1PUAA

Crystal structure of tetrahymena gcn5 with bound coenzyme a and a phosphorylated, 19-residue histone h3 peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
162
structure length
162
Chain Sequence
LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/structural protein
molecule keywords HAT A1
publication title Structural basis for histone and phospho-histone binding by the GCN5 histone acetyltransferase
pubmed doi rcsb
source organism Tetrahymena thermophila
total genus 44
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2003-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1puaA00
5ISVA 3CXPA 4U5YA 4KVME 3GKRA 1B87A 5E96A 3W6SA 4OLLA 5JQ4A 3W91A 2OZGA 2PRBA 2ARHA 3IGRA 3P2FA 1XF8A 2JEVA 1NMTA 2OU2A 4FD4A 2FL4A 5DWNA 5DWMA 4KOWA 1IIDA 1YGHA 4JXRA 1ON0A 2R98A 3CXSA 3WR7A 4Y49B 2GE3A 3BJ7A 4YRHA 4CS0B 3NE7A 2Z0ZA 2WPXA 2PR1A 1M44A 2ZPAA 1YK3A 4FD7A 2DXQA 1Q2DA 2IL4A 4KZTA 2ATRA 4II9A 2P6EA 3F8KA 4HNYB 3S6GA 2QECA 4YGOA 3VWDA 2B4BA 3I9SA 2BUEA 1XEBA 3G3SA 2Y0MA 4JD6A 4I49A 5J8CA 4BMHA 1QSTA 1KUXA 3FIXA 2Q4YA 1YVOA 4CRYB 1CM0A 5JPHA 3F0AA 2PR8A 2ZW4A 5KTAA 1P0HA 1YX0A 2WPWA 1FY7A 3GYAA 3FB3A 4L8AA 1MJ9A 1Y9WA 4KOXA 1QSMA 4IF5A 4H89A 4KOSA 3EY5A 2HV2A 4HNXB 2ZW5A 4UBRA 2P6GA 1L0CA 4QB9A 3QAHA 4H6UA 4LX9A 4U9ZA 1QSOA 4M85A 2J8RA 2CNMA 3TOAA 4AVAA 2BL1A 2AE6A 2RC4A 5EC4A 4KVOE 1CJWA 3TE4A 2B3VA 3MGDA 3K9UA 3D8PA 3KKWA 5F47A 1PUAA 2JLMA 1R57A 5IV0A 4OAEA 1RO5A 2CY2A 2QIRA 2PSWA 2EVNA 1S7LA 1Y7RA 2REEA 1I21A 3JVNA 1UFHA 2Q0YA 1XIXA 4E0AA 3D2MA 4AG7A 1N71A 3DNSA 1S3ZA 3R1KA 3ZZIA 2C27A 3D3SA 4KLWA 5KTDA 5IX3A 4UA3A 1Q2CA 4MY3A 1NSLA 2I79A 4LUAA 4U9YA 3N7ZA 2G0BA 4KOUA 2OB0A 1M4DA 3H4QA 3TCVA 4XPLA 4QC6A 3TO6A 2OH1A 4NXYA 1XE4A 3LD2A 1V0CA 4L89A 4B5OA 4MHDA 3DR8A 3W6XA 3S6HA 4AVCA 4E8OA 1PU9A 4XPDB 3R9GA 4AVBA 3DDDA 2Z10A 1BO4A 3LODA 1M4GA 3D2PA 2FXFA 5IB0A 1TIQA 5F48A 1YVKA 2B58A 4J3GA 4DNCA 3PP9A 2CNTA 4OADA 2VQYA 2FT0A 4K30A 4PSWA 1VHSA 2G3TA 2P6FA 4PK2A 4XPKA 5HMNA 4AB7A 2VBQA 4KOVA 4HKFA 3SXNA 3PGPA 4ONUA 1M1DA 1GHEA 3E0KA 4ORFA 2I00A 3EXNA 3FRMA 3V8IA 4KOTA 3TO9A 2BEIA 3CXQA 1Z9UA 2B5GB 3FYNA 4FD6A 4KOYA 3BJ8A 3QB8A 1YR0A 2REFA 2ZXVA 4QUSA 3T9YA 4CAWA 2B4DB 2PDOA 2H5MA 2Q04A 3EFAA 3SXOA 2B3UA 2Q44A 2FS5A 1MK4A 2JDCA 1WWZA 3P2HA 4UWJA 4CAXA 5F49A 1Y9KA 2QMLA 3R95A 2VEZA 2FIWA 4CAVA 3BLNA 2AJ6A 4KORA 3I3GA 1LRZA 2D4OA 2X7BA 3OWCA 4NEXA 3S6FA 1IICA 4Y49C 2NMTA 1S5KA 3G8WA 4KUAA 5HH1A 2B5GA 2VZYA 2ZW6A 3TFYA 1IYLA 4AG9A 4CRZB 4FD5A 3JUWA 5EBVA 1I12A 4R57A 5J8FA 5I0CA 2EUIA 2B4DA 2CNSA 1M4IA 3S6KA 4ZBGA 1S7KA 4NF1A 5H86A 2A4NA 4XNHC 1S60A 4KLVA 4MI4A 2G3AA 1I1DA 1P4NA 4R3KA 5KTCA 1S7FA 4PSXA 2Q4VA 2ZW7A 1IYKA 2J8MA 4MY0A 1QSRA 1YREA 1YLEA 2KCWA 5GCNA 4RI1A 4F0YA 1KZFA 4R87A 2HUZA 4EVYA 4JWPA 3TO7A 4R9MA 3SHPA 1WK4A 2VI7A 4HNWB 4JLYA 4IUSA 2OZHA 2JDDA 3C26A 3R9FA 3EC4A 4NCZA 4NSQA 5CNPA 3ZJ0A 4B5PB 3T90A 3F5BA 2PQ8A 2GIVA 2GANA 3R96A 4XNHB 3DSBA 1MJBA 5F46A 2FSRA 4M3SA 4YFJA 1K4JA 4R3LA 1Z4RA 3FNCA 2HQYA 4E2AA 4QVTA 1S7NA 3TT2A 3IWGA 3DR6A 3UY5A 2R7HA 4PV6A 4H6ZA 1MJAA 1RXTA 1B6BA 3FXTA 2R8VA 1SQHA 1Z4EA 3TOBA 3R9EA 1VKCA 4RS2A 3EO4A 4F6AA 5FVJA 4KVXA 4KUBA 4QBJA 2O28A 5C88A 5H84A 2VZZA 1J4JA 1BOBA 4JJXA 2R1IA 3TTHA 2BSWA 2VXKA 2FE7A 3GY9A 4B5PA 2FIAA 4JXQA 5C82A 4X5KA 1OZPA 3FBUA 1KUVA 1IB1E 1NE9A 1XMTA 2D4PA 2Z11A 4GS4A 2F5IA 3VWEA 1U6MA 2PC1A 4MJ8A 2Q7BA 3PZJA 4PK3A 3B8GA 2P0WA 3RYOA 4MBUA 2FCKA 4XPDC 1KUYA 1Q2YA 2OZUA 4UWIA 2K5TA 2J8NA 1QSNA
chains in the Genus database with same CATH superfamily
