1PUAA

Crystal structure of tetrahymena gcn5 with bound coenzyme a and a phosphorylated, 19-residue histone h3 peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
162
structure length
162
Chain Sequence
LDFDILTNDGTHRNMKLLIDLKNIFSRQLPKMPKEYIVKLVFDRHHESMVILKNKQKVIGGICFRQYKPQRFAEVAFLAVTANEQVRGYGTRLMNKFKDHMQKQNIEYLLTYADNFAIGYFKKQGFTKEHRMPQEKWKGYIKDYDGGTLMECYIHPYVDYGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HAT A1
publication title Structural basis for histone and phospho-histone binding by the GCN5 histone acetyltransferase
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Transferase/structural protein
total genus 44
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2003-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1puaA00
3R96A 1IYKA 4MY0A 3I3GA 1YREA 2VZZA 4X5KA 2FXFA 2FIWA 2GIVA 2VXKA 4PSWA 2FSRA 2G3TA 4CS0B 1QSNA 4KOSA 3R9EA 2PR1A 2ATRA 3TO6A 1KUXA 1S7NA 2B4BA 2JDDA 2VZYA 3W6SA 2Z0ZA 4H89A 4NCZA 4Y49B 1IYLA 4R87A 3BJ7A 1ON0A 3CXSA 1XIXA 5J8CA 2KCWA 1B6BA 2OB0A 1M4DA 1M4IA 4HNYB 2QECA 4R57A 4CAWA 3I9SA 3EFAA 4JXQA 1M1DA 1SQHA 2PSWA 3GY9A 4Y49C 1MJBA 2Z10A 2ZXVA 3G8WA 2P6EA 2B5GB 2B5GA 3EC4A 2J8NA 1S7FA 4IUSA 4NXYA 3C26A 3SXNA 3K9UA 4II9A 3R1KA 4EVYA 4QUSA 2G0BA 3T90A 2FT0A 2D4OA 1PU9A 4KOUA 2H5MA 3DR6A 4R3LA 3D8PA 4E8OA 3BJ8A 4ORFA 3R9GA 2X7BA 4L89A 1BOBA 2REEA 2Q7BA 5I0CA 3WR7A 4KOTA 2ZW6A 2REFA 1XF8A 4KLWA 3ZJ0A 4AG9A 4QBJA 4K30A 3JVNA 1QSOA 3BLNA 1XEBA 4U9ZA 4AG7A 1FY7A 4KVXA 3E0KA 1J4JA 4E0AA 2FCKA 4MHDA 1Y9WA 3N7ZA 1V0CA 4LX9A 3CXQA 5IB0A 4GS4A 4KVOE 1KUYA 1P4NA 5H86A 3S6HA 3CXPA 3P2FA 4AB7A 4AVCA 1MJAA 2B58A 2JLMA 2EUIA 4B5OA 2CNTA 1LRZA 5HMNA 1IICA 4KLVA 2Y0MA 1BO4A 4AVAA 4HNWB 3SXOA 3TO9A 5IX3A 4H6UA 1XMTA 1S5KA 4XNHB 1KZFA 2G3AA 1WK4A 2FE7A 5E96A 4NSQA 1TIQA 2ARHA 1VKCA 1Q2YA 5FVJA 2WPXA 1QSMA 4PK3A 2Q44A 3DSBA 2OZUA 2JDCA 4KOWA 2Q0YA 4M3SA 1Y9KA 3DNSA 3R95A 4XPDC 2BSWA 4CRYB 1NMTA 1YGHA 2AJ6A 1YLEA 4MBUA 3LD2A 4OAEA 1MK4A 3P2HA 3TCVA 3LODA 3SHPA 4XNHC 4MY3A 1CM0A 5DWMA 1R57A 1M4GA 3PP9A 2R8VA 4R3KA 2Q4VA 4JJXA 5F49A 2Q04A 3TT2A 4JXRA 4F6AA 3RYOA 3F8KA 2B3VA 2NMTA 3GYAA 4XPLA 2A4NA 1RO5A 3W91A 1P0HA 4NF1A 1I21A 4KOYA 3S6GA 1UFHA 4ZBGA 2I79A 3B8GA 2HUZA 4FD5A 4KZTA 3QB8A 4LUAA 2J8RA 1YR0A 1Z4EA 3FYNA 2ZW4A 2P6FA 3D2PA 5IV0A 5JPHA 1CJWA 1YVKA 1L0CA 4JLYA 5CNPA 4FD6A 4CRZB 3EO4A 1KUVA 3IGRA 4CAVA 5DWNA 2F5IA 4CAXA 4QVTA 1Z4RA 4YGOA 2CY2A 1MJ9A 3PZJA 3FIXA 1NSLA 4QB9A 3ZZIA 1S60A 1YVOA 4L8AA 1S3ZA 3V8IA 2WPWA 3VWEA 2JEVA 1VHSA 1Q2DA 2ZW7A 5KTDA 4MI4A 2R7HA 5EC4A 4RI1A 5KTCA 4XPDB 4KOVA 2HQYA 3TTHA 2R1IA 4J3GA 2OZHA 3DR8A 1B87A 1QSTA 1Z9UA 2QIRA 3F5BA 1NE9A 1M44A 4KORA 3S6FA 3TE4A 3KKWA 5HH1A 2OU2A 4IF5A 2QMLA 4B5PB 3F0AA 4B5PA 1N71A 4UA3A 3W6XA 5ISVA 3R9FA 2B4DB 4NEXA 2B4DA 2O28A 1IIDA 2AE6A 2I00A 2RC4A 4M85A 3TOBA 5JQ4A 3FXTA 4U9YA 3FB3A 4OLLA 2FIAA 4HKFA 4YFJA 3TO7A 5GCNA 1RXTA 5F48A 5F47A 1PUAA 2BEIA 4UWJA 3D2MA 3FRMA 3VWDA 2EVNA 2BUEA 3EY5A 1S7LA 5F46A 3JUWA 4JWPA 2J8MA 3TFYA 1I1DA 4OADA 1YX0A 2PQ8A 2K5TA 1IB1E 1GHEA 2FL4A 2DXQA 4E2AA 4H6ZA 2PRBA 3OWCA 5J8FA 5C82A 4DNCA 1Y7RA 2P0WA 2FS5A 3EXNA 4FD4A 2OH1A 4KUAA 2D4PA 4ONUA 3NE7A 4F0YA 4PV6A 2PDOA 3D3SA 4I49A 5C88A 1K4JA 1QSRA 2R98A 2GE3A 3FBUA 2GANA 2B3UA 3DDDA 3PGPA 2HV2A 4PK2A 4UBRA 4YRHA 3S6KA 2ZPAA 3H4QA 3IWGA 2VBQA 4FD7A 2BL1A 3QAHA 4PSXA 2C27A 3FNCA 4XPKA 1WWZA 3MGDA 3TOAA 5H84A 2PR8A 5KTAA 2ZW5A 5EBVA 2IL4A 2PC1A 2Z11A 3UY5A 4U5YA 4KUBA 1XE4A 2VI7A 2CNMA 2CNSA 4AVBA 3T9YA 2VQYA 2VEZA 1S7KA 4BMHA 2P6GA 4RS2A 1Q2CA 2OZGA 4HNXB 4MJ8A 4QC6A 4R9MA 4JD6A 1YK3A 1U6MA 3GKRA 4KOXA 4KVME 3G3SA 1I12A 1OZPA 4UWIA 2Q4YA
chains in the Genus database with same CATH superfamily
