1Y9KA

Iaa acetyltransferase from bacillus cereus atcc 14579
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
152
structure length
152
Chain Sequence
b'MSVVIERIPKEAIPKSLLLLADPSERQIATYVQRGLTYVAKQGGSVIGVYVLLETRPKTMEIMNIAVAEHLQGKGIGKKLLRHAVETAKGYGMSKLEVGTGNSSVSQLALYQKCGFRIFSIDFDYFSKHYEEEIIENGIVCRDMIRLAMELN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IAA acetyltransferase
publication title A crystal structure of IAA acetyltransferase from Bacillus cereus
rcsb
source organism Bacillus cereus atcc 14579
molecule tags Transferase
total genus 36
structure length 152
sequence length 152
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.-:
pdb deposition date 2004-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1y9kA01
1B6BA 1ON0A 5KTDA 1YGHA 1GHEA 1MK4A 5CNPA 3D3SA 3TFYA 1L0CA 4M3SA 1S7LA 1B87A 2VZZA 4XPDC 4E8OA 1K4JA 5H86A 4HNYB 4XPDB 3N7ZA 1N71A 2D4PA 4B5PA 4JXQA 2ZW7A 4HNXB 1R57A 4KOYA 1YR0A 3I9SA 1XF8A 4GS4A 4NF1A 4ORFA 2Z10A 3S6KA 3T90A 3S6HA 4QB9A 1YK3A 4FD5A 5KTAA 1Q2DA 3R9GA 2HQYA 3DSBA 3H4QA 5DWMA 2PRBA 4CAXA 1VKCA 4RS2A 3SXOA 1XE4A 4UWJA 3FYNA 3JUWA 4B5OA 1NMTA 2ATRA 2DXQA 3LD2A 1SQHA 4CAWA 2OH1A 4MBUA 1YVOA 2OZUA 4KLWA 2R7HA 3B8GA 1MJ9A 5I0CA 3D8PA 4PSWA 2GE3A 2Q4YA 1M4GA 3EC4A 3EO4A 4OLLA 3TOAA 5C82A 2JLMA 3VWDA 4HKFA 4LX9A 4NCZA 4XNHC 3K9UA 4XNHB 4XPLA 3UY5A 3TOBA 2P6GA 4AVAA 5F46A 4BMHA 2VQYA 4QUSA 1FY7A 4R87A 3KKWA 4KOUA 1J4JA 4KORA 2Q0YA 1S7NA 3R1KA 2D4OA 2Q04A 4I49A 4II9A 4MY0A 4KOSA 2B5GA 4JLYA 3FXTA 3PZJA 3EXNA 4FD4A 4RI1A 4M85A 1S60A 3BLNA 5J8FA 2BL1A 2FT0A 2OZHA 1U6MA 4UBRA 4AG9A 5F47A 5F49A 1OZPA 1CJWA 1BO4A 3GYAA 4ZBGA 2ZW6A 4X5KA 4AG7A 2FCKA 2PR8A 5JQ4A 2P0WA 2QIRA 3WR7A 4YGOA 5J8CA 3TO7A 3ZZIA 2WPWA 1VHSA 2OZGA 1UFHA 4PV6A 3E0KA 3V8IA 2B3VA 4KOXA 2P6EA 5E96A 2JDCA 1WK4A 1Y7RA 4KZTA 4ONUA 1NE9A 2OB0A 2G0BA 1IIDA 2REFA 4JWPA 3G3SA 3PGPA 3F8KA 2RC4A 3CXSA 3FBUA 4PK3A 1Q2CA 3TT2A 3F0AA 2AE6A 2Z0ZA 1RXTA 1KZFA 1QSMA 1Y9WA 4J3GA 2NMTA 2IL4A 2VZYA 4KVME 4UWIA 4PK2A 2FIWA 4OAEA 3P2HA 2B58A 2JEVA 1IYLA 2ZW4A 4KOTA 3PP9A 5JPHA 4NXYA 3DDDA 4FD7A 5EBVA 3TO6A 1BOBA 2FXFA 1S3ZA 3CXQA 2HUZA 2C27A 2R1IA 2Y0MA 2Q4VA 2ZPAA 5HH1A 2G3TA 2B5GB 2OU2A 4QC6A 2QMLA 2PDOA 3TCVA 1Y9KA 2PC1A 4MI4A 3TTHA 3FNCA 1QSNA 1PU9A 4JXRA 4U9YA 5HMNA 3SHPA 3R96A 2K5TA 4R3KA 4MJ8A 2I79A 2PR1A 2PQ8A 2P6FA 3RYOA 1MJAA 1Q2YA 2G3AA 2GANA 2QECA 4L89A 4KVOE 4PSXA 3C26A 3IGRA 2J8RA 4KOVA 2REEA 4IUSA 4OADA 2CNMA 1V0CA 4YFJA 1S7KA 4L8AA 4KLVA 2HV2A 4EVYA 2A4NA 3BJ7A 1M1DA 4F0YA 3GKRA 4MY3A 3LODA 3R9FA 3T9YA 1IICA 3W6XA 5IB0A 3ZJ0A 4YRHA 4E2AA 1XEBA 4Y49C 4Y49B 2H5MA 3F5BA 1KUYA 3D2PA 1S7FA 2Z11A 2X7BA 3P2FA 5IV0A 3NE7A 5F48A 2WPXA 2BUEA 4CS0B 3MGDA 2PSWA 3D2MA 1QSTA 4U5YA 4E0AA 2KCWA 3G8WA 4R9MA 1KUVA 4CRZB 3W6SA 2FSRA 1WWZA 2VEZA 5GCNA 4QVTA 4FD6A 2B4BA 4H89A 1XIXA 2Q7BA 1P4NA 2EUIA 1I21A 2JDDA 2CNTA 4R3LA 1YVKA 1XMTA 1YLEA 4CRYB 2O28A 3S6GA 1M4IA 2I00A 1CM0A 5IX3A 1MJBA 4KUBA 2Q44A 2R98A 1IYKA 2AJ6A 4NSQA 1M4DA 3FIXA 3GY9A 1I12A 4HNWB 1Z4RA 4R57A 1LRZA 4H6UA 1YREA 1TIQA 4K30A 4KOWA 1I1DA 2CY2A 2FL4A 2FS5A 2B4DB 4U9ZA 2F5IA 4NEXA 2GIVA 4H6ZA 5C88A 2BEIA 4AVCA 4KVXA 4JD6A 4AVBA 5H84A 4XPKA 3SXNA 1P0HA 3TE4A 4CAVA 3W91A 1NSLA 4IF5A 3S6FA 1M44A 3JVNA 1IB1E 4JJXA 4UA3A 1QSRA 3VWEA 2ARHA 3QAHA 1Z4EA 2ZW5A 4DNCA 2J8MA 2BSWA 2CNSA 2B4DA 2FE7A 2ZXVA 3BJ8A 1S5KA 3EFAA 2VBQA 1KUXA 5ISVA 3R9EA 1YX0A 1Z9UA 2R8VA 1PUAA 3TO9A 2EVNA 5EC4A 4KUAA 3IWGA 2VI7A 2VXKA 3I3GA 3EY5A 3R95A 4AB7A 3OWCA 1RO5A 2FIAA 4MHDA 3QB8A 2B3UA 3FRMA 4QBJA 4B5PB 2J8NA 3CXPA 4F6AA 5KTCA 5FVJA 1QSOA 3DR6A 3FB3A 5DWNA 3DNSA 3DR8A 4LUAA
chains in the Genus database with same CATH superfamily
