1LOKA

The 1.20 angstrom resolution crystal structure of the aminopeptidase from aeromonas proteolytica complexed with tris: a tale of buffer inhibition
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.20 Angstrom Resolution Crystal Structure of the Aminopeptidase from Aeromonas proteolytica Complexed with Tris A tale of Buffer Inhibition
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Bacterial leucyl aminopeptidase
total genus 113
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2002-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1lokA00
2HB6A 3LMSA 1BPNA 4NGSA 1GYTA 3PBBA 4UEEA 4IAVA 1CPSA 2OR4A 2V8DA 3VARA 4OC5A 5JGFA 4UEFA 4DYOA 2PJ8A 3SJXA 2ZEPA 4DUKA 2C6PA 3KQZA 4PXBA 3S9MA 1CP7A 4PXDA 2O4HA 6CPAA 3CDXA 1OBRA 2F8HA 1NSAA 4WWVA 2PJ7A 2PJAA 4F8ZA 3L2NA 4AXVA 3PFEA 2V77A 1BAVA 2PE3A 4P4DA 3I1UA 2ZEOA 1EE3P 3VH9A 3GB0A 3PB7X 1R43A 4TWEA 2XEGA 4R6TA 4MCRA 2ANPA 2PJ6A 2QYVA 1LAMA 3D7DA 2JEWA 2PJBA 3MRUA 4P45A 2V8GA 3SJEA 1QQ9A 4FBEA 1RTQA 2ZEHA 4A94A 2F7VA 3H8FA 1XMBA 4NJQA 3IEHA 3KR4A 3TC8A 2RB7A 4UIBA 4FWUA 2C6CA 1TKJA 1M4LA 3WT4A 4P44A 1IY7A 3KZWA 2PVWA 4MMOA 3B3TA 5K8OA 1R3NA 4MCQA 2PJ0A 3GLJA 4OIDA 4NFRA 1DE4C 3KR5A 4BD9A 4A38A 2RFHA 5JM6A 1ZG7A 4OC4A 5I4MA 4UF4A 3FF3A 2CTBA 1HEEA 3ISZA 4F9UA 2AFZA 2HC9A 5LYDA 2EK9A 1Z5RA 2IMOA 4P4FA 4W9YA 1BPMA 3D7FA 2ZOGA 3IIBA 7CPAA 1H8LA 3GUXA 1CPXA 2AFXA 3D68A 4P4JA 4A37A 2VL1A 3SI2A 1PCAA 3PRTA 4NGTA 3MN8A 2OOTA 2PJ2A 5ELYA 1TF9A 2G9DA 4A39A 8CPAA 3BI1A 1LOKA 1VIXA 3TX8A 5D29A 1YLOA 2AFUA 2J9AA 2ZEEA 2PJ3A 4GM5A 2PVVA 4X3RA 3SJFA 1TXRA 2WYRA 4ZX9A 3KGQA 2Q4ZA 3FX6A 4NGPA 2PJ9A 3QNVA 1IGBA 5IB9A 3D4UA 4PXEA 5J1QA 5F09A 3FECA 1VHEA 1VGYA 3WC7A 3PEIA 4MHPA 2GLJA 1ARLA 4ZY2A 1YMEA 2ZEDA 1XFOA 3K9TA 5LYFA 2ZENA 3CT9A 5D8NA 4ZY0A 1CX8A 3B3SA 3RZAA 3IC1A 1LCPA 3NH5A 4MHZA 2C6GA 3DLJA 4FAIA 4NGMA 4P10A 3B35A 4PQAA 1XRYA 3LWUA 2GLFA 4IK2A 1CBXA 2EWBA 3SJGA 3FJUA 1XBUA 3PB9X 1Q7LA 2AFWA 2FVGA 2AFMA 1UWYA 2PIYA 3SI1A 5HXDA 1Y0YA 2ZEMA 3NFZA 3KI9A 4FUUA 4MXUA 4UIAA 3KHXA 3D7HA 1CG2A 4ZI6A 4OMEA 1LFWA 3B7IA 5LYLA 3N5FA 2XEIA 1ELMP 3WC5A 1QMUA 2C1CA 2EK8A 4OKOA 3H8EA 3BXMA 4B6ZA 4NGRA 5JH9A 4DJLA 3KL9A 3PFOA 2AFOA 1ELLP 1ARMA 3PB4X 1YSJA 3FEEA 4R8FA 3B3WA 1TF8A 4OC3A 2PJ5A 4Q7AA 3JRUA 3PBEA 4OC2A 4MHNA 3PB6X 4R76A 1Z8LA 4Z65A 4NJRA 3D66A 4MHYA 3S9NA 5LRGA 2I3CA 1Z2LA 4P4EA 5DS0A 4P4IA 3KQXA 1DTDA 4ONWA 1FT7A 2BO9A 4OC1A 4EMEA 2JBKA 2XEFA 3WABA 2O53A 4G1PA 1F2OA 1CP6A 2PJCA 4MCPA 3SI0A 1HDQA 2ABZA 4K3NA 3D7GA 4ZY1A 4YU9A 1ZLIA 2WZNA 5HVGA 3FEDA 3IFEA 5K8MA 1TKFA 4EFDA 5K8PA 3D67A 2V8HA 3BI0A 4LQGA 3B3VA 3NH8A 3VATA 3NA6A 1FNOA 4MRIA 4H2KA 4CPAA 4ZYQA 4UEZA 2PIZA 2AFSA 1AYEA 4RUHA 1HDUA 2ZEGA 3KASA 5THWA 1JQGA 1KWMA 2CF4A 2BCOA 3CPAA 3IWWA 3H8GA 3FH4A 2BOAA 2XEJA 2GREA 1XJOA 1LAPA 4P6YA 5K8NA 1F57A 4NGNA 1AMPA 4JYWA 2NSMA 2PJ4A 3HUVA 5CPAA 5LYIA 5LRJA 2IJZA 1YW4A 4IHMA 5HVFA 4X2TA 2QVPA 3HLPA 4PPZA 3B3CA 3WC6A 1YW6A 2V8VA 3RBUA 1ZLHA 1LANA 1ZG9A 3PB8X 1TKHA 3IJ3A 3FMCA 2ZOFA 3V38A 2ZEFA 3CPXA 4ZX8A 1F2PA 2DEAA 1Y0RA 3FVLA 4P4BA 4YWYA 2Q51A 3V7ZA 3DGVA 2Q43A 1ZG8A 4O23A 4OIWA 4OC0A 3B2YA 4R7MA 4MCSA 2IQ6A 4WJBA 5HVHA 2POKA 4OP4A 2PRQA 3KHZA 2NYQA 2GU2A 4KSIA 1PYTB 4PXCA 3BHXA 2PCUA 3T8WA 2ZELA 3RAMA 1BLLE 5LRKA 4X8IA 4NGQA 4TNUA 3NH4A 4EWTA 1VHOA 2PJ1A 1Y7EA 2JBJA 4JZ0A 2CIJA 4F9VA 3S9LA 3IO1A 2CTCA 3ISXA 5CBMA 3K2KA 2QJ8A
chains in the Genus database with same CATH superfamily
