3R9GA

Crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with coenzyme a and processed microcin c7 antibiotic
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
180
Chain Sequence
DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Microcin C7 Inactivation by the MccE Acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transferase inhibitor
molecule keywords MccE protein
total genus 55
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3r9gA00
3JVNA 4KUBA 5KTAA 2HUZA 3W6SA 3SXNA 5C88A 1OZPA 4QB9A 3T90A 2Y0MA 4JLYA 2FCKA 5H86A 2QIRA 4H6UA 3LODA 4OAEA 2O28A 5JQ4A 1YX0A 3P2FA 1TIQA 3S6KA 3MGDA 2A4NA 4FD6A 4ONUA 3H4QA 4FD5A 5KTCA 2FIAA 2FT0A 2RC4A 4XPDC 2B4DA 4KOUA 1YVKA 1MK4A 2OZUA 2B5GA 4CS0B 4GS4A 2P6GA 3PZJA 2R7HA 4LUAA 2OZHA 5F49A 4CAXA 4QUSA 4UBRA 5KTDA 1MJAA 1QSMA 2JDDA 4Y49C 1L0CA 1QSTA 2CNTA 1QSOA 1N71A 2VBQA 3TTHA 4QC6A 3V8IA 3WR7A 3D8PA 2OZGA 2FE7A 2HV2A 1CM0A 2ZPAA 2JEVA 2DXQA 4XNHB 2PQ8A 4PK2A 4HNXB 4II9A 3T9YA 1YR0A 4E0AA 4UWJA 4FD4A 4YFJA 3DDDA 3D2PA 3QAHA 5ISVA 3EFAA 3CXQA 4JD6A 4M85A 1S7LA 2ZW7A 3TT2A 3D2MA 3I9SA 4CAWA 1S7KA 1B87A 1IIDA 1Q2DA 4KUAA 2VXKA 1KZFA 2REEA 3FB3A 3FBUA 4Y49B 5HMNA 4HKFA 1LRZA 2PC1A 1QSNA 4DNCA 4AVBA 4KOSA 3TOAA 4KVME 4AVAA 1Z4EA 2P6FA 4U9YA 3VWEA 4EVYA 1K4JA 2Q4YA 4L8AA 2R98A 1I21A 4KOYA 2BUEA 2J8MA 3VWDA 4R87A 4KVXA 1PU9A 2VEZA 3BJ8A 3TE4A 3DR8A 4QBJA 3R9EA 3EY5A 2B4BA 5I0CA 4MY0A 2Z10A 2OH1A 2BL1A 4MI4A 4F6AA 1WWZA 2Q0YA 5F47A 4E8OA 3TFYA 2F5IA 2VZZA 2B3VA 4RS2A 1Q2YA 2Q04A 4U9ZA 3R95A 4KLWA 4HNWB 3BLNA 5FVJA 1UFHA 3R1KA 4NSQA 4X5KA 4UWIA 1P4NA 4H6ZA 2VI7A 3OWCA 2VQYA 4KVOE 3JUWA 3GY9A 4XNHC 5F48A 5IX3A 4AVCA 5H84A 4AB7A 4RI1A 2G0BA 3PGPA 1S3ZA 4B5OA 4E2AA 1IYLA 4JJXA 4OLLA 3SXOA 2CY2A 5JPHA 4CAVA 4U5YA 1M4IA 4NCZA 3TOBA 1BOBA 3F8KA 1V0CA 4B5PA 2GANA 3EC4A 1KUVA 4H89A 4HNYB 3TCVA 3C26A 2FSRA 1I1DA 1XIXA 3QB8A 1CJWA 1XF8A 5CNPA 2ARHA 2G3AA 2QECA 4PV6A 3ZJ0A 3EXNA 2OU2A 1Q2CA 2FS5A 1Y7RA 3P2HA 2FXFA 4MY3A 4R3LA 2GIVA 2Q7BA 4OADA 3B8GA 2BSWA 2ZW6A 1Y9WA 5IB0A 1MJBA 2B3UA 2JLMA 1IICA 5J8CA 5C82A 1M1DA 2I00A 3D3SA 1Z4RA 1S60A 1BO4A 4MHDA 2VZYA 4KLVA 4YRHA 1SQHA 2WPWA 5DWNA 2CNMA 4KORA 2J8NA 2R8VA 1B6BA 3R9GA 3UY5A 2B58A 2REFA 1YREA 2EUIA 4KOVA 5IV0A 1YGHA 4CRYB 4B5PB 4NEXA 2X7BA 2ZW4A 1XEBA 2FL4A 4BMHA 1VKCA 3GYAA 3TO9A 1XMTA 2QMLA 4K30A 4M3SA 1YK3A 2B5GB 3ZZIA 1MJ9A 2FIWA 1S5KA 2EVNA 3W91A 2K5TA 2Z0ZA 3TO7A 4F0YA 3RYOA 1J4JA 2Q44A 3S6GA 1M44A 1XE4A 1YVOA 4AG9A 2WPXA 3LD2A 3SHPA 2ATRA 1QSRA 1NMTA 4J3GA 4NXYA 5E96A 4YGOA 4UA3A 2PSWA 1GHEA 2OB0A 3GKRA 1M4GA 4AG7A 5EBVA 5J8FA 4QVTA 3DSBA 3R96A 3TO6A 2D4OA 3N7ZA 2PR1A 2HQYA 5GCNA 4XPLA 4KOXA 2GE3A 4CRZB 3NE7A 3R9FA 4R9MA 4FD7A 3DNSA 2JDCA 1S7NA 1PUAA 4XPDB 3S6FA 1NE9A 3EO4A 3FRMA 2P0WA 4JXQA 5DWMA 3KKWA 2Z11A 3CXPA 1KUYA 3K9UA 4ZBGA 1M4DA 4KZTA 2ZW5A 2I79A 4PSXA 5HH1A 2PDOA 3FYNA 2Q4VA 4MJ8A 4I49A 4R57A 4KOTA 2G3TA 3CXSA 1IB1E 3F0AA 2C27A 1I12A 1KUXA 4PSWA 4KOWA 4LX9A 3G8WA 1P0HA 3E0KA 3IWGA 4MBUA 1RXTA 2D4PA 4L89A 4R3KA 2AE6A 3IGRA 2BEIA 1Y9KA 4PK3A 1U6MA 1YLEA 4IUSA 1VHSA 2IL4A 3FNCA 4IF5A 5F46A 4JXRA 1NSLA 3BJ7A 2AJ6A 3DR6A 4ORFA 1IYKA 5EC4A 3F5BA 1WK4A 2CNSA 1R57A 3FIXA 4NF1A 3S6HA 2B4DB 2ZXVA 1FY7A 3I3GA 2H5MA 3W6XA 3FXTA 3G3SA 1Z9UA 1S7FA 2PR8A 2R1IA 2J8RA 2KCWA 4XPKA 2NMTA 2PRBA 3PP9A 4JWPA 1ON0A 2P6EA 1RO5A
chains in the Genus database with same CATH superfamily
4CGOA 3JVNA 4KUBA 4M6IA 5KTAA 1ELMP 3RNZA 4F8ZA 2ZOFA 2HUZA 4FWUA 5HVFA 3W6SA 3KHXA 3SXNA 2CTBA 5C88A 1OZPA 4QB9A 3T90A 2Y0MA 5AGEA 4Q36A 1LAMA 4JLYA 2FCKA 4ONWA 4EMEA 5LYLA 5HVHA 1ELLP 4NGQA 1TXRA 5H86A 3K9TA 3TC8A 2QIRA 4H6UA 4MFKA 4NGTA 3LODA 4OAEA 2O28A 2Z3OA 5JQ4A 2PJ8A 4OC4A 1YX0A 3P2FA 3ISXA 5D29A 4CYQA 3NH8A 2GLJA 1TIQA 4C2ZA 4X8IA 1HDQA 3IWWA 3S6KA 3MGDA 2A4NA 4YWYA 4BBHA 2PIYA 3IC1A 1Y0YA 3D7HA 2XEFA 4FD6A 2POKA 3GUXA 4ONUA 3WC5A 3H4QA 4FD5A 5KTCA 3KQXA 2FIAA 2PRQA 2FT0A 2RC4A 4PXDA 4XPDC 2XEGA 2B4DA 3D68A 3B3SA 5K8PA 2HB6A 1CPXA 1YSJA 1YVKA 4KOUA 4A39A 1MK4A 2OZUA 3BI0A 5J1QA 3CT9A 2B5GA 2ANPA 4NJQA 