1Y9KA

Iaa acetyltransferase from bacillus cereus atcc 14579
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
152
structure length
152
Chain Sequence
MSVVIERIPKEAIPKSLLLLADPSERQIATYVQRGLTYVAKQGGSVIGVYVLLETRPKTMEIMNIAVAEHLQGKGIGKKLLRHAVETAKGYGMSKLEVGTGNSSVSQLALYQKCGFRIFSIDFDYFSKHYEEEIIENGIVCRDMIRLAMELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords IAA acetyltransferase
publication title A crystal structure of IAA acetyltransferase from Bacillus cereus
rcsb
source organism Bacillus cereus atcc 14579
total genus 36
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2004-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1y9kA01
3TO9A 3KKWA 4KOTA 3F8KA 1PUAA 1XF8A 2REFA 2HV2A 3VWDA 4XPDB 4JD6A 1IICA 1TIQA 2BUEA 5IV0A 4FD6A 4X5KA 3BJ8A 4CAXA 2B5GA 4R57A 2GIVA 4B5PB 4Y49C 4E8OA 2VQYA 1U6MA 2B5GB 4UBRA 4PSXA 3TTHA 2X7BA 2PQ8A 1YLEA 1M1DA 2DXQA 1Q2DA 1VKCA 2G0BA 4JXRA 3IWGA 4I49A 4UWJA 1YK3A 4AG7A 4R87A 4JLYA 3B8GA 4CAVA 3MGDA 3F0AA 4KVOE 2ATRA 4KOSA 3E0KA 4AVAA 3G3SA 3FYNA 3ZJ0A 1S7NA 1BOBA 4HNWB 3D2MA 4IUSA 5C88A 3TOAA 4DNCA 4CRYB 4PK3A 2K5TA 4LX9A 1QSTA 3W91A 2ZXVA 1KUYA 5I0CA 2OU2A 5FVJA 2R7HA 3FXTA 2CNTA 1VHSA 2P0WA 1YVKA 2FXFA 3S6HA 4FD4A 4AB7A 4OLLA 1B6BA 4MJ8A 5EBVA 1K4JA 5GCNA 3EXNA 1I1DA 4KORA 4KVME 3NE7A 1Q2YA 4PV6A 2JDDA 2BL1A 2CY2A 3T90A 1QSMA 2D4OA 4AVBA 1M4IA 1V0CA 2OZHA 4NXYA 4NSQA 2B58A 1FY7A 3LD2A 3W6SA 3S6KA 3S6GA 1XMTA 5F48A 3CXSA 3DR6A 2OH1A 2EUIA 1NMTA 4EVYA 1WK4A 2QMLA 4AVCA 1SQHA 2Y0MA 1Y7RA 1Y9KA 2CNSA 3DSBA 2B4DB 2J8NA 2Q7BA 2B3UA 1RO5A 4E0AA 2D4PA 5HMNA 3T9YA 2ZW4A 2P6FA 2P6EA 1MJAA 5KTCA 4KOVA 4II9A 4UA3A 2P6GA 1YGHA 1PU9A 2PR1A 3R96A 5IX3A 4HNXB 4MBUA 3JUWA 3FNCA 4B5PA 1MK4A 4RS2A 3R95A 3TO6A 2I00A 2ZW6A 2AJ6A 1YX0A 4FD5A 1S7FA 5KTAA 2FL4A 4FD7A 1Q2CA 2FE7A 3SHPA 4QB9A 4KZTA 4AG9A 4MHDA 3TCVA 4NEXA 3TOBA 4HNYB 2PC1A 3R1KA 1KUVA 3P2FA 5H84A 2B4BA 4KOYA 2Z0ZA 2Z11A 3K9UA 4H6UA 4R3LA 1KZFA 4M85A 2RC4A 2BEIA 5J8CA 1B87A 1NE9A 3DNSA 1CJWA 4MY0A 2WPXA 3FRMA 2H5MA 3W6XA 1MJBA 1P0HA 4IF5A 2Q4VA 3LODA 4ORFA 4OADA 4XNHC 4E2AA 2HUZA 1QSRA 4YFJA 2VZZA 2REEA 4JJXA 2PRBA 3DDDA 1Z9UA 1IB1E 3BLNA 2GANA 1L0CA 1UFHA 4YGOA 1R57A 4MI4A 3SXOA 3QB8A 3GY9A 2G3TA 4U9ZA 4PSWA 2Q04A 2QECA 4UWIA 4XNHB 2ZW5A 1OZPA 1RXTA 4YRHA 3IGRA 4L8AA 2OZUA 1J4JA 2F5IA 3EY5A 2C27A 4OAEA 3EFAA 3SXNA 2HQYA 4M3SA 4KUAA 3EC4A 4ONUA 4JWPA 5F47A 2Q0YA 4KLWA 4H6ZA 2QIRA 3GKRA 4NCZA 3GYAA 4CAWA 3UY5A 5IB0A 4MY3A 1KUXA 1Z4EA 2OZGA 4GS4A 1S3ZA 3I9SA 4RI1A 2VEZA 3S6FA 4KUBA 2B4DA 4KLVA 2EVNA 2WPWA 2IL4A 3WR7A 2PDOA 2AE6A 1XEBA 1YR0A 3DR8A 5DWMA 2Q4YA 3FBUA 2B3VA 2VXKA 3PZJA 5F46A 3FB3A 1YVOA 3D8PA 2VZYA 1Y9WA 5H86A 2ARHA 4XPKA 1LRZA 1MJ9A 3RYOA 3P2HA 3PP9A 4F6AA 3VWEA 4K30A 3PGPA 2ZW7A 3F5BA 4QC6A 4JXQA 5JPHA 1P4NA 2FSRA 1N71A 1S5KA 3TE4A 1IYKA 1ON0A 1BO4A 1I12A 2GE3A 4H89A 2FT0A 2OB0A 5F49A 2CNMA 1IIDA 1M4GA 4R3KA 5EC4A 3C26A 2JLMA 2PR8A 3JVNA 3QAHA 3CXQA 1Z4RA 4Y49B 4L89A 2G3AA 4HKFA 2FS5A 4R9MA 5HH1A 2O28A 2R8VA 1GHEA 4KOWA 3I3GA 1WWZA 4QUSA 2I79A 5DWNA 3D3SA 4B5OA 2PSWA 4U5YA 5ISVA 1CM0A 3TO7A 1QSNA 4CRZB 2ZPAA 2FIAA 5CNPA 4QVTA 2FCKA 5JQ4A 3CXPA 4PK2A 3H4QA 2Q44A 2FIWA 5J8FA 1M4DA 2R1IA 4J3GA 5C82A 3ZZIA 1YREA 5E96A 3TFYA 3EO4A 1S60A 3FIXA 5KTDA 1XIXA 4QBJA 3R9GA 1I21A 4KOXA 1XE4A 3V8IA 4KVXA 4U9YA 2NMTA 2JEVA 4NF1A 4LUAA 2VBQA 1S7KA 3D2PA 4CS0B 1M44A 4ZBGA 3OWCA 2J8MA 1IYLA 3G8WA 3TT2A 2R98A 2VI7A 2A4NA 1QSOA 4XPLA 4KOUA 4BMHA 4XPDC 2Z10A 2JDCA 2J8RA 3BJ7A 3R9EA 3N7ZA 2BSWA 4F0YA 3R9FA 2KCWA 1NSLA 1S7LA
chains in the Genus database with same CATH superfamily