1B6BA 1ON0A 2YNDA 5KTDA 2QJ8A 3PBBA 1YGHA 2GLFA 4R76A 1GHEA 4DUKA 1MK4A 4OIWA 2Z3OA 4P45A 4UCNA 2ABZA 1ARMA 3D3SA 1L0CA 2O4HA 1S7LA 2EK9A 4M3SA 5CNPA 1B87A 4C68A 2VZZA 4XPDC 4E8OA 1K4JA 2AFWA 5H86A 4HNYB 4XPDB 3B3CA 3N7ZA 4IK2A 1N71A 2Z3MA 3JRUA 2D4PA 3PBEA 3HUVA 1BPNA 4GM5A 4UIBA 4B5PA 4JXQA 2NSMA 4FWUA 2DF5A 2ZW7A 4HNXB 1R57A 2AFMA 5G20A 1XFOA 2G9DA 4A31A 1X12A 1YR0A 3GB0A 4KOYA 2GFQA 3I9SA 1CPXA 4F9VA 4ONWA 5HVGA 1XF8A 4GS4A 4NF1A 4BINA 4ORFA 3IC1A 1XMBA 2Z10A 3S6KA 1TF9A 2EWBA 3T90A 3S6HA 2PJAA 4C7HA 4QB9A 1H8LA 1YK3A 4KSAA 4FD5A 5K8MA 1Q2DA 3R9GA 5KTAA 2HQYA 3DSBA 3D68A 3H4QA 3IFEA 2PRBA 5DWMA 1LAPA 4CAXA 4NJRA 2XEFA 1VKCA 3H5ZA 1Y0YA 3CPAA 4RS2A 3SXOA 4B10A 4CGLA 1XE4A 4NFRA 4UWJA 4PXCA 2PCUA 1X10A 4LQGA 3FYNA 3V38A 1PCAA 4WWVA 4CGNA 2CTBA 3JUWA 4FUUA 4B5OA 1VIXA 2IMOA 3HLPA 3N5FA 3KQZA 1NMTA 2OOTA 2ATRA 2DXQA 3LD2A 3CPXA 1SQHA 4CAWA 2OH1A 3KL9A 4YWYA 4C2YA 1FNOA 4MBUA 2POKA 2ZEFA 1YLOA 1TKJA 3PB6X 4MXUA 4ZY2A 2Q4ZA 5K8PA 1YVOA 2OZUA 3S9NA 4KLWA 3MRUA 4R8FA 3IWWA 2R7HA 4UEFA 3B8GA 1MJ9A 5I0CA 3D8PA 4PSWA 2GE3A 1CP6A 5K8NA 3RZAA 2ZEOA 2Q4YA 3RO0A 3V7ZA 1M4GA 3EC4A 4MCPA 4ZGYB 3D67A 3EO4A 4OLLA 5AG5A 7CPAA 3TOAA 5C82A 2DPTA 2JLMA 3VWDA 2EO8A 3WC7A 4NGRA 4HKFA 4LX9A 3PB8X 1IGBA 4NCZA 4M6GA 2AFZA 4XNHC 1EE3P 1JQGA 4YU9A 3K9UA 4P4EA 4XNHB 4NJQA 4CYPA 4XPLA 3UY5A 3TOBA 5LRGA 5DS0A 2P6GA 2PJ4A 4MFKA 4O23A 4PQAA 2FVGA 4AVAA 5F46A 3TX8A 3BI0A 4BMHA 2ZOGA 2GU2A 1LCPA 2VQYA 4QUSA 1FY7A 1JWQA 5HVFA 4R87A 4UEEA 3KKWA 1AMPA 1TXRA 3SJXA 4KSIA 4KOUA 1J4JA 1XOVA 4KORA 2Q0YA 1S7NA 3R1KA 2D4OA 2WSAA 2Q04A 4I49A 4II9A 4MY0A 4DYOA 3D7DA 4KOSA 3H8EA 3SI1A 2B5GA 4JLYA 5LRJA 3FXTA 5LYFA 5A27A 2DEAA 1CX8A 3KR5A 3EXNA 3PZJA 4FD4A 4RI1A 4GXHA 2V8HA 4M85A 1S60A 4FAIA 1ELMP 3BLNA 3IU2A 5J8FA 3JTKA 2BL1A 1VHOA 4UF4A 2FT0A 2OZHA 1U6MA 3B35A 3LACA 1ZLHA 4UCMA 5LYLA 4UBRA 4ZY1A 4AG9A 3NFZA 5F47A 4ZX8A 4EWTA 5JM6A 5F49A 1OZPA 2YNCC 1CJWA 4K3NA 1BO4A 2V8GA 3GYAA 4MFZA 2ZW6A 1Z5RA 3FEDA 4OC5A 4ZBGA 3FECA 4X5KA 4ZX9A 4AXVA 4C2XA 4AG7A 2Z3PA 2FCKA 2PR8A 3B3VA 3IO1A 4NGPA 3S9MA 5JQ4A 2P0WA 4Q36A 4MFJA 2QIRA 3RAMA 1Y0RA 3WR7A 2CXAA 4UIAA 2PJ5A 4CGOA 2PRQA 1CPSA 3KGQA 1A2ZA 3D4UA 4YGOA 5J8CA 3TO7A 3ZZIA 2WPWA 3IU1A 4PXDA 1VHSA 3CT9A 1ZG8A 2OZGA 1FT7A 1UFHA 4X8IA 4BBHA 1UWYA 4PV6A 3KR4A 3E0KA 3V8IA 4B6ZA 5JH9A 2B3VA 1HEEA 2Z3LA 3GLJA 2GREA 4KOXA 2C6CA 2HC9A 3T8WA 1OBRA 1XRYA 1IY7A 4P6YA 4A95A 2IJZA 2P6EA 4R7MA 5E96A 3PFOA 3TFYA 2JDCA 1WK4A 4M6HA 4X2TA 1Z8TA 1TF8A 2YNCA 1Y7RA 4KZTA 4ONUA 1NE9A 2EK8A 4PXEA 4CGPA 8CPAA 1RTQA 2OB0A 3D66A 2G0BA 1IIDA 4RUHA 3SJEA 2REFA 4JWPA 1HDUA 2Q7SA 2ZEDA 2CF4A 3G3SA 3PGPA 3F8KA 1YW4A 2HB6A 2RC4A 4P4DA 2Z3KA 3LMSA 3BI1A 3CXSA 2CTCA 1KWMA 3FBUA 3S9LA 5THWA 4PK3A 4F8ZA 5CBMA 1Q2CA 2Q43A 3F0AA 3FH4A 4P4BA 3TT2A 2ZELA 3FMCA 2ZENA 2AE6A 2Z0ZA 1RXTA 1KZFA 1DTDA 1QSMA 1Y9WA 2C6GA 2IQ6A 2JBKA 2IL4A 2NMTA 2O53A 2VZYA 3CZXA 2ZEEA 2YNEA 4KVME 4UCPA 4UWIA 4PK2A 4NGMA 2FIWA 4OAEA 4IAVA 3GIUA 3P2HA 2PJCA 4LQ6A 2B58A 2JEVA 1IYLA 2ZW4A 4KOTA 3PP9A 5JPHA 4MHNA 4NXYA 3DDDA 4C7IA 4FD7A 5EBVA 1BAVA 1BOBA 3TO6A 1Z8LA 4Z65A 2ZEGA 3QAYA 2PJ7A 2FXFA 2RFHA 4KS9A 1S3ZA 3RNZA 3NE8A 3CXQA 4M6IA 2DPSA 4UFWA 2HUZA 1BLLE 2C27A 1R43A 2PIYA 2R1IA 5J1QA 3VATA 2Y0MA 2Q4VA 2ODFA 2ZPAA 4OC1A 5AG4A 4NGQA 2YGWA 5HH1A 2AFUA 2G3TA 2ANPA 2B5GB 2OU2A 2AFSA 4MMOA 3NH4A 4QC6A 4FBEA 2ZOFA 3NA6A 2XEGA 2QMLA 2PDOA 3TCVA 1Y9KA 2PC1A 4MI4A 2XEJA 3TTHA 1NSAA 3FNCA 5IB9A 4A30A 1QSNA 1LFWA 1PU9A 4JXRA 1HDQA 2GLJA 5EMIA 4U9YA 5HMNA 2V8DA 3SHPA 2ZEHA 2PJ2A 3R96A 5F09A 2K5TA 3B2YA 3ISXA 4R3KA 2ZEPA 3WC6A 4MJ8A 2I79A 2PR1A 4P4IA 1Q7LA 5LRKA 5LYIA 2PVWA 2PQ8A 3ISZA 2P6FA 1ZG7A 3RYOA 1MJAA 2PJ9A 3PRTA 4EMEA 1Q2YA 2G3AA 2GANA 2QECA 4L89A 3FEEA 2PVVA 3SI0A 4KVOE 4PSXA 4Q7AA 3C26A 3IGRA 3PB9X 2J8RA 2CIJA 4HPSA 4KOVA 4JZ0A 1VGYA 2REEA 4IUSA 4OADA 1Z2LA 4LUAA 4OC0A 4CAEA 2CNMA 1V0CA 4CPAA 2I3CA 3KQXA 4YFJA 4TWEA 1GYTA 1S7KA 4L8AA 5CPAA 3QNVA 5D8NA 4A2ZA 3DLJA 4A32A 4KLVA 2HV2A 3SJGA 4EVYA 3NH5A 2A4NA 4A38A 4BD9A 4CYNA 3I1UA 1F2OA 3BJ7A 1M1DA 3K9TA 4F0YA 3GKRA 3VH9A 4CGMA 1R3NA 4NGNA 2AFXA 4OC4A 4KSFA 3LODA 4MY3A 2Z3NA 3A9LA 5G22A 3B3WA 5G1ZA 2C1CA 3R9FA 3T9YA 1IICA 3TC8A 3W6XA 5IB0A 3ZJ0A 3PB7X 4YRHA 3B7IA 3GUXA 4E2AA 1XEBA 4UFXA 1CP7A 4Y49C 4MCSA 2XEIA 4OMEA 4PXBA 4Y49B 2H5MA 3WABA 1AUGA 3KHXA 5LYDA 3PFEA 3F5BA 1KUYA 4MCQA 4OP4A 5AG7A 4NGSA 3D2PA 4A39A 4OIDA 1S7FA 2Z11A 2JBJA 2X7BA 2F7VA 3MN8A 3P2FA 5G21A 5IV0A 3NE7A 5F48A 1TKHA 2WPXA 2PJ0A 