4CS0B 4GS4A 4A2ZA 2P6GA 3PZJA 2R7HA 4LUAA 4MFQA 2OZHA 4TWEA 5F49A 3H5ZA 3PRTA 4NGPA 4QUSA 4UBRA 4AXVA 4CAXA 5KTDA 1MJAA 1QSMA 3CPAA 2C6PA 2ZEOA 2JDDA 1Y7EA 1IU8A 4BINA 4Y49C 1L0CA 2AFZA 1QSTA 3NH4A 4CGLA 2CNTA 1QSOA 1N71A 2VBQA 4G1PA 4QC6A 3SI1A 3TTHA 3V8IA 6CPAA 2NSMA 3D8PA 2OZGA 5G20A 3PEIA 3WR7A 1M4LA 2BCOA 1BPNA 5A27A 2Q4ZA 3SI0A 2FE7A 2HV2A 1CM0A 2ZPAA 5THWA 4C7HA 2ZENA 2JEVA 4IHMA 2DXQA 4XNHB 2PQ8A 4P6YA 5I4MA 2PJ5A 2EWBA 5AG4A 4PK2A 3BI1A 4OC1A 4HNXB 3IJ3A 3TX8A 4EFDA 4II9A 3T9YA 1FNOA 1YR0A 3MRUA 4A38A 4E0AA 4FAIA 2GFQA 2J9AA 4FD4A 4UWJA 4YFJA 3DDDA 3FJUA 1IOFA 2Q51A 3D2PA 3QAHA 5A28A 5ELYA 5ISVA 3EFAA 2XEIA 3CXQA 3IIBA 4JD6A 4M85A 1S7LA 2ZW7A 2AFWA 2DPSA 3IFEA 3TT2A 1R3NA 3PFOA 4Q7AA 2CTCA 3D2MA 3I9SA 2WUUA 4OC2A 4CAWA 4RN7A 2PJAA 1X10A 4A37A 4C2YA 4B14A 1S7KA 4MHNA 1F2PA 1B87A 5CBMA 1IIDA 4YU9A 1AUGA 1XFOA 1Q2DA 4K3NA 1XRYA 3GLJA 2JEWA 4MHYA 4KUAA 3VATA 4B6ZA 3S9NA 2VXKA 2Z3MA 2Z3PA 1KZFA 2REEA 1VIXA 3FB3A 3FBUA 3KI9A 4Y49B 5HMNA 1BLLE 4HKFA 1LRZA 2PJ0A 3NE8A 1IY7A 2PC1A 1QSNA 4B10A 3S9MA 4DNCA 4AVBA 4ZGYB 2JBKA 2PJ1A 4KOSA 3PB8X 4MCRA 4WWVA 4HPSA 2GREA 3TOAA 4P45A 4P4BA 4KVME 4LQ6A 4NJRA 4AVAA 1Z4EA 2EK9A 2P6FA 3KGQA 4U9YA 4ZX8A 2WSAA 3VWEA 4CGMA 4EVYA 1K4JA 5AG7A 2Q4YA 3B3WA 5G21A 4L8AA 2R98A 2ZEMA 1I21A 2ZEPA 2BUEA 3ISZA 4KOYA 2HC9A 2J8MA 2ZEHA 3CDXA 4R87A 4IAVA 3VWDA 5IB9A 4W9YA 4KVXA 1PU9A 4R8FA 4CAEA 2VEZA 3BJ8A 3TE4A 1YW6A 2XEJA 2Z3KA 2C6GA 4P4EA 4ZY2A 3DR8A 4ZI6A 1XJOA 4QBJA 3R9EA 5HVGA 3EY5A 2B4BA 2QVPA 5I0CA 4MY0A 2Z10A 2OH1A 2BL1A 4MI4A 2WZNA 1WWZA 2Q0YA 5F47A 4F6AA 4E8OA 3B3CA 4OKOA 1ZLHA 3TFYA 2F5IA 1LFWA 3IWEA 2VZZA 2B3VA 5BWAB 2VL1A 2RFHA 3L2NA 4RS2A 2AFSA 2ZEFA 1Q2YA 2Q04A 4U9ZA 3R95A 5K8OA 2CXAA 4KLWA 5LYDA 3CZXA 4HNWB 1VGYA 3BLNA 5FVJA 1IOIA 2GLFA 1UFHA 3RO0A 3R1KA 4NSQA 4X5KA 4UWIA 4LQGA 1P4NA 8CPAA 1LOKA 2AFMA 2WYRA 4H6ZA 1BPMA 2V8VA 2AFXA 2VI7A 3OWCA 2VQYA 2O4HA 4F9VA 3LACA 5LRGA 2BOAA 2DEAA 4KVOE 3JUWA 4OIWA 4R7MA 3WC7A 3FVLA 3GY9A 3T8WA 4XNHC 1BAVA 1F2OA 4JYWA 5F48A 3NFZA 3JRUA 4MCQA 4C68A 5IX3A 5HXDA 3GIUA 3KASA 4AVCA 5H84A 4AB7A 1YQEA 4FBEA 2IJZA 4RI1A 2G0BA 3PGPA 2OOTA 1S3ZA 4B5OA 4E2AA 1NSAA 4MXUA 4MCPA 3RAMA 1IYLA 3FF3A 2CF4A 2PJCA 3SI2A 3PB6X 4OC3A 1TKFA 4PPZA 3KHZA 5LRKA 4RUHA 2JBJA 1CBXA 4JJXA 4OLLA 3SXOA 2CY2A 5JPHA 4OC5A 2YNCC 4PXEA 4CAVA 4CYNA 4U5YA 1HDUA 1M4IA 3DGVA 4NCZA 5E96A 1FT7A 1X12A 2FVGA 3TOBA 1BOBA 3F8KA 1V0CA 4B5PA 2GANA 2QYVA 3EC4A 4R6TA 1KUVA 1Y0RA 4H89A 4UCNA 4UFXA 4UCPA 4HNYB 3TCVA 2G9DA 3C26A 2FSRA 1I1DA 3D7DA 1XIXA 3H8EA 2ABZA 4A31A 3QB8A 3DLJA 5D8NA 1CJWA 5JGFA 1XF8A 4PXCA 5CNPA 2ARHA 2C1CA 4BD9A 2G3AA 4A95A 4CAFA 2QECA 3B3TA 3KQZA 4F9UA 4B11A 4PV6A 3HUVA 3EXNA 2OU2A 4MRIA 3ZJ0A 1Q2CA 1LANA 2FS5A 2PJ3A 1Y7RA 3P2HA 2FXFA 4A94A 1TKJA 4MY3A 3D7FA 4UEEA 4R3LA 3BXMA 3FH4A 2GIVA 3I1UA 1PYTB 1QQ9A 2PVVA 2Q7BA 1LCPA 4OADA 2CIJA 2BSWA 2ZW6A 3B8GA 3IO1A 1Y9WA 4UCMA 5IB0A 4TNUA 4UIBA 3KR5A 4UEFA 1MJBA 2B3UA 2JLMA 2PJBA 5LYFA 1CP7A 1IICA 5F09A 1Z2LA 5J8CA 5C82A 1M1DA 2I00A 3D3SA 1GYTA 1Z4RA 1S60A 1BO4A 4MHDA 4MCSA 2VZYA 4KLVA 7CPAA 1YMEA 4YRHA 3WABA 1YLOA 2PIZA 1SQHA 2WPWA 5DWNA 4B12A 2CNMA 3S9LA 4KORA 2J8NA 5K8MA 2R8VA 4ZY1A 1B6BA 3R9GA 3UY5A 4P4JA 3VARA 4KSAA 2B58A 1ARMA 2NYQA 2REFA 3KZWA 3N5FA 1YREA 2EUIA 4KOVA 5IV0A 1YGHA 4CRYB 3MN8A 4B5PB 4NEXA 2YGWA 2X7BA 2V77A 2ZEDA 2ZW4A 1XEBA 2FL4A 4BMHA 1VKCA 3GYAA 1XMBA 2RB7A 3HLPA 3CPXA 4P4IA 1XMTA 2QMLA 4K30A 3TO9A 4M3SA 1H8LA 1YK3A 2B5GB 3D7GA 3ZZIA 1CP6A 1KWMA 2C6CA 1MJ9A 2FIWA 4M6GA 3SJEA 1S5KA 3GB0A 2EVNA 3IU2A 4M6HA 3W91A 2EO8A 1EE3P 4X2TA 2K5TA 2Z0ZA 3TO7A 1TF8A 4F0YA 1JQGA 3RYOA 1J4JA 4IK2A 2Q44A 1A2ZA 3S6GA 3LMSA 1M44A 2DF5A 4X3RA 1XE4A 4OMEA 5K8NA 2PCUA 1YVOA 4AG9A 2WPXA 1ARLA 3LD2A 3SHPA 3RZAA 1PCAA 1QSRA 2ATRA 4UIAA 1NMTA 2V8GA 2V8HA 4J3GA 4NXYA 1AYEA 4UFWA 1XOVA 4YGOA 2EK8A 2PSWA 1GHEA 2OB0A 2YNDA 4UA3A 3GKRA 4ZX9A 1QMUA 3SJGA 2F8HA 1M4GA 3A9LA 5DS0A 4AG7A 3B3VA 5EBVA 2PE3A 2PJ6A 3FX6A 3NA6A 4NFRA 5J8FA 3B2YA 2Z3NA 4JZ0A 4QVTA 3DSBA 3R96A 3TO6A 3PBBA 2F7VA 4ZY0A 4NGMA 