3TO9A 3KKWA 2PIYA 3B3VA 4KOTA 7CPAA 3F8KA 1PUAA 4C2YA 1XF8A 4MHPA 3IWWA 1HEEA 2REFA 2HV2A 3VWDA 2PJ8A 4MCQA 4AXVA 2C6GA 4XPDB 4JD6A 1VHEA 1IICA 1TIQA 2BUEA 3SI1A 3KR4A 2PJ6A 3B3SA 4FD6A 4X5KA 5IV0A 3BJ8A 1Z2LA 4M6IA 4BBHA 4CAXA 2ABZA 3PEIA 1IOIA 4A32A 2BCOA 2B5GA 1BPMA 5A28A 4R57A 4EFDA 2GIVA 4B5PB 4Y49C 4E8OA 2VQYA 2PE3A 1ZLIA 3RZAA 1U6MA 2B5GB 3KZWA 2HB6A 4UBRA 2O53A 1ARMA 4PSXA 4NGMA 2X7BA 2PQ8A 3TTHA 1YLEA 2AFOA 2DEAA 1AMPA 3GLJA 1OBRA 5LRJA 4MCSA 2PJ4A 1M1DA 2V8GA 2DXQA 4ZX8A 1CPXA 1Q2DA 4IK2A 3NE8A 1VKCA 1YQEA 3NH5A 2G0BA 3WT4A 4JXRA 3IWGA 4I49A 4UCPA 4TNUA 4UWJA 1F2PA 1YK3A 3IO1A 4P4IA 4AG7A 4R87A 4JLYA 3B8GA 1ZLHA 5K8MA 4CAVA 4NFRA 4CYQA 3MGDA 3F0AA 4KVOE 5JM6A 2ATRA 3BXMA 3E0KA 4KOSA 4AVAA 5LYDA 5AGEA 2Z3NA 3G3SA 3FYNA 1Z5RA 3ZJ0A 4O23A 1S7NA 1BOBA 4HNWB 4KS9A 3D2MA 4IUSA 3MN8A 5C88A 3TOAA 3VARA 4DNCA 4CRYB 4PK3A 4MCRA 1LAPA 2K5TA 2ZEHA 3FEDA 4LX9A 6CPAA 1QSTA 4P45A 1F57A 2ZXVA 1KUYA 3W91A 5I0CA 1ZO0A 3LACA 2OU2A 1DTDA 5FVJA 2R7HA 4IAVA 8CPAA 4NGQA 4C2XA 1HDQA 5LRKA 3FXTA 1Q7LA 3VH9A 1ZG8A 2GLJA 3LMSA 2CNTA 4DYOA 1VHSA 2P0WA 4NJQA 1YVKA 4NGPA 4R7MA 3PB7X 1KWMA 2FXFA 3S6HA 3HLPA 4FD4A 1XOVA 4AB7A 4OLLA 5AG5A 1B6BA 2JBJA 4MJ8A 5EBVA 4PQAA 2Z3MA 4NGNA 1K4JA 5GCNA 3EXNA 2PJCA 1I1DA 4KORA 4KVME 3NE7A 1Q2YA 5HVGA 4PV6A 1LAMA 2JDDA 2BL1A 2CY2A 3T90A 1QSMA 2D4OA 4AVBA 2Z3PA 1M4IA 1V0CA 5J1QA 1A2ZA 1H8LA 2OZHA 2ZEFA 3PRTA 4NSQA 4NXYA 4A39A 1DE4C 2B58A 4P10A 1FY7A 2AFZA 3LD2A 3SI2A 3W6SA 4NJRA 5JGFA 2Z3OA 3S6KA 1Z8WA 1NSAA 1XMTA 3S6GA 3FEEA 2O4HA 4OMEA 2WUUA 3CXSA 5F48A 2NSMA 3DR6A 1TXRA 2OH1A 2PVVA 2EUIA 4B6ZA 5AG4A 1HDUA 1NMTA 3FJUA 1WK4A 2QMLA 4WJBA 4MFJA 4EVYA 4AVCA 2VL1A 4P6YA 4ZI6A 3QAYA 4F9VA 1SQHA 1CP6A 2Y0MA 1Y7RA 1Y9KA 2CNSA 4UIAA 3DSBA 3FX6A 2B4DB 2DF5A 2J8NA 2PJ1A 3D7DA 2Q7BA 3KL9A 1CBXA 2B3UA 4K3NA 1RO5A 4E0AA 3D66A 5THWA 4X2TA 2D4PA 4B13A 2AFSA 4HPSA 5HMNA 3T9YA 2ZELA 2ZW4A 2PVWA 3V7ZA 4M6HA 2P6FA 2P6EA 1MJAA 2GFQA 3SI0A 1ELLP 4KOVA 5KTCA 4II9A 4MMOA 4UA3A 4ZGYB 2P6GA 1YGHA 3PFOA 1PU9A 1CPSA 2YNEA 2OOTA 2PR1A 2GLFA 3R96A 5EMIA 4HNXB 5IX3A 1YSJA 2C6PA 2PJ9A 3JUWA 4MBUA 4ZY0A 3FNCA 4B5PA 4UEZA 1LOKA 4YWYA 2F7VA 1MK4A 4RS2A 2YNDA 3R95A 3TO6A 2I00A 3IU1A 2IJZA 2AJ6A 2ZW6A 5HVFA 4OIDA 2CTBA 3SJGA 1YX0A 4FD5A 1S7FA 3B3WA 5KTAA 4UFWA 2EK8A 2FL4A 2XEFA 3CDXA 4FD7A 1Q2CA 2FE7A 3SHPA 4QB9A 1Z8LA 4KZTA 4MHDA 4AG9A 4CGNA 3TCVA 4NEXA 4MHZA 1IY7A 3PB4X 3H8GA 4PXCA 3TOBA 4HNYB 1CX8A 2PC1A 2V8HA 3R1KA 1KUVA 3WC5A 2GREA 3P2FA 5H84A 1YLOA 1RTQA 1TKFA 4A31A 2B4BA 5D8NA 4KOYA 2Z0ZA 1ZG7A 2Z11A 3K9UA 5K8NA 4MFPA 4H6UA 3CPAA 4R3LA 2WSAA 2V77A 4MFLA 2ZOGA 1KZFA 4M85A 4GM5A 2RC4A 2BEIA 3CT9A 5J8CA 1B87A 4B14A 2V8VA 4KSIA 1NE9A 3GIUA 2JBKA 3DNSA 1CJWA 4MY0A 2WPXA 2Z3KA 3FRMA 5AG7A 3D68A 2H5MA 4MRIA 3RO0A 2RFHA 2BO9A 3W6XA 1EE3P 1MJBA 3T8WA 1P0HA 4IF5A 2Q4VA 3LODA 4ORFA 4OADA 1M4LA 2WYRA 4XNHC 3NFZA 1XBUA 3N5FA 4E2AA 2HUZA 4M6GA 1QSRA 2I3CA 5G1ZA 1XFOA 2REEA 2VZZA 4JJXA 2PRBA 3VATA 4YFJA 5HXDA 3DDDA 4MHYA 3RAMA 3D7HA 1Y0YA 1Z9UA 2YGWA 1IB1E 3BLNA 2GANA 1BPNA 1L0CA 1UFHA 1LANA 4YGOA 1R57A 4R76A 4MI4A 3SXOA 3QB8A 1VHOA 3GY9A 4P4JA 4Z65A 2G3TA 4U9ZA 1YMEA 2EWBA 4PSWA 3KGQA 2Q04A 2QECA 3FVLA 4P4BA 4UEFA 4UWIA 4PPZA 2ZW5A 4Q38A 4UIBA 4XNHB 1OZPA 1RXTA 4YRHA 3IGRA 5CPAA 2F5IA 2OZUA 1J4JA 2CIJA 2ZEPA 4L8AA 5LRGA 4A30A 3RBUA 4DUKA 4RUHA 4F8ZA 3EY5A 2C27A 5BWAB 4OAEA 3EFAA 2DPTA 4CPAA 3SXNA 3IIBA 4P4DA 2HQYA 4ZX9A 4WWVA 4M3SA 2XEIA 4KUAA 2ZENA 3IJ3A 5LYLA 3EC4A 4ONUA 1X12A 3BI0A 2POKA 1CG2A 4JWPA 2IMOA 5F47A 4A33A 2CXAA 4BINA 4FAIA 2Q0YA 3KR5A 4KLWA 3NA6A 4H6ZA 2QIRA 3H8EA 3GKRA 4NCZA 1FNOA 5IB9A 3KI9A 3GYAA 2XEGA 4CAWA 2AFMA 1IU8A 3DGVA 3UY5A 4NGSA 3KQXA 5K8PA 5IB0A 4MY3A 1KUXA 3K2KA 2YNCC 1YW6A 1Z4EA 5AG6A 2OZGA 4GS4A 4DJLA 2J9AA 1S3ZA 5D29A 3I9SA 4YU9A 4RI1A 2VEZA 4A94A 3S6FA 2EBJA 4KUBA 2B4DA 4KLVA 2EVNA 2WPWA 2IL4A 3B3CA 4ZY2A 4KSFA 3WR7A 2PDOA 2ZEEA 4CGOA 1BLLE 1TF8A 3JTKA 2AE6A 2YNCA 1XEBA 3SJXA 2PJ0A 1YR0A 4NGRA 3SJEA 2PJBA 3DR8A 5DWMA 4C7HA 2Q4YA 4OC5A 3FBUA 3FECA 3GB0A 2B3VA 3D4UA 3NH8A 4B10A 3HUVA 4RN7A 2VXKA 4X8IA 1PYTB 3PZJA 1VGYA 3BHXA 2PRQA 5F46A 3FB3A 1YVOA 3MRUA 4MCPA 3D8PA 4P4FA 1R43A 3SJFA 4B12A 1CP7A 4FWUA 3PB6X 2VZYA 1Y9WA 3ISZA 3FF3A 5H86A 2V8DA 2ARHA 2Z3LA 4XPKA 4FBEA 3WABA 4A2ZA 5G21A 2GU2A 4OC4A 4PXDA 1LRZA 1MJ9A 2C1CA 2EK9A 4BD9A 3FMCA 3P2HA 3RYOA 3PP9A 4G1PA 5JH9A 2QYVA 4F6AA 3S9MA 3K9TA 4UFXA 5I4MA 1QQ9A 3VWEA 2QJ8A 4K30A 3PGPA 2ZW7A 3B3TA 4UCMA 4CGPA 3F5BA 2OR4A 4QC6A 4JXQA 5JPHA 1P4NA 2FSRA 2IQ6A 1N71A 3LWUA 1S5KA 3B7IA 3TE4A 3KHZA 