5ISVA 3CXPA 4U5YA 4KVME 3GKRA 1B87A 5E96A 4W9YA 3W6SA 4OLLA 1KWMA 2ZEHA 5JQ4A 3CZXA 3W91A 1YQEA 3HLPA 2OZGA 3GB0A 4CYNA 3S9MA 2PIYA 2PRBA 2PIZA 2ARHA 3IGRA 3P2FA 1XF8A 2JEVA 4MFKA 4FUUA 4A30A 1NMTA 3B3VA 2OU2A 2V8VA 4FD4A 2FL4A 2PJ1A 1ZO0A 5DWNA 4CGPA 1VHOA 5DWMA 4KOWA 2ZEGA 1IIDA 4UFWA 2Z3PA 1YGHA 4JXRA 4X2TA 1ON0A 2R98A 3CXSA 5CBMA 1ZG7A 3WR7A 2PJ7A 2V8DA 3JTKA 4Y49B 2PJ3A 3KI9A 2GE3A 1ELMP 5G22A 3BJ7A 2XEIA 2XEJA 3RZAA 4YRHA 4CS0B 3NE7A 4C7IA 4RUHA 2YNCA 2ABZA 2Z0ZA 2EO8A 3L2NA 2WPXA 2GREA 2PR1A 2YNDA 3PB4X 1M44A 4ZY0A 2ZPAA 1NSAA 1YK3A 2RB7A 4FD7A 1OBRA 2PRQA 1JQGA 1Q2DA 2DXQA 2IL4A 4FAIA 2AFWA 3SJGA 4KZTA 3PFEA 4IAVA 2ATRA 2O4HA 4TWEA 4R76A 4II9A 2PJ5A 2P6EA 3F8KA 4HNYB 4CGNA 3S6GA 2QECA 4YGOA 3VWDA 4NFRA 2B4BA 3FMCA 2BUEA 1XEBA 3D7DA 3I9SA 3G3SA 3B2YA 2Y0MA 1TKHA 3PEIA 4JD6A 3S9NA 4LQGA 2AFZA 3GLJA 4I49A 3IIBA 4BMHA 4C68A 5J8CA 5HH1A 3B7IA 4BD9A 1QSTA 4BBHA 1KUXA 5JM6A 3CPAA 3FIXA 2Q4YA 2QVPA 1YVOA 4KSAA 4OIWA 3H8EA 4MHNA 4NJQA 2EWBA 1DE4C 2V77A 4CRYB 1CM0A 4B10A 5JPHA 1QMUA 1IOIA 2WZNA 3F0AA 3FF3A 3KL9A 2EBJA 2PR8A 1YW4A 2WYRA 4CGMA 3FECA 3NFZA 4OC1A 2ZW4A 3SI0A 1LCPA 2V8HA 5KTAA 1CG2A 4Z65A 1LAMA 1P0HA 1YX0A 2WPWA 4ZY2A 1FY7A 1XOVA 1LANA 3FB3A 3GYAA 1CPSA 1MJ9A 4L8AA 4P4FA 1Y9WA 4KOXA 4M6IA 4C2XA 1QSMA 3PBEA 5K8OA 4IF5A 4H89A 4KOSA 1HDQA 3EY5A 1JWQA 2HV2A 2FVGA 3NE8A 6CPAA 4UFVA 2F7VA 4UF4A 2WSAA 4HNXB 1BAVA 2ZW5A 4UBRA 4JZ0A 2P6GA 1L0CA 2Q4ZA 4OC2A 5D8NA 1R3NA 4QB9A 3PRTA 3QAHA 4H6UA 3QNVA 4LX9A 4U9ZA 4H2KA 4MCPA 3NH4A 1QSOA 4M85A 2J8RA 4MFQA 3D67A 1Z2LA 2CNMA 3TOAA 2ANPA 1R43A 4AVAA 1Z8TA 4UEEA 2PCUA 2CTBA 2BL1A 2AE6A 5HVGA 1VHEA 3BHXA 2RC4A 5EC4A 4KVOE 5BWAB 1CJWA 4GXHA 3TE4A 2B3VA 3MGDA 3PB9X 4CAFA 3K9UA 2PE3A 2PJ0A 3D8PA 2ZEOA 3KKWA 5F47A 4NGMA 4OMEA 1F2OA 1PUAA 2JLMA 1R57A 1YW6A 5IV0A 4OAEA 1RO5A 1YMEA 2CY2A 4UCPA 4C2YA 2Q43A 4OP4A 2QIRA 4FBEA 2PSWA 1Y0RA 5HXDA 2EVNA 4MCRA 2C6PA 1FNOA 1S7LA 1Y7RA 2REEA 4MFLA 1CP7A 3H5ZA 1I21A 3JVNA 5ELYA 3V7ZA 1XFOA 4MMOA 1UFHA 2Z3KA 4NGQA 4BINA 2Q0YA 1XIXA 3IWEA 4E0AA 3D2MA 3IU1A 4AG7A 1N71A 3DNSA 4NJRA 1S3ZA 4CYPA 4NGNA 5AGEA 1XJOA 1Z8LA 3R1KA 5A27A 4UIBA 3ZZIA 2C27A 3D3SA 4KLWA 5DS0A 5KTDA 2I3CA 5IX3A 4UA3A 2QYVA 1Q2CA 4MY3A 1NSLA 2I79A 3FX6A 4LUAA 4U9YA 3N7ZA 5J1QA 3PB8X 2EK8A 2G0BA 4UEFA 4KOUA 2OB0A 5G21A 3SI2A 1M4DA 3H4QA 3TCVA 4XPLA 4YWYA 2Z3NA 4QC6A 1H8LA 2C6CA 2HC9A 3TO6A 4NGSA 2OH1A 4NXYA 1XE4A 4UEZA 5LRGA 3LD2A 2AFUA 1V0CA 4L89A 4B5OA 4MHDA 3PB7X 3DR8A 3KQXA 4P4IA 3VH9A 2ZOFA 3S6HA 4PXEA 1M4LA 1PU9A 3W6XA 4AVCA 4E8OA 4XPDB 3R9GA 4AVBA 2CF4A 4OKOA 3IEHA 3D7GA 2NSMA 2Z10A 2JBKA 3DDDA 5THWA 1Q7LA 1BO4A 3LODA 1CP6A 1M4GA 4B12A 2CXAA 3D7HA 3D2PA 4P4JA 5K8NA 2FXFA 4CAEA 3V38A 5IB0A 1TIQA 1TXRA 1YVKA 2B58A 4J3GA 5F48A 4DNCA 1ZG9A 2IJZA 3LMSA 4NGPA 3PP9A 2RFHA 4MHYA 4OC4A 2CNTA 4EWTA 4OADA 1X10A 2VQYA 3JRUA 4F0XA 2Q51A 4ZI6A 2FT0A 5G20A 4K30A 4PSWA 1VHSA 2G3TA 2P6FA 1IOFA 3WC5A 3K9TA 4PK2A 4XPKA 2PJ6A 4AB7A 5HMNA 3I1UA 2VBQA 4KOVA 4HKFA 3NH5A 3SXNA 4DUKA 4C7HA 2HB6A 4GM5A 3B3SA 3D66A 2DF5A 3CPXA 3WC6A 2CIJA 1A2ZA 1M1DA 1GHEA 3E0KA 3PGPA 4ONUA 4ORFA 1CBXA 2I00A 3EXNA 3FRMA 4UCNA 2POKA 1Y7EA 4FWUA 1QQ9A 3FVLA 5JH9A 1AUGA 1GYTA 3B3TA 4WWVA 1TF9A 3V8IA 4Q36A 4KOTA 4CGLA 3TO9A 2BEIA 3CXQA 4M6GA 3KHXA 1DTDA 1Z9UA 2B5GB 3FYNA 2IMOA 4A38A 3MRUA 4FD6A 5JGFA 2DPTA 2ZEFA 4KOYA 5LRJA 1Z5RA 2Z3OA 3IJ3A 1TKJA 2O53A 3BJ8A 3QB8A 1YR0A 2AFSA 2REFA 3B3WA 3DLJA 4IK2A 2ZXVA 3CT9A 2ZEMA 4QUSA 4ONWA 1TF8A 5LYIA 3T9YA 4CAWA 2B4DB 4PXDA 2PDOA 2PVWA 2H5MA 2C6GA 3K2KA 4CPAA 2Q04A 4EFDA 2V8GA 4F8ZA 1Z8WA 3S9LA 3EFAA 3SXOA 3CDXA 4P45A 1EE3P 3KHZA 2B3UA 3B3CA 2Q44A 2FS5A 4TNUA 4OC3A 5EMIA 5CPAA 1MK4A 3PBBA 3VATA 2JDCA 5LYFA 3PB6X 1WWZA 3P2HA 2GLJA 4YU9A 4MRIA 4UWJA 3IU2A 1AMPA 4MFZA 3RNZA 3KR5A 4CAXA 5F49A 2DEAA 4P44A 2AFXA 4Q38A 4DJLA 1Y9KA 4A31A 2QMLA 1BPMA 1YSJA 1XRYA 2JBJA 3R95A 2VEZA 2FIWA 4CAVA 2PJCA 3BLNA 4PXCA 2WUUA 2AJ6A 3A9LA 4KORA 3SJFA 2PJ8A 4B13A 1F2PA 3I3GA 1LFWA 1LRZA 2D4OA 3BXMA 1XBUA 2X7BA 3OWCA 2NYQA 4UCMA 4F9UA 3PFOA 2ZELA 4CYQA 4NEXA 3S6FA 1IICA 4Y49C 4HPSA 2NMTA 1S5KA 2BOAA 2ZEEA 3G8WA 4KUAA 2B5GA 2G9DA 2VZYA 4JYWA 2ZW6A 3SJXA 3D7FA 3TFYA 1IYLA 8CPAA 3IFEA 4AG9A 4P10A 4CRZB 3LWUA 3JUWA 4FD5A 1I12A 4MHPA 1LAPA 3ISZA 2XEFA 4R57A 5EBVA 4AXVA 5J8FA 4OC0A 3N5FA 5I0CA 5K8PA 2EUIA 1IGBA 2ZOGA 4MCSA 2B4DA 2CNSA 3HUVA 5IB9A 1M4IA 2YNEA 4KSIA 4NGTA 4ZBGA 3S6KA 3WT4A 2PJ9A 3H8GA 3IWWA 1S7KA 4NF1A 5H86A 5LRKA 4PXBA 4X3RA 2A4NA 3IC1A 4XNHC 1S60A 4A32A 1IU8A 4KLVA 3ISXA 4MI4A 4PQAA 2G3AA 4O23A 1I1DA 1P4NA 4R7MA 4R3KA 5KTCA 1S7FA 4PSXA 2Q4VA 1PYTB 