2B3VA

Spermine spermidine acetyltransferase in complex with acetylcoa, k26r mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
167
structure length
167
Chain Sequence
FVIRPATAADCSDILRLIKELARYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 1
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 35
structure length 167
sequence length 167
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b3vA00
4YRHA 4AG9A 1BO4A 2AE6A 4AVAA 2PR1A 3QAHA 4BMHA 1KUVA 2CNMA 2HQYA 2OZHA 3S6KA 2JEVA 4PSWA 1YR0A 2PDOA 4ORFA 4FD4A 3S6GA 3DR6A 1M4IA 4FD6A 1RXTA 3D3SA 4QVTA 3TE4A 1QSRA 4RS2A 2BUEA 1S7LA 4GS4A 4UWIA 4OADA 2OZGA 4PK3A 1S7NA 5I0CA 3W6SA 2PC1A 2AJ6A 3E0KA 3JUWA 5EC4A 4B5PA 3FNCA 1S3ZA 1Y7RA 5KTDA 1VKCA 2OH1A 2REEA 1GHEA 2FT0A 3PGPA 5IX3A 4KOSA 1KZFA 2EUIA 1IICA 4JJXA 2K5TA 4AG7A 3CXQA 4KOTA 3BJ8A 3JVNA 4K30A 1LRZA 1L0CA 2VEZA 4NF1A 4YFJA 4R3KA 5E96A 4H6UA 3SXNA 1Z4RA 4CS0B 1UFHA 3FIXA 4U9YA 1ON0A 3CXSA 4B5OA 1IYLA 3T90A 5IV0A 1Z9UA 4CAWA 2O28A 4CRYB 2FS5A 4CAXA 4F0YA 3OWCA 1BOBA 1YLEA 4R57A 1YVOA 4MHDA 4MY0A 4QBJA 4KVME 3TTHA 3TFYA 2FL4A 3QB8A 3IWGA 2P6EA 1YK3A 1M4DA 4EVYA 1J4JA 1XMTA 2VZYA 3DR8A 1CJWA 1TIQA 4QUSA 5ISVA 4NSQA 2R7HA 2A4NA 2ZPAA 1P0HA 3P2HA 3TT2A 4KOWA 2R8VA 4NXYA 2WPXA 5GCNA 2Z0ZA 3EFAA 2BSWA 1R57A 2B4BA 3W91A 2WPWA 2GE3A 2QECA 4LX9A 3R9FA 4E2AA 1M1DA 3P2FA 2CY2A 4AB7A 4XPDB 4F6AA 1YREA 3SHPA 2ZW4A 3R96A 1OZPA 1Q2YA 2QMLA 2J8NA 4X5KA 4I49A 2F5IA 5CNPA 3TO9A 2ZW6A 4ZBGA 2Z10A 1M44A 3I3GA 4AVBA 2VI7A 3N7ZA 3IGRA 4Y49C 3SXOA 3FXTA 3G8WA 4KVOE 3VWEA 4KORA 2QIRA 2PRBA 4UA3A 2ZW7A 3UY5A 4AVCA 4ONUA 4KUAA 3F0AA 1MJBA 2ZXVA 1XE4A 2Q4YA 3PP9A 2G3TA 3FRMA 1U6MA 1XEBA 1NSLA 1NE9A 2ATRA 4JXQA 1XF8A 1I1DA 2JDCA 4MI4A 4YGOA 3I9SA 4XPDC 4HNXB 4XPLA 4E0AA 4KLVA 3TOAA 1IIDA 3VWDA 4XNHB 3S6FA 1MJAA 1QSNA 2Q7BA 1I21A 3DNSA 1B87A 3BJ7A 2Z11A 3TO7A 4KOXA 2Q04A 3R95A 4JXRA 2CNTA 3PZJA 4QC6A 4QB9A 3H4QA 1NMTA 4OAEA 1Y9KA 1S7KA 2FIWA 2B5GB 2R1IA 3GKRA 4NCZA 2FE7A 3EXNA 5IB0A 1S7FA 4HNYB 2VBQA 5JQ4A 3V8IA 2Q4VA 2D4PA 2Y0MA 4PV6A 2R98A 3FB3A 4XNHC 4H89A 3D2PA 2I00A 3FBUA 2BL1A 4PK2A 4M3SA 1S5KA 2REFA 4H6ZA 4DNCA 3GYAA 5J8CA 5H86A 2B3UA 3K9UA 4KOUA 4KOYA 1IYKA 2G3AA 1S60A 5HH1A 1K4JA 1MK4A 3S6HA 3EO4A 2HUZA 2PQ8A 4L8AA 2FCKA 5H84A 3EY5A 3RYOA 2ARHA 4MY3A 2RC4A 2Q0YA 4UWJA 2D4OA 3F5BA 1QSOA 4JLYA 2NMTA 1IB1E 3F8KA 5EBVA 3B8GA 2VQYA 3D8PA 1SQHA 2OZUA 3T9YA 1KUXA 3KKWA 1Y9WA 3R1KA 1P4NA 4FD5A 5KTAA 1WK4A 1YX0A 1MJ9A 2B4DB 2FIAA 5HMNA 2VXKA 5F48A 4CRZB 4KZTA 4L89A 4U5YA 3TOBA 2GANA 2H5MA 4KUBA 3LD2A 1PUAA 4XPKA 2C27A 2P6FA 4FD7A 1Q2CA 4MBUA 3WR7A 3ZJ0A 5F47A 4IF5A 2PR8A 3BLNA 1B6BA 4RI1A 2VZZA 3W6XA 4B5PB 2ZW5A 2B5GA 4II9A 2G0BA 3DSBA 4MJ8A 3GY9A 1Z4EA 2BEIA 5F46A 2PSWA 4NEXA 2FXFA 2Q44A 4J3GA 2OU2A 5C88A 4CAVA 4KOVA 5C82A 3C26A 1WWZA 2KCWA 5F49A 2J8MA 3FYNA 1I12A 4HNWB 1YVKA 1N71A 3NE7A 2OB0A 3D2MA 3MGDA 3TCVA 4E8OA 2IL4A 5JPHA 1VHSA 3G3SA 2I79A 4KVXA 4JWPA 2B3VA 5KTCA 1M4GA 2FSRA 2DXQA 1QSTA 4PSXA 3ZZIA 1FY7A 1QSMA 5DWMA 2P0WA 1CM0A 2B58A 1V0CA 4Y49B 4R87A 4OLLA 3LODA 2P6GA 3R9EA 3R9GA 2CNSA 4KLWA 2J8RA 1RO5A 4UBRA 1Q2DA 1PU9A 2JLMA 4LUAA 2JDDA 4R9MA 4M85A 4HKFA 4R3LA 2HV2A 5J8FA 3CXPA 3EC4A 2GIVA 2EVNA 3TO6A 1XIXA 4U9ZA 5FVJA 2X7BA 1KUYA 1YGHA 4JD6A 3DDDA 2B4DA 5DWNA 4IUSA