2OR4A 1TKFA 4H2KA 3RBUA 4TNUA 2BUEA 4R6TA 3L2NA 4CS0B 2V77A 3MGDA 2PSWA 3D2MA 1QSTA 5HXDA 3IJ3A 3KI9A 4MFLA 4U5YA 3SJFA 4E0AA 2KCWA 3G8WA 4R9MA 1KUVA 1YSJA 4CRZB 3W6SA 6CPAA 5JGFA 2J9AA 3IWEA 2FSRA 4MHZA 1WWZA 2VEZA 5GCNA 4QVTA 4FD6A 5D29A 1AYEA 2B4BA 4H89A 1XIXA 4P10A 2Q7BA 1P4NA 4A94A 3WT4A 2EUIA 3KZWA 1I21A 2JDDA 2CNTA 4MHPA 4R3LA 1YVKA 1XMTA 1YLEA 4CRYB 2O28A 3S6GA 1M4IA 2I00A 1CM0A 5IX3A 1MJBA 4KUBA 2PJ8A 2Q44A 2R98A 4F9UA 3K2KA 1IYKA 2AJ6A 1Y7EA 1LANA 3H8GA 2BO9A 3NH8A 4A33A 4NSQA 1M4DA 4WJBA 4MCRA 3FIXA 5I4MA 3GY9A 2JEWA 1I12A 1ZLIA 2NYQA 1Z4RA 2EBJA 4HNWB 4B14A 4B11A 4P4FA 1DE4C 4R57A 1VHEA 1XJOA 1LRZA 5AGEA 1LOKA 1ZG9A 2PJ6A 1ZO0A 2WYRA 4H6UA 1YREA 1TIQA 4G1PA 4UFVA 4C2ZA 4K30A 4W9YA 4KOWA 1IU8A 3IIBA 1CG2A 1Z8WA 4MHYA 1I1DA 4MRIA 3IEHA 5HVHA 2BOAA 5ELYA 1QMUA 2CY2A 4MFQA 2FL4A 3LWUA 4F0XA 3D7GA 2FS5A 4OC3A 2B4DB 4RN7A 4U9ZA 2F5IA 4NEXA 3CDXA 3FF3A 2GIVA 3PEIA 4H6ZA 5C88A 4ZY0A 4P44A 2BEIA 1IOIA 4CYOA 4AVCA 2QYVA 1QQ9A 4KVXA 4JD6A 4AVBA 4JYWA 5H84A 4XPKA 3SXNA 1P0HA 2ZEMA 2PJ3A 3SI2A 3WC5A 3TE4A 2VL1A 4CAVA 3W91A 3B3TA 4B12A 5AG6A 1XBUA 1NSLA 1F57A 4IF5A 1Z8XA 3S6FA 1M44A 3JVNA 1IB1E 4JJXA 4UA3A 1QSRA 2PIZA 3VWEA 3VARA 4ZI6A 4UEZA 2ARHA 4J3GA 4Q38A 3QAHA 5K8OA 4EFDA 1Z4EA 3H8FA 2WUUA 2ZW5A 4DNCA 2J8MA 4MFPA 2PE3A 2V8VA 1CBXA 2BSWA 2CNSA 3D7FA 3FVLA 4OKOA 4CAFA 3BXMA 2B4DA 2FE7A 2ZXVA 3BJ8A 1BPMA 1S5KA 2QVPA 3EFAA 2VBQA 3KHZA 2PJBA 1KUXA 4B13A 3R9EA 5ISVA 1YX0A 1Z9UA 2C6PA 2R8VA 4P4JA 1PUAA 1PYTB 2AFOA 4ZYQA 5BWAB 3KASA 3TO9A 2EVNA 5EC4A 4KUAA 3B3SA 4A37A 1M4LA 1ELLP 4IHMA 4NGTA 4OC2A 3IWGA 2VI7A 2VXKA 4DJLA 3I3GA 3EY5A 1LAMA 3R95A 4AB7A 5A28A 3OWCA 1RO5A 2PJ1A 2FIAA 3FX6A 4MHDA 1YMEA 1ARLA 3QB8A 2B3UA 3FJUA 3FRMA 4QBJA 1YW6A 2J8NA 3CXPA 4B5PB 4F6AA 3BHXA 5KTCA 2BCOA 1QSOA 3DR6A 2F8HA 2RB7A 5FVJA 3DGVA 3D7HA 1YQEA 3FB3A 5DWNA 1IOFA 4PPZA 2Q51A 4CYQA 3DNSA 3PB4X 4X3RA 2WZNA 3DR8A 1F2PA
chains in the Genus database with same CATH topology
1B6BA 1ON0A 2YNDA 5KTDA 1YGHA 1GHEA 1MK4A 2Z3OA 4UCNA 5CNPA 3D3SA 4C68A 1L0CA 4M3SA 1S7LA 3TFYA 1B87A 2VZZA 4XPDC 4E8OA 1K4JA 5H86A 4HNYB 4XPDB 3N7ZA 1N71A 2Z3MA 2D4PA 4B5PA 4JXQA 2ZW7A 4HNXB 1R57A 5G20A 4A31A 4KOYA 1YR0A 3I9SA 1XF8A 4GS4A 4NF1A 4ORFA 2Z10A 3S6KA 3T90A 3S6HA 4C7HA 4QB9A 1YK3A 4KSAA 4FD5A 5KTAA 1Q2DA 3R9GA 2HQYA 3DSBA 3H4QA 5DWMA 2PRBA 4CAXA 1VKCA 3H5ZA 4RS2A 3SXOA 4B10A 4CGLA 1XE4A 4UWJA 3FYNA 4CGNA 3JUWA 4B5OA 1NMTA 2ATRA 2DXQA 3LD2A 1SQHA 4CAWA 2OH1A 4C2YA 4MBUA 1YVOA 2OZUA 4KLWA 2R7HA 3B8GA 1MJ9A 5I0CA 3D8PA 4PSWA 2GE3A 2Q4YA 1M4GA 3EC4A 4ZGYB 3EO4A 4OLLA 5AG5A 3TOAA 5C82A 2DPTA 2JLMA 3VWDA 4HKFA 4LX9A 4NCZA 4XNHC 3K9UA 4XNHB 4CYPA 4XPLA 3UY5A 3TOBA 2P6GA 4MFKA 4AVAA 5F46A 4BMHA 2VQYA 4QUSA 1FY7A 4R87A 3KKWA 4KOUA 1J4JA 4KORA 2Q0YA 1S7NA 3R1KA 2WSAA 2D4OA 2Q04A 4I49A 4II9A 4MY0A 4KOSA 2B5GA 4JLYA 3FXTA 5A27A 3PZJA 3EXNA 4FD4A 4RI1A 4M85A 1S60A 3BLNA 3IU2A 5J8FA 3JTKA 2BL1A 2FT0A 2OZHA 1U6MA 4UCMA 4UBRA 4AG9A 5F47A 5F49A 1OZPA 2YNCC 1CJWA 4MFZA 1BO4A 3GYAA 4ZBGA 2ZW6A 4X5KA 4C2XA 4AG7A 2Z3PA 2FCKA 2PR8A 5JQ4A 2P0WA 4Q36A 4MFJA 2QIRA 3WR7A 2CXAA 4CGOA 4YGOA 5J8CA 3TO7A 3ZZIA 2WPWA 3IU1A 1VHSA 2OZGA 1UFHA 4BBHA 4PV6A 3E0KA 3V8IA 2B3VA 2Z3LA 4KOXA 4A95A 2P6EA 5E96A 2JDCA 1WK4A 2YNCA 1Y7RA 4KZTA 4ONUA 1NE9A 4CGPA 2OB0A 2G0BA 1IIDA 2REFA 4JWPA 3G3SA 3PGPA 3F8KA 2RC4A 2Z3KA 3CXSA 3FBUA 4PK3A 1Q2CA 3TT2A 3F0AA 2AE6A 2Z0ZA 1RXTA 1KZFA 1QSMA 1Y9WA 4J3GA 2NMTA 4CAEA 2IL4A 2VZYA 4KVME 2YNEA 4UCPA 4UWIA 4PK2A 2FIWA 4OAEA 3P2HA 2B58A 2JEVA 1IYLA 2ZW4A 4KOTA 3PP9A 5JPHA 4NXYA 3DDDA 4C7IA 4FD7A 5EBVA 3TO6A 1BOBA 2FXFA 4KS9A 1S3ZA 3CXQA 2DPSA 4UFWA 2HUZA 2C27A 2R1IA 2Y0MA 2Q4VA 2ZPAA 5AG4A 5HH1A 2YGWA 2G3TA 2B5GB 2OU2A 4QC6A 2QMLA 2PDOA 3TCVA 1Y9KA 2PC1A 4MI4A 3TTHA 3FNCA 4A30A 1QSNA 1PU9A 4JXRA 4U9YA 5HMNA 3SHPA 3R96A 2K5TA 4R3KA 4MJ8A 2I79A 2PR1A 2PQ8A 2P6FA 3RYOA 1MJAA 1Q2YA 2G3AA 2GANA 2QECA 4L89A 4KVOE 4PSXA 3C26A 3IGRA 2J8RA 4KOVA 2REEA 4IUSA 4OADA 2CNMA 1V0CA 4YFJA 1S7KA 4L8AA 4A2ZA 4A32A 4KLVA 2HV2A 4EVYA 2A4NA 4CYNA 3BJ7A 1M1DA 4F0YA 3GKRA 4CGMA 4KSFA 3LODA 