2ZW7A 1IYKA 2J8MA 4MY0A 1QSRA 1YREA 4R8FA 1YLEA 2KCWA 1ZLHA 1ARLA 1HDUA 5GCNA 4RI1A 1PCAA 5AG7A 4F0YA 1KZFA 3GIUA 4G1PA 4R87A 1FT7A 4MXUA 2HUZA 4B14A 5AG6A 3WC7A 2ODFA 4ZYQA 4LQ6A 5HVFA 4JWPA 4OIDA 3SI1A 4EVYA 5HVHA 2OR4A 3FH4A 3TO7A 3WABA 1YLOA 4R9MA 4UIAA 3SHPA 1LOKA 3FEEA 2GLFA 1TKFA 1Z8XA 5AG4A 5LYLA 2AFMA 1WK4A 2VI7A 1BPNA 2GU2A 4HNWB 4JLYA 4IUSA 2OZHA 2ZENA 3NH8A 4ZX8A 4P4DA 4A33A 1XMBA 2PJ4A 3IO1A 4M6HA 2JDDA 3C26A 1ELLP 3R9FA 3EC4A 1CPXA 4NCZA 4NSQA 2C1CA 3FJUA 5CNPA 3ZJ0A 1ZLIA 3BI0A 4B5PB 3T90A 3VARA 3F5BA 2PQ8A 2GIVA 3D4UA 3NA6A 4A39A 2GANA 3MN8A 2PJBA 4F9VA 3R96A 4XNHB 3GUXA 3DSBA 4P6YA 1RTQA 3TX8A 1MJBA 5F46A 4A95A 1F57A 2FSRA 4M3SA 5G1ZA 1BLLE 1VIXA 1AYEA 3FEDA 4YFJA 1K4JA 4R3LA 1Z4RA 3D68A 3FNCA 4P4BA 2HQYA 4MFJA 4E2AA 5K8MA 2BO9A 4QVTA 3B35A 1ARMA 1S7NA 2JEWA 3TT2A 3IWGA 2CTCA 2IQ6A 3DR6A 4ZY1A 3UY5A 4IHMA 2R7HA 4PV6A 5AG5A 4H6ZA 2YNCC 1MJAA 1RXTA 3KR4A 4NGRA 4R6TA 1B6BA 4MHZA 3FXTA 2R8VA 1SQHA 2PJAA 1Z4EA 1VGYA 3TOBA 4A2ZA 4CGOA 4DYOA 2Q7SA 3KZWA 3R9EA 3RAMA 3LACA 1VKCA 4RS2A 3EO4A 4Q7AA 1Y0YA 4P4EA 1ZG8A 2ZEPA 3DGVA 4ZX9A 4F6AA 4K3NA 5FVJA 2Z3LA 4KVXA 2J9AA 4KUBA 4QBJA 4B6ZA 5F09A 5A28A 2O28A 3T8WA 4MFPA 2XEGA 2PVVA 2DPSA 5C88A 1UWYA 5H84A 2QJ8A 2VZZA 3QAYA 1J4JA 1BOBA 5D29A 4JJXA 4KS9A 2R1IA 4B11A 3TTHA 2BSWA 2VXKA 2FE7A 3GY9A 3BI1A 3H8FA 4B5PA 2FIAA 2BCOA 4OC5A 4EMEA 4JXQA 2EK9A 4A94A 5C82A 3KQZA 4X5KA 1OZPA 3FBUA 3RBUA 2AFOA 7CPAA 3SJEA 5I4MA 1KUVA 1IY7A 1IB1E 1NE9A 2ZEDA 1XMTA 2D4PA 2OOTA 2Z11A 3TC8A 4GS4A 4MCQA 2F5IA 3RO0A 3VWEA 4WJBA 1U6MA 2GFQA 1HEEA 2PC1A 2YGWA 4MJ8A 2Q7BA 4A37A 3PZJA 4PK3A 3B8GA 4CYOA 3KGQA 4PPZA 4RN7A 4C2ZA 2P0WA 5LYDA 3RYOA 4MBUA 3KASA 2F8HA 2FCKA 4X8IA 1KUYA 1Q2YA 4XPDC 1CX8A 2OZUA 4UWIA 2Z3MA 2VL1A 2K5TA 2J8NA 4KSFA 4UFXA 1X12A 4ZGYB 1QSNA 2PJ2A
chains in the Genus database with same CATH topology
5ISVA 3CXPA 4U5YA 4KVME 3GKRA 1B87A 5E96A 3W6SA 4OLLA 5JQ4A 3W91A 2OZGA 4CYNA 2PRBA 2ARHA 3IGRA 3P2FA 1XF8A 2JEVA 4MFKA 4A30A 1NMTA 2OU2A 4FD4A 2FL4A 1ZO0A 5DWNA 4CGPA 5DWMA 4KOWA 1IIDA 4UFWA 2Z3PA 1YGHA 4JXRA 1ON0A 2R98A 3CXSA 3WR7A 3JTKA 4Y49B 2GE3A 5G22A 3BJ7A 4YRHA 4CS0B 3NE7A 4C7IA 2YNCA 2Z0ZA 2WPXA 2PR1A 2YNDA 1M44A 2ZPAA 1YK3A 4FD7A 2DXQA 1Q2DA 2IL4A 4KZTA 2ATRA 4II9A 2P6EA 3F8KA 4HNYB 4CGNA 3S6GA 2QECA 4YGOA 3VWDA 2B4BA 3I9SA 2BUEA 1XEBA 3G3SA 2Y0MA 4JD6A 4I49A 5J8CA 4BMHA 4C68A 1QSTA 4BBHA 1KUXA 3FIXA 2Q4YA 1YVOA 4KSAA 4CRYB 1CM0A 4B10A 5JPHA 3F0AA 2PR8A 4CGMA 2ZW4A 5KTAA 1P0HA 1YX0A 2WPWA 1FY7A 3GYAA 3FB3A 4L8AA 1MJ9A 4C2XA 1Y9WA 4KOXA 1QSMA 4IF5A 4H89A 4KOSA 3EY5A 2HV2A 4UFVA 2WSAA 4HNXB 2ZW5A 4UBRA 2P6GA 1L0CA 4QB9A 3QAHA 4H6UA 4LX9A 4U9ZA 1QSOA 4M85A 2J8RA 4MFQA 2CNMA 3TOAA 4AVAA 2BL1A 2AE6A 2RC4A 5EC4A 4KVOE 5BWAB 1CJWA 3TE4A 2B3VA 3MGDA 4CAFA 3K9UA 3D8PA 3KKWA 5F47A 1PUAA 2JLMA 1R57A 5IV0A 4OAEA 1RO5A 2CY2A 4UCPA 4C2YA 2QIRA 2PSWA 2EVNA 1S7LA 1Y7RA 2REEA 4MFLA 3H5ZA 1I21A 3JVNA 1UFHA 2Z3KA 2Q0YA 1XIXA 3IWEA 4E0AA 3D2MA 3IU1A 4AG7A 1N71A 3DNSA 1S3ZA 4CYPA 5AGEA 3R1KA 5A27A 3ZZIA 2C27A 3D3SA 4KLWA 5KTDA 5IX3A 4UA3A 1Q2CA 4MY3A 1NSLA 2I79A 4LUAA 4U9YA 3N7ZA 2G0BA 4KOUA 2OB0A 5G21A 1M4DA 3H4QA 3TCVA 4XPLA 2Z3NA 4QC6A 3TO6A 2OH1A 4NXYA 1XE4A 3LD2A 1V0CA 4L89A 4B5OA 4MHDA 3DR8A 3W6XA 3S6HA 4AVCA 4E8OA 1PU9A 4XPDB 3R9GA 4AVBA 3DDDA 2Z10A 1BO4A 3LODA 1M4GA 4B12A 2CXAA 3D2PA 2FXFA 4CAEA 5IB0A 1TIQA 5F48A 1YVKA 2B58A 4J3GA 4DNCA 3PP9A 2CNTA 4OADA 2VQYA 4F0XA 2FT0A 5G20A 4K30A 4PSWA 1VHSA 2G3TA 2P6FA 4PK2A 4XPKA 5HMNA 4AB7A 2VBQA 4KOVA 4HKFA 3SXNA 4C7HA 3PGPA 4ONUA 1M1DA 1GHEA 3E0KA 4UCNA 4ORFA 2I00A 3EXNA 3FRMA 3V8IA 4Q36A 4KOTA 4CGLA 3TO9A 2BEIA 3CXQA 1Z9UA 2B5GB 3FYNA 4FD6A 2DPTA 4KOYA 2Z3OA 3BJ8A 3QB8A 1YR0A 2REFA 2ZXVA 4QUSA 3T9YA 4CAWA 2B4DB 2PDOA 2H5MA 2Q04A 3EFAA 3SXOA 2B3UA 2Q44A 2FS5A 1MK4A 2JDCA 1WWZA 3P2HA 4UWJA 3IU2A 4MFZA 4CAXA 5F49A 4Q38A 1Y9KA 4A31A 2QMLA 3R95A 2VEZA 2FIWA 4CAVA 3BLNA 2WUUA 2AJ6A 3A9LA 4KORA 4B13A 3I3GA 1LRZA 2D4OA 2X7BA 3OWCA 4UCMA 4CYQA 4NEXA 3S6FA 1IICA 4Y49C 2NMTA 1S5KA 3G8WA 4KUAA 5HH1A 2B5GA 2VZYA 2ZW6A 