GS4A 2FSRA 3SXNA 3R9EA 4JXRA 3GYAA 1B87A 3W6XA 4KUAA 1Z4RA 1NSLA 2Q0YA 3BJ8A 5DWNA 4QUSA 3DR6A 4E0AA 4II9A 5FVJA 3I3GA 3TO6A 4MY0A 3NE7A 2FS5A 4KVME 1WWZA 2R8VA 1QSOA 2BEIA 5H84A 1TIQA 5GCNA 2HV2A 4MJ8A 5J8FA 1QSRA 4U9ZA 2BSWA 3GY9A 3TTHA 1R57A 4FD7A 2ZW7A 2A4NA 2G3AA 4R87A 2FE7A 2PC1A 3BLNA 3K9UA 1MJ9A 2F5IA 3PZJA 4NF1A 3DSBA 5HMNA 3TFYA 3D8PA 4MBUA 3G3SA 2JLMA 2B3VA 1RO5A 1XIXA 4RI1A 2FL4A 4QC6A 4PK2A 2P6GA 2J8RA 2Z10A 2FIAA 4ONUA 1FY7A 4U5YA 2AE6A 5F48A 2Y0MA 4HKFA 2Q4YA 3TCVA 2ZW4A 1YK3A 2ARHA 2WPWA 4NCZA 3F0AA 3IWGA 4M3SA 4E8OA 3D3SA 4CAVA 4MHDA 3CXQA 4JJXA 2PR8A 4NSQA 4AB7A 1VKCA 2NMTA 2REFA 2VZZA 3VWDA 3CXPA 4FD6A 3SHPA 1MJBA 2VXKA 4HNYB 4B5OA 2CY2A 3OWCA 2B58A 1Y9KA 1YR0A 4K30A 3F8KA 1S60A 1KUXA 1KUYA 1CJWA 3R95A 4NXYA 2ZPAA 3S6HA 4DNCA 4AVAA 2FXFA 4HNWB 2PR1A 2Q44A 3R9FA 3EC4A 1P4NA 1U6MA 1YGHA 2G0BA 4KOTA 1M44A 2D4PA 5EC4A 2QIRA 2Z0ZA 4JLYA 4HNXB 2Q4VA 1Z9UA 2P6EA 2B4DA 5H86A 2B4DB 3B8GA 4OLLA 1YVKA 1LRZA 2Q04A 4XPKA 4CS0B 3GKRA 4B5PA 4U9YA 3KKWA 1M4DA 2J8MA 2PQ8A 3SXOA 1Q2DA 3G8WA 3ZJ0A 4AVCA 4OADA 1VHSA 4R3KA 3DR8A 5DWMA 1ON0A 1I1DA 1QSNA 3V8IA 4YFJA 1V0CA 4CRZB 4IF5A 4L89A 1S7LA 3TOAA 1XE4A 1SQHA 2QMLA 3W6SA 2OZUA 4AG7A 3QB8A 1Q2CA 2B4BA 1CM0A 4PK3A 3WR7A 1NMTA 1M1DA 1S3ZA 4J3GA 2ZXVA 2PDOA 3P2FA 5C82A 2D4OA 1GHEA 5HH1A 5JQ4A 5CNPA 1S7NA 2VI7A 2I00A 2G3TA 1XF8A 4YGOA 3D2PA 2PRBA 2B5GA 4MY3A 1YREA 2P6FA 4LUAA 2K5TA 4KOUA 1M4IA 2ZW6A 4PSXA 5JPHA 2CNSA 2GIVA 4E2AA 1J4JA 2R1IA 1BOBA 1YLEA 2J8NA 2OU2A 3FXTA 5F46A 3LD2A 5EBVA 4KLWA 3S6GA 4Y49C 2GANA 5F47A 4KOYA 1Z4EA 1K4JA 2DXQA 1NE9A 5J8CA 3E0KA 4KOVA 4Y49B 4CRYB 4UWIA 4B5PB 4RS2A 2Z11A 2OZHA 3TE4A 3QAHA 3T9YA 3FB3A 4UBRA 2PSWA 2C27A 2I79A 5IB0A 3S6FA 3DDDA 2IL4A 4KVXA 2REEA 2CNMA 2OB0A 4XNHC 4H6UA 4NEXA 4UWJA 3W91A 1P0HA 3D2MA 4CAXA 4MI4A 3FYNA 1I12A 1UFHA 2P0WA 4JD6A 4H89A 4JWPA 2O28A 3FRMA 2EVNA 2HUZA 3EXNA 3DNSA 4QBJA 1IICA 1PUAA 1B6BA 1Y7RA 4EVYA 3C26A 4KOXA 4ZBGA 1YVOA 2H5MA 3BJ7A 3N7ZA 1QSTA 2OZGA 3P2HA 3EFAA 2Q7BA 1N71A 3I9SA 2FCKA 3S6KA 5KTDA 2WPXA 3EY5A 3EO4A 4KOSA 4R57A 2VEZA 4KOWA 3VWEA 3RYOA 4LX9A 3TO9A 4XPLA 1S7KA 3LODA 2ATRA 3MGDA 3R1KA 1M4GA 4BMHA 2HQYA 1IYLA 4ORFA 1L0CA 2FT0A 1MK4A 2VBQA 4H6ZA 1Q2YA 3UY5A 4L8AA 2BL1A 4YRHA 5C88A 5KTAA 2RC4A 1RXTA 4UA3A 2X7BA 3IGRA 3TT2A 4F0YA 1BO4A 2JDDA 2AJ6A 1MJAA 3JUWA 4JXQA 4FD5A 3FIXA 1OZPA 1QSMA 4R3LA 2OH1A 4R9MA 4PSWA 5F49A 2VQYA 4X5KA 1I21A 2BUEA 3R96A 1IB1E 4XPDB 5ISVA 2R7HA 2JEVA 4QVTA 4KZTA 5KTCA 4KVOE 3R9GA 1S5KA 2GE3A 2CNTA 3T90A 1Y9WA 4IUSA 4QB9A 3TOBA 2B5GB 1XMTA 1PU9A 1WK4A 5IV0A 4I49A 3FBUA 4XPDC 4XNHB 1KZFA 3PGPA 1IYKA 2FIWA 2KCWA 1S7FA 1IIDA 3ZZIA 4M85A 5E96A 4AG9A 4OAEA 5IX3A 4PV6A 4CAWA 1YX0A 2R98A 2JDCA 2VZYA 4F6AA
chains in the Genus database with same CATH superfamily
4P44A 3JVNA 4FD4A 4KORA 3RO0A 3FNCA 4P4EA 4AVBA 3SJGA 3PP9A 2C6CA 3F5BA 3CXSA 2ZW5A 3TO7A 3H4QA 4NGSA 4GXHA 4KLVA 5I0CA 2QECA 4A37A 4UCPA 1Z2LA 1YW4A 1LANA 2B3UA 2EUIA 2GLJA 1XEBA 2PJ6A 4KUBA 4UEFA 1KUVA 4A95A 2EK9A 4GS4A 2OR4A 2FSRA 4CPAA 5I4MA 3FMCA 2C6GA 4OKOA 3IEHA 3R9EA 3RBUA 3SXNA 4JXRA 3WC7A 3PB9X 4ZX9A 4MCPA 2C1CA 1A2ZA 3K9TA 1YSJA 2PRQA 1HEEA 1B87A 1ZG9A 2PJ2A 3GYAA 1IU8A 4NJRA 4KSFA 4P6YA 3TC8A 3W6XA 4KUAA 1YQEA 1Z4RA 1NSLA 2Q0YA 3BJ8A 5DWNA 4QUSA 3DR6A 4E0AA 4II9A 5FVJA 4O23A 3FF3A 4OIWA 1VGYA 3I3GA 3TO6A 2Z3KA 3IU1A 4MFKA 4MY0A 1TKFA 2EWBA 1Z8LA 3NE7A 3PB7X 2GFQA 2FS5A 2ZOGA 3QAYA 1WWZA 2AFZA 2R8VA 4KVME 3BXMA 4OMEA 1QSOA 2BEIA 1TXRA 2ZEDA 3PFEA 4ZYQA 2ZELA 5H84A 4IHMA 4X8IA 1TIQA 2Z3NA 1LFWA 2J9AA 2HV2A 3B3WA 4MJ8A 5GCNA 2OOTA 4ZX8A 5J8FA 1QSRA 4U9ZA 1LCPA 4F9VA 2BSWA 3GY9A 3NH8A 3TTHA 4TWEA 1R57A 4FD7A 2ZW7A 4R76A 4UIBA 2A4NA 2G3AA 4R87A 2FE7A 2PC1A 3BLNA 4LQGA 3GLJA 1Y0YA 2EO8A 3K9UA 3H8EA 3B3VA 1MJ9A 4MXUA 2F5IA 1AYEA 3PZJA 3DSBA 4NF1A 5HMNA 3TFYA 1EE3P 3D8PA 3FEDA 4MBUA 4CGOA 3G3SA 2JLMA 1VHEA 4TNUA 2B3VA 2DEAA 2CTBA 3BI0A 3QNVA 4OC3A 1RO5A 1XIXA 2QVPA 2FL4A 4RI1A 5LRKA 3CPXA 4YU9A 3RAMA 