4MY3A 2Z3NA 3A9LA 5G22A 5G1ZA 3R9FA 3T9YA 1IICA 3W6XA 5IB0A 3ZJ0A 4YRHA 4E2AA 1XEBA 4UFXA 4Y49C 4Y49B 2H5MA 3F5BA 1KUYA 5AG7A 3D2PA 1S7FA 2Z11A 2X7BA 3P2FA 5G21A 5IV0A 3NE7A 5F48A 2WPXA 2BUEA 4CS0B 3MGDA 2PSWA 3D2MA 1QSTA 4MFLA 4U5YA 4E0AA 2KCWA 3G8WA 4R9MA 1KUVA 4CRZB 3W6SA 3IWEA 2FSRA 1WWZA 2VEZA 5GCNA 4QVTA 4FD6A 2B4BA 4H89A 1XIXA 2Q7BA 1P4NA 2EUIA 1I21A 2JDDA 2CNTA 4R3LA 1YVKA 1XMTA 1YLEA 4CRYB 2O28A 3S6GA 1M4IA 2I00A 1CM0A 5IX3A 1MJBA 4KUBA 2Q44A 2R98A 1IYKA 2AJ6A 4A33A 4NSQA 1M4DA 3FIXA 3GY9A 1I12A 4B14A 4HNWB 1Z4RA 4B11A 4R57A 1LRZA 5AGEA 4H6UA 4C2ZA 1ZO0A 4UFVA 1YREA 1TIQA 4K30A 4KOWA 1I1DA 2CY2A 4MFQA 2FL4A 4F0XA 2FS5A 2B4DB 4U9ZA 2F5IA 4NEXA 2GIVA 4H6ZA 5C88A 2BEIA 4CYOA 4AVCA 4KVXA 4JD6A 4AVBA 5H84A 4XPKA 3SXNA 1P0HA 3TE4A 4CAVA 3W91A 4B12A 5AG6A 1NSLA 4IF5A 3S6FA 1M44A 3JVNA 1IB1E 4JJXA 4UA3A 1QSRA 3VWEA 2ARHA 4Q38A 3QAHA 1Z4EA 2WUUA 2ZW5A 4DNCA 2J8MA 4MFPA 2BSWA 2CNSA 4CAFA 2B4DA 2FE7A 2ZXVA 3BJ8A 1S5KA 3EFAA 2VBQA 1KUXA 4B13A 3R9EA 5ISVA 1YX0A 1Z9UA 2R8VA 1PUAA 5BWAB 3TO9A 2EVNA 5EC4A 4KUAA 3IWGA 2VI7A 2VXKA 3I3GA 3EY5A 3R95A 4AB7A 5A28A 3OWCA 1RO5A 2FIAA 4MHDA 3QB8A 2B3UA 3FRMA 4QBJA 4B5PB 2J8NA 3CXPA 4F6AA 5KTCA 5FVJA 1QSOA 3DR6A 3FB3A 5DWNA 4CYQA 3DNSA 3DR8A 4LUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B6B A;  1ON0 A;  5KTD A;  1YGH A;  1GHE A;  1MK4 A;  5CNP A;  3D3S A;  3TFY A;  1L0C A;  4M3S A;  1S7L A;  1B87 A;  2VZZ A;  4XPD C;  4E8O A;  1K4J A;  5H86 A;  4HNY B;  4XPD B;  3N7Z A;  1N71 A;  2D4P A;  4B5P A;  4JXQ A;  2ZW7 A;  4HNX B;  1R57 A;  4KOY A;  1YR0 A;  3I9S A;  1XF8 A;  4GS4 A;  4NF1 A;  4ORF A;  2Z10 A;  3S6K A;  3T90 A;  3S6H A;  4QB9 A;  1YK3 A;  4FD5 A;  5KTA A;  1Q2D A;  3R9G A;  2HQY A;  3DSB A;  3H4Q A;  5DWM A;  2PRB A;  4CAX A;  1VKC A;  4RS2 A;  3SXO A;  1XE4 A;  4UWJ A;  3FYN A;  3JUW A;  4B5O A;  1NMT A;  2ATR A;  2DXQ A;  3LD2 A;  1SQH A;  4CAW A;  2OH1 A;  4MBU A;  1YVO A;  2OZU A;  4KLW A;  2R7H A;  3B8G A;  1MJ9 A;  5I0C A;  3D8P A;  4PSW A;  2GE3 A;  2Q4Y A;  1M4G A;  3EC4 A;  3EO4 A;  4OLL A;  3TOA A;  5C82 A;  2JLM A;  3VWD A;  4HKF A;  4LX9 A;  4NCZ A;  4XNH C;  3K9U A;  4XNH B;  4XPL A;  3UY5 A;  3TOB A;  2P6G A;  4AVA A;  5F46 A;  4BMH A;  2VQY A;  4QUS A;  1FY7 A;  4R87 A;  3KKW A;  4KOU A;  1J4J A;  4KOR A;  2Q0Y A;  1S7N A;  3R1K A;  2D4O A;  2Q04 A;  4I49 A;  4II9 A;  4MY0 A;  4KOS A;  2B5G A;  4JLY A;  3FXT A;  3PZJ A;  3EXN A;  4FD4 A;  4RI1 A;  4M85 A;  1S60 A;  3BLN A;  5J8F A;  2BL1 A;  2FT0 A;  2OZH A;  1U6M A;  4UBR A;  4AG9 A;  5F47 A;  5F49 A;  1OZP A;  1CJW A;  1BO4 A;  3GYA A;  4ZBG A;  2ZW6 A;  4X5K A;  4AG7 A;  2FCK A;  2PR8 A;  5JQ4 A;  2P0W A;  2QIR A;  3WR7 A;  4YGO A;  5J8C A;  3TO7 A;  3ZZI A;  2WPW A;  1VHS A;  2OZG A;  1UFH A;  4PV6 A;  3E0K A;  3V8I A;  2B3V A;  4KOX A;  2P6E A;  5E96 A;  2JDC A;  1WK4 A;  1Y7R A;  4KZT A;  4ONU A;  1NE9 A;  2OB0 A;  2G0B A;  1IID A;  2REF A;  4JWP A;  3G3S A;  3PGP A;  3F8K A;  2RC4 A;  3CXS A;  3FBU A;  4PK3 A;  1Q2C A;  3TT2 A;  3F0A A;  2AE6 A;  2Z0Z A;  1RXT A;  1KZF A;  1QSM A;  1Y9W A;  4J3G A;  2NMT A;  2IL4 A;  2VZY A;  4KVM E;  4UWI A;  4PK2 A;  2FIW A;  4OAE A;  3P2H A;  2B58 A;  2JEV A;  1IYL A;  2ZW4 A;  4KOT A;  3PP9 A;  5JPH A;  4NXY A;  3DDD A;  4FD7 A;  5EBV A;  3TO6 A;  1BOB A;  2FXF A;  1S3Z A;  3CXQ A;  2HUZ A;  2C27 A;  2R1I A;  2Y0M A;  2Q4V A;  2ZPA A;  5HH1 A;  2G3T A;  2B5G B;  2OU2 A;  4QC6 A;  2QML A;  2PDO A;  3TCV A;  1Y9K A;  2PC1 A;  4MI4 A;  3TTH A;  3FNC A;  1QSN A;  1PU9 A;  4JXR A;  4U9Y A;  5HMN A;  3SHP A;  3R96 A;  2K5T A;  4R3K A;  4MJ8 A;  2I79 A;  2PR1 A;  2PQ8 A;  2P6F A;  3RYO A;  1MJA A;  1Q2Y A;  2G3A A;  2GAN A;  2QEC A;  4L89 A;  4KVO E;  4PSX A;  3C26 A;  3IGR A;  2J8R A;  4KOV A;  2REE A;  4IUS A;  4OAD A;  2CNM A;  1V0C A;  4YFJ A;  1S7K A;  4L8A A;  4KLV A;  2HV2 A;  4EVY A;  2A4N A;  3BJ7 A;  1M1D A;  4F0Y A;  3GKR A;  4MY3 A;  3LOD A;  3R9F A;  3T9Y A;  1IIC A;  3W6X A;  5IB0 A;  3ZJ0 A;  4YRH A;  4E2A A;  1XEB A;  4Y49 C;  4Y49 B;  