5AG6A 2C6PA 1DE4C 4LQGA 1IYKA 4MY0A 4UCMA 5D8NA 3R96A 2GREA 4BBHA 1ELLP 4LQ6A 5THWA 3I3GA 2C6GA 1YREA 2VZZA 2FVGA 4X5KA 4HPSA 4NGQA 4NGMA 2FXFA 2FIWA 2GIVA 2QYVA 2VXKA 2ZOGA 4M6GA 4PSWA 2Q7SA 2PVWA 5LYFA 2C6CA 5ELYA 1ZLIA 2FSRA 2G3TA 3N5FA 4Q36A 1IOFA 3VARA 3JTKA 4CS0B 1QSNA 4KOSA 3R9EA 2PR1A 2Q4ZA 2ATRA 4UCNA 3TO6A 3WABA 4M6IA 1KUXA 1S7NA 2B4BA 2JDDA 2VZYA 3RZAA 5HVHA 3W6SA 2Z0ZA 1VHEA 2AFMA 4H89A 4A31A 4NCZA 2PJ4A 2DPSA 4Y49B 4KS9A 4IK2A 2PJCA 3B3VA 3D7DA 4AXVA 2YGWA 3B2YA 4IHMA 1IYLA 4MXUA 4R87A 3BJ7A 3KI9A 3LWUA 4PXBA 2YNCA 3I1UA 1ON0A 2V77A 1XIXA 3B3CA 3CXSA 5J8CA 2KCWA 1B6BA 4UFWA 3CPAA 4C2XA 1LFWA 1JQGA 2OB0A 3K9TA 2NSMA 4OC0A 3IC1A 2POKA 4A33A 3H8EA 1M4DA 3GUXA 4PXDA 4ZYQA 1LAPA 1M4IA 4WWVA 2JBJA 3CZXA 4HNYB 2XEJA 2XEGA 2QECA 4R57A 4CAWA 3I9SA 3EFAA 1DTDA 4JXQA 4MFLA 1CX8A 5AGEA 1M1DA 5AG7A 1SQHA 1FT7A 2OR4A 2HC9A 3SI2A 4OC1A 2PSWA 3HUVA 3GY9A 5G22A 4NGPA 1VHOA 4Y49C 3CDXA 2EK9A 1MJBA 2CF4A 2Z10A 2ZXVA 3G8WA 2P6EA 2B5GB 3HLPA 3NA6A 4FBEA 2B5GA 3EC4A 3PB4X 3KHXA 4UEZA 2J8NA 1FNOA 2RB7A 2CTCA 1S7FA 3NH5A 4IUSA 4NXYA 5AG5A 3C26A 4F8ZA 2DPTA 2ABZA 3KR4A 2CTBA 3K9UA 3NFZA 2GLFA 1QQ9A 4OC2A 3SXNA 2ZEMA 3NH4A 4II9A 1GYTA 3R1KA 4EVYA 4MFPA 4QUSA 2G0BA 3PB7X 3T90A 3DGVA 2G9DA 2Z3OA 1KWMA 2FT0A 2D4OA 1YW4A 3IEHA 1PU9A 4KOUA 2H5MA 3S9NA 1CPSA 2Z3LA 1EE3P 3DR6A 4R3LA 3D8PA 4UFVA 4E8OA 5BWAB 2GU2A 3BJ8A 4NGRA 3B3WA 3H8FA 4ORFA 1ZLHA 2O53A 3R9GA 1CPXA 2X7BA 4R8FA 4L89A 3FECA 5K8MA 1BOBA 1HDQA 3PBBA 2I3CA 1YMEA 4UEFA 2REEA 4TNUA 4WJBA 2Q7BA 4MHZA 5I0CA 3WR7A 4KOTA 2ZW6A 3WC5A 1XF8A 2REFA 4KLWA 4PXCA 3ZJ0A 4YWYA 4AG9A 4ZX9A 5HXDA 4QBJA 4K30A 3QNVA 4JZ0A 4EFDA 1Z8WA 3JVNA 2CXAA 1QSOA 1ZG9A 3BLNA 2GLJA 3VATA 4X8IA 3MRUA 1XEBA 2PJ6A 4U9ZA 4AG7A 3SI0A 1FY7A 4CYQA 4DYOA 5CBMA 4ZY2A 4KVXA 3E0KA 1J4JA 4P4IA 4E0AA 2IQ6A 2FCKA 3KHZA 1TKJA 4MHDA 1ARMA 1Y9WA 3N7ZA 1V0CA 3D66A 3IJ3A 4LX9A 4CYPA 3CXQA 2PJ7A 5IB0A 4GS4A 4KVOE 1UWYA 3KQZA 1KUYA 1P4NA 5H86A 3S6HA 2YNDA 1BPMA 3CXPA 3P2FA 1Y0YA 3D68A 4AB7A 4AVCA 5HVGA 3JRUA 2PE3A 4ONWA 2Z3PA 4P4FA 4BINA 1XFOA 1MJAA 2B58A 2JLMA 2V8DA 3V38A 2EUIA 2HB6A 2J9AA 2PJ3A 4B5OA 2V8VA 2PCUA 2CNTA 3FMCA 4B14A 1M4LA 2EWBA 5JM6A 2Z3NA 1LCPA 1LRZA 4O23A 5HMNA 1IICA 4KLVA 2Y0MA 1BO4A 4AVAA 4HNWB 3SXOA 4EWTA 2PJ1A 3TO9A 5IX3A 4H6UA 1XMTA 1S5KA 4OIWA 4XNHB 4FUUA 1TKHA 1YW6A 1KZFA 2G3AA 1WK4A 2FE7A 2PJ8A 5E96A 4NSQA 1TIQA 2ARHA 4MHPA 2BCOA 4B6ZA 1VKCA 2NYQA 1Q2YA 4P4EA 5FVJA 3TC8A 4CGMA 2WPXA 1QSMA 2ZEPA 2Z3MA 4F0XA 3KASA 4OMEA 5K8NA 4PK3A 2Q44A 3FEDA 3DSBA 2OZUA 4NJRA 4CGNA 4P10A 2JDCA 4KOWA 4B11A 2ZEOA 2Q0YA 4M3SA 1Y9KA 2F7VA 3DNSA 4CGLA 4YU9A 1CP7A 3R95A 4XPDC 2BSWA 4B12A 3BI0A 1AYEA 4CRYB 1ARLA 1NMTA 1YGHA 2AJ6A 1YLEA 5HVFA 5LRJA 4RUHA 2GFQA 4Q38A 1TF8A 2O4HA 1HEEA 3RAMA 2V8GA 4KSAA 4MBUA 3B35A 1ELMP 3GLJA 1YQEA 2ZEEA 1XJOA 2WYRA 3LD2A 4OAEA 1MK4A 3A9LA 3P2HA 3TCVA 2C1CA 3B7IA 3LODA 4P6YA 3FVLA 1X12A 4MHYA 2OOTA 3SHPA 4XNHC 4A39A 4X3RA 1HDUA 3ISZA 4MY3A 1XRYA 1CM0A 2ZEDA 4EMEA 6CPAA 5DWMA 1R57A 2CIJA 4KSIA 3KQXA 4NJQA 1M4GA 3PP9A 2R8VA 1AMPA 2Q4VA 4JJXA 4R3KA 1BLLE 5F49A 2Q04A 3TT2A 3VH9A 4CYNA 3NE8A 3CPXA 4C2ZA 4IAVA 4P45A 4JXRA 4A95A 3KGQA 4F6AA 3RYOA 4P4DA 4OKOA 3BI1A 3F8KA 2B3VA 2NMTA 2PJBA 1TF9A 2PIZA 2XEFA 4NFRA 5LRKA 3GYAA 2PJ9A 1PYTB 3FX6A 3GB0A 3TX8A 4XPLA 3PRTA 2A4NA 1IU8A 4OIDA 5LYLA 1RO5A 3W91A 1P0HA 4NF1A 4R76A 2Z3KA 1I21A 4KOYA 3S6GA 4ZGYB 1UFHA 3D7HA 1F57A 4MHNA 4ZBGA 2I79A 3B8GA 1H8LA 2HUZA 3B3SA 4FD5A 4UF4A 4DJLA 3PBEA 1XOVA 1Z8TA 5D29A 4F9UA 4KZTA 3QB8A 4LUAA 4MCPA 2J8RA 4ZY1A 1YLOA 1YR0A 1Z4EA 3FYNA 2ZW4A 2P6FA 3D2PA 5LYDA 5IV0A 5JPHA 1CJWA 5G21A 1YVKA 4CGOA 1L0CA 1VIXA 4BD9A 4JLYA 4MFJA 5I4MA 5K8OA 5CNPA 1CBXA 4R7MA 1IGBA 3H5ZA 4FD6A 3T8WA 4CRZB 3BXMA 3EO4A 1KUVA 4ZX8A 3IGRA 4CAVA 5DWNA 1JWQA 2F5IA 3PB8X 4B13A 4CAXA 4QVTA 7CPAA 4PQAA 1Z4RA 4Q7AA 4YGOA 4C68A 2CY2A 4DUKA 1MJ9A 1AUGA 3IU1A 4UIAA 1Y0RA 3PZJA 3FIXA 3IIBA 1Y7EA 4QB9A 2QVPA 1NSLA 3ZZIA 2V8HA 1S60A 3PFEA 1YVOA 3QAYA 3V7ZA 4L8AA 4M6HA 1VGYA 1S3ZA 4RN7A 3V8IA 2ZENA 3H8GA 2WPWA 2BO9A 2JBKA 3VWEA 2JEWA 3DLJA 4P44A 2JEVA 4OP4A 1VHSA 1Q2DA 2ZW7A 5KTDA 4MCRA 4MI4A 2R7HA 5EC4A 4RI1A 5KTCA 4NGTA 2Q51A 4XPDB 4A32A 4KOVA 2IJZA 2HQYA 3TTHA 2R1IA 4J3GA 3FF3A 4MFZA 2OZHA 4A38A 3FEEA 2AFXA 3DR8A 3D7GA 3PB6X 3IO1A 1B87A 1QSTA 1XBUA 5DS0A 1Z9UA 2QIRA 3F5BA 1NE9A 1Z2LA 1M44A 4KORA 5K8PA 2ANPA 4MMOA 4OC5A 3S6FA 5A27A 2WSAA 4MCQA 1OBRA 2PRQA 3KKWA 3TE4A 1Q7LA 5HH1A 2OU2A 4IF5A 2AFWA 2QMLA 2RFHA 