chains in the Genus database with same CATH superfamily
4YRHA 5K8NA 4AG9A 3PFEA 8CPAA 4ZYQA 2YNEA 1BO4A 3D68A 4X8IA 2AE6A 4AVAA 3IJ3A 1BPMA 2PR1A 3B35A 3QAHA 5LYFA 4BMHA 2ABZA 4R8FA 3RZAA 1JQGA 1KUVA 2CNMA 2HQYA 4A32A 1ZLIA 2OZHA 4OC5A 3S6KA 2JEVA 4PSWA 1YR0A 4C2ZA 2ZEHA 3KI9A 1IOFA 4NGMA 4X2TA 2PDOA 3BI0A 4ORFA 3D66A 2V8HA 4FD4A 3S6GA 4MHZA 3DR6A 1XJOA 1M4IA 1YLOA 4CYQA 4FD6A 1RXTA 2AFMA 3D3SA 4UCMA 4CGLA 4QVTA 3TE4A 3D7GA 1QSRA 4RS2A 2BUEA 3BXMA 3JTKA 1S7LA 2V8DA 4GS4A 1CG2A 4UWIA 4OADA 1TF8A 2OZGA 4PK3A 1S7NA 2PRQA 2YNDA 4CAFA 1LAPA 5I0CA 3PB8X 3W6SA 2PC1A 2AJ6A 5G21A 3E0KA 1TXRA 3JUWA 5EC4A 4UF4A 4B5PA 1YMEA 2ZEGA 3FNCA 1S3ZA 1Y7RA 4B6ZA 5KTDA 3KQXA 1VKCA 2AFXA 2OH1A 2C6PA 2REEA 1GHEA 2FT0A 3FF3A 3PGPA 5IX3A 4KOSA 1KZFA 2EUIA 1CP6A 1VHEA 4OMEA 1IICA 4C68A 4JJXA 2K5TA 4AG7A 3K2KA 3S9NA 3TX8A 4A39A 3D7FA 4CGPA 3CXQA 4KOTA 2F8HA 3BJ8A 3JVNA 4K30A 2EO8A 1LRZA 1L0CA 3NA6A 5AG4A 2VEZA 4NF1A 1Z5RA 5LYLA 4CYNA 3I1UA 1ZG9A 4YFJA 3KL9A 4R3KA 5E96A 4H6UA 4TNUA 3SXNA 1Y7EA 1Z4RA 3WT4A 3PEIA 4M6HA 4CS0B 1UFHA 3FIXA 5G1ZA 4U9YA 2AFWA 1IY7A 1ON0A 2PCUA 4Q38A 4ZX8A 4UCPA 2J9AA 2Q43A 2PJ6A 4BBHA 3CXSA 4B5OA 2RB7A 4UIAA 3GB0A 1IYLA 3T90A 5IV0A 1Z9UA 4CAWA 2O28A 4CRYB 2FS5A 3D4UA 4CAXA 4F0YA 4OIWA 3TC8A 1LFWA 4CGNA 3OWCA 1BOBA 1YLEA 1YSJA 4R57A 3HLPA 3B2YA 1BLLE 4MHNA 1YVOA 2ZOFA 4MHDA 3B3VA 4MY0A 5LRJA 5K8PA 3FEDA 4QBJA 4KVME 3TTHA 3TFYA 2Z3PA 3FH4A 2FL4A 2DF5A 1ARLA 3IWGA 3QB8A 4IHMA 2AFSA 2P6EA 1YK3A 4Q36A 1LOKA 2C1CA 3FJUA 4P4FA 1M4DA 5AGEA 2O4HA 4EVYA 3ISXA 1J4JA 2WYRA 3MN8A 2BCOA 5G20A 1XMTA 4PXEA 2VZYA 2Q51A 4ZGYB 3DR8A 3RO0A 1CJWA 1TIQA 1VHOA 4QUSA 4NSQA 5A28A 2R7HA 4IAVA 5ISVA 2A4NA 2ZPAA 4BINA 1P0HA 5BWAB 3P2HA 4KSFA 3TT2A 4H2KA 3NH4A 4KOWA 2CIJA 1F2OA 2V77A 3WC7A 1AYEA 2R8VA 4P4IA 1FNOA 4FWUA 4C2XA 2YGWA 1AMPA 4NXYA 4PPZA 4A94A 3DLJA 3PB6X 4GM5A 2WPXA 3KR5A 2Z0ZA 5GCNA 3EFAA 3KQZA 4YWYA 2BSWA 4OP4A 1R57A 2B4BA 3W91A 5A27A 1Y0YA 2GU2A 2WPWA 2GE3A 2CXAA 2QECA 4CYPA 4LX9A 3R9FA 1LANA 2PJCA 2VL1A 4E2AA 1M1DA 3P2FA 2CY2A 4AB7A 4XPDB 2DPSA 7CPAA 4F6AA 1Y0RA 1YREA 2HC9A 2ZW4A 4MFKA 3IC1A 4PXDA 4R6TA 2ZELA 1OZPA 1Q2YA 3R96A 2QMLA 2J8NA 3KASA 4C7IA 4CYOA 5K8OA 2ZEEA 2NSMA 1VIXA 4X5KA 4I49A 4C7HA 2F5IA 1Q7LA 5CNPA 1EE3P 2OR4A 5HVFA 3TO9A 4LQGA 4AXVA 3CZXA 2ZW6A 4ZBGA 2Z10A 1M44A 3I3GA 4AVBA 2VI7A 3RBUA 3LMSA 3N7ZA 3B3WA 3B3SA 3IGRA 4Y49C 3FXTA 3SXOA 4UFWA 3G8WA 4KVOE 3VWEA 4KORA 4M6IA 3NH8A 2CTCA 3IWEA 3B7IA 3PFOA 2QIRA 3LWUA 1ARMA 1LAMA 2PRBA 4MRIA 4UA3A 3SI1A 2ZW7A 4NGQA 3UY5A 4AVCA 2ZOGA 