3R9GA

Crystal structure of microcin c7 self immunity acetyltransferase mcce in complex with coenzyme a and processed microcin c7 antibiotic
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
180
Chain Sequence
DVSLTPSGIKVNDEITLLYPALKYAEELYLLINQNKINFIKSMAWPAFVNNISDSVSFIEQSMIDNQNEKALILFIKYKTKIAGVVSFNIIDHANKTAYIGYWLGANFQGKGIVTNAINKLIQEYGDSGVIKRFVIKCIVDNKKSNATALRCGFTLEGVLQKAEILNGVSYDQNIYSKVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccE protein
publication title Structural Basis for Microcin C7 Inactivation by the MccE Acetyltransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transferase inhibitor
total genus 55
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3r9gA00
4KLWA 4MY0A 4QUSA 2ARHA 3BJ8A 3V8IA 4CAXA 1L0CA 4RI1A 2JEVA 1K4JA 2OU2A 2VEZA 4FD4A 3H4QA 3EC4A 1MK4A 3D3SA 4KUBA 5H84A 1M4DA 2REEA 1B87A 4KOUA 1KUXA 3TO9A 1Q2YA 2O28A 1BO4A 4YGOA 4ZBGA 2P6FA 2FSRA 5F49A 4YRHA 3R95A 3W6SA 2OZUA 4MBUA 5IV0A 2R8VA 2PR8A 1Q2CA 4HKFA 4LX9A 4XPLA 2B58A 3G3SA 3D2MA 5HH1A 2QECA 1IIDA 2B5GB 4OADA 2OZHA 4MJ8A 5IX3A 4H6ZA 3TOAA 4JJXA 1NMTA 2VQYA 1V0CA 4M3SA 1YVOA 4X5KA 1XF8A 3ZJ0A 4NXYA 2PDOA 2Q44A 2Q4VA 4FD6A 3QAHA 1Q2DA 2B3UA 4OAEA 2Z0ZA 4HNXB 2ZW7A 4KOTA 1S5KA 3K9UA 1S7FA 2BL1A 3I3GA 4IF5A 5I0CA 3UY5A 3F0AA 3PP9A 4IUSA 4JXRA 4B5PA 3GYAA 1M4GA 1I12A 4UWJA 3DDDA 3R9FA 2D4PA 2QIRA 1S7LA 3TO7A 2Y0MA 2OZGA 3R1KA 1LRZA 2PSWA 1QSOA 3VWEA 3N7ZA 1XEBA 3TCVA 1WK4A 5C88A 4CRYB 2HV2A 2VZYA 2GIVA 4CRZB 2ZW4A 3DSBA 4I49A 2B4DB 4NF1A 4Y49C 4XPDC 4BMHA 3IGRA 4KOXA 5JPHA 4NCZA 3SHPA 5GCNA 2J8NA 2VXKA 4UA3A 1P0HA 4L89A 2P6EA 2VBQA 2FIWA 4KZTA 1OZPA 1WWZA 2VI7A 2CNSA 3TOBA 1VHSA 3F5BA 2PR1A 4QB9A 2B4BA 4F0YA 2ZPAA 4XPDB 3EXNA 4CAVA 2ZW5A 3S6KA 3S6FA 2AJ6A 3IWGA 1Z4EA 3TFYA 3NE7A 3MGDA 4DNCA 4CAWA 3DR8A 2R7HA 1S60A 4GS4A 4JXQA 4QC6A 3EFAA 2D4OA 4H89A 4RS2A 1NE9A 1QSTA 2Q4YA 2PQ8A 4MHDA 3T9YA 5F48A 4B5OA 3I9SA 2EUIA 1M44A 5JQ4A 2OB0A 2I79A 4U9YA 4R87A 1YLEA 1I21A 1GHEA 4FD7A 5KTDA 4H6UA 3PGPA 2CY2A 2G3TA 2VZZA 2ZW6A 2OH1A 2J8RA 3FYNA 3KKWA 2AE6A 3FBUA 3TE4A 4AB7A 4QVTA 4AVCA 3LODA 4L8AA 2G3AA 4MI4A 2GANA 3JVNA 3S6HA 4EVYA 5E96A 1YVKA 3P2HA 1IB1E 3CXQA 3EY5A 5J8CA 3RYOA 4UWIA 2BSWA 2RC4A 3D2PA 5F47A 1QSMA 4KVME 3VWDA 2ZXVA 4PSWA 1SQHA 4B5PB 3W91A 2DXQA 4PV6A 1BOBA 1J4JA 3G8WA 4ONUA 2F5IA 1KUYA 4FD5A 4KVOE 3GKRA 2G0BA 1MJ9A 2EVNA 3SXOA 1M1DA 2BUEA 3EO4A 1VKCA 2CNMA 4CS0B 2WPXA 1RO5A 2QMLA 4K30A 3FRMA 4J3GA 2BEIA 1Y7RA 3FNCA 2Q0YA 4R3KA 3CXPA 2H5MA 4U9ZA 4YFJA 1MJBA 2B3VA 3OWCA 5KTCA 1Z9UA 4F6AA 2FCKA 3TT2A 1XE4A 1Y9KA 5ISVA 4Y49B 4AG7A 4KOSA 4KOVA 4UBRA 1S7KA 3DR6A 5C82A 5DWNA 3QB8A 1QSNA 3E0KA 1KZFA 2IL4A 3R9EA 3BJ7A 2FS5A 3TTHA 3TO6A 4LUAA 3W6XA 1YX0A 1YR0A 5EBVA 3CXSA 2FL4A 5EC4A 3WR7A 4KLVA 2REFA 3R96A 4KORA 1Z4RA 4R9MA 4E2AA 5FVJA 4XNHC 4AVAA 4JD6A 4ORFA 3ZZIA 1YREA 4PSXA 5F46A 2B5GA 2R1IA 2X7BA 4JWPA 4HNYB 1IYLA 2NMTA 4XPKA 5CNPA 3F8KA 4NEXA 1YGHA 2PRBA 4KVXA 1FY7A 4XNHB 1P4NA 2ATRA 1QSRA 4E8OA 5HMNA 2P0WA 4MY3A 4OLLA 4KUAA 1PU9A 1YK3A 2CNTA 5J8FA 1S7NA 3BLNA 1CJWA 2K5TA 2Q04A 2PC1A 1XIXA 1N71A 1ON0A 1TIQA 2C27A 3FB3A 1XMTA 1UFHA 2JDCA 2FT0A 1KUVA 1IYKA 3P2FA 2R98A 3S6GA 3FIXA 2FXFA 1CM0A 2J8MA 2HQYA 2P6GA 4AVBA 5KTAA 4II9A 4M85A 4NSQA 1PUAA 3LD2A 3SXNA 1IICA 3PZJA 4AG9A 4PK3A 3R9GA 5H86A 2I00A 1M4IA 2FE7A 3GY9A 4PK2A 3D8PA 1S3ZA 4HNWB 1B6BA 4R3LA 2Q7BA 3DNSA 2B4DA 2JDDA 2JLMA 1U6MA 2A4NA 4KOWA 2KCWA 3B8GA 1Y9WA 2GE3A 3T90A 4R57A 4E0AA 2Z11A 4KOYA 2FIAA 4JLYA 1RXTA 2Z10A 1I1DA 5DWMA 1R57A 2HUZA 1NSLA 3C26A 3JUWA 4QBJA 1MJAA 2WPWA 5IB0A 3FXTA 4U5YA
chains in the Genus database with same CATH superfamily
