1LOKA

The 1.20 angstrom resolution crystal structure of the aminopeptidase from aeromonas proteolytica complexed with tris: a tale of buffer inhibition
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
291
structure length
291
Chain Sequence
b'MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
molecule tags Hydrolase
publication title The 1.20 Angstrom Resolution Crystal Structure of the Aminopeptidase from Aeromonas proteolytica Complexed with Tris A tale of Buffer Inhibition
pubmed doi rcsb
total genus 113
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2002-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1lokA00
4P4BA 2XEFA 4ZY1A 4DUKA 3CPXA 4X2TA 4LQGA 5J1QA 5IB9A 3NH4A 1VHEA 4P6YA 4P45A 3FECA 1XJOA 4A39A 4P4DA 3I1UA 3TX8A 2PJ3A 4MCSA 6CPAA 5K8PA 4NJRA 2QJ8A 2CIJA 1Z8LA 3PFEA 1NSAA 3V38A 2DEAA 2PJBA 1OBRA 4P10A 2PJ7A 2ZEFA 4MHYA 2PJAA 3S9LA 3B3SA 5LYLA 2PJ2A 4ZI6A 2C1CA 2ZEOA 2ZEEA 4NGPA 2RB7A 2V77A 4EFDA 2J9AA 4FWUA 4IHMA 3WC5A 3FH4A 2POKA 2V8VA 3PBBA 2QVPA 1YW6A 1F2PA 3D7GA 3KHXA 5LYFA 2CF4A 1ZLHA 3FJUA 1Y7EA 4NGNA 1ZG7A 2XEJA 3BXMA 2PE3A 4P44A 1IGBA 1YSJA 4P4JA 1JQGA 1FT7A 3B3VA 4A94A 4ZY2A 5JH9A 2FVGA 4IK2A 4ONWA 3CDXA 4NGTA 1BPMA 2O53A 2OR4A 4PXEA 4F9VA 2ABZA 1LFWA 4YWYA 1H8LA 3SJGA 1LAPA 3B7IA 3GB0A 3BHXA 3SI1A 3IEHA 3LWUA 2EK8A 3QNVA 3RAMA 2C6CA 4IAVA 1ZG8A 2AFXA 1QQ9A 4B6ZA 1BLLE 2VL1A 4OKOA 3PB9X 4MCQA 3FMCA 4AXVA 5K8MA 2G9DA 1Y0RA 4H2KA 1TF8A 3PB7X 2ZOGA 4TWEA 2ZOFA 1CPXA 2GLJA 1Z5RA 3RZAA 3PEIA 3D4UA 1CG2A 2WYRA 2V8HA 4TNUA 5THWA 4JZ0A 3S9NA 3WC7A 4NFRA 4FUUA 3D7HA 1TXRA 2ZEMA 2AFZA 1ARLA 4G1PA 4KSIA 4MCPA 1LANA 4OMEA 1XBUA 4EWTA 3KR4A 4K3NA 4ZX9A 4UEEA 3NH8A 1Z2LA 3PBEA 2PJ8A 2PVVA 4WWVA 4Q7AA 3VH9A 2C6PA 4FAIA 1VHOA 4MHNA 3SI2A 3PB6X 3KGQA 5LRJA 4X8IA 4R8FA 3IIBA 1ELLP 2XEIA 4UIBA 1CP7A 4Z65A 3MRUA 4UEFA 2PJ1A 2OOTA 3KASA 1ARMA 2O4HA 5K8NA 8CPAA 3SJXA 1TKJA 4NGSA 4FBEA 4WJBA 1GYTA 4MCRA 2EWBA 1F57A 3FEDA 2V8GA 4R7MA 3D66A 1CBXA 1AMPA 2AFUA 1UWYA 2GREA 2PCUA 5K8OA 3NH5A 1LOKA 2ZENA 1EE3P 3CPAA 2ZEPA 3IO1A 2IMOA 2JBJA 3WT4A 3ISXA 4PQAA 3N5FA 2EK9A 4GM5A 1ELMP 3FEEA 2JEWA 3D7FA 2Q4ZA 4PXDA 4UF4A 1TKFA 3KL9A 1HEEA 4R76A 4MMOA 4NGMA 1PCAA 5I4MA 1LCPA 2V8DA 1ZG9A 2NSMA 4P4IA 3KI9A 4P4EA 1YMEA 4R6TA 5D8NA 3K9TA 4OIDA 4A37A 1ZLIA 4MRIA 2ZEHA 3B3TA 1HDQA 5DS0A 4X3RA 2GU2A 4PPZA 3FVLA 3ISZA 1HDUA 3RBUA 4EMEA 2GLFA 3H8GA 2CTBA 3PFOA 4PXBA 1LAMA 1R43A 3KHZA 3B3CA 3S9MA 4OC5A 1DTDA 1F2OA 4NJQA 2BCOA 4ZY0A 4DJLA 2ZEDA 2PRQA 3KR5A 2AFSA 4A38A 2C6GA 2WZNA 2RFHA 1R3NA 5CBMA 2JBKA 4MHPA 5LRGA 3BI1A 1VIXA 3B3WA 3CT9A 3H8FA 2XEGA 4OC3A 1XMBA 3TC8A 5LYDA 1IY7A 1YLOA 5CPAA 2PJCA 2ZEGA 2AFWA 3GLJA 3PB8X 2F7VA 2F8HA 2PIYA 2AFOA 1YW4A 5D29A 3VARA 4ZYQA 2ANPA 3IJ3A 4NGRA 3D67A 3SJEA 4UIAA 4JYWA 2BO9A 1BPNA 2PIZA 5HVFA 4BD9A 4OC0A 2ZELA 3HLPA 1QMUA 3VATA 1XRYA 1KWMA 2Q43A 2Q51A 5HVGA 3V7ZA 2PJ9A 5LYIA 4O23A 1VGYA 3NA6A 2HB6A 1TKHA 3WC6A 3KZWA 2CTCA 1M4LA 2PVWA 3MN8A 2PJ4A 4MXUA 5JGFA 3B2YA 3H8EA 2IJZA 2PJ6A 7CPAA 1BAVA 5HXDA 1CPSA 4W9YA 5LRKA 1CP6A 4F8ZA 4OIWA 3PRTA 1Q7LA 1RTQA 4MHZA 3IC1A 5ELYA 3WABA 1DE4C 4NGQA 4OC1A 4UEZA 1FNOA 3IFEA 4ZX8A 4YU9A 1Y0YA 3T8WA 3FF3A 4RUHA 3K2KA 3SI0A 5F09A 3LMSA 1AYEA 2PJ0A 3KQZA 3JRUA 2I3CA 3DLJA 1XFOA 1CX8A 2NYQA 3KQXA 3HUVA 5HVHA 4DYOA 3DGVA 1TF9A 3D7DA 2QYVA 3NFZA 4OC2A 2BOAA 2IQ6A 3SJFA 3D68A 3L2NA 5JM6A 3BI0A 4F9UA 2AFMA 3IWWA 2PJ5A 3GUXA 4OC4A 2HC9A 4PXCA 4OP4A 4CPAA 1PYTB 4P4FA 3B35A 3FX6A 3PB4X
chains in the Genus database with same CATH superfamily