2H5M A;  3F5B A;  1KUY A;  3D2P A;  1S7F A;  2Z11 A;  2X7B A;  3P2F A;  5IV0 A;  3NE7 A;  5F48 A;  2WPX A;  2BUE A;  4CS0 B;  3MGD A;  2PSW A;  3D2M A;  1QST A;  4U5Y A;  4E0A A;  2KCW A;  3G8W A;  4R9M A;  1KUV A;  4CRZ B;  3W6S A;  2FSR A;  1WWZ A;  2VEZ A;  5GCN A;  4QVT A;  4FD6 A;  2B4B A;  4H89 A;  1XIX A;  2Q7B A;  1P4N A;  2EUI A;  1I21 A;  2JDD A;  2CNT A;  4R3L A;  1YVK A;  1XMT A;  1YLE A;  4CRY B;  2O28 A;  3S6G A;  1M4I A;  2I00 A;  1CM0 A;  5IX3 A;  1MJB A;  4KUB A;  2Q44 A;  2R98 A;  1IYK A;  2AJ6 A;  4NSQ A;  1M4D A;  3FIX A;  3GY9 A;  1I12 A;  4HNW B;  1Z4R A;  4R57 A;  1LRZ A;  4H6U A;  1YRE A;  1TIQ A;  4K30 A;  4KOW A;  1I1D A;  2CY2 A;  2FL4 A;  2FS5 A;  2B4D B;  4U9Z A;  2F5I A;  4NEX A;  2GIV A;  4H6Z A;  5C88 A;  2BEI A;  4AVC A;  4KVX A;  4JD6 A;  4AVB A;  5H84 A;  4XPK A;  3SXN A;  1P0H A;  3TE4 A;  4CAV A;  3W91 A;  1NSL A;  4IF5 A;  3S6F A;  1M44 A;  3JVN A;  1IB1 E;  4JJX A;  4UA3 A;  1QSR A;  3VWE A;  2ARH A;  3QAH A;  1Z4E A;  2ZW5 A;  4DNC A;  2J8M A;  2BSW A;  2CNS A;  2B4D A;  2FE7 A;  2ZXV A;  3BJ8 A;  1S5K A;  3EFA A;  2VBQ A;  1KUX A;  5ISV A;  3R9E A;  1YX0 A;  1Z9U A;  2R8V A;  1PUA A;  3TO9 A;  2EVN A;  5EC4 A;  4KUA A;  3IWG A;  2VI7 A;  2VXK A;  3I3G A;  3EY5 A;  3R95 A;  4AB7 A;  3OWC A;  1RO5 A;  2FIA A;  4MHD A;  3QB8 A;  2B3U A;  3FRM A;  4QBJ A;  4B5P B;  2J8N A;  3CXP A;  4F6A A;  5KTC A;  5FVJ A;  1QSO A;  3DR6 A;  3FB3 A;  5DWN A;  3DNS A;  3DR8 A;  4LUA A; 
#chains in the Genus database with same CATH topology
 1B6B A;  1ON0 A;  2YND A;  5KTD A;  2QJ8 A;  3PBB A;  1YGH A;  2GLF A;  4R76 A;  1GHE A;  4DUK A;  1MK4 A;  4OIW A;  2Z3O A;  4P45 A;  4UCN A;  2ABZ A;  1ARM A;  3D3S A;  1L0C A;  2O4H A;  1S7L A;  2EK9 A;  4M3S A;  5CNP A;  1B87 A;  4C68 A;  2VZZ A;  4XPD C;  4E8O A;  1K4J A;  2AFW A;  5H86 A;  4HNY B;  4XPD B;  3B3C A;  3N7Z A;  4IK2 A;  1N71 A;  2Z3M A;  3JRU A;  2D4P A;  3PBE A;  3HUV A;  1BPN A;  4GM5 A;  4UIB A;  4B5P A;  4JXQ A;  2NSM A;  4FWU A;  2DF5 A;  2ZW7 A;  4HNX B;  1R57 A;  2AFM A;  5G20 A;  1XFO A;  2G9D A;  4A31 A;  1X12 A;  1YR0 A;  3GB0 A;  4KOY A;  2GFQ A;  3I9S A;  1CPX A;  4F9V A;  4ONW A;  5HVG A;  1XF8 A;  4GS4 A;  4NF1 A;  4BIN A;  4ORF A;  3IC1 A;  1XMB A;  2Z10 A;  3S6K A;  1TF9 A;  2EWB A;  3T90 A;  3S6H A;  2PJA A;  4C7H A;  4QB9 A;  1H8L A;  1YK3 A;  4KSA A;  4FD5 A;  5K8M A;  1Q2D A;  3R9G A;  5KTA A;  2HQY A;  3DSB A;  3D68 A;  3H4Q A;  3IFE A;  2PRB A;  5DWM A;  1LAP A;  4CAX A;  4NJR A;  2XEF A;  1VKC A;  3H5Z A;  1Y0Y A;  3CPA A;  4RS2 A;  3SXO A;  4B10 A;  4CGL A;  1XE4 A;  4NFR A;  4UWJ A;  4PXC A;  2PCU A;  1X10 A;  4LQG A;  3FYN A;  3V38 A;  1PCA A;  4WWV A;  4CGN A;  2CTB A;  3JUW A;  4FUU A;  4B5O A;  1VIX A;  2IMO A;  3HLP A;  3N5F A;  3KQZ A;  1NMT A;  2OOT A;  2ATR A;  2DXQ A;  3LD2 A;  3CPX A;  1SQH A;  4CAW A;  2OH1 A;  3KL9 A;  4YWY A;  4C2Y A;  1FNO A;  4MBU A;  2POK A;  2ZEF A;  1YLO A;  1TKJ A;  3PB6 X;  4MXU A;  4ZY2 A;  2Q4Z A;  5K8P A;  1YVO A;  2OZU A;  3S9N A;  4KLW A;  3MRU A;  4R8F A;  3IWW A;  2R7H A;  4UEF A;  3B8G A;  1MJ9 A;  5I0C A;  3D8P A;  4PSW A;  2GE3 A;  1CP6 A;  5K8N A;  3RZA A;  2ZEO A;  2Q4Y A;  3RO0 A;  3V7Z A;  1M4G A;  3EC4 A;  4MCP A;  4ZGY B;  3D67 A;  3EO4 A;  4OLL A;  5AG5 A;  7CPA A;  3TOA A;  5C82 A;  2DPT A;  2JLM A;  3VWD A;  2EO8 A;  3WC7 A;  4NGR A;  4HKF A;  4LX9 A;  3PB8 X;  1IGB A;  4NCZ A;  4M6G A;  2AFZ A;  4XNH C;  1EE3 P;  1JQG A;  4YU9 A;  3K9U A;  4P4E A;  4XNH B;  4NJQ A;  4CYP A;  4XPL A;  3UY5 A;  3TOB A;  5LRG A;  5DS0 A;  2P6G A;  2PJ4 A;  4MFK A;  4O23 A;  4PQA A;  2FVG A;  4AVA A;  5F46 A;  3TX8 A;  3BI0 A;  4BMH A;  2ZOG A;  2GU2 A;  1LCP A;  2VQY A;  4QUS A;  1FY7 A;  1JWQ A;  5HVF A;  4R87 A;  4UEE A;  3KKW A;  1AMP A;  1TXR A;  3SJX A;  4KSI A;  4KOU A;  1J4J A;  1XOV A;  4KOR A;  2Q0Y A;  1S7N A;  3R1K A;  2D4O A;  2WSA A;  2Q04 A;  4I49 A;  4II9 A;  4MY0 A;  4DYO A;  3D7D A;  4KOS A;  3H8E A;  3SI1 A;  2B5G A;  4JLY A;  5LRJ A;  3FXT A;  5LYF A;  