4B5PB 3F0AA 3D7FA 1N71A 1ZO0A 4B5PA 4UA3A 2YNEA 3RNZA 3IU2A 4TWEA 4OC4A 3W6XA 4K3NA 3R9FA 2B4DB 4NEXA 5ISVA 4A30A 2B4DA 3GIUA 2O28A 5F09A 1IIDA 3SJEA 2AE6A 2I00A 2RC4A 4M85A 4PPZA 8CPAA 4A37A 4B10A 2ODFA 3TOBA 5JQ4A 3FXTA 4U9YA 3FB3A 4PXEA 4W9YA 3KZWA 4MRIA 4OLLA 2XEIA 2FIAA 4HKFA 2ZELA 4YFJA 3FH4A 3TO7A 5GCNA 2AFOA 1RXTA 3LMSA 3L2NA 5F48A 5F47A 1LAMA 1PUAA 2BEIA 4UWJA 3D2MA 3FRMA 3S9MA 3VWDA 4MFKA 2EVNA 2BUEA 5IB9A 1F2PA 1CG2A 3EY5A 1S7LA 4JYWA 3JUWA 4JWPA 3WC7A 2J8MA 5F46A 3TFYA 1I1DA 4OADA 1YX0A 4UFXA 3PB9X 2PQ8A 4C7HA 2K5TA 3KR5A 3SJGA 2Q43A 5AG4A 1TXRA 1IOIA 1IB1E 3FJUA 2F8HA 1GHEA 3PFOA 4H2KA 4C2YA 3S9LA 1LOKA 4R6TA 3IWWA 2FL4A 1R43A 2DXQA 1XMBA 4E2AA 4H6ZA 1F2OA 2PRBA 3OWCA 4CGPA 5J1QA 2EK8A 3CT9A 5J8FA 5C82A 4X2TA 4GXHA 4DNCA 1YSJA 4Z65A 2AFSA 5A28A 1Y7RA 2P0WA 2FS5A 2WUUA 3EXNA 3NH8A 1Z8LA 2PIYA 4FD4A 3WC6A 2OH1A 4KUAA 1ZG8A 2D4PA 3SI1A 2DF5A 3ISXA 4ONUA 4C7IA 4OC3A 3NE7A 4F0YA 4PV6A 4GM5A 3MN8A 2PDOA 2YNCC 4KSFA 3D3SA 4FAIA 4I49A 5LRGA 2VL1A 2QJ8A 5C88A 1K4JA 1QSRA 2R98A 4NGNA 3RO0A 5JGFA 5JH9A 2ZOFA 2GE3A 3D67A 3FBUA 2GANA 5LYIA 1IY7A 2B3UA 3DDDA 3PGPA 2HV2A 1RTQA 4PK2A 4UBRA 4CAEA 4MCSA 4YRHA 2ZPAA 3H4QA 3IWGA 3KL9A 3S6KA 1LANA 4UIBA 2EBJA 4MFQA 2VBQA 2PVVA 4FD7A 3B3TA 2BL1A 2BOAA 4ZY0A 3QAHA 1A2ZA 3RBUA 2AFZA 2IMOA 4PSXA 2C27A 2ZEHA 4UEEA 3FNCA 3IWEA 2DEAA 1WWZA 4XPKA 4NGSA 3MGDA 1R3NA 3WT4A 3TOAA 5H84A 2PR8A 4CYOA 5KTAA 2PJ0A 2ZW5A 2IL4A 2ZEGA 2PC1A 2ZEFA 2Z11A 5EBVA 3UY5A 4A2ZA 1BAVA 4U5YA 2PJ5A 3BHXA 1PCAA 4KUBA 1XE4A 4CPAA 3K2KA 5G20A 5G1ZA 1TKFA 2VI7A 4ZI6A 4UCPA 2CNMA 2CNSA 4AVBA 3T9YA 4P4JA 2AFUA 2VQYA 2VEZA 3IFEA 1X10A 4FWUA 3SJFA 1S7KA 4BMHA 2P6GA 4RS2A 1NSAA 5CPAA 1Q2CA 2OZGA 4HNXB 4G1PA 1Z8XA 3D4UA 4MJ8A 4QC6A 4R9MA 4A94A 3SJXA 1BPNA 4JD6A 1YK3A 1U6MA 4P4BA 3GKRA 3PEIA 1ZG7A 1CP6A 1QMUA 1Z5RA 4KOXA 4KVME 2WZNA 2PJAA 1I12A 1OZPA 2PJ2A 2Q4YA 2EO8A 3G3SA 3LACA 4UWIA 4CAFA 4F9VA 5EMIA
chains in the Genus database with same CATH topology
5AG6A 3R96A 1IYKA 4MY0A 4UCMA 4BBHA 3I3GA 1YREA 2VZZA 4X5KA 2FXFA 2FIWA 2GIVA 2VXKA 4PSWA 2FSRA 2G3TA 4Q36A 3JTKA 4CS0B 1QSNA 4KOSA 3R9EA 2PR1A 2ATRA 4UCNA 3TO6A 1KUXA 1S7NA 2B4BA 2JDDA 2VZYA 3W6SA 2Z0ZA 4H89A 4A31A 4NCZA 2DPSA 4Y49B 4KS9A 2YGWA 1IYLA 4R87A 3BJ7A 2YNCA 1ON0A 3CXSA 1XIXA 5J8CA 2KCWA 1B6BA 4UFWA 4C2XA 2OB0A 4A33A 1M4DA 1M4IA 4HNYB 2QECA 4R57A 4CAWA 3I9SA 3EFAA 4JXQA 4MFLA 5AGEA 1M1DA 5AG7A 1SQHA 2PSWA 5G22A 3GY9A 4Y49C 1MJBA 2Z10A 2ZXVA 3G8WA 2P6EA 2B5GB 2B5GA 3EC4A 2J8NA 1S7FA 4IUSA 4NXYA 5AG5A 3C26A 2DPTA 3SXNA 3K9UA 4II9A 3R1KA 4EVYA 4MFPA 4QUSA 2G0BA 3T90A 2Z3OA 2FT0A 2D4OA 1PU9A 4KOUA 2H5MA 2Z3LA 3DR6A 5BWAB 4R3LA 3D8PA 4UFVA 4E8OA 3BJ8A 4ORFA 3R9GA 2X7BA 4L89A 1BOBA 2REEA 2Q7BA 5I0CA 3WR7A 4KOTA 2ZW6A 2REFA 1XF8A 4KLWA 3ZJ0A 4AG9A 4QBJA 4K30A 3JVNA 2CXAA 1QSOA 3BLNA 1XEBA 4U9ZA 4AG7A 4CYQA 1FY7A 4KVXA 3E0KA 1J4JA 4E0AA 2FCKA 4MHDA 1Y9WA 3N7ZA 1V0CA 4LX9A 4CYPA 3CXQA 5IB0A 4GS4A 4KVOE 1KUYA 1P4NA 5H86A 3S6HA 2YNDA 3CXPA 3P2FA 4AB7A 4AVCA 2Z3PA 1MJAA 2B58A 2JLMA 2EUIA 4B5OA 2CNTA 4B14A 2Z3NA 1LRZA 5HMNA 1IICA 4KLVA 2Y0MA 1BO4A 4AVAA 4HNWB 3SXOA 3TO9A 5IX3A 4H6UA 1XMTA 1S5KA 4XNHB 1KZFA 2G3AA 1WK4A 2FE7A 5E96A 4NSQA 1TIQA 2ARHA 1VKCA 1Q2YA 5FVJA 4CGMA 2WPXA 1QSMA 2Z3MA 4F0XA 4PK3A 2Q44A 3DSBA 2OZUA 4CGNA 2JDCA 4KOWA 4B11A 2Q0YA 4M3SA 1Y9KA 3DNSA 4CGLA 3R95A 4XPDC 2BSWA 4B12A 4CRYB 1NMTA 1YGHA 2AJ6A 1YLEA 4Q38A 4KSAA 4MBUA 3LD2A 4OAEA 1MK4A 3A9LA 3P2HA 3TCVA 3LODA 3SHPA 4XNHC 4MY3A 1CM0A 5DWMA 1R57A 1M4GA 3PP9A 2R8VA 4R3KA 2Q4VA 4JJXA 5F49A 2Q04A 3TT2A 4CYNA 4C2ZA 4JXRA 4A95A 4F6AA 3RYOA 3F8KA 2B3VA 2NMTA 3GYAA 4XPLA 2A4NA 1RO5A 3W91A 1P0HA 4NF1A 2Z3KA 1I21A 4KOYA 3S6GA 4ZGYB 1UFHA 4ZBGA 2I79A 3B8GA 2HUZA 4FD5A 4KZTA 3QB8A 4LUAA 2J8RA 1YR0A 1Z4EA 3FYNA 2ZW4A 2P6FA 3D2PA 5IV0A 5JPHA 1CJWA 5G21A 1YVKA 4CGOA 1L0CA 4JLYA 4MFJA 5CNPA 3H5ZA 4FD6A 4CRZB 3EO4A 1KUVA 3IGRA 4CAVA 5DWNA 2F5IA 4B13A 4CAXA 4QVTA 1Z4RA 4YGOA 4C68A 2CY2A 1MJ9A 3IU1A 3PZJA 3FIXA 1NSLA 4QB9A 3ZZIA 1S60A 1YVOA 4L8AA 1S3ZA 3V8IA 2WPWA 3VWEA 2JEVA 1VHSA 1Q2DA 2ZW7A 5KTDA 4MI4A 