4ONUA 4KUAA 3F0AA 4KSIA 1MJBA 3N5FA 1XFOA 2ZXVA 1XE4A 1YQEA 4P6YA 3V7ZA 2Q4YA 4A95A 2YNCC 5LYIA 3KZWA 4JYWA 3PP9A 4RUHA 2G3TA 1ZLHA 3FRMA 3B3TA 1CX8A 3D7DA 4MMOA 4A38A 4F0XA 2V8GA 3H8EA 1U6MA 2JBJA 1XEBA 4FAIA 1NSLA 1NE9A 2ATRA 3D67A 4P10A 4JXQA 2ODFA 4G1PA 4F9VA 5HVHA 1XF8A 1I1DA 2JDCA 1UWYA 4MI4A 4OC2A 4TWEA 4YGOA 3I9SA 3PBEA 3QNVA 4IK2A 2Z3OA 3A9LA 3IU1A 4XPDC 4DUKA 4HNXB 4F8ZA 3IIBA 2PVVA 4XPLA 4E0AA 4KLVA 3TOAA 3WC6A 3SJFA 3SJGA 1IIDA 3VWDA 1R43A 4XNHB 2WUUA 3S6FA 1MJAA 1QSNA 2Q7BA 3RNZA 3SHPA 1I21A 3KHZA 4A33A 3DNSA 1B87A 3BJ7A 1FT7A 2Z11A 2F7VA 4B13A 3NE8A 3TO7A 3IEHA 3T8WA 2Z3KA 4P4DA 4KOXA 5I4MA 2Q04A 3R95A 4ONWA 4JXRA 3FEEA 2CNTA 3PZJA 4QC6A 5ELYA 4QB9A 2Q4ZA 1X10A 2PE3A 5IB9A 1QQ9A 4MHPA 3H4QA 4F9UA 2XEGA 4GXHA 2Q7SA 2V8VA 1NMTA 2JEWA 4YU9A 2IMOA 4OAEA 1Y9KA 1S7KA 2CTBA 4M6GA 4NGRA 4PXBA 3RAMA 2PVWA 2JBKA 3SJEA 2FIWA 2B5GB 2R1IA 3GKRA 2PJ5A 4NCZA 2IJZA 1A2ZA 2PJ8A 4NGSA 2AFZA 3VATA 2FE7A 4O23A 3EXNA 5IB0A 1S7FA 3ISZA 1PCAA 2RFHA 4X3RA 1TF9A 4R76A 4HNYB 5D29A 5JM6A 2VBQA 5JQ4A 2PJ2A 2ZEMA 3V8IA 4MFPA 2Q4VA 4NFRA 3H5ZA 4B14A 2D4PA 2Y0MA 1CPXA 2YNCA 1F2PA 4MCPA 2R98A 4PV6A 1OBRA 5LRGA 4EFDA 2POKA 3FB3A 4XNHC 4H89A 4BD9A 1BAVA 3D2PA 2I00A 4A31A 3IU2A 3GUXA 2PJ7A 3FBUA 3KR4A 1DTDA 4CGOA 1IOIA 2BL1A 3WC5A 1ELLP 4PK2A 2PJ3A 4FUUA 4UIBA 4NJRA 3H8GA 1F57A 4M3SA 1S5KA 2REFA 4H6ZA 3CPAA 4DNCA 1H8LA 3GYAA 2AFOA 5J8CA 5H86A 2B3UA 3K9UA 4KOYA 1IYKA 4KOUA 2G3AA 1S60A 5HH1A 1K4JA 1MK4A 3S6HA 4A37A 1HDUA 2GLFA 4B10A 3EO4A 2HUZA 3WABA 4C2YA 2PQ8A 3PBBA 4L8AA 2FCKA 5H84A 4CAEA 1R3NA 3JRUA 3EY5A 3KGQA 4MCQA 3RYOA 2ARHA 4MY3A 1KWMA 2BOAA 2XEFA 2RC4A 6CPAA 2AFUA 2Q0YA 4UWJA 4WWVA 2GFQA 2D4OA 1HDQA 2G9DA 3F5BA 1QSOA 4JLYA 4K3NA 2NMTA 4A30A 1IB1E 3CDXA 5G22A 3F8KA 3DGVA 1GYTA 3GIUA 2DEAA 2QVPA 3FX6A 4P4JA 5EBVA 3B8GA 2VQYA 3D8PA 4MCSA 2ZEFA 1X12A 1SQHA 2OZUA 3T9YA 1KUXA 3KKWA 4DYOA 5LRKA 4ZX9A 1Y9WA 2HB6A 2XEIA 3H8FA 3R1KA 4ZY2A 3GLJA 3SI2A 4OC4A 2IQ6A 1P4NA 4FD5A 4CPAA 5KTAA 1WK4A 1YX0A 4MFZA 3QAYA 4PQAA 1MJ9A 1HEEA 1Z2LA 2B4DB 5JH9A 4JZ0A 2FIAA 4B11A 2XEJA 5HMNA 4KSAA 2VXKA 5F48A 3CPXA 5AG6A 2PJ0A 1Z8LA 4RN7A 4ZY0A 4ZY1A 4CRZB 4KZTA 4L89A 4U5YA 2PJBA 3TOBA 3L2NA 2ZEDA 5D8NA 2ZENA 1M4LA 2GANA 1JWQA 5J1QA 2NYQA 4ZI6A 1XBUA 2H5MA 4KUBA 4UEFA 2Z3NA 3LD2A 3BHXA 4OKOA 2CF4A 3IO1A 1ELMP 1PUAA 3FVLA 4XPKA 1CBXA 1RTQA 3IFEA 2C27A 1XRYA 1AUGA 4UCNA 2P6FA 4FD7A 4UEZA 4MFJA 4DJLA 1Q2CA 4MBUA 3WR7A 3PB9X 3ZJ0A 5F47A 3K9TA 2PJ9A 4IF5A 4R7MA 4UFVA 2PR8A 4LQ6A 3BLNA 2OOTA 1B6BA 2ANPA 4RI1A 2VZZA 3W6XA 4MCRA 2I3CA 4CGMA 4OC3A 2QJ8A 3CT9A 4B5PB 5JGFA 2ZEPA 2PIYA 2PJ1A 2PJAA 4B12A 3FECA 2ZW5A 2B5GA 5K8MA 1Z8XA 4II9A 2G0BA 3DSBA 4MJ8A 3GY9A 1Z4EA 2FVGA 2BEIA 3PB4X 5F46A 5AG5A 2PSWA 4NEXA 5LYDA 1ZO0A 3D7HA 2FXFA 4NGTA 4NGNA 2Q44A 5THWA 4EMEA 1IGBA 1LCPA 2Z3LA 4EWTA 1CP7A 4J3GA 4WJBA 2OU2A 4OIDA 3V38A 5C88A 1YW4A 5AG7A 4CAVA 4KOVA 4P45A 5C82A 2C6CA 