4MHZA 3PFEA 2D4OA 1UWYA 1ZG8A 4FUUA 3N7ZA 2PR1A 2ZEEA 4UFVA 2HQYA 4R76A 5GCNA 4Z65A 1RTQA 2AFUA 3D66A 4XPLA 2IMOA 4KOXA 4DUKA 2GE3A 4CRZB 3D67A 1Z5RA 5LYIA 3NE7A 2PJ7A 3R9FA 4Q38A 4R9MA 3K2KA 4GM5A 2EBJA 4NGSA 1ZLIA 2YNEA 4FD7A 3DNSA 4P4FA 3KR4A 2JDCA 1Q7LA 2PJ2A 4CYOA 1S7NA 2YNCA 3JTKA 4OIDA 1PUAA 4XPDB 2BO9A 3NH5A 3S6FA 2ZEGA 2ZOGA 3SJFA 5JM6A 3RBUA 4EWTA 1NE9A 3EO4A 3FEDA 3FRMA 4WJBA 2P0WA 4JXQA 1OBRA 5DWMA 4CYPA 3KKWA 4OC0A 3PB4X 2Z11A 4P10A 3FECA 3IU1A 5AG6A 3CXPA 1KUYA 3K9UA 4ZBGA 1M4DA 1TKHA 4KZTA 2ZW5A 2I79A 1Z8LA 2O53A 3FMCA 4PSXA 4PXBA 1ZG7A 1VHOA 2PDOA 5HH1A 2ZELA 4CGNA 4CPAA 3FYNA 1HEEA 1TF9A 2I3CA 2Q4VA 2V8DA 5EMIA 5LRJA 4DJLA 3VH9A 4P44A 4F0XA 4A33A 4KS9A 4I49A 4MJ8A 4KOTA 3CXSA 2G3TA 4R57A 2ODFA 2IQ6A 1IB1E 3F0AA 2C27A 1I12A 1KUXA 3PB9X 4PSWA 4KOWA 5AG5A 4LX9A 1ZG9A 2Q43A 3G8WA 1P0HA 1Z8WA 3H8FA 3E0KA 3IWGA 4UF4A 4MBUA 4MHPA 1CG2A 1RXTA 2Q7SA 1F57A 1Z8TA 2D4PA 4PQAA 3KL9A 4ZYQA 2PVWA 4UEZA 4L89A 4MFLA 4R3KA 2AE6A 4C7IA 4P4DA 1DE4C 1CX8A 3B35A 1XBUA 1Y9KA 2BEIA 2GU2A 1YW4A 2PJ9A 3IGRA 4PK3A 5CPAA 5G1ZA 3V7ZA 4O23A 4B13A 4MFZA 4GXHA 1U6MA 1YLEA 4IUSA 1VHSA 2IL4A 3FEEA 3B7IA 3FNCA 3BHXA 3H8GA 2AFOA 4IF5A 4C2XA 1DTDA 1ZO0A 3PBEA 4DYOA 5F46A 1VHEA 4JXRA 1NSLA 3BJ7A 2AJ6A 3DR6A 1IYKA 4ORFA 1LAPA 3F5BA 5EC4A 1WK4A 1JWQA 4MFPA 1R43A 2PJ4A 2CNSA 4CGPA 1R57A 3IEHA 3FIXA 3WC6A 4NF1A 1IGBA 3S6HA 2B4DB 2ZXVA 1CPSA 3LWUA 5JH9A 2Z3LA 4KSIA 1AMPA 1FY7A 3I3GA 4MMOA 2H5MA 4MFJA 3W6XA 3PB7X 3SJXA 4A32A 2DPTA 3FXTA 4NGRA 3G3SA 1Z9UA 1S7FA 2PR8A 3D4UA 4NGNA 4OP4A 5G22A 2OR4A 2R1IA 2J8RA 2KCWA 3QAYA 4XPKA 4H2KA 2QJ8A 1Z8XA 2NMTA 4KSFA 3V38A 2PRBA 3PP9A 3QNVA 4JWPA 4A30A 3WT4A 1ON0A 2P6EA 1RO5A
chains in the Genus database with same CATH topology
4CGOA 3JVNA 4KUBA 5KTAA 2HUZA 3W6SA 3SXNA 5C88A 1OZPA 4QB9A 3T90A 2Y0MA 5AGEA 4Q36A 4JLYA 2FCKA 5H86A 2QIRA 4H6UA 4MFKA 3LODA 4OAEA 2O28A 2Z3OA 5JQ4A 1YX0A 3P2FA 4CYQA 1TIQA 4C2ZA 3S6KA 3MGDA 2A4NA 4BBHA 4FD6A 4ONUA 3H4QA 4FD5A 5KTCA 2FIAA 2FT0A 2RC4A 4XPDC 2B4DA 4KOUA 1YVKA 1MK4A 2OZUA 2B5GA 4CS0B 4GS4A 4A2ZA 2P6GA 3PZJA 2R7HA 4LUAA 4MFQA 2OZHA 5F49A 3H5ZA 4QUSA 4CAXA 4UBRA 5KTDA 1MJAA 1QSMA 2JDDA 4Y49C 1L0CA 1QSTA 4CGLA 2CNTA 1QSOA 1N71A 2VBQA 3TTHA 4QC6A 3V8IA 3WR7A 3D8PA 2OZGA 5G20A 5A27A 2FE7A 2HV2A 1CM0A 2ZPAA 4C7HA 2JEVA 2DXQA 4XNHB 2PQ8A 5AG4A 4PK2A 4HNXB 4II9A 3T9YA 1YR0A 4E0AA 4UWJA 4FD4A 4YFJA 3DDDA 3D2PA 3QAHA 5A28A 5ISVA 3EFAA 3CXQA 4JD6A 4M85A 1S7LA 2ZW7A 2DPSA 3TT2A 3D2MA 3I9SA 4CAWA 2WUUA 4C2YA 4B14A 1S7KA 1B87A 1IIDA 1Q2DA 4KUAA 2VXKA 2Z3MA 2Z3PA 1KZFA 2REEA 3FB3A 3FBUA 4Y49B 5HMNA 4HKFA 1LRZA 2PC1A 1QSNA 4B10A 4DNCA 4AVBA 4ZGYB 4KOSA 3TOAA 4KVME 4AVAA 1Z4EA 2P6FA 4U9YA 2WSAA 3VWEA 4CGMA 4EVYA 1K4JA 5AG7A 2Q4YA 5G21A 4L8AA 2R98A 1I21A 4KOYA 2BUEA 2J8MA 3VWDA 4R87A 4KVXA 1PU9A 4CAEA 2VEZA 3BJ8A 3TE4A 2Z3KA 3DR8A 4QBJA 3R9EA 3EY5A 2B4BA 5I0CA 4MY0A 2Z10A 2OH1A 2BL1A 4MI4A 4F6AA 1WWZA 2Q0YA 5F47A 4E8OA 3TFYA 2F5IA 3IWEA 2VZZA 2B3VA 5BWAB 4RS2A 1Q2YA 2Q04A 4U9ZA 3R95A 2CXAA 4KLWA 4HNWB 3BLNA 5FVJA 1UFHA 3R1KA 4NSQA 4X5KA 4UWIA 1P4NA 4H6ZA 2VI7A 3OWCA 2VQYA 4KVOE 3JUWA 3GY9A 4XNHC 5F48A 4C68A 5IX3A 4AVCA 5H84A 4AB7A 4RI1A 2G0BA 3PGPA 1S3ZA 4B5OA 4E2AA 1IYLA 4JJXA 4OLLA 3SXOA 2CY2A 5JPHA 2YNCC 4CAVA 4CYNA 4U5YA 1M4IA 4NCZA 3TOBA 1BOBA 3F8KA 1V0CA 4B5PA 2GANA 3EC4A 1KUVA 4H89A 4UCNA 4UFXA 4UCPA 4HNYB 3TCVA 3C26A 2FSRA 1I1DA 1XIXA 4A31A 3QB8A 1CJWA 1XF8A 5CNPA 2ARHA 2G3AA 4A95A 4CAFA 2QECA 4B11A 4PV6A 3ZJ0A 3EXNA 2OU2A 1Q2CA 2FS5A 1Y7RA 3P2HA 2FXFA 4MY3A 4R3LA 2GIVA 2Q7BA 4OADA 3B8GA 2BSWA 2ZW6A 1Y9WA 4UCMA 5IB0A 1MJBA 2B3UA 2JLMA 1IICA 5J8CA 5C82A 1M1DA 2I00A 3D3SA 1Z4RA 1S60A 1BO4A 4MHDA 2VZYA 4KLVA 4YRHA 1SQHA 2WPWA 5DWNA 4B12A 2CNMA 4KORA 2J8NA 2R8VA 1B6BA 3R9GA 3UY5A 4KSAA 2B58A 2REFA 1YREA 2EUIA 4KOVA 5IV0A 1YGHA 4CRYB 4B5PB 4NEXA 2YGWA 2X7BA 2ZW4A 1XEBA 2FL4A 4BMHA 1VKCA 3GYAA 3TO9A 1XMTA 2QMLA 4K30A 4M3SA 1YK3A 2B5GB 3ZZIA 1MJ9A 2FIWA 1S5KA 2EVNA 3IU2A 3W91A 2K5TA 2Z0ZA 3TO7A 4F0YA 3RYOA 1J4JA 2Q44A 3S6GA 1M44A 1XE4A 1YVOA 