2C6CA 2PJCA 3KHZA 5BWAB 4KLWA 3MRUA 2HB6A 4MY0A 4QUSA 4M6GA 1CX8A 2ARHA 5F09A 2FVGA 4OP4A 3BJ8A 3V8IA 2RB7A 4CAXA 1L0CA 4R7MA 4RI1A 2ZEEA 4F9VA 2JEVA 1K4JA 4ZYQA 2EO8A 5A28A 2OU2A 1Z8TA 2VEZA 1AUGA 4FD4A 4UFVA 3H4QA 4MFJA 3EC4A 1MK4A 3D3SA 4MFPA 4PXDA 4F0XA 4KUBA 5H84A 1M4DA 2REEA 1B87A 2ZOGA 1ZLIA 4KOUA 1KUXA 3CPXA 3TO9A 4OC0A 1Q2YA 2PJAA 1BPNA 1PCAA 2V77A 2O28A 4CGNA 1BO4A 4YGOA 4ZBGA 2P6FA 2FSRA 1F2PA 1YW4A 5D29A 4YRHA 5F49A 3D7HA 3R95A 3W6SA 2OZUA 4K3NA 4CYQA 3BI1A 4MBUA 1TKFA 4R8FA 5IV0A 2R8VA 2PR8A 4C2YA 2JBJA 4CYNA 3B35A 4DJLA 2PJ6A 1Q2CA 4HKFA 4LX9A 4XPLA 2B58A 3G3SA 3D2MA 2NYQA 4NGQA 5HH1A 4MCQA 4MHNA 1KWMA 2QECA 1IIDA 2XEIA 2B5GB 3B3WA 2GU2A 2OZHA 4MJ8A 4H6ZA 4OADA 4LQ6A 4JJXA 4ONWA 3TOAA 4FAIA 2F8HA 2BO9A 1NMTA 2VQYA 2ODFA 1V0CA 2Z3MA 4UFXA 4BINA 4GM5A 3FMCA 1YVOA 4M3SA 2DPSA 4Q36A 4DYOA 4X5KA 1XF8A 3RZAA 3ZJ0A 1VHOA 4NXYA 2IMOA 2IJZA 5K8PA 2PDOA 2Q44A 2Q4VA 4FD6A 4TWEA 4A32A 3PEIA 2ZEFA 5D8NA 1AYEA 5K8MA 3CPAA 3QAHA 4CGOA 1HDQA 1Q2DA 2B3UA 3I1UA 3S9NA 2I3CA 2GLJA 4OAEA 2Z0ZA 4HNXB 2ZW7A 2ZOFA 3DGVA 4KOTA 4P6YA 1S5KA 2PCUA 2V8DA 3K9UA 4ZY0A 4FBEA 1S7FA 4A30A 2Z3OA 1H8LA 2BL1A 2YNDA 3I3GA 4IF5A 1FT7A 5I0CA 2EK8A 4P10A 5JM6A 3FX6A 2AFUA 4ZX8A 3JRUA 2GREA 3UY5A 3F0AA 1VGYA 2PIYA 2ZEDA 3PP9A 4KSFA 4IUSA 4JXRA 2Q51A 4B5PA 8CPAA 3GYAA 2WSAA 3IIBA 4RN7A 3PB7X 4YU9A 3RO0A 4CGLA 4F9UA 1LOKA 4A95A 2ZEOA 2PJ1A 1CBXA 2YNEA 1M4GA 3IWWA 1I12A 4UWJA 3DDDA 3R9FA 2PE3A 2D4PA 3H8GA 2ZEGA 5G20A 1YSJA 2QIRA 4DUKA 5LYFA 1S7LA 2Z3NA 3TO7A 3LMSA 1ARMA 2Y0MA 4UEZA 2OZGA 3B3CA 3R1KA 1LRZA 2PSWA 3KHXA 3LWUA 1QSOA 5LRJA 3N7ZA 1XEBA 3VWEA 4NJQA 3TCVA 1WK4A 5C88A 2O53A 3KR5A 4CRYB 3BHXA 2HV2A 1TF8A 4UIAA 4W9YA 1BPMA 2VZYA 4FUUA 5AG5A 5IB9A 1A2ZA 2GIVA 3SI2A 4CRZB 2ZW4A 5LYDA 3DSBA 1YQEA 1TKHA 4F8ZA 1JWQA 2B4DB 4I49A 4NF1A 3A9LA 2WUUA 1QQ9A 4Y49C 4XPDC 4BMHA 3IGRA 4KOXA 5JPHA 4NCZA 3SHPA 4M6IA 1Z8XA 4RUHA 3IC1A 4KS9A 5GCNA 2POKA 2C6GA 2J8NA 2VXKA 3BI0A 1Y0YA 3SJGA 4P44A 1ZO0A 4UA3A 3VATA 1P0HA 4A37A 4L89A 2PJ5A 2P6EA 2VBQA 3IO1A 4P4EA 5G1ZA 1CP6A 3H8FA 2FIWA 4KZTA 5LYLA 1OZPA 1XBUA 1WWZA 2VI7A 3BXMA 2CNSA 4ZY2A 1XOVA 4KSIA 3TOBA 5JGFA 1VHSA 4MHYA 3F5BA 1ARLA 4P4IA 2PR1A 3D7FA 4QB9A 2B4BA 4B11A 1XFOA 4F0YA 2ZPAA 4XPDB 3EXNA 3KASA 4CAVA 4CGMA 2XEJA 2ZW5A 4UEEA 3S6KA 3NH4A 3S6FA 3PFEA 2OR4A 2AJ6A 3PB4X 3IWGA 1Z4EA 4C7HA 3TFYA 2ZEPA 3NE7A 2NSMA 3MGDA 4DNCA 4CAWA 3DR8A 5K8NA 3N5FA 2R7HA 3PRTA 2C1CA 4GXHA 4A39A 1VIXA 2IQ6A 4CGPA 1S60A 4GS4A 4JXQA 5AG7A 4QC6A 3EFAA 5AGEA 5DS0A 3GUXA 2D4OA 4H89A 4RS2A 1NE9A 1QSTA 2HC9A 2PJ3A 4R6TA 2Q4YA 2PQ8A 4MHDA 3T9YA 3K2KA 5F48A 4B5OA 3NFZA 3I9SA 2V8VA 3B3SA 2EUIA 4ZGYB 1M44A 2PVWA 5JQ4A 2OB0A 2PRQA 2CTBA 2I79A 4B12A 4U9YA 4R87A 1YLEA 3S9LA 2AFWA 1I21A 4ZI6A 1GHEA 2XEGA 4BD9A 4FD7A 4NGTA 4IK2A 4Z65A 6CPAA 3FECA 4A31A 4P4JA 1LFWA 2GLFA 4OC3A 5HVHA 3V38A 5KTDA 1Z2LA 4BBHA 1IOFA 4R76A 3WC7A 3NA6A 3PBEA 4H6UA 3PGPA 2CY2A 2G3TA 4H2KA 1DTDA 2EBJA 2VZZA 2ZW6A 2OH1A 3IFEA 2ZEHA 3KI9A 4MXUA 3SJEA 2XEFA 2EWBA 2PIZA 2J8RA 3FYNA 5K8OA 3IJ3A 1VHEA 1ZLHA 2AE6A 2PJ4A 2F7VA 3CT9A 3KKWA 2Q4ZA 3FF3A 3FBUA 1Q7LA 3TE4A 3D7GA 3PBBA 4AB7A 4QVTA 3RNZA 4AVCA 3LODA 4L8AA 3RBUA 1X10A 1CPXA 2JBKA 2ZELA 4G1PA 2G3AA 1AMPA 4MFLA 4MI4A 2CF4A 2GANA 2PJ9A 3JVNA 4UCPA 4JYWA 3S6HA 3B3VA 4EVYA 5E96A 1LANA 1YVKA 4PXBA 3P2HA 3SI0A 1IB1E 4CPAA 3CXQA 3EY5A 3D67A 4OMEA 1CPSA 3K9TA 1YW6A 3RYOA 3FJUA 5J8CA 2AFOA 5IX3A 4UWIA 2BSWA 1RTQA 4X3RA 4A94A 3IU2A 3V7ZA 4ZY1A 2RC4A 3D2PA 4NGPA 5F47A 1QSMA 4KVME 4PXCA 3VWDA 2ZXVA 3LACA 2Z3LA 4UCNA 4PSWA 1SQHA 1F57A 4B5PB 3S9MA 3W91A 4P4BA 5AG6A 4P4DA 2AFSA 2DXQA 2PJ7A 2PJ2A 3B3TA 4PV6A 1BOBA 2QJ8A 4P4FA 1J4JA 3G8WA 1DE4C 4ONUA 1ZG7A 2ABZA 2F5IA 1KUYA 3KL9A 4NGNA 4FD5A 1R43A 3D66A 4KVOE 3GKRA 2G0BA 4C2XA 1MJ9A 2EVNA 3SXOA 1M1DA 2BUEA 3EO4A 5LRGA 2JEWA 1UWYA 1VKCA 2CNMA 3RAMA 1TXRA 2PJ8A 4CS0B 3GB0A 1XRYA 1RO5A 2QMLA 2WPXA 4K30A 4CYPA 3KZWA 3FRMA 4EFDA 4B14A 2Z3KA 2ZENA 4J3GA 2BEIA 4AXVA 1IU8A 1Y7RA 2Q0YA 2VL1A 3FNCA 4R3KA 3CXPA 2H5MA 4U9ZA 4YFJA 1MJBA 2B3VA 2PJ0A 3OWCA 3H8EA 1Y7EA 3KQXA 5KTCA 1Z9UA 4F6AA 2V8GA 5A27A 2FCKA 3TT2A 2WYRA 1XE4A 1NSAA 1Y9KA 3ISXA 4X2TA 3KGQA 5ISVA 3TX8A 4Y49B 1YLOA 4AG7A 3WABA 4KOSA 4KOVA 4UBRA 1S7KA 3DR6A 5C82A 4WWVA 1Z5RA 3QB8A 5DWNA 1QSNA 3E0KA 2CIJA 1KZFA 4MFZA 2AFXA 2IL4A 1HEEA 4MMOA 5HVFA 3BJ7A 2FS5A 3R9EA 3TTHA 2YNCC 2CTCA 1BLLE 4OC5A 3TO6A 4C7IA 1JQGA 4LUAA 1X12A 1ZG8A 3W6XA 1YX0A 3T8WA 3IU1A 1YR0A 5EBVA 3CXSA 4NGRA 4OIDA 2FL4A 4UIBA 3NE8A 5THWA 2PVVA 5I4MA 5G22A 2PJBA 