3TFYA 1IYLA 4AG9A 4CRZB 4FD5A 3JUWA 5EBVA 1I12A 4R57A 5J8FA 5I0CA 2EUIA 2B4DA 2CNSA 1M4IA 2YNEA 3S6KA 4ZBGA 1S7KA 4NF1A 5H86A 2A4NA 4A32A 4XNHC 1S60A 4KLVA 4MI4A 2G3AA 1I1DA 1P4NA 4R3KA 5KTCA 1S7FA 4PSXA 2Q4VA 2ZW7A 1IYKA 2J8MA 4MY0A 1QSRA 1YREA 1YLEA 2KCWA 5GCNA 4RI1A 5AG7A 4F0YA 1KZFA 4R87A 2HUZA 4B14A 5AG6A 4EVYA 4JWPA 3TO7A 4R9MA 3SHPA 5AG4A 1WK4A 2VI7A 4HNWB 4JLYA 4IUSA 2OZHA 4A33A 2JDDA 3C26A 3R9FA 3EC4A 4NCZA 4NSQA 5CNPA 3ZJ0A 4B5PB 3T90A 3F5BA 2PQ8A 2GIVA 2GANA 3R96A 4XNHB 3DSBA 1MJBA 5F46A 4A95A 2FSRA 4M3SA 5G1ZA 4YFJA 1K4JA 4R3LA 1Z4RA 3FNCA 2HQYA 4MFJA 4E2AA 4QVTA 1S7NA 3TT2A 3IWGA 3DR6A 3UY5A 2R7HA 4PV6A 5AG5A 4H6ZA 2YNCC 1MJAA 1RXTA 1B6BA 3FXTA 2R8VA 1SQHA 1Z4EA 3TOBA 4A2ZA 4CGOA 3R9EA 1VKCA 4RS2A 3EO4A 4F6AA 5FVJA 2Z3LA 4KVXA 4KUBA 4QBJA 5A28A 2O28A 4MFPA 2DPSA 5C88A 5H84A 2VZZA 1J4JA 1BOBA 4JJXA 4KS9A 2R1IA 4B11A 3TTHA 2BSWA 2VXKA 2FE7A 3GY9A 4B5PA 2FIAA 4JXQA 5C82A 4X5KA 1OZPA 3FBUA 1KUVA 1IB1E 1NE9A 1XMTA 2D4PA 2Z11A 4GS4A 2F5IA 3VWEA 1U6MA 2PC1A 2YGWA 4MJ8A 2Q7BA 4CYOA 3PZJA 4PK3A 3B8GA 4C2ZA 2P0WA 3RYOA 4MBUA 2FCKA 4XPDC 1KUYA 1Q2YA 2OZUA 4UWIA 2Z3MA 2K5TA 2J8NA 4KSFA 4UFXA 4ZGYB 1QSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ISV A;  3CXP A;  4U5Y A;  4KVM E;  3GKR A;  1B87 A;  5E96 A;  3W6S A;  4OLL A;  5JQ4 A;  3W91 A;  2OZG A;  2PRB A;  2ARH A;  3IGR A;  3P2F A;  1XF8 A;  2JEV A;  1NMT A;  2OU2 A;  4FD4 A;  2FL4 A;  5DWN A;  5DWM A;  4KOW A;  1IID A;  1YGH A;  4JXR A;  1ON0 A;  2R98 A;  3CXS A;  3WR7 A;  4Y49 B;  2GE3 A;  3BJ7 A;  4YRH A;  4CS0 B;  3NE7 A;  2Z0Z A;  2WPX A;  2PR1 A;  1M44 A;  2ZPA A;  1YK3 A;  4FD7 A;  2DXQ A;  1Q2D A;  2IL4 A;  4KZT A;  2ATR A;  4II9 A;  2P6E A;  3F8K A;  4HNY B;  3S6G A;  2QEC A;  4YGO A;  3VWD A;  2B4B A;  3I9S A;  2BUE A;  1XEB A;  3G3S A;  2Y0M A;  4JD6 A;  4I49 A;  5J8C A;  4BMH A;  1QST A;  1KUX A;  3FIX A;  2Q4Y A;  1YVO A;  4CRY B;  1CM0 A;  5JPH A;  3F0A A;  2PR8 A;  2ZW4 A;  5KTA A;  1P0H A;  1YX0 A;  2WPW A;  1FY7 A;  3GYA A;  3FB3 A;  4L8A A;  1MJ9 A;  1Y9W A;  4KOX A;  1QSM A;  4IF5 A;  4H89 A;  4KOS A;  3EY5 A;  2HV2 A;  4HNX B;  2ZW5 A;  4UBR A;  2P6G A;  1L0C A;  4QB9 A;  3QAH A;  4H6U A;  4LX9 A;  4U9Z A;  1QSO A;  4M85 A;  2J8R A;  2CNM A;  3TOA A;  4AVA A;  2BL1 A;  2AE6 A;  2RC4 A;  5EC4 A;  4KVO E;  1CJW A;  3TE4 A;  2B3V A;  3MGD A;  3K9U A;  3D8P A;  3KKW A;  5F47 A;  1PUA A;  2JLM A;  1R57 A;  5IV0 A;  4OAE A;  1RO5 A;  2CY2 A;  2QIR A;  2PSW A;  2EVN A;  1S7L A;  1Y7R A;  2REE A;  1I21 A;  3JVN A;  1UFH A;  2Q0Y A;  1XIX A;  4E0A A;  3D2M A;  4AG7 A;  1N71 A;  3DNS A;  1S3Z A;  3R1K A;  3ZZI A;  2C27 A;  3D3S A;  4KLW A;  5KTD A;  5IX3 A;  4UA3 A;  1Q2C A;  4MY3 A;  1NSL A;  2I79 A;  4LUA A;  4U9Y A;  3N7Z A;  2G0B A;  4KOU A;  2OB0 A;  1M4D A;  3H4Q A;  3TCV A;  4XPL A;  4QC6 A;  3TO6 A;  2OH1 A;  4NXY A;  1XE4 A;  3LD2 A;  1V0C A;  4L89 A;  4B5O A;  4MHD A;  3DR8 A;  3W6X A;  3S6H A;  4AVC A;  4E8O A;  1PU9 A;  4XPD B;  3R9G A;  4AVB A;  3DDD A;  2Z10 A;  1BO4 A;  3LOD A;  1M4G A;  3D2P A;  2FXF A;  5IB0 A;  1TIQ A;  5F48 A;  1YVK A;  2B58 A;  4J3G A;  4DNC A;  3PP9 A;  2CNT A;  4OAD A;  2VQY A;  2FT0 A;  4K30 A;  4PSW A;  1VHS A;  2G3T A;  2P6F A;  4PK2 A;  4XPK A;  5HMN A;  4AB7 A;  2VBQ A;  4KOV A;  4HKF A;  3SXN A;  3PGP A;  4ONU A;  1M1D A;  1GHE A;  3E0K A;  4ORF A;  2I00 A;  3EXN A;  3FRM A;  3V8I A;  4KOT A;  3TO9 A;  2BEI A;  3CXQ A;  1Z9U A;  2B5G B;  3FYN A;  4FD6 A;  4KOY A;  3BJ8 A;  3QB8 A;  1YR0 A;  2REF A;  2ZXV A;  4QUS A;  3T9Y A;  4CAW A;  2B4D B;  2PDO A;  2H5M A;  2Q04 A;  3EFA A;  3SXO A;  2B3U A;  2Q44 A;  2FS5 A;  1MK4 A;  2JDC A;  1WWZ A;  3P2H A;  4UWJ A;  4CAX A;  5F49 A;  1Y9K A;  2QML A;  3R95 A;  2VEZ A;  2FIW A;  4CAV A;  3BLN A;  2AJ6 A;  4KOR A;  3I3G A;  1LRZ A;  2D4O A;  2X7B A;  3OWC A;  4NEX A;  3S6F A;  1IIC A;  4Y49 C;  2NMT A;  1S5K A;  3G8W A;  4KUA A;  5HH1 A;  2B5G A;  2VZY A;  2ZW6 A;  3TFY A;  1IYL A;  4AG9 A;  4CRZ B;  4FD5 A;  3JUW A;  5EBV A;  1I12 A;  