2R7HA 5EC4A 4RI1A 5KTCA 4XPDB 4A32A 4KOVA 2HQYA 3TTHA 2R1IA 4J3GA 4MFZA 2OZHA 3DR8A 1B87A 1QSTA 1Z9UA 2QIRA 3F5BA 1NE9A 1M44A 4KORA 3S6FA 5A27A 2WSAA 3TE4A 3KKWA 5HH1A 2OU2A 4IF5A 2QMLA 4B5PB 3F0AA 4B5PA 1N71A 1ZO0A 4UA3A 2YNEA 3W6XA 3IU2A 5ISVA 3R9FA 2B4DB 4NEXA 4A30A 2B4DA 2O28A 1IIDA 2AE6A 2I00A 2RC4A 4M85A 4B10A 3TOBA 5JQ4A 3FXTA 4U9YA 3FB3A 4OLLA 2FIAA 4HKFA 4YFJA 3TO7A 5GCNA 1RXTA 5F48A 5F47A 1PUAA 2BEIA 4UWJA 3D2MA 3FRMA 3VWDA 4MFKA 2EVNA 2BUEA 3EY5A 1S7LA 5F46A 3JUWA 4JWPA 2J8MA 3TFYA 1I1DA 4OADA 1YX0A 4UFXA 2PQ8A 4C7HA 2K5TA 5AG4A 1IB1E 4C2YA 1GHEA 2FL4A 2DXQA 4E2AA 4H6ZA 2PRBA 3OWCA 4CGPA 5J8FA 5C82A 4DNCA 5A28A 1Y7RA 2P0WA 2FS5A 2WUUA 3EXNA 4FD4A 2OH1A 4KUAA 2D4PA 4C7IA 4ONUA 3NE7A 4F0YA 4PV6A 2PDOA 2YNCC 4KSFA 3D3SA 4I49A 5C88A 1K4JA 1QSRA 2R98A 2GE3A 3FBUA 2GANA 2B3UA 3DDDA 3PGPA 2HV2A 4PK2A 4UBRA 4CAEA 4YRHA 3S6KA 2ZPAA 3H4QA 3IWGA 4MFQA 2VBQA 4FD7A 2BL1A 3QAHA 4PSXA 2C27A 3FNCA 3IWEA 4XPKA 1WWZA 3MGDA 3TOAA 5H84A 2PR8A 4CYOA 5KTAA 2ZW5A 5EBVA 2IL4A 2PC1A 2Z11A 3UY5A 4A2ZA 4U5YA 4KUBA 1XE4A 5G20A 5G1ZA 2VI7A 4UCPA 2CNMA 2CNSA 4AVBA 3T9YA 2VQYA 2VEZA 1S7KA 4BMHA 2P6GA 4RS2A 1Q2CA 2OZGA 4HNXB 4MJ8A 4QC6A 4R9MA 4JD6A 1YK3A 1U6MA 3GKRA 4KOXA 4KVME 3G3SA 1I12A 1OZPA 4UWIA 2Q4YA 4CAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R96 A;  1IYK A;  4MY0 A;  3I3G A;  1YRE A;  2VZZ A;  4X5K A;  2FXF A;  2FIW A;  2GIV A;  2VXK A;  4PSW A;  2FSR A;  2G3T A;  4CS0 B;  1QSN A;  4KOS A;  3R9E A;  2PR1 A;  2ATR A;  3TO6 A;  1KUX A;  1S7N A;  2B4B A;  2JDD A;  2VZY A;  3W6S A;  2Z0Z A;  4H89 A;  4NCZ A;  4Y49 B;  1IYL A;  4R87 A;  3BJ7 A;  1ON0 A;  3CXS A;  1XIX A;  5J8C A;  2KCW A;  1B6B A;  2OB0 A;  1M4D A;  1M4I A;  4HNY B;  2QEC A;  4R57 A;  4CAW A;  3I9S A;  3EFA A;  4JXQ A;  1M1D A;  1SQH A;  2PSW A;  3GY9 A;  4Y49 C;  1MJB A;  2Z10 A;  2ZXV A;  3G8W A;  2P6E A;  2B5G B;  2B5G A;  3EC4 A;  2J8N A;  1S7F A;  4IUS A;  4NXY A;  3C26 A;  3SXN A;  3K9U A;  4II9 A;  3R1K A;  4EVY A;  4QUS A;  2G0B A;  3T90 A;  2FT0 A;  2D4O A;  1PU9 A;  4KOU A;  2H5M A;  3DR6 A;  4R3L A;  3D8P A;  4E8O A;  3BJ8 A;  4ORF A;  3R9G A;  2X7B A;  4L89 A;  1BOB A;  2REE A;  2Q7B A;  5I0C A;  3WR7 A;  4KOT A;  2ZW6 A;  2REF A;  1XF8 A;  4KLW A;  3ZJ0 A;  4AG9 A;  4QBJ A;  4K30 A;  3JVN A;  1QSO A;  3BLN A;  1XEB A;  4U9Z A;  4AG7 A;  1FY7 A;  4KVX A;  3E0K A;  1J4J A;  4E0A A;  2FCK A;  4MHD A;  1Y9W A;  3N7Z A;  1V0C A;  4LX9 A;  3CXQ A;  5IB0 A;  4GS4 A;  4KVO E;  1KUY A;  1P4N A;  5H86 A;  3S6H A;  3CXP A;  3P2F A;  4AB7 A;  4AVC A;  1MJA A;  2B58 A;  2JLM A;  2EUI A;  4B5O A;  2CNT A;  1LRZ A;  5HMN A;  1IIC A;  4KLV A;  2Y0M A;  1BO4 A;  4AVA A;  4HNW B;  3SXO A;  3TO9 A;  5IX3 A;  4H6U A;  1XMT A;  1S5K A;  4XNH B;  1KZF A;  2G3A A;  1WK4 A;  2FE7 A;  5E96 A;  4NSQ A;  1TIQ A;  2ARH A;  1VKC A;  1Q2Y A;  5FVJ A;  2WPX A;  1QSM A;  4PK3 A;  2Q44 A;  3DSB A;  2OZU A;  2JDC A;  4KOW A;  2Q0Y A;  4M3S A;  1Y9K A;  3DNS A;  3R95 A;  4XPD C;  2BSW A;  4CRY B;  1NMT A;  1YGH A;  2AJ6 A;  1YLE A;  4MBU A;  3LD2 A;  4OAE A;  1MK4 A;  3P2H A;  3TCV A;  3LOD A;  3SHP A;  4XNH C;  4MY3 A;  1CM0 A;  5DWM A;  1R57 A;  1M4G A;  3PP9 A;  2R8V A;  4R3K A;  2Q4V A;  4JJX A;  5F49 A;  2Q04 A;  3TT2 A;  4JXR A;  4F6A A;  3RYO A;  3F8K A;  2B3V A;  2NMT A;  3GYA A;  4XPL A;  2A4N A;  1RO5 A;  3W91 A;  1P0H A;  4NF1 A;  1I21 A;  4KOY A;  3S6G A;  1UFH A;  4ZBG A;  2I79 A;  3B8G A;  2HUZ A;  4FD5 A;  4KZT A;  3QB8 A;  4LUA A;  2J8R A;  1YR0 A;  1Z4E A;  3FYN A;  2ZW4 A;  2P6F A;  3D2P A;  5IV0 A;  5JPH A;  1CJW A;  1YVK A;  1L0C A;  4JLY A;  5CNP A;  4FD6 A;  4CRZ B;  3EO4 A;  1KUV A;  3IGR A;  4CAV A;  5DWN A;  2F5I A;  4CAX A;  4QVT A;  1Z4R A;  4YGO A;  2CY2 A;  1MJ9 A;  3PZJ A;  3FIX A;  1NSL A;  4QB9 A;  3ZZI A;  1S60 A;  1YVO A;  4L8A A;  1S3Z A;  3V8I A;  2WPW A;  3VWE A;  2JEV A;  1VHS A;  1Q2D A;  2ZW7 A;  5KTD A;  4MI4 A;  2R7H A;  5EC4 A;  4RI1 A;  5KTC A;  4XPD B;  4KOV A;  2HQY A;  3TTH A;  2R1I A;  4J3G A;  2OZH A;  3DR8 A;  1B87 A;  