4P4BA 4M3SA 3TE4A 1QSRA 4XPKA 2XEFA 4K30A 5EMIA 3D2MA 3RYOA 4B5PA 4ZY1A 4MFQA 4DUKA 2WPXA 3CPXA 4X2TA 5E96A 3S6KA 4NF1A 1S7FA 4LQGA 5J1QA 3JUWA 5IB9A 3NH4A 4A31A 1Z4RA 2EUIA 1VHEA 4P6YA 2Z0ZA 4P45A 1A2ZA 3FECA 3VWDA 4KORA 4C2XA 1XJOA 3QAHA 5F48A 4A39A 3R1KA 2H5MA 2DF5A 3W6XA 4P4DA 3I1UA 4M6GA 4NXYA 1KUXA 3TX8A 2PJ3A 3FX6A 1ZO0A 4MCSA 3WR7A 4HKFA 1N71A 4NJRA 4DNCA 6CPAA 5K8PA 2QJ8A 3QB8A 1WWZA 4MBUA 2B4DB 4C2ZA 1S3ZA 2CIJA 2ZW6A 1Z8LA 3PFEA 3PZJA 2P6GA 4KOXA 1YK3A 1NSAA 3TT2A 2PDOA 3V38A 2DEAA 2PJBA 1OBRA 4P10A 4UWJA 2PJ7A 4CAXA 2ZEFA 4MHYA 4CYPA 2PJAA 3S9LA 2Z11A 3B3SA 5LYLA 2PJ2A 3FNCA 2J8RA 5KTDA 5ISVA 1V0CA 3C26A 3LD2A 4ZI6A 2C1CA 2ZEOA 2ZEEA 5EC4A 4B12A 4PK3A 4IF5A 2B4BA 4NGPA 4QC6A 3I3GA 2RB7A 2V77A 4UFVA 4EFDA 2CNSA 2J9AA 2R98A 4FWUA 4IHMA 3WC5A 4CAVA 4F0XA 5IB0A 1XIXA 4NEXA 3FH4A 2POKA 2V8VA 2WUUA 3PBBA 2QVPA 1YW6A 4L89A 2PC1A 1F2PA 3D7GA 2Q44A 3GY9A 3KHXA 1VKCA 5LYFA 2GANA 1YVOA 2CF4A 3FXTA 2GFQA 1ZLHA 4CYOA 3FJUA 4M85A 4MI4A 1Y7EA 4NGNA 4UCNA 1ZG7A 2XEJA 3TO9A 3BXMA 2PE3A 4P44A 5AG4A 1IGBA 3CZXA 3EO4A 4C7HA 1YSJA 4P4JA 5FVJA 1JQGA 1FT7A 2Q0YA 3B3VA 2I79A 4A33A 4A94A 2P0WA 4ZY2A 4CAEA 2HV2A 2QECA 5AG7A 1FY7A 3RNZA 5JH9A 2FVGA 4ONUA 4IK2A 4ONWA 3BJ8A 3CDXA 4NGTA 1BPMA 1RO5A 3BLNA 2O53A 2OR4A 4PXEA 4F9VA 5I0CA 2ABZA 1LFWA 1MJAA 2ZPAA 4L8AA 4JJXA 1YVKA 4YWYA 1H8LA 2EO8A 2R8VA 4C68A 1OZPA 2YNCA 3B8GA 2J8MA 3SJGA 4HNXB 1LAPA 2DXQA 2FSRA 3B7IA 3F0AA 1X10A 3R95A 3GB0A 3BHXA 1U6MA 3SI1A 2K5TA 3IEHA 3LWUA 2EK8A 3JVNA 3QNVA 4FD6A 2G0BA 1XEBA 5C88A 3DSBA 3RAMA 2C6CA 3A9LA 3CXSA 2FIWA 4FD4A 4IAVA 1ZG8A 4NCZA 2GE3A 1S7NA 4AG9A 2AFXA 4H6UA 1QQ9A 4B6ZA 1SQHA 1BLLE 1Z9UA 2VL1A 2JLMA 4OKOA 2AE6A 3SXOA 1IB1E 2FCKA 3F8KA 3PB9X 4B5OA 4JD6A 4JXRA 4MCQA 3FMCA 4Q38A 4AXVA 2CNTA 5K8MA 2G9DA 1IOIA 1Y0RA 2OZGA 4H2KA 3DDDA 1TF8A 3EC4A 1IU8A 2O28A 3PB7X 2B4DA 5G22A 4PSWA 1BO4A 4GS4A 4E2AA 1B87A 3K9UA 2ZOGA 4RN7A 4TWEA 2ZOFA 4QUSA 1CPXA 3KKWA 2GLJA 5GCNA 4B14A 4B13A 1Z5RA 3RZAA 3PEIA 2OH1A 3QAYA 3D4UA 4M6HA 2PSWA 2CNMA 1CG2A 3PGPA 4LQ6A 4YFJA 2WYRA 2PRBA 2V8HA 4TNUA 5THWA 2VI7A 1M4GA 4JZ0A 4IUSA 1Z8TA 3S9NA 3PP9A 3RO0A 3ZZIA 5F49A 2VXKA 3WC7A 4NFRA 4FUUA 3D7HA 1TXRA 2ZEMA 5KTAA 2AFZA 1ARLA 2VZYA 4G1PA 4KSIA 1QSTA 3UY5A 4MCPA 1S5KA 2ARHA 1LANA 4OMEA 1XBUA 4AVCA 5DWMA 4EWTA 2ZW7A 2QMLA 3GKRA 1UFHA 2G3TA 2JDCA 4JWPA 4CGNA 1XOVA 1GHEA 4KUBA 5AG5A 1ON0A 2BSWA 3KR4A 2ZW4A 4FD7A 4K3NA 4ZX9A 3TOBA 4UEEA 4PSXA 3NH8A 1Z2LA 3PBEA 4JLYA 2IL4A 3TTHA 2PJ8A 1Q2YA 2PVVA 2QIRA 4Q7AA 4UCPA 4WWVA 3VH9A 2C6PA 3G8WA 4FAIA 1VHOA 4MHNA 3SI2A 2CY2A 3PB6X 2YGWA 3KGQA 5LRJA 3G3SA 5HMNA 4X8IA 4R8FA 4B10A 4LX9A 3IIBA 1ELLP 2PQ8A 2FT0A 5EBVA 4CGPA 4QBJA 5A27A 4HNWB 2XEIA 4UIBA 2YNDA 5KTCA 1Q2DA 1CP7A 1Z8WA 4Z65A 1R57A 3MRUA 5G21A 4UEFA 4Y49B 2PJ1A 4XNHB 1KUVA 4X5KA 2OOTA 4E0AA 1IYLA 1MJ9A 3KASA 1ARMA 3R96A 4KSAA 4UWIA 2O4HA 4LUAA 8CPAA 5K8NA 4KUAA 4BBHA 2D4PA 3SJXA 3CXQA 1TKJA 3MGDA 4NGSA 4FBEA 2PR8A 4WJBA 1GYTA 1NMTA 4MCRA 4ZGYB 1VHSA 1F57A 2EWBA 2Q4VA 4PK2A 2I00A 1M4IA 3FEDA 2V8GA 3D66A 4R7MA 1CBXA 3D2PA 2BUEA 1AMPA 1Y9WA 2AFUA 1UWYA 2DPTA 2WSAA 2PCUA 2GREA 4J3GA 5K8OA 3FBUA 3NH5A 1XF8A 4KSFA 1LOKA 1XMTA 2ZENA 3IWEA 3DR6A 1EE3P 4U9ZA 1YR0A 3CPAA 1PU9A 1KUYA 3N7ZA 5CNPA 2J8NA 2ZEPA 2ZW5A 4MFJA 3IO1A 2IMOA 4Y49C 3WT4A 3ISXA 4KOWA 4PQAA 5G1ZA 1YLEA 4JXQA 2R1IA 4C2YA 3N5FA 2EK9A 1Y7RA 2FL4A 2ZXVA 4GM5A 3D8PA 1ELMP 3FEEA 2VZZA 2AJ6A 2JEWA 4UFXA 4YGOA 2OZHA 3D7FA 2Q4ZA 4PXDA 4UF4A 1TKFA 2Z3LA 3JTKA 2Z10A 3KL9A 1HEEA 2Q7BA 4R76A 1MK4A 1IIDA 2BL1A 3OWCA 4CS0B 2G3AA 4MMOA 4NGMA 2FE7A 4FD5A 1PCAA 5I4MA 1LCPA 2OU2A 2V8DA 1ZG9A 2NSMA 4R3LA 4XNHC 3EY5A 3IU1A 2C27A 3NE8A 5DWNA 2KCWA 4P4IA 3KI9A 4P4EA 1YMEA 2A4NA 4R6TA 5D8NA 2FIAA 4OAEA 4KOTA 3TCVA 3K9TA 4MFLA 1J4JA 1PUAA 4CYQA 4OIDA 1K4JA 3W91A 1ZLIA 4MRIA 2ZEHA 4A37A 3B3TA 1HDQA 5DS0A 1WK4A 1XE4A 4X3RA 1M4DA 4QB9A 2GU2A 3FVLA 4PPZA 1MJBA 4F6AA 2JDDA 3ISZA 1HDUA 3RBUA 4EMEA 2GLFA 4F0YA 4XPDC 3H8GA 4AG7A 3GYAA 2CTBA 3PFOA 4PXBA 1LAMA 4HPSA 4UBRA 1L0CA 1R43A 3VWEA 2R7HA 3KHZA 4KVME 4A95A 3B3CA 3S9MA 1YGHA 4OC5A 1DTDA 1Q2CA 1BOBA 3H5ZA 3IGRA 1F2OA 5HH1A 4A2ZA 3NE7A 5J8CA 4NJQA 3DNSA 4CYNA 1CJWA 2OZUA 2VBQA 3SHPA 4GXHA 2BCOA 1TIQA 4KOVA 4ZY0A 4DJLA 