2CTCA 1IYKA 1ON0A 3I1UA 3IC1A 1BO4A 1TKJA 2ODFA 1I12A 2CF4A 4JZ0A 3WC6A 1YW4A 4PXEA 2PJ7A 4TWEA 2GE3A 4P4EA 3DLJA 4H89A 4R6TA 4CAFA 1GYTA 2FT0A 2AFXA 2OB0A 5F49A 4CYOA 2PJ5A 1ELMP 1F2OA 2CNMA 2XEJA 3CZXA 1AUGA 1JWQA 5HVHA 4R8FA 4UF4A 4MXUA 3QNVA 1IIDA 1QMUA 3GUXA 4A95A 1M4GA 2EO8A 4R3KA 5EC4A 1R3NA 3C26A 5DS0A 2JLMA 2PR8A 4MHNA 4KSAA 3IU2A 3JVNA 3QAHA 4OKOA 4OC3A 3WC7A 4MFKA 3PB9X 3CXQA 1Z4RA 4Y49B 4L89A 1VIXA 2ANPA 2G3AA 4HKFA 2PJAA 2FS5A 2QVPA 2PJ2A 1TF9A 2RB7A 3KQZA 4R9MA 5HH1A 2O28A 2NYQA 4C2ZA 3D67A 5LYFA 5G22A 4ZYQA 1UWYA 4UFVA 3KASA 2R8VA 3B2YA 4W9YA 1XJOA 3TC8A 1GHEA 4CAEA 4CGLA 4KOWA 3I3GA 2DPSA 4C7IA 1WWZA 1FT7A 3PFEA 4QUSA 2I79A 4OC2A 2BOAA 3BI1A 4LQ6A 5DWNA 2ZEGA 3D3SA 4B5OA 4CYNA 2F8HA 3JRUA 2PSWA 3H5ZA 4U5YA 2WZNA 4F9UA 1CM0A 3TO7A 3B35A 1QSNA 5ISVA 1X10A 1Z8TA 2ZPAA 3ISXA 2FIAA 4C68A 5CNPA 4QVTA 4CRZB 4CYPA 4PXBA 2FCKA 5JQ4A 3IFEA 3CXPA 4Q7AA 4IHMA 4PK2A 3H4QA 2Q44A 5K8OA 2FIWA 3IWEA 4NGTA 1IGBA 1M4DA 5J8FA 2R1IA 3A9LA 4J3GA 4UEEA 3ZZIA 1YREA 5C82A 2Q7SA 2ZEDA 5E96A 2PIZA 3NH4A 3TFYA 4X3RA 3EO4A 1S60A 2Q51A 2FVGA 4MFQA 3FIXA 5KTDA 4H2KA 3RNZA 4F0XA 3PBBA 2Q4ZA 3CPXA 4P44A 4A37A 1PCAA 3D7GA 2C6CA 4MFZA 1XIXA 5F09A 4QBJA 3L2NA 1I21A 4KOXA 1XE4A 3R9GA 4KVXA 3D7FA 3PBEA 3V8IA 2PJ3A 4U9YA 2NMTA 2JEVA 4NF1A 4EWTA 4LUAA 1BAVA 3H8FA 4FUUA 2JEWA 1S7KA 1IOFA 2VBQA 3D2PA 3KHXA 3PB8X 1Z8XA 2PCUA 4OIWA 4EMEA 3FH4A 1JQGA 4CS0B 1TKHA 1M44A 1XMBA 4Q36A 4ZBGA 3TX8A 1XRYA 3OWCA 2J8MA 1IYLA 1LFWA 4B11A 3G8WA 4ONWA 4OC1A 2G9DA 2R98A 2VI7A 2A4NA 3TT2A 1LCPA 4GXHA 1ARLA 1ZG9A 4OC0A 5ELYA 1QSOA 1Y7EA 2AFUA 2ZOFA 4XPLA 1AYEA 4KOUA 4JYWA 4BMHA 4XPDC 2Q43A 2Z10A 2ZEMA 1Y0RA 4UCNA 4OP4A 2JDCA 2AFWA 2J8RA 2ZEOA 3BJ7A 4LQGA 5G20A 3R9EA 5CBMA 5LYIA 3N7ZA 3S9LA 2HC9A 2BSWA 3IEHA 4CGMA 3S9NA 4A38A 4F0YA 3R9FA 5A27A 3V38A 2KCWA 1NSLA 4ZY1A 1S7LA
chains in the Genus database with same CATH topology
3TO9A 3KKWA 4KOTA 3F8KA 1PUAA 4C2YA 1XF8A 2REFA 2HV2A 3VWDA 4XPDB 4JD6A 1IICA 1TIQA 2BUEA 5IV0A 4FD6A 4X5KA 3BJ8A 4BBHA 4CAXA 4A32A 2B5GA 5A28A 4R57A 2GIVA 4B5PB 4Y49C 4E8OA 2VQYA 1U6MA 2B5GB 4UBRA 4PSXA 3TTHA 2X7BA 2PQ8A 1YLEA 1M1DA 2DXQA 1Q2DA 1VKCA 2G0BA 4JXRA 3IWGA 4I49A 4UCPA 4UWJA 1YK3A 4AG7A 4R87A 4JLYA 3B8GA 4CAVA 4CYQA 3MGDA 3F0AA 4KVOE 2ATRA 4KOSA 3E0KA 4AVAA 5AGEA 2Z3NA 3G3SA 3FYNA 3ZJ0A 1S7NA 1BOBA 4HNWB 4KS9A 3D2MA 4IUSA 5C88A 3TOAA 4DNCA 4CRYB 4PK3A 2K5TA 4LX9A 1QSTA 3W91A 2ZXVA 1KUYA 5I0CA 1ZO0A 2OU2A 5FVJA 2R7HA 4C2XA 3FXTA 2CNTA 1VHSA 2P0WA 1YVKA 2FXFA 3S6HA 4FD4A 4AB7A 4OLLA 5AG5A 1B6BA 4MJ8A 5EBVA 2Z3MA 1K4JA 5GCNA 3EXNA 1I1DA 4KORA 4KVME 3NE7A 1Q2YA 4PV6A 2JDDA 2BL1A 2CY2A 3T90A 1QSMA 2D4OA 4AVBA 2Z3PA 1M4IA 1V0CA 2OZHA 4NXYA 4NSQA 2B58A 1FY7A 3LD2A 3W6SA 2Z3OA 3S6KA 3S6GA 1XMTA 5F48A 2WUUA 3CXSA 3DR6A 2OH1A 2EUIA 5AG4A 1NMTA 4EVYA 1WK4A 2QMLA 4MFJA 4AVCA 1SQHA 2Y0MA 1Y7RA 1Y9KA 2CNSA 3DSBA 2B4DB 2J8NA 2Q7BA 2B3UA 1RO5A 4E0AA 2D4PA 4B13A 5HMNA 3T9YA 2ZW4A 2P6FA 2P6EA 1MJAA 5KTCA 4KOVA 4II9A 4UA3A 4ZGYB 2P6GA 1YGHA 1PU9A 2YNEA 2PR1A 3R96A 5IX3A 4HNXB 4MBUA 3JUWA 3FNCA 4B5PA 1MK4A 4RS2A 2YNDA 3R95A 3TO6A 2I00A 3IU1A 2ZW6A 2AJ6A 1YX0A 4FD5A 1S7FA 5KTAA 4UFWA 2FL4A 4FD7A 1Q2CA 2FE7A 3SHPA 4QB9A 4KZTA 4AG9A 4MHDA 4CGNA 3TCVA 4NEXA 3TOBA 4HNYB 2PC1A 3R1KA 1KUVA 3P2FA 5H84A 4A31A 2B4BA 4KOYA 2Z0ZA 2Z11A 3K9UA 4MFPA 4H6UA 4R3LA 2WSAA 4MFLA 1KZFA 4M85A 2RC4A 2BEIA 5J8CA 1B87A 4B14A 1NE9A 3DNSA 1CJWA 4MY0A 2WPXA 2Z3KA 3FRMA 5AG7A 2H5MA 3W6XA 1MJBA 1P0HA 4IF5A 2Q4VA 3LODA 4ORFA 4OADA 4XNHC 4E2AA 2HUZA 1QSRA 5G1ZA 2VZZA 2REEA 4YFJA 4JJXA 2PRBA 3DDDA 1Z9UA 2YGWA 1IB1E 3BLNA 2GANA 1L0CA 1UFHA 4YGOA 1R57A 4MI4A 3SXOA 3QB8A 3GY9A 2G3TA 4U9ZA 4PSWA 2Q04A 2QECA 4UWIA 4XNHB 2ZW5A 4Q38A 1OZPA 1RXTA 4YRHA 3IGRA 2F5IA 2OZUA 1J4JA 4L8AA 4A30A 3EY5A 2C27A 5BWAB 4OAEA 3EFAA 2DPTA 3SXNA 2HQYA 4M3SA 4KUAA 3EC4A 4ONUA 4A33A 4JWPA 5F47A 2CXAA 2Q0YA 4KLWA 4H6ZA 2QIRA 3GKRA 4NCZA 3GYAA 4CAWA 3UY5A 5IB0A 4MY3A 1KUXA 2YNCC 1Z4EA 5AG6A 2OZGA 4GS4A 1S3ZA 3I9SA 4RI1A 2VEZA 3S6FA 4KUBA 2B4DA 4KLVA 2EVNA 2WPWA 2IL4A 4KSFA 3WR7A 2PDOA 4CGOA 