3IU2A 2PJ1A 3WABA 2ZEGA 2QYVA 4BBHA 4OP4A 4QC6A 5LYFA 3SI1A 2YNCA 3PEIA 2WYRA 3HLPA 4PK2A 3IC1A 2P6GA 4C2YA 4CYNA 2J8RA 2Z10A 1UWYA 2PCUA 4A94A 2FIAA 2PVWA 4ONUA 4OC2A 1FY7A 2ZEOA 2YNDA 4U5YA 5THWA 2AE6A 2PE3A 5F48A 2Y0MA 2V8DA 4HKFA 2Q4YA 3D4UA 3TCVA 2PIYA 4B14A 6CPAA 2VL1A 3PB4X 1TF8A 2ZW4A 1YK3A 2ARHA 3FH4A 4PXEA 4PQAA 2WPWA 3F0AA 4NCZA 3LWUA 3IWGA 4EFDA 1TKHA 4M3SA 4E8OA 2XEJA 1NSAA 3D3SA 3H8GA 4CAVA 2I3CA 4MHDA 3CXQA 4JJXA 2PR8A 4NSQA 4AB7A 3SJXA 1VKCA 4A31A 4BINA 2NMTA 2REFA 2VZZA 3VWDA 3CXPA 3FEEA 1QMUA 4FD6A 3SHPA 1MJBA 3D7GA 4KSIA 2VXKA 4HNYB 4B5OA 2CY2A 3OWCA 1JWQA 2V77A 3SI0A 2B58A 2G9DA 3KHXA 2QJ8A 3B3SA 4UFWA 4MHPA 2GU2A 1Y9KA 2ZEPA 2Q43A 1YR0A 4K30A 2AFMA 3F8KA 5HVGA 1S60A 4GM5A 3IIBA 1KUXA 3KZWA 4P4JA 2DF5A 4MFQA 4PPZA 1DE4C 5AG6A 1KUYA 1CJWA 2V8GA 1M4LA 2WZNA 2ZPAA 4NXYA 5CPAA 3R95A 4P10A 3S6HA 4DNCA 4AVAA 2PJCA 4ZGYB 2FXFA 4P45A 3DGVA 4HNWB 2PR1A 2Q44A 4DUKA 2CTCA 3JRUA 4X2TA 3R9FA 3EC4A 5G20A 1Y7EA 1P4NA 1U6MA 4NJQA 5EMIA 4ZY1A 1YGHA 2PJ7A 2G0BA 4KOTA 4PXBA 1M44A 2D4PA 2ZEHA 2QIRA 2XEFA 2Z0ZA 5EC4A 1GYTA 4JLYA 4HNXB 1IY7A 3KHZA 1ZO0A 2Q4VA 3CZXA 1Z9UA 4F0XA 1Z8WA 2P6EA 2B4DA 2O53A 4UFXA 5H86A 3WC5A 2B4DB 4F9UA 3CPAA 5LRGA 3KL9A 4A30A 3B8GA 4UCNA 2JBKA 3MN8A 4OLLA 2DPTA 1YVKA 2PJAA 3GB0A 5HVHA 1ELLP 1LRZA 2Q04A 4XPKA 3PRTA 3GKRA 4CS0B 5HXDA 4B5PA 2BOAA 4U9YA 1IOFA 3CDXA 5IB9A 3KGQA 3KKWA 1KWMA 3ISZA 3NE8A 2PVVA 1M4DA 2F7VA 2J8MA 2PQ8A 3SXOA 1Q2DA 3G8WA 3BI1A 3KR4A 1LOKA 3ZJ0A 4AVCA 4OADA 1ZG7A 1VHSA 4R3KA 4X3RA 2AFOA 3DR8A 5AG5A 5DWMA 1ON0A 3B35A 1I1DA 1QSNA 2EBJA 3V8IA 4YFJA 1V0CA 4CRZB 2WSAA 4IF5A 4R8FA 3FVLA 4L89A 2C6PA 1S7LA 4A32A 4MHYA 3TOAA 1XE4A 8CPAA 4UFVA 2RB7A 3WC6A 1SQHA 3NH5A 3RZAA 1VHOA 4Q38A 4F8ZA 1F2OA 1HDUA 2YNCC 3N5FA 5DS0A 3BHXA 1XMBA 2QMLA 4RN7A 1H8LA 1IOIA 4PXCA 3W6SA 1BAVA 3NA6A 2OZUA 4AG7A 3B3TA 3SI2A 3QB8A 1Q2CA 2B4BA 1CM0A 4PK3A 4HPSA 3WR7A 1NMTA 1CBXA 1Q7LA 3IJ3A 3PB6X 1M1DA 2PJ0A 1S3ZA 4J3GA 2ZXVA 2PDOA 3P2FA 5C82A 4ZY2A 2CIJA 2D4OA 2Q51A 4K3NA 4MCQA 4CGMA 1ZLHA 1GHEA 4NFRA 2ANPA 5HH1A 4CYPA 5JQ4A 5CNPA 1S7NA 2BCOA 2HC9A 2RFHA 2VI7A 3V7ZA 1CPXA 3ISXA 2I00A 2NSMA 4NGPA 5G1ZA 2G3TA 2PJ5A 1XF8A 2WUUA 4NGQA 4YGOA 5JGFA 1Z8TA 3FJUA 2JBJA 4FBEA 3D2PA 3PBBA 2PRBA 4KSAA 2B5GA 3V38A 4MY3A 3NFZA 1YREA 1AUGA 5AG4A 2AFSA 2P6FA 4LUAA 2K5TA 3GIUA 3D7DA 4KOUA 1M4IA 2Q7SA 2ZW6A 4PSXA 5JPHA 2CNSA 2GIVA 1F2PA 4E2AA 1J4JA 4FUUA 2R1IA 1BOBA 3K2KA 3KR5A 4EMEA 5K8PA 4MFLA 1YLEA 5LYIA 2J8NA 2OU2A 3FXTA 3IWWA 4NGRA 3IWEA 5F46A 3LD2A 4P4FA 5EBVA 5F09A 4KLWA 3S6GA 4UIAA 4Y49C 2F8HA 2GANA 5F47A 2ZEMA 1Z4EA 4KOYA 1K4JA 4MHZA 5J1QA 4PXDA 4P4IA 1XJOA 3PFOA 4R6TA 3H8FA 1CG2A 5AG7A 4EWTA 2DXQA 1NE9A 2EK8A 5J8CA 3E0KA 3MRUA 4KOVA 1X10A 1R43A 5LYDA 4C2XA 4Y49B 4B12A 5JM6A 4Q7AA 2ODFA 4CRYB 3FX6A 3LMSA 1VIXA 4UWIA 4B5PB 4RS2A 1ZLIA 3KI9A 2Z11A 2OZHA 2PJ9A 5ELYA 3TE4A 5K8NA 4M6HA 1FT7A 1BLLE 4MRIA 3D66A 3IFEA 3QAHA 1BPMA 3T9YA 3FB3A 4UBRA 2PSWA 2C27A 2I79A 4C7HA 5IB0A 1QQ9A 1OBRA 3S6FA 4CGNA 5G22A 3DDDA 2IMOA 4OC4A 2IL4A 2REEA 4KVXA 2CNMA 5D8NA 2CF4A 2OB0A 4KS9A 5JH9A 4XNHC 4H6UA 3FECA 1CPSA 4NEXA 4UWJA 4CAFA 4FAIA 4M6IA 3W91A 2AFXA 1P0HA 3D2MA 3VH9A 4CAXA 5LYLA 5K8MA 4H2KA 4P4DA 4B13A 3CT9A 4MI4A 3FYNA 1I12A 3RNZA 4M6GA 2Q4ZA 4IK2A 4UEZA 1UFHA 2P0WA 3TX8A 4JD6A 4H89A 4JWPA 3S9LA 2O28A 2ABZA 2EVNA 2HUZA 3FRMA 4A33A 3EXNA 4R7MA 2XEIA 3DNSA 4QBJA 2ZENA 5K8OA 1IICA 1XOVA 1PUAA 4Z65A 1IGBA 1B6BA 3B2YA 1JQGA 1Y7RA 5LRJA 4CAEA 2PJ8A 3SJFA 4EVYA 3L2NA 3PB8X 4C68A 3C26A 2CXAA 4KOXA 4JZ0A 4ZBGA 5CBMA 7CPAA 4C2ZA 1YVOA 2H5MA 3BJ7A 3N7ZA 1QSTA 1ARLA 2OZGA 4IAVA 4Q36A 2PIZA 3P2HA 3B7IA 3KQXA 4DYOA 3EFAA 2Q7BA 1N71A 3I9SA 2FCKA 3S6KA 5KTDA 2WPXA 3EY5A 4A38A 2ZEEA 4CYOA 3EO4A 4G1PA 4KOSA 4OIDA 4R57A 3WT4A 3KASA 4MFJA 2VEZA 2AFUA 2NYQA 4KOWA 2YGWA 4YWYA 4LX9A 3RYOA 3VWEA 2Z3LA 3VARA 1FNOA 3TO9A 4XPLA 1S7KA 4B11A 3LODA 1PCAA 2ATRA 3MGDA 1M4GA 3R1KA 1F57A 1BPNA 4BMHA 1DTDA 1IYLA 2HQYA 4ORFA 1L0CA 1ARMA 4NGMA 2IQ6A 