4AG9A 2WPXA 3LD2A 3SHPA 2ATRA 1QSRA 1NMTA 4J3GA 4NXYA 5E96A 4UFWA 4YGOA 2YNDA 2PSWA 1GHEA 2OB0A 4UA3A 3GKRA 3A9LA 1M4GA 4AG7A 5EBVA 5J8FA 2Z3NA 4QVTA 3DSBA 3R96A 3TO6A 2D4OA 3N7ZA 2PR1A 4UFVA 2HQYA 5GCNA 4XPLA 4KOXA 2GE3A 4CRZB 3NE7A 3R9FA 4Q38A 4R9MA 2YNEA 4FD7A 3DNSA 2JDCA 4CYOA 1S7NA 2YNCA 3JTKA 1PUAA 4XPDB 3S6FA 1NE9A 3EO4A 3FRMA 2P0WA 4JXQA 5DWMA 4CYPA 3KKWA 2Z11A 3IU1A 5AG6A 3CXPA 1KUYA 3K9UA 4ZBGA 1M4DA 4KZTA 2ZW5A 2I79A 4PSXA 5HH1A 2PDOA 4CGNA 3FYNA 2Q4VA 4F0XA 4A33A 4KS9A 4I49A 4MJ8A 4KOTA 3CXSA 2G3TA 4R57A 1IB1E 3F0AA 2C27A 1I12A 1KUXA 4PSWA 4KOWA 5AG5A 4LX9A 3G8WA 1P0HA 3E0KA 3IWGA 4MBUA 1RXTA 2D4PA 4L89A 4MFLA 4R3KA 2AE6A 4C7IA 3IGRA 2BEIA 1Y9KA 4PK3A 5G1ZA 4B13A 4MFZA 1U6MA 1YLEA 4IUSA 1VHSA 2IL4A 3FNCA 4IF5A 4C2XA 1ZO0A 5F46A 4JXRA 1NSLA 3BJ7A 2AJ6A 3DR6A 1IYKA 4ORFA 5EC4A 3F5BA 1WK4A 4MFPA 2CNSA 4CGPA 1R57A 3FIXA 4NF1A 3S6HA 2B4DB 2ZXVA 2Z3LA 1FY7A 3I3GA 4MFJA 2H5MA 3W6XA 4A32A 2DPTA 3FXTA 3G3SA 1Z9UA 1S7FA 2PR8A 5G22A 2R1IA 2J8RA 2KCWA 4XPKA 2NMTA 4KSFA 2PRBA 3PP9A 4JWPA 4A30A 1ON0A 2P6EA 1RO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JVN A;  4KUB A;  5KTA A;  2HUZ A;  3W6S A;  3SXN A;  5C88 A;  1OZP A;  4QB9 A;  3T90 A;  2Y0M A;  4JLY A;  2FCK A;  5H86 A;  2QIR A;  4H6U A;  3LOD A;  4OAE A;  2O28 A;  5JQ4 A;  1YX0 A;  3P2F A;  1TIQ A;  3S6K A;  3MGD A;  2A4N A;  4FD6 A;  4ONU A;  3H4Q A;  4FD5 A;  5KTC A;  2FIA A;  2FT0 A;  2RC4 A;  4XPD C;  2B4D A;  4KOU A;  1YVK A;  1MK4 A;  2OZU A;  2B5G A;  4CS0 B;  4GS4 A;  2P6G A;  3PZJ A;  2R7H A;  4LUA A;  2OZH A;  5F49 A;  4CAX A;  4QUS A;  4UBR A;  5KTD A;  1MJA A;  1QSM A;  2JDD A;  4Y49 C;  1L0C A;  1QST A;  2CNT A;  1QSO A;  1N71 A;  2VBQ A;  3TTH A;  4QC6 A;  3V8I A;  3WR7 A;  3D8P A;  2OZG A;  2FE7 A;  2HV2 A;  1CM0 A;  2ZPA A;  2JEV A;  2DXQ A;  4XNH B;  2PQ8 A;  4PK2 A;  4HNX B;  4II9 A;  3T9Y A;  1YR0 A;  4E0A A;  4UWJ A;  4FD4 A;  4YFJ A;  3DDD A;  3D2P A;  3QAH A;  5ISV A;  3EFA A;  3CXQ A;  4JD6 A;  4M85 A;  1S7L A;  2ZW7 A;  3TT2 A;  3D2M A;  3I9S A;  4CAW A;  1S7K A;  1B87 A;  1IID A;  1Q2D A;  4KUA A;  2VXK A;  1KZF A;  2REE A;  3FB3 A;  3FBU A;  4Y49 B;  5HMN A;  4HKF A;  1LRZ A;  2PC1 A;  1QSN A;  4DNC A;  4AVB A;  4KOS A;  3TOA A;  4KVM E;  4AVA A;  1Z4E A;  2P6F A;  4U9Y A;  3VWE A;  4EVY A;  1K4J A;  2Q4Y A;  4L8A A;  2R98 A;  1I21 A;  4KOY A;  2BUE A;  2J8M A;  3VWD A;  4R87 A;  4KVX A;  1PU9 A;  2VEZ A;  3BJ8 A;  3TE4 A;  3DR8 A;  4QBJ A;  3R9E A;  3EY5 A;  2B4B A;  5I0C A;  4MY0 A;  2Z10 A;  2OH1 A;  2BL1 A;  4MI4 A;  4F6A A;  1WWZ A;  2Q0Y A;  5F47 A;  4E8O A;  3TFY A;  2F5I A;  2VZZ A;  2B3V A;  4RS2 A;  1Q2Y A;  2Q04 A;  4U9Z A;  3R95 A;  4KLW A;  4HNW B;  3BLN A;  5FVJ A;  1UFH A;  3R1K A;  4NSQ A;  4X5K A;  4UWI A;  1P4N A;  4H6Z A;  2VI7 A;  3OWC A;  2VQY A;  4KVO E;  3JUW A;  3GY9 A;  4XNH C;  5F48 A;  5IX3 A;  4AVC A;  5H84 A;  4AB7 A;  4RI1 A;  2G0B A;  3PGP A;  1S3Z A;  4B5O A;  4E2A A;  1IYL A;  4JJX A;  4OLL A;  3SXO A;  2CY2 A;  5JPH A;  4CAV A;  4U5Y A;  1M4I A;  4NCZ A;  3TOB A;  1BOB A;  3F8K A;  1V0C A;  4B5P A;  2GAN A;  3EC4 A;  1KUV A;  4H89 A;  4HNY B;  3TCV A;  3C26 A;  2FSR A;  1I1D A;  1XIX A;  3QB8 A;  1CJW A;  1XF8 A;  5CNP A;  2ARH A;  2G3A A;  2QEC A;  4PV6 A;  3ZJ0 A;  3EXN A;  2OU2 A;  1Q2C A;  2FS5 A;  1Y7R A;  3P2H A;  2FXF A;  4MY3 A;  4R3L A;  2GIV A;  2Q7B A;  4OAD A;  3B8G A;  2BSW A;  2ZW6 A;  1Y9W A;  5IB0 A;  1MJB A;  2B3U A;  2JLM A;  1IIC A;  5J8C A;  5C82 A;  1M1D A;  2I00 A;  3D3S A;  1Z4R A;  1S60 A;  1BO4 A;  4MHD A;  2VZY A;  4KLV A;  4YRH A;  1SQH A;  2WPW A;  5DWN A;  2CNM A;  4KOR A;  2J8N A;  2R8V A;  1B6B A;  3R9G A;  3UY5 A;  2B58 A;  2REF A;  1YRE A;  2EUI A;  4KOV A;  5IV0 A;  1YGH A;  4CRY B;  4B5P B;  4NEX A;  2X7B A;  2ZW4 A;  1XEB A;  2FL4 A;  4BMH A;  1VKC A;  3GYA A;  3TO9 A;  1XMT A;  2QML A;  4K30 A;  4M3S A;  1YK3 A;  2B5G B;  3ZZI A;  1MJ9 A;  2FIW A;  1S5K A;  2EVN A;  3W91 A;  2K5T A;  2Z0Z A;  3TO7 A;  4F0Y A;  3RYO