3R9GA

Crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with coenzyme a and processed microcin c7 antibiotic
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
180
Chain Sequence
DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccE protein
publication title Structural Basis for Microcin C7 Inactivation by the MccE Acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transferase inhibitor
total genus 55
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3r9gA00
2X7BA 3G8WA 4XPLA 4R9MA 2GANA 2ZW6A 1Y7RA 1S7FA 1WWZA 1ON0A 2FIWA 2Q4VA 5IX3A 3S6GA 2Z0ZA 1KUYA 1R57A 1RXTA 3R9FA 2FXFA 1S7KA 3BLNA 1WK4A 2CNTA 4YFJA 5KTDA 4XNHC 1QSNA 2G0BA 2P6GA 4PSWA 2CNSA 1QSOA 2Q04A 2ZPAA 1IIDA 4E8OA 4YRHA 1GHEA 2HV2A 4M85A 4XNHB 2PSWA 3I9SA 2BL1A 4MI4A 4CAWA 3CXSA 2A4NA 1NSLA 1FY7A 2BEIA 5FVJA 4PSXA 4R57A 2D4OA 2PRBA 3VWEA 5C88A 3OWCA 3D8PA 1MK4A 3GYAA 4QC6A 1MJAA 4FD7A 4HKFA 2VQYA 1S3ZA 2QECA 4ZBGA 4BMHA 4MHDA 2RC4A 3UY5A 2KCWA 3FXTA 3RYOA 4ORFA 4NEXA 4B5OA 5H84A 3FNCA 1KZFA 3SXNA 3WR7A 2AJ6A 3TOBA 4IF5A 4J3GA 2Z11A 1BO4A 4E2AA 4K30A 2FL4A 2NMTA 2ARHA 2OZHA 4KLWA 2BSWA 3LODA 3FRMA 5GCNA 2QIRA 1YK3A 5HH1A 5JQ4A 2OB0A 2F5IA 2I79A 1Y9KA 2FT0A 4KVME 1PUAA 4IUSA 3R96A 4HNWB 2Q7BA 1IYKA 1VHSA 1YLEA 2I00A 2OU2A 3PGPA 4R87A 3PZJA 4KOUA 2P6FA 3E0KA 4CAVA 4KOWA 2G3TA 3W6SA 1S5KA 3D3SA 3VWDA 5CNPA 1XF8A 3TO7A 4KOXA 3LD2A 4DNCA 2FIAA 4MJ8A 2R98A 4JD6A 4E0AA 2Y0MA 3CXQA 5EC4A 4KOSA 2ATRA 2JDCA 2ZXVA 4OAEA 3W6XA 1B6BA 4JWPA 1BOBA 2ZW7A 1M4DA 4GS4A 1UFHA 2FSRA 3QAHA 4XPKA 1PU9A 3CXPA 2B5GB 1YGHA 2VBQA 3GKRA 2WPWA 2D4PA 2FCKA 4JLYA 5F48A 4CRYB 4AB7A 3S6HA 3EC4A 4FD5A 3P2FA 2PDOA 5I0CA 4CRZB 3FYNA 2R1IA 2Z10A 4HNXB 4CAXA 3TT2A 4H6ZA 4I49A 1S60A 3TOAA 4QB9A 4UWJA 2G3AA 2O28A 2PC1A 1QSRA 2PR8A 2REEA 3SXOA 4NSQA 1L0CA 1Q2YA 4QBJA 3TCVA 3DNSA 2AE6A 4EVYA 1XEBA 4H89A 5E96A 4U5YA 1KUVA 2OZGA 2B5GA 2REFA 4F0YA 3S6KA 4AVAA 4PV6A 3T9YA 4NF1A 3JVNA 1NE9A 1U6MA 2VI7A 1Z4RA 2K5TA 1VKCA 2CNMA 1S7NA 4H6UA 4FD6A 2DXQA 4MBUA 5IV0A 2CY2A 2J8NA 3FIXA 3TTHA 1P4NA 2B4BA 3K9UA 2GIVA 3EFAA 4M3SA 4LX9A 3B8GA 2WPXA 4F6AA 3EO4A 3G3SA 4NCZA 2J8RA 4QUSA 3GY9A 3R9EA 2C27A 3ZZIA 3D2MA 3R95A 4UA3A 1I21A 4FD4A 4UBRA 1CM0A 5HMNA 2B3UA 4PK2A 2H5MA 1YVOA 2VXKA 5EBVA 5C82A 1RO5A 4CS0B 3EY5A 4LUAA 3FB3A 4MY3A 1YR0A 5KTCA 4KOYA 5F47A 4KORA 2PR1A 1P0HA 5H86A 4UWIA 3R9GA 3D2PA 2JEVA 5IB0A 3TO9A 2R8VA 3DR6A 4AVBA 1M4IA 1IB1E 4B5PB 4NXYA 1SQHA 1Y9WA 1I1DA 1I12A 3NE7A 1IICA 4X5KA 3V8IA 5KTAA 1Z4EA 2B58A 2PQ8A 5DWNA 2VZYA 1TIQA 1J4JA 3BJ8A 1CJWA 1KUXA 1M1DA 3F8KA 4AG9A 1Q2DA 2OZUA 4JXQA 3JUWA 3BJ7A 4U9YA 1V0CA 2B3VA 3DSBA 3DR8A 3PP9A 2VEZA 2ZW4A 4R3KA 1Q2CA 3N7ZA 4KOTA 4L8AA 4Y49C 2OH1A 2P6EA 2Q44A 1YX0A 5F49A 1M44A 3QB8A 4JXRA 4KVOE 2EVNA 1YREA 4II9A 3MGDA 1NMTA 1N71A 4KOVA 1MJ9A 2P0WA 4B5PA 1M4GA 4HNYB 4AVCA 4L89A 4Y49B 1XE4A 4PK3A 2GE3A 2JDDA 2FE7A 3I3GA 2B4DB 1Z9UA 2QMLA 2VZZA 2HQYA 2FS5A 5ISVA 1QSTA 2HUZA 1K4JA 4U9ZA 4KVXA 2Q0YA 3SHPA 3KKWA 4AG7A 4QVTA 3R1KA 4KUAA 5DWMA 4KUBA 2ZW5A 2Q4YA 4KLVA 3ZJ0A 1MJBA 4RS2A 1B87A 3F5BA 2R7HA 1S7LA 3C26A 3W91A 3TFYA 2JLMA 3IWGA 3EXNA 2IL4A 4KZTA 4R3LA 1XIXA 1YVKA 2J8MA 3P2HA 3F0AA 4RI1A 3TE4A 2EUIA 3H4QA 2BUEA 4YGOA 3T90A 4OADA 5J8FA 4XPDC 3IGRA 3FBUA 3TO6A 1LRZA 1OZPA 5F46A 1QSMA 1IYLA 1XMTA 4OLLA 2B4DA 4MY0A 3DDDA 3S6FA 4ONUA 5JPHA 4JJXA 4XPDB 5J8CA
chains in the Genus database with same CATH superfamily
2JEWA 2X7BA 2IQ6A 4OKOA 3G8WA 3WT4A 4ZGYB 1FNOA 2GLFA 3ISZA 3GUXA 1CP7A 4EFDA 2DPTA 3MRUA 3IWWA 3WABA 2QVPA 2PIYA 4XPLA 4R9MA 4DUKA 2GANA 2ZW6A 5BWAB 3VATA 3LWUA 4MXUA 3K9TA 4NJRA 3D67A 3H5ZA 1Y7RA 1S7FA 5G21A 1WWZA 1ON0A 2FIWA 4MCPA 2Q4VA 1IOFA 4CGLA 2GFQA 5IX3A 3S6GA 4HPSA 2Z0ZA 4MFQA 1KUYA 1R57A 3FEDA 3KI9A 1RXTA 5ELYA 1HDUA 3R9FA 4UFWA 2FXFA 1S7KA 4CYOA 2XEGA 3BLNA 1WK4A 4UEFA 4NGRA 2CNTA 4ZX9A 4YFJA 4UF4A 5KTDA 4XNHC 4FWUA 1QSNA 2G0BA 4ZY0A 1AMPA 1JQGA 2P6GA 4PSWA 4C7HA 2CNSA 1QSOA 1TF9A 5G20A 2Q04A 4MRIA 1ZG9A 5G1ZA 2ZPAA 1IIDA 4M6HA 4CGOA 4E8OA 3HLPA 4YRHA 1GHEA 4CGMA 3D7FA 2HV2A 4G1PA 