2DPTA 1ELLP 2YNCA 4KLVA 4NJRA 2REFA 5EC4A 3SJFA 3WR7A 2J9AA 4KORA 1Z4RA 3D68A 3IEHA 4R9MA 3R96A 1CP7A 4OKOA 2CXAA 1Y0RA 4E2AA 5FVJA 4XNHC 4AVAA 3FEDA 4YWYA 4LQGA 4JD6A 4UEFA 3IWEA 4ORFA 1EE3P 4X8IA 4KSAA 4HPSA 3ZZIA 5EMIA 1YREA 4PSXA 5F46A 2B5GA 1BAVA 2R1IA 2X7BA 3JTKA 2Z3PA 4HNYB 4JWPA 4MCSA 1IYLA 2NMTA 4OC1A 4XPKA 2RFHA 3MN8A 4IHMA 4MRIA 4OC4A 5CNPA 3F8KA 4JZ0A 3D4UA 1GYTA 1PYTB 3CDXA 4NEXA 3SJXA 4EMEA 3B7IA 3WT4A 1YGHA 2GFQA 2QVPA 2PRBA 1Z8WA 4UF4A 4MCPA 4KVXA 1LAMA 1FY7A 4XNHB 3NH5A 1P4NA 2ATRA 2WZNA 7CPAA 3SI1A 1QSRA 4E8OA 5HMNA 2AFMA 2QYVA 3HLPA 5LYIA 2G9DA 5G21A 4MCRA 2P0WA 4MY3A 3QNVA 3GIUA 3HUVA 4OLLA 4OC2A 4KUAA 1PU9A 1YK3A 1Z8LA 1CG2A 2CNTA 4MHZA 3FEEA 3WC5A 2Q43A 4NGMA 1S7NA 5J8FA 3BLNA 1CJWA 5HVGA 2K5TA 2Q04A 2PC1A 2DEAA 1XIXA 1N71A 2BOAA 4O23A 4TNUA 2AFZA 3KR4A 1ON0A 5HXDA 1TIQA 5J1QA 2C27A 3FB3A 1XMTA 3H5ZA 1UFHA 2V8HA 4ZX9A 3GLJA 2JDCA 2FT0A 1KUVA 1IYKA 4B10A 3P2FA 2R98A 3S6GA 4PPZA 3FIXA 3NH8A 4C2ZA 2FXFA 3PFOA 1CM0A 1QMUA 2J8MA 1IGBA 2HQYA 1F2OA 3D7DA 4MHPA 2P6GA 4AVBA 5KTAA 4II9A 4M85A 2ANPA 1PUAA 3LD2A 4NSQA 4UCMA 3SXNA 4C68A 4OIWA 1IICA 1XMBA 2O4HA 4PQAA 5JH9A 4MFKA 1R3NA 3PZJA 4CAEA 2EK9A 3QAYA 4AG9A 4PK3A 3L2NA 5CPAA 3R9GA 5H86A 2BCOA 2I00A 1LAPA 1M4IA 2FE7A 3FVLA 3GY9A 4PK2A 3D8PA 3PB6X 1S3ZA 4HNWB 1B6BA 1IY7A 3CZXA 1TF9A 1OBRA 1TKJA 4MFQA 4R3LA 3DNSA 1YMEA 4P45A 3PB9X 2B4DA 2YGWA 2Q7BA 5AG4A 1LCPA 4A38A 2JDDA 1HDUA 3TC8A 2JLMA 4A2ZA 1U6MA 2C6PA 2A4NA 3KQZA 4IAVA 2KCWA 4KOWA 3B8GA 4PXEA 3VARA 1Y9WA 4Q38A 2GE3A 4EWTA 5ELYA 2Q7SA 4R57A 3T90A 1M4LA 4B13A 4E0AA 5CBMA 1IOIA 2Z11A 4B6ZA 4KOYA 2FIAA 1ELMP 4FWUA 4JLYA 1RXTA 3B2YA 4M6HA 2Z10A 2DF5A 1I1DA 4Q7AA 2OOTA 4CYOA 5LRKA 4NFRA 1FNOA 5DWMA 1R57A 2HUZA 4WJBA 1NSLA 3C26A 3FH4A 3JUWA 4QBJA 1MJAA 3VH9A 4NGSA 1ZG9A 2WPWA 3ISZA 3PB8X 4UFWA 4A33A 4CAFA 1XJOA 3FXTA 3DLJA 3WC6A 4U5YA 2ZEMA 5IB0A
chains in the Genus database with same CATH topology
5BWAB 4KLWA 4MY0A 4QUSA 2ARHA 3BJ8A 3V8IA 4CAXA 1L0CA 4RI1A 2JEVA 1K4JA 5A28A 2OU2A 2VEZA 4FD4A 4UFVA 3H4QA 4MFJA 3EC4A 1MK4A 3D3SA 4MFPA 4F0XA 4KUBA 5H84A 1M4DA 2REEA 1B87A 4KOUA 1KUXA 3TO9A 1Q2YA 2O28A 4CGNA 1BO4A 4YGOA 4ZBGA 2P6FA 2FSRA 5F49A 4YRHA 3R95A 3W6SA 2OZUA 4CYQA 4MBUA 5IV0A 2R8VA 2PR8A 4C2YA 4CYNA 1Q2CA 4HKFA 4LX9A 4XPLA 2B58A 3G3SA 3D2MA 5HH1A 2QECA 1IIDA 2B5GB 4OADA 2OZHA 4MJ8A 5IX3A 4H6ZA 3TOAA 4JJXA 1NMTA 2VQYA 4UFXA 1V0CA 2Z3MA 4M3SA 1YVOA 2DPSA 4Q36A 4X5KA 1XF8A 3ZJ0A 4NXYA 2PDOA 2Q44A 2Q4VA 4FD6A 3QAHA 4CGOA 1Q2DA 2B3UA 4OAEA 2Z0ZA 4HNXB 2ZW7A 4KOTA 1S5KA 3K9UA 1S7FA 4A30A 2Z3OA 2BL1A 2YNDA 3I3GA 4IF5A 5I0CA 3UY5A 3F0AA 4KSFA 3PP9A 4IUSA 4JXRA 4B5PA 3GYAA 2WSAA 4CGLA 4A95A 2YNEA 1M4GA 1I12A 4UWJA 3DDDA 3R9FA 2D4PA 5G20A 2QIRA 1S7LA 2Z3NA 3TO7A 2Y0MA 2OZGA 3R1KA 1LRZA 2PSWA 1QSOA 3VWEA 3N7ZA 1XEBA 3TCVA 1WK4A 5C88A 4CRYB 2HV2A 2VZYA 5AG5A 2GIVA 4CRZB 2ZW4A 3DSBA 4I49A 2B4DB 4NF1A 3A9LA 2WUUA 4Y49C 4XPDC 4BMHA 3IGRA 4KOXA 5JPHA 4NCZA 3SHPA 4KS9A 5GCNA 2J8NA 2VXKA 1ZO0A 4UA3A 1P0HA 4L89A 2P6EA 2VBQA 5G1ZA 2FIWA 4KZTA 1OZPA 1WWZA 2VI7A 2CNSA 3TOBA 1VHSA 3F5BA 2PR1A 4QB9A 2B4BA 4B11A 4F0YA 2ZPAA 4XPDB 3EXNA 4CAVA 4CGMA 2ZW5A 3S6KA 3S6FA 2AJ6A 3IWGA 1Z4EA 4C7HA 3TFYA 3NE7A 3MGDA 4DNCA 4CAWA 3DR8A 2R7HA 4CGPA 1S60A 4GS4A 4JXQA 5AG7A 4QC6A 3EFAA 5AGEA 2D4OA 4H89A 4RS2A 1NE9A 1QSTA 2Q4YA 2PQ8A 4MHDA 3T9YA 5F48A 4B5OA 3I9SA 2EUIA 4ZGYB 1M44A 5JQ4A 2OB0A 2I79A 4B12A 4U9YA 4R87A 1YLEA 1I21A 1GHEA 4FD7A 4A31A 5KTDA 4BBHA 4H6UA 3PGPA 2CY2A 2G3TA 2VZZA 2ZW6A 2OH1A 2J8RA 3FYNA 3KKWA 2AE6A 3FBUA 3TE4A 4AB7A 4QVTA 4AVCA 3LODA 4L8AA 2G3AA 4MFLA 4MI4A 2GANA 3JVNA 4UCPA 3S6HA 4EVYA 5E96A 1YVKA 3P2HA 1IB1E 3CXQA 3EY5A 5J8CA 3RYOA 4UWIA 2BSWA 3IU2A 2RC4A 3D2PA 5F47A 1QSMA 4KVME 3VWDA 2ZXVA 2Z3LA 4UCNA 4PSWA 1SQHA 4B5PB 3W91A 5AG6A 2DXQA 4PV6A 1BOBA 1J4JA 3G8WA 4ONUA 2F5IA 1KUYA 4FD5A 4KVOE 3GKRA 2G0BA 4C2XA 1MJ9A 2EVNA 3SXOA 1M1DA 2BUEA 3EO4A 1VKCA 2CNMA 4CS0B 2WPXA 1RO5A 2QMLA 4K30A 4CYPA 3FRMA 4B14A 2Z3KA 4J3GA 2BEIA 1Y7RA 3FNCA 2Q0YA 4R3KA 3CXPA 2H5MA 4U9ZA 4YFJA 1MJBA 2B3VA 3OWCA 5KTCA 1Z9UA 4F6AA 5A27A 2FCKA 3TT2A 1XE4A 1Y9KA 5ISVA 4Y49B 4AG7A 4KOSA 4KOVA 4UBRA 1S7KA 3DR6A 5C82A 5DWNA 3QB8A 1QSNA 3E0KA 1KZFA 4MFZA 2IL4A 3R9EA 3BJ7A 2FS5A 4C7IA 3TTHA 2YNCC 3TO6A 4LUAA 3W6XA 1YX0A 3IU1A 1YR0A 5EBVA 3CXSA 2FL4A 5G22A 2DPTA 2YNCA 5EC4A 4KLVA 3WR7A 2REFA 3R96A 4KORA 1Z4RA 4R9MA 2CXAA 4E2AA 5FVJA 4XNHC 4AVAA 4JD6A 3IWEA 4ORFA 4KSAA 3ZZIA 1YREA 4PSXA 5F46A 2B5GA 2R1IA 2X7BA 3JTKA 2Z3PA 4HNYB 4JWPA 1IYLA 2NMTA 4XPKA 5CNPA 3F8KA 4NEXA 1YGHA 2PRBA 4KVXA 1FY7A 4XNHB 1P4NA 2ATRA 1QSRA 4E8OA 5HMNA 5G21A 2P0WA 4MY3A 4OLLA 4KUAA 1PU9A 1YK3A 2CNTA 5J8FA 1S7NA 3BLNA 1CJWA 2K5TA 2Q04A 2PC1A 1XIXA 1N71A 1ON0A 1TIQA 2C27A 3H5ZA 3FB3A 1XMTA 1UFHA 2JDCA 2FT0A 1KUVA 1IYKA 4B10A 3P2FA 2R98A 3S6GA 3FIXA 4C2ZA 2FXFA 1CM0A 2J8MA 2HQYA 2P6GA 4AVBA 5KTAA 4II9A 4M85A 4NSQA 1PUAA 3LD2A 4UCMA 3SXNA 4C68A 1IICA 4MFKA 3PZJA 4CAEA 4AG9A 4PK3A 3R9GA 5H86A 2I00A 1M4IA 2FE7A 3GY9A 4PK2A 3D8PA 1S3ZA 4HNWB 1B6BA 4R3LA 4MFQA 2Q7BA 3DNSA 2B4DA 2YGWA 5AG4A 2JDDA 2JLMA 4A2ZA 1U6MA 2A4NA 4KOWA 2KCWA 3B8GA 1Y9WA 4Q38A 2GE3A 3T90A 4R57A 4E0AA 4B13A 2Z11A 4KOYA 2FIAA 4JLYA 4A32A 4CYOA 1RXTA 2Z10A 1I1DA 5DWMA 1R57A 2HUZA 1NSLA 3C26A 3JUWA 4QBJA 1MJAA 2WPWA 4UFWA 4A33A 4CAFA 5IB0A 3FXTA 4U5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KLW A;  4MY0 A;  4QUS A;  2ARH A;  3BJ8 A;  3V8I A;  4CAX A;  1L0C A;  4RI1 A;  2JEV A;  1K4J A;  2OU2 A;  2VEZ A;  4FD4 A;  3H4Q A;  3EC4 A;  1MK4 A;  3D3S A;  4KUB A;  5H84 A;  1M4D A;  2REE A;  1B87 A;  4KOU A;  1KUX A;  3TO9 A;  1Q2Y A;  2O28 A;  1BO4 A;  4YGO A;  4ZBG A;  2P6F A;  2FSR A;  5F49 A;  4YRH A;  3R95 A;  3W6S A;  2OZU A;  4MBU A;  5IV0 A;  2R8V A;  2PR8 A;  1Q2C A;  4HKF A;  4LX9 A;  4XPL A;  2B58 A;  3G3S A;  3D2M A;  5HH1 A;  2QEC A;  1IID A;  2B5G B;  4OAD A;  2OZH A;  4MJ8 A;  5IX3 A;  4H6Z A;  3TOA A;  4JJX A;  1NMT A;  2VQY A;  1V0C A;  4M3S A;  1YVO A;  4X5K A;  1XF8 A;  3ZJ0 A;  4NXY A;  2PDO A;  2Q44 A;  2Q4V A;  4FD6 A;  3QAH A;  1Q2D A;  2B3U A;  4OAE A;  2Z0Z A;  4HNX B;  2ZW7 A;  4KOT A;  1S5K A;  3K9U A;  1S7F A;  2BL1 A;  3I3G A;  4IF5 A;  5I0C A;  3UY5 A;  3F0A A;  3PP9 A;  4IUS A;  4JXR A;  4B5P A;  3GYA A;  1M4G A;  1I12 A;  4UWJ A;  3DDD A;  3R9F A;  2D4P A;  2QIR A;  1S7L A;  3TO7 A;  2Y0M A;  2OZG A;  3R1K A;  1LRZ A;  2PSW A;  1QSO A;  3VWE A;  3N7Z A;  1XEB A;  3TCV A;  1WK4 A;  5C88 A;  4CRY B;  2HV2 A;  2VZY A;  2GIV A;  4CRZ B;  2ZW4 A;  3DSB A;  4I49 A;  2B4D B;  4NF1 A;  4Y49 C;  4XPD C;  4BMH A;  3IGR A;  4KOX A;  5JPH A;  4NCZ A;  3SHP A;  5GCN A;  2J8N A;  2VXK A;  4UA3 A;  1P0H A;  4L89 A;  2P6E A;  2VBQ A;  2FIW A;  4KZT A;  1OZP A;  1WWZ A;  2VI7 A;  2CNS A;  3TOB A;  1VHS A;  3F5B A;  2PR1 A;  4QB9 A;  2B4B A;  4F0Y A;  2ZPA A;  4XPD B;  3EXN A;  4CAV A;  2ZW5 A;  3S6K A;  3S6F A;  2AJ6 A;  3IWG A;  1Z4E A;  3TFY A;  3NE7 A;  3MGD A;  4DNC A;  4CAW A;  3DR8 A;  2R7H A;  1S60 A;  4GS4 A;  4JXQ A;  4QC6 A;  3EFA A;  2D4O A;  4H89 A;  4RS2 A;  1NE9 A;  1QST A;  2Q4Y A;  2PQ8 A;  4MHD A;  3T9Y A;  5F48 A;  4B5O A;  3I9S A;  2EUI A;  1M44 A;  5JQ4 A;  2OB0 A;  2I79 A;  4U9Y A;  4R87 A;  1YLE A;  1I21 A;  1GHE A;  4FD7 A;  5KTD A;  4H6U A;  3PGP A;  2CY2 A;  2G3T A;  2VZZ A;  2ZW6 A;  2OH1 A;  2J8R A;  3FYN A;  3KKW A;  2AE6 A;  3FBU A;  3TE4 A;  4AB7 A;  4QVT A;  4AVC A;  3LOD A;  4L8A A;  2G3A A;  4MI4 A;  2GAN A;  3JVN A;  3S6H A;  4EVY A;  5E96 A;  1YVK A;  3P2H A;  1IB1 E;  3CXQ A;  3EY5 A;  5J8C A;  3RYO A;  4UWI A;  2BSW A;  2RC4 A;  3D2P A;  5F47 A;  1QSM A;  4KVM E;  3VWD A;  2ZXV A;  4PSW A;  1SQH A;  4B5P B;  3W91 A;  2DXQ A;  4PV6 A;  1BOB A;  1J4J A;  3G8W A;  4ONU A;  2F5I A;  1KUY A;  4FD5 A;  4KVO E;  3GKR A;  2G0B A;  1MJ9 A;  2EVN A;  3SXO A;  1M1D A;  2BUE A;  3EO4 A;  1VKC A;  2CNM A;  4CS0 B;  2WPX A;  1RO5 A;  2QML A;  4K30 A;  3FRM A;  4J3G A;  2BEI A;  1Y7R A;  3FNC A;  2Q0Y A;  4R3K A;  3CXP A;  2H5M A;  4U9Z A;  4YFJ A;  1MJB A;  2B3V A;  3OWC A;  5KTC A;  1Z9U A;  4F6A A;  2FCK A;  3TT2 A;  1XE4 A;  1Y9K A;  5ISV A;  4Y49 B;  4AG7 