2HB6A 3LMSA 3WR7A 1BPNA 2ZW5A 1S60A 4Y49C 4MFKA 1GYTA 4NGSA 2CXAA 2Q7BA 3PBBA 4UEEA 4IAVA 2OB0A 1CPSA 4E0AA 3R95A 2OR4A 2V8DA 5EBVA 2EO8A 3VARA 1JWQA 1N71A 1CJWA 2B3UA 4OC5A 5JGFA 4XNHB 4UEFA 2ZXVA 4CAEA 2P6GA 2HUZA 4DYOA 1QSOA 4YRHA 2PJ8A 3SJXA 2ZEPA 4DUKA 2C6PA 3KQZA 4PXBA 4MHDA 4MJ8A 3S9MA 1CP7A 2B5GA 3MGDA 4PXDA 2B58A 2DPSA 2O4HA 3CDXA 4L89A 5HH1A 1OBRA 1VHSA 4MY3A 4F0XA 2F8HA 5A28A 3C26A 1NSAA 4WWVA 5H84A 2PJ7A 4KOTA 2PJAA 4QBJA 3UY5A 1RXTA 4NSQA 3L2NA 4F8ZA 4A95A 2FSRA 3TO9A 3PFEA 4AXVA 2V77A 1BAVA 1Q2CA 2PE3A 4P4DA 4XNHC 2YNDA 4K30A 3I1UA 2DF5A 1Y9WA 5G22A 2ZEOA 1EE3P 3VH9A 4HNWB 3GB0A 3PB7X 5F48A 1Y9KA 4B5PA 3PP9A 1R43A 1TIQA 4R87A 4KS9A 4TWEA 2XEGA 2YNCA 2BUEA 5A27A 1QSRA 4R6TA 2ANPA 2I79A 2OU2A 3LD2A 2PJ6A 2QYVA 4MCRA 3IU2A 4Y49B 4B13A 1M4IA 1LAMA 3D7DA 2JEWA 4HPSA 4EVYA 5J8CA 2GE3A 1UFHA 3P2FA 4CGMA 5AG5A 2PJBA 2VZYA 5DWMA 2PDOA 1R57A 3MRUA 4P45A 2V8GA 3SJEA 1QQ9A 2Z3OA 3R9FA 4FBEA 2R98A 3DR6A 1Y7RA 1RTQA 2ZEHA 4A94A 2F7VA 4KSAA 3H8FA 1XMBA 1RO5A 5G1ZA 3E0KA 2RC4A 4NJQA 4DNCA 3IEHA 3JVNA 1IU8A 3KR4A 3TC8A 4QB9A 2Z3LA 2IL4A 2RB7A 4FD5A 2Y0MA 3JTKA 4UIBA 4FWUA 4NEXA 2C6CA 1TKJA 1M4LA 4NCZA 2EUIA 3WT4A 1S7FA 4KLWA 4P44A 1IY7A 2R7HA 3KZWA 2PVWA 3V8IA 4MMOA 3B3TA 5K8OA 1X12A 1R3NA 4MCQA 1IYKA 3ZZIA 3OWCA 4ZBGA 2G3AA 2PJ0A 1AUGA 4M6IA 2WSAA 1L0CA 3CZXA 3GLJA 4OIDA 4CGNA 4II9A 3D8PA 4NFRA 1DE4C 4HNXB 3T9YA 3KR5A 2YNCC 4BD9A 2R8VA 1M4GA 2DPTA 1MJBA 1Z4EA 4ONUA 2RFHA 4XPDB 4A38A 4B5OA 1ZG7A 5JM6A 4A2ZA 4OC4A 5I4MA 4UF4A 4UCNA 4CYNA 4C2ZA 2QMLA 2CTBA 1HEEA 3FF3A 1WWZA 4OLLA 3ISZA 2D4PA 2Z3NA 4YFJA 2ZW7A 4PK3A 4R3KA 4C68A 4F9UA 1V0CA 2AFZA 2HC9A 4E2AA 2D4OA 5LYDA 1KUYA 2EK9A 1Z5RA 2IMOA 4P4FA 3W6XA 5AG7A 2J8MA 3BJ7A 4AG7A 3RO0A 4JLYA 2FS5A 4W9YA 5LRJA 1BPMA 2CNSA 3D7FA 3KKWA 3NE7A 2ZW6A 2ZOGA 3IIBA 2R1IA 2FIAA 2REEA 7CPAA 4MBUA 1H8LA 4UCPA 2JDDA 3GUXA 1Q2DA 1CPXA 3RYOA 5BWAB 4MFPA 5G20A 4KLVA 2AFXA 3D68A 4P4JA 4A37A 2VL1A 2X7BA 3SI2A 1PCAA 3PRTA 4NGTA 4HKFA 3MN8A 5C82A 4JXQA 3TE4A 3H5ZA 3SXOA 5H86A 4JD6A 2FE7A 2OOTA 1XEBA 3D3SA 2PJ2A 5ELYA 1IOIA 1XIXA 1XOVA 1TF9A 2G9DA 4UFWA 4H6ZA 5C88A 4A39A 4H6UA 3BLNA 3G8WA 8CPAA 2ODFA 3BI1A 2Z11A 2EBJA 1LOKA 1VIXA 3TX8A 2GIVA 3D2PA 4M3SA 5D29A 3TOAA 1YLOA 3K9UA 2AFUA 4AB7A 4CYOA 2ZW4A 2J9AA 2ZEEA 2PJ3A 4GM5A 2PVVA 4X3RA 2JLMA 1CM0A 1TXRA 2WYRA 4ZX9A 3KGQA 3SJFA 4BINA 3VWEA 2B4BA 2Q4ZA 3FX6A 4NGPA 5JQ4A 2PJ9A 3QNVA 2PQ8A 4KSFA 1NSLA 4CS0B 5JPHA 2JEVA 3GKRA 1IGBA 5IB9A 3D4UA 4PXEA 4M6HA 5J1QA 1QSTA 5F09A 2I00A 4R9MA 4C7HA 4CAVA 1I1DA 2B4DB 1KZFA 1VHEA 2FIWA 3FECA 3GIUA 2PR8A 3I3GA 3QB8A 4B14A 4BMHA 1VGYA 2PRBA 5GCNA 3WC7A 3EFAA 3PEIA 1YX0A 4MHPA 2GLJA 2P0WA 4CRYB 5KTAA 4ZGYB 1ARLA 4KORA 4HNYB 4ZY2A 4PK2A 4FD6A 1YMEA 2ZEDA 1XFOA 3NE8A 3K9TA 1YQEA 5LYFA 2ZENA 3CT9A 4R3LA 5D8NA 1CX8A 4KOWA 3T90A 4ZY0A 3B3SA 3RZAA 3IC1A 4MI4A 4IUSA 1LCPA 3NH5A 3P2HA 5IX3A 4MHZA 2C6GA 1Z8WA 3DLJA 4CAWA 4FAIA 2Q7SA 1FY7A 4MY0A 4NGMA 4P10A 3B35A 3R9EA 2CY2A 2Z3PA 3B8GA 4A30A 4AG9A 4PSWA 1I12A 2VZZA 1S5KA 4PQAA 2A4NA 1NE9A 1XRYA 3LWUA 1KUXA 2GLFA 4IK2A 1CBXA 2EWBA 4UWJA 3W6SA 3S6FA 3SJGA 3FJUA 1YR0A 1XBUA 2HV2A 2OZUA 1Q7LA 3G3SA 3PB9X 4XPKA 5F47A 2AFWA 3TO7A 1IYLA 3D2MA 2FVGA 3LACA 2AFMA 1UWYA 2PIYA 2VBQA 3N7ZA 3SI1A 5HXDA 1Y0YA 3F0AA 2ZEMA 3I9SA 3NFZA 3KI9A 1Z9UA 2Q4YA 2FCKA 3QAHA 3GY9A 4FUUA 3FB3A 4MXUA 3IWGA 3TT2A 2VEZA 3EXNA 2BL1A 4UIAA 4CYPA 3KHXA 1Z4RA 3D7HA 4RI1A 3TCVA 1CG2A 4U5YA 1GHEA 4AVCA 4ZI6A 6CPAA 3PGPA 4OMEA 1LFWA 1LRZA 4UCMA 2B4DA 3B7IA 2HQYA 4KVXA 5LYLA 3N5FA 2J8RA 2XEIA 3SHPA 1ELMP 1MJAA 3WC5A 4C2XA 1QMUA 5KTDA 2P6FA 2C1CA 4RN7A 2EK8A 4B10A 1A2ZA 4OKOA 3H8EA 4JJXA 3ZJ0A 2WPWA 2P6EA 2G0BA 4OADA 1VKCA 3BXMA 1Q2YA 4B6ZA 4NGRA 5JH9A 4LX9A 3W91A 4BBHA 3PZJA 2OZHA 4KOSA 2EVNA 2DXQA 4DJLA 3TFYA 2PR1A 2CNMA 4CAXA 2Q44A 2YGWA 4L8AA 4CAFA 4QUSA 3KL9A 3PFOA 1IICA 2AFOA 1ELLP 1YGHA 1ARMA 3BJ8A 3PB4X 1YSJA 3FEEA 4R8FA 2QIRA 3K2KA 3B3WA 1TF8A 4OC3A 2PJ5A 4Q7AA 4CYQA 3JRUA 1PUAA 3PBEA 4OC2A 5EMIA 3FNCA 4MHNA 4QVTA 3PB6X 3QAYA 4R76A 1Z8LA 4NF1A 1IIDA 4Z65A 4LQ6A 4NJRA 4KUAA 3D66A 1S7NA 2O28A 3EC4A 2VQYA 4J3GA 4MHYA 5AG6A 3S9NA 4C2YA 2JDCA 5J8FA 5LRGA 4CGOA 2C27A 5KTCA 2I3CA 4CGPA 4MFJA 2WUUA 4KUBA 4KVOE 2B3VA 4GS4A 4M6GA 5FVJA 1Z2LA 1IB1E 3S6GA 3IWEA 4P4EA 2Q4VA 3DSBA 5DS0A 