2Z3OA 2EVNA 2ZEDA 2PRQA 3KR5A 2AFSA 4A38A 2FXFA 2FS5A 3FIXA 2C6GA 1IYKA 1IICA 2WZNA 4U5YA 2Z3NA 2RFHA 1R3NA 5CBMA 2JBKA 2Z3PA 5F47A 4MHPA 5LRGA 4NSQA 4XPDB 3IWGA 3S6GA 3TOAA 3BI1A 4KVOE 4CRYB 3BJ7A 4OADA 1I1DA 1VIXA 3T90A 3EFAA 3B3WA 3CT9A 3H8FA 2XEGA 4OLLA 1XMBA 4OC3A 3TC8A 1P0HA 2B5GB 5LYDA 4MJ8A 1M1DA 1IY7A 1YLOA 3H4QA 2PJCA 5CPAA 5A28A 4KOSA 1AUGA 4KLWA 1KZFA 2Q04A 2D4OA 2WPWA 2ZEGA 4MFKA 2VEZA 5AGEA 2AFWA 3GLJA 3PB8X 2F7VA 1S7KA 2F8HA 1I21A 2PIYA 2P6FA 2BEIA 4KLVA 3E0KA 5G20A 2REEA 4E8OA 3DR8A 3R9GA 2AFOA 4BINA 1IOFA 1YW4A 4MHDA 2CXAA 5D29A 4RS2A 2ANPA 3VARA 4CGMA 4ZYQA 5IX3A 2HUZA 4YRHA 3IJ3A 4C7IA 3F5BA 4NGRA 2ATRA 3D67A 3W6SA 3SJEA 4UIAA 2YNCC 4UCMA 4JYWA 1YX0A 2BO9A 4KOUA 1BPNA 2PIZA 4CGOA 3EXNA 4R87A 5HVFA 4BD9A 4KVXA 2ZELA 4OC0A 5BWAB 3HLPA 4EVYA 1QMUA 3GIUA 3VATA 1XRYA 3CXPA 4R9MA 3TFYA 1P4NA 5F46A 1KWMA 2F5IA 4ORFA 2Q43A 2Q51A 1YQEA 2NMTA 3S6FA 3FB3A 5HVGA 4CGLA 3V7ZA 4B5PB 4MY3A 3R9FA 5IV0A 4PV6A 2PJ9A 5LYIA 3ZJ0A 4O23A 2Q4YA 1VGYA 3S6HA 4KZTA 3NA6A 2HB6A 4H6ZA 1TKHA 1Z8XA 3WC6A 3KZWA 5JPHA 1QSNA 3TO7A 4R3KA 2CTCA 1M4LA 2ODFA 2PVWA 3MN8A 2PJ4A 1B6BA 4MXUA 5JGFA 2PR1A 3B2YA 3H8EA 1S7LA 4I49A 2DPSA 3I9SA 4MFPA 4MFZA 1RXTA 1S60A 2B3VA 2IJZA 1BAVA 2PJ6A 4KOYA 7CPAA 3V8IA 3R9EA 5HXDA 1CPSA 2GIVA 4W9YA 5LRKA 4R57A 1CP6A 4A32A 4AVBA 4F8ZA 2B3UA 2B58A 2VQYA 2X7BA 3PRTA 2OB0A 4OIWA 1Q7LA 4H89A 1RTQA 3LODA 4MHZA 3IC1A 4QVTA 1CM0A 5ELYA 5H84A 3WABA 1M44A 1NE9A 1DE4C 4NGQA 4M6IA 2EBJA 4OC1A 4UEZA 1FNOA 1I12A 3IFEA 4ZX8A 4XPLA 4AVAA 2RC4A 4KS9A 3P2HA 4YU9A 1Y0YA 5AG6A 3FF3A 3T8WA 2Q7SA 4RUHA 4RI1A 2Y0MA 3K2KA 3SI0A 4CAFA 3TO6A 5F09A 3LMSA 2Z3KA 1YREA 4UFWA 4Q36A 2B5GA 1AYEA 2PJ0A 3KQZA 2REFA 3D3SA 4UA3A 3SXNA 1QSOA 3JRUA 2I3CA 3T9YA 3DLJA 1XFOA 2Z3MA 5J8FA 1CX8A 2NYQA 3KQXA 3HUVA 3LACA 4CAWA 4MY0A 5HVHA 1X12A 3P2FA 4DYOA 3DGVA 1TF9A 3FRMA 4AB7A 3D7DA 2QYVA 3NFZA 1LRZA 4OC2A 4BMHA 2BOAA 2IQ6A 2JEVA 2P6EA 3SJFA 4U9YA 1JWQA 4B11A 3IU2A 3D68A 3L2NA 2YNEA 5JM6A 3BI0A 4F9UA 4A30A 2AFMA 1Z4EA 3IWWA 2PJ5A 3GUXA 5JQ4A 4HNYB 5C82A 4OC4A 4ZBGA 1Y9KA 2HC9A 4II9A 4PXCA 5H86A 3FYNA 4CRZB 4OP4A 4CPAA 1PYTB 4P4FA 1NSLA 2HQYA 3B35A 1QSMA 2JBJA 3PB4X
chains in the Genus database with same CATH topology
4P4BA 2XEFA 4ZY1A 4DUKA 3CPXA 4X2TA 4LQGA 5J1QA 5IB9A 3NH4A 1VHEA 4P6YA 4P45A 3FECA 1XJOA 4A39A 4P4DA 3I1UA 3TX8A 2PJ3A 4MCSA 6CPAA 5K8PA 4NJRA 2QJ8A 2CIJA 1Z8LA 3PFEA 1NSAA 3V38A 2DEAA 2PJBA 1OBRA 4P10A 2PJ7A 2ZEFA 4MHYA 2PJAA 3S9LA 3B3SA 5LYLA 2PJ2A 4ZI6A 2C1CA 2ZEOA 2ZEEA 4NGPA 2RB7A 2V77A 4EFDA 2J9AA 4FWUA 4IHMA 3WC5A 3FH4A 2POKA 2V8VA 3PBBA 2QVPA 1YW6A 1F2PA 3D7GA 3KHXA 5LYFA 2CF4A 1ZLHA 3FJUA 1Y7EA 4NGNA 1ZG7A 2XEJA 3BXMA 2PE3A 4P44A 1IGBA 1YSJA 4P4JA 1JQGA 1FT7A 3B3VA 4A94A 4ZY2A 5JH9A 2FVGA 4IK2A 4ONWA 3CDXA 4NGTA 1BPMA 2O53A 2OR4A 4PXEA 4F9VA 2ABZA 1LFWA 4YWYA 1H8LA 3SJGA 1LAPA 3B7IA 3GB0A 3BHXA 3SI1A 3IEHA 3LWUA 2EK8A 3QNVA 3RAMA 2C6CA 4IAVA 1ZG8A 2AFXA 1QQ9A 4B6ZA 1BLLE 2VL1A 4OKOA 3PB9X 4MCQA 3FMCA 4AXVA 5K8MA 2G9DA 1Y0RA 4H2KA 1TF8A 3PB7X 2ZOGA 4TWEA 2ZOFA 1CPXA 2GLJA 1Z5RA 3RZAA 3PEIA 3D4UA 1CG2A 2WYRA 2V8HA 4TNUA 5THWA 4JZ0A 3S9NA 3WC7A 4NFRA 4FUUA 3D7HA 1TXRA 2ZEMA 2AFZA 1ARLA 4G1PA 4KSIA 4MCPA 1LANA 4OMEA 1XBUA 4EWTA 3KR4A 4K3NA 4ZX9A 4UEEA 3NH8A 1Z2LA 3PBEA 2PJ8A 2PVVA 4WWVA 4Q7AA 3VH9A 2C6PA 4FAIA 1VHOA 4MHNA 3SI2A 3PB6X 3KGQA 5LRJA 4X8IA 4R8FA 3IIBA 1ELLP 2XEIA 4UIBA 1CP7A 4Z65A 3MRUA 4UEFA 2PJ1A 2OOTA 3KASA 1ARMA 2O4HA 5K8NA 8CPAA 3SJXA 1TKJA 4NGSA 4FBEA 4WJBA 1GYTA 4MCRA 2EWBA 1F57A 3FEDA 2V8GA 4R7MA 3D66A 1CBXA 1AMPA 2AFUA 1UWYA 2GREA 2PCUA 5K8OA 3NH5A 1LOKA 2ZENA 1EE3P 3CPAA 2ZEPA 3IO1A 2IMOA 2JBJA 3WT4A 3ISXA 4PQAA 3N5FA 2EK9A 4GM5A 1ELMP 3FEEA 2JEWA 3D7FA 2Q4ZA 4PXDA 4UF4A 1TKFA 3KL9A 1HEEA 4R76A 4MMOA 4NGMA 1PCAA 5I4MA 1LCPA 2V8DA 1ZG9A 2NSMA 4P4IA 3KI9A 4P4EA 1YMEA 4R6TA 5D8NA 3K9TA 4OIDA 4A37A 1ZLIA 4MRIA 