2QYVA 4PXCA 4P4BA 3C26A 1WWZA 2KCWA 2DPTA 4W9YA 3VH9A 4KS9A 1TKJA 2GREA 5F49A 2J8MA 3FYNA 1I12A 4HNWB 5HVGA 5CBMA 1YVKA 1N71A 3NE7A 3VARA 3SI0A 2OB0A 3D2MA 1TKHA 3PRTA 2C6GA 3PB7X 3MGDA 3TCVA 4E8OA 2IL4A 4MHYA 5JPHA 1VHSA 3G3SA 2I79A 2WSAA 3HUVA 4KVXA 4JWPA 2B3VA 5KTCA 3MRUA 2FSRA 1M4GA 2DXQA 1ZG7A 2Z3MA 4P44A 3FMCA 1QSTA 2EBJA 4PSXA 1IU8A 5CPAA 2ZEOA 4HPSA 1XOVA 4MXUA 3ZZIA 1FY7A 1QSMA 1CPSA 1ZG8A 2P0WA 4MFQA 5DWMA 2PIZA 1CM0A 2B58A 1TKFA 5DS0A 1V0CA 3IWWA 4FBEA 3BI1A 4Y49B 4R87A 4OLLA 4NGPA 4OC1A 1VGYA 3LODA 3SJXA 1DE4C 3KHXA 2P6GA 3R9EA 3R9GA 2CNSA 3LACA 4KLWA 2J8RA 5F09A 1RO5A 4UBRA 3S9LA 1Q2DA 1PU9A 2EK9A 2EWBA 2JLMA 4LUAA 2O53A 2JDDA 2EK8A 3NH5A 4NJQA 4R9MA 4M85A 4A2ZA 1NSAA 4Q7AA 5HXDA 4HKFA 4R3LA 2HV2A 3S9MA 5J8FA 2BO9A 3CXPA 3EC4A 2GIVA 1XMBA 2EVNA 3TO6A 4Z65A 1BPNA 4UFXA 1XIXA 4U9ZA 5FVJA 4MFLA 2X7BA 1Z8WA 4UEEA 1KUYA 1Z8TA 1PYTB 2PJ4A 1YW6A 3NFZA 2WZNA 3B3CA 2GLJA 1QMUA 4P4EA 5EMIA 1YGHA 4JD6A 3DDDA 2B4DA 5DWNA 4OC0A 4IUSA
chains in the Genus database with same CATH topology
4YRHA 4AG9A 2YNEA 1BO4A 2AE6A 4AVAA 2PR1A 3QAHA 4BMHA 1KUVA 4A32A 2CNMA 2HQYA 2OZHA 3S6KA 2JEVA 4PSWA 1YR0A 4C2ZA 2PDOA 4ORFA 4FD4A 3S6GA 3DR6A 1M4IA 4CYQA 4FD6A 1RXTA 3D3SA 4UCMA 4CGLA 4QVTA 3TE4A 1QSRA 4RS2A 2BUEA 3JTKA 1S7LA 4GS4A 4UWIA 4OADA 2OZGA 4PK3A 1S7NA 5I0CA 2YNDA 4CAFA 3W6SA 2PC1A 2AJ6A 5G21A 3E0KA 3JUWA 5EC4A 4B5PA 3FNCA 1S3ZA 1Y7RA 5KTDA 1VKCA 2OH1A 2REEA 1GHEA 2FT0A 3PGPA 5IX3A 4KOSA 1KZFA 2EUIA 1IICA 4C68A 4JJXA 2K5TA 4AG7A 4CGPA 3CXQA 4KOTA 3BJ8A 3JVNA 4K30A 1LRZA 1L0CA 5AG4A 2VEZA 4NF1A 4CYNA 4YFJA 4R3KA 5E96A 4H6UA 3SXNA 1Z4RA 4CS0B 1UFHA 3FIXA 5G1ZA 4U9YA 1ON0A 4Q38A 4UCPA 4BBHA 3CXSA 4B5OA 1IYLA 3T90A 5IV0A 1Z9UA 4CAWA 2O28A 4CRYB 2FS5A 4CAXA 4F0YA 4CGNA 3OWCA 1BOBA 1YLEA 4R57A 1YVOA 4MHDA 4MY0A 4QBJA 4KVME 3TTHA 3TFYA 2Z3PA 2FL4A 3QB8A 3IWGA 2P6EA 1YK3A 4Q36A 1M4DA 5AGEA 4EVYA 1J4JA 5G20A 1XMTA 2VZYA 4ZGYB 3DR8A 1CJWA 1TIQA 4QUSA 5ISVA 4NSQA 5A28A 2R7HA 2A4NA 2ZPAA 1P0HA 5BWAB 3P2HA 4KSFA 3TT2A 4KOWA 2R8VA 4C2XA 2YGWA 4NXYA 2WPXA 5GCNA 2Z0ZA 3EFAA 2BSWA 1R57A 2B4BA 3W91A 5A27A 2WPWA 2GE3A 2CXAA 2QECA 4CYPA 4LX9A 3R9FA 4E2AA 1M1DA 3P2FA 2CY2A 4AB7A 4XPDB 2DPSA 4F6AA 1YREA 4MFKA 2ZW4A 3SHPA 3R96A 1OZPA 1Q2YA 2QMLA 2J8NA 4CYOA 4C7IA 4X5KA 4I49A 4C7HA 2F5IA 5CNPA 3TO9A 2ZW6A 4ZBGA 2Z10A 1M44A 3I3GA 4AVBA 2VI7A 3N7ZA 3IGRA 4Y49C 3SXOA 3FXTA 4UFWA 3G8WA 4KVOE 3VWEA 4KORA 3IWEA 2QIRA 2PRBA 4UA3A 2ZW7A 3UY5A 4AVCA 4ONUA 4KUAA 3F0AA 1MJBA 2ZXVA 1XE4A 2Q4YA 4A95A 2YNCC 3PP9A 2G3TA 3FRMA 4F0XA 1U6MA 1XEBA 1NSLA 1NE9A 2ATRA 4JXQA 1XF8A 1I1DA 2JDCA 4MI4A 4YGOA 3I9SA 2Z3OA 3A9LA 3IU1A 4XPDC 4HNXB 4XPLA 4E0AA 4KLVA 3TOAA 1IIDA 3VWDA 4XNHB 2WUUA 3S6FA 1MJAA 1QSNA 2Q7BA 1I21A 4A33A 3DNSA 1B87A 3BJ7A 2Z11A 4B13A 3TO7A 2Z3KA 4KOXA 2Q04A 3R95A 4JXRA 2CNTA 3PZJA 4QC6A 4QB9A 3H4QA 1NMTA 4OAEA 1Y9KA 1S7KA 2FIWA 2B5GB 2R1IA 3GKRA 4NCZA 