2FT0A 1MK4A 2Z3OA 1Y0RA 2VBQA 4H6ZA 1Q2YA 1CP6A 4L8AA 2BL1A 4MCRA 4YRHA 3UY5A 5C88A 1XFOA 5KTAA 4CYQA 2RC4A 1RXTA 4UA3A 2X7BA 3IGRA 3TT2A 4BD9A 4F0YA 1ELMP 2HB6A 2PJ3A 1BO4A 2AFWA 1YW6A 2BO9A 4AXVA 1YMEA 2JDDA 5D29A 2AJ6A 1MJAA 2FVGA 1LAPA 3I1UA 3S9NA 3JUWA 2XEGA 4JXQA 1XBUA 1TF9A 1PYTB 1TKJA 2Z3MA 2ZOFA 4MFPA 4FD5A 3FIXA 1OZPA 2PJ4A 4W9YA 5BWAB 2IJZA 2POKA 1QSMA 1RTQA 5A28A 4R3LA 3SJEA 2OH1A 1ZG8A 3NH4A 1Z5RA 3IO1A 4R9MA 3VATA 4RUHA 4OC0A 3KQZA 1X12A 4PSWA 5F49A 4DJLA 2VQYA 4X5KA 1I21A 2BUEA 2Z3PA 3R96A 1IB1E 3HUVA 4XPDB 5ISVA 2R7HA 2JEVA 4OC5A 2JEWA 3H5ZA 4QVTA 4KZTA 4WWVA 1LAMA 1YLOA 2O4HA 4ONWA 5KTCA 4KVOE 4WJBA 4UCMA 3R9GA 3D67A 1S5KA 2GE3A 4ZY0A 3PBEA 2PJBA 2CNTA 3T90A 4A2ZA 5G21A 1Y9WA 4IUSA 4NGTA 4MFZA 4QB9A 4C7IA 3TOBA 2B5GB 3D7HA 1XMTA 1PU9A 1WK4A 4CGPA 5IV0A 3JTKA 1Z8XA 2V8VA 2V8HA 4I49A 4OC1A 3FBUA 2ZEFA 4B10A 4XPDC 3DLJA 1KZFA 3A9LA 4XNHB 3GUXA 3PGPA 3S9MA 1IYKA 2DPSA 2FIWA 4MCSA 4B6ZA 2KCWA 1S7FA 4P4BA 4UEEA 4JYWA 1IIDA 4MHNA 1AMPA 1HDQA 4FWUA 3D68A 5AGEA 3D7FA 5HVFA 2GREA 1XRYA 2YNEA 3LACA 3ZZIA 3B3CA 4A39A 4M85A 5E96A 4AG9A 4CGLA 1CX8A 5A27A 2GLFA 4UF4A 4OAEA 3T8WA 5IX3A 4PV6A 4CAWA 1R3NA 1YX0A 4ZI6A 4LQ6A 2R98A 1CP7A 2JDCA 2VZYA 4F6AA 4MMOA 4NGNA
chains in the Genus database with same CATH topology
3JVNA 4FD4A 4KORA 3FNCA 4AVBA 3PP9A 3F5BA 3CXSA 2ZW5A 3TO7A 3H4QA 4KLVA 5I0CA 2QECA 4UCPA 2B3UA 2EUIA 1XEBA 4KUBA 1KUVA 4A95A 4GS4A 2FSRA 3SXNA 3R9EA 4JXRA 3GYAA 1B87A 4KSFA 3W6XA 4KUAA 1Z4RA 1NSLA 2Q0YA 3BJ8A 5DWNA 4QUSA 3DR6A 4E0AA 4II9A 5FVJA 3I3GA 3TO6A 2Z3KA 3IU1A 4MFKA 4MY0A 3NE7A 2FS5A 4KVME 1WWZA 2R8VA 1QSOA 2BEIA 5H84A 1TIQA 2Z3NA 5GCNA 2HV2A 4MJ8A 5J8FA 1QSRA 4U9ZA 2BSWA 3GY9A 3TTHA 1R57A 4FD7A 2ZW7A 2A4NA 2G3AA 4R87A 2FE7A 2PC1A 3BLNA 3K9UA 1MJ9A 2F5IA 3PZJA 4NF1A 3DSBA 5HMNA 3TFYA 3D8PA 4MBUA 4CGOA 3G3SA 2JLMA 2B3VA 1RO5A 1XIXA 4RI1A 2FL4A 3IU2A 4BBHA 4QC6A 2YNCA 4PK2A 2P6GA 4C2YA 4CYNA 2J8RA 2Z10A 2FIAA 4ONUA 1FY7A 4U5YA 2YNDA 2AE6A 5F48A 2Y0MA 4HKFA 2Q4YA 3TCVA 4B14A 2ZW4A 1YK3A 2ARHA 2WPWA 3F0AA 4NCZA 3IWGA 4M3SA 4E8OA 3D3SA 4CAVA 4MHDA 3CXQA 4JJXA 2PR8A 4NSQA 4AB7A 1VKCA 4A31A 2NMTA 2REFA 2VZZA 3VWDA 3CXPA 4FD6A 3SHPA 1MJBA 2VXKA 4HNYB 4B5OA 2CY2A 3OWCA 2B58A 4UFWA 1Y9KA 1YR0A 4K30A 3F8KA 1S60A 1KUXA 4MFQA 5AG6A 1KUYA 1CJWA 3R95A 4NXYA 2ZPAA 3S6HA 4DNCA 4AVAA 4ZGYB 2FXFA 4HNWB 2PR1A 2Q44A 3R9FA 3EC4A 5G20A 1P4NA 1U6MA 1YGHA 2G0BA 4KOTA 1M44A 2D4PA 5EC4A 2QIRA 2Z0ZA 4JLYA 4HNXB 1ZO0A 2Q4VA 1Z9UA 4F0XA 2P6EA 2B4DA 4UFXA 5H86A 2B4DB 4A30A 3B8GA 4UCNA 4OLLA 2DPTA 1YVKA 1LRZA 2Q04A 4XPKA 4CS0B 3GKRA 4B5PA 4U9YA 3KKWA 1M4DA 2J8MA 2PQ8A 3SXOA 1Q2DA 3G8WA 3ZJ0A 4AVCA 4OADA 1VHSA 4R3KA 5AG5A 3DR8A 5DWMA 1ON0A 1I1DA 1QSNA 3V8IA 4YFJA 1V0CA 4CRZB 2WSAA 4IF5A 4L89A 4A32A 1S7LA 3TOAA 1XE4A 4UFVA 1SQHA 4Q38A 2YNCC 2QMLA 3W6SA 2OZUA 4AG7A 3QB8A 1Q2CA 2B4BA 1CM0A 4PK3A 3WR7A 1NMTA 1M1DA 1S3ZA 4J3GA 2ZXVA 2PDOA 3P2FA 5C82A 2D4OA 4CGMA 1GHEA 5HH1A 4CYPA 5JQ4A 5CNPA 1S7NA 2VI7A 2I00A 5G1ZA 2G3TA 1XF8A 2WUUA 4YGOA 3D2PA 2PRBA 4KSAA 2B5GA 4MY3A 1YREA 5AG4A 4LUAA 2P6FA 2K5TA 4KOUA 1M4IA 2ZW6A 4PSXA 5JPHA 2CNSA 2GIVA 4E2AA 1J4JA 2R1IA 1BOBA 4MFLA 1YLEA 2J8NA 2OU2A 3FXTA 3IWEA 5F46A 3LD2A 5EBVA 4KLWA 3S6GA 4Y49C 2GANA 5F47A 4KOYA 1Z4EA 1K4JA 5AG7A 2DXQA 1NE9A 5J8CA 3E0KA 4KOVA 4C2XA 4Y49B 4B12A 4CRYB 4UWIA 4B5PB 4RS2A 2Z11A 2OZHA 3TE4A 3QAHA 3T9YA 3FB3A 4UBRA 2PSWA 2C27A 2I79A 4C7HA 5IB0A 3S6FA 4CGNA 5G22A 3DDDA 2IL4A 4KVXA 2REEA 2CNMA 2OB0A 4KS9A 4XNHC 4H6UA 4NEXA 4UWJA 4CAFA 3W91A 1P0HA 3D2MA 4CAXA 4B13A 4MI4A 3FYNA 1I12A 1UFHA 2P0WA 4JD6A 4H89A 4JWPA 2O28A 3FRMA 2EVNA 2HUZA 4A33A 3EXNA 3DNSA 4QBJA 1IICA 1PUAA 1B6BA 1Y7RA 4CAEA 4EVYA 4C68A 3C26A 2CXAA 4KOXA 4ZBGA 4C2ZA 1YVOA 2H5MA 3BJ7A 3N7ZA 1QSTA 2OZGA 4Q36A 3P2HA 3EFAA 2Q7BA 1N71A 3I9SA 2FCKA 3S6KA 5KTDA 2WPXA 3EY5A 4CYOA 3EO4A 4KOSA 4R57A 4MFJA 2VEZA 4KOWA 3VWEA 2YGWA 3RYOA 4LX9A 2Z3LA 3TO9A 4XPLA 1S7KA 4B11A 3LODA 2ATRA 3MGDA 3R1KA 1M4GA 4BMHA 