3IJ3A 5LRKA 4M85A 4XNHB 2PSWA 5AG6A 5J1QA 1XRYA 3I9SA 1F2PA 2BL1A 4MI4A 4CAWA 1HEEA 2OR4A 1XBUA 2A4NA 2ANPA 3CXSA 1NSLA 1FY7A 2BEIA 5FVJA 5K8PA 4PSXA 4R57A 2D4OA 2PRBA 2I3CA 3FECA 3VWEA 5C88A 2PJ3A 3OWCA 3D8PA 3DLJA 4UCMA 1MK4A 3GYAA 2GREA 5HVFA 4QC6A 1MJAA 4FD7A 5K8MA 4ONWA 4HKFA 2VQYA 1YW4A 1S3ZA 2QECA 4O23A 4Q7AA 1PYTB 4ZBGA 1VHEA 1X10A 4WJBA 4B13A 4MHDA 2ZOFA 4BMHA 2RC4A 5JGFA 3RZAA 5G22A 3UY5A 2KCWA 3FXTA 3RYOA 4ORFA 1XJOA 2CXAA 4NEXA 2ZEMA 4B5OA 4B11A 5H84A 1VIXA 2IMOA 2ZEDA 3FNCA 3NH4A 2Z3KA 4UCPA 1KZFA 3SXNA 3IU2A 2AFSA 3WR7A 2AJ6A 3TOBA 3FEEA 4IF5A 4J3GA 2Z11A 4KS9A 4JYWA 3VH9A 1BO4A 4E2AA 3PRTA 1Z5RA 4A33A 3KASA 4K30A 2FL4A 2NMTA 2VL1A 2ARHA 2OZHA 4KLWA 2BSWA 1BLLE 5A27A 4OC2A 3LODA 4ZX8A 2JBJA 3BHXA 3FRMA 5GCNA 3V38A 4F8ZA 2QIRA 5HXDA 1YK3A 5HH1A 5JQ4A 2OB0A 4WWVA 2F5IA 2I79A 4UIAA 4MCSA 3IC1A 1Y9KA 3TX8A 2FT0A 4KVME 2F8HA 1PUAA 4IUSA 3R96A 4HNWB 4MHZA 1XFOA 2Q7BA 2ZENA 1IYKA 1VHSA 3IEHA 2PVVA 4P4FA 3WC7A 4C2ZA 3KHXA 2RFHA 1YLEA 3PFOA 2I00A 2OU2A 3JTKA 3PGPA 4R87A 1F2OA 4EWTA 2YNEA 3PZJA 3B3CA 4KOUA 4UEEA 4YU9A 2PRQA 3FH4A 2P6FA 5IB9A 1ZO0A 3E0KA 2XEFA 4CAVA 4MMOA 2XEIA 3VARA 1EE3P 4KOWA 2G3TA 3I1UA 5LYIA 3W6SA 1S5KA 2Z3LA 3NFZA 3SI0A 3D3SA 5AG5A 3VWDA 4Q36A 5CNPA 7CPAA 3TC8A 1XF8A 2DF5A 1VHOA 2ABZA 5F09A 1LAMA 3NE8A 5AGEA 2WYRA 3DGVA 3KQZA 2WUUA 3TO7A 4DJLA 4KOXA 2O4HA 5D8NA 3LD2A 4DNCA 2FIAA 3PBEA 4MJ8A 2R98A 4JD6A 4E0AA 2Y0MA 3RO0A 3CXQA 3PB7X 3B7IA 1ARMA 5EC4A 4KOSA 2ATRA 2JDCA 2ZXVA 4OAEA 2PCUA 3W6XA 5EMIA 1B6BA 4JWPA 1BOBA 3CT9A 1Z8TA 2ZW7A 1M4DA 2WSAA 2ZEOA 3SJXA 4GS4A 1UFHA 4LQGA 3S9MA 2FSRA 3QAHA 1TXRA 4A30A 4XPKA 5AG4A 4KSAA 1PU9A 3CXPA 5LRGA 1BAVA 1PCAA 2B5GB 3D7GA 3FX6A 1YGHA 2VBQA 1XOVA 3GKRA 2WPWA 5A28A 2D4PA 4MFZA 1CP6A 2C6GA 2FCKA 3N5FA 4JLYA 5F48A 4CRYB 4AB7A 1LOKA 3S6HA 1IGBA 3EC4A 4FBEA 4FD5A 4KSIA 1YQEA 4CYNA 3P2FA 2PDOA 1ELLP 1ARLA 2J9AA 4CRZB 5I0CA 3FYNA 2PIZA 1F57A 1Z8LA 2YNCA 3RBUA 1Q7LA 4CPAA 4X3RA 3B3TA 5CBMA 2R1IA 3KR5A 2Z10A 4GM5A 4HNXB 3TT2A 4H6ZA 4CAXA 4CAEA 4UFVA 3QNVA 3T8WA 4UFXA 1YW6A 3A9LA 4UCNA 4I49A 1S60A 3TOAA 3SJEA 4GXHA 4F0XA 1TKFA 4B10A 4QB9A 3H8FA 4UWJA 2G3AA 2O28A 4W9YA 1M4LA 2PC1A 5K8OA 1QSRA 1Z8XA 2PR8A 2REEA 3D68A 2YGWA 3SXOA 3LMSA 4ZI6A 4NSQA 1L0CA 2AFXA 1Q2YA 2V8VA 1TKJA 4M6GA 4QBJA 2DPSA 1Y7EA 3TCVA 3DNSA 3BI0A 2AE6A 2C6PA 5HVHA 4EVYA 1XEBA 2XEJA 4H89A 2OOTA 2JBKA 5E96A 2F7VA 4U5YA 1KUVA 2OZGA 2B5GA 2REFA 4P4DA 4OC4A 4F0YA 3S6KA 3IO1A 4AVAA 3PB9X 4UEZA 4NGTA 1H8LA 4F9VA 2PJ4A 3CPXA 4PV6A 3T9YA 4OC5A 4B12A 1LANA 4MFLA 3FVLA 4NF1A 3NH5A 3JVNA 1NE9A 1U6MA 2VI7A 1Z4RA 2K5TA 4TWEA 5LYFA 2NYQA 2YNDA 1VKCA 4NGMA 4PXCA 2CNMA 2PE3A 1Y0YA 1AUGA 4FAIA 1S7NA 2Q51A 4H6UA 4FD6A 3PBBA 2DXQA 4MBUA 2EBJA 3D7HA 4OIDA 4ZY2A 3KR4A 5IV0A 4MHPA 4M6IA 2CY2A 4YWYA 2J8NA 3SI2A 2QJ8A 3BI1A 3FIXA 2C6CA 4MHNA 4CGNA 1TF8A 2HC9A 2PJBA 4NGSA 2PJ9A 1IU8A 3TTHA 1P4NA 1BPNA 2AFWA 3K2KA 1LAPA 2B4BA 4MFPA 1LFWA 2BCOA 2NSMA 1AYEA 2GIVA 3EFAA 1RTQA 3K9UA 4LX9A 2CTBA 4M3SA 4X8IA 4A37A 3B8GA 4ZY1A 2ZELA 2WPXA 4F6AA 4Z65A 4A38A 3EO4A 3G3SA 1CG2A 3H8GA 2J8RA 4NCZA 3GY9A 4Q38A 4QUSA 6CPAA 4PPZA 2RB7A 4FUUA 4DYOA 2PJ5A 3R9EA 2C27A 3ZZIA 2AFUA 5JH9A 3D2MA 8CPAA 5I4MA 3R95A 4UA3A 1I21A 4FD4A 1CX8A 4OC1A 4UBRA 4PXBA 1CM0A 5HMNA 4H2KA 2B3UA 2Z3NA 3PB4X 4PK2A 2H5MA 1Y0RA 4C7IA 5LRJA 3QAYA 1YVOA 1Z2LA 2PJ7A 2VXKA 4P4IA 5EBVA 3SI1A 5C82A 1RO5A 4CS0B 3EY5A 4LUAA 3FB3A 4MY3A 1YR0A 5KTCA 3S9NA 4KOYA 4ZYQA 5F47A 3FJUA 3IWEA 4OP4A 4KORA 3PEIA 2DEAA 4NGNA 2IJZA 3CZXA 3D4UA 2PR1A 2WZNA 1P0HA 3PB8X 4X2TA 4NJQA 4UWIA 3FMCA 4MFJA 5H86A 3D2PA 2JEVA 3R9GA 4A31A 4MCRA 2G9DA 4CAFA 5IB0A 3TO9A 2R8VA 3DR6A 4AVBA 1M4IA 4P10A 1IB1E 1YSJA 4UIBA 4B5PB 4NXYA 1SQHA 2EK8A 1Y9WA 2PJCA 1I1DA 1I12A 3NE7A 1A2ZA 1QQ9A 4P4BA 2Z3OA 3WC5A 4NGQA 5AG7A 1KWMA 1IICA 4X5KA 3KGQA 4K3NA 3V7ZA 2V77A 5CPAA 3V8IA 5KTAA 1Z8WA 1Z4EA 3RAMA 4IAVA 2B58A 4A94A 2PQ8A 5DWNA 4NGPA 3KZWA 2VZYA 1TIQA 2PJ1A 4C68A 4A39A 4BINA 2Q43A 1J4JA 2ZEPA 3GIUA 3B35A 3BJ8A 1ZLIA 1CJWA 1KUXA 1M1DA 2BO9A 4R76A 2ZEEA 2CIJA 3F8KA 3GB0A 