3R9GA

Crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with coenzyme a and processed microcin c7 antibiotic
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
180
Chain Sequence
DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords MccE protein
publication title Structural Basis for Microcin C7 Inactivation by the MccE Acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
total genus 55
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3r9gA00
1M4GA 2P0WA 2AE6A 3ZZIA 3PGPA 4UBRA 2OZGA 4KOVA 3IGRA 4JXRA 1Q2CA 1ON0A 4E8OA 5I0CA 1MJAA 1L0CA 3TO7A 4JWPA 4L89A 2FIWA 2Q7BA 1MJBA 2VZZA 4ORFA 3R1KA 4QUSA 2JDCA 2PSWA 4J3GA 3TTHA 3JVNA 4KOYA 4PK3A 3S6KA 3DR6A 4QB9A 4PSXA 4HNWB 2R1IA 4QC6A 1IIDA 2VEZA 3CXSA 4M85A 5F49A 1TIQA 4H6UA 1QSMA 2B5GB 2G0BA 4FD4A 5F48A 1RO5A 1WK4A 3RYOA 2O28A 2HQYA 3BJ8A 3S6GA 4HKFA 4MY0A 1M4IA 3GKRA 4MI4A 3TO6A 1BO4A 4KUAA 1PUAA 1S7KA 4XNHC 3SHPA 5J8CA 4JD6A 3DDDA 4KOWA 4M3SA 1QSTA 1YVOA 4QBJA 4B5PA 5H86A 1PU9A 4KVME 1P4NA 3R9EA 3WR7A 4MHDA 5H84A 1I21A 1V0CA 3S6FA 1YR0A 1OZPA 2PC1A 4NSQA 2RC4A 2GIVA 2JEVA 4FD5A 2PDOA 3EO4A 2ZW5A 2PR1A 3IWGA 4ZBGA 3TFYA 1MK4A 4OAEA 2OZUA 3N7ZA 3SXNA 4XNHB 3TE4A 4CRZB 1M44A 1QSRA 4F0YA 2HV2A 2H5MA 2OB0A 4L8AA 3EFAA 1KUYA 3D8PA 2K5TA 4R3KA 1IICA 2WPXA 2C27A 4NXYA 4KOSA 4KLWA 4K30A 4E2AA 4ONUA 3KKWA 3TT2A 4XPDC 2DXQA 4UWIA 1GHEA 4NF1A 2NMTA 2J8NA 2GANA 3F0AA 4HNYB 4I49A 4MY3A 2PQ8A 3F8KA 4UWJA 3PZJA 5KTDA 2ZW7A 2FCKA 1B87A 4KVXA 2FSRA 4R3LA 2REFA 5JPHA 3E0KA 1YREA 3DSBA 2D4OA 3QAHA 2GE3A 3TOBA 5IB0A 3D2MA 1Z9UA 2FE7A 4KZTA 2J8RA 3I9SA 2P6FA 2B3UA 4XPKA 2EVNA 3FNCA 2B4DA 3FYNA 2Z0ZA 4BMHA 3BLNA 2FXFA 2ATRA 3D3SA 4RI1A 4XPDB 2Q0YA 4MBUA 4FD6A 3LD2A 2G3TA 3OWCA 2ZPAA 1BOBA 2WPWA 4Y49C 2QMLA 4JXQA 1Y9WA 4R87A 3G3SA 2EUIA 3R96A 1XE4A 4R9MA 2P6GA 5FVJA 1YGHA 5IX3A 5J8FA 2B4BA 2I00A 3H4QA 2BUEA 3P2FA 4CAXA 3G8WA 3EXNA 1S5KA 4CAWA 2CNMA 3K9UA 3T90A 3V8IA 2ARHA 5IV0A 4KORA 2R7HA 3R9GA 1NSLA 3R9FA 1NE9A 4EVYA 1FY7A 4U9YA 4NCZA 4Y49B 2VZYA 5CNPA 4MJ8A 3R95A 3GY9A 1UFHA 4AVCA 5KTCA 4DNCA 2OH1A 4HNXB 3TCVA 4QVTA 2FL4A 5DWNA 3JUWA 3NE7A 2Q4VA 1KUVA 4XPLA 2QIRA 3EC4A 3C26A 3CXPA 4UA3A 1Y7RA 1YX0A 1IB1E 4CS0B 2Y0MA 1N71A 3PP9A 4X5KA 5HH1A 4B5PB 2B58A 3BJ7A 4IUSA 4AVAA 2JLMA 2I79A 3W6XA 2PRBA 5C82A 1M1DA 4OADA 1S7LA 4NEXA 5HMNA 3TOAA 2X7BA 4IF5A 4F6AA 1QSNA 4YGOA 1SQHA 3LODA 2Z10A 2ZXVA 2PR8A 3VWDA 4KUBA 2BL1A 2D4PA 3EY5A 2CNTA 2B3VA 4KOUA 4II9A 2VXKA 3DNSA 1M4DA 2Q04A 3FB3A 4LUAA 5JQ4A 2J8MA 2VBQA 4CRYB 2Q44A 3P2HA 2F5IA 1J4JA 2AJ6A 4PV6A 4PSWA 4FD7A 5EBVA 1XMTA 2REEA 5KTAA 4H6ZA 4R57A 2CNSA 2B5GA 1B6BA 2CY2A 2R98A 4AG9A 4E0AA 3SXOA 3W91A 1IYLA 1CJWA 2Z11A 1LRZA 1XIXA 2JDDA 1Q2DA 5F47A 2VI7A 5GCNA 3FBUA 4KVOE 3FXTA 5ISVA 3VWEA 3I3GA 5EC4A 2P6EA 4LX9A 2G3AA 2R8VA 4AVBA 1Y9KA 1WWZA 3GYAA 3T9YA 1S7FA 4KOTA 3ZJ0A 2KCWA 1I12A 4KLVA 1P0HA 3W6SA 3FIXA 1KZFA 1XEBA 2B4DB 3CXQA 1XF8A 2VQYA 1MJ9A 5E96A 2FT0A 2BSWA 4CAVA 2BEIA 4U5YA 3S6HA 3D2PA 1VKCA 2FS5A 2IL4A 4YFJA 3MGDA 1Q2YA 4JJXA 2QECA 3UY5A 1RXTA 1CM0A 1YK3A 4OLLA 4B5OA 4RS2A 1KUXA 4PK2A 1S60A 3FRMA 2OU2A 2A4NA 1I1DA 1U6MA 1Z4RA 5C88A 1R57A 4KOXA 2HUZA 2ZW6A 4U9ZA 1K4JA 1IYKA 1S7NA 3B8GA 3F5BA 4GS4A 2FIAA 1S3ZA 2ZW4A 4AB7A 4H89A 5F46A 5DWMA 2OZHA 1NMTA 3TO9A 3DR8A 2Q4YA 4YRHA 1VHSA 3QB8A 4AG7A 4JLYA 1YVKA 1Z4EA 1QSOA 1YLEA
chains in the Genus database with same CATH superfamily
2BCOA 2ZENA 1M4GA 2P0WA 4BD9A 5K8MA 2AE6A 3ZZIA 4Q36A 2PJ1A 2DEAA 3PGPA 4UBRA 2OZGA 2VL1A 4KOVA 2PCUA 1ZG7A 3GIUA 3IGRA 3D7GA 4JXRA 2PE3A 2PJ8A 1CPSA 2C6GA 4UIBA 4MHZA 1YW4A 1Q2CA 3CPXA 4MFQA 1ON0A 4E8OA 2FVGA 4F8ZA 4MFKA 3PBEA 5I0CA 1MJAA 1R43A 1LCPA 1L0CA 3CPAA 3TO7A 1Z8WA 3NA6A 4MFLA 1CP6A 1F57A 1IGBA 3N5FA 4JWPA 2CTBA 3PB4X 1Q7LA 2FIWA 4L89A 4R76A 4P44A 2V8DA 2Q7BA 4B10A 1MJBA 2VZZA 3ISXA 3GB0A 3R1KA 4ORFA 2JDCA 2PSWA 4P45A 4QUSA 5D29A 4B12A 2AFMA 5LRGA 4ZI6A 2EWBA 4J3GA 3TTHA 4OC0A 4W9YA 5G22A 1Y0YA 3JVNA 2ZEGA 2O4HA 4ZYQA 4KOYA 4PK3A 4X8IA 2XEGA 3S6KA 4M6IA 3DR6A 4QB9A 5EMIA 4PSXA 4DJLA 4HNWB 2R1IA 