5A27 A;  2DEA A;  1CX8 A;  3KR5 A;  3EXN A;  3PZJ A;  4FD4 A;  4RI1 A;  4GXH A;  2V8H A;  4M85 A;  1S60 A;  4FAI A;  1ELM P;  3BLN A;  3IU2 A;  5J8F A;  3JTK A;  2BL1 A;  1VHO A;  4UF4 A;  2FT0 A;  2OZH A;  1U6M A;  3B35 A;  3LAC A;  1ZLH A;  4UCM A;  5LYL A;  4UBR A;  4ZY1 A;  4AG9 A;  3NFZ A;  5F47 A;  4ZX8 A;  4EWT A;  5JM6 A;  5F49 A;  1OZP A;  2YNC C;  1CJW A;  4K3N A;  1BO4 A;  2V8G A;  3GYA A;  4MFZ A;  2ZW6 A;  1Z5R A;  3FED A;  4OC5 A;  4ZBG A;  3FEC A;  4X5K A;  4ZX9 A;  4AXV A;  4C2X A;  4AG7 A;  2Z3P A;  2FCK A;  2PR8 A;  3B3V A;  3IO1 A;  4NGP A;  3S9M A;  5JQ4 A;  2P0W A;  4Q36 A;  4MFJ A;  2QIR A;  3RAM A;  1Y0R A;  3WR7 A;  2CXA A;  4UIA A;  2PJ5 A;  4CGO A;  2PRQ A;  1CPS A;  3KGQ A;  1A2Z A;  3D4U A;  4YGO A;  5J8C A;  3TO7 A;  3ZZI A;  2WPW A;  3IU1 A;  4PXD A;  1VHS A;  3CT9 A;  1ZG8 A;  2OZG A;  1FT7 A;  1UFH A;  4X8I A;  4BBH A;  1UWY A;  4PV6 A;  3KR4 A;  3E0K A;  3V8I A;  4B6Z A;  5JH9 A;  2B3V A;  1HEE A;  2Z3L A;  3GLJ A;  2GRE A;  4KOX A;  2C6C A;  2HC9 A;  3T8W A;  1OBR A;  1XRY A;  1IY7 A;  4P6Y A;  4A95 A;  2IJZ A;  2P6E A;  4R7M A;  5E96 A;  3PFO A;  3TFY A;  2JDC A;  1WK4 A;  4M6H A;  4X2T A;  1Z8T A;  1TF8 A;  2YNC A;  1Y7R A;  4KZT A;  4ONU A;  1NE9 A;  2EK8 A;  4PXE A;  4CGP A;  8CPA A;  1RTQ A;  2OB0 A;  3D66 A;  2G0B A;  1IID A;  4RUH A;  3SJE A;  2REF A;  4JWP A;  1HDU A;  2Q7S A;  2ZED A;  2CF4 A;  3G3S A;  3PGP A;  3F8K A;  1YW4 A;  2HB6 A;  2RC4 A;  4P4D A;  2Z3K A;  3LMS A;  3BI1 A;  3CXS A;  2CTC A;  1KWM A;  3FBU A;  3S9L A;  5THW A;  4PK3 A;  4F8Z A;  5CBM A;  1Q2C A;  2Q43 A;  3F0A A;  3FH4 A;  4P4B A;  3TT2 A;  2ZEL A;  3FMC A;  2ZEN A;  2AE6 A;  2Z0Z A;  1RXT A;  1KZF A;  1DTD A;  1QSM A;  1Y9W A;  2C6G A;  2IQ6 A;  2JBK A;  2IL4 A;  2NMT A;  2O53 A;  2VZY A;  3CZX A;  2ZEE A;  2YNE A;  4KVM E;  4UCP A;  4UWI A;  4PK2 A;  4NGM A;  2FIW A;  4OAE A;  4IAV A;  3GIU A;  3P2H A;  2PJC A;  4LQ6 A;  2B58 A;  2JEV A;  1IYL A;  2ZW4 A;  4KOT A;  3PP9 A;  5JPH A;  4MHN A;  4NXY A;  3DDD A;  4C7I A;  4FD7 A;  5EBV A;  1BAV A;  1BOB A;  3TO6 A;  1Z8L A;  4Z65 A;  2ZEG A;  3QAY A;  2PJ7 A;  2FXF A;  2RFH A;  4KS9 A;  1S3Z A;  3RNZ A;  3NE8 A;  3CXQ A;  4M6I A;  2DPS A;  4UFW A;  2HUZ A;  1BLL E;  2C27 A;  1R43 A;  2PIY A;  2R1I A;  5J1Q A;  3VAT A;  2Y0M A;  2Q4V A;  2ODF A;  2ZPA A;  4OC1 A;  5AG4 A;  4NGQ A;  2YGW A;  5HH1 A;  2AFU A;  2G3T A;  2ANP A;  2B5G B;  2OU2 A;  2AFS A;  4MMO A;  3NH4 A;  4QC6 A;  4FBE A;  2ZOF A;  3NA6 A;  2XEG A;  2QML A;  2PDO A;  3TCV A;  1Y9K A;  2PC1 A;  4MI4 A;  2XEJ A;  3TTH A;  1NSA A;  3FNC A;  5IB9 A;  4A30 A;  1QSN A;  1LFW A;  1PU9 A;  4JXR A;  1HDQ A;  2GLJ A;  5EMI A;  4U9Y A;  5HMN A;  2V8D A;  3SHP A;  2ZEH A;  2PJ2 A;  3R96 A;  5F09 A;  2K5T A;  3B2Y A;  3ISX A;  4R3K A;  2ZEP A;  3WC6 A;  4MJ8 A;  2I79 A;  2PR1 A;  4P4I A;  1Q7L A;  5LRK A;  5LYI A;  2PVW A;  2PQ8 A;  3ISZ A;  2P6F A;  1ZG7 A;  3RYO A;  1MJA A;  2PJ9 A;  3PRT A;  4EME A;  1Q2Y A;  2G3A A;  2GAN A;  2QEC A;  4L89 A;  3FEE A;  2PVV A;  3SI0 A;  4KVO E;  4PSX A;  4Q7A A;  3C26 A;  3IGR A;  3PB9 X;  2J8R A;  2CIJ A;  4HPS A;  4KOV A;  4JZ0 A;  1VGY A;  2REE A;  4IUS A;  4OAD A;  1Z2L A;  4LUA A;  4OC0 A;  4CAE A;  2CNM A;  1V0C A;  4CPA A;  2I3C A;  3KQX A;  4YFJ A;  4TWE A;  1GYT A;  1S7K A;  4L8A A;  5CPA A;  3QNV A;  5D8N A;  4A2Z A;  3DLJ A;  4A32 A;  4KLV A;  2HV2 A;  3SJG A;  4EVY A;  3NH5 A;  2A4N A;  4A38 A;  4BD9 A;  4CYN A;  3I1U A;  1F2O A;  3BJ7 A;  1M1D A;  3K9T A;  4F0Y A;  3GKR A;  3VH9 A;  4CGM A;  1R3N A;  4NGN A;  2AFX A;  4OC4 A;  4KSF A;  3LOD A;  4MY3 A;  2Z3N A;  3A9L A;  5G22 A;  3B3W A;  5G1Z A;  2C1C A;  3R9F A;  3T9Y A;  1IIC A;  3TC8 A;  3W6X A;  5IB0 A;  3ZJ0 A;  3PB7 X;  4YRH A;  3B7I A;  3GUX A;  4E2A A;  1XEB A;  4UFX A;  1CP7 A;  4Y49 C;  4MCS A;  2XEI A;  4OME A;  4PXB A;  4Y49 B;  2H5M A;  3WAB A;  1AUG A;  3KHX A;  5LYD A;  3PFE A;  3F5B A;  1KUY A;  4MCQ A;  4OP4 A;  5AG7 A;  4NGS A;  3D2P A;  4A39 A;  4OID A;  1S7F A;  2Z11 