2ZEHA 3B3TA 1HDQA 5DS0A 4X3RA 2GU2A 4PPZA 3FVLA 3ISZA 1HDUA 3RBUA 4EMEA 2GLFA 3H8GA 2CTBA 3PFOA 4PXBA 1LAMA 1R43A 3KHZA 3B3CA 3S9MA 4OC5A 1DTDA 1F2OA 4NJQA 2BCOA 4ZY0A 4DJLA 2ZEDA 2PRQA 3KR5A 2AFSA 4A38A 2C6GA 2WZNA 2RFHA 1R3NA 5CBMA 2JBKA 4MHPA 5LRGA 3BI1A 1VIXA 3B3WA 3CT9A 3H8FA 2XEGA 4OC3A 1XMBA 3TC8A 5LYDA 1IY7A 1YLOA 5CPAA 2PJCA 2ZEGA 2AFWA 3GLJA 3PB8X 2F7VA 2F8HA 2PIYA 2AFOA 1YW4A 5D29A 3VARA 4ZYQA 2ANPA 3IJ3A 4NGRA 3D67A 3SJEA 4UIAA 4JYWA 2BO9A 1BPNA 2PIZA 5HVFA 4BD9A 4OC0A 2ZELA 3HLPA 1QMUA 3VATA 1XRYA 1KWMA 2Q43A 2Q51A 5HVGA 3V7ZA 2PJ9A 5LYIA 4O23A 1VGYA 3NA6A 2HB6A 1TKHA 3WC6A 3KZWA 2CTCA 1M4LA 2PVWA 3MN8A 2PJ4A 4MXUA 5JGFA 3B2YA 3H8EA 2IJZA 2PJ6A 7CPAA 1BAVA 5HXDA 1CPSA 4W9YA 5LRKA 1CP6A 4F8ZA 4OIWA 3PRTA 1Q7LA 1RTQA 4MHZA 3IC1A 5ELYA 3WABA 1DE4C 4NGQA 4OC1A 4UEZA 1FNOA 3IFEA 4ZX8A 4YU9A 1Y0YA 3T8WA 3FF3A 4RUHA 3K2KA 3SI0A 5F09A 3LMSA 1AYEA 2PJ0A 3KQZA 3JRUA 2I3CA 3DLJA 1XFOA 1CX8A 2NYQA 3KQXA 3HUVA 5HVHA 4DYOA 3DGVA 1TF9A 3D7DA 2QYVA 3NFZA 4OC2A 2BOAA 2IQ6A 3SJFA 3D68A 3L2NA 5JM6A 3BI0A 4F9UA 2AFMA 3IWWA 2PJ5A 3GUXA 4OC4A 2HC9A 4PXCA 4OP4A 4CPAA 1PYTB 4P4FA 3B35A 3FX6A 3PB4X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4B A;  2XEF A;  4ZY1 A;  4DUK A;  3CPX A;  4X2T A;  4LQG A;  5J1Q A;  5IB9 A;  3NH4 A;  1VHE A;  4P6Y A;  4P45 A;  3FEC A;  1XJO A;  4A39 A;  4P4D A;  3I1U A;  3TX8 A;  2PJ3 A;  4MCS A;  6CPA A;  5K8P A;  4NJR A;  2QJ8 A;  2CIJ A;  1Z8L A;  3PFE A;  1NSA A;  3V38 A;  2DEA A;  2PJB A;  1OBR A;  4P10 A;  2PJ7 A;  2ZEF A;  4MHY A;  2PJA A;  3S9L A;  3B3S A;  5LYL A;  2PJ2 A;  4ZI6 A;  2C1C A;  2ZEO A;  2ZEE A;  4NGP A;  2RB7 A;  2V77 A;  4EFD A;  2J9A A;  4FWU A;  4IHM A;  3WC5 A;  3FH4 A;  2POK A;  2V8V A;  3PBB A;  2QVP A;  1YW6 A;  1F2P A;  3D7G A;  3KHX A;  5LYF A;  2CF4 A;  1ZLH A;  3FJU A;  1Y7E A;  4NGN A;  1ZG7 A;  2XEJ A;  3BXM A;  2PE3 A;  4P44 A;  1IGB A;  1YSJ A;  4P4J A;  1JQG A;  1FT7 A;  3B3V A;  4A94 A;  4ZY2 A;  5JH9 A;  2FVG A;  4IK2 A;  4ONW A;  3CDX A;  4NGT A;  1BPM A;  2O53 A;  2OR4 A;  4PXE A;  4F9V A;  2ABZ A;  1LFW A;  4YWY A;  1H8L A;  3SJG A;  1LAP A;  3B7I A;  3GB0 A;  3BHX A;  3SI1 A;  3IEH A;  3LWU A;  2EK8 A;  3QNV A;  3RAM A;  2C6C A;  4IAV A;  1ZG8 A;  2AFX A;  1QQ9 A;  4B6Z A;  1BLL E;  2VL1 A;  4OKO A;  3PB9 X;  4MCQ A;  3FMC A;  4AXV A;  5K8M A;  2G9D A;  1Y0R A;  4H2K A;  1TF8 A;  3PB7 X;  2ZOG A;  4TWE A;  2ZOF A;  1CPX A;  2GLJ A;  1Z5R A;  3RZA A;  3PEI A;  3D4U A;  1CG2 A;  2WYR A;  2V8H A;  4TNU A;  5THW A;  4JZ0 A;  3S9N A;  3WC7 A;  4NFR A;  4FUU A;  3D7H A;  1TXR A;  2ZEM A;  2AFZ A;  1ARL A;  4G1P A;  4KSI A;  4MCP A;  1LAN A;  4OME A;  1XBU A;  4EWT A;  3KR4 A;  4K3N A;  4ZX9 A;  4UEE A;  3NH8 A;  1Z2L A;  3PBE A;  2PJ8 A;  2PVV A;  4WWV A;  4Q7A A;  3VH9 A;  2C6P A;  4FAI A;  1VHO A;  4MHN A;  3SI2 A;  3PB6 X;  3KGQ A;  5LRJ A;  4X8I A;  4R8F A;  3IIB A;  1ELL P;  2XEI A;  4UIB A;  1CP7 A;  4Z65 A;  3MRU A;  4UEF A;  2PJ1 A;  2OOT A;  3KAS A;  1ARM A;  2O4H A;  5K8N A;  8CPA A;  3SJX A;  1TKJ A;  4NGS A;  4FBE A;  4WJB A;  1GYT A;  4MCR A;  2EWB A;  1F57 A;  3FED A;  2V8G A;  4R7M A;  3D66 A;  1CBX A;  1AMP A;  2AFU A;  1UWY A;  2GRE A;  2PCU A;  5K8O A;  3NH5 A;  1LOK A;  2ZEN A;  1EE3 P;  3CPA A;  2ZEP A;  3IO1 A;  2IMO A;  2JBJ A;  3WT4 A;  3ISX A;  4PQA A;  3N5F A;  2EK9 A;  4GM5 A;  1ELM P;  3FEE A;  2JEW A;  3D7F A;  2Q4Z A;  4PXD A;  4UF4 A;  1TKF A;  3KL9 A;  1HEE A;  4R76 A;  4MMO A;  4NGM A;  1PCA A;  5I4M A;  1LCP A;  2V8D A;  1ZG9 A;  2NSM A;  4P4I A;  3KI9 A;  4P4E A;  1YME A;  4R6T A;  5D8N A;  3K9T A;  4OID A;  4A37 A;  1ZLI A;  4MRI A;  2ZEH A;  3B3T A;  1HDQ A;  5DS0 A;  4X3R A;  2GU2 A;  4PPZ A;  3FVL A;  3ISZ A;  1HDU A;  3RBU A;  4EME A;  2GLF A;  3H8G A;  2CTB A;  3PFO A;  4PXB A;  1LAM A;  1R43 A;  3KHZ A;  3B3C A;  3S9M