4IK2A 3GLJA 4AG9A 1Q2DA 2OZUA 4PXDA 4JXQA 3IFEA 5LYLA 2AFMA 2FVGA 2PJ6A 1IOIA 3CDXA 3SJFA 3JUWA 4P45A 4BD9A 3D7DA 4P4JA 3BJ7A 1DTDA 4U9YA 1NSAA 1R3NA 3B3SA 1V0CA 2AFZA 4CYQA 2V8DA 2B3VA 3DSBA 1ZG7A 3HUVA 1YLOA 3DR8A 1JWQA 3PP9A 3B3WA 2VEZA 2ZW4A 4R3KA 4CGPA 3PB6X 1Q2CA 3N7ZA 4KOTA 4L8AA 4NFRA 2OH1A 2P6EA 2Q44A 3H8EA 1YX0A 2GU2A 4Y49C 4PQAA 1M44A 1VGYA 3QB8A 5F49A 2ZOGA 4JXRA 2EVNA 3LACA 4KVOE 1YREA 4OC3A 4JZ0A 2GLJA 3MGDA 4MHYA 1NMTA 4AXVA 4II9A 1IY7A 1N71A 4KOVA 1MJ9A 4B14A 2P0WA 4B5PA 4EMEA 1CPSA 1QMUA 1M4GA 4KSFA 2PJ2A 4HNYB 4AVCA 4L89A 4Y49B 1XE4A 4PK3A 2GE3A 5HVGA 2JDDA 4R7MA 2PVWA 1BPMA 1CBXA 1HDQA 2PJAA 2FE7A 2O53A 1UWYA 3I3GA 1X12A 2B4DB 1Z9UA 3NA6A 2QMLA 2Z3PA 2VZZA 4OC0A 2HQYA 3BXMA 1R43A 2FS5A 5ISVA 1QSTA 2HUZA 1ZLHA 3SJGA 1K4JA 2EO8A 4U9ZA 3NH8A 2BOAA 4KVXA 2Q0YA 3SHPA 1XMBA 4MCQA 4A95A 3KKWA 4AG7A 2C1CA 3WC6A 2Q4ZA 2ZEGA 4QVTA 3R1KA 1ZG8A 4KUAA 4KUBA 1ELMP 2Q4YA 2ZW5A 4MFKA 1OBRA 5DWMA 4KLVA 4CYPA 3ZJ0A 3D66A 4P6YA 1MJBA 1FT7A 3L2NA 4IHMA 4RS2A 4R8FA 3RNZA 3S9LA 1B87A 3F5BA 4R6TA 2R7HA 1S7LA 3MN8A 3C26A 4A32A 3W91A 4PXEA 1CPXA 1YMEA 3TFYA 2Q7SA 2JLMA 2ZEFA 2V8GA 3IWGA 2AFOA 3EXNA 2IL4A 2PJ0A 3CPAA 1XIXA 3IIBA 4KZTA 3JRUA 4R3LA 1YVKA 3IU1A 5K8NA 3ISXA 2J8MA 3P2HA 3F0AA 2PJ8A 4A2ZA 4OIWA 4RI1A 3TE4A 4C2YA 5JM6A 1LCPA 2EUIA 3H4QA 4RN7A 2BUEA 3KHZA 1GYTA 3B3VA 4BBHA 2CTCA 3PFEA 4P4EA 4YGOA 2ZEHA 4RUHA 3KQXA 3FF3A 3B2YA 4TNUA 3T90A 3KL9A 2POKA 2CF4A 2QYVA 4OADA 5DS0A 5J8FA 1DE4C 4XPDC 3IGRA 3FBUA 2EWBA 3TO6A 1LRZA 4P44A 5LYDA 1OZPA 5F46A 1QSMA 1IYLA 2EK9A 2V8HA 4LQ6A 2HB6A 2YNCC 1XMTA 4OLLA 2B4DA 4F9UA 4MY0A 4C2XA 5THWA 3DDDA 5D29A 3S6FA 4ONUA 4OMEA 4B6ZA 5JPHA 4JJXA 4XPDB 1TKHA 2ODFA 2Z3MA 5J8CA
chains in the Genus database with same CATH topology
2X7BA 4ZGYB 3G8WA 2DPTA 4XPLA 4R9MA 2GANA 2ZW6A 5BWAB 3H5ZA 1Y7RA 1S7FA 5G21A 1WWZA 1ON0A 2FIWA 2Q4VA 4CGLA 5IX3A 3S6GA 2Z0ZA 4MFQA 1KUYA 1R57A 1RXTA 3R9FA 4UFWA 2FXFA 1S7KA 4CYOA 3BLNA 1WK4A 2CNTA 4YFJA 5KTDA 4XNHC 1QSNA 2G0BA 2P6GA 4PSWA 4C7HA 2CNSA 1QSOA 5G20A 2Q04A 5G1ZA 2ZPAA 1IIDA 4CGOA 4E8OA 4YRHA 1GHEA 4CGMA 2HV2A 4M85A 4XNHB 2PSWA 5AG6A 3I9SA 2BL1A 4MI4A 4CAWA 3CXSA 2A4NA 1NSLA 1FY7A 2BEIA 5FVJA 4PSXA 4R57A 2D4OA 2PRBA 3VWEA 5C88A 3OWCA 3D8PA 4UCMA 1MK4A 3GYAA 4QC6A 1MJAA 4FD7A 4HKFA 2VQYA 1S3ZA 2QECA 4ZBGA 4B13A 4BMHA 4MHDA 2RC4A 5G22A 3UY5A 2KCWA 3FXTA 3RYOA 4ORFA 2CXAA 4NEXA 4B5OA 4B11A 5H84A 3FNCA 2Z3KA 4UCPA 1KZFA 3SXNA 3IU2A 3WR7A 2AJ6A 3TOBA 4IF5A 4J3GA 2Z11A 4KS9A 1BO4A 4E2AA 4A33A 4K30A 2FL4A 2NMTA 2ARHA 2OZHA 4KLWA 2BSWA 5A27A 3LODA 3FRMA 5GCNA 2QIRA 1YK3A 5HH1A 5JQ4A 2OB0A 2F5IA 2I79A 1Y9KA 2FT0A 4KVME 1PUAA 4IUSA 3R96A 4HNWB 2Q7BA 1IYKA 1VHSA 4C2ZA 1YLEA 2I00A 2OU2A 3JTKA 3PGPA 4R87A 2YNEA 3PZJA 4KOUA 2P6FA 1ZO0A 3E0KA 4CAVA 4KOWA 2G3TA 3W6SA 1S5KA 2Z3LA 3D3SA 5AG5A 3VWDA 4Q36A 5CNPA 1XF8A 5AGEA 3TO7A 2WUUA 4KOXA 3LD2A 4DNCA 2FIAA 4MJ8A 2R98A 4JD6A 4E0AA 2Y0MA 3CXQA 5EC4A 4KOSA 2ATRA 2JDCA 2ZXVA 4OAEA 3W6XA 1B6BA 4JWPA 1BOBA 2ZW7A 1M4DA 2WSAA 4GS4A 1UFHA 2FSRA 3QAHA 4A30A 4XPKA 5AG4A 4KSAA 1PU9A 3CXPA 2B5GB 1YGHA 2VBQA 3GKRA 2WPWA 5A28A 2D4PA 4MFZA 2FCKA 4JLYA 5F48A 4CRYB 4AB7A 3S6HA 3EC4A 4FD5A 4CYNA 3P2FA 2PDOA 5I0CA 4CRZB 3FYNA 2YNCA 2R1IA 2Z10A 4HNXB 4CAXA 3TT2A 4H6ZA 4CAEA 4UFVA 4UFXA 4UCNA 3A9LA 4I49A 1S60A 3TOAA 4B10A 4QB9A 4UWJA 2G3AA 2O28A 2PC1A 1QSRA 2PR8A 2REEA 2YGWA 3SXOA 4NSQA 1L0CA 1Q2YA 4QBJA 2DPSA 3TCVA 3DNSA 2AE6A 4EVYA 1XEBA 4H89A 5E96A 4U5YA 1KUVA 2OZGA 2B5GA 2REFA 4F0YA 3S6KA 4AVAA 4PV6A 3T9YA 4B12A 4MFLA 4NF1A 3JVNA 1NE9A 1U6MA 2VI7A 1Z4RA 2K5TA 2YNDA 1VKCA 2CNMA 1S7NA 4H6UA 4FD6A 2DXQA 4MBUA 5IV0A 2CY2A 2J8NA 4CGNA 3FIXA 3TTHA 1P4NA 2B4BA 4MFPA 3K9UA 2GIVA 3EFAA 4LX9A 4M3SA 3B8GA 2WPXA 4F6AA 3EO4A 3G3SA 4NCZA 4Q38A 2J8RA 4QUSA 3GY9A 3R9EA 2C27A 3ZZIA 3D2MA 3R95A 4UA3A 1I21A 4FD4A 4UBRA 1CM0A 5HMNA 2B3UA 2Z3NA 4PK2A 2H5MA 4C7IA 1YVOA 2VXKA 5EBVA 5C82A 1RO5A 4CS0B 3EY5A 4LUAA 3FB3A 4MY3A 1YR0A 5KTCA 4KOYA 5F47A 3IWEA 4KORA 2PR1A 1P0HA 5H86A 4UWIA 3R9GA 4MFJA 4F0XA 3D2PA 2JEVA 4A31A 5IB0A 