5JGFA 2ANPA 4QC6A 5AG4A 1IIDA 2VEZA 5IB9A 4Q38A 2PJBA 3CXSA 3NH5A 4M85A 3K2KA 3KQXA 5F49A 1TIQA 3PB9X 4P6YA 4B11A 5K8OA 2AFXA 4H6UA 1VHEA 1QSMA 3RZAA 4R6TA 4DYOA 3KASA 2B5GB 3SJXA 2G0BA 4FD4A 5LYFA 2JBKA 1RO5A 1WK4A 5F48A 4A39A 3RYOA 2O28A 2HQYA 4CYQA 4B6ZA 3BJ8A 4CGPA 2ZELA 5JM6A 2Z3NA 3S6GA 3KR4A 4HKFA 4O23A 4MY0A 2V77A 3IFEA 3KR5A 4CGOA 5DS0A 4MHNA 4AXVA 3FJUA 1M4IA 4EFDA 3FECA 3MRUA 3GKRA 4MI4A 4PPZA 3TO6A 3S9NA 1PCAA 3NFZA 3D7FA 2YGWA 1BO4A 2YNEA 4KUAA 1PUAA 3K9TA 1S7KA 5LYDA 4XNHC 2OR4A 4MFJA 3SHPA 5J8CA 3MN8A 2AFUA 3BI1A 3DDDA 4JD6A 4KOWA 4KSAA 4M3SA 4OKOA 1QSTA 2YNCC 4WWVA 5J1QA 1X12A 1YVOA 4GXHA 4QBJA 4B5PA 5H86A 3RBUA 1PU9A 4KVME 3IU1A 1P4NA 3R9EA 1KWMA 2HC9A 4MHDA 3WR7A 2PVVA 3GUXA 5H84A 1ZLIA 1BLLE 2Z3MA 7CPAA 1I21A 1V0CA 3FEEA 3PFEA 3S6FA 1YR0A 1OZPA 2PC1A 4X3RA 3ISZA 5LRJA 3TC8A 4NSQA 3B3CA 4OIDA 2RC4A 2GIVA 2JEVA 3FVLA 2J9AA 4FD5A 3IU2A 4MFPA 2PDOA 3SI0A 8CPAA 3EO4A 4MHPA 1BPNA 2ZW5A 2PR1A 4PQAA 3IWGA 2ZEOA 3I1UA 5AG6A 4ZBGA 4CAFA 3D68A 3TFYA 1AMPA 1MK4A 1HEEA 4OAEA 3BXMA 5K8NA 2OZUA 2PJ6A 2PIZA 3N7ZA 2PIYA 1EE3P 1ARLA 3SXNA 1TKFA 4DUKA 1XMBA 4M6HA 4XNHB 1YLOA 3TE4A 4CRZB 2I3CA 1M44A 1QSRA 4MCPA 4F0YA 2HV2A 4CYNA 1UWYA 2H5MA 2OB0A 4L8AA 1HDQA 1DE4C 3EFAA 5K8PA 1QQ9A 1KUYA 5JH9A 3D8PA 4R8FA 4UFVA 2DPTA 2K5TA 1XJOA 4R3KA 1IICA 2WPXA 2C27A 3B2YA 4UIAA 3RO0A 4NXYA 4KOSA 4KLWA 3IWWA 4K30A 3SJGA 1CP7A 1VIXA 4E2AA 4ONUA 1IOIA 1Z8LA 3KQZA 4OMEA 3KKWA 3TT2A 4UEEA 4XPDC 2DXQA 4UWIA 1GHEA 4A95A 2Z3OA 4NF1A 4F9VA 2NMTA 1Y0RA 2J8NA 2GANA 1BPMA 2O53A 4OC3A 3F0AA 3FX6A 2PJCA 4HNYB 4I49A 3WT4A 4MY3A 2PQ8A 3F8KA 3IEHA 3PZJA 4UWJA 5G1ZA 2RFHA 4C2YA 1ZG8A 4X2TA 5KTDA 1CG2A 2ZW7A 3B3TA 3S9LA 2FCKA 1B87A 2WYRA 4KVXA 2FSRA 3PB8X 3JTKA 3PEIA 4R3LA 1Y7EA 2REFA 5JPHA 2F8HA 3E0KA 1YREA 3DSBA 2OOTA 2D4OA 3QAHA 2GE3A 4OC4A 3TOBA 4UFXA 4PXCA 4B14A 3PB6X 5IB0A 3D2MA 1Z9UA 2FE7A 2DPSA 4KZTA 1ZO0A 2V8GA 2J8RA 2EBJA 3I9SA 4TWEA 4B13A 3KZWA 4UCPA 2P6FA 1QMUA 2B3UA 3B3VA 4ONWA 4XPKA 1ELMP 3H8FA 2EVNA 3FNCA 3LWUA 2B4DA 3FYNA 2Z0ZA 4BMHA 3BLNA 2FXFA 2ATRA 4PXBA 4CPAA 5THWA 3D3SA 4RI1A 3CZXA 4XPDB 2C6CA 3B3SA 2Q0YA 5F09A 4KSIA 4MBUA 4FD6A 3LD2A 2G3TA 3OWCA 3H8EA 2ZPAA 3KI9A 4C7HA 3H5ZA 1BOBA 2WPWA 4Y49C 2QMLA 4JXQA 3DLJA 1Y9WA 2Q4ZA 4R87A 3G3SA 5HVHA 3S9MA 1IOFA 2EUIA 3R96A 2GREA 1F2PA 3NE8A 1XE4A 2GFQA 1TXRA 4R9MA 3DGVA 4OC5A 2P6GA 5FVJA 2PJ3A 1YGHA 5IX3A 2F7VA 3FH4A 4EWTA 5J8FA 2B4BA 3B3WA 3FF3A 2I00A 3GLJA 3H4QA 2BUEA 4A33A 3P2FA 3D66A 3PFOA 4CAXA 2PJ5A 2AFZA 3G8WA 3EXNA 4ZX9A 4A32A 3SI1A 1S5KA 4IK2A 4CAWA 3PRTA 2ZEFA 2CNMA 4CGLA 3K9UA 1XRYA 3T90A 3V8IA 4NGTA 2QVPA 3RNZA 2ARHA 5IV0A 5LYIA 4KORA 2R7HA 2YNDA 3QAYA 4G1PA 1NSLA 3R9GA 1XBUA 3VARA 1M4LA 2PJ0A 3WC5A 4MFZA 1R3NA 3R9FA 1NE9A 4CGMA 4EVYA 2Z3KA 4NGNA 2ZEEA 2C6PA 1FY7A 4U9YA 4NCZA 4Y49B 2VZYA 5CNPA 4OC2A 4MJ8A 3R95A 3GY9A 5CPAA 1UFHA 3B7IA 4AVCA 4DNCA 4CAEA 2OH1A 2AFOA 5KTCA 4HNXB 3TCVA 4FWUA 4QVTA 1LOKA 1Z8XA 2FL4A 4A30A 5DWNA 3L2NA 2Q43A 3JUWA 3NE7A 4WJBA 2Q4VA 1KUVA 1AYEA 4R7MA 2QIRA 4NGSA 3D4UA 4XPLA 4F0XA 3EC4A 4H2KA 3C26A 5G20A 3CXPA 4UA3A 2G9DA 1Y7RA 1YX0A 3IWEA 1IB1E 1VHOA 1LFWA 4CS0B 2Y0MA 3IJ3A 2PRQA 1N71A 3PP9A 1TF9A 1OBRA 4NJRA 2ZEHA 4FUUA 4X5KA 3D7DA 1YQEA 5HH1A 4B5PB 2B58A 4CGNA 3BJ7A 3FMCA 3IO1A 4ZX8A 2EK9A 5A27A 1LAPA 1X10A 4IUSA 4BBHA 4C2ZA 4AVAA 2JLMA 2I79A 4NGRA 2EK8A 4Q7AA 4PXEA 3W6XA 5LYLA 2PRBA 3V7ZA 2ZEMA 5C82A 1M1DA 4OADA 5AG5A 1S7LA 4RUHA 4NEXA 5HMNA 1XOVA 4C7IA 3TOAA 3KL9A 2X7BA 3B35A 4IF5A 4F6AA 1QSNA 4YGOA 4UCNA 1ARMA 1SQHA 1NSAA 3LODA 1JQGA 2WUUA 2Z10A 4JYWA 2XEFA 2PR8A 2ZEPA 2ZXVA 4UEZA 4KUBA 4UEFA 2BL1A 4MCSA 2CXAA 2D4PA 3EY5A 3VWDA 2CNTA 2B3VA 4OIWA 4KOUA 2IMOA 4II9A 2VXKA 4MHYA 3DNSA 3NH4A 1M4DA 1Z5RA 3JRUA 3BI0A 3IC1A 2Q04A 3FB3A 4LUAA 5JQ4A 1JWQA 4CYPA 2J8MA 2VBQA 4NJQA 2V8HA 3V38A 4CRYB 2Q44A 3P2HA 2F5IA 4A37A 4P10A 5AG7A 1J4JA 2AJ6A 1AUGA 4PV6A 4P4JA 1ZG9A 2GLFA 4PSWA 4FD7A 2RB7A 2DF5A 1XMTA 2REEA 5EBVA 2POKA 2PJ2A 4ZY0A 4H6ZA 5KTAA 2IQ6A 2WZNA 4FAIA 3TX8A 4ZY1A 4R57A 1BAVA 2CNSA 2B5GA 4P4EA 4NFRA 4ZY2A 