4Q36A 1BOBA 3KQXA 4P4IA 1M4DA 1DTDA 1FT7A 2BO9A 1S7LA 4ONWA 4OC1A 4KOXA 4ORFA 2WPXA 4Q38A 4UFVA 3TOBA 1PU9A 4EMEA 2JBKA 2XEFA 4A31A 4I49A 3WABA 1M44A 3TO6A 2O53A 5CNPA 4G1PA 1F2OA 1CP6A 5HMNA 3CXSA 4UWIA 2PJCA 4M85A 1YVKA 4MCPA 1HDQA 2ABZA 3SI0A 4F0YA 5F46A 4K3NA 1S7KA 3D7GA 3FRMA 4ZY1A 1YVOA 4B11A 4YU9A 1ZLIA 2WZNA 4LUAA 5DWNA 5HVGA 3FEDA 3IFEA 3JUWA 5K8MA 1TKFA 4KOUA 4E8OA 4EFDA 4X5KA 4B12A 2Z10A 3GYAA 4C7IA 5K8PA 3D67A 2V8HA 3VWDA 1K4JA 3DR8A 3BI0A 4A33A 5G21A 5E96A 4LQGA 3B3VA 3NH8A 3VATA 2VI7A 3NA6A 1FNOA 4CRZB 4MRIA 1X10A 4H2KA 4AVAA 4CPAA 4ZYQA 3IGRA 1P0HA 3IU1A 5EC4A 5F49A 4UEZA 3R1KA 2PIZA 2AFSA 1AYEA 1WK4A 1XE4A 1HDUA 2ZEGA 4RUHA 2REFA 3DNSA 2AE6A 3SXNA 3KASA 3S6HA 2Z0ZA 5THWA 3TTHA 4PSXA 4B5PB 1JQGA 1KWMA 2CF4A 1J4JA 2Z3MA 2BCOA 1OZPA 3CPAA 3H8GA 3IWWA 4NXYA 3FH4A 3H4QA 2BOAA 2XEJA 2FT0A 2GREA 4JXRA 2PC1A 1XJOA 1LAPA 4P6YA 2Q04A 5K8NA 1F57A 4NGNA 3DDDA 2H5MA 1AMPA 3F5BA 4JYWA 3CXPA 4MFLA 2FL4A 2NSMA 1SQHA 2PJ4A 3HUVA 5CPAA 5LYIA 1YREA 4KZTA 4R57A 2IJZA 1YW4A 4IHMA 4PV6A 2OH1A 1BO4A 2Z3KA 3LODA 5HVFA 3F8KA 4CGLA 3A9LA 4X2TA 2QVPA 3HLPA 4PPZA 3B3CA 2BEIA 1NMTA 3WC6A 5I0CA 2AJ6A 4KOVA 3FYNA 1YW6A 1XF8A 2GANA 1MK4A 2V8VA 1ZLHA 1LANA 1ZG9A 2VXKA 3RBUA 3PB8X 5AG4A 1TKHA 2K5TA 3FMCA 2GFQA 3IJ3A 4UFXA 1I21A 2PSWA 2ZOFA 3V38A 2ZEFA 3CPXA 4KVME 4ZX8A 4GXHA 1F2PA 2DEAA 1Y0RA 3FVLA 4P4BA 3EY5A 2ARHA 4YWYA 4KOYA 4QC6A 1XMTA 2Q51A 3V7ZA 3DGVA 3EO4A 5IV0A 2Q43A 3R96A 1B6BA 4JWPA 4XPLA 1ZG8A 4A32A 2QECA 5ISVA 4O23A 1Z8TA 1ON0A 3FIXA 4OIWA 2BSWA 4OC0A 3B2YA 4R7MA 4U9YA 2KCWA 4MCSA 2IQ6A 2CNTA 3FXTA 2G3TA 4UA3A 5AGEA 4WJBA 3RNZA 2NMTA 5HVHA 4MFZA 1P4NA 2B5GB 2F5IA 3FBUA 2POKA 4OP4A 3S6KA 1Z8XA 1B87A 2J8NA 2PRQA 3KHZA 4OAEA 2NYQA 2GU2A 2ATRA 1QSNA 4KSIA 1PYTB 2FXFA 4PXCA 3BHXA 5IB0A 4H89A 1IOFA 2PCUA 4FD4A 3T8WA 4AVBA 4MFQA 1KUVA 1M1DA 1U6MA 4IF5A 4UBRA 2ZELA 3RAMA 3R9GA 1BLLE 4F6AA 2OZGA 5LRKA 1QSMA 1MJ9A 2ZPAA 4NGQA 3NH4A 4TNUA 4X8IA 4EWTA 1YLEA 1VHOA 2YNEA 4U9ZA 4YGOA 1ZO0A 2PJ1A 3CXQA 1Y7EA 2JBJA 4JZ0A 1S3ZA 2CIJA 4XPDC 4F9VA 4RS2A 3S9LA 3IO1A 2CTCA 3ISXA 5CBMA 2Q0YA 4FD7A 1YK3A 2QJ8A
chains in the Genus database with same CATH topology
2HB6A 3LMSA 1BPNA 4NGSA 1GYTA 3PBBA 4UEEA 4IAVA 1CPSA 2OR4A 2V8DA 3VARA 4OC5A 5JGFA 4UEFA 4DYOA 2PJ8A 3SJXA 2ZEPA 4DUKA 2C6PA 3KQZA 4PXBA 3S9MA 1CP7A 4PXDA 2O4HA 6CPAA 3CDXA 1OBRA 2F8HA 1NSAA 4WWVA 2PJ7A 2PJAA 4F8ZA 3L2NA 4AXVA 3PFEA 2V77A 1BAVA 2PE3A 4P4DA 3I1UA 2ZEOA 1EE3P 3VH9A 3GB0A 3PB7X 1R43A 4TWEA 2XEGA 4R6TA 4MCRA 2ANPA 2PJ6A 2QYVA 1LAMA 3D7DA 2JEWA 2PJBA 3MRUA 4P45A 2V8GA 3SJEA 1QQ9A 4FBEA 1RTQA 2ZEHA 4A94A 2F7VA 3H8FA 1XMBA 4NJQA 3IEHA 3KR4A 3TC8A 2RB7A 4UIBA 4FWUA 2C6CA 1TKJA 1M4LA 3WT4A 4P44A 1IY7A 3KZWA 2PVWA 4MMOA 3B3TA 5K8OA 1R3NA 4MCQA 2PJ0A 3GLJA 4OIDA 4NFRA 1DE4C 3KR5A 4BD9A 4A38A 2RFHA 5JM6A 1ZG7A 4OC4A 5I4MA 4UF4A 3FF3A 2CTBA 1HEEA 3ISZA 4F9UA 2AFZA 2HC9A 5LYDA 2EK9A 1Z5RA 2IMOA 4P4FA 4W9YA 1BPMA 3D7FA 2ZOGA 3IIBA 7CPAA 1H8LA 3GUXA 1CPXA 2AFXA 3D68A 4P4JA 4A37A 2VL1A 3SI2A 1PCAA 3PRTA 4NGTA 3MN8A 2OOTA 2PJ2A 5ELYA 1TF9A 2G9DA 4A39A 8CPAA 3BI1A 1LOKA 1VIXA 3TX8A 5D29A 1YLOA 2AFUA 2J9AA 2ZEEA 2PJ3A 4GM5A 2PVVA 4X3RA 3SJFA 1TXRA 2WYRA 4ZX9A 3KGQA 2Q4ZA 3FX6A 4NGPA 2PJ9A 3QNVA 1IGBA 5IB9A 3D4UA 4PXEA 5J1QA 5F09A 3FECA 1VHEA 1VGYA 3WC7A 3PEIA 4MHPA 2GLJA 1ARLA 4ZY2A 1YMEA 2ZEDA 1XFOA 3K9TA 5LYFA 2ZENA 3CT9A 5D8NA 4ZY0A 1CX8A 3B3SA 3RZAA 3IC1A 1LCPA 3NH5A 4MHZA 2C6GA 3DLJA 4FAIA 4NGMA 4P10A 3B35A 4PQAA 1XRYA 3LWUA 2GLFA 4IK2A 1CBXA 2EWBA 3SJGA 3FJUA 1XBUA 3PB9X 1Q7LA 2AFWA 2FVGA 2AFMA 1UWYA 2PIYA 3SI1A 5HXDA 1Y0YA 2ZEMA 3NFZA 3KI9A 4FUUA 4MXUA 4UIAA 3KHXA 3D7HA 1CG2A 4ZI6A 4OMEA 1LFWA 3B7IA 5LYLA 3N5FA 2XEIA 1ELMP 3WC5A 1QMUA 2C1CA 2EK8A 4OKOA 3H8EA 3BXMA 4B6ZA 4NGRA 5JH9A 4DJLA 3KL9A 3PFOA 2AFOA 1ELLP 1ARMA 3PB4X 1YSJA 3FEEA 4R8FA 3B3WA 1TF8A 4OC3A 2PJ5A 4Q7AA 3JRUA 