A;  4OC5 A;  1DTD A;  1F2O A;  4NJQ A;  2BCO A;  4ZY0 A;  4DJL A;  2ZED A;  2PRQ A;  3KR5 A;  2AFS A;  4A38 A;  2C6G A;  2WZN A;  2RFH A;  1R3N A;  5CBM A;  2JBK A;  4MHP A;  5LRG A;  3BI1 A;  1VIX A;  3B3W A;  3CT9 A;  3H8F A;  2XEG A;  4OC3 A;  1XMB A;  3TC8 A;  5LYD A;  1IY7 A;  1YLO A;  5CPA A;  2PJC A;  2ZEG A;  2AFW A;  3GLJ A;  3PB8 X;  2F7V A;  2F8H A;  2PIY A;  2AFO A;  1YW4 A;  5D29 A;  3VAR A;  4ZYQ A;  2ANP A;  3IJ3 A;  4NGR A;  3D67 A;  3SJE A;  4UIA A;  4JYW A;  2BO9 A;  1BPN A;  2PIZ A;  5HVF A;  4BD9 A;  4OC0 A;  2ZEL A;  3HLP A;  1QMU A;  3VAT A;  1XRY A;  1KWM A;  2Q43 A;  2Q51 A;  5HVG A;  3V7Z A;  2PJ9 A;  5LYI A;  4O23 A;  1VGY A;  3NA6 A;  2HB6 A;  1TKH A;  3WC6 A;  3KZW A;  2CTC A;  1M4L A;  2PVW A;  3MN8 A;  2PJ4 A;  4MXU A;  5JGF A;  3B2Y A;  3H8E A;  2IJZ A;  2PJ6 A;  7CPA A;  1BAV A;  5HXD A;  1CPS A;  4W9Y A;  5LRK A;  1CP6 A;  4F8Z A;  4OIW A;  3PRT A;  1Q7L A;  1RTQ A;  4MHZ A;  3IC1 A;  5ELY A;  3WAB A;  1DE4 C;  4NGQ A;  4OC1 A;  4UEZ A;  1FNO A;  3IFE A;  4ZX8 A;  4YU9 A;  1Y0Y A;  3T8W A;  3FF3 A;  4RUH A;  3K2K A;  3SI0 A;  5F09 A;  3LMS A;  1AYE A;  2PJ0 A;  3KQZ A;  3JRU A;  2I3C A;  3DLJ A;  1XFO A;  1CX8 A;  2NYQ A;  3KQX A;  3HUV A;  5HVH A;  4DYO A;  3DGV A;  1TF9 A;  3D7D A;  2QYV A;  3NFZ A;  4OC2 A;  2BOA A;  2IQ6 A;  3SJF A;  3D68 A;  3L2N A;  5JM6 A;  3BI0 A;  4F9U A;  2AFM A;  3IWW A;  2PJ5 A;  3GUX A;  4OC4 A;  2HC9 A;  4PXC A;  4OP4 A;  4CPA A;  1PYT B;  4P4F A;  3B35 A;  3FX6 A;  3PB4 X; 
#chains in the Genus database with same CATH topology
 4P4B A;  4M3S A;  3TE4 A;  1QSR A;  4XPK A;  2XEF A;  4K30 A;  5EMI A;  3D2M A;  3RYO A;  4B5P A;  4ZY1 A;  4MFQ A;  4DUK A;  2WPX A;  3CPX A;  4X2T A;  5E96 A;  3S6K A;  4NF1 A;  1S7F A;  4LQG A;  5J1Q A;  3JUW A;  5IB9 A;  3NH4 A;  4A31 A;  1Z4R A;  2EUI A;  1VHE A;  4P6Y A;  2Z0Z A;  4P45 A;  1A2Z A;  3FEC A;  3VWD A;  4KOR A;  4C2X A;  1XJO A;  3QAH A;  5F48 A;  4A39 A;  3R1K A;  2H5M A;  2DF5 A;  3W6X A;  4P4D A;  3I1U A;  4M6G A;  4NXY A;  1KUX A;  3TX8 A;  2PJ3 A;  3FX6 A;  1ZO0 A;  4MCS A;  3WR7 A;  4HKF A;  1N71 A;  4NJR A;  4DNC A;  6CPA A;  5K8P A;  2QJ8 A;  3QB8 A;  1WWZ A;  4MBU A;  2B4D B;  4C2Z A;  1S3Z A;  2CIJ A;  2ZW6 A;  1Z8L A;  3PFE A;  3PZJ A;  2P6G A;  4KOX A;  1YK3 A;  1NSA A;  3TT2 A;  2PDO A;  3V38 A;  2DEA A;  2PJB A;  1OBR A;  4P10 A;  4UWJ A;  2PJ7 A;  4CAX A;  2ZEF A;  4MHY A;  4CYP A;  2PJA A;  3S9L A;  2Z11 A;  3B3S A;  5LYL A;  2PJ2 A;  3FNC A;  2J8R A;  5KTD A;  5ISV A;  1V0C A;  3C26 A;  3LD2 A;  4ZI6 A;  2C1C A;  2ZEO A;  2ZEE A;  5EC4 A;  4B12 A;  4PK3 A;  4IF5 A;  2B4B A;  4NGP A;  4QC6 A;  3I3G A;  2RB7 A;  2V77 A;  4UFV A;  4EFD A;  2CNS A;  2J9A A;  2R98 A;  4FWU A;  4IHM A;  3WC5 A;  4CAV A;  4F0X A;  5IB0 A;  1XIX A;  4NEX A;  3FH4 A;  2POK A;  2V8V A;  2WUU A;  3PBB A;  2QVP A;  1YW6 A;  4L89 A;  2PC1 A;  1F2P A;  3D7G A;  2Q44 A;  3GY9 A;  3KHX A;  1VKC A;  5LYF A;  2GAN A;  1YVO A;  2CF4 A;  3FXT A;  2GFQ A;  1ZLH A;  4CYO A;  3FJU A;  4M85 A;  4MI4 A;  1Y7E A;  4NGN A;  4UCN A;  1ZG7 A;  2XEJ A;  3TO9 A;  3BXM A;  2PE3 A;  4P44 A;  5AG4 A;  1IGB A;  3CZX A;  3EO4 A;  4C7H A;  1YSJ A;  4P4J A;  5FVJ A;  1JQG A;  1FT7 A;  2Q0Y A;  3B3V A;  2I79 A;  4A33 A;  4A94 A;  2P0W A;  4ZY2 A;  4CAE A;  2HV2 A;  2QEC A;  5AG7 A;  1FY7 A;  3RNZ A;  5JH9 A;  2FVG A;  4ONU A;  4IK2 A;  4ONW A;  3BJ8 A;  3CDX A;  4NGT A;  1BPM A;  1RO5 A;  3BLN A;  2O53 A;  2OR4 A;  4PXE A;  4F9V A;  5I0C A;  2ABZ A;  1LFW A;  1MJA A;  2ZPA A;  4L8A A;  4JJX A;  1YVK A;  4YWY A;  1H8L A;  2EO8 A;  2R8V A;  4C68 A;  1OZP A;  2YNC A;  3B8G A;  2J8M A;  3SJG A;  4HNX B;  1LAP A;  2DXQ A;  2FSR A;  3B7I A;  3F0A A;  1X10 A;  3R95 A;  3GB0 A;  3BHX A;  1U6M A;  3SI1 A;  2K5T A;  3IEH A;  3LWU A;  2EK8 A;  3JVN A;  3QNV