A;  1J4J A;  2Q44 A;  3S6G A;  1M44 A;  1XE4 A;  1YVO A;  4AG9 A;  2WPX A;  3LD2 A;  3SHP A;  2ATR A;  1QSR A;  1NMT A;  4J3G A;  4NXY A;  5E96 A;  4YGO A;  4UA3 A;  2PSW A;  1GHE A;  2OB0 A;  3GKR A;  1M4G A;  4AG7 A;  5EBV A;  5J8F A;  4QVT A;  3DSB A;  3R96 A;  3TO6 A;  2D4O A;  3N7Z A;  2PR1 A;  2HQY A;  5GCN A;  4XPL A;  4KOX A;  2GE3 A;  4CRZ B;  3NE7 A;  3R9F A;  4R9M A;  4FD7 A;  3DNS A;  2JDC A;  1S7N A;  1PUA A;  4XPD B;  3S6F A;  1NE9 A;  3EO4 A;  3FRM A;  2P0W A;  4JXQ A;  5DWM A;  3KKW A;  2Z11 A;  3CXP A;  1KUY A;  3K9U A;  4ZBG A;  1M4D A;  4KZT A;  2ZW5 A;  2I79 A;  4PSX A;  5HH1 A;  2PDO A;  3FYN A;  2Q4V A;  4MJ8 A;  4I49 A;  4R57 A;  4KOT A;  2G3T A;  3CXS A;  1IB1 E;  3F0A A;  2C27 A;  1I12 A;  1KUX A;  4PSW A;  4KOW A;  4LX9 A;  3G8W A;  1P0H A;  3E0K A;  3IWG A;  4MBU A;  1RXT A;  2D4P A;  4L89 A;  4R3K A;  2AE6 A;  3IGR A;  2BEI A;  1Y9K A;  4PK3 A;  1U6M A;  1YLE A;  4IUS A;  1VHS A;  2IL4 A;  3FNC A;  4IF5 A;  5F46 A;  4JXR A;  1NSL A;  3BJ7 A;  2AJ6 A;  3DR6 A;  4ORF A;  1IYK A;  5EC4 A;  3F5B A;  1WK4 A;  2CNS A;  1R57 A;  3FIX A;  4NF1 A;  3S6H A;  2B4D B;  2ZXV A;  1FY7 A;  3I3G A;  2H5M A;  3W6X A;  3FXT A;  3G3S A;  1Z9U A;  1S7F A;  2PR8 A;  2R1I A;  2J8R A;  2KCW A;  4XPK A;  2NMT A;  2PRB A;  3PP9 A;  4JWP A;  1ON0 A;  2P6E A;  1RO5 A; 
#chains in the Genus database with same CATH topology
 4CGO A;  3JVN A;  4KUB A;  4M6I A;  5KTA A;  1ELM P;  3RNZ A;  4F8Z A;  2ZOF A;  2HUZ A;  4FWU A;  5HVF A;  3W6S A;  3KHX A;  3SXN A;  2CTB A;  5C88 A;  1OZP A;  4QB9 A;  3T90 A;  2Y0M A;  5AGE A;  4Q36 A;  1LAM A;  4JLY A;  2FCK A;  4ONW A;  4EME A;  5LYL A;  5HVH A;  1ELL P;  4NGQ A;  1TXR A;  5H86 A;  3K9T A;  3TC8 A;  2QIR A;  4H6U A;  4MFK A;  4NGT A;  3LOD A;  4OAE A;  2O28 A;  2Z3O A;  5JQ4 A;  2PJ8 A;  4OC4 A;  1YX0 A;  3P2F A;  3ISX A;  5D29 A;  4CYQ A;  3NH8 A;  2GLJ A;  1TIQ A;  4C2Z A;  4X8I A;  1HDQ A;  3IWW A;  3S6K A;  3MGD A;  2A4N A;  4YWY A;  4BBH A;  2PIY A;  3IC1 A;  1Y0Y A;  3D7H A;  2XEF A;  4FD6 A;  2POK A;  3GUX A;  4ONU A;  3WC5 A;  3H4Q A;  4FD5 A;  5KTC A;  3KQX A;  2FIA A;  2PRQ A;  2FT0 A;  2RC4 A;  4PXD A;  4XPD C;  2XEG A;  2B4D A;  3D68 A;  3B3S A;  5K8P A;  2HB6 A;  1CPX A;  1YSJ A;  1YVK A;  4KOU A;  4A39 A;  1MK4 A;  2OZU A;  3BI0 A;  5J1Q A;  3CT9 A;  2B5G A;  2ANP A;  4NJQ A;  4CS0 B;  4GS4 A;  4A2Z A;  2P6G A;  3PZJ A;  2R7H A;  4LUA A;  4MFQ A;  2OZH A;  4TWE A;  5F49 A;  3H5Z A;  3PRT A;  4NGP A;  4QUS A;  4UBR A;  4AXV A;  4CAX A;  5KTD A;  1MJA A;  1QSM A;  3CPA A;  2C6P A;  2ZEO A;  2JDD A;  1Y7E A;  1IU8 A;  4BIN A;  4Y49 C;  1L0C A;  2AFZ A;  1QST A;  3NH4 A;  4CGL A;  2CNT A;  1QSO A;  1N71 A;  2VBQ A;  4G1P A;  4QC6 A;  3SI1 A;  3TTH A;  3V8I A;  6CPA A;  2NSM A;  3D8P A;  2OZG A;  5G20 A;  3PEI A;  3WR7 A;  1M4L A;  2BCO A;  1BPN A;  5A27 A;  2Q4Z A;  3SI0 A;  2FE7 A;  2HV2 A;  1CM0 A;  2ZPA A;  5THW A;  4C7H A;  2ZEN A;  2JEV A;  4IHM A;  2DXQ A;  4XNH B;  2PQ8 A;  4P6Y A;  5I4M A;  2PJ5 A;  2EWB A;  5AG4 A;  4PK2 A;  3BI1 A;  4OC1 A;  4HNX B;  3IJ3 A;  3TX8 A;  4EFD A;  4II9 A;  3T9Y A;  1FNO A;  1YR0 A;  3MRU A;  4A38 A;  4E0A A;  4FAI A;  2GFQ A;  2J9A A;  4FD4 A;  4UWJ A;  4YFJ A;  3DDD A;  3FJU A;  1IOF A;  2Q51 A;  3D2P A;  3QAH A;  5A28 A;  5ELY A;  5ISV A;  3EFA A;  2XEI A;  3CXQ A;  3IIB A;  4JD6 A;  4M85 A;  1S7L A;  2ZW7 A;  2AFW A;  2DPS A;  3IFE A;  3TT2 A;  1R3N A;  3PFO A;  4Q7A A;  2CTC A;  3D2M A;  3I9S A;  2WUU A;  4OC2 A;  4CAW A;  4RN7 A;  2PJA A;  1X10 A;  4A37 A;  4C2Y A;  4B14 A;  1S7K A;  4MHN A;  1F2P A;  1B87 A;  5CBM A;  1IID A;  4YU9 A;  1AUG A;  1XFO A;  1Q2D A;  4K3N A;  1XRY A;  3GLJ A;  2JEW A;  4MHY A;  4KUA A;  3VAT A;  4B6Z A;  3S9N A;  2VXK A;  2Z3M A;  2Z3P A;  1KZF A;  2REE A;  1VIX A;  3FB3 A;  3FBU A;  3KI9 A;  4Y49 B;  5HMN A;  1BLL E;  4HKF A;  1LRZ A;  2PJ0 A;  3NE8 A;  1IY7 A;  2PC1 A;  1QSN A;  4B10 A;  3S9M A;  4DNC A;  4AVB A;  4ZGY B;  2JBK A;  2PJ1 A;  4KOS