2FE7A 3EXNA 5IB0A 1S7FA 4HNYB 2VBQA 5JQ4A 3V8IA 4MFPA 2Q4VA 3H5ZA 4B14A 2D4PA 2Y0MA 2YNCA 4PV6A 2R98A 3FB3A 4XNHC 4H89A 3D2PA 2I00A 4A31A 3IU2A 3FBUA 4CGOA 2BL1A 4PK2A 4M3SA 1S5KA 2REFA 4H6ZA 4DNCA 3GYAA 5J8CA 5H86A 2B3UA 3K9UA 4KOYA 1IYKA 4KOUA 2G3AA 1S60A 5HH1A 1K4JA 1MK4A 3S6HA 4B10A 3EO4A 2HUZA 4C2YA 2PQ8A 4L8AA 2FCKA 5H84A 4CAEA 3EY5A 3RYOA 2ARHA 4MY3A 2RC4A 2Q0YA 4UWJA 2D4OA 3F5BA 1QSOA 4JLYA 2NMTA 4A30A 1IB1E 5G22A 3F8KA 5EBVA 3B8GA 2VQYA 3D8PA 1SQHA 2OZUA 3T9YA 1KUXA 3KKWA 1Y9WA 3R1KA 1P4NA 4FD5A 5KTAA 1WK4A 1YX0A 4MFZA 1MJ9A 2B4DB 4B11A 2FIAA 5HMNA 4KSAA 2VXKA 5F48A 5AG6A 4CRZB 4KZTA 4L89A 4U5YA 3TOBA 2GANA 2H5MA 4KUBA 2Z3NA 3LD2A 1PUAA 4XPKA 2C27A 4UCNA 2P6FA 4FD7A 4MFJA 1Q2CA 4MBUA 3WR7A 3ZJ0A 5F47A 4IF5A 4UFVA 2PR8A 3BLNA 1B6BA 4RI1A 2VZZA 3W6XA 4CGMA 4B5PB 4B12A 2ZW5A 2B5GA 4II9A 2G0BA 3DSBA 4MJ8A 3GY9A 1Z4EA 2BEIA 5F46A 5AG5A 2PSWA 4NEXA 1ZO0A 2FXFA 2Q44A 2Z3LA 4J3GA 2OU2A 5C88A 5AG7A 4CAVA 4KOVA 5C82A 3C26A 1WWZA 2KCWA 2DPTA 4KS9A 5F49A 2J8MA 3FYNA 1I12A 4HNWB 1YVKA 1N71A 3NE7A 2OB0A 3D2MA 3MGDA 3TCVA 4E8OA 2IL4A 5JPHA 1VHSA 3G3SA 2I79A 2WSAA 4KVXA 4JWPA 2B3VA 5KTCA 1M4GA 2FSRA 2DXQA 2Z3MA 1QSTA 4PSXA 3ZZIA 1FY7A 1QSMA 5DWMA 2P0WA 4MFQA 1CM0A 2B58A 1V0CA 4Y49B 4R87A 4OLLA 3LODA 2P6GA 3R9EA 3R9GA 2CNSA 4KLWA 2J8RA 1RO5A 4UBRA 1Q2DA 1PU9A 2JLMA 4LUAA 2JDDA 4R9MA 4M85A 4A2ZA 4HKFA 4R3LA 2HV2A 5J8FA 3CXPA 3EC4A 2GIVA 2EVNA 3TO6A 4UFXA 1XIXA 4U9ZA 5FVJA 4MFLA 2X7BA 1KUYA 1YGHA 4JD6A 3DDDA 2B4DA 5DWNA 4IUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YRH A;  4AG9 A;  1BO4 A;  2AE6 A;  4AVA A;  2PR1 A;  3QAH A;  4BMH A;  1KUV A;  2CNM A;  2HQY A;  2OZH A;  3S6K A;  2JEV A;  4PSW A;  1YR0 A;  2PDO A;  4ORF A;  4FD4 A;  3S6G A;  3DR6 A;  1M4I A;  4FD6 A;  1RXT A;  3D3S A;  4QVT A;  3TE4 A;  1QSR A;  4RS2 A;  2BUE A;  1S7L A;  4GS4 A;  4UWI A;  4OAD A;  2OZG A;  4PK3 A;  1S7N A;  5I0C A;  3W6S A;  2PC1 A;  2AJ6 A;  3E0K A;  3JUW A;  5EC4 A;  4B5P A;  3FNC A;  1S3Z A;  1Y7R A;  5KTD A;  1VKC A;  2OH1 A;  2REE A;  1GHE A;  2FT0 A;  3PGP A;  5IX3 A;  4KOS A;  1KZF A;  2EUI A;  1IIC A;  4JJX A;  2K5T A;  4AG7 A;  3CXQ A;  4KOT A;  3BJ8 A;  3JVN A;  4K30 A;  1LRZ A;  1L0C A;  2VEZ A;  4NF1 A;  4YFJ A;  4R3K A;  5E96 A;  4H6U A;  3SXN A;  1Z4R A;  4CS0 B;  1UFH A;  3FIX A;  4U9Y A;  1ON0 A;  3CXS A;  4B5O A;  1IYL A;  3T90 A;  5IV0 A;  1Z9U A;  4CAW A;  2O28 A;  4CRY B;  2FS5 A;  4CAX A;  4F0Y A;  3OWC A;  1BOB A;  1YLE A;  4R57 A;  1YVO A;  4MHD A;  4MY0 A;  4QBJ A;  4KVM E;  3TTH A;  3TFY A;  2FL4 A;  3QB8 A;  3IWG A;  2P6E A;  1YK3 A;  1M4D A;  4EVY A;  1J4J A;  1XMT A;  2VZY A;  3DR8 A;  1CJW A;  1TIQ A;  4QUS A;  5ISV A;  4NSQ A;  2R7H A;  2A4N A;  2ZPA A;  1P0H A;  3P2H A;  3TT2 A;  4KOW A;  2R8V A;  4NXY A;  2WPX A;  5GCN A;  2Z0Z A;  3EFA A;  2BSW A;  1R57 A;  2B4B A;  3W91 A;  2WPW A;  2GE3 A;  2QEC A;  4LX9 