A;  4FD6 A;  2G0B A;  1XEB A;  5C88 A;  3DSB A;  3RAM A;  2C6C A;  3A9L A;  3CXS A;  2FIW A;  4FD4 A;  4IAV A;  1ZG8 A;  4NCZ A;  2GE3 A;  1S7N A;  4AG9 A;  2AFX A;  4H6U A;  1QQ9 A;  4B6Z A;  1SQH A;  1BLL E;  1Z9U A;  2VL1 A;  2JLM A;  4OKO A;  2AE6 A;  3SXO A;  1IB1 E;  2FCK A;  3F8K A;  3PB9 X;  4B5O A;  4JD6 A;  4JXR A;  4MCQ A;  3FMC A;  4Q38 A;  4AXV A;  2CNT A;  5K8M A;  2G9D A;  1IOI A;  1Y0R A;  2OZG A;  4H2K A;  3DDD A;  1TF8 A;  3EC4 A;  1IU8 A;  2O28 A;  3PB7 X;  2B4D A;  5G22 A;  4PSW A;  1BO4 A;  4GS4 A;  4E2A A;  1B87 A;  3K9U A;  2ZOG A;  4RN7 A;  4TWE A;  2ZOF A;  4QUS A;  1CPX A;  3KKW A;  2GLJ A;  5GCN A;  4B14 A;  4B13 A;  1Z5R A;  3RZA A;  3PEI A;  2OH1 A;  3QAY A;  3D4U A;  4M6H A;  2PSW A;  2CNM A;  1CG2 A;  3PGP A;  4LQ6 A;  4YFJ A;  2WYR A;  2PRB A;  2V8H A;  4TNU A;  5THW A;  2VI7 A;  1M4G A;  4JZ0 A;  4IUS A;  1Z8T A;  3S9N A;  3PP9 A;  3RO0 A;  3ZZI A;  5F49 A;  2VXK A;  3WC7 A;  4NFR A;  4FUU A;  3D7H A;  1TXR A;  2ZEM A;  5KTA A;  2AFZ A;  1ARL A;  2VZY A;  4G1P A;  4KSI A;  1QST A;  3UY5 A;  4MCP A;  1S5K A;  2ARH A;  1LAN A;  4OME A;  1XBU A;  4AVC A;  5DWM A;  4EWT A;  2ZW7 A;  2QML A;  3GKR A;  1UFH A;  2G3T A;  2JDC A;  4JWP A;  4CGN A;  1XOV A;  1GHE A;  4KUB A;  5AG5 A;  1ON0 A;  2BSW A;  3KR4 A;  2ZW4 A;  4FD7 A;  4K3N A;  4ZX9 A;  3TOB A;  4UEE A;  4PSX A;  3NH8 A;  1Z2L A;  3PBE A;  4JLY A;  2IL4 A;  3TTH A;  2PJ8 A;  1Q2Y A;  2PVV A;  2QIR A;  4Q7A A;  4UCP A;  4WWV A;  3VH9 A;  2C6P A;  3G8W A;  4FAI A;  1VHO A;  4MHN A;  3SI2 A;  2CY2 A;  3PB6 X;  2YGW A;  3KGQ A;  5LRJ A;  3G3S A;  5HMN A;  4X8I A;  4R8F A;  4B10 A;  4LX9 A;  3IIB A;  1ELL P;  2PQ8 A;  2FT0 A;  5EBV A;  4CGP A;  4QBJ A;  5A27 A;  4HNW B;  2XEI A;  4UIB A;  2YND A;  5KTC A;  1Q2D A;  1CP7 A;  1Z8W A;  4Z65 A;  1R57 A;  3MRU A;  5G21 A;  4UEF A;  4Y49 B;  2PJ1 A;  4XNH B;  1KUV A;  4X5K A;  2OOT A;  4E0A A;  1IYL A;  1MJ9 A;  3KAS A;  1ARM A;  3R96 A;  4KSA A;  4UWI A;  2O4H A;  4LUA A;  8CPA A;  5K8N A;  4KUA A;  4BBH A;  2D4P A;  3SJX A;  3CXQ A;  1TKJ A;  3MGD A;  4NGS A;  4FBE A;  2PR8 A;  4WJB A;  1GYT A;  1NMT A;  4MCR A;  4ZGY B;  1VHS A;  1F57 A;  2EWB A;  2Q4V A;  4PK2 A;  2I00 A;  1M4I A;  3FED A;  2V8G A;  3D66 A;  4R7M A;  1CBX A;  3D2P A;  2BUE A;  1AMP A;  1Y9W A;  2AFU A;  1UWY A;  2DPT A;  2WSA A;  2PCU A;  2GRE A;  4J3G A;  5K8O A;  3FBU A;  3NH5 A;  1XF8 A;  4KSF A;  1LOK A;  1XMT A;  2ZEN A;  3IWE A;  3DR6 A;  1EE3 P;  4U9Z A;  1YR0 A;  3CPA A;  1PU9 A;  1KUY A;  3N7Z A;  5CNP A;  2J8N A;  2ZEP A;  2ZW5 A;  4MFJ A;  3IO1 A;  2IMO A;  4Y49 C;  3WT4 A;  3ISX A;  4KOW A;  4PQA A;  5G1Z A;  1YLE A;  4JXQ A;  2R1I A;  4C2Y A;  3N5F A;  2EK9 A;  1Y7R A;  2FL4 A;  2ZXV A;  4GM5 A;  3D8P A;  1ELM P;  3FEE A;  2VZZ A;  2AJ6 A;  2JEW A;  4UFX A;  4YGO A;  2OZH A;  3D7F A;  2Q4Z A;  4PXD A;  4UF4 A;  1TKF A;  2Z3L A;  3JTK A;  2Z10 A;  3KL9 A;  1HEE A;  2Q7B A;  4R76 A;  1MK4 A;  1IID A;  2BL1 A;  3OWC A;  4CS0 B;  2G3A A;  4MMO A;  4NGM A;  2FE7 A;  4FD5 A;  1PCA A;  5I4M A;  1LCP A;  2OU2 A;  2V8D A;  1ZG9 A;  2NSM A;  4R3L A;  4XNH C;  3EY5 A;  3IU1 A;  2C27 A;  3NE8 A;  5DWN A;  2KCW A;  4P4I A;  3KI9 A;  4P4E A;  1YME A;  2A4N A;  4R6T A;  5D8N A;  2FIA A;  4OAE A;  4KOT A;  3TCV A;  3K9T A;  4MFL A;  1J4J A;  1PUA A;  4CYQ A;  4OID A;  1K4J A;  3W91 A;  1ZLI A;  4MRI A;  2ZEH A;  4A37 A;  3B3T A;  1HDQ A;  5DS0 A;  1WK4 A;  1XE4 A;  4X3R A;  1M4D A;  4QB9 A;  2GU2 A;  3FVL A;  4PPZ A;  1MJB A;  4F6A A;  2JDD A;  3ISZ A;  1HDU A;  3RBU A;  4EME A;  2GLF A;  4F0Y A;  4XPD C;  3H8G A;  4AG7 A;  3GYA A;  2CTB A;  3PFO A;  4PXB A;  1LAM A;  4HPS A;  4UBR A;  1L0C A;  1R43 A;  3VWE A;  2R7H A;  3KHZ A;  4KVM E;  4A95 A;  3B3C A;  3S9M A;  1YGH A;  4OC5 A;  1DTD A;  1Q2C A;  1BOB A;  3H5Z A;  3IGR A;  