3PBEA 4OC2A 4MHNA 3PB6X 4R76A 1Z8LA 4Z65A 4NJRA 3D66A 4MHYA 3S9NA 5LRGA 2I3CA 1Z2LA 4P4EA 5DS0A 4P4IA 3KQXA 1DTDA 4ONWA 1FT7A 2BO9A 4OC1A 4EMEA 2JBKA 2XEFA 3WABA 2O53A 4G1PA 1F2OA 1CP6A 2PJCA 4MCPA 3SI0A 1HDQA 2ABZA 4K3NA 3D7GA 4ZY1A 4YU9A 1ZLIA 2WZNA 5HVGA 3FEDA 3IFEA 5K8MA 1TKFA 4EFDA 5K8PA 3D67A 2V8HA 3BI0A 4LQGA 3B3VA 3NH8A 3VATA 3NA6A 1FNOA 4MRIA 4H2KA 4CPAA 4ZYQA 4UEZA 2PIZA 2AFSA 1AYEA 4RUHA 1HDUA 2ZEGA 3KASA 5THWA 1JQGA 1KWMA 2CF4A 2BCOA 3CPAA 3IWWA 3H8GA 3FH4A 2BOAA 2XEJA 2GREA 1XJOA 1LAPA 4P6YA 5K8NA 1F57A 4NGNA 1AMPA 4JYWA 2NSMA 2PJ4A 3HUVA 5CPAA 5LYIA 5LRJA 2IJZA 1YW4A 4IHMA 5HVFA 4X2TA 2QVPA 3HLPA 4PPZA 3B3CA 3WC6A 1YW6A 2V8VA 3RBUA 1ZLHA 1LANA 1ZG9A 3PB8X 1TKHA 3IJ3A 3FMCA 2ZOFA 3V38A 2ZEFA 3CPXA 4ZX8A 1F2PA 2DEAA 1Y0RA 3FVLA 4P4BA 4YWYA 2Q51A 3V7ZA 3DGVA 2Q43A 1ZG8A 4O23A 4OIWA 4OC0A 3B2YA 4R7MA 4MCSA 2IQ6A 4WJBA 5HVHA 2POKA 4OP4A 2PRQA 3KHZA 2NYQA 2GU2A 4KSIA 1PYTB 4PXCA 3BHXA 2PCUA 3T8WA 2ZELA 3RAMA 1BLLE 5LRKA 4X8IA 4NGQA 4TNUA 3NH4A 4EWTA 1VHOA 2PJ1A 1Y7EA 2JBJA 4JZ0A 2CIJA 4F9VA 3S9LA 3IO1A 2CTCA 3ISXA 5CBMA 3K2KA 2QJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HB6 A;  3LMS A;  1BPN A;  4NGS A;  1GYT A;  3PBB A;  4UEE A;  4IAV A;  1CPS A;  2OR4 A;  2V8D A;  3VAR A;  4OC5 A;  5JGF A;  4UEF A;  4DYO A;  2PJ8 A;  3SJX A;  2ZEP A;  4DUK A;  2C6P A;  3KQZ A;  4PXB A;  3S9M A;  1CP7 A;  4PXD A;  2O4H A;  6CPA A;  3CDX A;  1OBR A;  2F8H A;  1NSA A;  4WWV A;  2PJ7 A;  2PJA A;  4F8Z A;  3L2N A;  4AXV A;  3PFE A;  2V77 A;  1BAV A;  2PE3 A;  4P4D A;  3I1U A;  2ZEO A;  1EE3 P;  3VH9 A;  3GB0 A;  3PB7 X;  1R43 A;  4TWE A;  2XEG A;  4R6T A;  4MCR A;  2ANP A;  2PJ6 A;  2QYV A;  1LAM A;  3D7D A;  2JEW A;  2PJB A;  3MRU A;  4P45 A;  2V8G A;  3SJE A;  1QQ9 A;  4FBE A;  1RTQ A;  2ZEH A;  4A94 A;  2F7V A;  3H8F A;  1XMB A;  4NJQ A;  3IEH A;  3KR4 A;  3TC8 A;  2RB7 A;  4UIB A;  4FWU A;  2C6C A;  1TKJ A;  1M4L A;  3WT4 A;  4P44 A;  1IY7 A;  3KZW A;  2PVW A;  4MMO A;  3B3T A;  5K8O A;  1R3N A;  4MCQ A;  2PJ0 A;  3GLJ A;  4OID A;  4NFR A;  1DE4 C;  3KR5 A;  4BD9 A;  4A38 A;  2RFH A;  5JM6 A;  1ZG7 A;  4OC4 A;  5I4M A;  4UF4 A;  3FF3 A;  2CTB A;  1HEE A;  3ISZ A;  4F9U A;  2AFZ A;  2HC9 A;  5LYD A;  2EK9 A;  1Z5R A;  2IMO A;  4P4F A;  4W9Y A;  1BPM A;  3D7F A;  2ZOG A;  3IIB A;  7CPA A;  1H8L A;  3GUX A;  1CPX A;  2AFX A;  3D68 A;  4P4J A;  4A37 A;  2VL1 A;  3SI2 A;  1PCA A;  3PRT A;  4NGT A;  3MN8 A;  2OOT A;  2PJ2 A;  5ELY A;  1TF9 A;  2G9D A;  4A39 A;  8CPA A;  3BI1 A;  1LOK A;  1VIX A;  3TX8 A;  5D29 A;  1YLO A;  2AFU A;  2J9A A;  2ZEE A;  2PJ3 A;  4GM5 A;  2PVV A;  4X3R A;  3SJF A;  1TXR A;  2WYR A;  4ZX9 A;  3KGQ A;  2Q4Z A;  3FX6 A;  4NGP A;  2PJ9 A;  3QNV A;  1IGB A;  5IB9 A;  3D4U A;  4PXE A;  5J1Q A;  5F09 A;  3FEC A;  1VHE A;  1VGY A;  3WC7 A;  3PEI A;  4MHP A;  2GLJ A;  1ARL A;  4ZY2 A;  1YME A;  2ZED A;  1XFO A;  3K9T A;  5LYF A;  2ZEN A;  3CT9 A;  5D8N A;  4ZY0 A;  1CX8 A;  3B3S A;  3RZA A;  3IC1 A;  1LCP A;  3NH5 A;  4MHZ A;  2C6G A;  3DLJ A;  4FAI A;  4NGM A;  4P10 A;  3B35 A;  4PQA A;  1XRY A;  3LWU A;  2GLF A;  4IK2 A;  1CBX A;  2EWB A;  3SJG A;  3FJU A;  1XBU A;  3PB9 X;  1Q7L A;  2AFW A;  2FVG A;  2AFM A;  1UWY A;  2PIY A;  3SI1 A;  5HXD A;  1Y0Y A;  2ZEM A;  3NFZ A;  3KI9 A;  4FUU A;  4MXU A;  4UIA A;  3KHX A;  3D7H A;  1CG2 A;  4ZI6 A;  4OME A;  1LFW A;  3B7I A;  5LYL A;  3N5F A;  2XEI A;  1ELM P;  3WC5 A;  1QMU A;  2C1C A;  2EK8 A;  4OKO A;  3H8E A;  3BXM A;  4B6Z A;  4NGR A;  5JH9 A;  4DJL A;  3KL9 A;  3PFO A;  2AFO A;  1ELL P;  1ARM A;  3PB4 X;  1YSJ A;  3FEE A;  4R8F A;  3B3W A;  1TF8 A;  4OC3 A;  2PJ5 A;  4Q7A A;  3JRU A;  3PBE A;  4OC2 A;  4MHN A;  3PB6 X;  4R76 A;  1Z8L A;  4Z65 A;  4NJR A;  3D66 A;  4MHY A;  3S9N A;  5LRG A;  2I3C A;  1Z2L A;  4P4E A;  5DS0 A;  4P4I A;  3KQX