4CAFA 3TO9A 2R8VA 3DR6A 4AVBA 1M4IA 1IB1E 4B5PB 4NXYA 1SQHA 1Y9WA 1I1DA 1I12A 3NE7A 2Z3OA 5AG7A 1IICA 4X5KA 3V8IA 5KTAA 1Z4EA 2B58A 2PQ8A 5DWNA 2VZYA 1TIQA 4C68A 1J4JA 3BJ8A 1CJWA 1KUXA 1M1DA 3F8KA 4AG9A 1Q2DA 2OZUA 4JXQA 3JUWA 3BJ7A 4U9YA 1V0CA 4CYQA 2B3VA 3DSBA 3DR8A 3PP9A 2VEZA 2ZW4A 4R3KA 4CGPA 1Q2CA 3N7ZA 4KOTA 4L8AA 4Y49C 2OH1A 2P6EA 2Q44A 1YX0A 5F49A 1M44A 3QB8A 4JXRA 4KVOE 2EVNA 1YREA 4II9A 3MGDA 1NMTA 1N71A 4KOVA 1MJ9A 4B14A 2P0WA 4B5PA 1M4GA 4KSFA 4HNYB 4AVCA 4L89A 4Y49B 1XE4A 4PK3A 2GE3A 2JDDA 2FE7A 3I3GA 2B4DB 1Z9UA 2QMLA 2Z3PA 2VZZA 2HQYA 2FS5A 5ISVA 1QSTA 2HUZA 1K4JA 4U9ZA 4KVXA 2Q0YA 3SHPA 4A95A 3KKWA 4AG7A 4QVTA 3R1KA 4KUAA 5DWMA 4KUBA 2ZW5A 2Q4YA 4MFKA 4CYPA 4KLVA 3ZJ0A 1MJBA 4RS2A 1B87A 3F5BA 2R7HA 1S7LA 3C26A 4A32A 3W91A 3TFYA 2JLMA 3IWGA 3EXNA 2IL4A 4KZTA 4R3LA 1XIXA 1YVKA 3IU1A 2J8MA 3P2HA 3F0AA 4A2ZA 4RI1A 3TE4A 4C2YA 2EUIA 3H4QA 2BUEA 4BBHA 4YGOA 3T90A 4OADA 5J8FA 4XPDC 3IGRA 3FBUA 3TO6A 1LRZA 1OZPA 5F46A 1QSMA 1IYLA 2YNCC 1XMTA 4OLLA 2B4DA 4MY0A 4C2XA 3DDDA 3S6FA 4ONUA 5JPHA 4JJXA 4XPDB 2Z3MA 5J8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X7B A;  3G8W A;  4XPL A;  4R9M A;  2GAN A;  2ZW6 A;  1Y7R A;  1S7F A;  1WWZ A;  1ON0 A;  2FIW A;  2Q4V A;  5IX3 A;  3S6G A;  2Z0Z A;  1KUY A;  1R57 A;  1RXT A;  3R9F A;  2FXF A;  1S7K A;  3BLN A;  1WK4 A;  2CNT A;  4YFJ A;  5KTD A;  4XNH C;  1QSN A;  2G0B A;  2P6G A;  4PSW A;  2CNS A;  1QSO A;  2Q04 A;  2ZPA A;  1IID A;  4E8O A;  4YRH A;  1GHE A;  2HV2 A;  4M85 A;  4XNH B;  2PSW A;  3I9S A;  2BL1 A;  4MI4 A;  4CAW A;  3CXS A;  2A4N A;  1NSL A;  1FY7 A;  2BEI A;  5FVJ A;  4PSX A;  4R57 A;  2D4O A;  2PRB A;  3VWE A;  5C88 A;  3OWC A;  3D8P A;  1MK4 A;  3GYA A;  4QC6 A;  1MJA A;  4FD7 A;  4HKF A;  2VQY A;  1S3Z A;  2QEC A;  4ZBG A;  4BMH A;  4MHD A;  2RC4 A;  3UY5 A;  2KCW A;  3FXT A;  3RYO A;  4ORF A;  4NEX A;  4B5O A;  5H84 A;  3FNC A;  1KZF A;  3SXN A;  3WR7 A;  2AJ6 A;  3TOB A;  4IF5 A;  4J3G A;  2Z11 A;  1BO4 A;  4E2A A;  4K30 A;  2FL4 A;  2NMT A;  2ARH A;  2OZH A;  4KLW A;  2BSW A;  3LOD A;  3FRM A;  5GCN A;  2QIR A;  1YK3 A;  5HH1 A;  5JQ4 A;  2OB0 A;  2F5I A;  2I79 A;  1Y9K A;  2FT0 A;  4KVM E;  1PUA A;  4IUS A;  3R96 A;  4HNW B;  2Q7B A;  1IYK A;  1VHS A;  1YLE A;  2I00 A;  2OU2 A;  3PGP A;  4R87 A;  3PZJ A;  4KOU A;  2P6F A;  3E0K A;  4CAV A;  4KOW A;  2G3T A;  3W6S A;  1S5K A;  3D3S A;  3VWD A;  5CNP A;  1XF8 A;  3TO7 A;  4KOX A;  3LD2 A;  4DNC A;  2FIA A;  4MJ8 A;  2R98 A;  4JD6 A;  4E0A A;  2Y0M A;  3CXQ A;  5EC4 A;  4KOS A;  2ATR A;  2JDC A;  2ZXV A;  4OAE A;  3W6X A;  1B6B A;  4JWP A;  1BOB A;  2ZW7 A;  1M4D A;  4GS4 A;  1UFH A;  2FSR A;  3QAH A;  4XPK A;  1PU9 A;  3CXP A;  2B5G B;  1YGH A;  2VBQ A;  3GKR A;  2WPW A;  2D4P A;  2FCK A;  4JLY A;  5F48 A;  4CRY B;  4AB7 A;  3S6H A;  3EC4 A;  4FD5 A;  3P2F A;  2PDO A;  5I0C A;  4CRZ B;  3FYN A;  2R1I A;  2Z10 A;  4HNX B;  4CAX A;  3TT2 A;  4H6Z A;  4I49 A;  1S60 A;  3TOA A;  4QB9 A;  4UWJ A;  2G3A A;  2O28 A;  2PC1 A;  1QSR A;  2PR8 A;  2REE A;  3SXO A;  4NSQ A;  1L0C A;  1Q2Y A;  4QBJ A;  3TCV A;  3DNS A;  2AE6 A;  4EVY A;  1XEB A;  4H89 A;  5E96 A;  4U5Y A;  1KUV A;  2OZG A;  2B5G A;  2REF A;  4F0Y A;  3S6K A;  4AVA A;  4PV6 A;  3T9Y A;  4NF1 A;  3JVN A;  1NE9 A;  1U6M A;  2VI7 A;  1Z4R A;  2K5T A;  1VKC A;  2CNM A;  1S7N A;  4H6U A;  4FD6 A;  2DXQ A;  4MBU A;  5IV0 A;  2CY2 A;  2J8N A;  3FIX A;  3TTH A;  1P4N A;  2B4B A;  3K9U A;  2GIV A;  3EFA A;  4M3S A;  4LX9 A;  3B8G A;  2WPX A;  4F6A A;  3EO4 A;  3G3S A;  4NCZ A;  2J8R A;  4QUS A;  3GY9 A;  3R9E A;  2C27 A;  3ZZI A;  3D2M A;  3R95 A;  4UA3 A;  1I21 A;  4FD4 A;  4UBR A;  1CM0 A;  5HMN A;  2B3U A;  4PK2 A;  2H5M A;  1YVO A;  2VXK A;  5EBV A;  5C82 A;  1RO5 A;  4CS0 B;  3EY5 A;  4LUA A;  3FB3 A;  4MY3 A;  1YR0 A;  5KTC A;  4KOY A;  5F47 A;  4KOR A;  2PR1 A;  1P0H A;  5H86 A;  4UWI A;  3R9G A;  3D2P A;  2JEV A;  5IB0 A;  3TO9 A;  2R8V A;  3DR6 A;  4AVB A;  1M4I A;  1IB1 E;  4B5P B;  4NXY A;  