1B6BA 2CY2A 3HUVA 4KS9A 2ZOGA 4UCMA 2R98A 4AG9A 2CTCA 4E0AA 3SXOA 1YW6A 4YU9A 3W91A 1IYLA 3WC6A 2PJ4A 1CJWA 2AFSA 1LRZA 2Z11A 3NH8A 4NGPA 3H8GA 1XIXA 2JDDA 1Q2DA 5CBMA 4P4IA 4UFWA 5F47A 3VH9A 1IY7A 2VI7A 5GCNA 3FBUA 1TF8A 4IHMA 4KVOE 5AGEA 3VATA 3FXTA 5ISVA 1A2ZA 3VWEA 2GU2A 3I3GA 5G21A 5EC4A 4BINA 2JEWA 2P6EA 4EMEA 4LX9A 2G3AA 2R8VA 4AVBA 3KHZA 1Y9KA 3IIBA 1WWZA 2NYQA 3GYAA 4HPSA 3FEDA 3T9YA 2GLJA 3QNVA 1S7FA 3D7HA 4KOTA 1LAMA 3RAMA 3ZJ0A 2QYVA 2KCWA 1I12A 4KLVA 2HB6A 4P4DA 4UF4A 1P0HA 3W6SA 1HDUA 3FIXA 2ZEDA 2PJAA 1TKHA 4JZ0A 1KZFA 1XEBA 2B4DB 2PJ9A 3CXQA 1IU8A 1XF8A 4OC1A 3KHXA 4Z65A 2BOAA 2VQYA 2BO9A 4MRIA 4TNUA 1MJ9A 2NSMA 5E96A 2FT0A 2JBJA 2BSWA 2ZOFA 2C1CA 4P4FA 4CAVA 5A28A 2BEIA 4U5YA 4A2ZA 5BWAB 3S6HA 3D2PA 4YWYA 2CF4A 2Z3PA 4M6GA 1VKCA 2FS5A 5D8NA 5HVGA 2IL4A 2AFWA 4YFJA 3LACA 1TKJA 3MGDA 4FBEA 4K3NA 1VGYA 1Q2YA 2CIJA 3SJEA 2ODFA 4JJXA 1RTQA 2ABZA 2QECA 3UY5A 1RXTA 4A94A 1CM0A 1YK3A 1YMEA 4OLLA 4B5OA 2V8VA 1LANA 4RS2A 1Z8TA 1CX8A 3KGQA 1ZLHA 5ELYA 1KUXA 4PK2A 1S60A 2YNCA 3FRMA 4NGQA 4PXDA 2OU2A 2A4NA 2Q7SA 2XEJA 4A38A 1I1DA 1U6MA 1Z4RA 4IAVA 3T8WA 4A31A 1R57A 4KOXA 5C88A 3LMSA 2HUZA 4MXUA 2WSAA 1PYTB 1F2OA 2ZW6A 4ZGYB 5HXDA 3D67A 4MCQA 1XFOA 2EO8A 4OP4A 4NGMA 4U9ZA 3CDXA 3BHXA 4LQGA 5HVFA 1K4JA 1FT7A 1IYKA 1GYTA 1S7NA 3WABA 3PBBA 4C68A 4C2XA 3B8GA 3CT9A 4GM5A 1ELLP 3F5BA 4GS4A 2FIAA 2XEIA 1S3ZA 2ZW4A 4AB7A 4KSFA 1DTDA 4H89A 2Z3LA 5F46A 5DWMA 2PJ7A 2OZHA 1FNOA 3HLPA 4RN7A 1CPXA 4MCRA 4LQ6A 1NMTA 2Q51A 3TO9A 3DR8A 2QJ8A 2Q4YA 4YRHA 1VHSA 3QB8A 4F9UA 5I4MA 4MMOA 2IJZA 1H8LA 2PVWA 3PB7X 3SI2A 4JLYA 4P4BA 1YVKA 1Z2LA 4AG7A 3A9LA 6CPAA 1YSJA 1CBXA 1Z4EA 1QSOA 3SJFA 4CYOA 3WC7A 1YLEA 5LRKA
chains in the Genus database with same CATH topology
1M4GA 2P0WA 2AE6A 3ZZIA 4Q36A 3PGPA 4UBRA 2OZGA 4KOVA 3IGRA 4JXRA 1Q2CA 4MFQA 1ON0A 4E8OA 4MFKA 5I0CA 1MJAA 1L0CA 3TO7A 4MFLA 4JWPA 4L89A 2FIWA 2Q7BA 4B10A 1MJBA 2VZZA 4ORFA 3R1KA 4QUSA 2JDCA 2PSWA 4B12A 4J3GA 3TTHA 5G22A 3JVNA 4KOYA 4PK3A 3S6KA 3DR6A 4QB9A 4PSXA 4HNWB 2R1IA 4QC6A 5AG4A 1IIDA 2VEZA 4Q38A 3CXSA 4M85A 5F49A 1TIQA 4B11A 4H6UA 1QSMA 2B5GB 2G0BA 4FD4A 5F48A 1RO5A 1WK4A 3RYOA 2O28A 2HQYA 4CYQA 3BJ8A 4CGPA 2Z3NA 3S6GA 4HKFA 4MY0A 4CGOA 1M4IA 3GKRA 4MI4A 3TO6A 2YGWA 1BO4A 2YNEA 4KUAA 1PUAA 1S7KA 4XNHC 4MFJA 3SHPA 5J8CA 4JD6A 3DDDA 4KSAA 4KOWA 4M3SA 1QSTA 2YNCC 1YVOA 4QBJA 4B5PA 5H86A 1PU9A 4KVME 3IU1A 1P4NA 3R9EA 3WR7A 4MHDA 5H84A 2Z3MA 1I21A 1V0CA 3S6FA 1YR0A 1OZPA 2PC1A 4NSQA 2RC4A 2GIVA 2JEVA 4FD5A 3IU2A 4MFPA 2PDOA 3EO4A 2ZW5A 2PR1A 3IWGA 4CAFA 5AG6A 4ZBGA 3TFYA 1MK4A 4OAEA 2OZUA 3N7ZA 3SXNA 4XNHB 3TE4A 4CRZB 1M44A 1QSRA 4F0YA 2HV2A 4CYNA 2H5MA 2OB0A 4L8AA 3EFAA 1KUYA 3D8PA 4UFVA 2DPTA 2K5TA 4R3KA 1IICA 2WPXA 2C27A 4NXYA 4KOSA 4KLWA 4K30A 4E2AA 4ONUA 3KKWA 3TT2A 4XPDC 2DXQA 4UWIA 1GHEA 4A95A 2Z3OA 4NF1A 2NMTA 2J8NA 2GANA 3F0AA 4HNYB 4I49A 4MY3A 2PQ8A 3F8KA 4UWJA 3PZJA 5G1ZA 4C2YA 5KTDA 2ZW7A 2FCKA 1B87A 4KVXA 2FSRA 3JTKA 4R3LA 2REFA 5JPHA 3E0KA 1YREA 3DSBA 2D4OA 3QAHA 2GE3A 3TOBA 4UFXA 4B14A 5IB0A 3D2MA 1Z9UA 2FE7A 2DPSA 4KZTA 1ZO0A 2J8RA 3I9SA 4B13A 4UCPA 2P6FA 2B3UA 4XPKA 2EVNA 3FNCA 2B4DA 3FYNA 2Z0ZA 4BMHA 3BLNA 2FXFA 2ATRA 3D3SA 4RI1A 4XPDB 2Q0YA 4MBUA 4FD6A 3LD2A 2G3TA 3OWCA 2ZPAA 4C7HA 3H5ZA 1BOBA 2WPWA 4Y49C 2QMLA 4JXQA 1Y9WA 4R87A 3G3SA 2EUIA 3R96A 1XE4A 4R9MA 2P6GA 5FVJA 1YGHA 5IX3A 5J8FA 2B4BA 2I00A 3H4QA 2BUEA 4A33A 3P2FA 4CAXA 3G8WA 3EXNA 4A32A 1S5KA 4CAWA 2CNMA 4CGLA 3K9UA 3T90A 3V8IA 2ARHA 5IV0A 4KORA 2R7HA 2YNDA 3R9GA 1NSLA 4MFZA 3R9FA 4CGMA 1NE9A 4EVYA 2Z3KA 1FY7A 4U9YA 4NCZA 4Y49B 2VZYA 5CNPA 4MJ8A 3R95A 3GY9A 1UFHA 4AVCA 5KTCA 4DNCA 4CAEA 2OH1A 4HNXB 3TCVA 4QVTA 2FL4A 4A30A 5DWNA 3JUWA 3NE7A 2Q4VA 1KUVA 4XPLA 2QIRA 4F0XA 3EC4A 3C26A 5G20A 3CXPA 4UA3A 3IWEA 1Y7RA 1YX0A 4BBHA 1IB1E 4CS0B 2Y0MA 1N71A 3PP9A 4X5KA 5HH1A 4B5PB 2B58A 4CGNA 3BJ7A 5A27A 4IUSA 4C2ZA 4AVAA 2JLMA 2I79A 3W6XA 2PRBA 5C82A 1M1DA 4OADA 5AG5A 1S7LA 4NEXA 5HMNA 4C7IA 3TOAA 2X7BA 4IF5A 4F6AA 1QSNA 4YGOA 4UCNA 1SQHA 3LODA 2WUUA 2Z10A 2ZXVA 