A;  4KOS A;  4KOV A;  4UBR A;  1S7K A;  3DR6 A;  5C82 A;  5DWN A;  3QB8 A;  1QSN A;  3E0K A;  1KZF A;  2IL4 A;  3R9E A;  3BJ7 A;  2FS5 A;  3TTH A;  3TO6 A;  4LUA A;  3W6X A;  1YX0 A;  1YR0 A;  5EBV A;  3CXS A;  2FL4 A;  5EC4 A;  3WR7 A;  4KLV A;  2REF A;  3R96 A;  4KOR A;  1Z4R A;  4R9M A;  4E2A A;  5FVJ A;  4XNH C;  4AVA A;  4JD6 A;  4ORF A;  3ZZI A;  1YRE A;  4PSX A;  5F46 A;  2B5G A;  2R1I A;  2X7B A;  4JWP A;  4HNY B;  1IYL A;  2NMT A;  4XPK A;  5CNP A;  3F8K A;  4NEX A;  1YGH A;  2PRB A;  4KVX A;  1FY7 A;  4XNH B;  1P4N A;  2ATR A;  1QSR A;  4E8O A;  5HMN A;  2P0W A;  4MY3 A;  4OLL A;  4KUA A;  1PU9 A;  1YK3 A;  2CNT A;  5J8F A;  1S7N A;  3BLN A;  1CJW A;  2K5T A;  2Q04 A;  2PC1 A;  1XIX A;  1N71 A;  1ON0 A;  1TIQ A;  2C27 A;  3FB3 A;  1XMT A;  1UFH A;  2JDC A;  2FT0 A;  1KUV A;  1IYK A;  3P2F A;  2R98 A;  3S6G A;  3FIX A;  2FXF A;  1CM0 A;  2J8M A;  2HQY A;  2P6G A;  4AVB A;  5KTA A;  4II9 A;  4M85 A;  4NSQ A;  1PUA A;  3LD2 A;  3SXN A;  1IIC A;  3PZJ A;  4AG9 A;  4PK3 A;  3R9G A;  5H86 A;  2I00 A;  1M4I A;  2FE7 A;  3GY9 A;  4PK2 A;  3D8P A;  1S3Z A;  4HNW B;  1B6B A;  4R3L A;  2Q7B A;  3DNS A;  2B4D A;  2JDD A;  2JLM A;  1U6M A;  2A4N A;  4KOW A;  2KCW A;  3B8G A;  1Y9W A;  2GE3 A;  3T90 A;  4R57 A;  4E0A A;  2Z11 A;  4KOY A;  2FIA A;  4JLY A;  1RXT A;  2Z10 A;  1I1D A;  5DWM A;  1R57 A;  2HUZ A;  1NSL A;  3C26 A;  3JUW A;  4QBJ A;  1MJA A;  2WPW A;  5IB0 A;  3FXT A;  4U5Y A; 
#chains in the Genus database with same CATH topology
 2C6C A;  2PJC A;  3KHZ A;  5BWA B;  4KLW A;  3MRU A;  2HB6 A;  4MY0 A;  4QUS A;  4M6G A;  1CX8 A;  2ARH A;  5F09 A;  2FVG A;  4OP4 A;  3BJ8 A;  3V8I A;  2RB7 A;  4CAX A;  1L0C A;  4R7M A;  4RI1 A;  2ZEE A;  4F9V A;  2JEV A;  1K4J A;  4ZYQ A;  2EO8 A;  5A28 A;  2OU2 A;  1Z8T A;  2VEZ A;  1AUG A;  4FD4 A;  4UFV A;  3H4Q A;  4MFJ A;  3EC4 A;  1MK4 A;  3D3S A;  4MFP A;  4PXD A;  4F0X A;  4KUB A;  5H84 A;  1M4D A;  2REE A;  1B87 A;  2ZOG A;  1ZLI A;  4KOU A;  1KUX A;  3CPX A;  3TO9 A;  4OC0 A;  1Q2Y A;  2PJA A;  1BPN A;  1PCA A;  2V77 A;  2O28 A;  4CGN A;  1BO4 A;  4YGO A;  4ZBG A;  2P6F A;  2FSR A;  1F2P A;  1YW4 A;  5D29 A;  4YRH A;  5F49 A;  3D7H A;  3R95 A;  3W6S A;  2OZU A;  4K3N A;  4CYQ A;  3BI1 A;  4MBU A;  1TKF A;  4R8F A;  5IV0 A;  2R8V A;  2PR8 A;  4C2Y A;  2JBJ A;  4CYN A;  3B35 A;  4DJL A;  2PJ6 A;  1Q2C A;  4HKF A;  4LX9 A;  4XPL A;  2B58 A;  3G3S A;  3D2M A;  2NYQ A;  4NGQ A;  5HH1 A;  4MCQ A;  4MHN A;  1KWM A;  2QEC A;  1IID A;  2XEI A;  2B5G B;  3B3W A;  2GU2 A;  2OZH A;  4MJ8 A;  4H6Z A;  4OAD A;  4LQ6 A;  4JJX A;  4ONW A;  3TOA A;  4FAI A;  2F8H A;  2BO9 A;  1NMT A;  2VQY A;  2ODF A;  1V0C A;  2Z3M A;  4UFX A;  4BIN A;  4GM5 A;  3FMC A;  1YVO A;  4M3S A;  2DPS A;  4Q36 A;  4DYO A;  4X5K A;  1XF8 A;  3RZA A;  3ZJ0 A;  1VHO A;  4NXY A;  2IMO A;  2IJZ A;  5K8P A;  2PDO A;  2Q44 A;  2Q4V A;  4FD6 A;  4TWE A;  4A32 A;  3PEI A;  2ZEF A;  5D8N A;  1AYE A;  5K8M A;  3CPA A;  3QAH A;  4CGO A;  1HDQ A;  1Q2D A;  2B3U A;  3I1U A;  3S9N A;  2I3C A;  2GLJ A;  4OAE A;  2Z0Z A;  4HNX B;  2ZW7 A;  2ZOF A;  3DGV A;  4KOT A;  4P6Y A;  1S5K A;  2PCU A;  2V8D A;  3K9U A;  4ZY0 A;  4FBE A;  1S7F A;  4A30 A;  2Z3O A;  1H8L A;  2BL1 A;  2YND A;  3I3G A;  4IF5 A;  1FT7 A;  5I0C A;  2EK8 A;  4P10 A;  5JM6 A;  3FX6 A;  2AFU A;  4ZX8 A;  3JRU A;  2GRE A;  3UY5 A;  3F0A A;  1VGY A;  2PIY A;  2ZED A;  3PP9 A;  4KSF A;  4IUS A;  4JXR A;  2Q51 A;  4B5P A;  8CPA A;  3GYA A;  2WSA A;  3IIB A;  4RN7 A;  3PB7 X;  4YU9 A;  3RO0 A;  4CGL A;  4F9U A;  1LOK A;  4A95 A;  2ZEO A;  2PJ1 A;  1CBX A;  2YNE A;  1M4G A;  3IWW A;  1I12 A;  4UWJ A;  3DDD A;  3R9F A;  2PE3 A;  2D4P A;  3H8G A;  2ZEG A;  5G20 A;  1YSJ A;  2QIR A;  4DUK A;  5LYF A;  1S7L A;  2Z3N A;  3TO7 A;  3LMS A;  1ARM A;  2Y0M A;  4UEZ A;  2OZG A;  3B3C A;  3R1K A;  1LRZ A;  2PSW A;  3KHX A;  3LWU A;  1QSO A;  5LRJ A;  3N7Z A;  1XEB A;  3VWE A;  4NJQ A;  3TCV A;  1WK4 A;  5C88 A;  2O53 A;  3KR5 A;  4CRY B;  3BHX A;  2HV2 A;  1TF8 