1F2O A;  5HH1 A;  4A2Z A;  3NE7 A;  5J8C A;  4NJQ A;  3DNS A;  4CYN A;  1CJW A;  2OZU A;  2VBQ A;  3SHP A;  4GXH A;  2BCO A;  1TIQ A;  4KOV A;  4ZY0 A;  4DJL A;  2Z3O A;  2EVN A;  2ZED A;  2PRQ A;  3KR5 A;  2AFS A;  4A38 A;  2FXF A;  2FS5 A;  3FIX A;  2C6G A;  1IYK A;  1IIC A;  2WZN A;  4U5Y A;  2Z3N A;  2RFH A;  1R3N A;  5CBM A;  2JBK A;  2Z3P A;  5F47 A;  4MHP A;  5LRG A;  4NSQ A;  4XPD B;  3IWG A;  3S6G A;  3TOA A;  3BI1 A;  4KVO E;  4CRY B;  3BJ7 A;  4OAD A;  1I1D A;  1VIX A;  3T90 A;  3EFA A;  3B3W A;  3CT9 A;  3H8F A;  2XEG A;  4OLL A;  1XMB A;  4OC3 A;  3TC8 A;  1P0H A;  2B5G B;  5LYD A;  4MJ8 A;  1M1D A;  1IY7 A;  1YLO A;  3H4Q A;  2PJC A;  5CPA A;  5A28 A;  4KOS A;  1AUG A;  4KLW A;  1KZF A;  2Q04 A;  2D4O A;  2WPW A;  2ZEG A;  4MFK A;  2VEZ A;  5AGE A;  2AFW A;  3GLJ A;  3PB8 X;  2F7V A;  1S7K A;  2F8H A;  1I21 A;  2PIY A;  2P6F A;  2BEI A;  4KLV A;  3E0K A;  5G20 A;  2REE A;  4E8O A;  3DR8 A;  3R9G A;  2AFO A;  4BIN A;  1IOF A;  1YW4 A;  4MHD A;  2CXA A;  5D29 A;  4RS2 A;  2ANP A;  3VAR A;  4CGM A;  4ZYQ A;  5IX3 A;  2HUZ A;  4YRH A;  3IJ3 A;  4C7I A;  3F5B A;  4NGR A;  2ATR A;  3D67 A;  3W6S A;  3SJE A;  4UIA A;  2YNC C;  4UCM A;  4JYW A;  1YX0 A;  2BO9 A;  4KOU A;  1BPN A;  2PIZ A;  4CGO A;  3EXN A;  4R87 A;  5HVF A;  4BD9 A;  4KVX A;  2ZEL A;  4OC0 A;  5BWA B;  3HLP A;  4EVY A;  1QMU A;  3GIU A;  3VAT A;  1XRY A;  3CXP A;  4R9M A;  3TFY A;  1P4N A;  5F46 A;  1KWM A;  2F5I A;  4ORF A;  2Q43 A;  2Q51 A;  1YQE A;  2NMT A;  3S6F A;  3FB3 A;  5HVG A;  4CGL A;  3V7Z A;  4B5P B;  4MY3 A;  3R9F A;  5IV0 A;  4PV6 A;  2PJ9 A;  5LYI A;  3ZJ0 A;  4O23 A;  2Q4Y A;  1VGY A;  3S6H A;  4KZT A;  3NA6 A;  2HB6 A;  4H6Z A;  1TKH A;  1Z8X A;  3WC6 A;  3KZW A;  5JPH A;  1QSN A;  3TO7 A;  4R3K A;  2CTC A;  1M4L A;  2ODF A;  2PVW A;  3MN8 A;  2PJ4 A;  1B6B A;  4MXU A;  5JGF A;  2PR1 A;  3B2Y A;  3H8E A;  1S7L A;  4I49 A;  2DPS A;  3I9S A;  4MFP A;  4MFZ A;  1RXT A;  1S60 A;  2B3V A;  2IJZ A;  1BAV A;  2PJ6 A;  4KOY A;  7CPA A;  3V8I A;  3R9E A;  5HXD A;  1CPS A;  2GIV A;  4W9Y A;  5LRK A;  4R57 A;  1CP6 A;  4A32 A;  4AVB A;  4F8Z A;  2B3U A;  2B58 A;  2VQY A;  2X7B A;  3PRT A;  2OB0 A;  4OIW A;  1Q7L A;  4H89 A;  1RTQ A;  3LOD A;  4MHZ A;  3IC1 A;  4QVT A;  1CM0 A;  5ELY A;  5H84 A;  3WAB A;  1M44 A;  1NE9 A;  1DE4 C;  4NGQ A;  4M6I A;  2EBJ A;  4OC1 A;  4UEZ A;  1FNO A;  1I12 A;  3IFE A;  4ZX8 A;  4XPL A;  4AVA A;  2RC4 A;  4KS9 A;  3P2H A;  4YU9 A;  1Y0Y A;  5AG6 A;  3FF3 A;  3T8W A;  2Q7S A;  4RUH A;  4RI1 A;  2Y0M A;  3K2K A;  3SI0 A;  4CAF A;  3TO6 A;  5F09 A;  3LMS A;  2Z3K A;  1YRE A;  4UFW A;  4Q36 A;  2B5G A;  1AYE A;  2PJ0 A;  3KQZ A;  2REF A;  3D3S A;  4UA3 A;  3SXN A;  1QSO A;  3JRU A;  2I3C A;  3T9Y A;  3DLJ A;  1XFO A;  2Z3M A;  5J8F A;  1CX8 A;  2NYQ A;  3KQX A;  3HUV A;  3LAC A;  4CAW A;  4MY0 A;  5HVH A;  1X12 A;  3P2F A;  4DYO A;  3DGV A;  1TF9 A;  3FRM A;  4AB7 A;  3D7D A;  2QYV A;  3NFZ A;  1LRZ A;  4OC2 A;  4BMH A;  2BOA A;  2IQ6 A;  2JEV A;  2P6E A;  3SJF A;  4U9Y A;  1JWQ A;  4B11 A;  3IU2 A;  3D68 A;  3L2N A;  2YNE A;  5JM6 A;  3BI0 A;  4F9U A;  4A30 A;  2AFM A;  1Z4E A;  3IWW A;  2PJ5 A;  3GUX A;  5JQ4 A;  4HNY B;  5C82 A;  4OC4 A;  4ZBG A;  1Y9K A;  2HC9 A;  4II9 A;  4PXC A;  5H86 A;  3FYN A;  4CRZ B;  4OP4 A;  4CPA A;  1PYT B;  4P4F A;  1NSL A;  2HQY A;  3B35 A;  1QSM A;  2JBJ A;  3PB4 X; 
#chains in the Genus database with same CATH homology