2PR8A 3VWDA 4KUBA 2BL1A 2CXAA 2D4PA 3EY5A 2CNTA 2B3VA 4KOUA 4II9A 2VXKA 3DNSA 1M4DA 2Q04A 3FB3A 4LUAA 5JQ4A 4CYPA 2J8MA 2VBQA 4CRYB 2Q44A 3P2HA 2F5IA 5AG7A 1J4JA 2AJ6A 4PV6A 4PSWA 4FD7A 5EBVA 1XMTA 2REEA 5KTAA 4H6ZA 4R57A 2CNSA 2B5GA 1B6BA 2CY2A 4KS9A 4UCMA 2R98A 4AG9A 4E0AA 3SXOA 3W91A 1IYLA 1CJWA 2Z11A 1LRZA 1XIXA 2JDDA 1Q2DA 4UFWA 5F47A 2VI7A 5GCNA 3FBUA 4KVOE 5AGEA 3FXTA 5ISVA 3VWEA 3I3GA 5G21A 5EC4A 2P6EA 4LX9A 2G3AA 2R8VA 4AVBA 1Y9KA 1WWZA 3GYAA 3T9YA 1S7FA 4KOTA 3ZJ0A 2KCWA 1I12A 4KLVA 1P0HA 3W6SA 3FIXA 1KZFA 1XEBA 2B4DB 3CXQA 1XF8A 2VQYA 1MJ9A 5E96A 2FT0A 2BSWA 4CAVA 5A28A 2BEIA 4U5YA 4A2ZA 5BWAB 3S6HA 3D2PA 2Z3PA 1VKCA 2FS5A 2IL4A 4YFJA 3MGDA 1Q2YA 4JJXA 2QECA 3UY5A 1RXTA 1CM0A 1YK3A 4OLLA 4B5OA 4RS2A 1KUXA 4PK2A 1S60A 2YNCA 3FRMA 2OU2A 2A4NA 1I1DA 1U6MA 1Z4RA 5C88A 4A31A 1R57A 4KOXA 2HUZA 2WSAA 2ZW6A 4ZGYB 4U9ZA 1K4JA 1IYKA 1S7NA 4C68A 4C2XA 3B8GA 3F5BA 4GS4A 2FIAA 1S3ZA 2ZW4A 4AB7A 4KSFA 4H89A 5F46A 2Z3LA 5DWMA 2OZHA 1NMTA 3TO9A 3DR8A 2Q4YA 4YRHA 1VHSA 3QB8A 4AG7A 4JLYA 1YVKA 3A9LA 1Z4EA 1QSOA 4CYOA 1YLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M4G A;  2P0W A;  2AE6 A;  3ZZI A;  3PGP A;  4UBR A;  2OZG A;  4KOV A;  3IGR A;  4JXR A;  1Q2C A;  1ON0 A;  4E8O A;  5I0C A;  1MJA A;  1L0C A;  3TO7 A;  4JWP A;  4L89 A;  2FIW A;  2Q7B A;  1MJB A;  2VZZ A;  4ORF A;  3R1K A;  4QUS A;  2JDC A;  2PSW A;  4J3G A;  3TTH A;  3JVN A;  4KOY A;  4PK3 A;  3S6K A;  3DR6 A;  4QB9 A;  4PSX A;  4HNW B;  2R1I A;  4QC6 A;  1IID A;  2VEZ A;  3CXS A;  4M85 A;  5F49 A;  1TIQ A;  4H6U A;  1QSM A;  2B5G B;  2G0B A;  4FD4 A;  5F48 A;  1RO5 A;  1WK4 A;  3RYO A;  2O28 A;  2HQY A;  3BJ8 A;  3S6G A;  4HKF A;  4MY0 A;  1M4I A;  3GKR A;  4MI4 A;  3TO6 A;  1BO4 A;  4KUA A;  1PUA A;  1S7K A;  4XNH C;  3SHP A;  5J8C A;  4JD6 A;  3DDD A;  4KOW A;  4M3S A;  1QST A;  1YVO A;  4QBJ A;  4B5P A;  5H86 A;  1PU9 A;  4KVM E;  1P4N A;  3R9E A;  3WR7 A;  4MHD A;  5H84 A;  1I21 A;  1V0C A;  3S6F A;  1YR0 A;  1OZP A;  2PC1 A;  4NSQ A;  2RC4 A;  2GIV A;  2JEV A;  4FD5 A;  2PDO A;  3EO4 A;  2ZW5 A;  2PR1 A;  3IWG A;  4ZBG A;  3TFY A;  1MK4 A;  4OAE A;  2OZU A;  3N7Z A;  3SXN A;  4XNH B;  3TE4 A;  4CRZ B;  1M44 A;  1QSR A;  4F0Y A;  2HV2 A;  2H5M A;  2OB0 A;  4L8A A;  3EFA A;  1KUY A;  3D8P A;  2K5T A;  4R3K A;  1IIC A;  2WPX A;  2C27 A;  4NXY A;  4KOS A;  4KLW A;  4K30 A;  4E2A A;  4ONU A;  3KKW A;  3TT2 A;  4XPD C;  2DXQ A;  4UWI A;  1GHE A;  4NF1 A;  2NMT A;  2J8N A;  2GAN A;  3F0A A;  4HNY B;  4I49 A;  4MY3 A;  2PQ8 A;  3F8K A;  4UWJ A;  3PZJ A;  5KTD A;  2ZW7 A;  2FCK A;  1B87 A;  4KVX A;  2FSR A;  4R3L A;  2REF A;  5JPH A;  3E0K A;  1YRE A;  3DSB A;  2D4O A;  3QAH A;  2GE3 A;  3TOB A;  5IB0 A;  3D2M A;  1Z9U A;  2FE7 A;  4KZT A;  2J8R A;  3I9S A;  2P6F A;  2B3U A;  4XPK A;  2EVN A;  3FNC A;  2B4D A;  3FYN A;  2Z0Z A;  4BMH A;  3BLN A;  2FXF A;  2ATR A;  3D3S A;  4RI1 A;  4XPD B;  2Q0Y A;  4MBU A;  4FD6 A;  3LD2 A;  2G3T A;  3OWC A;  2ZPA A;  1BOB A;  2WPW A;  4Y49 C;  2QML A;  4JXQ A;  1Y9W A;  4R87 A;  3G3S A;  2EUI A;  3R96 A;  1XE4 A;  4R9M A;  2P6G A;  5FVJ A;  1YGH A;  5IX3 A;  5J8F A;  2B4B A;  2I00 A;  3H4Q A;  2BUE A;  3P2F A;  4CAX A;  3G8W A;  3EXN A;  1S5K A;  4CAW A;  2CNM A;  3K9U A;  3T90 A;  3V8I A;  2ARH A;  5IV0 A;  4KOR A;  2R7H A;  3R9G A;  1NSL A;  3R9F A;  1NE9 A;  4EVY A;  1FY7 A;  4U9Y A;  4NCZ A;  4Y49 B;  2VZY A;  5CNP A;  4MJ8 A;  3R95 A;  3GY9 A;  1UFH A;  4AVC A;  5KTC A;  4DNC A;  2OH1 A;  4HNX B;  3TCV A;  4QVT A;  2FL4 A;  5DWN A;  3JUW A;  3NE7 A;  2Q4V A;  1KUV A;  4XPL A;  2QIR A;  3EC4 A;  3C26 A;  3CXP A;  4UA3 A;  1Y7R A;  1YX0 A;  1IB1 E;  4CS0 B;  2Y0M A;  1N71 A;  3PP9 A;  4X5K A;  5HH1 A;  4B5P B;  2B58 A;  3BJ7 A;  4IUS A;  4AVA A;  2JLM A;  2I79 A;  3W6X A;  2PRB A;  5C82 A;  1M1D A;  4OAD A;  1S7L A;  4NEX A;  5HMN A;  3TOA A;  2X7B A;  4IF5 A;  4F6A A;  1QSN A;  4YGO A;  1SQH A;  3LOD A;  2Z10 A;  2ZXV A;  2PR8 A;  3VWD A;  4KUB A;  2BL1 A;  2D4P A;  3EY5 A;  