A;  3PB8 X;  4MCR A;  4WWV A;  4HPS A;  2GRE A;  3TOA A;  4P45 A;  4P4B A;  4KVM E;  4LQ6 A;  4NJR A;  4AVA A;  1Z4E A;  2EK9 A;  2P6F A;  3KGQ A;  4U9Y A;  4ZX8 A;  2WSA A;  3VWE A;  4CGM A;  4EVY A;  1K4J A;  5AG7 A;  2Q4Y A;  3B3W A;  5G21 A;  4L8A A;  2R98 A;  2ZEM A;  1I21 A;  2ZEP A;  2BUE A;  3ISZ A;  4KOY A;  2HC9 A;  2J8M A;  2ZEH A;  3CDX A;  4R87 A;  4IAV A;  3VWD A;  5IB9 A;  4W9Y A;  4KVX A;  1PU9 A;  4R8F A;  4CAE A;  2VEZ A;  3BJ8 A;  3TE4 A;  1YW6 A;  2XEJ A;  2Z3K A;  2C6G A;  4P4E A;  4ZY2 A;  3DR8 A;  4ZI6 A;  1XJO A;  4QBJ A;  3R9E A;  5HVG A;  3EY5 A;  2B4B A;  2QVP A;  5I0C A;  4MY0 A;  2Z10 A;  2OH1 A;  2BL1 A;  4MI4 A;  2WZN A;  1WWZ A;  2Q0Y A;  5F47 A;  4F6A A;  4E8O A;  3B3C A;  4OKO A;  1ZLH A;  3TFY A;  2F5I A;  1LFW A;  3IWE A;  2VZZ A;  2B3V A;  5BWA B;  2VL1 A;  2RFH A;  3L2N A;  4RS2 A;  2AFS A;  2ZEF A;  1Q2Y A;  2Q04 A;  4U9Z A;  3R95 A;  5K8O A;  2CXA A;  4KLW A;  5LYD A;  3CZX A;  4HNW B;  1VGY A;  3BLN A;  5FVJ A;  1IOI A;  2GLF A;  1UFH A;  3RO0 A;  3R1K A;  4NSQ A;  4X5K A;  4UWI A;  4LQG A;  1P4N A;  8CPA A;  1LOK A;  2AFM A;  2WYR A;  4H6Z A;  1BPM A;  2V8V A;  2AFX A;  2VI7 A;  3OWC A;  2VQY A;  2O4H A;  4F9V A;  3LAC A;  5LRG A;  2BOA A;  2DEA A;  4KVO E;  3JUW A;  4OIW A;  4R7M A;  3WC7 A;  3FVL A;  3GY9 A;  3T8W A;  4XNH C;  1BAV A;  1F2O A;  4JYW A;  5F48 A;  3NFZ A;  3JRU A;  4MCQ A;  4C68 A;  5IX3 A;  5HXD A;  3GIU A;  3KAS A;  4AVC A;  5H84 A;  4AB7 A;  1YQE A;  4FBE A;  2IJZ A;  4RI1 A;  2G0B A;  3PGP A;  2OOT A;  1S3Z A;  4B5O A;  4E2A A;  1NSA A;  4MXU A;  4MCP A;  3RAM A;  1IYL A;  3FF3 A;  2CF4 A;  2PJC A;  3SI2 A;  3PB6 X;  4OC3 A;  1TKF A;  4PPZ A;  3KHZ A;  5LRK A;  4RUH A;  2JBJ A;  1CBX A;  4JJX A;  4OLL A;  3SXO A;  2CY2 A;  5JPH A;  4OC5 A;  2YNC C;  4PXE A;  4CAV A;  4CYN A;  4U5Y A;  1HDU A;  1M4I A;  3DGV A;  4NCZ A;  5E96 A;  1FT7 A;  1X12 A;  2FVG A;  3TOB A;  1BOB A;  3F8K A;  1V0C A;  4B5P A;  2GAN A;  2QYV A;  3EC4 A;  4R6T A;  1KUV A;  1Y0R A;  4H89 A;  4UCN A;  4UFX A;  4UCP A;  4HNY B;  3TCV A;  2G9D A;  3C26 A;  2FSR A;  1I1D A;  3D7D A;  1XIX A;  3H8E A;  2ABZ A;  4A31 A;  3QB8 A;  3DLJ A;  5D8N A;  1CJW A;  5JGF A;  1XF8 A;  4PXC A;  5CNP A;  2ARH A;  2C1C A;  4BD9 A;  2G3A A;  4A95 A;  4CAF A;  2QEC A;  3B3T A;  3KQZ A;  4F9U A;  4B11 A;  4PV6 A;  3HUV A;  3EXN A;  2OU2 A;  4MRI A;  3ZJ0 A;  1Q2C A;  1LAN A;  2FS5 A;  2PJ3 A;  1Y7R A;  3P2H A;  2FXF A;  4A94 A;  1TKJ A;  4MY3 A;  3D7F A;  4UEE A;  4R3L A;  3BXM A;  3FH4 A;  2GIV A;  3I1U A;  1PYT B;  1QQ9 A;  2PVV A;  2Q7B A;  1LCP A;  4OAD A;  2CIJ A;  2BSW A;  2ZW6 A;  3B8G A;  3IO1 A;  1Y9W A;  4UCM A;  5IB0 A;  4TNU A;  4UIB A;  3KR5 A;  4UEF A;  1MJB A;  2B3U A;  2JLM A;  2PJB A;  5LYF A;  1CP7 A;  1IIC A;  5F09 A;  1Z2L A;  5J8C A;  5C82 A;  1M1D A;  2I00 A;  3D3S A;  1GYT A;  1Z4R A;  1S60 A;  1BO4 A;  4MHD A;  4MCS A;  2VZY A;  4KLV A;  7CPA A;  1YME A;  4YRH A;  3WAB A;  1YLO A;  2PIZ A;  1SQH A;  2WPW A;  5DWN A;  4B12 A;  2CNM A;  3S9L A;  4KOR A;  2J8N A;  5K8M A;  2R8V A;  4ZY1 A;  1B6B A;  3R9G A;  3UY5 A;  4P4J A;  3VAR A;  4KSA A;  2B58 A;  1ARM A;  2NYQ A;  2REF A;  3KZW A;  3N5F A;  1YRE A;  2EUI A;  4KOV A;  5IV0 A;  1YGH A;  4CRY B;  3MN8 A;  4B5P B;  4NEX A;  2YGW A;  2X7B A;  2V77 A;  2ZED A;  2ZW4 A;  1XEB A;  2FL4 A;  4BMH A;  1VKC A;  3GYA A;  1XMB A;  2RB7 A;  3HLP A;  3CPX A;  4P4I A;  1XMT A;  2QML A;  4K30 A;  3TO9 A;  4M3S A;  1H8L A;  1YK3 A;  2B5G B;  3D7G A;  3ZZI A;  1CP6 A;  1KWM A;  2C6C A;  1MJ9 A;  2FIW A;  4M6G A;  3SJE A;  1S5K A;  3GB0 A;  2EVN A;  3IU2 A;  4M6H A;  3W91 A;  2EO8 A;  1EE3 P;  4X2T A;  2K5T A;  2Z0Z A;  3TO7 A;  1TF8 A;  4F0Y A;  1JQG A;  3RYO A;  1J4J A;  4IK2 A;  2Q44 A;  1A2Z A;  3S6G A;  3LMS A;  1M44 A;  2DF5 A;  4X3R A;  1XE4 A;  4OME A;  5K8N A;  2PCU A;  1YVO A;  4AG9 A;  2WPX A;  1ARL A;  3LD2 A;  3SHP A;  3RZA A;  1PCA A;  1QSR A;  2ATR A;  4UIA A;  1NMT A;  2V8G A;  2V8H A;  4J3G