1QST A;  1Z9U A;  2QIR A;  3F5B A;  1NE9 A;  1M44 A;  4KOR A;  3S6F A;  3TE4 A;  3KKW A;  5HH1 A;  2OU2 A;  4IF5 A;  2QML A;  4B5P B;  3F0A A;  4B5P A;  1N71 A;  4UA3 A;  3W6X A;  5ISV A;  3R9F A;  2B4D B;  4NEX A;  2B4D A;  2O28 A;  1IID A;  2AE6 A;  2I00 A;  2RC4 A;  4M85 A;  3TOB A;  5JQ4 A;  3FXT A;  4U9Y A;  3FB3 A;  4OLL A;  2FIA A;  4HKF A;  4YFJ A;  3TO7 A;  5GCN A;  1RXT A;  5F48 A;  5F47 A;  1PUA A;  2BEI A;  4UWJ A;  3D2M A;  3FRM A;  3VWD A;  2EVN A;  2BUE A;  3EY5 A;  1S7L A;  5F46 A;  3JUW A;  4JWP A;  2J8M A;  3TFY A;  1I1D A;  4OAD A;  1YX0 A;  2PQ8 A;  2K5T A;  1IB1 E;  1GHE A;  2FL4 A;  2DXQ A;  4E2A A;  4H6Z A;  2PRB A;  3OWC A;  5J8F A;  5C82 A;  4DNC A;  1Y7R A;  2P0W A;  2FS5 A;  3EXN A;  4FD4 A;  2OH1 A;  4KUA A;  2D4P A;  4ONU A;  3NE7 A;  4F0Y A;  4PV6 A;  2PDO A;  3D3S A;  4I49 A;  5C88 A;  1K4J A;  1QSR A;  2R98 A;  2GE3 A;  3FBU A;  2GAN A;  2B3U A;  3DDD A;  3PGP A;  2HV2 A;  4PK2 A;  4UBR A;  4YRH A;  3S6K A;  2ZPA A;  3H4Q A;  3IWG A;  2VBQ A;  4FD7 A;  2BL1 A;  3QAH A;  4PSX A;  2C27 A;  3FNC A;  4XPK A;  1WWZ A;  3MGD A;  3TOA A;  5H84 A;  2PR8 A;  5KTA A;  2ZW5 A;  5EBV A;  2IL4 A;  2PC1 A;  2Z11 A;  3UY5 A;  4U5Y A;  4KUB A;  1XE4 A;  2VI7 A;  2CNM A;  2CNS A;  4AVB A;  3T9Y A;  2VQY A;  2VEZ A;  1S7K A;  4BMH A;  2P6G A;  4RS2 A;  1Q2C A;  2OZG A;  4HNX B;  4MJ8 A;  4QC6 A;  4R9M A;  4JD6 A;  1YK3 A;  1U6M A;  3GKR A;  4KOX A;  4KVM E;  3G3S A;  1I12 A;  1OZP A;  4UWI A;  2Q4Y A; 
#chains in the Genus database with same CATH topology
 5AG6 A;  2C6P A;  1DE4 C;  4LQG A;  1IYK A;  4MY0 A;  4UCM A;  5D8N A;  3R96 A;  2GRE A;  4BBH A;  1ELL P;  4LQ6 A;  5THW A;  3I3G A;  2C6G A;  1YRE A;  2VZZ A;  2FVG A;  4X5K A;  4HPS A;  4NGQ A;  4NGM A;  2FXF A;  2FIW A;  2GIV A;  2QYV A;  2VXK A;  2ZOG A;  4M6G A;  4PSW A;  2Q7S A;  2PVW A;  5LYF A;  2C6C A;  5ELY A;  1ZLI A;  2FSR A;  2G3T A;  3N5F A;  4Q36 A;  1IOF A;  3VAR A;  3JTK A;  4CS0 B;  1QSN A;  4KOS A;  3R9E A;  2PR1 A;  2Q4Z A;  2ATR A;  4UCN A;  3TO6 A;  3WAB A;  4M6I A;  1KUX A;  1S7N A;  2B4B A;  2JDD A;  2VZY A;  3RZA A;  5HVH A;  3W6S A;  2Z0Z A;  1VHE A;  2AFM A;  4H89 A;  4A31 A;  4NCZ A;  2PJ4 A;  2DPS A;  4Y49 B;  4KS9 A;  4IK2 A;  2PJC A;  3B3V A;  3D7D A;  4AXV A;  2YGW A;  3B2Y A;  4IHM A;  1IYL A;  4MXU A;  4R87 A;  3BJ7 A;  3KI9 A;  3LWU A;  4PXB A;  2YNC A;  3I1U A;  1ON0 A;  2V77 A;  1XIX A;  3B3C A;  3CXS A;  5J8C A;  2KCW A;  1B6B A;  4UFW A;  3CPA A;  4C2X A;  1LFW A;  1JQG A;  2OB0 A;  3K9T A;  2NSM A;  4OC0 A;  3IC1 A;  2POK A;  4A33 A;  3H8E A;  1M4D A;  3GUX A;  4PXD A;  4ZYQ A;  1LAP A;  1M4I A;  4WWV A;  2JBJ A;  3CZX A;  4HNY B;  2XEJ A;  2XEG A;  2QEC A;  4R57 A;  4CAW A;  3I9S A;  3EFA A;  1DTD A;  4JXQ A;  4MFL A;  1CX8 A;  5AGE A;  1M1D A;  5AG7 A;  1SQH A;  1FT7 A;  2OR4 A;  2HC9 A;  3SI2 A;  4OC1 A;  2PSW A;  3HUV A;  3GY9 A;  5G22 A;  4NGP A;  1VHO A;  4Y49 C;  3CDX A;  2EK9 A;  1MJB A;  2CF4 A;  2Z10 A;  2ZXV A;  3G8W A;  2P6E A;  2B5G B;  3HLP A;  3NA6 A;  4FBE A;  2B5G A;  3EC4 A;  3PB4 X;  3KHX A;  4UEZ A;  2J8N A;  1FNO A;  2RB7 A;  2CTC A;  1S7F A;  3NH5 A;  4IUS A;  4NXY A;  5AG5 A;  3C26 A;  4F8Z A;  2DPT A;  2ABZ A;  3KR4 A;  2CTB A;  3K9U A;  3NFZ A;  2GLF A;  1QQ9 A;  4OC2 A;  3SXN A;  2ZEM A;  3NH4 A;  4II9 A;  1GYT A;  3R1K A;  4EVY A;  4MFP A;  4QUS A;  2G0B A;  3PB7 X;  3T90 A;  3DGV A;  2G9D A;  2Z3O A;  1KWM A;  2FT0 A;  2D4O A;  1YW4 A;  3IEH A;  1PU9 A;  4KOU A;  2H5M A;  3S9N A;  1CPS A;  2Z3L A;  1EE3 P;  3DR6 A;  4R3L A;  3D8P A;  4UFV A;  4E8O A;  5BWA B;  2GU2 A;  3BJ8 A;  4NGR A;  3B3W A;  3H8F A;  4ORF A;  1ZLH A;  2O53 A;  3R9G A;  1CPX A;  2X7B A;  4R8F A;  4L89 A;  3FEC A;  5K8M A;  1BOB A;  1HDQ A;  3PBB A;  2I3C A;  1YME A;  4UEF A;  2REE A;  4TNU A;  4WJB A;  2Q7B A;  4MHZ A;  5I0C A;  3WR7 A;  4KOT A;  2ZW6 A;  3WC5 A;  1XF8 A;  2REF A;  4KLW A;  4PXC A;  3ZJ0 A;  4YWY A;  4AG9 A;  4ZX9 A;  5HXD A;  4QBJ A;  4K30 A;  3QNV A;  4JZ0 A;  4EFD A;  1Z8W A;  3JVN A;  