A;  1DTD A;  4ONW A;  1FT7 A;  2BO9 A;  4OC1 A;  4EME A;  2JBK A;  2XEF A;  3WAB A;  2O53 A;  4G1P A;  1F2O A;  1CP6 A;  2PJC A;  4MCP A;  3SI0 A;  1HDQ A;  2ABZ A;  4K3N A;  3D7G A;  4ZY1 A;  4YU9 A;  1ZLI A;  2WZN A;  5HVG A;  3FED A;  3IFE A;  5K8M A;  1TKF A;  4EFD A;  5K8P A;  3D67 A;  2V8H A;  3BI0 A;  4LQG A;  3B3V A;  3NH8 A;  3VAT A;  3NA6 A;  1FNO A;  4MRI A;  4H2K A;  4CPA A;  4ZYQ A;  4UEZ A;  2PIZ A;  2AFS A;  1AYE A;  4RUH A;  1HDU A;  2ZEG A;  3KAS A;  5THW A;  1JQG A;  1KWM A;  2CF4 A;  2BCO A;  3CPA A;  3IWW A;  3H8G A;  3FH4 A;  2BOA A;  2XEJ A;  2GRE A;  1XJO A;  1LAP A;  4P6Y A;  5K8N A;  1F57 A;  4NGN A;  1AMP A;  4JYW A;  2NSM A;  2PJ4 A;  3HUV A;  5CPA A;  5LYI A;  5LRJ A;  2IJZ A;  1YW4 A;  4IHM A;  5HVF A;  4X2T A;  2QVP A;  3HLP A;  4PPZ A;  3B3C A;  3WC6 A;  1YW6 A;  2V8V A;  3RBU A;  1ZLH A;  1LAN A;  1ZG9 A;  3PB8 X;  1TKH A;  3IJ3 A;  3FMC A;  2ZOF A;  3V38 A;  2ZEF A;  3CPX A;  4ZX8 A;  1F2P A;  2DEA A;  1Y0R A;  3FVL A;  4P4B A;  4YWY A;  2Q51 A;  3V7Z A;  3DGV A;  2Q43 A;  1ZG8 A;  4O23 A;  4OIW A;  4OC0 A;  3B2Y A;  4R7M A;  4MCS A;  2IQ6 A;  4WJB A;  5HVH A;  2POK A;  4OP4 A;  2PRQ A;  3KHZ A;  2NYQ A;  2GU2 A;  4KSI A;  1PYT B;  4PXC A;  3BHX A;  2PCU A;  3T8W A;  2ZEL A;  3RAM A;  1BLL E;  5LRK A;  4X8I A;  4NGQ A;  4TNU A;  3NH4 A;  4EWT A;  1VHO A;  2PJ1 A;  1Y7E A;  2JBJ A;  4JZ0 A;  2CIJ A;  4F9V A;  3S9L A;  3IO1 A;  2CTC A;  3ISX A;  5CBM A;  3K2K A;  2QJ8 A; 
#chains in the Genus database with same CATH topology
 2HB6 A;  3LMS A;  3WR7 A;  1BPN A;  2ZW5 A;  1S60 A;  4Y49 C;  4MFK A;  1GYT A;  4NGS A;  2CXA A;  2Q7B A;  3PBB A;  4UEE A;  4IAV A;  2OB0 A;  1CPS A;  4E0A A;  3R95 A;  2OR4 A;  2V8D A;  5EBV A;  2EO8 A;  3VAR A;  1JWQ A;  1N71 A;  1CJW A;  2B3U A;  4OC5 A;  5JGF A;  4XNH B;  4UEF A;  2ZXV A;  4CAE A;  2P6G A;  2HUZ A;  4DYO A;  1QSO A;  4YRH A;  2PJ8 A;  3SJX A;  2ZEP A;  4DUK A;  2C6P A;  3KQZ A;  4PXB A;  4MHD A;  4MJ8 A;  3S9M A;  1CP7 A;  2B5G A;  3MGD A;  4PXD A;  2B58 A;  2DPS A;  2O4H A;  3CDX A;  4L89 A;  5HH1 A;  1OBR A;  1VHS A;  4MY3 A;  4F0X A;  2F8H A;  5A28 A;  3C26 A;  1NSA A;  4WWV A;  5H84 A;  2PJ7 A;  4KOT A;  2PJA A;  4QBJ A;  3UY5 A;  1RXT A;  4NSQ A;  3L2N A;  4F8Z A;  4A95 A;  2FSR A;  3TO9 A;  3PFE A;  4AXV A;  2V77 A;  1BAV A;  1Q2C A;  2PE3 A;  4P4D A;  4XNH C;  2YND A;  4K30 A;  3I1U A;  2DF5 A;  1Y9W A;  5G22 A;  2ZEO A;  1EE3 P;  3VH9 A;  4HNW B;  3GB0 A;  3PB7 X;  5F48 A;  1Y9K A;  4B5P A;  3PP9 A;  1R43 A;  1TIQ A;  4R87 A;  4KS9 A;  4TWE A;  2XEG A;  2YNC A;  2BUE A;  5A27 A;  1QSR A;  4R6T A;  2ANP A;  2I79 A;  2OU2 A;  3LD2 A;  2PJ6 A;  2QYV A;  4MCR A;  3IU2 A;  4Y49 B;  4B13 A;  1M4I A;  1LAM A;  3D7D A;  2JEW A;  4HPS A;  4EVY A;  5J8C A;  2GE3 A;  1UFH A;  3P2F A;  4CGM A;  5AG5 A;  2PJB A;  2VZY A;  5DWM A;  2PDO A;  1R57 A;  3MRU A;  4P45 A;  2V8G A;  3SJE A;  1QQ9 A;  2Z3O A;  3R9F A;  4FBE A;  2R98 A;  3DR6 A;  1Y7R A;  1RTQ A;  2ZEH A;  4A94 A;  2F7V A;  4KSA A;  3H8F A;  1XMB A;  1RO5 A;  5G1Z A;  3E0K A;  2RC4 A;  4NJQ A;  4DNC A;  3IEH A;  3JVN A;  1IU8 A;  3KR4 A;  3TC8 A;  4QB9 A;  2Z3L A;  2IL4 A;  2RB7 A;  4FD5 A;  2Y0M A;  3JTK A;  4UIB A;  4FWU A;  4NEX A;  2C6C A;  1TKJ A;  1M4L A;  4NCZ A;  2EUI A;  3WT4 A;  1S7F A;  4KLW A;  4P44 A;  1IY7 A;  2R7H A;  3KZW A;  2PVW A;  3V8I A;  4MMO A;  3B3T A;  5K8O A;  1X12 A;  1R3N A;  4MCQ A;  1IYK A;  3ZZI A;  3OWC A;  4ZBG A;  2G3A A;  2PJ0 A;  1AUG A;  4M6I A;  2WSA A;  1L0C A;  3CZX A;  3GLJ A;  4OID A;  4CGN A;  4II9 A;  3D8P A;  4NFR A;  1DE4 C;  4HNX B;  3T9Y A;  3KR5 A;  2YNC C;  4BD9 A;  2R8V A;  1M4G A;  2DPT A;  1MJB A;  1Z4E A;  4ONU A;  2RFH A;  4XPD B;  4A38 A;  4B5O A;  1ZG7 A;  5JM6 A;  4A2Z A;  4OC4 A;  5I4M A;  4UF4 A;  4UCN A;  4CYN A;  4C2Z