A;  4NXY A;  1AYE A;  4UFW A;  1XOV A;  4YGO A;  2EK8 A;  2PSW A;  1GHE A;  2OB0 A;  2YND A;  4UA3 A;  3GKR A;  4ZX9 A;  1QMU A;  3SJG A;  2F8H A;  1M4G A;  3A9L A;  5DS0 A;  4AG7 A;  3B3V A;  5EBV A;  2PE3 A;  2PJ6 A;  3FX6 A;  3NA6 A;  4NFR A;  5J8F A;  3B2Y A;  2Z3N A;  4JZ0 A;  4QVT A;  3DSB A;  3R96 A;  3TO6 A;  3PBB A;  2F7V A;  4ZY0 A;  4NGM A;  4MHZ A;  3PFE A;  2D4O A;  1UWY A;  1ZG8 A;  4FUU A;  3N7Z A;  2PR1 A;  2ZEE A;  4UFV A;  2HQY A;  4R76 A;  5GCN A;  4Z65 A;  1RTQ A;  2AFU A;  3D66 A;  4XPL A;  2IMO A;  4KOX A;  4DUK A;  2GE3 A;  4CRZ B;  3D67 A;  1Z5R A;  5LYI A;  3NE7 A;  2PJ7 A;  3R9F A;  4Q38 A;  4R9M A;  3K2K A;  4GM5 A;  2EBJ A;  4NGS A;  1ZLI A;  2YNE A;  4FD7 A;  3DNS A;  4P4F A;  3KR4 A;  2JDC A;  1Q7L A;  2PJ2 A;  4CYO A;  1S7N A;  2YNC A;  3JTK A;  4OID A;  1PUA A;  4XPD B;  2BO9 A;  3NH5 A;  3S6F A;  2ZEG A;  2ZOG A;  3SJF A;  5JM6 A;  3RBU A;  4EWT A;  1NE9 A;  3EO4 A;  3FED A;  3FRM A;  4WJB A;  2P0W A;  4JXQ A;  1OBR A;  5DWM A;  4CYP A;  3KKW A;  4OC0 A;  3PB4 X;  2Z11 A;  4P10 A;  3FEC A;  3IU1 A;  5AG6 A;  3CXP A;  1KUY A;  3K9U A;  4ZBG A;  1M4D A;  1TKH A;  4KZT A;  2ZW5 A;  2I79 A;  1Z8L A;  2O53 A;  3FMC A;  4PSX A;  4PXB A;  1ZG7 A;  1VHO A;  2PDO A;  5HH1 A;  2ZEL A;  4CGN A;  4CPA A;  3FYN A;  1HEE A;  1TF9 A;  2I3C A;  2Q4V A;  2V8D A;  5EMI A;  5LRJ A;  4DJL A;  3VH9 A;  4P44 A;  4F0X A;  4A33 A;  4KS9 A;  4I49 A;  4MJ8 A;  4KOT A;  3CXS A;  2G3T A;  4R57 A;  2ODF A;  2IQ6 A;  1IB1 E;  3F0A A;  2C27 A;  1I12 A;  1KUX A;  3PB9 X;  4PSW A;  4KOW A;  5AG5 A;  4LX9 A;  1ZG9 A;  2Q43 A;  3G8W A;  1P0H A;  1Z8W A;  3H8F A;  3E0K A;  3IWG A;  4UF4 A;  4MBU A;  4MHP A;  1CG2 A;  1RXT A;  2Q7S A;  1F57 A;  1Z8T A;  2D4P A;  4PQA A;  3KL9 A;  4ZYQ A;  2PVW A;  4UEZ A;  4L89 A;  4MFL A;  4R3K A;  2AE6 A;  4C7I A;  4P4D A;  1DE4 C;  1CX8 A;  3B35 A;  1XBU A;  1Y9K A;  2BEI A;  2GU2 A;  1YW4 A;  2PJ9 A;  3IGR A;  4PK3 A;  5CPA A;  5G1Z A;  3V7Z A;  4O23 A;  4B13 A;  4MFZ A;  4GXH A;  1U6M A;  1YLE A;  4IUS A;  1VHS A;  2IL4 A;  3FEE A;  3B7I A;  3FNC A;  3BHX A;  3H8G A;  2AFO A;  4IF5 A;  4C2X A;  1DTD A;  1ZO0 A;  3PBE A;  4DYO A;  5F46 A;  1VHE A;  4JXR A;  1NSL A;  3BJ7 A;  2AJ6 A;  3DR6 A;  1IYK A;  4ORF A;  1LAP A;  3F5B A;  5EC4 A;  1WK4 A;  1JWQ A;  4MFP A;  1R43 A;  2PJ4 A;  2CNS A;  4CGP A;  1R57 A;  3IEH A;  3FIX A;  3WC6 A;  4NF1 A;  1IGB A;  3S6H A;  2B4D B;  2ZXV A;  1CPS A;  3LWU A;  5JH9 A;  2Z3L A;  4KSI A;  1AMP A;  1FY7 A;  3I3G A;  4MMO A;  2H5M A;  4MFJ A;  3W6X A;  3PB7 X;  3SJX A;  4A32 A;  2DPT A;  3FXT A;  4NGR A;  3G3S A;  1Z9U A;  1S7F A;  2PR8 A;  3D4U A;  4NGN A;  4OP4 A;  5G22 A;  2OR4 A;  2R1I A;  2J8R A;  2KCW A;  3QAY A;  4XPK A;  4H2K A;  2QJ8 A;  1Z8X A;  2NMT A;  4KSF A;  3V38 A;  2PRB A;  3PP9 A;  3QNV A;  4JWP A;  4A30 A;  3WT4 A;  1ON0 A;  2P6E A;  1RO5 A; 
#chains in the Genus database with same CATH homology
 4CGO A;  3JVN A;  4KUB A;  5KTA A;  2HUZ A;  3W6S A;  3SXN A;  5C88 A;  1OZP A;  4QB9 A;  3T90 A;  2Y0M A;  5AGE A;  4Q36 A;  4JLY A;  2FCK A;  5H86 A;  2QIR A;  4H6U A;  4MFK A;  3LOD A;  4OAE A;  2O28 A;  2Z3O A;  5JQ4 A;  1YX0 A;  3P2F A;  4CYQ A;  1TIQ A;  4C2Z A;  3S6K A;  3MGD A;  2A4N A;  4BBH A;  4FD6 A;  4ONU A;  3H4Q A;  4FD5 A;  5KTC A;  2FIA A;  2FT0 A;  2RC4 A;  4XPD C;  2B4D A;  4KOU A;  1YVK A;  1MK4 A;  2OZU A;  2B5G A;  4CS0 B;  4GS4 A;  4A2Z A;  2P6G A;  3PZJ A;  2R7H A;  4LUA A;  4MFQ A;  2OZH A;  5F49 A;  3H5Z A;  4QUS A;  4CAX A;  4UBR A;  5KTD A;  1MJA A;  1QSM A;  2JDD A;  4Y49 C;  1L0C A;  1QST A;  4CGL A;  2CNT A;  1QSO A;  1N71 A;  2VBQ A;  3TTH A;  4QC6 A;  3V8I A;  3WR7 A;  3D8P A;  2OZG A;  5G20 A;  5A27 A;  2FE7 A;  2HV2 A;  1CM0 A;  2ZPA A;  4C7H A;  2JEV A;  2DXQ A;  4XNH B;  2PQ8 A;  5AG4 A;  4PK2 A;  4HNX B;  4II9 A;  3T9Y A;  1YR0 A;  4E0A A;  4UWJ A;  4FD4 A;  4YFJ A;  3DDD A;  3D2P A;  3QAH A;  5A28 A;  5ISV A;  3EFA A;  3CXQ A;  4JD6 A;  4M85 A;  1S7L A;  2ZW7 