A;  3R9F A;  4E2A A;  1M1D A;  3P2F A;  2CY2 A;  4AB7 A;  4XPD B;  4F6A A;  1YRE A;  3SHP A;  2ZW4 A;  3R96 A;  1OZP A;  1Q2Y A;  2QML A;  2J8N A;  4X5K A;  4I49 A;  2F5I A;  5CNP A;  3TO9 A;  2ZW6 A;  4ZBG A;  2Z10 A;  1M44 A;  3I3G A;  4AVB A;  2VI7 A;  3N7Z A;  3IGR A;  4Y49 C;  3SXO A;  3FXT A;  3G8W A;  4KVO E;  3VWE A;  4KOR A;  2QIR A;  2PRB A;  4UA3 A;  2ZW7 A;  3UY5 A;  4AVC A;  4ONU A;  4KUA A;  3F0A A;  1MJB A;  2ZXV A;  1XE4 A;  2Q4Y A;  3PP9 A;  2G3T A;  3FRM A;  1U6M A;  1XEB A;  1NSL A;  1NE9 A;  2ATR A;  4JXQ A;  1XF8 A;  1I1D A;  2JDC A;  4MI4 A;  4YGO A;  3I9S A;  4XPD C;  4HNX B;  4XPL A;  4E0A A;  4KLV A;  3TOA A;  1IID A;  3VWD A;  4XNH B;  3S6F A;  1MJA A;  1QSN A;  2Q7B A;  1I21 A;  3DNS A;  1B87 A;  3BJ7 A;  2Z11 A;  3TO7 A;  4KOX A;  2Q04 A;  3R95 A;  4JXR A;  2CNT A;  3PZJ A;  4QC6 A;  4QB9 A;  3H4Q A;  1NMT A;  4OAE A;  1Y9K A;  1S7K A;  2FIW A;  2B5G B;  2R1I A;  3GKR A;  4NCZ A;  2FE7 A;  3EXN A;  5IB0 A;  1S7F A;  4HNY B;  2VBQ A;  5JQ4 A;  3V8I A;  2Q4V A;  2D4P A;  2Y0M A;  4PV6 A;  2R98 A;  3FB3 A;  4XNH C;  4H89 A;  3D2P A;  2I00 A;  3FBU A;  2BL1 A;  4PK2 A;  4M3S A;  1S5K A;  2REF A;  4H6Z A;  4DNC A;  3GYA A;  5J8C A;  5H86 A;  2B3U A;  3K9U A;  4KOU A;  4KOY A;  1IYK A;  2G3A A;  1S60 A;  5HH1 A;  1K4J A;  1MK4 A;  3S6H A;  3EO4 A;  2HUZ A;  2PQ8 A;  4L8A A;  2FCK A;  5H84 A;  3EY5 A;  3RYO A;  2ARH A;  4MY3 A;  2RC4 A;  2Q0Y A;  4UWJ A;  2D4O A;  3F5B A;  1QSO A;  4JLY A;  2NMT A;  1IB1 E;  3F8K A;  5EBV A;  3B8G A;  2VQY A;  3D8P A;  1SQH A;  2OZU A;  3T9Y A;  1KUX A;  3KKW A;  1Y9W A;  3R1K A;  1P4N A;  4FD5 A;  5KTA A;  1WK4 A;  1YX0 A;  1MJ9 A;  2B4D B;  2FIA A;  5HMN A;  2VXK A;  5F48 A;  4CRZ B;  4KZT A;  4L89 A;  4U5Y A;  3TOB A;  2GAN A;  2H5M A;  4KUB A;  3LD2 A;  1PUA A;  4XPK A;  2C27 A;  2P6F A;  4FD7 A;  1Q2C A;  4MBU A;  3WR7 A;  3ZJ0 A;  5F47 A;  4IF5 A;  2PR8 A;  3BLN A;  1B6B A;  4RI1 A;  2VZZ A;  3W6X A;  4B5P B;  2ZW5 A;  2B5G A;  4II9 A;  2G0B A;  3DSB A;  4MJ8 A;  3GY9 A;  1Z4E A;  2BEI A;  5F46 A;  2PSW A;  4NEX A;  2FXF A;  2Q44 A;  4J3G A;  2OU2 A;  5C88 A;  4CAV A;  4KOV A;  5C82 A;  3C26 A;  1WWZ A;  2KCW A;  5F49 A;  2J8M A;  3FYN A;  1I12 A;  4HNW B;  1YVK A;  1N71 A;  3NE7 A;  2OB0 A;  3D2M A;  3MGD A;  3TCV A;  4E8O A;  2IL4 A;  5JPH A;  1VHS A;  3G3S A;  2I79 A;  4KVX A;  4JWP A;  2B3V A;  5KTC A;  1M4G A;  2FSR A;  2DXQ A;  1QST A;  4PSX A;  3ZZI A;  1FY7 A;  1QSM A;  5DWM A;  2P0W A;  1CM0 A;  2B58 A;  1V0C A;  4Y49 B;  4R87 A;  4OLL A;  3LOD A;  2P6G A;  3R9E A;  3R9G A;  2CNS A;  4KLW A;  2J8R A;  1RO5 A;  4UBR A;  1Q2D A;  1PU9 A;  2JLM A;  4LUA A;  2JDD A;  4R9M A;  4M85 A;  4HKF A;  4R3L A;  2HV2 A;  5J8F A;  3CXP A;  3EC4 A;  2GIV A;  2EVN A;  3TO6 A;  1XIX A;  4U9Z A;  5FVJ A;  2X7B A;  1KUY A;  1YGH A;  4JD6 A;  3DDD A;  2B4D A;  5DWN A;  4IUS A; 