A;  2JBJ A;  2X7B A;  2F7V A;  3MN8 A;  3P2F A;  5G21 A;  5IV0 A;  3NE7 A;  5F48 A;  1TKH A;  2WPX A;  2PJ0 A;  2OR4 A;  1TKF A;  4H2K A;  3RBU A;  4TNU A;  2BUE A;  4R6T A;  3L2N A;  4CS0 B;  2V77 A;  3MGD A;  2PSW A;  3D2M A;  1QST A;  5HXD A;  3IJ3 A;  3KI9 A;  4MFL A;  4U5Y A;  3SJF A;  4E0A A;  2KCW A;  3G8W A;  4R9M A;  1KUV A;  1YSJ A;  4CRZ B;  3W6S A;  6CPA A;  5JGF A;  2J9A A;  3IWE A;  2FSR A;  4MHZ A;  1WWZ A;  2VEZ A;  5GCN A;  4QVT A;  4FD6 A;  5D29 A;  1AYE A;  2B4B A;  4H89 A;  1XIX A;  4P10 A;  2Q7B A;  1P4N A;  4A94 A;  3WT4 A;  2EUI A;  3KZW A;  1I21 A;  2JDD A;  2CNT A;  4MHP A;  4R3L A;  1YVK A;  1XMT A;  1YLE A;  4CRY B;  2O28 A;  3S6G A;  1M4I A;  2I00 A;  1CM0 A;  5IX3 A;  1MJB A;  4KUB A;  2PJ8 A;  2Q44 A;  2R98 A;  4F9U A;  3K2K A;  1IYK A;  2AJ6 A;  1Y7E A;  1LAN A;  3H8G A;  2BO9 A;  3NH8 A;  4A33 A;  4NSQ A;  1M4D A;  4WJB A;  4MCR A;  3FIX A;  5I4M A;  3GY9 A;  2JEW A;  1I12 A;  1ZLI A;  2NYQ A;  1Z4R A;  2EBJ A;  4HNW B;  4B14 A;  4B11 A;  4P4F A;  1DE4 C;  4R57 A;  1VHE A;  1XJO A;  1LRZ A;  5AGE A;  1LOK A;  1ZG9 A;  2PJ6 A;  1ZO0 A;  2WYR A;  4H6U A;  1YRE A;  1TIQ A;  4G1P A;  4UFV A;  4C2Z A;  4K30 A;  4W9Y A;  4KOW A;  1IU8 A;  3IIB A;  1CG2 A;  1Z8W A;  4MHY A;  1I1D A;  4MRI A;  3IEH A;  5HVH A;  2BOA A;  5ELY A;  1QMU A;  2CY2 A;  4MFQ A;  2FL4 A;  3LWU A;  4F0X A;  3D7G A;  2FS5 A;  4OC3 A;  2B4D B;  4RN7 A;  4U9Z A;  2F5I A;  4NEX A;  3CDX A;  3FF3 A;  2GIV A;  3PEI A;  4H6Z A;  5C88 A;  4ZY0 A;  4P44 A;  2BEI A;  1IOI A;  4CYO A;  4AVC A;  2QYV A;  1QQ9 A;  4KVX A;  4JD6 A;  4AVB A;  4JYW A;  5H84 A;  4XPK A;  3SXN A;  1P0H A;  2ZEM A;  2PJ3 A;  3SI2 A;  3WC5 A;  3TE4 A;  2VL1 A;  4CAV A;  3W91 A;  3B3T A;  4B12 A;  5AG6 A;  1XBU A;  1NSL A;  1F57 A;  4IF5 A;  1Z8X A;  3S6F A;  1M44 A;  3JVN A;  1IB1 E;  4JJX A;  4UA3 A;  1QSR A;  2PIZ A;  3VWE A;  3VAR A;  4ZI6 A;  4UEZ A;  2ARH A;  4J3G A;  4Q38 A;  3QAH A;  5K8O A;  4EFD A;  1Z4E A;  3H8F A;  2WUU A;  2ZW5 A;  4DNC A;  2J8M A;  4MFP A;  2PE3 A;  2V8V A;  1CBX A;  2BSW A;  2CNS A;  3D7F A;  3FVL A;  4OKO A;  4CAF A;  3BXM A;  2B4D A;  2FE7 A;  2ZXV A;  3BJ8 A;  1BPM A;  1S5K A;  2QVP A;  3EFA A;  2VBQ A;  3KHZ A;  2PJB A;  1KUX A;  4B13 A;  3R9E A;  5ISV A;  1YX0 A;  1Z9U A;  2C6P A;  2R8V A;  4P4J A;  1PUA A;  1PYT B;  2AFO A;  4ZYQ A;  5BWA B;  3KAS A;  3TO9 A;  2EVN A;  5EC4 A;  4KUA A;  3B3S A;  4A37 A;  1M4L A;  1ELL P;  4IHM A;  4NGT A;  4OC2 A;  3IWG A;  2VI7 A;  2VXK A;  4DJL A;  3I3G A;  3EY5 A;  1LAM A;  3R95 A;  4AB7 A;  5A28 A;  3OWC A;  1RO5 A;  2PJ1 A;  2FIA A;  3FX6 A;  4MHD A;  1YME A;  1ARL A;  3QB8 A;  2B3U A;  3FJU A;  3FRM A;  4QBJ A;  1YW6 A;  2J8N A;  3CXP A;  4B5P B;  4F6A A;  3BHX A;  5KTC A;  2BCO A;  1QSO A;  3DR6 A;  2F8H A;  2RB7 A;  5FVJ A;  3DGV A;  3D7H A;  1YQE A;  3FB3 A;  5DWN A;  1IOF A;  4PPZ A;  2Q51 A;  4CYQ A;  3DNS A;  3PB4 X;  4X3R A;  2WZN A;  3DR8 A;  1F2P A; 
#chains in the Genus database with same CATH homology
 1B6B A;  1ON0 A;  2YND A;  5KTD A;  1YGH A;  1GHE A;  1MK4 A;  2Z3O A;  4UCN A;  5CNP A;  3D3S A;  4C68 A;  1L0C A;  4M3S A;  1S7L A;  3TFY A;  1B87 A;  2VZZ A;  4XPD C;  4E8O A;  1K4J A;  5H86 A;  4HNY B;  4XPD B;  3N7Z A;  1N71 A;  2Z3M A;  2D4P A;  4B5P A;  4JXQ A;  2ZW7 A;  4HNX B;  1R57 A;  5G20 A;  4A31 A;  4KOY A;  1YR0 A;  3I9S A;  1XF8 A;  4GS4 A;  4NF1 A;  4ORF A;  2Z10 A;  3S6K A;  3T90 A;  3S6H A;  4C7H A;  4QB9 A;  1YK3 A;  4KSA A;  4FD5 A;  5KTA A;  1Q2D A;  3R9G A;  2HQY A;  3DSB A;  3H4Q A;  5DWM A;  2PRB A;  4CAX A;  1VKC A;  3H5Z A;  4RS2 A;  3SXO A;  4B10 A;  4CGL A;  1XE4 A;  4UWJ A;  3FYN A;  4CGN A;  3JUW A;  4B5O A;  1NMT A;  2ATR A;  2DXQ A;  3LD2 A;  1SQH A;  4CAW A;  2OH1 A;  4C2Y A;  4MBU A;  1YVO A;  2OZU A;  4KLW A;  2R7H A;  3B8G A;  1MJ9 A;  5I0C A;  3D8P A;  4PSW A;  2GE3 A;  2Q4Y A;  1M4G A;  3EC4 A;  4ZGY B;  3EO4 A;  4OLL A;  5AG5 A;  3TOA A;  5C82 A;  2DPT A;  2JLM A;  3VWD A;  4HKF A;  4LX9 A;  4NCZ A;  4XNH C;  3K9U A;  4XNH