2CXA A;  1QSO A;  1ZG9 A;  3BLN A;  2GLJ A;  3VAT A;  4X8I A;  3MRU A;  1XEB A;  2PJ6 A;  4U9Z A;  4AG7 A;  3SI0 A;  1FY7 A;  4CYQ A;  4DYO A;  5CBM A;  4ZY2 A;  4KVX A;  3E0K A;  1J4J A;  4P4I A;  4E0A A;  2IQ6 A;  2FCK A;  3KHZ A;  1TKJ A;  4MHD A;  1ARM A;  1Y9W A;  3N7Z A;  1V0C A;  3D66 A;  3IJ3 A;  4LX9 A;  4CYP A;  3CXQ A;  2PJ7 A;  5IB0 A;  4GS4 A;  4KVO E;  1UWY A;  3KQZ A;  1KUY A;  1P4N A;  5H86 A;  3S6H A;  2YND A;  1BPM A;  3CXP A;  3P2F A;  1Y0Y A;  3D68 A;  4AB7 A;  4AVC A;  5HVG A;  3JRU A;  2PE3 A;  4ONW A;  2Z3P A;  4P4F A;  4BIN A;  1XFO A;  1MJA A;  2B58 A;  2JLM A;  2V8D A;  3V38 A;  2EUI A;  2HB6 A;  2J9A A;  2PJ3 A;  4B5O A;  2V8V A;  2PCU A;  2CNT A;  3FMC A;  4B14 A;  1M4L A;  2EWB A;  5JM6 A;  2Z3N A;  1LCP A;  1LRZ A;  4O23 A;  5HMN A;  1IIC A;  4KLV A;  2Y0M A;  1BO4 A;  4AVA A;  4HNW B;  3SXO A;  4EWT A;  2PJ1 A;  3TO9 A;  5IX3 A;  4H6U A;  1XMT A;  1S5K A;  4OIW A;  4XNH B;  4FUU A;  1TKH A;  1YW6 A;  1KZF A;  2G3A A;  1WK4 A;  2FE7 A;  2PJ8 A;  5E96 A;  4NSQ A;  1TIQ A;  2ARH A;  4MHP A;  2BCO A;  4B6Z A;  1VKC A;  2NYQ A;  1Q2Y A;  4P4E A;  5FVJ A;  3TC8 A;  4CGM A;  2WPX A;  1QSM A;  2ZEP A;  2Z3M A;  4F0X A;  3KAS A;  4OME A;  5K8N A;  4PK3 A;  2Q44 A;  3FED A;  3DSB A;  2OZU A;  4NJR A;  4CGN A;  4P10 A;  2JDC A;  4KOW A;  4B11 A;  2ZEO A;  2Q0Y A;  4M3S A;  1Y9K A;  2F7V A;  3DNS A;  4CGL A;  4YU9 A;  1CP7 A;  3R95 A;  4XPD C;  2BSW A;  4B12 A;  3BI0 A;  1AYE A;  4CRY B;  1ARL A;  1NMT A;  1YGH A;  2AJ6 A;  1YLE A;  5HVF A;  5LRJ A;  4RUH A;  2GFQ A;  4Q38 A;  1TF8 A;  2O4H A;  1HEE A;  3RAM A;  2V8G A;  4KSA A;  4MBU A;  3B35 A;  1ELM P;  3GLJ A;  1YQE A;  2ZEE A;  1XJO A;  2WYR A;  3LD2 A;  4OAE A;  1MK4 A;  3A9L A;  3P2H A;  3TCV A;  2C1C A;  3B7I A;  3LOD A;  4P6Y A;  3FVL A;  1X12 A;  4MHY A;  2OOT A;  3SHP A;  4XNH C;  4A39 A;  4X3R A;  1HDU A;  3ISZ A;  4MY3 A;  1XRY A;  1CM0 A;  2ZED A;  4EME A;  6CPA A;  5DWM A;  1R57 A;  2CIJ A;  4KSI A;  3KQX A;  4NJQ A;  1M4G A;  3PP9 A;  2R8V A;  1AMP A;  2Q4V A;  4JJX A;  4R3K A;  1BLL E;  5F49 A;  2Q04 A;  3TT2 A;  3VH9 A;  4CYN A;  3NE8 A;  3CPX A;  4C2Z A;  4IAV A;  4P45 A;  4JXR A;  4A95 A;  3KGQ A;  4F6A A;  3RYO A;  4P4D A;  4OKO A;  3BI1 A;  3F8K A;  2B3V A;  2NMT A;  2PJB A;  1TF9 A;  2PIZ A;  2XEF A;  4NFR A;  5LRK A;  3GYA A;  2PJ9 A;  1PYT B;  3FX6 A;  3GB0 A;  3TX8 A;  4XPL A;  3PRT A;  2A4N A;  1IU8 A;  4OID A;  5LYL A;  1RO5 A;  3W91 A;  1P0H A;  4NF1 A;  4R76 A;  2Z3K A;  1I21 A;  4KOY A;  3S6G A;  4ZGY B;  1UFH A;  3D7H A;  1F57 A;  4MHN A;  4ZBG A;  2I79 A;  3B8G A;  1H8L A;  2HUZ A;  3B3S A;  4FD5 A;  4UF4 A;  4DJL A;  3PBE A;  1XOV A;  1Z8T A;  5D29 A;  4F9U A;  4KZT A;  3QB8 A;  4LUA A;  4MCP A;  2J8R A;  4ZY1 A;  1YLO A;  1YR0 A;  1Z4E A;  3FYN A;  2ZW4 A;  2P6F A;  3D2P A;  5LYD A;  5IV0 A;  5JPH A;  1CJW A;  5G21 A;  1YVK A;  4CGO A;  1L0C A;  1VIX A;  4BD9 A;  4JLY A;  4MFJ A;  5I4M A;  5K8O A;  5CNP A;  1CBX A;  4R7M A;  1IGB A;  3H5Z A;  4FD6 A;  3T8W A;  4CRZ B;  3BXM A;  3EO4 A;  1KUV A;  4ZX8 A;  3IGR A;  4CAV A;  5DWN A;  1JWQ A;  2F5I A;  3PB8 X;  4B13 A;  4CAX A;  4QVT A;  7CPA A;  4PQA A;  1Z4R A;  4Q7A A;  4YGO A;  4C68 A;  2CY2 A;  4DUK A;  1MJ9 A;  1AUG A;  3IU1 A;  4UIA A;  1Y0R A;  3PZJ A;  3FIX A;  3IIB A;  1Y7E A;  4QB9 A;  2QVP A;  1NSL A;  3ZZI A;  2V8H A;  1S60 A;  3PFE A;  1YVO A;  3QAY A;  3V7Z A;  4L8A A;  4M6H A;  1VGY A;  1S3Z A;  4RN7 A;  3V8I A;  2ZEN A;  3H8G A;  2WPW A;  2BO9 A;  2JBK A;  3VWE A;  2JEW A;  3DLJ A;  4P44 A;  2JEV A;  4OP4 A;  1VHS A;  1Q2D A;  2ZW7 A;  5KTD A;  4MCR A;  4MI4 A;  2R7H A;  5EC4 A;  4RI1 A;  5KTC A;  4NGT A;  2Q51 A;  4XPD B;  4A32 A;  4KOV A;  2IJZ A;  2HQY A;  3TTH A;  2R1I A;  4J3G A;  3FF3 A;  4MFZ A;  2OZH A;  4A38 A;  3FEE A;  2AFX A;  3DR8 A;  3D7G A;  3PB6 X;  3IO1 A;  1B87 A;  1QST A;  1XBU A;  5DS0 A;  1Z9U A;  2QIR A;  3F5B A;  1NE9 A;  1Z2L A;  1M44 A;  4KOR A;  5K8P A;  2ANP A;  4MMO A;  4OC5 A;  3S6F A;  5A27 A;  2WSA A;  4MCQ A;  