A;  2QML A;  2CTB A;  1HEE A;  3FF3 A;  1WWZ A;  4OLL A;  3ISZ A;  2D4P A;  2Z3N A;  4YFJ A;  2ZW7 A;  4PK3 A;  4R3K A;  4C68 A;  4F9U A;  1V0C A;  2AFZ A;  2HC9 A;  4E2A A;  2D4O A;  5LYD A;  1KUY A;  2EK9 A;  1Z5R A;  2IMO A;  4P4F A;  3W6X A;  5AG7 A;  2J8M A;  3BJ7 A;  4AG7 A;  3RO0 A;  4JLY A;  2FS5 A;  4W9Y A;  5LRJ A;  1BPM A;  2CNS A;  3D7F A;  3KKW A;  3NE7 A;  2ZW6 A;  2ZOG A;  3IIB A;  2R1I A;  2FIA A;  2REE A;  7CPA A;  4MBU A;  1H8L A;  4UCP A;  2JDD A;  3GUX A;  1Q2D A;  1CPX A;  3RYO A;  5BWA B;  4MFP A;  5G20 A;  4KLV A;  2AFX A;  3D68 A;  4P4J A;  4A37 A;  2VL1 A;  2X7B A;  3SI2 A;  1PCA A;  3PRT A;  4NGT A;  4HKF A;  3MN8 A;  5C82 A;  4JXQ A;  3TE4 A;  3H5Z A;  3SXO A;  5H86 A;  4JD6 A;  2FE7 A;  2OOT A;  1XEB A;  3D3S A;  2PJ2 A;  5ELY A;  1IOI A;  1XIX A;  1XOV A;  1TF9 A;  2G9D A;  4UFW A;  4H6Z A;  5C88 A;  4A39 A;  4H6U A;  3BLN A;  3G8W A;  8CPA A;  2ODF A;  3BI1 A;  2Z11 A;  2EBJ A;  1LOK A;  1VIX A;  3TX8 A;  2GIV A;  3D2P A;  4M3S A;  5D29 A;  3TOA A;  1YLO A;  3K9U A;  2AFU A;  4AB7 A;  4CYO A;  2ZW4 A;  2J9A A;  2ZEE A;  2PJ3 A;  4GM5 A;  2PVV A;  4X3R A;  2JLM A;  1CM0 A;  1TXR A;  2WYR A;  4ZX9 A;  3KGQ A;  3SJF A;  4BIN A;  3VWE A;  2B4B A;  2Q4Z A;  3FX6 A;  4NGP A;  5JQ4 A;  2PJ9 A;  3QNV A;  2PQ8 A;  4KSF A;  1NSL A;  4CS0 B;  5JPH A;  2JEV A;  3GKR A;  1IGB A;  5IB9 A;  3D4U A;  4PXE A;  4M6H A;  5J1Q A;  1QST A;  5F09 A;  2I00 A;  4R9M A;  4C7H A;  4CAV A;  1I1D A;  2B4D B;  1KZF A;  1VHE A;  2FIW A;  3FEC A;  3GIU A;  2PR8 A;  3I3G A;  3QB8 A;  4B14 A;  4BMH A;  1VGY A;  2PRB A;  5GCN A;  3WC7 A;  3EFA A;  3PEI A;  1YX0 A;  4MHP A;  2GLJ A;  2P0W A;  4CRY B;  5KTA A;  4ZGY B;  1ARL A;  4KOR A;  4HNY B;  4ZY2 A;  4PK2 A;  4FD6 A;  1YME A;  2ZED A;  1XFO A;  3NE8 A;  3K9T A;  1YQE A;  5LYF A;  2ZEN A;  3CT9 A;  4R3L A;  5D8N A;  1CX8 A;  4KOW A;  3T90 A;  4ZY0 A;  3B3S A;  3RZA A;  3IC1 A;  4MI4 A;  4IUS A;  1LCP A;  3NH5 A;  3P2H A;  5IX3 A;  4MHZ A;  2C6G A;  1Z8W A;  3DLJ A;  4CAW A;  4FAI A;  2Q7S A;  1FY7 A;  4MY0 A;  4NGM A;  4P10 A;  3B35 A;  3R9E A;  2CY2 A;  2Z3P A;  3B8G A;  4A30 A;  4AG9 A;  4PSW A;  1I12 A;  2VZZ A;  1S5K A;  4PQA A;  2A4N A;  1NE9 A;  1XRY A;  3LWU A;  1KUX A;  2GLF A;  4IK2 A;  1CBX A;  2EWB A;  4UWJ A;  3W6S A;  3S6F A;  3SJG A;  3FJU A;  1YR0 A;  1XBU A;  2HV2 A;  2OZU A;  1Q7L A;  3G3S A;  3PB9 X;  4XPK A;  5F47 A;  2AFW A;  3TO7 A;  1IYL A;  3D2M A;  2FVG A;  3LAC A;  2AFM A;  1UWY A;  2PIY A;  2VBQ A;  3N7Z A;  3SI1 A;  5HXD A;  1Y0Y A;  3F0A A;  2ZEM A;  3I9S A;  3NFZ A;  3KI9 A;  1Z9U A;  2Q4Y A;  2FCK A;  3QAH A;  3GY9 A;  4FUU A;  3FB3 A;  4MXU A;  3IWG A;  3TT2 A;  2VEZ A;  3EXN A;  2BL1 A;  4UIA A;  4CYP A;  3KHX A;  1Z4R A;  3D7H A;  4RI1 A;  3TCV A;  1CG2 A;  4U5Y A;  1GHE A;  4AVC A;  4ZI6 A;  6CPA A;  3PGP A;  4OME A;  1LFW A;  1LRZ A;  4UCM A;  2B4D A;  3B7I A;  2HQY A;  4KVX A;  5LYL A;  3N5F A;  2J8R A;  2XEI A;  3SHP A;  1ELM P;  1MJA A;  3WC5 A;  4C2X A;  1QMU A;  5KTD A;  2P6F A;  2C1C A;  4RN7 A;  2EK8 A;  4B10 A;  1A2Z A;  4OKO A;  3H8E A;  4JJX A;  3ZJ0 A;  2WPW A;  2P6E A;  2G0B A;  4OAD A;  1VKC A;  3BXM A;  1Q2Y A;  4B6Z A;  4NGR A;  5JH9 A;  4LX9 A;  3W91 A;  4BBH A;  3PZJ A;  2OZH A;  4KOS A;  2EVN A;  2DXQ A;  4DJL A;  3TFY A;  2PR1 A;  2CNM A;  4CAX A;  2Q44 A;  2YGW A;  4L8A A;  4CAF A;  4QUS A;  3KL9 A;  3PFO A;  1IIC A;  2AFO A;  1ELL P;  1YGH A;  1ARM A;  3BJ8 A;  3PB4 X;  1YSJ A;  3FEE A;  4R8F A;  2QIR A;  3K2K A;  3B3W A;  1TF8 A;  4OC3 A;  2PJ5 A;  4Q7A A;  4CYQ A;  3JRU A;  1PUA A;  3PBE A;  4OC2 A;  5EMI A;  3FNC A;  4MHN A;  4QVT A;  3PB6 X;  3QAY A;  4R76 A;  1Z8L A;  4NF1 A;  1IID A;  4Z65 A;  4LQ6 A;  4NJR A;  4KUA A;  3D66 A;  1S7N A;  2O28 A;  3EC4 A;  2VQY A;  4J3G A;  4MHY A;  5AG6 A;  3S9N A;  