4R57 A;  5J8F A;  5I0C A;  2EUI A;  2B4D A;  2CNS A;  1M4I A;  3S6K A;  4ZBG A;  1S7K A;  4NF1 A;  5H86 A;  2A4N A;  4XNH C;  1S60 A;  4KLV A;  4MI4 A;  2G3A A;  1I1D A;  1P4N A;  4R3K A;  5KTC A;  1S7F A;  4PSX A;  2Q4V A;  2ZW7 A;  1IYK A;  2J8M A;  4MY0 A;  1QSR A;  1YRE A;  1YLE A;  2KCW A;  5GCN A;  4RI1 A;  4F0Y A;  1KZF A;  4R87 A;  2HUZ A;  4EVY A;  4JWP A;  3TO7 A;  4R9M A;  3SHP A;  1WK4 A;  2VI7 A;  4HNW B;  4JLY A;  4IUS A;  2OZH A;  2JDD A;  3C26 A;  3R9F A;  3EC4 A;  4NCZ A;  4NSQ A;  5CNP A;  3ZJ0 A;  4B5P B;  3T90 A;  3F5B A;  2PQ8 A;  2GIV A;  2GAN A;  3R96 A;  4XNH B;  3DSB A;  1MJB A;  5F46 A;  2FSR A;  4M3S A;  4YFJ A;  1K4J A;  4R3L A;  1Z4R A;  3FNC A;  2HQY A;  4E2A A;  4QVT A;  1S7N A;  3TT2 A;  3IWG A;  3DR6 A;  3UY5 A;  2R7H A;  4PV6 A;  4H6Z A;  1MJA A;  1RXT A;  1B6B A;  3FXT A;  2R8V A;  1SQH A;  1Z4E A;  3TOB A;  3R9E A;  1VKC A;  4RS2 A;  3EO4 A;  4F6A A;  5FVJ A;  4KVX A;  4KUB A;  4QBJ A;  2O28 A;  5C88 A;  5H84 A;  2VZZ A;  1J4J A;  1BOB A;  4JJX A;  2R1I A;  3TTH A;  2BSW A;  2VXK A;  2FE7 A;  3GY9 A;  4B5P A;  2FIA A;  4JXQ A;  5C82 A;  4X5K A;  1OZP A;  3FBU A;  1KUV A;  1IB1 E;  1NE9 A;  1XMT A;  2D4P A;  2Z11 A;  4GS4 A;  2F5I A;  3VWE A;  1U6M A;  2PC1 A;  4MJ8 A;  2Q7B A;  3PZJ A;  4PK3 A;  3B8G A;  2P0W A;  3RYO A;  4MBU A;  2FCK A;  4XPD C;  1KUY A;  1Q2Y A;  2OZU A;  4UWI A;  2K5T A;  2J8N A;  1QSN A; 
#chains in the Genus database with same CATH topology
 5ISV A;  3CXP A;  4U5Y A;  4KVM E;  3GKR A;  1B87 A;  5E96 A;  4W9Y A;  3W6S A;  4OLL A;  1KWM A;  2ZEH A;  5JQ4 A;  3CZX A;  3W91 A;  1YQE A;  3HLP A;  2OZG A;  3GB0 A;  4CYN A;  3S9M A;  2PIY A;  2PRB A;  2PIZ A;  2ARH A;  3IGR A;  3P2F A;  1XF8 A;  2JEV A;  4MFK A;  4FUU A;  4A30 A;  1NMT A;  3B3V A;  2OU2 A;  2V8V A;  4FD4 A;  2FL4 A;  2PJ1 A;  1ZO0 A;  5DWN A;  4CGP A;  1VHO A;  5DWM A;  4KOW A;  2ZEG A;  1IID A;  4UFW A;  2Z3P A;  1YGH A;  4JXR A;  4X2T A;  1ON0 A;  2R98 A;  3CXS A;  5CBM A;  1ZG7 A;  3WR7 A;  2PJ7 A;  2V8D A;  3JTK A;  4Y49 B;  2PJ3 A;  3KI9 A;  2GE3 A;  1ELM P;  5G22 A;  3BJ7 A;  2XEI A;  2XEJ A;  3RZA A;  4YRH A;  4CS0 B;  3NE7 A;  4C7I A;  4RUH A;  2YNC A;  2ABZ A;  2Z0Z A;  2EO8 A;  3L2N A;  2WPX A;  2GRE A;  2PR1 A;  2YND A;  3PB4 X;  1M44 A;  4ZY0 A;  2ZPA A;  1NSA A;  1YK3 A;  2RB7 A;  4FD7 A;  1OBR A;  2PRQ A;  1JQG A;  1Q2D A;  2DXQ A;  2IL4 A;  4FAI A;  2AFW A;  3SJG A;  4KZT A;  3PFE A;  4IAV A;  2ATR A;  2O4H A;  4TWE A;  4R76 A;  4II9 A;  2PJ5 A;  2P6E A;  3F8K A;  4HNY B;  4CGN A;  3S6G A;  2QEC A;  4YGO A;  3VWD A;  4NFR A;  2B4B A;  3FMC A;  2BUE A;  1XEB A;  3D7D A;  3I9S A;  3G3S A;  3B2Y A;  2Y0M A;  1TKH A;  3PEI A;  4JD6 A;  3S9N A;  4LQG A;  2AFZ A;  3GLJ A;  4I49 A;  3IIB A;  4BMH A;  4C68 A;  5J8C A;  5HH1 A;  3B7I A;  4BD9 A;  1QST A;  4BBH A;  1KUX A;  5JM6 A;  3CPA A;  3FIX A;  2Q4Y A;  2QVP A;  1YVO A;  4KSA A;  4OIW A;  3H8E A;  4MHN A;  4NJQ A;  2EWB A;  1DE4 C;  2V77 A;  4CRY B;  1CM0 A;  4B10 A;  5JPH A;  1QMU A;  1IOI A;  2WZN A;  3F0A A;  3FF3 A;  3KL9 A;  2EBJ A;  2PR8 A;  1YW4 A;  2WYR A;  4CGM A;  3FEC A;  3NFZ A;  4OC1 A;  2ZW4 A;  3SI0 A;  1LCP A;  2V8H A;  5KTA A;  1CG2 A;  4Z65 A;  1LAM A;  1P0H A;  1YX0 A;  2WPW A;  4ZY2 A;  1FY7 A;  1XOV A;  1LAN A;  3FB3 A;  3GYA A;  1CPS A;  1MJ9 A;  4L8A A;  4P4F A;  1Y9W A;  4KOX A;  4M6I A;  4C2X A;  1QSM A;  3PBE A;  5K8O A;  4IF5 A;  4H89 A;  4KOS A;  1HDQ A;  3EY5 A;  1JWQ A;  2HV2 A;  2FVG A;  3NE8 A;  6CPA A;  4UFV A;  2F7V A;  4UF4 A;  2WSA A;  4HNX B;  1BAV A;  2ZW5 A;  4UBR A;  4JZ0 A;  2P6G A;  1L0C A;  2Q4Z A;  4OC2 A;  5D8N A;  1R3N A;  4QB9 A;  3PRT A;  3QAH A;  4H6U A;  3QNV A;  4LX9 A;  4U9Z A;  4H2K A;  4MCP A;  3NH4 A;  1QSO A;  4M85 A;  2J8R A;  4MFQ A;  3D67 A;  1Z2L A;  2CNM A;  3TOA A;  2ANP A;  1R43 A;  4AVA A;  1Z8T A;  4UEE A;  2PCU A;  2CTB A;  2BL1 A;  2AE6 A;  5HVG A;  1VHE A;  3BHX A;  2RC4 A;  5EC4 A;  4KVO E;  5BWA B;  1CJW A;  4GXH A;  3TE4 A;  2B3V A;  3MGD A;  3PB9 