3JTKA 2AE6A 2YNCA 1XEBA 1YR0A 3DR8A 5DWMA 4C7HA 2Q4YA 3FBUA 2B3VA 4B10A 2VXKA 3PZJA 5F46A 3FB3A 1YVOA 3D8PA 4B12A 2VZYA 1Y9WA 5H86A 2ARHA 2Z3LA 4XPKA 4A2ZA 5G21A 1LRZA 1MJ9A 3RYOA 3P2HA 3PP9A 4F6AA 4UFXA 3VWEA 4K30A 3PGPA 2ZW7A 4UCMA 4CGPA 3F5BA 4QC6A 4JXQA 5JPHA 1P4NA 2FSRA 1N71A 1S5KA 3TE4A 1IYKA 1ON0A 1BO4A 1I12A 2GE3A 4H89A 4CAFA 2FT0A 2OB0A 5F49A 4CYOA 2CNMA 1IIDA 4A95A 1M4GA 4R3KA 5EC4A 3C26A 2JLMA 2PR8A 4KSAA 3IU2A 3JVNA 3QAHA 4MFKA 3CXQA 1Z4RA 4Y49B 4L89A 2G3AA 4HKFA 2FS5A 4R9MA 5HH1A 2O28A 4C2ZA 5G22A 4UFVA 2R8VA 1GHEA 4CAEA 4CGLA 4KOWA 3I3GA 2DPSA 4C7IA 1WWZA 4QUSA 2I79A 5DWNA 4CYNA 3D3SA 4B5OA 2PSWA 3H5ZA 4U5YA 5ISVA 1CM0A 3TO7A 1QSNA 4C68A 4CRZB 2ZPAA 2FIAA 5CNPA 4QVTA 4CYPA 2FCKA 5JQ4A 3CXPA 4PK2A 3H4QA 2Q44A 2FIWA 3IWEA 5J8FA 1M4DA 2R1IA 3A9LA 4J3GA 5C82A 3ZZIA 1YREA 5E96A 3TFYA 3EO4A 1S60A 4MFQA 3FIXA 5KTDA 4F0XA 4MFZA 1XIXA 4QBJA 3R9GA 1I21A 4KOXA 1XE4A 3V8IA 4KVXA 4U9YA 2NMTA 2JEVA 4NF1A 4LUAA 2VBQA 1S7KA 3D2PA 4CS0B 1M44A 4ZBGA 4Q36A 3OWCA 2J8MA 1IYLA 4B11A 3G8WA 3TT2A 2R98A 2VI7A 2A4NA 1QSOA 4XPLA 4KOUA 4BMHA 4XPDC 2Z10A 4UCNA 2JDCA 2J8RA 3BJ7A 5G20A 3R9EA 3N7ZA 2BSWA 4CGMA 4F0YA 3R9FA 5A27A 2KCWA 1NSLA 1S7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TO9 A;  3KKW A;  4KOT A;  3F8K A;  1PUA A;  1XF8 A;  2REF A;  2HV2 A;  3VWD A;  4XPD B;  4JD6 A;  1IIC A;  1TIQ A;  2BUE A;  5IV0 A;  4FD6 A;  4X5K A;  3BJ8 A;  4CAX A;  2B5G A;  4R57 A;  2GIV A;  4B5P B;  4Y49 C;  4E8O A;  2VQY A;  1U6M A;  2B5G B;  4UBR A;  4PSX A;  3TTH A;  2X7B A;  2PQ8 A;  1YLE A;  1M1D A;  2DXQ A;  1Q2D A;  1VKC A;  2G0B A;  4JXR A;  3IWG A;  4I49 A;  4UWJ A;  1YK3 A;  4AG7 A;  4R87 A;  4JLY A;  3B8G A;  4CAV A;  3MGD A;  3F0A A;  4KVO E;  2ATR A;  4KOS A;  3E0K A;  4AVA A;  3G3S A;  3FYN A;  3ZJ0 A;  1S7N A;  1BOB A;  4HNW B;  3D2M A;  4IUS A;  5C88 A;  3TOA A;  4DNC A;  4CRY B;  4PK3 A;  2K5T A;  4LX9 A;  1QST A;  3W91 A;  2ZXV A;  1KUY A;  5I0C A;  2OU2 A;  5FVJ A;  2R7H A;  3FXT A;  2CNT A;  1VHS A;  2P0W A;  1YVK A;  2FXF A;  3S6H A;  4FD4 A;  4AB7 A;  4OLL A;  1B6B A;  4MJ8 A;  5EBV A;  1K4J A;  5GCN A;  3EXN A;  1I1D A;  4KOR A;  4KVM E;  3NE7 A;  1Q2Y A;  4PV6 A;  2JDD A;  2BL1 A;  2CY2 A;  3T90 A;  1QSM A;  2D4O A;  4AVB A;  1M4I A;  1V0C A;  2OZH A;  4NXY A;  4NSQ A;  2B58 A;  1FY7 A;  3LD2 A;  3W6S A;  3S6K A;  3S6G A;  1XMT A;  5F48 A;  3CXS A;  3DR6 A;  2OH1 A;  2EUI A;  1NMT A;  4EVY A;  1WK4 A;  2QML A;  4AVC A;  1SQH A;  2Y0M A;  1Y7R A;  1Y9K A;  2CNS A;  3DSB A;  2B4D B;  2J8N A;  2Q7B A;  2B3U A;  1RO5 A;  4E0A A;  2D4P A;  5HMN A;  3T9Y A;  2ZW4 A;  2P6F A;  2P6E A;  1MJA A;  5KTC A;  4KOV A;  4II9 A;  4UA3 A;  2P6G A;  1YGH A;  1PU9 A;  2PR1 A;  3R96 A;  5IX3 A;  4HNX B;  4MBU A;  3JUW A;  3FNC A;  4B5P A;  1MK4 A;  4RS2 A;  3R95 A;  3TO6 A;  2I00 A;  2ZW6 A;  2AJ6 A;  1YX0 A;  4FD5 A;  1S7F A;  5KTA A;  2FL4 A;  4FD7 A;  1Q2C A;  2FE7 A;  3SHP A;  4QB9 A;  4KZT A;  4AG9 A;  4MHD A;  3TCV A;  4NEX A;  3TOB A;  4HNY B;  2PC1 A;  3R1K A;  1KUV A;  3P2F A;  5H84 A;  2B4B A;  4KOY A;  2Z0Z A;  2Z11 A;  3K9U A;  4H6U A;  4R3L A;  1KZF A;  4M85 A;  2RC4 A;  2BEI A;  5J8C A;  1B87 A;  1NE9 A;  3DNS A;  1CJW A;  4MY0 A;  2WPX A;  3FRM A;  2H5M A;  3W6X A;  1MJB A;  1P0H A;  4IF5 A;  2Q4V A;  3LOD A;  4ORF A;  4OAD A;  4XNH C;  4E2A A;  2HUZ A;  1QSR A;  4YFJ A;  2VZZ A;  2REE A;  4JJX A;  2PRB A;  3DDD A;  1Z9U A;  1IB1 E;  3BLN A;  2GAN A;  1L0C A;  1UFH A;  4YGO A;  1R57 A;  4MI4 A;  3SXO A;  3QB8 A;  3GY9 A;  2G3T A;  4U9Z A;  4PSW A;  2Q04 A;  2QEC A;  4UWI A;  4XNH B;  2ZW5 A;  1OZP A;  1RXT A;  4YRH A;  3IGR A;  4L8A A;  2OZU A;  1J4J A;  2F5I A;  3EY5 A;  2C27 A;  4OAE A;  3EFA A;  3SXN A;  2HQY A;  4M3S A;  4KUA A;  3EC4 A;  4ONU A;  4JWP A;  5F47 A;  2Q0Y A;  4KLW A;  4H6Z A;  2QIR A;  3GKR A;  4NCZ A;  3GYA A;  4CAW A;  3UY5 A;  5IB0 A;  4MY3 A;  1KUX A;  1Z4E A;  2OZG A;  4GS4 A;  1S3Z A;  3I9S A;  4RI1 A;  2VEZ A;  3S6F A;  4KUB A;  2B4D A;  4KLV A;  2EVN A;  2WPW A;  2IL4 A;  