2CNT A;  2B3V A;  4KOU A;  4II9 A;  2VXK A;  3DNS A;  1M4D A;  2Q04 A;  3FB3 A;  4LUA A;  5JQ4 A;  2J8M A;  2VBQ A;  4CRY B;  2Q44 A;  3P2H A;  2F5I A;  1J4J A;  2AJ6 A;  4PV6 A;  4PSW A;  4FD7 A;  5EBV A;  1XMT A;  2REE A;  5KTA A;  4H6Z A;  4R57 A;  2CNS A;  2B5G A;  1B6B A;  2CY2 A;  2R98 A;  4AG9 A;  4E0A A;  3SXO A;  3W91 A;  1IYL A;  1CJW A;  2Z11 A;  1LRZ A;  1XIX A;  2JDD A;  1Q2D A;  5F47 A;  2VI7 A;  5GCN A;  3FBU A;  4KVO E;  3FXT A;  5ISV A;  3VWE A;  3I3G A;  5EC4 A;  2P6E A;  4LX9 A;  2G3A A;  2R8V A;  4AVB A;  1Y9K A;  1WWZ A;  3GYA A;  3T9Y A;  1S7F A;  4KOT A;  3ZJ0 A;  2KCW A;  1I12 A;  4KLV A;  1P0H A;  3W6S A;  3FIX A;  1KZF A;  1XEB A;  2B4D B;  3CXQ A;  1XF8 A;  2VQY A;  1MJ9 A;  5E96 A;  2FT0 A;  2BSW A;  4CAV A;  2BEI A;  4U5Y A;  3S6H A;  3D2P A;  1VKC A;  2FS5 A;  2IL4 A;  4YFJ A;  3MGD A;  1Q2Y A;  4JJX A;  2QEC A;  3UY5 A;  1RXT A;  1CM0 A;  1YK3 A;  4OLL A;  4B5O A;  4RS2 A;  1KUX A;  4PK2 A;  1S60 A;  3FRM A;  2OU2 A;  2A4N A;  1I1D A;  1U6M A;  1Z4R A;  5C88 A;  1R57 A;  4KOX A;  2HUZ A;  2ZW6 A;  4U9Z A;  1K4J A;  1IYK A;  1S7N A;  3B8G A;  3F5B A;  4GS4 A;  2FIA A;  1S3Z A;  2ZW4 A;  4AB7 A;  4H89 A;  5F46 A;  5DWM A;  2OZH A;  1NMT A;  3TO9 A;  3DR8 A;  2Q4Y A;  4YRH A;  1VHS A;  3QB8 A;  4AG7 A;  4JLY A;  1YVK A;  1Z4E A;  1QSO A;  1YLE A; 
#chains in the Genus database with same CATH topology
 2BCO A;  2ZEN A;  1M4G A;  2P0W A;  4BD9 A;  5K8M A;  2AE6 A;  3ZZI A;  4Q36 A;  2PJ1 A;  2DEA A;  3PGP A;  4UBR A;  2OZG A;  2VL1 A;  4KOV A;  2PCU A;  1ZG7 A;  3GIU A;  3IGR A;  3D7G A;  4JXR A;  2PE3 A;  2PJ8 A;  1CPS A;  2C6G A;  4UIB A;  4MHZ A;  1YW4 A;  1Q2C A;  3CPX A;  4MFQ A;  1ON0 A;  4E8O A;  2FVG A;  4F8Z A;  4MFK A;  3PBE A;  5I0C A;  1MJA A;  1R43 A;  1LCP A;  1L0C A;  3CPA A;  3TO7 A;  1Z8W A;  3NA6 A;  4MFL A;  1CP6 A;  1F57 A;  1IGB A;  3N5F A;  4JWP A;  2CTB A;  3PB4 X;  1Q7L A;  2FIW A;  4L89 A;  4R76 A;  4P44 A;  2V8D A;  2Q7B A;  4B10 A;  1MJB A;  2VZZ A;  3ISX A;  3GB0 A;  3R1K A;  4ORF A;  2JDC A;  2PSW A;  4P45 A;  4QUS A;  5D29 A;  4B12 A;  2AFM A;  5LRG A;  4ZI6 A;  2EWB A;  4J3G A;  3TTH A;  4OC0 A;  4W9Y A;  5G22 A;  1Y0Y A;  3JVN A;  2ZEG A;  2O4H A;  4ZYQ A;  4KOY A;  4PK3 A;  4X8I A;  2XEG A;  3S6K A;  4M6I A;  3DR6 A;  4QB9 A;  5EMI A;  4PSX A;  4DJL A;  4HNW B;  2R1I A;  5JGF A;  2ANP A;  4QC6 A;  5AG4 A;  1IID A;  2VEZ A;  5IB9 A;  4Q38 A;  2PJB A;  3CXS A;  3NH5 A;  4M85 A;  3K2K A;  3KQX A;  5F49 A;  1TIQ A;  3PB9 X;  4P6Y A;  4B11 A;  5K8O A;  2AFX A;  4H6U A;  1VHE A;  1QSM A;  3RZA A;  4R6T A;  4DYO A;  3KAS A;  2B5G B;  3SJX A;  2G0B A;  4FD4 A;  5LYF A;  2JBK A;  1RO5 A;  1WK4 A;  5F48 A;  4A39 A;  3RYO A;  2O28 A;  2HQY A;  4CYQ A;  4B6Z A;  3BJ8 A;  4CGP A;  2ZEL A;  5JM6 A;  2Z3N A;  3S6G A;  3KR4 A;  4HKF A;  4O23 A;  4MY0 A;  2V77 A;  3IFE A;  3KR5 A;  4CGO A;  5DS0 A;  4MHN A;  4AXV A;  3FJU A;  1M4I A;  4EFD A;  3FEC A;  3MRU A;  3GKR A;  4MI4 A;  4PPZ A;  3TO6 A;  3S9N A;  1PCA A;  3NFZ A;  3D7F A;  2YGW A;  1BO4 A;  2YNE A;  4KUA A;  1PUA A;  3K9T A;  1S7K A;  5LYD A;  4XNH C;  2OR4 A;  4MFJ A;  3SHP A;  5J8C A;  3MN8 A;  2AFU A;  3BI1 A;  3DDD A;  4JD6 A;  4KOW A;  4KSA A;  4M3S A;  4OKO A;  1QST A;  2YNC C;  4WWV A;  5J1Q A;  1X12 A;  1YVO A;  4GXH A;  4QBJ A;  4B5P A;  5H86 A;  3RBU A;  1PU9 A;  4KVM E;  3IU1 A;  1P4N A;  3R9E A;  1KWM A;  2HC9 A;  4MHD A;  3WR7 A;  2PVV A;  3GUX A;  5H84 A;  1ZLI A;  1BLL E;  2Z3M A;  7CPA A;  1I21 A;  1V0C A;  3FEE A;  3PFE A;  3S6F A;  1YR0 A;  1OZP A;  2PC1 A;  4X3R A;  3ISZ A;  5LRJ A;  3TC8 A;  4NSQ A;  3B3C A;  4OID A;  2RC4 A;  2GIV A;  2JEV A;  3FVL A;  2J9A A;  4FD5 A;  3IU2 A;  4MFP A;  2PDO A;  3SI0 A;  8CPA A;  3EO4 A;  4MHP A;  1BPN A;  2ZW5 A;  2PR1 A;  4PQA A;  3IWG A;  2ZEO A;  3I1U A;  5AG6 A;  4ZBG A;  4CAF A;  3D68 A;  3TFY A;  1AMP A;  1MK4 A;  1HEE A;  4OAE A;  3BXM A;  5K8N A;  2OZU A;  2PJ6 A;  2PIZ A;  3N7Z A;  2PIY A;  1EE3 P;  1ARL A;  