2HQYA 1IYLA 4ORFA 1L0CA 2FT0A 1MK4A 2Z3OA 2VBQA 4H6ZA 1Q2YA 3UY5A 4L8AA 2BL1A 4YRHA 5C88A 5KTAA 4CYQA 2RC4A 1RXTA 4UA3A 2X7BA 3IGRA 3TT2A 4F0YA 1BO4A 2JDDA 2AJ6A 1MJAA 3JUWA 4JXQA 2Z3MA 4MFPA 4FD5A 3FIXA 1OZPA 5BWAB 1QSMA 5A28A 4R3LA 2OH1A 4R9MA 4PSWA 5F49A 2VQYA 4X5KA 1I21A 2BUEA 2Z3PA 3R96A 1IB1E 4XPDB 5ISVA 2R7HA 2JEVA 3H5ZA 4QVTA 4KZTA 5KTCA 4KVOE 3R9GA 4UCMA 1S5KA 2GE3A 2CNTA 3T90A 4A2ZA 5G21A 1Y9WA 4IUSA 4MFZA 4QB9A 4C7IA 3TOBA 2B5GB 1XMTA 1PU9A 1WK4A 4CGPA 5IV0A 3JTKA 4I49A 3FBUA 4B10A 4XPDC 4XNHB 1KZFA 3A9LA 3PGPA 1IYKA 2DPSA 2FIWA 2KCWA 1S7FA 1IIDA 5AGEA 2YNEA 3ZZIA 4M85A 5E96A 4AG9A 4CGLA 5A27A 4OAEA 5IX3A 4PV6A 4CAWA 1YX0A 2R98A 2JDCA 2VZYA 4F6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JVN A;  4FD4 A;  4KOR A;  3FNC A;  4AVB A;  3PP9 A;  3F5B A;  3CXS A;  2ZW5 A;  3TO7 A;  3H4Q A;  4KLV A;  5I0C A;  2QEC A;  2B3U A;  2EUI A;  1XEB A;  4KUB A;  1KUV A;  4GS4 A;  2FSR A;  3SXN A;  3R9E A;  4JXR A;  3GYA A;  1B87 A;  3W6X A;  4KUA A;  1Z4R A;  1NSL A;  2Q0Y A;  3BJ8 A;  5DWN A;  4QUS A;  3DR6 A;  4E0A A;  4II9 A;  5FVJ A;  3I3G A;  3TO6 A;  4MY0 A;  3NE7 A;  2FS5 A;  4KVM E;  1WWZ A;  2R8V A;  1QSO A;  2BEI A;  5H84 A;  1TIQ A;  5GCN A;  2HV2 A;  4MJ8 A;  5J8F A;  1QSR A;  4U9Z A;  2BSW A;  3GY9 A;  3TTH A;  1R57 A;  4FD7 A;  2ZW7 A;  2A4N A;  2G3A A;  4R87 A;  2FE7 A;  2PC1 A;  3BLN A;  3K9U A;  1MJ9 A;  2F5I A;  3PZJ A;  4NF1 A;  3DSB A;  5HMN A;  3TFY A;  3D8P A;  4MBU A;  3G3S A;  2JLM A;  2B3V A;  1RO5 A;  1XIX A;  4RI1 A;  2FL4 A;  4QC6 A;  4PK2 A;  2P6G A;  2J8R A;  2Z10 A;  2FIA A;  4ONU A;  1FY7 A;  4U5Y A;  2AE6 A;  5F48 A;  2Y0M A;  4HKF A;  2Q4Y A;  3TCV A;  2ZW4 A;  1YK3 A;  2ARH A;  2WPW A;  4NCZ A;  3F0A A;  3IWG A;  4M3S A;  4E8O A;  3D3S A;  4CAV A;  4MHD A;  3CXQ A;  4JJX A;  2PR8 A;  4NSQ A;  4AB7 A;  1VKC A;  2NMT A;  2REF A;  2VZZ A;  3VWD A;  3CXP A;  4FD6 A;  3SHP A;  1MJB A;  2VXK A;  4HNY B;  4B5O A;  2CY2 A;  3OWC A;  2B58 A;  1Y9K A;  1YR0 A;  4K30 A;  3F8K A;  1S60 A;  1KUX A;  1KUY A;  1CJW A;  3R95 A;  4NXY A;  2ZPA A;  3S6H A;  4DNC A;  4AVA A;  2FXF A;  4HNW B;  2PR1 A;  2Q44 A;  3R9F A;  3EC4 A;  1P4N A;  1U6M A;  1YGH A;  2G0B A;  4KOT A;  1M44 A;  2D4P A;  5EC4 A;  2QIR A;  2Z0Z A;  4JLY A;  4HNX B;  2Q4V A;  1Z9U A;  2P6E A;  2B4D A;  5H86 A;  2B4D B;  3B8G A;  4OLL A;  1YVK A;  1LRZ A;  2Q04 A;  4XPK A;  4CS0 B;  3GKR A;  4B5P A;  4U9Y A;  3KKW A;  1M4D A;  2J8M A;  2PQ8 A;  3SXO A;  1Q2D A;  3G8W A;  3ZJ0 A;  4AVC A;  4OAD A;  1VHS A;  4R3K A;  3DR8 A;  5DWM A;  1ON0 A;  1I1D A;  1QSN A;  3V8I A;  4YFJ A;  1V0C A;  4CRZ B;  4IF5 A;  4L89 A;  1S7L A;  3TOA A;  1XE4 A;  1SQH A;  2QML A;  3W6S A;  2OZU A;  4AG7 A;  3QB8 A;  1Q2C A;  2B4B A;  1CM0 A;  4PK3 A;  3WR7 A;  1NMT A;  1M1D A;  1S3Z A;  4J3G A;  2ZXV A;  2PDO A;  3P2F A;  5C82 A;  2D4O A;  1GHE A;  5HH1 A;  5JQ4 A;  5CNP A;  1S7N A;  2VI7 A;  2I00 A;  2G3T A;  1XF8 A;  4YGO A;  3D2P A;  2PRB A;  2B5G A;  4MY3 A;  1YRE A;  2P6F A;  4LUA A;  2K5T A;  4KOU A;  1M4I A;  2ZW6 A;  4PSX A;  5JPH A;  2CNS A;  2GIV A;  4E2A A;  1J4J A;  2R1I A;  1BOB A;  1YLE A;  2J8N A;  2OU2 A;  3FXT A;  5F46 A;  3LD2 A;  5EBV A;  4KLW A;  3S6G A;  4Y49 C;  2GAN A;  5F47 A;  4KOY A;  1Z4E A;  1K4J A;  2DXQ A;  1NE9 A;  5J8C A;  3E0K A;  4KOV A;  4Y49 B;  4CRY B;  4UWI A;  4B5P B;  4RS2 A;  2Z11 A;  2OZH A;  3TE4 A;  3QAH A;  3T9Y A;  3FB3 A;  4UBR A;  2PSW A;  2C27 A;  2I79 A;  5IB0 A;  3S6F A;  3DDD A;  2IL4 A;  4KVX A;  2REE A;  2CNM A;  2OB0 A;  4XNH C;  4H6U A;  4NEX A;  4UWJ A;  3W91 A;  1P0H A;  3D2M A;  4CAX A;  4MI4 A;  3FYN A;  1I12 A;  1UFH A;  2P0W A;  4JD6 A;  4H89 A;  4JWP A;  2O28 A;  3FRM A;  2EVN A;  2HUZ A;  3EXN A;  3DNS A;  4QBJ A;  1IIC A;  1PUA A;  1B6B A;  1Y7R A;  4EVY A;  3C26 A;  4KOX A;  4ZBG A;  1YVO A;  2H5M A;  3BJ7 A;  3N7Z A;  1QST A;  2OZG A;  3P2H A;  3EFA A;  2Q7B A;  1N71 A;  3I9S