1OBR A;  2PRQ A;  3KKW A;  3TE4 A;  1Q7L A;  5HH1 A;  2OU2 A;  4IF5 A;  2AFW A;  2QML A;  2RFH A;  4B5P B;  3F0A A;  3D7F A;  1N71 A;  1ZO0 A;  4B5P A;  4UA3 A;  2YNE A;  3RNZ A;  3IU2 A;  4TWE A;  4OC4 A;  3W6X A;  4K3N A;  3R9F A;  2B4D B;  4NEX A;  5ISV A;  4A30 A;  2B4D A;  3GIU A;  2O28 A;  5F09 A;  1IID A;  3SJE A;  2AE6 A;  2I00 A;  2RC4 A;  4M85 A;  4PPZ A;  8CPA A;  4A37 A;  4B10 A;  2ODF A;  3TOB A;  5JQ4 A;  3FXT A;  4U9Y A;  3FB3 A;  4PXE A;  4W9Y A;  3KZW A;  4MRI A;  4OLL A;  2XEI A;  2FIA A;  4HKF A;  2ZEL A;  4YFJ A;  3FH4 A;  3TO7 A;  5GCN A;  2AFO A;  1RXT A;  3LMS A;  3L2N A;  5F48 A;  5F47 A;  1LAM A;  1PUA A;  2BEI A;  4UWJ A;  3D2M A;  3FRM A;  3S9M A;  3VWD A;  4MFK A;  2EVN A;  2BUE A;  5IB9 A;  1F2P A;  1CG2 A;  3EY5 A;  1S7L A;  4JYW A;  3JUW A;  4JWP A;  3WC7 A;  2J8M A;  5F46 A;  3TFY A;  1I1D A;  4OAD A;  1YX0 A;  4UFX A;  3PB9 X;  2PQ8 A;  4C7H A;  2K5T A;  3KR5 A;  3SJG A;  2Q43 A;  5AG4 A;  1TXR A;  1IOI A;  1IB1 E;  3FJU A;  2F8H A;  1GHE A;  3PFO A;  4H2K A;  4C2Y A;  3S9L A;  1LOK A;  4R6T A;  3IWW A;  2FL4 A;  1R43 A;  2DXQ A;  1XMB A;  4E2A A;  4H6Z A;  1F2O A;  2PRB A;  3OWC A;  4CGP A;  5J1Q A;  2EK8 A;  3CT9 A;  5J8F A;  5C82 A;  4X2T A;  4GXH A;  4DNC A;  1YSJ A;  4Z65 A;  2AFS A;  5A28 A;  1Y7R A;  2P0W A;  2FS5 A;  2WUU A;  3EXN A;  3NH8 A;  1Z8L A;  2PIY A;  4FD4 A;  3WC6 A;  2OH1 A;  4KUA A;  1ZG8 A;  2D4P A;  3SI1 A;  2DF5 A;  3ISX A;  4ONU A;  4C7I A;  4OC3 A;  3NE7 A;  4F0Y A;  4PV6 A;  4GM5 A;  3MN8 A;  2PDO A;  2YNC C;  4KSF A;  3D3S A;  4FAI A;  4I49 A;  5LRG A;  2VL1 A;  2QJ8 A;  5C88 A;  1K4J A;  1QSR A;  2R98 A;  4NGN A;  3RO0 A;  5JGF A;  5JH9 A;  2ZOF A;  2GE3 A;  3D67 A;  3FBU A;  2GAN A;  5LYI A;  1IY7 A;  2B3U A;  3DDD A;  3PGP A;  2HV2 A;  1RTQ A;  4PK2 A;  4UBR A;  4CAE A;  4MCS A;  4YRH A;  2ZPA A;  3H4Q A;  3IWG A;  3KL9 A;  3S6K A;  1LAN A;  4UIB A;  2EBJ A;  4MFQ A;  2VBQ A;  2PVV A;  4FD7 A;  3B3T A;  2BL1 A;  2BOA A;  4ZY0 A;  3QAH A;  1A2Z A;  3RBU A;  2AFZ A;  2IMO A;  4PSX A;  2C27 A;  2ZEH A;  4UEE A;  3FNC A;  3IWE A;  2DEA A;  1WWZ A;  4XPK A;  4NGS A;  3MGD A;  1R3N A;  3WT4 A;  3TOA A;  5H84 A;  2PR8 A;  4CYO A;  5KTA A;  2PJ0 A;  2ZW5 A;  2IL4 A;  2ZEG A;  2PC1 A;  2ZEF A;  2Z11 A;  5EBV A;  3UY5 A;  4A2Z A;  1BAV A;  4U5Y A;  2PJ5 A;  3BHX A;  1PCA A;  4KUB A;  1XE4 A;  4CPA A;  3K2K A;  5G20 A;  5G1Z A;  1TKF A;  2VI7 A;  4ZI6 A;  4UCP A;  2CNM A;  2CNS A;  4AVB A;  3T9Y A;  4P4J A;  2AFU A;  2VQY A;  2VEZ A;  3IFE A;  1X10 A;  4FWU A;  3SJF A;  1S7K A;  4BMH A;  2P6G A;  4RS2 A;  1NSA A;  5CPA A;  1Q2C A;  2OZG A;  4HNX B;  4G1P A;  1Z8X A;  3D4U A;  4MJ8 A;  4QC6 A;  4R9M A;  4A94 A;  3SJX A;  1BPN A;  4JD6 A;  1YK3 A;  1U6M A;  4P4B A;  3GKR A;  3PEI A;  1ZG7 A;  1CP6 A;  1QMU A;  1Z5R A;  4KOX A;  4KVM E;  2WZN A;  2PJA A;  1I12 A;  1OZP A;  2PJ2 A;  2Q4Y A;  2EO8 A;  3G3S A;  3LAC A;  4UWI A;  4CAF A;  4F9V A;  5EMI A; 
#chains in the Genus database with same CATH homology
 5AG6 A;  3R96 A;  1IYK A;  4MY0 A;  4UCM A;  4BBH A;  3I3G A;  1YRE A;  2VZZ A;  4X5K A;  2FXF A;  2FIW A;  2GIV A;  2VXK A;  4PSW A;  2FSR A;  2G3T A;  4Q36 A;  3JTK A;  4CS0 B;  1QSN A;  4KOS A;  3R9E A;  2PR1 A;  2ATR A;  4UCN A;  3TO6 A;  1KUX A;  1S7N A;  2B4B A;  2JDD A;  2VZY A;  3W6S A;  2Z0Z A;  4H89 A;  4A31 A;  4NCZ A;  2DPS A;  4Y49 B;  4KS9 A;  2YGW A;  1IYL A;  4R87 A;  3BJ7 A;  2YNC A;  1ON0 A;  3CXS A;  1XIX A;  5J8C A;  2KCW A;  1B6B A;  4UFW A;  4C2X A;  2OB0 A;  4A33 A;  1M4D A;  1M4I A;  4HNY B;  2QEC A;  4R57 A;  4CAW A;  3I9S A;  3EFA A;  4JXQ A;  4MFL A;  5AGE A;  1M1D A;  5AG7 A;  1SQH A;  2PSW A;  5G22 A;  3GY9 A;  4Y49 C;  1MJB A;  2Z10 A;  2ZXV A;  3G8W A;  2P6E A;  2B5G B;  2B5G A;  3EC4 A;  2J8N A;  1S7F A;  4IUS A;  4NXY A;  5AG5 A;  3C26 A;  2DPT A;  3SXN A;  3K9U A;  4II9 A;  3R1K A;  4EVY A;  4MFP A;  4QUS A;  2G0B A;  3T90 A;  2Z3O A;  2FT0 A;  2D4O A;  1PU9 A;  4KOU A;  2H5M A;  2Z3L A;  3DR6 A;  5BWA B;  4R3L A;  3D8P A;  4UFV