3SXN A;  1TKF A;  4DUK A;  1XMB A;  4M6H A;  4XNH B;  1YLO A;  3TE4 A;  4CRZ B;  2I3C A;  1M44 A;  1QSR A;  4MCP A;  4F0Y A;  2HV2 A;  4CYN A;  1UWY A;  2H5M A;  2OB0 A;  4L8A A;  1HDQ A;  1DE4 C;  3EFA A;  5K8P A;  1QQ9 A;  1KUY A;  5JH9 A;  3D8P A;  4R8F A;  4UFV A;  2DPT A;  2K5T A;  1XJO A;  4R3K A;  1IIC A;  2WPX A;  2C27 A;  3B2Y A;  4UIA A;  3RO0 A;  4NXY A;  4KOS A;  4KLW A;  3IWW A;  4K30 A;  3SJG A;  1CP7 A;  1VIX A;  4E2A A;  4ONU A;  1IOI A;  1Z8L A;  3KQZ A;  4OME A;  3KKW A;  3TT2 A;  4UEE A;  4XPD C;  2DXQ A;  4UWI A;  1GHE A;  4A95 A;  2Z3O A;  4NF1 A;  4F9V A;  2NMT A;  1Y0R A;  2J8N A;  2GAN A;  1BPM A;  2O53 A;  4OC3 A;  3F0A A;  3FX6 A;  2PJC A;  4HNY B;  4I49 A;  3WT4 A;  4MY3 A;  2PQ8 A;  3F8K A;  3IEH A;  3PZJ A;  4UWJ A;  5G1Z A;  2RFH A;  4C2Y A;  1ZG8 A;  4X2T A;  5KTD A;  1CG2 A;  2ZW7 A;  3B3T A;  3S9L A;  2FCK A;  1B87 A;  2WYR A;  4KVX A;  2FSR A;  3PB8 X;  3JTK A;  3PEI A;  4R3L A;  1Y7E A;  2REF A;  5JPH A;  2F8H A;  3E0K A;  1YRE A;  3DSB A;  2OOT A;  2D4O A;  3QAH A;  2GE3 A;  4OC4 A;  3TOB A;  4UFX A;  4PXC A;  4B14 A;  3PB6 X;  5IB0 A;  3D2M A;  1Z9U A;  2FE7 A;  2DPS A;  4KZT A;  1ZO0 A;  2V8G A;  2J8R A;  2EBJ A;  3I9S A;  4TWE A;  4B13 A;  3KZW A;  4UCP A;  2P6F A;  1QMU A;  2B3U A;  3B3V A;  4ONW A;  4XPK A;  1ELM P;  3H8F A;  2EVN A;  3FNC A;  3LWU A;  2B4D A;  3FYN A;  2Z0Z A;  4BMH A;  3BLN A;  2FXF A;  2ATR A;  4PXB A;  4CPA A;  5THW A;  3D3S A;  4RI1 A;  3CZX A;  4XPD B;  2C6C A;  3B3S A;  2Q0Y A;  5F09 A;  4KSI A;  4MBU A;  4FD6 A;  3LD2 A;  2G3T A;  3OWC A;  3H8E A;  2ZPA A;  3KI9 A;  4C7H A;  3H5Z A;  1BOB A;  2WPW A;  4Y49 C;  2QML A;  4JXQ A;  3DLJ A;  1Y9W A;  2Q4Z A;  4R87 A;  3G3S A;  5HVH A;  3S9M A;  1IOF A;  2EUI A;  3R96 A;  2GRE A;  1F2P A;  3NE8 A;  1XE4 A;  2GFQ A;  1TXR A;  4R9M A;  3DGV A;  4OC5 A;  2P6G A;  5FVJ A;  2PJ3 A;  1YGH A;  5IX3 A;  2F7V A;  3FH4 A;  4EWT A;  5J8F A;  2B4B A;  3B3W A;  3FF3 A;  2I00 A;  3GLJ A;  3H4Q A;  2BUE A;  4A33 A;  3P2F A;  3D66 A;  3PFO A;  4CAX A;  2PJ5 A;  2AFZ A;  3G8W A;  3EXN A;  4ZX9 A;  4A32 A;  3SI1 A;  1S5K A;  4IK2 A;  4CAW A;  3PRT A;  2ZEF A;  2CNM A;  4CGL A;  3K9U A;  1XRY A;  3T90 A;  3V8I A;  4NGT A;  2QVP A;  3RNZ A;  2ARH A;  5IV0 A;  5LYI A;  4KOR A;  2R7H A;  2YND A;  3QAY A;  4G1P A;  1NSL A;  3R9G A;  1XBU A;  3VAR A;  1M4L A;  2PJ0 A;  3WC5 A;  4MFZ A;  1R3N A;  3R9F A;  1NE9 A;  4CGM A;  4EVY A;  2Z3K A;  4NGN A;  2ZEE A;  2C6P A;  1FY7 A;  4U9Y A;  4NCZ A;  4Y49 B;  2VZY A;  5CNP A;  4OC2 A;  4MJ8 A;  3R95 A;  3GY9 A;  5CPA A;  1UFH A;  3B7I A;  4AVC A;  4DNC A;  4CAE A;  2OH1 A;  2AFO A;  5KTC A;  4HNX B;  3TCV A;  4FWU A;  4QVT A;  1LOK A;  1Z8X A;  2FL4 A;  4A30 A;  5DWN A;  3L2N A;  2Q43 A;  3JUW A;  3NE7 A;  4WJB A;  2Q4V A;  1KUV A;  1AYE A;  4R7M A;  2QIR A;  4NGS A;  3D4U A;  4XPL A;  4F0X A;  3EC4 A;  4H2K A;  3C26 A;  5G20 A;  3CXP A;  4UA3 A;  2G9D A;  1Y7R A;  1YX0 A;  3IWE A;  1IB1 E;  1VHO A;  1LFW A;  4CS0 B;  2Y0M A;  3IJ3 A;  2PRQ A;  1N71 A;  3PP9 A;  1TF9 A;  1OBR A;  4NJR A;  2ZEH A;  4FUU A;  4X5K A;  3D7D A;  1YQE A;  5HH1 A;  4B5P B;  2B58 A;  4CGN A;  3BJ7 A;  3FMC A;  3IO1 A;  4ZX8 A;  2EK9 A;  5A27 A;  1LAP A;  1X10 A;  4IUS A;  4BBH A;  4C2Z A;  4AVA A;  2JLM A;  2I79 A;  4NGR A;  2EK8 A;  4Q7A A;  4PXE A;  3W6X A;  5LYL A;  2PRB A;  3V7Z A;  2ZEM A;  5C82 A;  1M1D A;  4OAD A;  5AG5 A;  1S7L A;  4RUH A;  4NEX A;  5HMN A;  1XOV A;  4C7I A;  3TOA A;  3KL9 A;  2X7B A;  3B35 A;  4IF5 A;  4F6A A;  1QSN A;  4YGO A;  4UCN A;  1ARM A;  1SQH A;  1NSA A;  3LOD A;  1JQG A;  2WUU A;  2Z10 A;  4JYW A;  2XEF A;  2PR8 A;  2ZEP A;  2ZXV A;  4UEZ A;  4KUB A;  4UEF A;  2BL1 A;  4MCS A;  2CXA A;  2D4P A;  3EY5 A;  3VWD A;  2CNT A;  2B3V A;  4OIW A;  4KOU A;  2IMO A;  4II9 A;  2VXK A;  4MHY A;  3DNS A;  3NH4 A;  1M4D A;  1Z5R A;  3JRU A;  3BI0 A;  3IC1 A;  2Q04 A;  3FB3 A;  4LUA A;  5JQ4 A;  1JWQ A;  4CYP A;  2J8M A;  2VBQ A;  4NJQ A;  2V8H A;  3V38 