A;  2FCK A;  3S6K A;  5KTD A;  2WPX A;  3EY5 A;  3EO4 A;  4KOS A;  4R57 A;  2VEZ A;  4KOW A;  3VWE A;  3RYO A;  4LX9 A;  3TO9 A;  4XPL A;  1S7K A;  3LOD A;  2ATR A;  3MGD A;  3R1K A;  1M4G A;  4BMH A;  2HQY A;  1IYL A;  4ORF A;  1L0C A;  2FT0 A;  1MK4 A;  2VBQ A;  4H6Z A;  1Q2Y A;  3UY5 A;  4L8A A;  2BL1 A;  4YRH A;  5C88 A;  5KTA A;  2RC4 A;  1RXT A;  4UA3 A;  2X7B A;  3IGR A;  3TT2 A;  4F0Y A;  1BO4 A;  2JDD A;  2AJ6 A;  1MJA A;  3JUW A;  4JXQ A;  4FD5 A;  3FIX A;  1OZP A;  1QSM A;  4R3L A;  2OH1 A;  4R9M A;  4PSW A;  5F49 A;  2VQY A;  4X5K A;  1I21 A;  2BUE A;  3R96 A;  1IB1 E;  4XPD B;  5ISV A;  2R7H A;  2JEV A;  4QVT A;  4KZT A;  5KTC A;  4KVO E;  3R9G A;  1S5K A;  2GE3 A;  2CNT A;  3T90 A;  1Y9W A;  4IUS A;  4QB9 A;  3TOB A;  2B5G B;  1XMT A;  1PU9 A;  1WK4 A;  5IV0 A;  4I49 A;  3FBU A;  4XPD C;  4XNH B;  1KZF A;  3PGP A;  1IYK A;  2FIW A;  2KCW A;  1S7F A;  1IID A;  3ZZI A;  4M85 A;  5E96 A;  4AG9 A;  4OAE A;  5IX3 A;  4PV6 A;  4CAW A;  1YX0 A;  2R98 A;  2JDC A;  2VZY A;  4F6A A; 
#chains in the Genus database with same CATH topology
 4P44 A;  3JVN A;  4FD4 A;  4KOR A;  3RO0 A;  3FNC A;  4P4E A;  4AVB A;  3SJG A;  3PP9 A;  2C6C A;  3F5B A;  3CXS A;  2ZW5 A;  3TO7 A;  3H4Q A;  4NGS A;  4GXH A;  4KLV A;  5I0C A;  2QEC A;  4A37 A;  4UCP A;  1Z2L A;  1YW4 A;  1LAN A;  2B3U A;  2EUI A;  2GLJ A;  1XEB A;  2PJ6 A;  4KUB A;  4UEF A;  1KUV A;  4A95 A;  2EK9 A;  4GS4 A;  2OR4 A;  2FSR A;  4CPA A;  5I4M A;  3FMC A;  2C6G A;  4OKO A;  3IEH A;  3R9E A;  3RBU A;  3SXN A;  4JXR A;  3WC7 A;  3PB9 X;  4ZX9 A;  4MCP A;  2C1C A;  1A2Z A;  3K9T A;  1YSJ A;  2PRQ A;  1HEE A;  1B87 A;  1ZG9 A;  2PJ2 A;  3GYA A;  1IU8 A;  4NJR A;  4KSF A;  4P6Y A;  3TC8 A;  3W6X A;  4KUA A;  1YQE A;  1Z4R A;  1NSL A;  2Q0Y A;  3BJ8 A;  5DWN A;  4QUS A;  3DR6 A;  4E0A A;  4II9 A;  5FVJ A;  4O23 A;  3FF3 A;  4OIW A;  1VGY A;  3I3G A;  3TO6 A;  2Z3K A;  3IU1 A;  4MFK A;  4MY0 A;  1TKF A;  2EWB A;  1Z8L A;  3NE7 A;  3PB7 X;  2GFQ A;  2FS5 A;  2ZOG A;  3QAY A;  1WWZ A;  2AFZ A;  2R8V A;  4KVM E;  3BXM A;  4OME A;  1QSO A;  2BEI A;  1TXR A;  2ZED A;  3PFE A;  4ZYQ A;  2ZEL A;  5H84 A;  4IHM A;  4X8I A;  1TIQ A;  2Z3N A;  1LFW A;  2J9A A;  2HV2 A;  3B3W A;  4MJ8 A;  5GCN A;  2OOT A;  4ZX8 A;  5J8F A;  1QSR A;  4U9Z A;  1LCP A;  4F9V A;  2BSW A;  3GY9 A;  3NH8 A;  3TTH A;  4TWE A;  1R57 A;  4FD7 A;  2ZW7 A;  4R76 A;  4UIB A;  2A4N A;  2G3A A;  4R87 A;  2FE7 A;  2PC1 A;  3BLN A;  4LQG A;  3GLJ A;  1Y0Y A;  2EO8 A;  3K9U A;  3H8E A;  3B3V A;  1MJ9 A;  4MXU A;  2F5I A;  1AYE A;  3PZJ A;  3DSB A;  4NF1 A;  5HMN A;  3TFY A;  1EE3 P;  3D8P A;  3FED A;  4MBU A;  4CGO A;  3G3S A;  2JLM A;  1VHE A;  4TNU A;  2B3V A;  2DEA A;  2CTB A;  3BI0 A;  3QNV A;  4OC3 A;  1RO5 A;  1XIX A;  2QVP A;  2FL4 A;  4RI1 A;  5LRK A;  3CPX A;  4YU9 A;  3RAM A;  3IU2 A;  2PJ1 A;  3WAB A;  2ZEG A;  2QYV A;  4BBH A;  4OP4 A;  4QC6 A;  5LYF A;  3SI1 A;  2YNC A;  3PEI A;  2WYR A;  3HLP A;  4PK2 A;  3IC1 A;  2P6G A;  4C2Y A;  4CYN A;  2J8R A;  2Z10 A;  1UWY A;  2PCU A;  4A94 A;  2FIA A;  2PVW A;  4ONU A;  4OC2 A;  1FY7 A;  2ZEO A;  2YND A;  4U5Y A;  5THW A;  2AE6 A;  2PE3 A;  5F48 A;  2Y0M A;  2V8D A;  4HKF A;  2Q4Y A;  3D4U A;  3TCV A;  2PIY A;  4B14 A;  6CPA A;  2VL1 A;  3PB4 X;  1TF8 A;  2ZW4 A;  1YK3 A;  2ARH A;  3FH4 A;  4PXE A;  4PQA A;  2WPW A;  3F0A A;  4NCZ A;  3LWU A;  3IWG A;  4EFD A;  1TKH A;  4M3S A;  4E8O A;  2XEJ A;  1NSA A;  3D3S A;  3H8G A;  4CAV A;  2I3C A;  4MHD A;  3CXQ A;  4JJX A;  2PR8 A;  4NSQ A;  4AB7 A;  3SJX A;  1VKC A;  4A31 A;  4BIN A;  2NMT A;  2REF A;  2VZZ A;  3VWD A;  3CXP A;  3FEE A;  1QMU A;  4FD6 A;  3SHP A;  1MJB A;  3D7G A;  4KSI A;  2VXK A;  4HNY B;  4B5O A;  2CY2 A;  3OWC A;  1JWQ A;  2V77 A;  3SI0 A;  2B58 A;  2G9D A;  3KHX A;  2QJ8 A;  3B3S A;  4UFW A;  4MHP A;  2GU2 A;  1Y9K A;  2ZEP A;  2Q43 A;  1YR0 A;  4K30 A;  2AFM A;  3F8K A;  5HVG