B;  4CYP A;  4XPL A;  3UY5 A;  3TOB A;  2P6G A;  4MFK A;  4AVA A;  5F46 A;  4BMH A;  2VQY A;  4QUS A;  1FY7 A;  4R87 A;  3KKW A;  4KOU A;  1J4J A;  4KOR A;  2Q0Y A;  1S7N A;  3R1K A;  2WSA A;  2D4O A;  2Q04 A;  4I49 A;  4II9 A;  4MY0 A;  4KOS A;  2B5G A;  4JLY A;  3FXT A;  5A27 A;  3PZJ A;  3EXN A;  4FD4 A;  4RI1 A;  4M85 A;  1S60 A;  3BLN A;  3IU2 A;  5J8F A;  3JTK A;  2BL1 A;  2FT0 A;  2OZH A;  1U6M A;  4UCM A;  4UBR A;  4AG9 A;  5F47 A;  5F49 A;  1OZP A;  2YNC C;  1CJW A;  4MFZ A;  1BO4 A;  3GYA A;  4ZBG A;  2ZW6 A;  4X5K A;  4C2X A;  4AG7 A;  2Z3P A;  2FCK A;  2PR8 A;  5JQ4 A;  2P0W A;  4Q36 A;  4MFJ A;  2QIR A;  3WR7 A;  2CXA A;  4CGO A;  4YGO A;  5J8C A;  3TO7 A;  3ZZI A;  2WPW A;  3IU1 A;  1VHS A;  2OZG A;  1UFH A;  4BBH A;  4PV6 A;  3E0K A;  3V8I A;  2B3V A;  2Z3L A;  4KOX A;  4A95 A;  2P6E A;  5E96 A;  2JDC A;  1WK4 A;  2YNC A;  1Y7R A;  4KZT A;  4ONU A;  1NE9 A;  4CGP A;  2OB0 A;  2G0B A;  1IID A;  2REF A;  4JWP A;  3G3S A;  3PGP A;  3F8K A;  2RC4 A;  2Z3K A;  3CXS A;  3FBU A;  4PK3 A;  1Q2C A;  3TT2 A;  3F0A A;  2AE6 A;  2Z0Z A;  1RXT A;  1KZF A;  1QSM A;  1Y9W A;  4J3G A;  2NMT A;  4CAE A;  2IL4 A;  2VZY A;  4KVM E;  2YNE A;  4UCP A;  4UWI A;  4PK2 A;  2FIW A;  4OAE A;  3P2H A;  2B58 A;  2JEV A;  1IYL A;  2ZW4 A;  4KOT A;  3PP9 A;  5JPH A;  4NXY A;  3DDD A;  4C7I A;  4FD7 A;  5EBV A;  3TO6 A;  1BOB A;  2FXF A;  4KS9 A;  1S3Z A;  3CXQ A;  2DPS A;  4UFW A;  2HUZ A;  2C27 A;  2R1I A;  2Y0M A;  2Q4V A;  2ZPA A;  5AG4 A;  5HH1 A;  2YGW A;  2G3T A;  2B5G B;  2OU2 A;  4QC6 A;  2QML A;  2PDO A;  3TCV A;  1Y9K A;  2PC1 A;  4MI4 A;  3TTH A;  3FNC A;  4A30 A;  1QSN A;  1PU9 A;  4JXR A;  4U9Y A;  5HMN A;  3SHP A;  3R96 A;  2K5T A;  4R3K A;  4MJ8 A;  2I79 A;  2PR1 A;  2PQ8 A;  2P6F A;  3RYO A;  1MJA A;  1Q2Y A;  2G3A A;  2GAN A;  2QEC A;  4L89 A;  4KVO E;  4PSX A;  3C26 A;  3IGR A;  2J8R A;  4KOV A;  2REE A;  4IUS A;  4OAD A;  2CNM A;  1V0C A;  4YFJ A;  1S7K A;  4L8A A;  4A2Z A;  4A32 A;  4KLV A;  2HV2 A;  4EVY A;  2A4N A;  4CYN A;  3BJ7 A;  1M1D A;  4F0Y A;  3GKR A;  4CGM A;  4KSF A;  3LOD A;  4MY3 A;  2Z3N A;  3A9L A;  5G22 A;  5G1Z A;  3R9F A;  3T9Y A;  1IIC A;  3W6X A;  5IB0 A;  3ZJ0 A;  4YRH A;  4E2A A;  1XEB A;  4UFX A;  4Y49 C;  4Y49 B;  2H5M A;  3F5B A;  1KUY A;  5AG7 A;  3D2P A;  1S7F A;  2Z11 A;  2X7B A;  3P2F A;  5G21 A;  5IV0 A;  3NE7 A;  5F48 A;  2WPX A;  2BUE A;  4CS0 B;  3MGD A;  2PSW A;  3D2M A;  1QST A;  4MFL A;  4U5Y A;  4E0A A;  2KCW A;  3G8W A;  4R9M A;  1KUV A;  4CRZ B;  3W6S A;  3IWE A;  2FSR A;  1WWZ A;  2VEZ A;  5GCN A;  4QVT A;  4FD6 A;  2B4B A;  4H89 A;  1XIX A;  2Q7B A;  1P4N A;  2EUI A;  1I21 A;  2JDD A;  2CNT A;  4R3L A;  1YVK A;  1XMT A;  1YLE A;  4CRY B;  2O28 A;  3S6G A;  1M4I A;  2I00 A;  1CM0 A;  5IX3 A;  1MJB A;  4KUB A;  2Q44 A;  2R98 A;  1IYK A;  2AJ6 A;  4A33 A;  4NSQ A;  1M4D A;  3FIX A;  3GY9 A;  1I12 A;  4B14 A;  4HNW B;  1Z4R A;  4B11 A;  4R57 A;  1LRZ A;  5AGE A;  4H6U A;  4C2Z A;  1ZO0 A;  4UFV A;  1YRE A;  1TIQ A;  4K30 A;  4KOW A;  1I1D A;  2CY2 A;  4MFQ A;  2FL4 A;  4F0X A;  2FS5 A;  2B4D B;  4U9Z A;  2F5I A;  4NEX A;  2GIV A;  4H6Z A;  5C88 A;  2BEI A;  4CYO A;  4AVC A;  4KVX A;  4JD6 A;  4AVB A;  5H84 A;  4XPK A;  3SXN A;  1P0H A;  3TE4 A;  4CAV A;  3W91 A;  4B12 A;  5AG6 A;  1NSL A;  4IF5 A;  3S6F A;  1M44 A;  3JVN A;  1IB1 E;  4JJX A;  4UA3 A;  1QSR A;  3VWE A;  2ARH A;  4Q38 A;  3QAH A;  1Z4E A;  2WUU A;  2ZW5 A;  4DNC A;  2J8M A;  4MFP A;  2BSW A;  2CNS A;  4CAF A;  2B4D A;  2FE7 A;  2ZXV A;  3BJ8 A;  1S5K A;  3EFA A;  2VBQ A;  1KUX A;  4B13 A;  3R9E A;  5ISV A;  1YX0 A;  1Z9U A;  2R8V A;  1PUA A;  5BWA B;  3TO9 A;  2EVN A;  5EC4 A;  4KUA A;  3IWG A;  2VI7 A;  2VXK A;  3I3G A;  3EY5 A;  3R95 A;  4AB7 A;  5A28 A;  3OWC A;  1RO5 A;  2FIA A;  4MHD A;  3QB8 A;  2B3U A;  3FRM A;  4QBJ A;  4B5P B;  2J8N A;  3CXP A;  4F6A A;  5KTC A;  5FVJ A;  1QSO A;  3DR6 A;  3FB3 A;  5DWN A;  4CYQ A;  3DNS A;  3DR8 A;  4LUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...