A;  4CRY B;  2Q44 A;  3P2H A;  2F5I A;  4A37 A;  4P10 A;  5AG7 A;  1J4J A;  2AJ6 A;  1AUG A;  4PV6 A;  4P4J A;  1ZG9 A;  2GLF A;  4PSW A;  4FD7 A;  2RB7 A;  2DF5 A;  1XMT A;  2REE A;  5EBV A;  2POK A;  2PJ2 A;  4ZY0 A;  4H6Z A;  5KTA A;  2IQ6 A;  2WZN A;  4FAI A;  3TX8 A;  4ZY1 A;  4R57 A;  1BAV A;  2CNS A;  2B5G A;  4P4E A;  4NFR A;  4ZY2 A;  1B6B A;  2CY2 A;  3HUV A;  4KS9 A;  2ZOG A;  4UCM A;  2R98 A;  4AG9 A;  2CTC A;  4E0A A;  3SXO A;  1YW6 A;  4YU9 A;  3W91 A;  1IYL A;  3WC6 A;  2PJ4 A;  1CJW A;  2AFS A;  1LRZ A;  2Z11 A;  3NH8 A;  4NGP A;  3H8G A;  1XIX A;  2JDD A;  1Q2D A;  5CBM A;  4P4I A;  4UFW A;  5F47 A;  3VH9 A;  1IY7 A;  2VI7 A;  5GCN A;  3FBU A;  1TF8 A;  4IHM A;  4KVO E;  5AGE A;  3VAT A;  3FXT A;  5ISV A;  1A2Z A;  3VWE A;  2GU2 A;  3I3G A;  5G21 A;  5EC4 A;  4BIN A;  2JEW A;  2P6E A;  4EME A;  4LX9 A;  2G3A A;  2R8V A;  4AVB A;  3KHZ A;  1Y9K A;  3IIB A;  1WWZ A;  2NYQ A;  3GYA A;  4HPS A;  3FED A;  3T9Y A;  2GLJ A;  3QNV A;  1S7F A;  3D7H A;  4KOT A;  1LAM A;  3RAM A;  3ZJ0 A;  2QYV A;  2KCW A;  1I12 A;  4KLV A;  2HB6 A;  4P4D A;  4UF4 A;  1P0H A;  3W6S A;  1HDU A;  3FIX A;  2ZED A;  2PJA A;  1TKH A;  4JZ0 A;  1KZF A;  1XEB A;  2B4D B;  2PJ9 A;  3CXQ A;  1IU8 A;  1XF8 A;  4OC1 A;  3KHX A;  4Z65 A;  2BOA A;  2VQY A;  2BO9 A;  4MRI A;  4TNU A;  1MJ9 A;  2NSM A;  5E96 A;  2FT0 A;  2JBJ A;  2BSW A;  2ZOF A;  2C1C A;  4P4F A;  4CAV A;  5A28 A;  2BEI A;  4U5Y A;  4A2Z A;  5BWA B;  3S6H A;  3D2P A;  4YWY A;  2CF4 A;  2Z3P A;  4M6G A;  1VKC A;  2FS5 A;  5D8N A;  5HVG A;  2IL4 A;  2AFW A;  4YFJ A;  3LAC A;  1TKJ A;  3MGD A;  4FBE A;  4K3N A;  1VGY A;  1Q2Y A;  2CIJ A;  3SJE A;  2ODF A;  4JJX A;  1RTQ A;  2ABZ A;  2QEC A;  3UY5 A;  1RXT A;  4A94 A;  1CM0 A;  1YK3 A;  1YME A;  4OLL A;  4B5O A;  2V8V A;  1LAN A;  4RS2 A;  1Z8T A;  1CX8 A;  3KGQ A;  1ZLH A;  5ELY A;  1KUX A;  4PK2 A;  1S60 A;  2YNC A;  3FRM A;  4NGQ A;  4PXD A;  2OU2 A;  2A4N A;  2Q7S A;  2XEJ A;  4A38 A;  1I1D A;  1U6M A;  1Z4R A;  4IAV A;  3T8W A;  4A31 A;  1R57 A;  4KOX A;  5C88 A;  3LMS A;  2HUZ A;  4MXU A;  2WSA A;  1PYT B;  1F2O A;  2ZW6 A;  4ZGY B;  5HXD A;  3D67 A;  4MCQ A;  1XFO A;  2EO8 A;  4OP4 A;  4NGM A;  4U9Z A;  3CDX A;  3BHX A;  4LQG A;  5HVF A;  1K4J A;  1FT7 A;  1IYK A;  1GYT A;  1S7N A;  3WAB A;  3PBB A;  4C68 A;  4C2X A;  3B8G A;  3CT9 A;  4GM5 A;  1ELL P;  3F5B A;  4GS4 A;  2FIA A;  2XEI A;  1S3Z A;  2ZW4 A;  4AB7 A;  4KSF A;  1DTD A;  4H89 A;  2Z3L A;  5F46 A;  5DWM A;  2PJ7 A;  2OZH A;  1FNO A;  3HLP A;  4RN7 A;  1CPX A;  4MCR A;  4LQ6 A;  1NMT A;  2Q51 A;  3TO9 A;  3DR8 A;  2QJ8 A;  2Q4Y A;  4YRH A;  1VHS A;  3QB8 A;  4F9U A;  5I4M A;  4MMO A;  2IJZ A;  1H8L A;  2PVW A;  3PB7 X;  3SI2 A;  4JLY A;  4P4B A;  1YVK A;  1Z2L A;  4AG7 A;  3A9L A;  6CPA A;  1YSJ A;  1CBX A;  1Z4E A;  1QSO A;  3SJF A;  4CYO A;  3WC7 A;  1YLE A;  5LRK A; 
#chains in the Genus database with same CATH homology
 1M4G A;  2P0W A;  2AE6 A;  3ZZI A;  4Q36 A;  3PGP A;  4UBR A;  2OZG A;  4KOV A;  3IGR A;  4JXR A;  1Q2C A;  4MFQ A;  1ON0 A;  4E8O A;  4MFK A;  5I0C A;  1MJA A;  1L0C A;  3TO7 A;  4MFL A;  4JWP A;  4L89 A;  2FIW A;  2Q7B A;  4B10 A;  1MJB A;  2VZZ A;  4ORF A;  3R1K A;  4QUS A;  2JDC A;  2PSW A;  4B12 A;  4J3G A;  3TTH A;  5G22 A;  3JVN A;  4KOY A;  4PK3 A;  3S6K A;  3DR6 A;  4QB9 A;  4PSX A;  4HNW B;  2R1I A;  4QC6 A;  5AG4 A;  1IID A;  2VEZ A;  4Q38 A;  3CXS A;  4M85 A;  5F49 A;  1TIQ A;  4B11 A;  4H6U A;  1QSM A;  2B5G B;  2G0B A;  4FD4 A;  5F48 A;  1RO5 A;  1WK4 A;  3RYO A;  2O28 A;  2HQY A;  4CYQ A;  3BJ8 A;  4CGP A;  2Z3N A;  3S6G A;  4HKF A;  4MY0 A;  4CGO A;  1M4I A;  3GKR A;  4MI4 A;  3TO6 A;  2YGW A;  1BO4 A;  2YNE A;  4KUA A;  1PUA A;  1S7K A;  4XNH C;  4MFJ A;  3SHP A;  5J8C A;  4JD6 A;  3DDD A;  4KSA A;  4KOW A;  4M3S A;  1QST A;  2YNC C;  1YVO A;  4QBJ A;  4B5P A;  5H86 A;  1PU9 A;  4KVM E;  3IU1 A;  1P4N A;  3R9E A;  3WR7 A;  4MHD A;  5H84 A;  2Z3M A;  1I21 A;  1V0C A;  3S6F A;  1YR0 