A;  2DPS A;  3TT2 A;  3D2M A;  3I9S A;  4CAW A;  2WUU A;  4C2Y A;  4B14 A;  1S7K A;  1B87 A;  1IID A;  1Q2D A;  4KUA A;  2VXK A;  2Z3M A;  2Z3P A;  1KZF A;  2REE A;  3FB3 A;  3FBU A;  4Y49 B;  5HMN A;  4HKF A;  1LRZ A;  2PC1 A;  1QSN A;  4B10 A;  4DNC A;  4AVB A;  4ZGY B;  4KOS A;  3TOA A;  4KVM E;  4AVA A;  1Z4E A;  2P6F A;  4U9Y A;  2WSA A;  3VWE A;  4CGM A;  4EVY A;  1K4J A;  5AG7 A;  2Q4Y A;  5G21 A;  4L8A A;  2R98 A;  1I21 A;  4KOY A;  2BUE A;  2J8M A;  3VWD A;  4R87 A;  4KVX A;  1PU9 A;  4CAE A;  2VEZ A;  3BJ8 A;  3TE4 A;  2Z3K A;  3DR8 A;  4QBJ A;  3R9E A;  3EY5 A;  2B4B A;  5I0C A;  4MY0 A;  2Z10 A;  2OH1 A;  2BL1 A;  4MI4 A;  4F6A A;  1WWZ A;  2Q0Y A;  5F47 A;  4E8O A;  3TFY A;  2F5I A;  3IWE A;  2VZZ A;  2B3V A;  5BWA B;  4RS2 A;  1Q2Y A;  2Q04 A;  4U9Z A;  3R95 A;  2CXA A;  4KLW A;  4HNW B;  3BLN A;  5FVJ A;  1UFH A;  3R1K A;  4NSQ A;  4X5K A;  4UWI A;  1P4N A;  4H6Z A;  2VI7 A;  3OWC A;  2VQY A;  4KVO E;  3JUW A;  3GY9 A;  4XNH C;  5F48 A;  4C68 A;  5IX3 A;  4AVC A;  5H84 A;  4AB7 A;  4RI1 A;  2G0B A;  3PGP A;  1S3Z A;  4B5O A;  4E2A A;  1IYL A;  4JJX A;  4OLL A;  3SXO A;  2CY2 A;  5JPH A;  2YNC C;  4CAV A;  4CYN A;  4U5Y A;  1M4I A;  4NCZ A;  3TOB A;  1BOB A;  3F8K A;  1V0C A;  4B5P A;  2GAN A;  3EC4 A;  1KUV A;  4H89 A;  4UCN A;  4UFX A;  4UCP A;  4HNY B;  3TCV A;  3C26 A;  2FSR A;  1I1D A;  1XIX A;  4A31 A;  3QB8 A;  1CJW A;  1XF8 A;  5CNP A;  2ARH A;  2G3A A;  4A95 A;  4CAF A;  2QEC A;  4B11 A;  4PV6 A;  3ZJ0 A;  3EXN A;  2OU2 A;  1Q2C A;  2FS5 A;  1Y7R A;  3P2H A;  2FXF A;  4MY3 A;  4R3L A;  2GIV A;  2Q7B A;  4OAD A;  3B8G A;  2BSW A;  2ZW6 A;  1Y9W A;  4UCM A;  5IB0 A;  1MJB A;  2B3U A;  2JLM A;  1IIC A;  5J8C A;  5C82 A;  1M1D A;  2I00 A;  3D3S A;  1Z4R A;  1S60 A;  1BO4 A;  4MHD A;  2VZY A;  4KLV A;  4YRH A;  1SQH A;  2WPW A;  5DWN A;  4B12 A;  2CNM A;  4KOR A;  2J8N A;  2R8V A;  1B6B A;  3R9G A;  3UY5 A;  4KSA A;  2B58 A;  2REF A;  1YRE A;  2EUI A;  4KOV A;  5IV0 A;  1YGH A;  4CRY B;  4B5P B;  4NEX A;  2YGW A;  2X7B A;  2ZW4 A;  1XEB A;  2FL4 A;  4BMH A;  1VKC A;  3GYA A;  3TO9 A;  1XMT A;  2QML A;  4K30 A;  4M3S A;  1YK3 A;  2B5G B;  3ZZI A;  1MJ9 A;  2FIW A;  1S5K A;  2EVN A;  3IU2 A;  3W91 A;  2K5T A;  2Z0Z A;  3TO7 A;  4F0Y A;  3RYO A;  1J4J A;  2Q44 A;  3S6G A;  1M44 A;  1XE4 A;  1YVO A;  4AG9 A;  2WPX A;  3LD2 A;  3SHP A;  2ATR A;  1QSR A;  1NMT A;  4J3G A;  4NXY A;  5E96 A;  4UFW A;  4YGO A;  2YND A;  2PSW A;  1GHE A;  2OB0 A;  4UA3 A;  3GKR A;  3A9L A;  1M4G A;  4AG7 A;  5EBV A;  5J8F A;  2Z3N A;  4QVT A;  3DSB A;  3R96 A;  3TO6 A;  2D4O A;  3N7Z A;  2PR1 A;  4UFV A;  2HQY A;  5GCN A;  4XPL A;  4KOX A;  2GE3 A;  4CRZ B;  3NE7 A;  3R9F A;  4Q38 A;  4R9M A;  2YNE A;  4FD7 A;  3DNS A;  2JDC A;  4CYO A;  1S7N A;  2YNC A;  3JTK A;  1PUA A;  4XPD B;  3S6F A;  1NE9 A;  3EO4 A;  3FRM A;  2P0W A;  4JXQ A;  5DWM A;  4CYP A;  3KKW A;  2Z11 A;  3IU1 A;  5AG6 A;  3CXP A;  1KUY A;  3K9U A;  4ZBG A;  1M4D A;  4KZT A;  2ZW5 A;  2I79 A;  4PSX A;  5HH1 A;  2PDO A;  4CGN A;  3FYN A;  2Q4V A;  4F0X A;  4A33 A;  4KS9 A;  4I49 A;  4MJ8 A;  4KOT A;  3CXS A;  2G3T A;  4R57 A;  1IB1 E;  3F0A A;  2C27 A;  1I12 A;  1KUX A;  4PSW A;  4KOW A;  5AG5 A;  4LX9 A;  3G8W A;  1P0H A;  3E0K A;  3IWG A;  4MBU A;  1RXT A;  2D4P A;  4L89 A;  4MFL A;  4R3K A;  2AE6 A;  4C7I A;  3IGR A;  2BEI A;  1Y9K A;  4PK3 A;  5G1Z A;  4B13 A;  4MFZ A;  1U6M A;  1YLE A;  4IUS A;  1VHS A;  2IL4 A;  3FNC A;  4IF5 A;  4C2X A;  1ZO0 A;  5F46 A;  4JXR A;  1NSL A;  3BJ7 A;  2AJ6 A;  3DR6 A;  1IYK A;  4ORF A;  5EC4 A;  3F5B A;  1WK4 A;  4MFP A;  2CNS A;  4CGP A;  1R57 A;  3FIX A;  4NF1 A;  3S6H A;  2B4D B;  2ZXV A;  2Z3L A;  1FY7 A;  3I3G A;  4MFJ A;  2H5M A;  3W6X A;  4A32 A;  2DPT A;  3FXT A;  3G3S A;  1Z9U A;  1S7F A;  2PR8 A;  5G22 A;  2R1I A;  2J8R A;  2KCW A;  4XPK A;  2NMT A;  4KSF A;  2PRB A;  3PP9 A;  4JWP A;  4A30 A;  1ON0 A;  2P6E A;  1RO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...