X;  4CAF A;  3K9U A;  2PE3 A;  2PJ0 A;  3D8P A;  2ZEO A;  3KKW A;  5F47 A;  4NGM A;  4OME A;  1F2O A;  1PUA A;  2JLM A;  1R57 A;  1YW6 A;  5IV0 A;  4OAE A;  1RO5 A;  1YME A;  2CY2 A;  4UCP A;  4C2Y A;  2Q43 A;  4OP4 A;  2QIR A;  4FBE A;  2PSW A;  1Y0R A;  5HXD A;  2EVN A;  4MCR A;  2C6P A;  1FNO A;  1S7L A;  1Y7R A;  2REE A;  4MFL A;  1CP7 A;  3H5Z A;  1I21 A;  3JVN A;  5ELY A;  3V7Z A;  1XFO A;  4MMO A;  1UFH A;  2Z3K A;  4NGQ A;  4BIN A;  2Q0Y A;  1XIX A;  3IWE A;  4E0A A;  3D2M A;  3IU1 A;  4AG7 A;  1N71 A;  3DNS A;  4NJR A;  1S3Z A;  4CYP A;  4NGN A;  5AGE A;  1XJO A;  1Z8L A;  3R1K A;  5A27 A;  4UIB A;  3ZZI A;  2C27 A;  3D3S A;  4KLW A;  5DS0 A;  5KTD A;  2I3C A;  5IX3 A;  4UA3 A;  2QYV A;  1Q2C A;  4MY3 A;  1NSL A;  2I79 A;  3FX6 A;  4LUA A;  4U9Y A;  3N7Z A;  5J1Q A;  3PB8 X;  2EK8 A;  2G0B A;  4UEF A;  4KOU A;  2OB0 A;  5G21 A;  3SI2 A;  1M4D A;  3H4Q A;  3TCV A;  4XPL A;  4YWY A;  2Z3N A;  4QC6 A;  1H8L A;  2C6C A;  2HC9 A;  3TO6 A;  4NGS A;  2OH1 A;  4NXY A;  1XE4 A;  4UEZ A;  5LRG A;  3LD2 A;  2AFU A;  1V0C A;  4L89 A;  4B5O A;  4MHD A;  3PB7 X;  3DR8 A;  3KQX A;  4P4I A;  3VH9 A;  2ZOF A;  3S6H A;  4PXE A;  1M4L A;  1PU9 A;  3W6X A;  4AVC A;  4E8O A;  4XPD B;  3R9G A;  4AVB A;  2CF4 A;  4OKO A;  3IEH A;  3D7G A;  2NSM A;  2Z10 A;  2JBK A;  3DDD A;  5THW A;  1Q7L A;  1BO4 A;  3LOD A;  1CP6 A;  1M4G A;  4B12 A;  2CXA A;  3D7H A;  3D2P A;  4P4J A;  5K8N A;  2FXF A;  4CAE A;  3V38 A;  5IB0 A;  1TIQ A;  1TXR A;  1YVK A;  2B58 A;  4J3G A;  5F48 A;  4DNC A;  1ZG9 A;  2IJZ A;  3LMS A;  4NGP A;  3PP9 A;  2RFH A;  4MHY A;  4OC4 A;  2CNT A;  4EWT A;  4OAD A;  1X10 A;  2VQY A;  3JRU A;  4F0X A;  2Q51 A;  4ZI6 A;  2FT0 A;  5G20 A;  4K30 A;  4PSW A;  1VHS A;  2G3T A;  2P6F A;  1IOF A;  3WC5 A;  3K9T A;  4PK2 A;  4XPK A;  2PJ6 A;  4AB7 A;  5HMN A;  3I1U A;  2VBQ A;  4KOV A;  4HKF A;  3NH5 A;  3SXN A;  4DUK A;  4C7H A;  2HB6 A;  4GM5 A;  3B3S A;  3D66 A;  2DF5 A;  3CPX A;  3WC6 A;  2CIJ A;  1A2Z A;  1M1D A;  1GHE A;  3E0K A;  3PGP A;  4ONU A;  4ORF A;  1CBX A;  2I00 A;  3EXN A;  3FRM A;  4UCN A;  2POK A;  1Y7E A;  4FWU A;  1QQ9 A;  3FVL A;  5JH9 A;  1AUG A;  1GYT A;  3B3T A;  4WWV A;  1TF9 A;  3V8I A;  4Q36 A;  4KOT A;  4CGL A;  3TO9 A;  2BEI A;  3CXQ A;  4M6G A;  3KHX A;  1DTD A;  1Z9U A;  2B5G B;  3FYN A;  2IMO A;  4A38 A;  3MRU A;  4FD6 A;  5JGF A;  2DPT A;  2ZEF A;  4KOY A;  5LRJ A;  1Z5R A;  2Z3O A;  3IJ3 A;  1TKJ A;  2O53 A;  3BJ8 A;  3QB8 A;  1YR0 A;  2AFS A;  2REF A;  3B3W A;  3DLJ A;  4IK2 A;  2ZXV A;  3CT9 A;  2ZEM A;  4QUS A;  4ONW A;  1TF8 A;  5LYI A;  3T9Y A;  4CAW A;  2B4D B;  4PXD A;  2PDO A;  2PVW A;  2H5M A;  2C6G A;  3K2K A;  4CPA A;  2Q04 A;  4EFD A;  2V8G A;  4F8Z A;  1Z8W A;  3S9L A;  3EFA A;  3SXO A;  3CDX A;  4P45 A;  1EE3 P;  3KHZ A;  2B3U A;  3B3C A;  2Q44 A;  2FS5 A;  4TNU A;  4OC3 A;  5EMI A;  5CPA A;  1MK4 A;  3PBB A;  3VAT A;  2JDC A;  5LYF A;  3PB6 X;  1WWZ A;  3P2H A;  2GLJ A;  4YU9 A;  4MRI A;  4UWJ A;  3IU2 A;  1AMP A;  4MFZ A;  3RNZ A;  3KR5 A;  4CAX A;  5F49 A;  2DEA A;  4P44 A;  2AFX A;  4Q38 A;  4DJL A;  1Y9K A;  4A31 A;  2QML A;  1BPM A;  1YSJ A;  1XRY A;  2JBJ A;  3R95 A;  2VEZ A;  2FIW A;  4CAV A;  2PJC A;  3BLN A;  4PXC A;  2WUU A;  2AJ6 A;  3A9L A;  4KOR A;  3SJF A;  2PJ8 A;  4B13 A;  1F2P A;  3I3G A;  1LFW A;  1LRZ A;  2D4O A;  3BXM A;  1XBU A;  2X7B A;  3OWC A;  2NYQ A;  4UCM A;  4F9U A;  3PFO A;  2ZEL A;  4CYQ A;  4NEX A;  3S6F A;  1IIC A;  4Y49 C;  4HPS A;  2NMT A;  1S5K A;  2BOA A;  2ZEE A;  3G8W A;  4KUA A;  2B5G A;  2G9D A;  2VZY A;  4JYW A;  2ZW6 A;  3SJX A;  3D7F A;  3TFY A;  1IYL A;  8CPA A;  3IFE A;  4AG9 A;  4P10 A;  4CRZ B;  3LWU A;  3JUW A;  4FD5 A;  1I12 A;  4MHP A;  1LAP A;  3ISZ A;  2XEF A;  4R57 A;  5EBV A;  4AXV A;  5J8F A;  4OC0 A;  3N5F A;  5I0C A;  5K8P A;  2EUI A;  1IGB A;  2ZOG A;  4MCS A;  2B4D A;  2CNS A;  3HUV A;  5IB9 A;  1M4I A;  2YNE A;  4KSI A;  4NGT A;  4ZBG A;  3S6K A;  3WT4 A;  2PJ9 A;  3H8G A;  3IWW A;  1S7K A;  4NF1 