A;  1S60 A;  4GM5 A;  3IIB A;  1KUX A;  3KZW A;  4P4J A;  2DF5 A;  4MFQ A;  4PPZ A;  1DE4 C;  5AG6 A;  1KUY A;  1CJW A;  2V8G A;  1M4L A;  2WZN A;  2ZPA A;  4NXY A;  5CPA A;  3R95 A;  4P10 A;  3S6H A;  4DNC A;  4AVA A;  2PJC A;  4ZGY B;  2FXF A;  4P45 A;  3DGV A;  4HNW B;  2PR1 A;  2Q44 A;  4DUK A;  2CTC A;  3JRU A;  4X2T A;  3R9F A;  3EC4 A;  5G20 A;  1Y7E A;  1P4N A;  1U6M A;  4NJQ A;  5EMI A;  4ZY1 A;  1YGH A;  2PJ7 A;  2G0B A;  4KOT A;  4PXB A;  1M44 A;  2D4P A;  2ZEH A;  2QIR A;  2XEF A;  2Z0Z A;  5EC4 A;  1GYT A;  4JLY A;  4HNX B;  1IY7 A;  3KHZ A;  1ZO0 A;  2Q4V A;  3CZX A;  1Z9U A;  4F0X A;  1Z8W A;  2P6E A;  2B4D A;  2O53 A;  4UFX A;  5H86 A;  3WC5 A;  2B4D B;  4F9U A;  3CPA A;  5LRG A;  3KL9 A;  4A30 A;  3B8G A;  4UCN A;  2JBK A;  3MN8 A;  4OLL A;  2DPT A;  1YVK A;  2PJA A;  3GB0 A;  5HVH A;  1ELL P;  1LRZ A;  2Q04 A;  4XPK A;  3PRT A;  3GKR A;  4CS0 B;  5HXD A;  4B5P A;  2BOA A;  4U9Y A;  1IOF A;  3CDX A;  5IB9 A;  3KGQ A;  3KKW A;  1KWM A;  3ISZ A;  3NE8 A;  2PVV A;  1M4D A;  2F7V A;  2J8M A;  2PQ8 A;  3SXO A;  1Q2D A;  3G8W A;  3BI1 A;  3KR4 A;  1LOK A;  3ZJ0 A;  4AVC A;  4OAD A;  1ZG7 A;  1VHS A;  4R3K A;  4X3R A;  2AFO A;  3DR8 A;  5AG5 A;  5DWM A;  1ON0 A;  3B35 A;  1I1D A;  1QSN A;  2EBJ A;  3V8I A;  4YFJ A;  1V0C A;  4CRZ B;  2WSA A;  4IF5 A;  4R8F A;  3FVL A;  4L89 A;  2C6P A;  1S7L A;  4A32 A;  4MHY A;  3TOA A;  1XE4 A;  8CPA A;  4UFV A;  2RB7 A;  3WC6 A;  1SQH A;  3NH5 A;  3RZA A;  1VHO A;  4Q38 A;  4F8Z A;  1F2O A;  1HDU A;  2YNC C;  3N5F A;  5DS0 A;  3BHX A;  1XMB A;  2QML A;  4RN7 A;  1H8L A;  1IOI A;  4PXC A;  3W6S A;  1BAV A;  3NA6 A;  2OZU A;  4AG7 A;  3B3T A;  3SI2 A;  3QB8 A;  1Q2C A;  2B4B A;  1CM0 A;  4PK3 A;  4HPS A;  3WR7 A;  1NMT A;  1CBX A;  1Q7L A;  3IJ3 A;  3PB6 X;  1M1D A;  2PJ0 A;  1S3Z A;  4J3G A;  2ZXV A;  2PDO A;  3P2F A;  5C82 A;  4ZY2 A;  2CIJ A;  2D4O A;  2Q51 A;  4K3N A;  4MCQ A;  4CGM A;  1ZLH A;  1GHE A;  4NFR A;  2ANP A;  5HH1 A;  4CYP A;  5JQ4 A;  5CNP A;  1S7N A;  2BCO A;  2HC9 A;  2RFH A;  2VI7 A;  3V7Z A;  1CPX A;  3ISX A;  2I00 A;  2NSM A;  4NGP A;  5G1Z A;  2G3T A;  2PJ5 A;  1XF8 A;  2WUU A;  4NGQ A;  4YGO A;  5JGF A;  1Z8T A;  3FJU A;  2JBJ A;  4FBE A;  3D2P A;  3PBB A;  2PRB A;  4KSA A;  2B5G A;  3V38 A;  4MY3 A;  3NFZ A;  1YRE A;  1AUG A;  5AG4 A;  2AFS A;  2P6F A;  4LUA A;  2K5T A;  3GIU A;  3D7D A;  4KOU A;  1M4I A;  2Q7S A;  2ZW6 A;  4PSX A;  5JPH A;  2CNS A;  2GIV A;  1F2P A;  4E2A A;  1J4J A;  4FUU A;  2R1I A;  1BOB A;  3K2K A;  3KR5 A;  4EME A;  5K8P A;  4MFL A;  1YLE A;  5LYI A;  2J8N A;  2OU2 A;  3FXT A;  3IWW A;  4NGR A;  3IWE A;  5F46 A;  3LD2 A;  4P4F A;  5EBV A;  5F09 A;  4KLW A;  3S6G A;  4UIA A;  4Y49 C;  2F8H A;  2GAN A;  5F47 A;  2ZEM A;  1Z4E A;  4KOY A;  1K4J A;  4MHZ A;  5J1Q A;  4PXD A;  4P4I A;  1XJO A;  3PFO A;  4R6T A;  3H8F A;  1CG2 A;  5AG7 A;  4EWT A;  2DXQ A;  1NE9 A;  2EK8 A;  5J8C A;  3E0K A;  3MRU A;  4KOV A;  1X10 A;  1R43 A;  5LYD A;  4C2X A;  4Y49 B;  4B12 A;  5JM6 A;  4Q7A A;  2ODF A;  4CRY B;  3FX6 A;  3LMS A;  1VIX A;  4UWI A;  4B5P B;  4RS2 A;  1ZLI A;  3KI9 A;  2Z11 A;  2OZH A;  2PJ9 A;  5ELY A;  3TE4 A;  5K8N A;  4M6H A;  1FT7 A;  1BLL E;  4MRI A;  3D66 A;  3IFE A;  3QAH A;  1BPM A;  3T9Y A;  3FB3 A;  4UBR A;  2PSW A;  2C27 A;  2I79 A;  4C7H A;  5IB0 A;  1QQ9 A;  1OBR A;  3S6F A;  4CGN A;  5G22 A;  3DDD A;  2IMO A;  4OC4 A;  2IL4 A;  2REE A;  4KVX A;  2CNM A;  5D8N A;  2CF4 A;  2OB0 A;  4KS9 A;  5JH9 A;  4XNH C;  4H6U A;  3FEC A;  1CPS A;  4NEX A;  4UWJ A;  4CAF A;  4FAI A;  4M6I A;  3W91 A;  2AFX A;  1P0H A;  3D2M A;  3VH9 A;  4CAX A;  5LYL A;  5K8M A;  4H2K A;  4P4D A;  4B13 A;  3CT9 A;  4MI4 A;  3FYN A;  1I12 A;  3RNZ A;  4M6G A;  2Q4Z A;  4IK2 A;  4UEZ A;  1UFH A;  2P0W A;  3TX8 A;  4JD6 A;  4H89 A;  4JWP A;  3S9L A;  2O28 A;  2ABZ A;  2EVN A;  2HUZ A;  3FRM A;  4A33 A;  3EXN A;  4R7M A;  2XEI A;  3DNS