A;  4UIA A;  4W9Y A;  1BPM A;  2VZY A;  4FUU A;  5AG5 A;  5IB9 A;  1A2Z A;  2GIV A;  3SI2 A;  4CRZ B;  2ZW4 A;  5LYD A;  3DSB A;  1YQE A;  1TKH A;  4F8Z A;  1JWQ A;  2B4D B;  4I49 A;  4NF1 A;  3A9L A;  2WUU A;  1QQ9 A;  4Y49 C;  4XPD C;  4BMH A;  3IGR A;  4KOX A;  5JPH A;  4NCZ A;  3SHP A;  4M6I A;  1Z8X A;  4RUH A;  3IC1 A;  4KS9 A;  5GCN A;  2POK A;  2C6G A;  2J8N A;  2VXK A;  3BI0 A;  1Y0Y A;  3SJG A;  4P44 A;  1ZO0 A;  4UA3 A;  3VAT A;  1P0H A;  4A37 A;  4L89 A;  2PJ5 A;  2P6E A;  2VBQ A;  3IO1 A;  4P4E A;  5G1Z A;  1CP6 A;  3H8F A;  2FIW A;  4KZT A;  5LYL A;  1OZP A;  1XBU A;  1WWZ A;  2VI7 A;  3BXM A;  2CNS A;  4ZY2 A;  1XOV A;  4KSI A;  3TOB A;  5JGF A;  1VHS A;  4MHY A;  3F5B A;  1ARL A;  4P4I A;  2PR1 A;  3D7F A;  4QB9 A;  2B4B A;  4B11 A;  1XFO A;  4F0Y A;  2ZPA A;  4XPD B;  3EXN A;  3KAS A;  4CAV A;  4CGM A;  2XEJ A;  2ZW5 A;  4UEE A;  3S6K A;  3NH4 A;  3S6F A;  3PFE A;  2OR4 A;  2AJ6 A;  3PB4 X;  3IWG A;  1Z4E A;  4C7H A;  3TFY A;  2ZEP A;  3NE7 A;  2NSM A;  3MGD A;  4DNC A;  4CAW A;  3DR8 A;  5K8N A;  3N5F A;  2R7H A;  3PRT A;  2C1C A;  4GXH A;  4A39 A;  1VIX A;  2IQ6 A;  4CGP A;  1S60 A;  4GS4 A;  4JXQ A;  5AG7 A;  4QC6 A;  3EFA A;  5AGE A;  5DS0 A;  3GUX A;  2D4O A;  4H89 A;  4RS2 A;  1NE9 A;  1QST A;  2HC9 A;  2PJ3 A;  4R6T A;  2Q4Y A;  2PQ8 A;  4MHD A;  3T9Y A;  3K2K A;  5F48 A;  4B5O A;  3NFZ A;  3I9S A;  2V8V A;  3B3S A;  2EUI A;  4ZGY B;  1M44 A;  2PVW A;  5JQ4 A;  2OB0 A;  2PRQ A;  2CTB A;  2I79 A;  4B12 A;  4U9Y A;  4R87 A;  1YLE A;  3S9L A;  2AFW A;  1I21 A;  4ZI6 A;  1GHE A;  2XEG A;  4BD9 A;  4FD7 A;  4NGT A;  4IK2 A;  4Z65 A;  6CPA A;  3FEC A;  4A31 A;  4P4J A;  1LFW A;  2GLF A;  4OC3 A;  5HVH A;  3V38 A;  5KTD A;  1Z2L A;  4BBH A;  1IOF A;  4R76 A;  3WC7 A;  3NA6 A;  3PBE A;  4H6U A;  3PGP A;  2CY2 A;  2G3T A;  4H2K A;  1DTD A;  2EBJ A;  2VZZ A;  2ZW6 A;  2OH1 A;  3IFE A;  2ZEH A;  3KI9 A;  4MXU A;  3SJE A;  2XEF A;  2EWB A;  2PIZ A;  2J8R A;  3FYN A;  5K8O A;  3IJ3 A;  1VHE A;  1ZLH A;  2AE6 A;  2PJ4 A;  2F7V A;  3CT9 A;  3KKW A;  2Q4Z A;  3FF3 A;  3FBU A;  1Q7L A;  3TE4 A;  3D7G A;  3PBB A;  4AB7 A;  4QVT A;  3RNZ A;  4AVC A;  3LOD A;  4L8A A;  3RBU A;  1X10 A;  1CPX A;  2JBK A;  2ZEL A;  4G1P A;  2G3A A;  1AMP A;  4MFL A;  4MI4 A;  2CF4 A;  2GAN A;  2PJ9 A;  3JVN A;  4UCP A;  4JYW A;  3S6H A;  3B3V A;  4EVY A;  5E96 A;  1LAN A;  1YVK A;  4PXB A;  3P2H A;  3SI0 A;  1IB1 E;  4CPA A;  3CXQ A;  3EY5 A;  3D67 A;  4OME A;  1CPS A;  3K9T A;  1YW6 A;  3RYO A;  3FJU A;  5J8C A;  2AFO A;  5IX3 A;  4UWI A;  2BSW A;  1RTQ A;  4X3R A;  4A94 A;  3IU2 A;  3V7Z A;  4ZY1 A;  2RC4 A;  3D2P A;  4NGP A;  5F47 A;  1QSM A;  4KVM E;  4PXC A;  3VWD A;  2ZXV A;  3LAC A;  2Z3L A;  4UCN A;  4PSW A;  1SQH A;  1F57 A;  4B5P B;  3S9M A;  3W91 A;  4P4B A;  5AG6 A;  4P4D A;  2AFS A;  2DXQ A;  2PJ7 A;  2PJ2 A;  3B3T A;  4PV6 A;  1BOB A;  2QJ8 A;  4P4F A;  1J4J A;  3G8W A;  1DE4 C;  4ONU A;  1ZG7 A;  2ABZ A;  2F5I A;  1KUY A;  3KL9 A;  4NGN A;  4FD5 A;  1R43 A;  3D66 A;  4KVO E;  3GKR A;  2G0B A;  4C2X A;  1MJ9 A;  2EVN A;  3SXO A;  1M1D A;  2BUE A;  3EO4 A;  5LRG A;  2JEW A;  1UWY A;  1VKC A;  2CNM A;  3RAM A;  1TXR A;  2PJ8 A;  4CS0 B;  3GB0 A;  1XRY A;  1RO5 A;  2QML A;  2WPX A;  4K30 A;  4CYP A;  3KZW A;  3FRM A;  4EFD A;  4B14 A;  2Z3K A;  2ZEN A;  4J3G A;  2BEI A;  4AXV A;  1IU8 A;  1Y7R A;  2Q0Y A;  2VL1 A;  3FNC A;  4R3K A;  3CXP A;  2H5M A;  4U9Z A;  4YFJ A;  1MJB A;  2B3V A;  2PJ0 A;  3OWC A;  3H8E A;  1Y7E A;  3KQX A;  5KTC A;  1Z9U A;  4F6A A;  2V8G A;  5A27 A;  2FCK A;  3TT2 A;  2WYR A;  1XE4 A;  1NSA A;  1Y9K A;  3ISX A;  4X2T A;  3KGQ A;  5ISV A;  3TX8 A;  4Y49 B;  1YLO A;  4AG7 A;  3WAB A;  4KOS A;  4KOV A;  4UBR A;  1S7K A;  3DR6 A;  5C82 A;  4WWV A;  1Z5R A;  3QB8 A;  5DWN A;  1QSN A;  3E0K A;  2CIJ A;  1KZF A;  4MFZ A;  2AFX A;  2IL4 A;  1HEE A;  4MMO A;  5HVF A;  3BJ7 A;  2FS5 A;  3R9E A;  3TTH A;  2YNC C;  2CTC A;  1BLL E;  4OC5 A;  3TO6 A;  4C7I A;  1JQG A;  4LUA A;  1X12 A;  1ZG8 A;  