#chains in the Genus database with same CATH topology
 4YRH A;  5K8N A;  4AG9 A;  3PFE A;  8CPA A;  4ZYQ A;  2YNE A;  1BO4 A;  3D68 A;  4X8I A;  2AE6 A;  4AVA A;  3IJ3 A;  1BPM A;  2PR1 A;  3B35 A;  3QAH A;  5LYF A;  4BMH A;  2ABZ A;  4R8F A;  3RZA A;  1JQG A;  1KUV A;  2CNM A;  2HQY A;  4A32 A;  1ZLI A;  2OZH A;  4OC5 A;  3S6K A;  2JEV A;  4PSW A;  1YR0 A;  4C2Z A;  2ZEH A;  3KI9 A;  1IOF A;  4NGM A;  4X2T A;  2PDO A;  3BI0 A;  4ORF A;  3D66 A;  2V8H A;  4FD4 A;  3S6G A;  4MHZ A;  3DR6 A;  1XJO A;  1M4I A;  1YLO A;  4CYQ A;  4FD6 A;  1RXT A;  2AFM A;  3D3S A;  4UCM A;  4CGL A;  4QVT A;  3TE4 A;  3D7G A;  1QSR A;  4RS2 A;  2BUE A;  3BXM A;  3JTK A;  1S7L A;  2V8D A;  4GS4 A;  1CG2 A;  4UWI A;  4OAD A;  1TF8 A;  2OZG A;  4PK3 A;  1S7N A;  2PRQ A;  2YND A;  4CAF A;  1LAP A;  5I0C A;  3PB8 X;  3W6S A;  2PC1 A;  2AJ6 A;  5G21 A;  3E0K A;  1TXR A;  3JUW A;  5EC4 A;  4UF4 A;  4B5P A;  1YME A;  2ZEG A;  3FNC A;  1S3Z A;  1Y7R A;  4B6Z A;  5KTD A;  3KQX A;  1VKC A;  2AFX A;  2OH1 A;  2C6P A;  2REE A;  1GHE A;  2FT0 A;  3FF3 A;  3PGP A;  5IX3 A;  4KOS A;  1KZF A;  2EUI A;  1CP6 A;  1VHE A;  4OME A;  1IIC A;  4C68 A;  4JJX A;  2K5T A;  4AG7 A;  3K2K A;  3S9N A;  3TX8 A;  4A39 A;  3D7F A;  4CGP A;  3CXQ A;  4KOT A;  2F8H A;  3BJ8 A;  3JVN A;  4K30 A;  2EO8 A;  1LRZ A;  1L0C A;  3NA6 A;  5AG4 A;  2VEZ A;  4NF1 A;  1Z5R A;  5LYL A;  4CYN A;  3I1U A;  1ZG9 A;  4YFJ A;  3KL9 A;  4R3K A;  5E96 A;  4H6U A;  4TNU A;  3SXN A;  1Y7E A;  1Z4R A;  3WT4 A;  3PEI A;  4M6H A;  4CS0 B;  1UFH A;  3FIX A;  5G1Z A;  4U9Y A;  2AFW A;  1IY7 A;  1ON0 A;  2PCU A;  4Q38 A;  4ZX8 A;  4UCP A;  2J9A A;  2Q43 A;  2PJ6 A;  4BBH A;  3CXS A;  4B5O A;  2RB7 A;  4UIA A;  3GB0 A;  1IYL A;  3T90 A;  5IV0 A;  1Z9U A;  4CAW A;  2O28 A;  4CRY B;  2FS5 A;  3D4U A;  4CAX A;  4F0Y A;  4OIW A;  3TC8 A;  1LFW A;  4CGN A;  3OWC A;  1BOB A;  1YLE A;  1YSJ A;  4R57 A;  3HLP A;  3B2Y A;  1BLL E;  4MHN A;  1YVO A;  2ZOF A;  4MHD A;  3B3V A;  4MY0 A;  5LRJ A;  5K8P A;  3FED A;  4QBJ A;  4KVM E;  3TTH A;  3TFY A;  2Z3P A;  3FH4 A;  2FL4 A;  2DF5 A;  1ARL A;  3IWG A;  3QB8 A;  4IHM A;  2AFS A;  2P6E A;  1YK3 A;  4Q36 A;  1LOK A;  2C1C A;  3FJU A;  4P4F A;  1M4D A;  5AGE A;  2O4H A;  4EVY A;  3ISX A;  1J4J A;  2WYR A;  3MN8 A;  2BCO A;  5G20 A;  1XMT A;  4PXE A;  2VZY A;  2Q51 A;  4ZGY B;  3DR8 A;  3RO0 A;  1CJW A;  1TIQ A;  1VHO A;  4QUS A;  4NSQ A;  5A28 A;  2R7H A;  4IAV A;  5ISV A;  2A4N A;  2ZPA A;  4BIN A;  1P0H A;  5BWA B;  3P2H A;  4KSF A;  3TT2 A;  4H2K A;  3NH4 A;  4KOW A;  2CIJ A;  1F2O A;  2V77 A;  3WC7 A;  1AYE A;  2R8V A;  4P4I A;  1FNO A;  4FWU A;  4C2X A;  2YGW A;  1AMP A;  4NXY A;  4PPZ A;  4A94 A;  3DLJ A;  3PB6 X;  4GM5 A;  2WPX A;  3KR5 A;  2Z0Z A;  5GCN A;  3EFA A;  3KQZ A;  4YWY A;  2BSW A;  4OP4 A;  1R57 A;  2B4B A;  3W91 A;  5A27 A;  1Y0Y A;  