A;  4QBJ A;  2ZEN A;  5K8O A;  1IIC A;  1XOV A;  1PUA A;  4Z65 A;  1IGB A;  1B6B A;  3B2Y A;  1JQG A;  1Y7R A;  5LRJ A;  4CAE A;  2PJ8 A;  3SJF A;  4EVY A;  3L2N A;  3PB8 X;  4C68 A;  3C26 A;  2CXA A;  4KOX A;  4JZ0 A;  4ZBG A;  5CBM A;  7CPA A;  4C2Z A;  1YVO A;  2H5M A;  3BJ7 A;  3N7Z A;  1QST A;  1ARL A;  2OZG A;  4IAV A;  4Q36 A;  2PIZ A;  3P2H A;  3B7I A;  3KQX A;  4DYO A;  3EFA A;  2Q7B A;  1N71 A;  3I9S A;  2FCK A;  3S6K A;  5KTD A;  2WPX A;  3EY5 A;  4A38 A;  2ZEE A;  4CYO A;  3EO4 A;  4G1P A;  4KOS A;  4OID A;  4R57 A;  3WT4 A;  3KAS A;  4MFJ A;  2VEZ A;  2AFU A;  2NYQ A;  4KOW A;  2YGW A;  4YWY A;  4LX9 A;  3RYO A;  3VWE A;  2Z3L A;  3VAR A;  1FNO A;  3TO9 A;  4XPL A;  1S7K A;  4B11 A;  3LOD A;  1PCA A;  2ATR A;  3MGD A;  1M4G A;  3R1K A;  1F57 A;  1BPN A;  4BMH A;  1DTD A;  1IYL A;  2HQY A;  4ORF A;  1L0C A;  1ARM A;  4NGM A;  2IQ6 A;  2FT0 A;  1MK4 A;  2Z3O A;  1Y0R A;  2VBQ A;  4H6Z A;  1Q2Y A;  1CP6 A;  4L8A A;  2BL1 A;  4MCR A;  4YRH A;  3UY5 A;  5C88 A;  1XFO A;  5KTA A;  4CYQ A;  2RC4 A;  1RXT A;  4UA3 A;  2X7B A;  3IGR A;  3TT2 A;  4BD9 A;  4F0Y A;  1ELM P;  2HB6 A;  2PJ3 A;  1BO4 A;  2AFW A;  1YW6 A;  2BO9 A;  4AXV A;  1YME A;  2JDD A;  5D29 A;  2AJ6 A;  1MJA A;  2FVG A;  1LAP A;  3I1U A;  3S9N A;  3JUW A;  2XEG A;  4JXQ A;  1XBU A;  1TF9 A;  1PYT B;  1TKJ A;  2Z3M A;  2ZOF A;  4MFP A;  4FD5 A;  3FIX A;  1OZP A;  2PJ4 A;  4W9Y A;  5BWA B;  2IJZ A;  2POK A;  1QSM A;  1RTQ A;  5A28 A;  4R3L A;  3SJE A;  2OH1 A;  1ZG8 A;  3NH4 A;  1Z5R A;  3IO1 A;  4R9M A;  3VAT A;  4RUH A;  4OC0 A;  3KQZ A;  1X12 A;  4PSW A;  5F49 A;  4DJL A;  2VQY A;  4X5K A;  1I21 A;  2BUE A;  2Z3P A;  3R96 A;  1IB1 E;  3HUV A;  4XPD B;  5ISV A;  2R7H A;  2JEV A;  4OC5 A;  2JEW A;  3H5Z A;  4QVT A;  4KZT A;  4WWV A;  1LAM A;  1YLO A;  2O4H A;  4ONW A;  5KTC A;  4KVO E;  4WJB A;  4UCM A;  3R9G A;  3D67 A;  1S5K A;  2GE3 A;  4ZY0 A;  3PBE A;  2PJB A;  2CNT A;  3T90 A;  4A2Z A;  5G21 A;  1Y9W A;  4IUS A;  4NGT A;  4MFZ A;  4QB9 A;  4C7I A;  3TOB A;  2B5G B;  3D7H A;  1XMT A;  1PU9 A;  1WK4 A;  4CGP A;  5IV0 A;  3JTK A;  1Z8X A;  2V8V A;  2V8H A;  4I49 A;  4OC1 A;  3FBU A;  2ZEF A;  4B10 A;  4XPD C;  3DLJ A;  1KZF A;  3A9L A;  4XNH B;  3GUX A;  3PGP A;  3S9M A;  1IYK A;  2DPS A;  2FIW A;  4MCS A;  4B6Z A;  2KCW A;  1S7F A;  4P4B A;  4UEE A;  4JYW A;  1IID A;  4MHN A;  1AMP A;  1HDQ A;  4FWU A;  3D68 A;  5AGE A;  3D7F A;  5HVF A;  2GRE A;  1XRY A;  2YNE A;  3LAC A;  3ZZI A;  3B3C A;  4A39 A;  4M85 A;  5E96 A;  4AG9 A;  4CGL A;  1CX8 A;  5A27 A;  2GLF A;  4UF4 A;  4OAE A;  3T8W A;  5IX3 A;  4PV6 A;  4CAW A;  1R3N A;  1YX0 A;  4ZI6 A;  4LQ6 A;  2R98 A;  1CP7 A;  2JDC A;  2VZY A;  4F6A A;  4MMO A;  4NGN A; 
#chains in the Genus database with same CATH homology
 3JVN A;  4FD4 A;  4KOR A;  3FNC A;  4AVB A;  3PP9 A;  3F5B A;  3CXS A;  2ZW5 A;  3TO7 A;  3H4Q A;  4KLV A;  5I0C A;  2QEC A;  4UCP A;  2B3U A;  2EUI A;  1XEB A;  4KUB A;  1KUV A;  4A95 A;  4GS4 A;  2FSR A;  3SXN A;  3R9E A;  4JXR A;  3GYA A;  1B87 A;  4KSF A;  3W6X A;  4KUA A;  1Z4R A;  1NSL A;  2Q0Y A;  3BJ8 A;  5DWN A;  4QUS A;  3DR6 A;  4E0A A;  4II9 A;  5FVJ A;  3I3G A;  3TO6 A;  2Z3K A;  3IU1 A;  4MFK A;  4MY0 A;  3NE7 A;  2FS5 A;  4KVM E;  1WWZ A;  2R8V A;  1QSO A;  2BEI A;  5H84 A;  1TIQ A;  2Z3N A;  5GCN A;  2HV2 A;  4MJ8 A;  5J8F A;  1QSR A;  4U9Z A;  2BSW A;  3GY9 A;  3TTH A;  1R57 A;  4FD7 A;  2ZW7 A;  2A4N A;  2G3A A;  4R87 A;  2FE7 A;  2PC1 A;  3BLN A;  3K9U A;  1MJ9 A;  2F5I A;  3PZJ A;  4NF1 A;  3DSB A;  5HMN A;  3TFY A;  3D8P A;  4MBU A;  4CGO A;  3G3S A;  2JLM A;  2B3V A;  1RO5 A;  1XIX A;  4RI1 A;  2FL4 A;  3IU2 A;  4BBH A;  4QC6 A;  2YNC A;  4PK2 A;  2P6G A;  4C2Y A;  4CYN A;  2J8R A;  2Z10 A;  2FIA A;  4ONU A;  1FY7 A;  4U5Y A;  2YND A;  2AE6 A;  5F48 A;  2Y0M A;  4HKF A;  2Q4Y A;  3TCV A;  4B14 A;  2ZW4 A;  1YK3 A;  2ARH A;  2WPW A;  3F0A A;  4NCZ A;  3IWG A;  4M3S A;  4E8O A;  3D3S A;  4CAV A;  4MHD A;  3CXQ A;  4JJX A;  2PR8 A;  4NSQ A;  4AB7 A;  1VKC A;  4A31 A;  2NMT A;  2REF A;  2VZZ A;  3VWD A;  3CXP A;  4FD6 A;  3SHP A;  1MJB A;  2VXK A;  4HNY B;  4B5O A;  2CY2 A;  3OWC A;  2B58 A;  4UFW A;  1Y9K A;  1YR0 A;  4K30 A;  3F8K A;  1S60 A;  1KUX A;  4MFQ A;  5AG6 A;  1KUY A;  1CJW A;  3R95 A;  4NXY A;  2ZPA A;  3S6H A;  4DNC A;  4AVA A;  4ZGY B;  2FXF A;  4HNW B;  2PR1 A;  2Q44 A;  3R9F A;  3EC4 A;  5G20 A;  1P4N A;  1U6M A;  1YGH A;  2G0B A;  4KOT A;  1M44 A;  2D4P A;  5EC4 A;  2QIR A;  2Z0Z A;  4JLY A;  4HNX B;  1ZO0 A;  2Q4V A;  1Z9U A;  4F0X A;  2P6E A;  2B4D A;  4UFX A;  5H86 A;  2B4D B;  4A30 A;  3B8G A;  4UCN A;  4OLL A;  2DPT A;  1YVK A;  1LRZ A;  2Q04 A;  4XPK A;  4CS0 B;  3GKR A;  4B5P A;  4U9Y A;  3KKW A;  1M4D A;  2J8M A;  2PQ8 A;  3SXO A;  1Q2D A;  3G8W A;  3ZJ0 A;  4AVC A;  4OAD A;  1VHS A;  4R3K A;  5AG5 A;  3DR8 A;  5DWM A;  1ON0 A;  1I1D A;  1QSN A;  3V8I A;  4YFJ A;  1V0C A;  4CRZ B;  2WSA A;  4IF5 A;  4L89 A;  4A32 A;  1S7L A;  3TOA A;  1XE4 A;  4UFV A;  1SQH A;  4Q38 A;  2YNC C;  2QML A;  3W6S A;  2OZU A;  4AG7 A;  3QB8 A;  1Q2C A;  2B4B A;  1CM0 A;  4PK3 A;  3WR7 A;  1NMT A;  1M1D A;  1S3Z A;  4J3G A;  2ZXV A;  2PDO A;  3P2F A;  5C82 A;  2D4O A;  4CGM A;  1GHE A;  5HH1 A;  4CYP A;  5JQ4 A;  5CNP A;  1S7N A;  2VI7 A;  2I00 A;  5G1Z A;  2G3T A;  1XF8 A;  2WUU A;  4YGO A;  3D2P A;  2PRB A;  4KSA A;  2B5G A;  4MY3 A;  1YRE A;  5AG4 A;  4LUA A;  2P6F A;  2K5T A;  4KOU A;  1M4I A;  2ZW6 A;  4PSX A;  5JPH A;  2CNS A;  2GIV A;  4E2A A;  1J4J A;  2R1I A;  1BOB A;  4MFL A;  1YLE A;  2J8N A;  2OU2 A;  3FXT A;  3IWE A;  5F46 A;  3LD2 A;  5EBV A;  4KLW A;  3S6G A;  4Y49 C;  2GAN A;  5F47 A;  4KOY A;  1Z4E A;  1K4J A;  5AG7 A;  2DXQ A;  1NE9 A;  5J8C A;  3E0K A;  4KOV A;  4C2X A;  4Y49 B;  4B12 A;  4CRY B;  4UWI A;  4B5P B;  4RS2 A;  2Z11 A;  2OZH A;  3TE4 A;  3QAH A;  3T9Y A;  3FB3 A;  4UBR A;  2PSW A;  2C27 A;  2I79 A;  4C7H A;  5IB0 A;  3S6F A;  4CGN A;  5G22 A;  3DDD A;  2IL4 A;  4KVX A;  2REE A;  2CNM A;  2OB0 A;  4KS9 A;  4XNH C;  4H6U A;  4NEX A;  4UWJ A;  4CAF A;  3W91 A;  1P0H A;  3D2M A;  4CAX A;  4B13 A;  4MI4 A;  3FYN A;  1I12 A;  1UFH A;  2P0W A;  4JD6 A;  4H89 A;  4JWP A;  2O28 A;  3FRM A;  2EVN A;  2HUZ A;  4A33 A;  3EXN A;  3DNS A;  4QBJ A;  1IIC A;  1PUA A;  1B6B A;  1Y7R A;  4CAE A;  4EVY A;  4C68 A;  3C26 A;  2CXA A;  4KOX A;  4ZBG A;  4C2Z A;  1YVO A;  2H5M A;  3BJ7 A;  3N7Z A;  1QST A;  2OZG A;  4Q36 A;  3P2H A;  3EFA A;  2Q7B A;  1N71 A;  3I9S A;  2FCK A;  3S6K A;  5KTD A;  2WPX A;  3EY5 A;  4CYO A;  3EO4 A;  4KOS A;  4R57 A;  4MFJ A;  2VEZ A;  4KOW A;  3VWE A;  2YGW A;  3RYO A;  4LX9 A;  2Z3L A;  3TO9 A;  4XPL A;  1S7K A;  4B11 A;  3LOD A;  2ATR A;  3MGD A;  3R1K A;  1M4G A;  4BMH A;  2HQY A;  1IYL A;  4ORF A;  1L0C A;  2FT0 A;  1MK4 A;  2Z3O A;  2VBQ A;  4H6Z A;  1Q2Y A;  3UY5 A;  4L8A A;  2BL1 A;  4YRH A;  5C88 A;  5KTA A;  4CYQ A;  2RC4 A;  1RXT A;  4UA3 A;  2X7B A;  3IGR A;  3TT2 A;  4F0Y A;  1BO4 A;  2JDD A;  2AJ6 A;  1MJA A;  3JUW A;  4JXQ A;  2Z3M A;  4MFP A;  4FD5 A;  3FIX A;  1OZP A;  5BWA B;  1QSM A;  5A28 A;  4R3L A;  2OH1 A;  4R9M A;  4PSW A;  5F49 A;  2VQY A;  4X5K A;  1I21 A;  2BUE A;  2Z3P A;  3R96 A;  1IB1 E;  4XPD B;  5ISV A;  2R7H A;  2JEV A;  3H5Z A;  4QVT A;  4KZT A;  5KTC A;  4KVO E;  3R9G A;  4UCM A;  1S5K A;  2GE3 A;  2CNT A;  3T90 A;  4A2Z A;  5G21 A;  1Y9W A;  4IUS A;  4MFZ A;  4QB9 A;  4C7I A;  3TOB A;  2B5G B;  1XMT A;  1PU9 A;  1WK4 A;  4CGP A;  5IV0 A;  3JTK A;  4I49 A;  3FBU A;  4B10 A;  4XPD C;  4XNH B;  1KZF A;  3A9L A;  3PGP A;  1IYK A;  2DPS A;  2FIW A;  2KCW A;  1S7F A;  1IID A;  5AGE A;  2YNE A;  3ZZI A;  4M85 A;  5E96 A;  4AG9 A;  4CGL A;  5A27 A;  4OAE A;  5IX3 A;  4PV6 A;  4CAW A;  1YX0 A;  2R98 A;  2JDC A;  2VZY A;  4F6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...