3W6X A;  1YX0 A;  3T8W A;  3IU1 A;  1YR0 A;  5EBV A;  3CXS A;  4NGR A;  4OID A;  2FL4 A;  4UIB A;  3NE8 A;  5THW A;  2PVV A;  5I4M A;  5G22 A;  2PJB A;  2DPT A;  1ELL P;  2YNC A;  4KLV A;  4NJR A;  2REF A;  5EC4 A;  3SJF A;  3WR7 A;  2J9A A;  4KOR A;  1Z4R A;  3D68 A;  3IEH A;  4R9M A;  3R96 A;  1CP7 A;  4OKO A;  2CXA A;  1Y0R A;  4E2A A;  5FVJ A;  4XNH C;  4AVA A;  3FED A;  4YWY A;  4LQG A;  4JD6 A;  4UEF A;  3IWE A;  4ORF A;  1EE3 P;  4X8I A;  4KSA A;  4HPS A;  3ZZI A;  5EMI A;  1YRE A;  4PSX A;  5F46 A;  2B5G A;  1BAV A;  2R1I A;  2X7B A;  3JTK A;  2Z3P A;  4HNY B;  4JWP A;  4MCS A;  1IYL A;  2NMT A;  4OC1 A;  4XPK A;  2RFH A;  3MN8 A;  4IHM A;  4MRI A;  4OC4 A;  5CNP A;  3F8K A;  4JZ0 A;  3D4U A;  1GYT A;  1PYT B;  3CDX A;  4NEX A;  3SJX A;  4EME A;  3B7I A;  3WT4 A;  1YGH A;  2GFQ A;  2QVP A;  2PRB A;  1Z8W A;  4UF4 A;  4MCP A;  4KVX A;  1LAM A;  1FY7 A;  4XNH B;  3NH5 A;  1P4N A;  2ATR A;  2WZN A;  7CPA A;  3SI1 A;  1QSR A;  4E8O A;  5HMN A;  2AFM A;  2QYV A;  3HLP A;  5LYI A;  2G9D A;  5G21 A;  4MCR A;  2P0W A;  4MY3 A;  3QNV A;  3GIU A;  3HUV A;  4OLL A;  4OC2 A;  4KUA A;  1PU9 A;  1YK3 A;  1Z8L A;  1CG2 A;  2CNT A;  4MHZ A;  3FEE A;  3WC5 A;  2Q43 A;  4NGM A;  1S7N A;  5J8F A;  3BLN A;  1CJW A;  5HVG A;  2K5T A;  2Q04 A;  2PC1 A;  2DEA A;  1XIX A;  1N71 A;  2BOA A;  4O23 A;  4TNU A;  2AFZ A;  3KR4 A;  1ON0 A;  5HXD A;  1TIQ A;  5J1Q A;  2C27 A;  3FB3 A;  1XMT A;  3H5Z A;  1UFH A;  2V8H A;  4ZX9 A;  3GLJ A;  2JDC A;  2FT0 A;  1KUV A;  1IYK A;  4B10 A;  3P2F A;  2R98 A;  3S6G A;  4PPZ A;  3FIX A;  3NH8 A;  4C2Z A;  2FXF A;  3PFO A;  1CM0 A;  1QMU A;  2J8M A;  1IGB A;  2HQY A;  1F2O A;  3D7D A;  4MHP A;  2P6G A;  4AVB A;  5KTA A;  4II9 A;  4M85 A;  2ANP A;  1PUA A;  3LD2 A;  4NSQ A;  4UCM A;  3SXN A;  4C68 A;  4OIW A;  1IIC A;  1XMB A;  2O4H A;  4PQA A;  5JH9 A;  4MFK A;  1R3N A;  3PZJ A;  4CAE A;  2EK9 A;  3QAY A;  4AG9 A;  4PK3 A;  3L2N A;  5CPA A;  3R9G A;  5H86 A;  2BCO A;  2I00 A;  1LAP A;  1M4I A;  2FE7 A;  3FVL A;  3GY9 A;  4PK2 A;  3D8P A;  3PB6 X;  1S3Z A;  4HNW B;  1B6B A;  1IY7 A;  3CZX A;  1TF9 A;  1OBR A;  1TKJ A;  4MFQ A;  4R3L A;  3DNS A;  1YME A;  4P45 A;  3PB9 X;  2B4D A;  2YGW A;  2Q7B A;  5AG4 A;  1LCP A;  4A38 A;  2JDD A;  1HDU A;  3TC8 A;  2JLM A;  4A2Z A;  1U6M A;  2C6P A;  2A4N A;  3KQZ A;  4IAV A;  2KCW A;  4KOW A;  3B8G A;  4PXE A;  3VAR A;  1Y9W A;  4Q38 A;  2GE3 A;  4EWT A;  5ELY A;  2Q7S A;  4R57 A;  3T90 A;  1M4L A;  4B13 A;  4E0A A;  5CBM A;  1IOI A;  2Z11 A;  4B6Z A;  4KOY A;  2FIA A;  1ELM P;  4FWU A;  4JLY A;  1RXT A;  3B2Y A;  4M6H A;  2Z10 A;  2DF5 A;  1I1D A;  4Q7A A;  2OOT A;  4CYO A;  5LRK A;  4NFR A;  1FNO A;  5DWM A;  1R57 A;  2HUZ A;  4WJB A;  1NSL A;  3C26 A;  3FH4 A;  3JUW A;  4QBJ A;  1MJA A;  3VH9 A;  4NGS A;  1ZG9 A;  2WPW A;  3ISZ A;  3PB8 X;  4UFW A;  4A33 A;  4CAF A;  1XJO A;  3FXT A;  3DLJ A;  3WC6 A;  4U5Y A;  2ZEM A;  5IB0 A; 
#chains in the Genus database with same CATH homology
 5BWA B;  4KLW A;  4MY0 A;  4QUS A;  2ARH A;  3BJ8 A;  3V8I A;  4CAX A;  1L0C A;  4RI1 A;  2JEV A;  1K4J A;  5A28 A;  2OU2 A;  2VEZ A;  4FD4 A;  4UFV A;  3H4Q A;  4MFJ A;  3EC4 A;  1MK4 A;  3D3S A;  4MFP A;  4F0X A;  4KUB A;  5H84 A;  1M4D A;  2REE A;  1B87 A;  4KOU A;  1KUX A;  3TO9 A;  1Q2Y A;  2O28 A;  4CGN A;  1BO4 A;  4YGO A;  4ZBG A;  2P6F A;  2FSR A;  5F49 A;  4YRH A;  3R95 A;  3W6S A;  2OZU A;  4CYQ A;  4MBU A;  5IV0 A;  2R8V A;  2PR8 A;  4C2Y A;  4CYN A;  1Q2C A;  4HKF A;  4LX9 A;  4XPL A;  2B58 A;  3G3S A;  3D2M A;  5HH1 A;  2QEC A;  1IID A;  2B5G B;  4OAD A;  2OZH A;  4MJ8 A;  5IX3 A;  4H6Z A;  3TOA A;  4JJX A;  1NMT A;  2VQY A;  4UFX A;  1V0C A;  2Z3M A;  4M3S A;  1YVO A;  2DPS A;  4Q36 A;  4X5K A;  1XF8 A;  3ZJ0 A;  4NXY A;  2PDO A;  2Q44 A;  2Q4V A;  4FD6 A;  3QAH A;  4CGO A;  1Q2D A;  2B3U A;  4OAE A;  2Z0Z A;  4HNX B;  2ZW7 A;  4KOT A;  1S5K A;  3K9U A;  1S7F A;  4A30 A;  2Z3O A;  2BL1 A;  2YND A;  3I3G A;  4IF5 A;  5I0C A;  3UY5 A;  3F0A A;  4KSF A;  