1SQH A;  1Y9W A;  1I1D A;  1I12 A;  3NE7 A;  1IIC A;  4X5K A;  3V8I A;  5KTA A;  1Z4E A;  2B58 A;  2PQ8 A;  5DWN A;  2VZY A;  1TIQ A;  1J4J A;  3BJ8 A;  1CJW A;  1KUX A;  1M1D A;  3F8K A;  4AG9 A;  1Q2D A;  2OZU A;  4JXQ A;  3JUW A;  3BJ7 A;  4U9Y A;  1V0C A;  2B3V A;  3DSB A;  3DR8 A;  3PP9 A;  2VEZ A;  2ZW4 A;  4R3K A;  1Q2C A;  3N7Z A;  4KOT A;  4L8A A;  4Y49 C;  2OH1 A;  2P6E A;  2Q44 A;  1YX0 A;  5F49 A;  1M44 A;  3QB8 A;  4JXR A;  4KVO E;  2EVN A;  1YRE A;  4II9 A;  3MGD A;  1NMT A;  1N71 A;  4KOV A;  1MJ9 A;  2P0W A;  4B5P A;  1M4G A;  4HNY B;  4AVC A;  4L89 A;  4Y49 B;  1XE4 A;  4PK3 A;  2GE3 A;  2JDD A;  2FE7 A;  3I3G A;  2B4D B;  1Z9U A;  2QML A;  2VZZ A;  2HQY A;  2FS5 A;  5ISV A;  1QST A;  2HUZ A;  1K4J A;  4U9Z A;  4KVX A;  2Q0Y A;  3SHP A;  3KKW A;  4AG7 A;  4QVT A;  3R1K A;  4KUA A;  5DWM A;  4KUB A;  2ZW5 A;  2Q4Y A;  4KLV A;  3ZJ0 A;  1MJB A;  4RS2 A;  1B87 A;  3F5B A;  2R7H A;  1S7L A;  3C26 A;  3W91 A;  3TFY A;  2JLM A;  3IWG A;  3EXN A;  2IL4 A;  4KZT A;  4R3L A;  1XIX A;  1YVK A;  2J8M A;  3P2H A;  3F0A A;  4RI1 A;  3TE4 A;  2EUI A;  3H4Q A;  2BUE A;  4YGO A;  3T90 A;  4OAD A;  5J8F A;  4XPD C;  3IGR A;  3FBU A;  3TO6 A;  1LRZ A;  1OZP A;  5F46 A;  1QSM A;  1IYL A;  1XMT A;  4OLL A;  2B4D A;  4MY0 A;  3DDD A;  3S6F A;  4ONU A;  5JPH A;  4JJX A;  4XPD B;  5J8C A; 
#chains in the Genus database with same CATH topology
 2JEW A;  2X7B A;  2IQ6 A;  4OKO A;  3G8W A;  3WT4 A;  4ZGY B;  1FNO A;  2GLF A;  3ISZ A;  3GUX A;  1CP7 A;  4EFD A;  2DPT A;  3MRU A;  3IWW A;  3WAB A;  2QVP A;  2PIY A;  4XPL A;  4R9M A;  4DUK A;  2GAN A;  2ZW6 A;  5BWA B;  3VAT A;  3LWU A;  4MXU A;  3K9T A;  4NJR A;  3D67 A;  3H5Z A;  1Y7R A;  1S7F A;  5G21 A;  1WWZ A;  1ON0 A;  2FIW A;  4MCP A;  2Q4V A;  1IOF A;  4CGL A;  2GFQ A;  5IX3 A;  3S6G A;  4HPS A;  2Z0Z A;  4MFQ A;  1KUY A;  1R57 A;  3FED A;  3KI9 A;  1RXT A;  5ELY A;  1HDU A;  3R9F A;  4UFW A;  2FXF A;  1S7K A;  4CYO A;  2XEG A;  3BLN A;  1WK4 A;  4UEF A;  4NGR A;  2CNT A;  4ZX9 A;  4YFJ A;  4UF4 A;  5KTD A;  4XNH C;  4FWU A;  1QSN A;  2G0B A;  4ZY0 A;  1AMP A;  1JQG A;  2P6G A;  4PSW A;  4C7H A;  2CNS A;  1QSO A;  1TF9 A;  5G20 A;  2Q04 A;  4MRI A;  1ZG9 A;  5G1Z A;  2ZPA A;  1IID A;  4M6H A;  4CGO A;  4E8O A;  3HLP A;  4YRH A;  1GHE A;  4CGM A;  3D7F A;  2HV2 A;  4G1P A;  3IJ3 A;  5LRK A;  4M85 A;  4XNH B;  2PSW A;  5AG6 A;  5J1Q A;  1XRY A;  3I9S A;  1F2P A;  2BL1 A;  4MI4 A;  4CAW A;  1HEE A;  2OR4 A;  1XBU A;  2A4N A;  2ANP A;  3CXS A;  1NSL A;  1FY7 A;  2BEI A;  5FVJ A;  5K8P A;  4PSX A;  4R57 A;  2D4O A;  2PRB A;  2I3C A;  3FEC A;  3VWE A;  5C88 A;  2PJ3 A;  3OWC A;  3D8P A;  3DLJ A;  4UCM A;  1MK4 A;  3GYA A;  2GRE A;  5HVF A;  4QC6 A;  1MJA A;  4FD7 A;  5K8M A;  4ONW A;  4HKF A;  2VQY A;  1YW4 A;  1S3Z A;  2QEC A;  4O23 A;  4Q7A A;  1PYT B;  4ZBG A;  1VHE A;  1X10 A;  4WJB A;  4B13 A;  4MHD A;  2ZOF A;  4BMH A;  2RC4 A;  5JGF A;  3RZA A;  5G22 A;  3UY5 A;  2KCW A;  3FXT A;  3RYO A;  4ORF A;  1XJO A;  2CXA A;  4NEX A;  2ZEM A;  4B5O A;  4B11 A;  5H84 A;  1VIX A;  2IMO A;  2ZED A;  3FNC A;  3NH4 A;  2Z3K A;  4UCP A;  1KZF A;  3SXN A;  3IU2 A;  2AFS A;  3WR7 A;  2AJ6 A;  3TOB A;  3FEE A;  4IF5 A;  4J3G A;  2Z11 A;  4KS9 A;  4JYW A;  3VH9 A;  1BO4 A;  4E2A A;  3PRT A;  1Z5R A;  4A33 A;  3KAS A;  4K30 A;  2FL4 A;  2NMT A;  2VL1 A;  2ARH A;  2OZH A;  4KLW A;  2BSW A;  1BLL E;  5A27 A;  4OC2 A;  3LOD A;  4ZX8 A;  2JBJ A;  3BHX A;  3FRM A;  5GCN A;  3V38 A;  4F8Z A;  2QIR A;  5HXD A;  1YK3 A;  5HH1 A;  5JQ4 A;  2OB0 A;  4WWV A;  2F5I A;  2I79 A;  4UIA A;  4MCS A;  3IC1 A;  1Y9K A;  3TX8 A;  2FT0 A;  4KVM E;  2F8H A;  1PUA A;  4IUS A;  3R96 A;  4HNW B;  4MHZ A;  1XFO A;  2Q7B A;  2ZEN A;  1IYK A;  1VHS A;  3IEH A;  2PVV A;  4P4F A;  3WC7 A;  4C2Z A;  3KHX A;  2RFH A;  1YLE A;  3PFO A;  2I00 A;  2OU2 A;  3JTK A;  3PGP A;  4R87 A;  1F2O A;  4EWT A;  2YNE A;  3PZJ A;  3B3C A;  4KOU A;  4UEE A;  4YU9 A;  2PRQ A;  3FH4 A;  2P6F A;  5IB9 