A;  5H86 A;  5LRK A;  4PXB A;  4X3R A;  2A4N A;  3IC1 A;  4XNH C;  1S60 A;  4A32 A;  1IU8 A;  4KLV A;  3ISX A;  4MI4 A;  4PQA A;  2G3A A;  4O23 A;  1I1D A;  1P4N A;  4R7M A;  4R3K A;  5KTC A;  1S7F A;  4PSX A;  2Q4V A;  1PYT B;  2ZW7 A;  1IYK A;  2J8M A;  4MY0 A;  1QSR A;  1YRE A;  4R8F A;  1YLE A;  2KCW A;  1ZLH A;  1ARL A;  1HDU A;  5GCN A;  4RI1 A;  1PCA A;  5AG7 A;  4F0Y A;  1KZF A;  3GIU A;  4G1P A;  4R87 A;  1FT7 A;  4MXU A;  2HUZ A;  4B14 A;  5AG6 A;  3WC7 A;  2ODF A;  4ZYQ A;  4LQ6 A;  5HVF A;  4JWP A;  4OID A;  3SI1 A;  4EVY A;  5HVH A;  2OR4 A;  3FH4 A;  3TO7 A;  3WAB A;  1YLO A;  4R9M A;  4UIA A;  3SHP A;  1LOK A;  3FEE A;  2GLF A;  1TKF A;  1Z8X A;  5AG4 A;  5LYL A;  2AFM A;  1WK4 A;  2VI7 A;  1BPN A;  2GU2 A;  4HNW B;  4JLY A;  4IUS A;  2OZH A;  2ZEN A;  3NH8 A;  4ZX8 A;  4P4D A;  4A33 A;  1XMB A;  2PJ4 A;  3IO1 A;  4M6H A;  2JDD A;  3C26 A;  1ELL P;  3R9F A;  3EC4 A;  1CPX A;  4NCZ A;  4NSQ A;  2C1C A;  3FJU A;  5CNP A;  3ZJ0 A;  1ZLI A;  3BI0 A;  4B5P B;  3T90 A;  3VAR A;  3F5B A;  2PQ8 A;  2GIV A;  3D4U A;  3NA6 A;  4A39 A;  2GAN A;  3MN8 A;  2PJB A;  4F9V A;  3R96 A;  4XNH B;  3GUX A;  3DSB A;  4P6Y A;  1RTQ A;  3TX8 A;  1MJB A;  5F46 A;  4A95 A;  1F57 A;  2FSR A;  4M3S A;  5G1Z A;  1BLL E;  1VIX A;  1AYE A;  3FED A;  4YFJ A;  1K4J A;  4R3L A;  1Z4R A;  3D68 A;  3FNC A;  4P4B A;  2HQY A;  4MFJ A;  4E2A A;  5K8M A;  2BO9 A;  4QVT A;  3B35 A;  1ARM A;  1S7N A;  2JEW A;  3TT2 A;  3IWG A;  2CTC A;  2IQ6 A;  3DR6 A;  4ZY1 A;  3UY5 A;  4IHM A;  2R7H A;  4PV6 A;  5AG5 A;  4H6Z A;  2YNC C;  1MJA A;  1RXT A;  3KR4 A;  4NGR A;  4R6T A;  1B6B A;  4MHZ A;  3FXT A;  2R8V A;  1SQH A;  2PJA A;  1Z4E A;  1VGY A;  3TOB A;  4A2Z A;  4CGO A;  4DYO A;  2Q7S A;  3KZW A;  3R9E A;  3RAM A;  3LAC A;  1VKC A;  4RS2 A;  3EO4 A;  4Q7A A;  1Y0Y A;  4P4E A;  1ZG8 A;  2ZEP A;  3DGV A;  4ZX9 A;  4F6A A;  4K3N A;  5FVJ A;  2Z3L A;  4KVX A;  2J9A A;  4KUB A;  4QBJ A;  4B6Z A;  5F09 A;  5A28 A;  2O28 A;  3T8W A;  4MFP A;  2XEG A;  2PVV A;  2DPS A;  5C88 A;  1UWY A;  5H84 A;  2QJ8 A;  2VZZ A;  3QAY A;  1J4J A;  1BOB A;  5D29 A;  4JJX A;  4KS9 A;  2R1I A;  4B11 A;  3TTH A;  2BSW A;  2VXK A;  2FE7 A;  3GY9 A;  3BI1 A;  3H8F A;  4B5P A;  2FIA A;  2BCO A;  4OC5 A;  4EME A;  4JXQ A;  2EK9 A;  4A94 A;  5C82 A;  3KQZ A;  4X5K A;  1OZP A;  3FBU A;  3RBU A;  2AFO A;  7CPA A;  3SJE A;  5I4M A;  1KUV A;  1IY7 A;  1IB1 E;  1NE9 A;  2ZED A;  1XMT A;  2D4P A;  2OOT A;  2Z11 A;  3TC8 A;  4GS4 A;  4MCQ A;  2F5I A;  3RO0 A;  3VWE A;  4WJB A;  1U6M A;  2GFQ A;  1HEE A;  2PC1 A;  2YGW A;  4MJ8 A;  2Q7B A;  4A37 A;  3PZJ A;  4PK3 A;  3B8G A;  4CYO A;  3KGQ A;  4PPZ A;  4RN7 A;  4C2Z A;  2P0W A;  5LYD A;  3RYO A;  4MBU A;  3KAS A;  2F8H A;  2FCK A;  4X8I A;  1KUY A;  1Q2Y A;  4XPD C;  1CX8 A;  2OZU A;  4UWI A;  2Z3M A;  2VL1 A;  2K5T A;  2J8N A;  4KSF A;  4UFX A;  1X12 A;  4ZGY B;  1QSN A;  2PJ2 A; 
#chains in the Genus database with same CATH homology
 5ISV A;  3CXP A;  4U5Y A;  4KVM E;  3GKR A;  1B87 A;  5E96 A;  3W6S A;  4OLL A;  5JQ4 A;  3W91 A;  2OZG A;  4CYN A;  2PRB A;  2ARH A;  3IGR A;  3P2F A;  1XF8 A;  2JEV A;  4MFK A;  4A30 A;  1NMT A;  2OU2 A;  4FD4 A;  2FL4 A;  1ZO0 A;  5DWN A;  4CGP A;  5DWM A;  4KOW A;  1IID A;  4UFW A;  2Z3P A;  1YGH A;  4JXR A;  1ON0 A;  2R98 A;  3CXS A;  3WR7 A;  3JTK A;  4Y49 B;  2GE3 A;  5G22 A;  3BJ7 A;  4YRH A;  4CS0 B;  3NE7 A;  4C7I A;  2YNC A;  2Z0Z A;  2WPX A;  2PR1 A;  2YND A;  1M44 A;  2ZPA A;  1YK3 A;  4FD7 A;  2DXQ A;  1Q2D A;  2IL4 A;  4KZT A;  2ATR A;  4II9 A;  2P6E A;  3F8K A;  4HNY B;  4CGN A;  3S6G A;  2QEC A;  4YGO A;  3VWD A;  2B4B A;  3I9S A;  2BUE A;  1XEB A;  3G3S A;  2Y0M A;  4JD6 A;  4I49 A;  5J8C A;  4BMH A;  4C68 A;  1QST A;  4BBH A;  1KUX A;  3FIX A;  2Q4Y A;  1YVO A;  4KSA A;  4CRY B;  1CM0 A;  4B10 A;  5JPH A;  3F0A A;  2PR8 A;  4CGM A;  2ZW4 A;  5KTA A;  1P0H A;  1YX0 A;  2WPW A;  1FY7 A;  3GYA A;  3FB3 A;  4L8A A;  1MJ9 A;  4C2X A;  1Y9W A;  4KOX A;  1QSM A;  4IF5 