4C2Y A;  2JDC A;  5J8F A;  5LRG A;  4CGO A;  2C27 A;  5KTC A;  2I3C A;  4CGP A;  4MFJ A;  2WUU A;  4KUB A;  4KVO E;  2B3V A;  4GS4 A;  4M6G A;  5FVJ A;  1Z2L A;  1IB1 E;  3S6G A;  3IWE A;  4P4E A;  2Q4V A;  3DSB A;  5DS0 A;  4Q36 A;  1BOB A;  3KQX A;  4P4I A;  1M4D A;  1DTD A;  1FT7 A;  2BO9 A;  1S7L A;  4ONW A;  4OC1 A;  4KOX A;  4ORF A;  2WPX A;  4Q38 A;  4UFV A;  3TOB A;  1PU9 A;  4EME A;  2JBK A;  2XEF A;  4A31 A;  4I49 A;  3WAB A;  1M44 A;  3TO6 A;  2O53 A;  5CNP A;  4G1P A;  1F2O A;  1CP6 A;  5HMN A;  3CXS A;  4UWI A;  2PJC A;  4M85 A;  1YVK A;  4MCP A;  1HDQ A;  2ABZ A;  3SI0 A;  4F0Y A;  5F46 A;  4K3N A;  1S7K A;  3D7G A;  3FRM A;  4ZY1 A;  1YVO A;  4B11 A;  4YU9 A;  1ZLI A;  2WZN A;  4LUA A;  5DWN A;  5HVG A;  3FED A;  3IFE A;  3JUW A;  5K8M A;  1TKF A;  4KOU A;  4E8O A;  4EFD A;  4X5K A;  4B12 A;  2Z10 A;  3GYA A;  4C7I A;  5K8P A;  3D67 A;  2V8H A;  3VWD A;  1K4J A;  3DR8 A;  3BI0 A;  4A33 A;  5G21 A;  5E96 A;  4LQG A;  3B3V A;  3NH8 A;  3VAT A;  2VI7 A;  3NA6 A;  1FNO A;  4CRZ B;  4MRI A;  1X10 A;  4H2K A;  4AVA A;  4CPA A;  4ZYQ A;  3IGR A;  1P0H A;  3IU1 A;  5EC4 A;  5F49 A;  4UEZ A;  3R1K A;  2PIZ A;  2AFS A;  1AYE A;  1WK4 A;  1XE4 A;  1HDU A;  2ZEG A;  4RUH A;  2REF A;  3DNS A;  2AE6 A;  3SXN A;  3KAS A;  3S6H A;  2Z0Z A;  5THW A;  3TTH A;  4PSX A;  4B5P B;  1JQG A;  1KWM A;  2CF4 A;  1J4J A;  2Z3M A;  2BCO A;  1OZP A;  3CPA A;  3H8G A;  3IWW A;  4NXY A;  3FH4 A;  3H4Q A;  2BOA A;  2XEJ A;  2FT0 A;  2GRE A;  4JXR A;  2PC1 A;  1XJO A;  1LAP A;  4P6Y A;  2Q04 A;  5K8N A;  1F57 A;  4NGN A;  3DDD A;  2H5M A;  1AMP A;  3F5B A;  4JYW A;  3CXP A;  4MFL A;  2FL4 A;  2NSM A;  1SQH A;  2PJ4 A;  3HUV A;  5CPA A;  5LYI A;  1YRE A;  4KZT A;  4R57 A;  2IJZ A;  1YW4 A;  4IHM A;  4PV6 A;  2OH1 A;  1BO4 A;  2Z3K A;  3LOD A;  5HVF A;  3F8K A;  4CGL A;  3A9L A;  4X2T A;  2QVP A;  3HLP A;  4PPZ A;  3B3C A;  2BEI A;  1NMT A;  3WC6 A;  5I0C A;  2AJ6 A;  4KOV A;  3FYN A;  1YW6 A;  1XF8 A;  2GAN A;  1MK4 A;  2V8V A;  1ZLH A;  1LAN A;  1ZG9 A;  2VXK A;  3RBU A;  3PB8 X;  5AG4 A;  1TKH A;  2K5T A;  3FMC A;  2GFQ A;  3IJ3 A;  4UFX A;  1I21 A;  2PSW A;  2ZOF A;  3V38 A;  2ZEF A;  3CPX A;  4KVM E;  4ZX8 A;  4GXH A;  1F2P A;  2DEA A;  1Y0R A;  3FVL A;  4P4B A;  3EY5 A;  2ARH A;  4YWY A;  4KOY A;  4QC6 A;  1XMT A;  2Q51 A;  3V7Z A;  3DGV A;  3EO4 A;  5IV0 A;  2Q43 A;  3R96 A;  1B6B A;  4JWP A;  4XPL A;  1ZG8 A;  4A32 A;  2QEC A;  5ISV A;  4O23 A;  1Z8T A;  1ON0 A;  3FIX A;  4OIW A;  2BSW A;  4OC0 A;  3B2Y A;  4R7M A;  4U9Y A;  2KCW A;  4MCS A;  2IQ6 A;  2CNT A;  3FXT A;  2G3T A;  4UA3 A;  5AGE A;  4WJB A;  3RNZ A;  2NMT A;  5HVH A;  4MFZ A;  1P4N A;  2B5G B;  2F5I A;  3FBU A;  2POK A;  4OP4 A;  3S6K A;  1Z8X A;  1B87 A;  2J8N A;  2PRQ A;  3KHZ A;  4OAE A;  2NYQ A;  2GU2 A;  2ATR A;  1QSN A;  4KSI A;  1PYT B;  2FXF A;  4PXC A;  3BHX A;  5IB0 A;  4H89 A;  1IOF A;  2PCU A;  4FD4 A;  3T8W A;  4AVB A;  4MFQ A;  1KUV A;  1M1D A;  1U6M A;  4IF5 A;  4UBR A;  2ZEL A;  3RAM A;  3R9G A;  1BLL E;  4F6A A;  2OZG A;  5LRK A;  1QSM A;  1MJ9 A;  2ZPA A;  4NGQ A;  3NH4 A;  4TNU A;  4X8I A;  4EWT A;  1YLE A;  1VHO A;  2YNE A;  4U9Z A;  4YGO A;  1ZO0 A;  2PJ1 A;  3CXQ A;  1Y7E A;  2JBJ A;  4JZ0 A;  1S3Z A;  2CIJ A;  4XPD C;  4F9V A;  4RS2 A;  3S9L A;  3IO1 A;  2CTC A;  3ISX A;  5CBM A;  2Q0Y A;  4FD7 A;  1YK3 A;  2QJ8 A; 
#chains in the Genus database with same CATH homology