3PP9 A;  4IUS A;  4JXR A;  4B5P A;  3GYA A;  2WSA A;  4CGL A;  4A95 A;  2YNE A;  1M4G A;  1I12 A;  4UWJ A;  3DDD A;  3R9F A;  2D4P A;  5G20 A;  2QIR A;  1S7L A;  2Z3N A;  3TO7 A;  2Y0M A;  2OZG A;  3R1K A;  1LRZ A;  2PSW A;  1QSO A;  3VWE A;  3N7Z A;  1XEB A;  3TCV A;  1WK4 A;  5C88 A;  4CRY B;  2HV2 A;  2VZY A;  5AG5 A;  2GIV A;  4CRZ B;  2ZW4 A;  3DSB A;  4I49 A;  2B4D B;  4NF1 A;  3A9L A;  2WUU A;  4Y49 C;  4XPD C;  4BMH A;  3IGR A;  4KOX A;  5JPH A;  4NCZ A;  3SHP A;  4KS9 A;  5GCN A;  2J8N A;  2VXK A;  1ZO0 A;  4UA3 A;  1P0H A;  4L89 A;  2P6E A;  2VBQ A;  5G1Z A;  2FIW A;  4KZT A;  1OZP A;  1WWZ A;  2VI7 A;  2CNS A;  3TOB A;  1VHS A;  3F5B A;  2PR1 A;  4QB9 A;  2B4B A;  4B11 A;  4F0Y A;  2ZPA A;  4XPD B;  3EXN A;  4CAV A;  4CGM A;  2ZW5 A;  3S6K A;  3S6F A;  2AJ6 A;  3IWG A;  1Z4E A;  4C7H A;  3TFY A;  3NE7 A;  3MGD A;  4DNC A;  4CAW A;  3DR8 A;  2R7H A;  4CGP A;  1S60 A;  4GS4 A;  4JXQ A;  5AG7 A;  4QC6 A;  3EFA A;  5AGE A;  2D4O A;  4H89 A;  4RS2 A;  1NE9 A;  1QST A;  2Q4Y A;  2PQ8 A;  4MHD A;  3T9Y A;  5F48 A;  4B5O A;  3I9S A;  2EUI A;  4ZGY B;  1M44 A;  5JQ4 A;  2OB0 A;  2I79 A;  4B12 A;  4U9Y A;  4R87 A;  1YLE A;  1I21 A;  1GHE A;  4FD7 A;  4A31 A;  5KTD A;  4BBH A;  4H6U A;  3PGP A;  2CY2 A;  2G3T A;  2VZZ A;  2ZW6 A;  2OH1 A;  2J8R A;  3FYN A;  3KKW A;  2AE6 A;  3FBU A;  3TE4 A;  4AB7 A;  4QVT A;  4AVC A;  3LOD A;  4L8A A;  2G3A A;  4MFL A;  4MI4 A;  2GAN A;  3JVN A;  4UCP A;  3S6H A;  4EVY A;  5E96 A;  1YVK A;  3P2H A;  1IB1 E;  3CXQ A;  3EY5 A;  5J8C A;  3RYO A;  4UWI A;  2BSW A;  3IU2 A;  2RC4 A;  3D2P A;  5F47 A;  1QSM A;  4KVM E;  3VWD A;  2ZXV A;  2Z3L A;  4UCN A;  4PSW A;  1SQH A;  4B5P B;  3W91 A;  5AG6 A;  2DXQ A;  4PV6 A;  1BOB A;  1J4J A;  3G8W A;  4ONU A;  2F5I A;  1KUY A;  4FD5 A;  4KVO E;  3GKR A;  2G0B A;  4C2X A;  1MJ9 A;  2EVN A;  3SXO A;  1M1D A;  2BUE A;  3EO4 A;  1VKC A;  2CNM A;  4CS0 B;  2WPX A;  1RO5 A;  2QML A;  4K30 A;  4CYP A;  3FRM A;  4B14 A;  2Z3K A;  4J3G A;  2BEI A;  1Y7R A;  3FNC A;  2Q0Y A;  4R3K A;  3CXP A;  2H5M A;  4U9Z A;  4YFJ A;  1MJB A;  2B3V A;  3OWC A;  5KTC A;  1Z9U A;  4F6A A;  5A27 A;  2FCK A;  3TT2 A;  1XE4 A;  1Y9K A;  5ISV A;  4Y49 B;  4AG7 A;  4KOS A;  4KOV A;  4UBR A;  1S7K A;  3DR6 A;  5C82 A;  5DWN A;  3QB8 A;  1QSN A;  3E0K A;  1KZF A;  4MFZ A;  2IL4 A;  3R9E A;  3BJ7 A;  2FS5 A;  4C7I A;  3TTH A;  2YNC C;  3TO6 A;  4LUA A;  3W6X A;  1YX0 A;  3IU1 A;  1YR0 A;  5EBV A;  3CXS A;  2FL4 A;  5G22 A;  2DPT A;  2YNC A;  5EC4 A;  4KLV A;  3WR7 A;  2REF A;  3R96 A;  4KOR A;  1Z4R A;  4R9M A;  2CXA A;  4E2A A;  5FVJ A;  4XNH C;  4AVA A;  4JD6 A;  3IWE A;  4ORF A;  4KSA A;  3ZZI A;  1YRE A;  4PSX A;  5F46 A;  2B5G A;  2R1I A;  2X7B A;  3JTK A;  2Z3P A;  4HNY B;  4JWP A;  1IYL A;  2NMT A;  4XPK A;  5CNP A;  3F8K A;  4NEX A;  1YGH A;  2PRB A;  4KVX A;  1FY7 A;  4XNH B;  1P4N A;  2ATR A;  1QSR A;  4E8O A;  5HMN A;  5G21 A;  2P0W A;  4MY3 A;  4OLL A;  4KUA A;  1PU9 A;  1YK3 A;  2CNT A;  5J8F A;  1S7N A;  3BLN A;  1CJW A;  2K5T A;  2Q04 A;  2PC1 A;  1XIX A;  1N71 A;  1ON0 A;  1TIQ A;  2C27 A;  3H5Z A;  3FB3 A;  1XMT A;  1UFH A;  2JDC A;  2FT0 A;  1KUV A;  1IYK A;  4B10 A;  3P2F A;  2R98 A;  3S6G A;  3FIX A;  4C2Z A;  2FXF A;  1CM0 A;  2J8M A;  2HQY A;  2P6G A;  4AVB A;  5KTA A;  4II9 A;  4M85 A;  4NSQ A;  1PUA A;  3LD2 A;  4UCM A;  3SXN A;  4C68 A;  1IIC A;  4MFK A;  3PZJ A;  4CAE A;  4AG9 A;  4PK3 A;  3R9G A;  5H86 A;  2I00 A;  1M4I A;  2FE7 A;  3GY9 A;  4PK2 A;  3D8P A;  1S3Z A;  4HNW B;  1B6B A;  4R3L A;  4MFQ A;  2Q7B A;  3DNS A;  2B4D A;  2YGW A;  5AG4 A;  2JDD A;  2JLM A;  4A2Z A;  1U6M A;  2A4N A;  4KOW A;  2KCW A;  3B8G A;  1Y9W A;  4Q38 A;  2GE3 A;  3T90 A;  4R57 A;  4E0A A;  4B13 A;  2Z11 A;  4KOY A;  2FIA A;  4JLY A;  4A32 A;  4CYO A;  1RXT A;  2Z10 A;  1I1D A;  5DWM A;  1R57 A;  2HUZ A;  1NSL A;  3C26 A;  3JUW A;  4QBJ A;  1MJA A;  2WPW A;  4UFW A;  4A33 A;  4CAF A;  5IB0 A;  3FXT A;  4U5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...