A;  1ZO0 A;  3E0K A;  2XEF A;  4CAV A;  4MMO A;  2XEI A;  3VAR A;  1EE3 P;  4KOW A;  2G3T A;  3I1U A;  5LYI A;  3W6S A;  1S5K A;  2Z3L A;  3NFZ A;  3SI0 A;  3D3S A;  5AG5 A;  3VWD A;  4Q36 A;  5CNP A;  7CPA A;  3TC8 A;  1XF8 A;  2DF5 A;  1VHO A;  2ABZ A;  5F09 A;  1LAM A;  3NE8 A;  5AGE A;  2WYR A;  3DGV A;  3KQZ A;  2WUU A;  3TO7 A;  4DJL A;  4KOX A;  2O4H A;  5D8N A;  3LD2 A;  4DNC A;  2FIA A;  3PBE A;  4MJ8 A;  2R98 A;  4JD6 A;  4E0A A;  2Y0M A;  3RO0 A;  3CXQ A;  3PB7 X;  3B7I A;  1ARM A;  5EC4 A;  4KOS A;  2ATR A;  2JDC A;  2ZXV A;  4OAE A;  2PCU A;  3W6X A;  5EMI A;  1B6B A;  4JWP A;  1BOB A;  3CT9 A;  1Z8T A;  2ZW7 A;  1M4D A;  2WSA A;  2ZEO A;  3SJX A;  4GS4 A;  1UFH A;  4LQG A;  3S9M A;  2FSR A;  3QAH A;  1TXR A;  4A30 A;  4XPK A;  5AG4 A;  4KSA A;  1PU9 A;  3CXP A;  5LRG A;  1BAV A;  1PCA A;  2B5G B;  3D7G A;  3FX6 A;  1YGH A;  2VBQ A;  1XOV A;  3GKR A;  2WPW A;  5A28 A;  2D4P A;  4MFZ A;  1CP6 A;  2C6G A;  2FCK A;  3N5F A;  4JLY A;  5F48 A;  4CRY B;  4AB7 A;  1LOK A;  3S6H A;  1IGB A;  3EC4 A;  4FBE A;  4FD5 A;  4KSI A;  1YQE A;  4CYN A;  3P2F A;  2PDO A;  1ELL P;  1ARL A;  2J9A A;  4CRZ B;  5I0C A;  3FYN A;  2PIZ A;  1F57 A;  1Z8L A;  2YNC A;  3RBU A;  1Q7L A;  4CPA A;  4X3R A;  3B3T A;  5CBM A;  2R1I A;  3KR5 A;  2Z10 A;  4GM5 A;  4HNX B;  3TT2 A;  4H6Z A;  4CAX A;  4CAE A;  4UFV A;  3QNV A;  3T8W A;  4UFX A;  1YW6 A;  3A9L A;  4UCN A;  4I49 A;  1S60 A;  3TOA A;  3SJE A;  4GXH A;  4F0X A;  1TKF A;  4B10 A;  4QB9 A;  3H8F A;  4UWJ A;  2G3A A;  2O28 A;  4W9Y A;  1M4L A;  2PC1 A;  5K8O A;  1QSR A;  1Z8X A;  2PR8 A;  2REE A;  3D68 A;  2YGW A;  3SXO A;  3LMS A;  4ZI6 A;  4NSQ A;  1L0C A;  2AFX A;  1Q2Y A;  2V8V A;  1TKJ A;  4M6G A;  4QBJ A;  2DPS A;  1Y7E A;  3TCV A;  3DNS A;  3BI0 A;  2AE6 A;  2C6P A;  5HVH A;  4EVY A;  1XEB A;  2XEJ A;  4H89 A;  2OOT A;  2JBK A;  5E96 A;  2F7V A;  4U5Y A;  1KUV A;  2OZG A;  2B5G A;  2REF A;  4P4D A;  4OC4 A;  4F0Y A;  3S6K A;  3IO1 A;  4AVA A;  3PB9 X;  4UEZ A;  4NGT A;  1H8L A;  4F9V A;  2PJ4 A;  3CPX A;  4PV6 A;  3T9Y A;  4OC5 A;  4B12 A;  1LAN A;  4MFL A;  3FVL A;  4NF1 A;  3NH5 A;  3JVN A;  1NE9 A;  1U6M A;  2VI7 A;  1Z4R A;  2K5T A;  4TWE A;  5LYF A;  2NYQ A;  2YND A;  1VKC A;  4NGM A;  4PXC A;  2CNM A;  2PE3 A;  1Y0Y A;  1AUG A;  4FAI A;  1S7N A;  2Q51 A;  4H6U A;  4FD6 A;  3PBB A;  2DXQ A;  4MBU A;  2EBJ A;  3D7H A;  4OID A;  4ZY2 A;  3KR4 A;  5IV0 A;  4MHP A;  4M6I A;  2CY2 A;  4YWY A;  2J8N A;  3SI2 A;  2QJ8 A;  3BI1 A;  3FIX A;  2C6C A;  4MHN A;  4CGN A;  1TF8 A;  2HC9 A;  2PJB A;  4NGS A;  2PJ9 A;  1IU8 A;  3TTH A;  1P4N A;  1BPN A;  2AFW A;  3K2K A;  1LAP A;  2B4B A;  4MFP A;  1LFW A;  2BCO A;  2NSM A;  1AYE A;  2GIV A;  3EFA A;  1RTQ A;  3K9U A;  4LX9 A;  2CTB A;  4M3S A;  4X8I A;  4A37 A;  3B8G A;  4ZY1 A;  2ZEL A;  2WPX A;  4F6A A;  4Z65 A;  4A38 A;  3EO4 A;  3G3S A;  1CG2 A;  3H8G A;  2J8R A;  4NCZ A;  3GY9 A;  4Q38 A;  4QUS A;  6CPA A;  4PPZ A;  2RB7 A;  4FUU A;  4DYO A;  2PJ5 A;  3R9E A;  2C27 A;  3ZZI A;  2AFU A;  5JH9 A;  3D2M A;  8CPA A;  5I4M A;  3R95 A;  4UA3 A;  1I21 A;  4FD4 A;  1CX8 A;  4OC1 A;  4UBR A;  4PXB A;  1CM0 A;  5HMN A;  4H2K A;  2B3U A;  2Z3N A;  3PB4 X;  4PK2 A;  2H5M A;  1Y0R A;  4C7I A;  5LRJ A;  3QAY A;  1YVO A;  1Z2L A;  2PJ7 A;  2VXK A;  4P4I A;  5EBV A;  3SI1 A;  5C82 A;  1RO5 A;  4CS0 B;  3EY5 A;  4LUA A;  3FB3 A;  4MY3 A;  1YR0 A;  5KTC A;  3S9N A;  4KOY A;  4ZYQ A;  5F47 A;  3FJU A;  3IWE A;  4OP4 A;  4KOR A;  3PEI A;  2DEA A;  4NGN A;  2IJZ A;  3CZX A;  3D4U A;  2PR1 A;  2WZN A;  1P0H A;  3PB8 X;  4X2T A;  4NJQ A;  4UWI A;  3FMC A;  4MFJ A;  5H86 A;  3D2P A;  2JEV A;  3R9G A;  4A31 A;  4MCR A;  2G9D A;  4CAF A;  5IB0 A;  3TO9 A;  2R8V A;  3DR6 A;  4AVB A;  1M4I A;  4P10 A;  1IB1 E;  1YSJ A;  4UIB A;  4B5P B;  4NXY A;  1SQH A;  2EK8 A;  1Y9W A;  2PJC A;  1I1D A;  1I12 A;  3NE7 A;  1A2Z A;  1QQ9 A;  4P4B A;  2Z3O A;  3WC5 A;  4NGQ A;  5AG7 A;  1KWM A;  1IIC A;  4X5K A;  3KGQ A;  4K3N A;  