 2HB6 A;  3LMS A;  1BPN A;  4NGS A;  1GYT A;  3PBB A;  4UEE A;  4IAV A;  1CPS A;  2OR4 A;  2V8D A;  3VAR A;  4OC5 A;  5JGF A;  4UEF A;  4DYO A;  2PJ8 A;  3SJX A;  2ZEP A;  4DUK A;  2C6P A;  3KQZ A;  4PXB A;  3S9M A;  1CP7 A;  4PXD A;  2O4H A;  6CPA A;  3CDX A;  1OBR A;  2F8H A;  1NSA A;  4WWV A;  2PJ7 A;  2PJA A;  4F8Z A;  3L2N A;  4AXV A;  3PFE A;  2V77 A;  1BAV A;  2PE3 A;  4P4D A;  3I1U A;  2ZEO A;  1EE3 P;  3VH9 A;  3GB0 A;  3PB7 X;  1R43 A;  4TWE A;  2XEG A;  4R6T A;  4MCR A;  2ANP A;  2PJ6 A;  2QYV A;  1LAM A;  3D7D A;  2JEW A;  2PJB A;  3MRU A;  4P45 A;  2V8G A;  3SJE A;  1QQ9 A;  4FBE A;  1RTQ A;  2ZEH A;  4A94 A;  2F7V A;  3H8F A;  1XMB A;  4NJQ A;  3IEH A;  3KR4 A;  3TC8 A;  2RB7 A;  4UIB A;  4FWU A;  2C6C A;  1TKJ A;  1M4L A;  3WT4 A;  4P44 A;  1IY7 A;  3KZW A;  2PVW A;  4MMO A;  3B3T A;  5K8O A;  1R3N A;  4MCQ A;  2PJ0 A;  3GLJ A;  4OID A;  4NFR A;  1DE4 C;  3KR5 A;  4BD9 A;  4A38 A;  2RFH A;  5JM6 A;  1ZG7 A;  4OC4 A;  5I4M A;  4UF4 A;  3FF3 A;  2CTB A;  1HEE A;  3ISZ A;  4F9U A;  2AFZ A;  2HC9 A;  5LYD A;  2EK9 A;  1Z5R A;  2IMO A;  4P4F A;  4W9Y A;  1BPM A;  3D7F A;  2ZOG A;  3IIB A;  7CPA A;  1H8L A;  3GUX A;  1CPX A;  2AFX A;  3D68 A;  4P4J A;  4A37 A;  2VL1 A;  3SI2 A;  1PCA A;  3PRT A;  4NGT A;  3MN8 A;  2OOT A;  2PJ2 A;  5ELY A;  1TF9 A;  2G9D A;  4A39 A;  8CPA A;  3BI1 A;  1LOK A;  1VIX A;  3TX8 A;  5D29 A;  1YLO A;  2AFU A;  2J9A A;  2ZEE A;  2PJ3 A;  4GM5 A;  2PVV A;  4X3R A;  3SJF A;  1TXR A;  2WYR A;  4ZX9 A;  3KGQ A;  2Q4Z A;  3FX6 A;  4NGP A;  2PJ9 A;  3QNV A;  1IGB A;  5IB9 A;  3D4U A;  4PXE A;  5J1Q A;  5F09 A;  3FEC A;  1VHE A;  1VGY A;  3WC7 A;  3PEI A;  4MHP A;  2GLJ A;  1ARL A;  4ZY2 A;  1YME A;  2ZED A;  1XFO A;  3K9T A;  5LYF A;  2ZEN A;  3CT9 A;  5D8N A;  4ZY0 A;  1CX8 A;  3B3S A;  3RZA A;  3IC1 A;  1LCP A;  3NH5 A;  4MHZ A;  2C6G A;  3DLJ A;  4FAI A;  4NGM A;  4P10 A;  3B35 A;  4PQA A;  1XRY A;  3LWU A;  2GLF A;  4IK2 A;  1CBX A;  2EWB A;  3SJG A;  3FJU A;  1XBU A;  3PB9 X;  1Q7L A;  2AFW A;  2FVG A;  2AFM A;  1UWY A;  2PIY A;  3SI1 A;  5HXD A;  1Y0Y A;  2ZEM A;  3NFZ A;  3KI9 A;  4FUU A;  4MXU A;  4UIA A;  3KHX A;  3D7H A;  1CG2 A;  4ZI6 A;  4OME A;  1LFW A;  3B7I A;  5LYL A;  3N5F A;  2XEI A;  1ELM P;  3WC5 A;  1QMU A;  2C1C A;  2EK8 A;  4OKO A;  3H8E A;  3BXM A;  4B6Z A;  4NGR A;  5JH9 A;  4DJL A;  3KL9 A;  3PFO A;  2AFO A;  1ELL P;  1ARM A;  3PB4 X;  1YSJ A;  3FEE A;  4R8F A;  3B3W A;  1TF8 A;  4OC3 A;  2PJ5 A;  4Q7A A;  3JRU A;  3PBE A;  4OC2 A;  4MHN A;  3PB6 X;  4R76 A;  1Z8L A;  4Z65 A;  4NJR A;  3D66 A;  4MHY A;  3S9N A;  5LRG A;  2I3C A;  1Z2L A;  4P4E A;  5DS0 A;  4P4I A;  3KQX A;  1DTD A;  4ONW A;  1FT7 A;  2BO9 A;  4OC1 A;  4EME A;  2JBK A;  2XEF A;  3WAB A;  2O53 A;  4G1P A;  1F2O A;  1CP6 A;  2PJC A;  4MCP A;  3SI0 A;  1HDQ A;  2ABZ A;  4K3N A;  3D7G A;  4ZY1 A;  4YU9 A;  1ZLI A;  2WZN A;  5HVG A;  3FED A;  3IFE A;  5K8M A;  1TKF A;  4EFD A;  5K8P A;  3D67 A;  2V8H A;  3BI0 A;  4LQG A;  3B3V A;  3NH8 A;  3VAT A;  3NA6 A;  1FNO A;  4MRI A;  4H2K A;  4CPA A;  4ZYQ A;  4UEZ A;  2PIZ A;  2AFS A;  1AYE A;  4RUH A;  1HDU A;  2ZEG A;  3KAS A;  5THW A;  1JQG A;  1KWM A;  2CF4 A;  2BCO A;  3CPA A;  3IWW A;  3H8G A;  3FH4 A;  2BOA A;  2XEJ A;  2GRE A;  1XJO A;  1LAP A;  4P6Y A;  5K8N A;  1F57 A;  4NGN A;  1AMP A;  4JYW A;  2NSM A;  2PJ4 A;  3HUV A;  5CPA A;  5LYI A;  5LRJ A;  2IJZ A;  1YW4 A;  4IHM A;  5HVF A;  4X2T A;  2QVP A;  3HLP A;  4PPZ A;  3B3C A;  3WC6 A;  1YW6 A;  2V8V A;  3RBU A;  1ZLH A;  1LAN A;  1ZG9 A;  3PB8 X;  1TKH A;  3IJ3 A;  3FMC A;  2ZOF A;  3V38 A;  2ZEF A;  3CPX A;  4ZX8 A;  1F2P A;  2DEA A;  1Y0R A;  3FVL A;  4P4B A;  4YWY A;  2Q51 A;  3V7Z A;  3DGV A;  2Q43 A;  1ZG8 A;  4O23 A;  4OIW A;  4OC0 A;  3B2Y A;  4R7M A;  4MCS A;  2IQ6 A;  4WJB A;  5HVH A;  2POK A;  4OP4 A;  2PRQ A;  3KHZ A;  2NYQ A;  2GU2 A;  4KSI A;  1PYT B;  4PXC A;  3BHX A;  2PCU A;  3T8W A;  2ZEL A;  3RAM A;  1BLL E;  5LRK A;  4X8I A;  4NGQ A;  4TNU A;  3NH4 A;  4EWT A;  1VHO A;  2PJ1 A;  1Y7E A;  2JBJ A;  4JZ0 A;  2CIJ A;  4F9V A;  3S9L A;  3IO1 A;  2CTC A;  3ISX A;  5CBM A;  3K2K A;  2QJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...