3WR7 A;  2PDO A;  2AE6 A;  1XEB A;  1YR0 A;  3DR8 A;  5DWM A;  2Q4Y A;  3FBU A;  2B3V A;  2VXK A;  3PZJ A;  5F46 A;  3FB3 A;  1YVO A;  3D8P A;  2VZY A;  1Y9W A;  5H86 A;  2ARH A;  4XPK A;  1LRZ A;  1MJ9 A;  3RYO A;  3P2H A;  3PP9 A;  4F6A A;  3VWE A;  4K30 A;  3PGP A;  2ZW7 A;  3F5B A;  4QC6 A;  4JXQ A;  5JPH A;  1P4N A;  2FSR A;  1N71 A;  1S5K A;  3TE4 A;  1IYK A;  1ON0 A;  1BO4 A;  1I12 A;  2GE3 A;  4H89 A;  2FT0 A;  2OB0 A;  5F49 A;  2CNM A;  1IID A;  1M4G A;  4R3K A;  5EC4 A;  3C26 A;  2JLM A;  2PR8 A;  3JVN A;  3QAH A;  3CXQ A;  1Z4R A;  4Y49 B;  4L89 A;  2G3A A;  4HKF A;  2FS5 A;  4R9M A;  5HH1 A;  2O28 A;  2R8V A;  1GHE A;  4KOW A;  3I3G A;  1WWZ A;  4QUS A;  2I79 A;  5DWN A;  3D3S A;  4B5O A;  2PSW A;  4U5Y A;  5ISV A;  1CM0 A;  3TO7 A;  1QSN A;  4CRZ B;  2ZPA A;  2FIA A;  5CNP A;  4QVT A;  2FCK A;  5JQ4 A;  3CXP A;  4PK2 A;  3H4Q A;  2Q44 A;  2FIW A;  5J8F A;  1M4D A;  2R1I A;  4J3G A;  5C82 A;  3ZZI A;  1YRE A;  5E96 A;  3TFY A;  3EO4 A;  1S60 A;  3FIX A;  5KTD A;  1XIX A;  4QBJ A;  3R9G A;  1I21 A;  4KOX A;  1XE4 A;  3V8I A;  4KVX A;  4U9Y A;  2NMT A;  2JEV A;  4NF1 A;  4LUA A;  2VBQ A;  1S7K A;  3D2P A;  4CS0 B;  1M44 A;  4ZBG A;  3OWC A;  2J8M A;  1IYL A;  3G8W A;  3TT2 A;  2R98 A;  2VI7 A;  2A4N A;  1QSO A;  4XPL A;  4KOU A;  4BMH A;  4XPD C;  2Z10 A;  2JDC A;  2J8R A;  3BJ7 A;  3R9E A;  3N7Z A;  2BSW A;  4F0Y A;  3R9F A;  2KCW A;  1NSL A;  1S7L A; 
#chains in the Genus database with same CATH topology
 3TO9 A;  3KKW A;  2PIY A;  3B3V A;  4KOT A;  7CPA A;  3F8K A;  1PUA A;  4C2Y A;  1XF8 A;  4MHP A;  3IWW A;  1HEE A;  2REF A;  2HV2 A;  3VWD A;  2PJ8 A;  4MCQ A;  4AXV A;  2C6G A;  4XPD B;  4JD6 A;  1VHE A;  1IIC A;  1TIQ A;  2BUE A;  3SI1 A;  3KR4 A;  2PJ6 A;  3B3S A;  4FD6 A;  4X5K A;  5IV0 A;  3BJ8 A;  1Z2L A;  4M6I A;  4BBH A;  4CAX A;  2ABZ A;  3PEI A;  1IOI A;  4A32 A;  2BCO A;  2B5G A;  1BPM A;  5A28 A;  4R57 A;  4EFD A;  2GIV A;  4B5P B;  4Y49 C;  4E8O A;  2VQY A;  2PE3 A;  1ZLI A;  3RZA A;  1U6M A;  2B5G B;  3KZW A;  2HB6 A;  4UBR A;  2O53 A;  1ARM A;  4PSX A;  4NGM A;  2X7B A;  2PQ8 A;  3TTH A;  1YLE A;  2AFO A;  2DEA A;  1AMP A;  3GLJ A;  1OBR A;  5LRJ A;  4MCS A;  2PJ4 A;  1M1D A;  2V8G A;  2DXQ A;  4ZX8 A;  1CPX A;  1Q2D A;  4IK2 A;  3NE8 A;  1VKC A;  1YQE A;  3NH5 A;  2G0B A;  3WT4 A;  4JXR A;  3IWG A;  4I49 A;  4UCP A;  4TNU A;  4UWJ A;  1F2P A;  1YK3 A;  3IO1 A;  4P4I A;  4AG7 A;  4R87 A;  4JLY A;  3B8G A;  1ZLH A;  5K8M A;  4CAV A;  4NFR A;  4CYQ A;  3MGD A;  3F0A A;  4KVO E;  5JM6 A;  2ATR A;  3BXM A;  3E0K A;  4KOS A;  4AVA A;  5LYD A;  5AGE A;  2Z3N A;  3G3S A;  3FYN A;  1Z5R A;  3ZJ0 A;  4O23 A;  1S7N A;  1BOB A;  4HNW B;  4KS9 A;  3D2M A;  4IUS A;  3MN8 A;  5C88 A;  3TOA A;  3VAR A;  4DNC A;  4CRY B;  4PK3 A;  4MCR A;  1LAP A;  2K5T A;  2ZEH A;  3FED A;  4LX9 A;  6CPA A;  1QST A;  4P45 A;  1F57 A;  2ZXV A;  1KUY A;  3W91 A;  5I0C A;  1ZO0 A;  3LAC A;  2OU2 A;  1DTD A;  5FVJ A;  2R7H A;  4IAV A;  8CPA A;  4NGQ A;  4C2X A;  1HDQ A;  5LRK A;  3FXT A;  1Q7L A;  3VH9 A;  1ZG8 A;  2GLJ A;  3LMS A;  2CNT A;  4DYO A;  1VHS A;  2P0W A;  4NJQ A;  1YVK A;  4NGP A;  4R7M A;  3PB7 X;  1KWM A;  2FXF A;  3S6H A;  3HLP A;  4FD4 A;  1XOV A;  4AB7 A;  4OLL A;  5AG5 A;  1B6B A;  2JBJ A;  4MJ8 A;  5EBV A;  4PQA A;  2Z3M A;  4NGN A;  1K4J A;  5GCN A;  3EXN A;  2PJC A;  1I1D A;  4KOR A;  4KVM E;  3NE7 A;  1Q2Y A;  5HVG A;  4PV6 A;  1LAM A;  2JDD A;  2BL1 A;  2CY2 A;  3T90 A;  1QSM A;  2D4O A;  4AVB A;  2Z3P A;  1M4I A;  1V0C A;  5J1Q A;  1A2Z A;  1H8L A;  2OZH A;  2ZEF A;  3PRT A;  4NSQ A;  4NXY A;  4A39 A;  1DE4 C;  2B58 A;  4P10 A;  1FY7 A;  2AFZ A;  3LD2 A;  3SI2 A;  3W6S A;  4NJR A;  5JGF A;  2Z3O A;  3S6K A;  1Z8W A;  1NSA A;  1XMT A;  3S6G A;  3FEE A;  2O4H A;  4OME A;  2WUU A;  3CXS A;  5F48 A;  2NSM A;  3DR6 A;  1TXR A;  2OH1 A;  2PVV A;  2EUI A;  4B6Z A;  5AG4 A;  1HDU A;  1NMT A;  3FJU A;  1WK4 A;  2QML A;  4WJB A;  4MFJ A;  4EVY A;  4AVC A;  2VL1 A;  4P6Y A;  4ZI6 A;  3QAY