A;  4H89 A;  4KOS A;  3EY5 A;  2HV2 A;  4UFV A;  2WSA A;  4HNX B;  2ZW5 A;  4UBR A;  2P6G A;  1L0C A;  4QB9 A;  3QAH A;  4H6U A;  4LX9 A;  4U9Z A;  1QSO A;  4M85 A;  2J8R A;  4MFQ A;  2CNM A;  3TOA A;  4AVA A;  2BL1 A;  2AE6 A;  2RC4 A;  5EC4 A;  4KVO E;  5BWA B;  1CJW A;  3TE4 A;  2B3V A;  3MGD A;  4CAF A;  3K9U A;  3D8P A;  3KKW A;  5F47 A;  1PUA A;  2JLM A;  1R57 A;  5IV0 A;  4OAE A;  1RO5 A;  2CY2 A;  4UCP A;  4C2Y A;  2QIR A;  2PSW A;  2EVN A;  1S7L A;  1Y7R A;  2REE A;  4MFL A;  3H5Z A;  1I21 A;  3JVN A;  1UFH A;  2Z3K A;  2Q0Y A;  1XIX A;  3IWE A;  4E0A A;  3D2M A;  3IU1 A;  4AG7 A;  1N71 A;  3DNS A;  1S3Z A;  4CYP A;  5AGE A;  3R1K A;  5A27 A;  3ZZI A;  2C27 A;  3D3S A;  4KLW A;  5KTD A;  5IX3 A;  4UA3 A;  1Q2C A;  4MY3 A;  1NSL A;  2I79 A;  4LUA A;  4U9Y A;  3N7Z A;  2G0B A;  4KOU A;  2OB0 A;  5G21 A;  1M4D A;  3H4Q A;  3TCV A;  4XPL A;  2Z3N A;  4QC6 A;  3TO6 A;  2OH1 A;  4NXY A;  1XE4 A;  3LD2 A;  1V0C A;  4L89 A;  4B5O A;  4MHD A;  3DR8 A;  3W6X A;  3S6H A;  4AVC A;  4E8O A;  1PU9 A;  4XPD B;  3R9G A;  4AVB A;  3DDD A;  2Z10 A;  1BO4 A;  3LOD A;  1M4G A;  4B12 A;  2CXA A;  3D2P A;  2FXF A;  4CAE A;  5IB0 A;  1TIQ A;  5F48 A;  1YVK A;  2B58 A;  4J3G A;  4DNC A;  3PP9 A;  2CNT A;  4OAD A;  2VQY A;  4F0X A;  2FT0 A;  5G20 A;  4K30 A;  4PSW A;  1VHS A;  2G3T A;  2P6F A;  4PK2 A;  4XPK A;  5HMN A;  4AB7 A;  2VBQ A;  4KOV A;  4HKF A;  3SXN A;  4C7H A;  3PGP A;  4ONU A;  1M1D A;  1GHE A;  3E0K A;  4UCN A;  4ORF A;  2I00 A;  3EXN A;  3FRM A;  3V8I A;  4Q36 A;  4KOT A;  4CGL A;  3TO9 A;  2BEI A;  3CXQ A;  1Z9U A;  2B5G B;  3FYN A;  4FD6 A;  2DPT A;  4KOY A;  2Z3O A;  3BJ8 A;  3QB8 A;  1YR0 A;  2REF A;  2ZXV A;  4QUS A;  3T9Y A;  4CAW A;  2B4D B;  2PDO A;  2H5M A;  2Q04 A;  3EFA A;  3SXO A;  2B3U A;  2Q44 A;  2FS5 A;  1MK4 A;  2JDC A;  1WWZ A;  3P2H A;  4UWJ A;  3IU2 A;  4MFZ A;  4CAX A;  5F49 A;  4Q38 A;  1Y9K A;  4A31 A;  2QML A;  3R95 A;  2VEZ A;  2FIW A;  4CAV A;  3BLN A;  2WUU A;  2AJ6 A;  3A9L A;  4KOR A;  4B13 A;  3I3G A;  1LRZ A;  2D4O A;  2X7B A;  3OWC A;  4UCM A;  4CYQ A;  4NEX A;  3S6F A;  1IIC A;  4Y49 C;  2NMT A;  1S5K A;  3G8W A;  4KUA A;  5HH1 A;  2B5G A;  2VZY A;  2ZW6 A;  3TFY A;  1IYL A;  4AG9 A;  4CRZ B;  4FD5 A;  3JUW A;  5EBV A;  1I12 A;  4R57 A;  5J8F A;  5I0C A;  2EUI A;  2B4D A;  2CNS A;  1M4I A;  2YNE A;  3S6K A;  4ZBG A;  1S7K A;  4NF1 A;  5H86 A;  2A4N A;  4A32 A;  4XNH C;  1S60 A;  4KLV A;  4MI4 A;  2G3A A;  1I1D A;  1P4N A;  4R3K A;  5KTC A;  1S7F A;  4PSX A;  2Q4V A;  2ZW7 A;  1IYK A;  2J8M A;  4MY0 A;  1QSR A;  1YRE A;  1YLE A;  2KCW A;  5GCN A;  4RI1 A;  5AG7 A;  4F0Y A;  1KZF A;  4R87 A;  2HUZ A;  4B14 A;  5AG6 A;  4EVY A;  4JWP A;  3TO7 A;  4R9M A;  3SHP A;  5AG4 A;  1WK4 A;  2VI7 A;  4HNW B;  4JLY A;  4IUS A;  2OZH A;  4A33 A;  2JDD A;  3C26 A;  3R9F A;  3EC4 A;  4NCZ A;  4NSQ A;  5CNP A;  3ZJ0 A;  4B5P B;  3T90 A;  3F5B A;  2PQ8 A;  2GIV A;  2GAN A;  3R96 A;  4XNH B;  3DSB A;  1MJB A;  5F46 A;  4A95 A;  2FSR A;  4M3S A;  5G1Z A;  4YFJ A;  1K4J A;  4R3L A;  1Z4R A;  3FNC A;  2HQY A;  4MFJ A;  4E2A A;  4QVT A;  1S7N A;  3TT2 A;  3IWG A;  3DR6 A;  3UY5 A;  2R7H A;  4PV6 A;  5AG5 A;  4H6Z A;  2YNC C;  1MJA A;  1RXT A;  1B6B A;  3FXT A;  2R8V A;  1SQH A;  1Z4E A;  3TOB A;  4A2Z A;  4CGO A;  3R9E A;  1VKC A;  4RS2 A;  3EO4 A;  4F6A A;  5FVJ A;  2Z3L A;  4KVX A;  4KUB A;  4QBJ A;  5A28 A;  2O28 A;  4MFP A;  2DPS A;  5C88 A;  5H84 A;  2VZZ A;  1J4J A;  1BOB A;  4JJX A;  4KS9 A;  2R1I A;  4B11 A;  3TTH A;  2BSW A;  2VXK A;  2FE7 A;  3GY9 A;  4B5P A;  2FIA A;  4JXQ A;  5C82 A;  4X5K A;  1OZP A;  3FBU A;  1KUV A;  1IB1 E;  1NE9 A;  1XMT A;  2D4P A;  2Z11 A;  4GS4 A;  2F5I A;  3VWE A;  1U6M A;  2PC1 A;  2YGW A;  4MJ8 A;  2Q7B A;  4CYO A;  3PZJ A;  4PK3 A;  3B8G A;  4C2Z A;  2P0W A;  3RYO A;  4MBU A;  2FCK A;  4XPD C;  1KUY A;  1Q2Y A;  2OZU A;  4UWI A;  2Z3M A;  2K5T A;  2J8N A;  4KSF A;  4UFX A;  4ZGY B;  1QSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...