3V7Z A;  2V77 A;  5CPA A;  3V8I A;  5KTA A;  1Z8W A;  1Z4E A;  3RAM A;  4IAV A;  2B58 A;  4A94 A;  2PQ8 A;  5DWN A;  4NGP A;  3KZW A;  2VZY A;  1TIQ A;  2PJ1 A;  4C68 A;  4A39 A;  4BIN A;  2Q43 A;  1J4J A;  2ZEP A;  3GIU A;  3B35 A;  3BJ8 A;  1ZLI A;  1CJW A;  1KUX A;  1M1D A;  2BO9 A;  4R76 A;  2ZEE A;  2CIJ A;  3F8K A;  3GB0 A;  4IK2 A;  3GLJ A;  4AG9 A;  1Q2D A;  2OZU A;  4PXD A;  4JXQ A;  3IFE A;  5LYL A;  2AFM A;  2FVG A;  2PJ6 A;  1IOI A;  3CDX A;  3SJF A;  3JUW A;  4P45 A;  4BD9 A;  3D7D A;  4P4J A;  3BJ7 A;  1DTD A;  4U9Y A;  1NSA A;  1R3N A;  3B3S A;  1V0C A;  2AFZ A;  4CYQ A;  2V8D A;  2B3V A;  3DSB A;  1ZG7 A;  3HUV A;  1YLO A;  3DR8 A;  1JWQ A;  3PP9 A;  3B3W A;  2VEZ A;  2ZW4 A;  4R3K A;  4CGP A;  3PB6 X;  1Q2C A;  3N7Z A;  4KOT A;  4L8A A;  4NFR A;  2OH1 A;  2P6E A;  2Q44 A;  3H8E A;  1YX0 A;  2GU2 A;  4Y49 C;  4PQA A;  1M44 A;  1VGY A;  3QB8 A;  5F49 A;  2ZOG A;  4JXR A;  2EVN A;  3LAC A;  4KVO E;  1YRE A;  4OC3 A;  4JZ0 A;  2GLJ A;  3MGD A;  4MHY A;  1NMT A;  4AXV A;  4II9 A;  1IY7 A;  1N71 A;  4KOV A;  1MJ9 A;  4B14 A;  2P0W A;  4B5P A;  4EME A;  1CPS A;  1QMU A;  1M4G A;  4KSF A;  2PJ2 A;  4HNY B;  4AVC A;  4L89 A;  4Y49 B;  1XE4 A;  4PK3 A;  2GE3 A;  5HVG A;  2JDD A;  4R7M A;  2PVW A;  1BPM A;  1CBX A;  1HDQ A;  2PJA A;  2FE7 A;  2O53 A;  1UWY A;  3I3G A;  1X12 A;  2B4D B;  1Z9U A;  3NA6 A;  2QML A;  2Z3P A;  2VZZ A;  4OC0 A;  2HQY A;  3BXM A;  1R43 A;  2FS5 A;  5ISV A;  1QST A;  2HUZ A;  1ZLH A;  3SJG A;  1K4J A;  2EO8 A;  4U9Z A;  3NH8 A;  2BOA A;  4KVX A;  2Q0Y A;  3SHP A;  1XMB A;  4MCQ A;  4A95 A;  3KKW A;  4AG7 A;  2C1C A;  3WC6 A;  2Q4Z A;  2ZEG A;  4QVT A;  3R1K A;  1ZG8 A;  4KUA A;  4KUB A;  1ELM P;  2Q4Y A;  2ZW5 A;  4MFK A;  1OBR A;  5DWM A;  4KLV A;  4CYP A;  3ZJ0 A;  3D66 A;  4P6Y A;  1MJB A;  1FT7 A;  3L2N A;  4IHM A;  4RS2 A;  4R8F A;  3RNZ A;  3S9L A;  1B87 A;  3F5B A;  4R6T A;  2R7H A;  1S7L A;  3MN8 A;  3C26 A;  4A32 A;  3W91 A;  4PXE A;  1CPX A;  1YME A;  3TFY A;  2Q7S A;  2JLM A;  2ZEF A;  2V8G A;  3IWG A;  2AFO A;  3EXN A;  2IL4 A;  2PJ0 A;  3CPA A;  1XIX A;  3IIB A;  4KZT A;  3JRU A;  4R3L A;  1YVK A;  3IU1 A;  5K8N A;  3ISX A;  2J8M A;  3P2H A;  3F0A A;  2PJ8 A;  4A2Z A;  4OIW A;  4RI1 A;  3TE4 A;  4C2Y A;  5JM6 A;  1LCP A;  2EUI A;  3H4Q A;  4RN7 A;  2BUE A;  3KHZ A;  1GYT A;  3B3V A;  4BBH A;  2CTC A;  3PFE A;  4P4E A;  4YGO A;  2ZEH A;  4RUH A;  3KQX A;  3FF3 A;  3B2Y A;  4TNU A;  3T90 A;  3KL9 A;  2POK A;  2CF4 A;  2QYV A;  4OAD A;  5DS0 A;  5J8F A;  1DE4 C;  4XPD C;  3IGR A;  3FBU A;  2EWB A;  3TO6 A;  1LRZ A;  4P44 A;  5LYD A;  1OZP A;  5F46 A;  1QSM A;  1IYL A;  2EK9 A;  2V8H A;  4LQ6 A;  2HB6 A;  2YNC C;  1XMT A;  4OLL A;  2B4D A;  4F9U A;  4MY0 A;  4C2X A;  5THW A;  3DDD A;  5D29 A;  3S6F A;  4ONU A;  4OME A;  4B6Z A;  5JPH A;  4JJX A;  4XPD B;  1TKH A;  2ODF A;  2Z3M A;  5J8C A; 
#chains in the Genus database with same CATH homology
 2X7B A;  4ZGY B;  3G8W A;  2DPT A;  4XPL A;  4R9M A;  2GAN A;  2ZW6 A;  5BWA B;  3H5Z A;  1Y7R A;  1S7F A;  5G21 A;  1WWZ A;  1ON0 A;  2FIW A;  2Q4V A;  4CGL A;  5IX3 A;  3S6G A;  2Z0Z A;  4MFQ A;  1KUY A;  1R57 A;  1RXT A;  3R9F A;  4UFW A;  2FXF A;  1S7K A;  4CYO A;  3BLN A;  1WK4 A;  2CNT A;  4YFJ A;  5KTD A;  4XNH C;  1QSN A;  2G0B A;  2P6G A;  4PSW A;  4C7H A;  2CNS A;  1QSO A;  5G20 A;  2Q04 A;  5G1Z A;  2ZPA A;  1IID A;  4CGO A;  4E8O A;  4YRH A;  1GHE A;  4CGM A;  2HV2 A;  4M85 A;  4XNH B;  2PSW A;  5AG6 A;  3I9S A;  2BL1 A;  4MI4 A;  4CAW A;  3CXS A;  2A4N A;  1NSL A;  1FY7 A;  2BEI A;  5FVJ A;  4PSX A;  4R57 A;  2D4O A;  2PRB A;  3VWE A;  5C88 A;  3OWC A;  3D8P A;  4UCM A;  1MK4 A;  3GYA A;  4QC6 A;  1MJA A;  4FD7 A;  4HKF A;  2VQY A;  1S3Z A;  2QEC A;  4ZBG A;  4B13 A;  4BMH A;  4MHD A;  2RC4 A;  5G22 A;  3UY5 A;  2KCW A;  3FXT A;  3RYO A;  4ORF A;  2CXA A;  4NEX A;  4B5O A;  4B11 A;  5H84 A;  3FNC A;  2Z3K A;  4UCP A;  1KZF A;  3SXN A;  3IU2 A;  3WR7 A;  2AJ6 A;  3TOB A;  4IF5 A;  