 4P4B A;  2XEF A;  4ZY1 A;  4DUK A;  3CPX A;  4X2T A;  4LQG A;  5J1Q A;  5IB9 A;  3NH4 A;  1VHE A;  4P6Y A;  4P45 A;  3FEC A;  1XJO A;  4A39 A;  4P4D A;  3I1U A;  3TX8 A;  2PJ3 A;  4MCS A;  6CPA A;  5K8P A;  4NJR A;  2QJ8 A;  2CIJ A;  1Z8L A;  3PFE A;  1NSA A;  3V38 A;  2DEA A;  2PJB A;  1OBR A;  4P10 A;  2PJ7 A;  2ZEF A;  4MHY A;  2PJA A;  3S9L A;  3B3S A;  5LYL A;  2PJ2 A;  4ZI6 A;  2C1C A;  2ZEO A;  2ZEE A;  4NGP A;  2RB7 A;  2V77 A;  4EFD A;  2J9A A;  4FWU A;  4IHM A;  3WC5 A;  3FH4 A;  2POK A;  2V8V A;  3PBB A;  2QVP A;  1YW6 A;  1F2P A;  3D7G A;  3KHX A;  5LYF A;  2CF4 A;  1ZLH A;  3FJU A;  1Y7E A;  4NGN A;  1ZG7 A;  2XEJ A;  3BXM A;  2PE3 A;  4P44 A;  1IGB A;  1YSJ A;  4P4J A;  1JQG A;  1FT7 A;  3B3V A;  4A94 A;  4ZY2 A;  5JH9 A;  2FVG A;  4IK2 A;  4ONW A;  3CDX A;  4NGT A;  1BPM A;  2O53 A;  2OR4 A;  4PXE A;  4F9V A;  2ABZ A;  1LFW A;  4YWY A;  1H8L A;  3SJG A;  1LAP A;  3B7I A;  3GB0 A;  3BHX A;  3SI1 A;  3IEH A;  3LWU A;  2EK8 A;  3QNV A;  3RAM A;  2C6C A;  4IAV A;  1ZG8 A;  2AFX A;  1QQ9 A;  4B6Z A;  1BLL E;  2VL1 A;  4OKO A;  3PB9 X;  4MCQ A;  3FMC A;  4AXV A;  5K8M A;  2G9D A;  1Y0R A;  4H2K A;  1TF8 A;  3PB7 X;  2ZOG A;  4TWE A;  2ZOF A;  1CPX A;  2GLJ A;  1Z5R A;  3RZA A;  3PEI A;  3D4U A;  1CG2 A;  2WYR A;  2V8H A;  4TNU A;  5THW A;  4JZ0 A;  3S9N A;  3WC7 A;  4NFR A;  4FUU A;  3D7H A;  1TXR A;  2ZEM A;  2AFZ A;  1ARL A;  4G1P A;  4KSI A;  4MCP A;  1LAN A;  4OME A;  1XBU A;  4EWT A;  3KR4 A;  4K3N A;  4ZX9 A;  4UEE A;  3NH8 A;  1Z2L A;  3PBE A;  2PJ8 A;  2PVV A;  4WWV A;  4Q7A A;  3VH9 A;  2C6P A;  4FAI A;  1VHO A;  4MHN A;  3SI2 A;  3PB6 X;  3KGQ A;  5LRJ A;  4X8I A;  4R8F A;  3IIB A;  1ELL P;  2XEI A;  4UIB A;  1CP7 A;  4Z65 A;  3MRU A;  4UEF A;  2PJ1 A;  2OOT A;  3KAS A;  1ARM A;  2O4H A;  5K8N A;  8CPA A;  3SJX A;  1TKJ A;  4NGS A;  4FBE A;  4WJB A;  1GYT A;  4MCR A;  2EWB A;  1F57 A;  3FED A;  2V8G A;  4R7M A;  3D66 A;  1CBX A;  1AMP A;  2AFU A;  1UWY A;  2GRE A;  2PCU A;  5K8O A;  3NH5 A;  1LOK A;  2ZEN A;  1EE3 P;  3CPA A;  2ZEP A;  3IO1 A;  2IMO A;  2JBJ A;  3WT4 A;  3ISX A;  4PQA A;  3N5F A;  2EK9 A;  4GM5 A;  1ELM P;  3FEE A;  2JEW A;  3D7F A;  2Q4Z A;  4PXD A;  4UF4 A;  1TKF A;  3KL9 A;  1HEE A;  4R76 A;  4MMO A;  4NGM A;  1PCA A;  5I4M A;  1LCP A;  2V8D A;  1ZG9 A;  2NSM A;  4P4I A;  3KI9 A;  4P4E A;  1YME A;  4R6T A;  5D8N A;  3K9T A;  4OID A;  4A37 A;  1ZLI A;  4MRI A;  2ZEH A;  3B3T A;  1HDQ A;  5DS0 A;  4X3R A;  2GU2 A;  4PPZ A;  3FVL A;  3ISZ A;  1HDU A;  3RBU A;  4EME A;  2GLF A;  3H8G A;  2CTB A;  3PFO A;  4PXB A;  1LAM A;  1R43 A;  3KHZ A;  3B3C A;  3S9M A;  4OC5 A;  1DTD A;  1F2O A;  4NJQ A;  2BCO A;  4ZY0 A;  4DJL A;  2ZED A;  2PRQ A;  3KR5 A;  2AFS A;  4A38 A;  2C6G A;  2WZN A;  2RFH A;  1R3N A;  5CBM A;  2JBK A;  4MHP A;  5LRG A;  3BI1 A;  1VIX A;  3B3W A;  3CT9 A;  3H8F A;  2XEG A;  4OC3 A;  1XMB A;  3TC8 A;  5LYD A;  1IY7 A;  1YLO A;  5CPA A;  2PJC A;  2ZEG A;  2AFW A;  3GLJ A;  3PB8 X;  2F7V A;  2F8H A;  2PIY A;  2AFO A;  1YW4 A;  5D29 A;  3VAR A;  4ZYQ A;  2ANP A;  3IJ3 A;  4NGR A;  3D67 A;  3SJE A;  4UIA A;  4JYW A;  2BO9 A;  1BPN A;  2PIZ A;  5HVF A;  4BD9 A;  4OC0 A;  2ZEL A;  3HLP A;  1QMU A;  3VAT A;  1XRY A;  1KWM A;  2Q43 A;  2Q51 A;  5HVG A;  3V7Z A;  2PJ9 A;  5LYI A;  4O23 A;  1VGY A;  3NA6 A;  2HB6 A;  1TKH A;  3WC6 A;  3KZW A;  2CTC A;  1M4L A;  2PVW A;  3MN8 A;  2PJ4 A;  4MXU A;  5JGF A;  3B2Y A;  3H8E A;  2IJZ A;  2PJ6 A;  7CPA A;  1BAV A;  5HXD A;  1CPS A;  4W9Y A;  5LRK A;  1CP6 A;  4F8Z A;  4OIW A;  3PRT A;  1Q7L A;  1RTQ A;  4MHZ A;  3IC1 A;  5ELY A;  3WAB A;  1DE4 C;  4NGQ A;  4OC1 A;  4UEZ A;  1FNO A;  3IFE A;  4ZX8 A;  4YU9 A;  1Y0Y A;  3T8W A;  3FF3 A;  4RUH A;  3K2K A;  3SI0 A;  5F09 A;  3LMS A;  1AYE A;  2PJ0 A;  3KQZ A;  3JRU A;  2I3C A;  3DLJ A;  1XFO A;  1CX8 A;  2NYQ A;  3KQX A;  3HUV A;  5HVH A;  4DYO A;  3DGV A;  1TF9 A;  3D7D A;  2QYV A;  3NFZ A;  4OC2 A;  2BOA A;  2IQ6 A;  3SJF A;  3D68 A;  3L2N A;  5JM6 A;  3BI0 A;  4F9U A;  2AFM A;  3IWW A;  2PJ5 A;  3GUX A;  4OC4 A;  2HC9 A;  4PXC A;  4OP4 A;  4CPA A;  1PYT B;  4P4F A;  3B35 A;  3FX6 A;  3PB4 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...