A;  4F9V A;  1SQH A;  1CP6 A;  2Y0M A;  1Y7R A;  1Y9K A;  2CNS A;  4UIA A;  3DSB A;  3FX6 A;  2B4D B;  2DF5 A;  2J8N A;  2PJ1 A;  3D7D A;  2Q7B A;  3KL9 A;  1CBX A;  2B3U A;  4K3N A;  1RO5 A;  4E0A A;  3D66 A;  5THW A;  4X2T A;  2D4P A;  4B13 A;  2AFS A;  4HPS A;  5HMN A;  3T9Y A;  2ZEL A;  2ZW4 A;  2PVW A;  3V7Z A;  4M6H A;  2P6F A;  2P6E A;  1MJA A;  2GFQ A;  3SI0 A;  1ELL P;  4KOV A;  5KTC A;  4II9 A;  4MMO A;  4UA3 A;  4ZGY B;  2P6G A;  1YGH A;  3PFO A;  1PU9 A;  1CPS A;  2YNE A;  2OOT A;  2PR1 A;  2GLF A;  3R96 A;  5EMI A;  4HNX B;  5IX3 A;  1YSJ A;  2C6P A;  2PJ9 A;  3JUW A;  4MBU A;  4ZY0 A;  3FNC A;  4B5P A;  4UEZ A;  1LOK A;  4YWY A;  2F7V A;  1MK4 A;  4RS2 A;  2YND A;  3R95 A;  3TO6 A;  2I00 A;  3IU1 A;  2IJZ A;  2AJ6 A;  2ZW6 A;  5HVF A;  4OID A;  2CTB A;  3SJG A;  1YX0 A;  4FD5 A;  1S7F A;  3B3W A;  5KTA A;  4UFW A;  2EK8 A;  2FL4 A;  2XEF A;  3CDX A;  4FD7 A;  1Q2C A;  2FE7 A;  3SHP A;  4QB9 A;  1Z8L A;  4KZT A;  4MHD A;  4AG9 A;  4CGN A;  3TCV A;  4NEX A;  4MHZ A;  1IY7 A;  3PB4 X;  3H8G A;  4PXC A;  3TOB A;  4HNY B;  1CX8 A;  2PC1 A;  2V8H A;  3R1K A;  1KUV A;  3WC5 A;  2GRE A;  3P2F A;  5H84 A;  1YLO A;  1RTQ A;  1TKF A;  4A31 A;  2B4B A;  5D8N A;  4KOY A;  2Z0Z A;  1ZG7 A;  2Z11 A;  3K9U A;  5K8N A;  4MFP A;  4H6U A;  3CPA A;  4R3L A;  2WSA A;  2V77 A;  4MFL A;  2ZOG A;  1KZF A;  4M85 A;  4GM5 A;  2RC4 A;  2BEI A;  3CT9 A;  5J8C A;  1B87 A;  4B14 A;  2V8V A;  4KSI A;  1NE9 A;  3GIU A;  2JBK A;  3DNS A;  1CJW A;  4MY0 A;  2WPX A;  2Z3K A;  3FRM A;  5AG7 A;  3D68 A;  2H5M A;  4MRI A;  3RO0 A;  2RFH A;  2BO9 A;  3W6X A;  1EE3 P;  1MJB A;  3T8W A;  1P0H A;  4IF5 A;  2Q4V A;  3LOD A;  4ORF A;  4OAD A;  1M4L A;  2WYR A;  4XNH C;  3NFZ A;  1XBU A;  3N5F A;  4E2A A;  2HUZ A;  4M6G A;  1QSR A;  2I3C A;  5G1Z A;  1XFO A;  2REE A;  2VZZ A;  4JJX A;  2PRB A;  3VAT A;  4YFJ A;  5HXD A;  3DDD A;  4MHY A;  3RAM A;  3D7H A;  1Y0Y A;  1Z9U A;  2YGW A;  1IB1 E;  3BLN A;  2GAN A;  1BPN A;  1L0C A;  1UFH A;  1LAN A;  4YGO A;  1R57 A;  4R76 A;  4MI4 A;  3SXO A;  3QB8 A;  1VHO A;  3GY9 A;  4P4J A;  4Z65 A;  2G3T A;  4U9Z A;  1YME A;  2EWB A;  4PSW A;  3KGQ A;  2Q04 A;  2QEC A;  3FVL A;  4P4B A;  4UEF A;  4UWI A;  4PPZ A;  2ZW5 A;  4Q38 A;  4UIB A;  4XNH B;  1OZP A;  1RXT A;  4YRH A;  3IGR A;  5CPA A;  2F5I A;  2OZU A;  1J4J A;  2CIJ A;  2ZEP A;  4L8A A;  5LRG A;  4A30 A;  3RBU A;  4DUK A;  4RUH A;  4F8Z A;  3EY5 A;  2C27 A;  5BWA B;  4OAE A;  3EFA A;  2DPT A;  4CPA A;  3SXN A;  3IIB A;  4P4D A;  2HQY A;  4ZX9 A;  4WWV A;  4M3S A;  2XEI A;  4KUA A;  2ZEN A;  3IJ3 A;  5LYL A;  3EC4 A;  4ONU A;  1X12 A;  3BI0 A;  2POK A;  1CG2 A;  4JWP A;  2IMO A;  5F47 A;  4A33 A;  2CXA A;  4BIN A;  4FAI A;  2Q0Y A;  3KR5 A;  4KLW A;  3NA6 A;  4H6Z A;  2QIR A;  3H8E A;  3GKR A;  4NCZ A;  1FNO A;  5IB9 A;  3KI9 A;  3GYA A;  2XEG A;  4CAW A;  2AFM A;  1IU8 A;  3DGV A;  3UY5 A;  4NGS A;  3KQX A;  5K8P A;  5IB0 A;  4MY3 A;  1KUX A;  3K2K A;  2YNC C;  1YW6 A;  1Z4E A;  5AG6 A;  2OZG A;  4GS4 A;  4DJL A;  2J9A A;  1S3Z A;  5D29 A;  3I9S A;  4YU9 A;  4RI1 A;  2VEZ A;  4A94 A;  3S6F A;  2EBJ A;  4KUB A;  2B4D A;  4KLV A;  2EVN A;  2WPW A;  2IL4 A;  3B3C A;  4ZY2 A;  4KSF A;  3WR7 A;  2PDO A;  2ZEE A;  4CGO A;  1BLL E;  1TF8 A;  3JTK A;  2AE6 A;  2YNC A;  1XEB A;  3SJX A;  2PJ0 A;  1YR0 A;  4NGR A;  3SJE A;  2PJB A;  3DR8 A;  5DWM A;  4C7H A;  2Q4Y A;  4OC5 A;  3FBU A;  3FEC A;  3GB0 A;  2B3V A;  3D4U A;  3NH8 A;  4B10 A;  3HUV A;  4RN7 A;  2VXK A;  4X8I A;  1PYT B;  3PZJ A;  1VGY A;  3BHX A;  2PRQ A;  5F46 A;  3FB3 A;  1YVO A;  3MRU A;  4MCP A;  3D8P A;  4P4F A;  1R43 A;  3SJF A;  4B12 A;  1CP7 A;  4FWU A;  3PB6 X;  2VZY A;  1Y9W A;  3ISZ A;  3FF3 A;  5H86 A;  2V8D A;  2ARH A;  2Z3L A;  4XPK A;  4FBE A;  3WAB A;  4A2Z A;  5G21 A;  2GU2 A;  4OC4 A;  4PXD A;  1LRZ A;  1MJ9 A;  2C1C A;  2EK9 A;  4BD9 A;  3FMC A;  3P2H A;  3RYO A;  3PP9 A;  4G1P A;  5JH9 A;  2QYV A;  4F6A A;  3S9M A;  3K9T A;  4UFX A;  5I4M A;  1QQ9 A;  3VWE A;  