A;  4E8O A;  3BJ8 A;  4ORF A;  3R9G A;  2X7B A;  4L89 A;  1BOB A;  2REE A;  2Q7B A;  5I0C A;  3WR7 A;  4KOT A;  2ZW6 A;  2REF A;  1XF8 A;  4KLW A;  3ZJ0 A;  4AG9 A;  4QBJ A;  4K30 A;  3JVN A;  2CXA A;  1QSO A;  3BLN A;  1XEB A;  4U9Z A;  4AG7 A;  4CYQ A;  1FY7 A;  4KVX A;  3E0K A;  1J4J A;  4E0A A;  2FCK A;  4MHD A;  1Y9W A;  3N7Z A;  1V0C A;  4LX9 A;  4CYP A;  3CXQ A;  5IB0 A;  4GS4 A;  4KVO E;  1KUY A;  1P4N A;  5H86 A;  3S6H A;  2YND A;  3CXP A;  3P2F A;  4AB7 A;  4AVC A;  2Z3P A;  1MJA A;  2B58 A;  2JLM A;  2EUI A;  4B5O A;  2CNT A;  4B14 A;  2Z3N A;  1LRZ A;  5HMN A;  1IIC A;  4KLV A;  2Y0M A;  1BO4 A;  4AVA A;  4HNW B;  3SXO A;  3TO9 A;  5IX3 A;  4H6U A;  1XMT A;  1S5K A;  4XNH B;  1KZF A;  2G3A A;  1WK4 A;  2FE7 A;  5E96 A;  4NSQ A;  1TIQ A;  2ARH A;  1VKC A;  1Q2Y A;  5FVJ A;  4CGM A;  2WPX A;  1QSM A;  2Z3M A;  4F0X A;  4PK3 A;  2Q44 A;  3DSB A;  2OZU A;  4CGN A;  2JDC A;  4KOW A;  4B11 A;  2Q0Y A;  4M3S A;  1Y9K A;  3DNS A;  4CGL A;  3R95 A;  4XPD C;  2BSW A;  4B12 A;  4CRY B;  1NMT A;  1YGH A;  2AJ6 A;  1YLE A;  4Q38 A;  4KSA A;  4MBU A;  3LD2 A;  4OAE A;  1MK4 A;  3A9L A;  3P2H A;  3TCV A;  3LOD A;  3SHP A;  4XNH C;  4MY3 A;  1CM0 A;  5DWM A;  1R57 A;  1M4G A;  3PP9 A;  2R8V A;  4R3K A;  2Q4V A;  4JJX A;  5F49 A;  2Q04 A;  3TT2 A;  4CYN A;  4C2Z A;  4JXR A;  4A95 A;  4F6A A;  3RYO A;  3F8K A;  2B3V A;  2NMT A;  3GYA A;  4XPL A;  2A4N A;  1RO5 A;  3W91 A;  1P0H A;  4NF1 A;  2Z3K A;  1I21 A;  4KOY A;  3S6G A;  4ZGY B;  1UFH A;  4ZBG A;  2I79 A;  3B8G A;  2HUZ A;  4FD5 A;  4KZT A;  3QB8 A;  4LUA A;  2J8R A;  1YR0 A;  1Z4E A;  3FYN A;  2ZW4 A;  2P6F A;  3D2P A;  5IV0 A;  5JPH A;  1CJW A;  5G21 A;  1YVK A;  4CGO A;  1L0C A;  4JLY A;  4MFJ A;  5CNP A;  3H5Z A;  4FD6 A;  4CRZ B;  3EO4 A;  1KUV A;  3IGR A;  4CAV A;  5DWN A;  2F5I A;  4B13 A;  4CAX A;  4QVT A;  1Z4R A;  4YGO A;  4C68 A;  2CY2 A;  1MJ9 A;  3IU1 A;  3PZJ A;  3FIX A;  1NSL A;  4QB9 A;  3ZZI A;  1S60 A;  1YVO A;  4L8A A;  1S3Z A;  3V8I A;  2WPW A;  3VWE A;  2JEV A;  1VHS A;  1Q2D A;  2ZW7 A;  5KTD A;  4MI4 A;  2R7H A;  5EC4 A;  4RI1 A;  5KTC A;  4XPD B;  4A32 A;  4KOV A;  2HQY A;  3TTH A;  2R1I A;  4J3G A;  4MFZ A;  2OZH A;  3DR8 A;  1B87 A;  1QST A;  1Z9U A;  2QIR A;  3F5B A;  1NE9 A;  1M44 A;  4KOR A;  3S6F A;  5A27 A;  2WSA A;  3TE4 A;  3KKW A;  5HH1 A;  2OU2 A;  4IF5 A;  2QML A;  4B5P B;  3F0A A;  4B5P A;  1N71 A;  1ZO0 A;  4UA3 A;  2YNE A;  3W6X A;  3IU2 A;  5ISV A;  3R9F A;  2B4D B;  4NEX A;  4A30 A;  2B4D A;  2O28 A;  1IID A;  2AE6 A;  2I00 A;  2RC4 A;  4M85 A;  4B10 A;  3TOB A;  5JQ4 A;  3FXT A;  4U9Y A;  3FB3 A;  4OLL A;  2FIA A;  4HKF A;  4YFJ A;  3TO7 A;  5GCN A;  1RXT A;  5F48 A;  5F47 A;  1PUA A;  2BEI A;  4UWJ A;  3D2M A;  3FRM A;  3VWD A;  4MFK A;  2EVN A;  2BUE A;  3EY5 A;  1S7L A;  5F46 A;  3JUW A;  4JWP A;  2J8M A;  3TFY A;  1I1D A;  4OAD A;  1YX0 A;  4UFX A;  2PQ8 A;  4C7H A;  2K5T A;  5AG4 A;  1IB1 E;  4C2Y A;  1GHE A;  2FL4 A;  2DXQ A;  4E2A A;  4H6Z A;  2PRB A;  3OWC A;  4CGP A;  5J8F A;  5C82 A;  4DNC A;  5A28 A;  1Y7R A;  2P0W A;  2FS5 A;  2WUU A;  3EXN A;  4FD4 A;  2OH1 A;  4KUA A;  2D4P A;  4C7I A;  4ONU A;  3NE7 A;  4F0Y A;  4PV6 A;  2PDO A;  2YNC C;  4KSF A;  3D3S A;  4I49 A;  5C88 A;  1K4J A;  1QSR A;  2R98 A;  2GE3 A;  3FBU A;  2GAN A;  2B3U A;  3DDD A;  3PGP A;  2HV2 A;  4PK2 A;  4UBR A;  4CAE A;  4YRH A;  3S6K A;  2ZPA A;  3H4Q A;  3IWG A;  4MFQ A;  2VBQ A;  4FD7 A;  2BL1 A;  3QAH A;  4PSX A;  2C27 A;  3FNC A;  3IWE A;  4XPK A;  1WWZ A;  3MGD A;  3TOA A;  5H84 A;  2PR8 A;  4CYO A;  5KTA A;  2ZW5 A;  5EBV A;  2IL4 A;  2PC1 A;  2Z11 A;  3UY5 A;  4A2Z A;  4U5Y A;  4KUB A;  1XE4 A;  5G20 A;  5G1Z A;  2VI7 A;  4UCP A;  2CNM A;  2CNS A;  4AVB A;  3T9Y A;  2VQY A;  2VEZ A;  1S7K A;  4BMH A;  2P6G A;  4RS2 A;  1Q2C A;  2OZG A;  4HNX B;  4MJ8 A;  4QC6 A;  4R9M A;  4JD6 A;  1YK3 A;  1U6M A;  3GKR A;  4KOX A;  4KVM E;  3G3S A;  1I12 A;  1OZP A;  4UWI A;  2Q4Y A;  4CAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...