A;  1OZP A;  2PC1 A;  4NSQ A;  2RC4 A;  2GIV A;  2JEV A;  4FD5 A;  3IU2 A;  4MFP A;  2PDO A;  3EO4 A;  2ZW5 A;  2PR1 A;  3IWG A;  4CAF A;  5AG6 A;  4ZBG A;  3TFY A;  1MK4 A;  4OAE A;  2OZU A;  3N7Z A;  3SXN A;  4XNH B;  3TE4 A;  4CRZ B;  1M44 A;  1QSR A;  4F0Y A;  2HV2 A;  4CYN A;  2H5M A;  2OB0 A;  4L8A A;  3EFA A;  1KUY A;  3D8P A;  4UFV A;  2DPT A;  2K5T A;  4R3K A;  1IIC A;  2WPX A;  2C27 A;  4NXY A;  4KOS A;  4KLW A;  4K30 A;  4E2A A;  4ONU A;  3KKW A;  3TT2 A;  4XPD C;  2DXQ A;  4UWI A;  1GHE A;  4A95 A;  2Z3O A;  4NF1 A;  2NMT A;  2J8N A;  2GAN A;  3F0A A;  4HNY B;  4I49 A;  4MY3 A;  2PQ8 A;  3F8K A;  4UWJ A;  3PZJ A;  5G1Z A;  4C2Y A;  5KTD A;  2ZW7 A;  2FCK A;  1B87 A;  4KVX A;  2FSR A;  3JTK A;  4R3L A;  2REF A;  5JPH A;  3E0K A;  1YRE A;  3DSB A;  2D4O A;  3QAH A;  2GE3 A;  3TOB A;  4UFX A;  4B14 A;  5IB0 A;  3D2M A;  1Z9U A;  2FE7 A;  2DPS A;  4KZT A;  1ZO0 A;  2J8R A;  3I9S A;  4B13 A;  4UCP A;  2P6F A;  2B3U A;  4XPK A;  2EVN A;  3FNC A;  2B4D A;  3FYN A;  2Z0Z A;  4BMH A;  3BLN A;  2FXF A;  2ATR A;  3D3S A;  4RI1 A;  4XPD B;  2Q0Y A;  4MBU A;  4FD6 A;  3LD2 A;  2G3T A;  3OWC A;  2ZPA A;  4C7H A;  3H5Z A;  1BOB A;  2WPW A;  4Y49 C;  2QML A;  4JXQ A;  1Y9W A;  4R87 A;  3G3S A;  2EUI A;  3R96 A;  1XE4 A;  4R9M A;  2P6G A;  5FVJ A;  1YGH A;  5IX3 A;  5J8F A;  2B4B A;  2I00 A;  3H4Q A;  2BUE A;  4A33 A;  3P2F A;  4CAX A;  3G8W A;  3EXN A;  4A32 A;  1S5K A;  4CAW A;  2CNM A;  4CGL A;  3K9U A;  3T90 A;  3V8I A;  2ARH A;  5IV0 A;  4KOR A;  2R7H A;  2YND A;  3R9G A;  1NSL A;  4MFZ A;  3R9F A;  4CGM A;  1NE9 A;  4EVY A;  2Z3K A;  1FY7 A;  4U9Y A;  4NCZ A;  4Y49 B;  2VZY A;  5CNP A;  4MJ8 A;  3R95 A;  3GY9 A;  1UFH A;  4AVC A;  5KTC A;  4DNC A;  4CAE A;  2OH1 A;  4HNX B;  3TCV A;  4QVT A;  2FL4 A;  4A30 A;  5DWN A;  3JUW A;  3NE7 A;  2Q4V A;  1KUV A;  4XPL A;  2QIR A;  4F0X A;  3EC4 A;  3C26 A;  5G20 A;  3CXP A;  4UA3 A;  3IWE A;  1Y7R A;  1YX0 A;  4BBH A;  1IB1 E;  4CS0 B;  2Y0M A;  1N71 A;  3PP9 A;  4X5K A;  5HH1 A;  4B5P B;  2B58 A;  4CGN A;  3BJ7 A;  5A27 A;  4IUS A;  4C2Z A;  4AVA A;  2JLM A;  2I79 A;  3W6X A;  2PRB A;  5C82 A;  1M1D A;  4OAD A;  5AG5 A;  1S7L A;  4NEX A;  5HMN A;  4C7I A;  3TOA A;  2X7B A;  4IF5 A;  4F6A A;  1QSN A;  4YGO A;  4UCN A;  1SQH A;  3LOD A;  2WUU A;  2Z10 A;  2ZXV A;  2PR8 A;  3VWD A;  4KUB A;  2BL1 A;  2CXA A;  2D4P A;  3EY5 A;  2CNT A;  2B3V A;  4KOU A;  4II9 A;  2VXK A;  3DNS A;  1M4D A;  2Q04 A;  3FB3 A;  4LUA A;  5JQ4 A;  4CYP A;  2J8M A;  2VBQ A;  4CRY B;  2Q44 A;  3P2H A;  2F5I A;  5AG7 A;  1J4J A;  2AJ6 A;  4PV6 A;  4PSW A;  4FD7 A;  5EBV A;  1XMT A;  2REE A;  5KTA A;  4H6Z A;  4R57 A;  2CNS A;  2B5G A;  1B6B A;  2CY2 A;  4KS9 A;  4UCM A;  2R98 A;  4AG9 A;  4E0A A;  3SXO A;  3W91 A;  1IYL A;  1CJW A;  2Z11 A;  1LRZ A;  1XIX A;  2JDD A;  1Q2D A;  4UFW A;  5F47 A;  2VI7 A;  5GCN A;  3FBU A;  4KVO E;  5AGE A;  3FXT A;  5ISV A;  3VWE A;  3I3G A;  5G21 A;  5EC4 A;  2P6E A;  4LX9 A;  2G3A A;  2R8V A;  4AVB A;  1Y9K A;  1WWZ A;  3GYA A;  3T9Y A;  1S7F A;  4KOT A;  3ZJ0 A;  2KCW A;  1I12 A;  4KLV A;  1P0H A;  3W6S A;  3FIX A;  1KZF A;  1XEB A;  2B4D B;  3CXQ A;  1XF8 A;  2VQY A;  1MJ9 A;  5E96 A;  2FT0 A;  2BSW A;  4CAV A;  5A28 A;  2BEI A;  4U5Y A;  4A2Z A;  5BWA B;  3S6H A;  3D2P A;  2Z3P A;  1VKC A;  2FS5 A;  2IL4 A;  4YFJ A;  3MGD A;  1Q2Y A;  4JJX A;  2QEC A;  3UY5 A;  1RXT A;  1CM0 A;  1YK3 A;  4OLL A;  4B5O A;  4RS2 A;  1KUX A;  4PK2 A;  1S60 A;  2YNC A;  3FRM A;  2OU2 A;  2A4N A;  1I1D A;  1U6M A;  1Z4R A;  5C88 A;  4A31 A;  1R57 A;  4KOX A;  2HUZ A;  2WSA A;  2ZW6 A;  4ZGY B;  4U9Z A;  1K4J A;  1IYK A;  1S7N A;  4C68 A;  4C2X A;  3B8G A;  3F5B A;  4GS4 A;  2FIA A;  1S3Z A;  2ZW4 A;  4AB7 A;  4KSF A;  4H89 A;  5F46 A;  2Z3L A;  5DWM A;  2OZH A;  1NMT A;  3TO9 A;  3DR8 A;  2Q4Y A;  4YRH A;  1VHS A;  3QB8 A;  4AG7 A;  4JLY A;  1YVK A;  3A9L A;  1Z4E A;  1QSO A;  4CYO A;  1YLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...