2QJ8 A;  4K30 A;  3PGP A;  2ZW7 A;  3B3T A;  4UCM A;  4CGP A;  3F5B A;  2OR4 A;  4QC6 A;  4JXQ A;  5JPH A;  1P4N A;  2FSR A;  2IQ6 A;  1N71 A;  3LWU A;  1S5K A;  3B7I A;  3TE4 A;  3KHZ A;  2CTC A;  1IYK A;  1ON0 A;  3I1U A;  3IC1 A;  1BO4 A;  1TKJ A;  2ODF A;  1I12 A;  2CF4 A;  4JZ0 A;  3WC6 A;  1YW4 A;  4PXE A;  2PJ7 A;  4TWE A;  2GE3 A;  4P4E A;  3DLJ A;  4H89 A;  4R6T A;  4CAF A;  1GYT A;  2FT0 A;  2AFX A;  2OB0 A;  5F49 A;  4CYO A;  2PJ5 A;  1ELM P;  1F2O A;  2CNM A;  2XEJ A;  3CZX A;  1AUG A;  1JWQ A;  5HVH A;  4R8F A;  4UF4 A;  4MXU A;  3QNV A;  1IID A;  1QMU A;  3GUX A;  4A95 A;  1M4G A;  2EO8 A;  4R3K A;  5EC4 A;  1R3N A;  3C26 A;  5DS0 A;  2JLM A;  2PR8 A;  4MHN A;  4KSA A;  3IU2 A;  3JVN A;  3QAH A;  4OKO A;  4OC3 A;  3WC7 A;  4MFK A;  3PB9 X;  3CXQ A;  1Z4R A;  4Y49 B;  4L89 A;  1VIX A;  2ANP A;  2G3A A;  4HKF A;  2PJA A;  2FS5 A;  2QVP A;  2PJ2 A;  1TF9 A;  2RB7 A;  3KQZ A;  4R9M A;  5HH1 A;  2O28 A;  2NYQ A;  4C2Z A;  3D67 A;  5LYF A;  5G22 A;  4ZYQ A;  1UWY A;  4UFV A;  3KAS A;  2R8V A;  3B2Y A;  4W9Y A;  1XJO A;  3TC8 A;  1GHE A;  4CAE A;  4CGL A;  4KOW A;  3I3G A;  2DPS A;  4C7I A;  1WWZ A;  1FT7 A;  3PFE A;  4QUS A;  2I79 A;  4OC2 A;  2BOA A;  3BI1 A;  4LQ6 A;  5DWN A;  2ZEG A;  3D3S A;  4B5O A;  4CYN A;  2F8H A;  3JRU A;  2PSW A;  3H5Z A;  4U5Y A;  2WZN A;  4F9U A;  1CM0 A;  3TO7 A;  3B35 A;  1QSN A;  5ISV A;  1X10 A;  1Z8T A;  2ZPA A;  3ISX A;  2FIA A;  4C68 A;  5CNP A;  4QVT A;  4CRZ B;  4CYP A;  4PXB A;  2FCK A;  5JQ4 A;  3IFE A;  3CXP A;  4Q7A A;  4IHM A;  4PK2 A;  3H4Q A;  2Q44 A;  5K8O A;  2FIW A;  3IWE A;  4NGT A;  1IGB A;  1M4D A;  5J8F A;  2R1I A;  3A9L A;  4J3G A;  4UEE A;  3ZZI A;  1YRE A;  5C82 A;  2Q7S A;  2ZED A;  5E96 A;  2PIZ A;  3NH4 A;  3TFY A;  4X3R A;  3EO4 A;  1S60 A;  2Q51 A;  2FVG A;  4MFQ A;  3FIX A;  5KTD A;  4H2K A;  3RNZ A;  4F0X A;  3PBB A;  2Q4Z A;  3CPX A;  4P44 A;  4A37 A;  1PCA A;  3D7G A;  2C6C A;  4MFZ A;  1XIX A;  5F09 A;  4QBJ A;  3L2N A;  1I21 A;  4KOX A;  1XE4 A;  3R9G A;  4KVX A;  3D7F A;  3PBE A;  3V8I A;  2PJ3 A;  4U9Y A;  2NMT A;  2JEV A;  4NF1 A;  4EWT A;  4LUA A;  1BAV A;  3H8F A;  4FUU A;  2JEW A;  1S7K A;  1IOF A;  2VBQ A;  3D2P A;  3KHX A;  3PB8 X;  1Z8X A;  2PCU A;  4OIW A;  4EME A;  3FH4 A;  1JQG A;  4CS0 B;  1TKH A;  1M44 A;  1XMB A;  4Q36 A;  4ZBG A;  3TX8 A;  1XRY A;  3OWC A;  2J8M A;  1IYL A;  1LFW A;  4B11 A;  3G8W A;  4ONW A;  4OC1 A;  2G9D A;  2R98 A;  2VI7 A;  2A4N A;  3TT2 A;  1LCP A;  4GXH A;  1ARL A;  1ZG9 A;  4OC0 A;  5ELY A;  1QSO A;  1Y7E A;  2AFU A;  2ZOF A;  4XPL A;  1AYE A;  4KOU A;  4JYW A;  4BMH A;  4XPD C;  2Q43 A;  2Z10 A;  2ZEM A;  1Y0R A;  4UCN A;  4OP4 A;  2JDC A;  2AFW A;  2J8R A;  2ZEO A;  3BJ7 A;  4LQG A;  5G20 A;  3R9E A;  5CBM A;  5LYI A;  3N7Z A;  3S9L A;  2HC9 A;  2BSW A;  3IEH A;  4CGM A;  3S9N A;  4A38 A;  4F0Y A;  3R9F A;  5A27 A;  3V38 A;  2KCW A;  1NSL A;  4ZY1 A;  1S7L A; 
#chains in the Genus database with same CATH homology
 3TO9 A;  3KKW A;  4KOT A;  3F8K A;  1PUA A;  4C2Y A;  1XF8 A;  2REF A;  2HV2 A;  3VWD A;  4XPD B;  4JD6 A;  1IIC A;  1TIQ A;  2BUE A;  5IV0 A;  4FD6 A;  4X5K A;  3BJ8 A;  4BBH A;  4CAX A;  4A32 A;  2B5G A;  5A28 A;  4R57 A;  2GIV A;  4B5P B;  4Y49 C;  4E8O A;  2VQY A;  1U6M A;  2B5G B;  4UBR A;  4PSX A;  3TTH A;  2X7B A;  2PQ8 A;  1YLE A;  1M1D A;  2DXQ A;  1Q2D A;  1VKC A;  2G0B A;  4JXR A;  3IWG A;  4I49 A;  4UCP A;  4UWJ A;  1YK3 A;  4AG7 A;  4R87 A;  4JLY A;  3B8G A;  4CAV A;  4CYQ A;  3MGD A;  3F0A A;  4KVO E;  2ATR A;  4KOS A;  3E0K A;  4AVA A;  5AGE A;  2Z3N A;  3G3S A;  3FYN A;  3ZJ0 A;  1S7N A;  1BOB A;  4HNW B;  4KS9 A;  3D2M A;  4IUS A;  5C88 A;  3TOA A;  4DNC A;  4CRY B;  4PK3 A;  2K5T A;  4LX9 A;  1QST A;  3W91 A;  2ZXV A;  1KUY A;  5I0C A;  1ZO0 A;  2OU2 A;  5FVJ A;  2R7H A;  4C2X A;  3FXT A;  2CNT A;  1VHS A;  2P0W A;  1YVK A;  2FXF A;  3S6H A;  4FD4 A;  4AB7 A;  4OLL A;  5AG5 A;  1B6B A;  4MJ8 A;  5EBV A;  2Z3M A;  1K4J A;  5GCN A;  3EXN A;  1I1D A;  4KOR A;  