4J3G A;  2Z11 A;  4KS9 A;  1BO4 A;  4E2A A;  4A33 A;  4K30 A;  2FL4 A;  2NMT A;  2ARH A;  2OZH A;  4KLW A;  2BSW A;  5A27 A;  3LOD A;  3FRM A;  5GCN A;  2QIR A;  1YK3 A;  5HH1 A;  5JQ4 A;  2OB0 A;  2F5I A;  2I79 A;  1Y9K A;  2FT0 A;  4KVM E;  1PUA A;  4IUS A;  3R96 A;  4HNW B;  2Q7B A;  1IYK A;  1VHS A;  4C2Z A;  1YLE A;  2I00 A;  2OU2 A;  3JTK A;  3PGP A;  4R87 A;  2YNE A;  3PZJ A;  4KOU A;  2P6F A;  1ZO0 A;  3E0K A;  4CAV A;  4KOW A;  2G3T A;  3W6S A;  1S5K A;  2Z3L A;  3D3S A;  5AG5 A;  3VWD A;  4Q36 A;  5CNP A;  1XF8 A;  5AGE A;  3TO7 A;  2WUU A;  4KOX A;  3LD2 A;  4DNC A;  2FIA A;  4MJ8 A;  2R98 A;  4JD6 A;  4E0A A;  2Y0M A;  3CXQ A;  5EC4 A;  4KOS A;  2ATR A;  2JDC A;  2ZXV A;  4OAE A;  3W6X A;  1B6B A;  4JWP A;  1BOB A;  2ZW7 A;  1M4D A;  2WSA A;  4GS4 A;  1UFH A;  2FSR A;  3QAH A;  4A30 A;  4XPK A;  5AG4 A;  4KSA A;  1PU9 A;  3CXP A;  2B5G B;  1YGH A;  2VBQ A;  3GKR A;  2WPW A;  5A28 A;  2D4P A;  4MFZ A;  2FCK A;  4JLY A;  5F48 A;  4CRY B;  4AB7 A;  3S6H A;  3EC4 A;  4FD5 A;  4CYN A;  3P2F A;  2PDO A;  5I0C A;  4CRZ B;  3FYN A;  2YNC A;  2R1I A;  2Z10 A;  4HNX B;  4CAX A;  3TT2 A;  4H6Z A;  4CAE A;  4UFV A;  4UFX A;  4UCN A;  3A9L A;  4I49 A;  1S60 A;  3TOA A;  4B10 A;  4QB9 A;  4UWJ A;  2G3A A;  2O28 A;  2PC1 A;  1QSR A;  2PR8 A;  2REE A;  2YGW A;  3SXO A;  4NSQ A;  1L0C A;  1Q2Y A;  4QBJ A;  2DPS A;  3TCV A;  3DNS A;  2AE6 A;  4EVY A;  1XEB A;  4H89 A;  5E96 A;  4U5Y A;  1KUV A;  2OZG A;  2B5G A;  2REF A;  4F0Y A;  3S6K A;  4AVA A;  4PV6 A;  3T9Y A;  4B12 A;  4MFL A;  4NF1 A;  3JVN A;  1NE9 A;  1U6M A;  2VI7 A;  1Z4R A;  2K5T A;  2YND A;  1VKC A;  2CNM A;  1S7N A;  4H6U A;  4FD6 A;  2DXQ A;  4MBU A;  5IV0 A;  2CY2 A;  2J8N A;  4CGN A;  3FIX A;  3TTH A;  1P4N A;  2B4B A;  4MFP A;  3K9U A;  2GIV A;  3EFA A;  4LX9 A;  4M3S A;  3B8G A;  2WPX A;  4F6A A;  3EO4 A;  3G3S A;  4NCZ A;  4Q38 A;  2J8R A;  4QUS A;  3GY9 A;  3R9E A;  2C27 A;  3ZZI A;  3D2M A;  3R95 A;  4UA3 A;  1I21 A;  4FD4 A;  4UBR A;  1CM0 A;  5HMN A;  2B3U A;  2Z3N A;  4PK2 A;  2H5M A;  4C7I A;  1YVO A;  2VXK A;  5EBV A;  5C82 A;  1RO5 A;  4CS0 B;  3EY5 A;  4LUA A;  3FB3 A;  4MY3 A;  1YR0 A;  5KTC A;  4KOY A;  5F47 A;  3IWE A;  4KOR A;  2PR1 A;  1P0H A;  5H86 A;  4UWI A;  3R9G A;  4MFJ A;  4F0X A;  3D2P A;  2JEV A;  4A31 A;  5IB0 A;  4CAF A;  3TO9 A;  2R8V A;  3DR6 A;  4AVB A;  1M4I A;  1IB1 E;  4B5P B;  4NXY A;  1SQH A;  1Y9W A;  1I1D A;  1I12 A;  3NE7 A;  2Z3O A;  5AG7 A;  1IIC A;  4X5K A;  3V8I A;  5KTA A;  1Z4E A;  2B58 A;  2PQ8 A;  5DWN A;  2VZY A;  1TIQ A;  4C68 A;  1J4J A;  3BJ8 A;  1CJW A;  1KUX A;  1M1D A;  3F8K A;  4AG9 A;  1Q2D A;  2OZU A;  4JXQ A;  3JUW A;  3BJ7 A;  4U9Y A;  1V0C A;  4CYQ A;  2B3V A;  3DSB A;  3DR8 A;  3PP9 A;  2VEZ A;  2ZW4 A;  4R3K A;  4CGP A;  1Q2C A;  3N7Z A;  4KOT A;  4L8A A;  4Y49 C;  2OH1 A;  2P6E A;  2Q44 A;  1YX0 A;  5F49 A;  1M44 A;  3QB8 A;  4JXR A;  4KVO E;  2EVN A;  1YRE A;  4II9 A;  3MGD A;  1NMT A;  1N71 A;  4KOV A;  1MJ9 A;  4B14 A;  2P0W A;  4B5P A;  1M4G A;  4KSF A;  4HNY B;  4AVC A;  4L89 A;  4Y49 B;  1XE4 A;  4PK3 A;  2GE3 A;  2JDD A;  2FE7 A;  3I3G A;  2B4D B;  1Z9U A;  2QML A;  2Z3P A;  2VZZ A;  2HQY A;  2FS5 A;  5ISV A;  1QST A;  2HUZ A;  1K4J A;  4U9Z A;  4KVX A;  2Q0Y A;  3SHP A;  4A95 A;  3KKW A;  4AG7 A;  4QVT A;  3R1K A;  4KUA A;  5DWM A;  4KUB A;  2ZW5 A;  2Q4Y A;  4MFK A;  4CYP A;  4KLV A;  3ZJ0 A;  1MJB A;  4RS2 A;  1B87 A;  3F5B A;  2R7H A;  1S7L A;  3C26 A;  4A32 A;  3W91 A;  3TFY A;  2JLM A;  3IWG A;  3EXN A;  2IL4 A;  4KZT A;  4R3L A;  1XIX A;  1YVK A;  3IU1 A;  2J8M A;  3P2H A;  3F0A A;  4A2Z A;  4RI1 A;  3TE4 A;  4C2Y A;  2EUI A;  3H4Q A;  2BUE A;  4BBH A;  4YGO A;  3T90 A;  4OAD A;  5J8F A;  4XPD C;  3IGR A;  3FBU A;  3TO6 A;  1LRZ A;  1OZP A;  5F46 A;  1QSM A;  1IYL A;  2YNC C;  1XMT A;  4OLL A;  2B4D A;  4MY0 A;  4C2X A;  3DDD A;  3S6F A;  4ONU A;  5JPH A;  4JJX A;  4XPD B;  2Z3M A;  5J8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...