4KVM E;  3NE7 A;  1Q2Y A;  4PV6 A;  2JDD A;  2BL1 A;  2CY2 A;  3T90 A;  1QSM A;  2D4O A;  4AVB A;  2Z3P A;  1M4I A;  1V0C A;  2OZH A;  4NXY A;  4NSQ A;  2B58 A;  1FY7 A;  3LD2 A;  3W6S A;  2Z3O A;  3S6K A;  3S6G A;  1XMT A;  5F48 A;  2WUU A;  3CXS A;  3DR6 A;  2OH1 A;  2EUI A;  5AG4 A;  1NMT A;  4EVY A;  1WK4 A;  2QML A;  4MFJ A;  4AVC A;  1SQH A;  2Y0M A;  1Y7R A;  1Y9K A;  2CNS A;  3DSB A;  2B4D B;  2J8N A;  2Q7B A;  2B3U A;  1RO5 A;  4E0A A;  2D4P A;  4B13 A;  5HMN A;  3T9Y A;  2ZW4 A;  2P6F A;  2P6E A;  1MJA A;  5KTC A;  4KOV A;  4II9 A;  4UA3 A;  4ZGY B;  2P6G A;  1YGH A;  1PU9 A;  2YNE A;  2PR1 A;  3R96 A;  5IX3 A;  4HNX B;  4MBU A;  3JUW A;  3FNC A;  4B5P A;  1MK4 A;  4RS2 A;  2YND A;  3R95 A;  3TO6 A;  2I00 A;  3IU1 A;  2ZW6 A;  2AJ6 A;  1YX0 A;  4FD5 A;  1S7F A;  5KTA A;  4UFW A;  2FL4 A;  4FD7 A;  1Q2C A;  2FE7 A;  3SHP A;  4QB9 A;  4KZT A;  4AG9 A;  4MHD A;  4CGN A;  3TCV A;  4NEX A;  3TOB A;  4HNY B;  2PC1 A;  3R1K A;  1KUV A;  3P2F A;  5H84 A;  4A31 A;  2B4B A;  4KOY A;  2Z0Z A;  2Z11 A;  3K9U A;  4MFP A;  4H6U A;  4R3L A;  2WSA A;  4MFL A;  1KZF A;  4M85 A;  2RC4 A;  2BEI A;  5J8C A;  1B87 A;  4B14 A;  1NE9 A;  3DNS A;  1CJW A;  4MY0 A;  2WPX A;  2Z3K A;  3FRM A;  5AG7 A;  2H5M A;  3W6X A;  1MJB A;  1P0H A;  4IF5 A;  2Q4V A;  3LOD A;  4ORF A;  4OAD A;  4XNH C;  4E2A A;  2HUZ A;  1QSR A;  5G1Z A;  2VZZ A;  2REE A;  4YFJ A;  4JJX A;  2PRB A;  3DDD A;  1Z9U A;  2YGW A;  1IB1 E;  3BLN A;  2GAN A;  1L0C A;  1UFH A;  4YGO A;  1R57 A;  4MI4 A;  3SXO A;  3QB8 A;  3GY9 A;  2G3T A;  4U9Z A;  4PSW A;  2Q04 A;  2QEC A;  4UWI A;  4XNH B;  2ZW5 A;  4Q38 A;  1OZP A;  1RXT A;  4YRH A;  3IGR A;  2F5I A;  2OZU A;  1J4J A;  4L8A A;  4A30 A;  3EY5 A;  2C27 A;  5BWA B;  4OAE A;  3EFA A;  2DPT A;  3SXN A;  2HQY A;  4M3S A;  4KUA A;  3EC4 A;  4ONU A;  4A33 A;  4JWP A;  5F47 A;  2CXA A;  2Q0Y A;  4KLW A;  4H6Z A;  2QIR A;  3GKR A;  4NCZ A;  3GYA A;  4CAW A;  3UY5 A;  5IB0 A;  4MY3 A;  1KUX A;  2YNC C;  1Z4E A;  5AG6 A;  2OZG A;  4GS4 A;  1S3Z A;  3I9S A;  4RI1 A;  2VEZ A;  3S6F A;  4KUB A;  2B4D A;  4KLV A;  2EVN A;  2WPW A;  2IL4 A;  4KSF A;  3WR7 A;  2PDO A;  4CGO A;  3JTK A;  2AE6 A;  2YNC A;  1XEB A;  1YR0 A;  3DR8 A;  5DWM A;  4C7H A;  2Q4Y A;  3FBU A;  2B3V A;  4B10 A;  2VXK A;  3PZJ A;  5F46 A;  3FB3 A;  1YVO A;  3D8P A;  4B12 A;  2VZY A;  1Y9W A;  5H86 A;  2ARH A;  2Z3L A;  4XPK A;  4A2Z A;  5G21 A;  1LRZ A;  1MJ9 A;  3RYO A;  3P2H A;  3PP9 A;  4F6A A;  4UFX A;  3VWE A;  4K30 A;  3PGP A;  2ZW7 A;  4UCM A;  4CGP A;  3F5B A;  4QC6 A;  4JXQ A;  5JPH A;  1P4N A;  2FSR A;  1N71 A;  1S5K A;  3TE4 A;  1IYK A;  1ON0 A;  1BO4 A;  1I12 A;  2GE3 A;  4H89 A;  4CAF A;  2FT0 A;  2OB0 A;  5F49 A;  4CYO A;  2CNM A;  1IID A;  4A95 A;  1M4G A;  4R3K A;  5EC4 A;  3C26 A;  2JLM A;  2PR8 A;  4KSA A;  3IU2 A;  3JVN A;  3QAH A;  4MFK A;  3CXQ A;  1Z4R A;  4Y49 B;  4L89 A;  2G3A A;  4HKF A;  2FS5 A;  4R9M A;  5HH1 A;  2O28 A;  4C2Z A;  5G22 A;  4UFV A;  2R8V A;  1GHE A;  4CAE A;  4CGL A;  4KOW A;  3I3G A;  2DPS A;  4C7I A;  1WWZ A;  4QUS A;  2I79 A;  5DWN A;  4CYN A;  3D3S A;  4B5O A;  2PSW A;  3H5Z A;  4U5Y A;  5ISV A;  1CM0 A;  3TO7 A;  1QSN A;  4C68 A;  4CRZ B;  2ZPA A;  2FIA A;  5CNP A;  4QVT A;  4CYP A;  2FCK A;  5JQ4 A;  3CXP A;  4PK2 A;  3H4Q A;  2Q44 A;  2FIW A;  3IWE A;  5J8F A;  1M4D A;  2R1I A;  3A9L A;  4J3G A;  5C82 A;  3ZZI A;  1YRE A;  5E96 A;  3TFY A;  3EO4 A;  1S60 A;  4MFQ A;  3FIX A;  5KTD A;  4F0X A;  4MFZ A;  1XIX A;  4QBJ A;  3R9G A;  1I21 A;  4KOX A;  1XE4 A;  3V8I A;  4KVX A;  4U9Y A;  2NMT A;  2JEV A;  4NF1 A;  4LUA A;  2VBQ A;  1S7K A;  3D2P A;  4CS0 B;  1M44 A;  4ZBG A;  4Q36 A;  3OWC A;  2J8M A;  1IYL A;  4B11 A;  3G8W A;  3TT2 A;  2R98 A;  2VI7 A;  2A4N A;  1QSO A;  4XPL A;  4KOU A;  4BMH A;  4XPD C;  2Z10 A;  4UCN A;  2JDC A;  2J8R A;  3BJ7 A;  5G20 A;  3R9E A;  3N7Z A;  2BSW A;  4CGM A;  4F0Y A;  3R9F A;  5A27 A;  2KCW A;  1NSL A;  1S7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...