2GU2 A;  2WPW A;  2GE3 A;  2CXA A;  2QEC A;  4CYP A;  4LX9 A;  3R9F A;  1LAN A;  2PJC A;  2VL1 A;  4E2A A;  1M1D A;  3P2F A;  2CY2 A;  4AB7 A;  4XPD B;  2DPS A;  7CPA A;  4F6A A;  1Y0R A;  1YRE A;  2HC9 A;  2ZW4 A;  4MFK A;  3IC1 A;  4PXD A;  4R6T A;  2ZEL A;  1OZP A;  1Q2Y A;  3R96 A;  2QML A;  2J8N A;  3KAS A;  4C7I A;  4CYO A;  5K8O A;  2ZEE A;  2NSM A;  1VIX A;  4X5K A;  4I49 A;  4C7H A;  2F5I A;  1Q7L A;  5CNP A;  1EE3 P;  2OR4 A;  5HVF A;  3TO9 A;  4LQG A;  4AXV A;  3CZX A;  2ZW6 A;  4ZBG A;  2Z10 A;  1M44 A;  3I3G A;  4AVB A;  2VI7 A;  3RBU A;  3LMS A;  3N7Z A;  3B3W A;  3B3S A;  3IGR A;  4Y49 C;  3FXT A;  3SXO A;  4UFW A;  3G8W A;  4KVO E;  3VWE A;  4KOR A;  4M6I A;  3NH8 A;  2CTC A;  3IWE A;  3B7I A;  3PFO A;  2QIR A;  3LWU A;  1ARM A;  1LAM A;  2PRB A;  4MRI A;  4UA3 A;  3SI1 A;  2ZW7 A;  4NGQ A;  3UY5 A;  4AVC A;  2ZOG A;  4ONU A;  4KUA A;  3F0A A;  4KSI A;  1MJB A;  3N5F A;  1XFO A;  2ZXV A;  1XE4 A;  1YQE A;  4P6Y A;  3V7Z A;  2Q4Y A;  4A95 A;  2YNC C;  5LYI A;  3KZW A;  4JYW A;  3PP9 A;  4RUH A;  2G3T A;  1ZLH A;  3FRM A;  3B3T A;  1CX8 A;  3D7D A;  4MMO A;  4A38 A;  4F0X A;  2V8G A;  3H8E A;  1U6M A;  2JBJ A;  1XEB A;  4FAI A;  1NSL A;  1NE9 A;  2ATR A;  3D67 A;  4P10 A;  4JXQ A;  2ODF A;  4G1P A;  4F9V A;  5HVH A;  1XF8 A;  1I1D A;  2JDC A;  1UWY A;  4MI4 A;  4OC2 A;  4TWE A;  4YGO A;  3I9S A;  3PBE A;  3QNV A;  4IK2 A;  2Z3O A;  3A9L A;  3IU1 A;  4XPD C;  4DUK A;  4HNX B;  4F8Z A;  3IIB A;  2PVV A;  4XPL A;  4E0A A;  4KLV A;  3TOA A;  3WC6 A;  3SJF A;  3SJG A;  1IID A;  3VWD A;  1R43 A;  4XNH B;  2WUU A;  3S6F A;  1MJA A;  1QSN A;  2Q7B A;  3RNZ A;  3SHP A;  1I21 A;  3KHZ A;  4A33 A;  3DNS A;  1B87 A;  3BJ7 A;  1FT7 A;  2Z11 A;  2F7V A;  4B13 A;  3NE8 A;  3TO7 A;  3IEH A;  3T8W A;  2Z3K A;  4P4D A;  4KOX A;  5I4M A;  2Q04 A;  3R95 A;  4ONW A;  4JXR A;  3FEE A;  2CNT A;  3PZJ A;  4QC6 A;  5ELY A;  4QB9 A;  2Q4Z A;  1X10 A;  2PE3 A;  5IB9 A;  1QQ9 A;  4MHP A;  3H4Q A;  4F9U A;  2XEG A;  4GXH A;  2Q7S A;  2V8V A;  1NMT A;  2JEW A;  4YU9 A;  2IMO A;  4OAE A;  1Y9K A;  1S7K A;  2CTB A;  4M6G A;  4NGR A;  4PXB A;  3RAM A;  2PVW A;  2JBK A;  3SJE A;  2FIW A;  2B5G B;  2R1I A;  3GKR A;  2PJ5 A;  4NCZ A;  2IJZ A;  1A2Z A;  2PJ8 A;  4NGS A;  2AFZ A;  3VAT A;  2FE7 A;  4O23 A;  3EXN A;  5IB0 A;  1S7F A;  3ISZ A;  1PCA A;  2RFH A;  4X3R A;  1TF9 A;  4R76 A;  4HNY B;  5D29 A;  5JM6 A;  2VBQ A;  5JQ4 A;  2PJ2 A;  2ZEM A;  3V8I A;  4MFP A;  2Q4V A;  4NFR A;  3H5Z A;  4B14 A;  2D4P A;  2Y0M A;  1CPX A;  2YNC A;  1F2P A;  4MCP A;  2R98 A;  4PV6 A;  1OBR A;  5LRG A;  4EFD A;  2POK A;  3FB3 A;  4XNH C;  4H89 A;  4BD9 A;  1BAV A;  3D2P A;  2I00 A;  4A31 A;  3IU2 A;  3GUX A;  2PJ7 A;  3FBU A;  3KR4 A;  1DTD A;  4CGO A;  1IOI A;  2BL1 A;  3WC5 A;  1ELL P;  4PK2 A;  2PJ3 A;  4FUU A;  4UIB A;  4NJR A;  3H8G A;  1F57 A;  4M3S A;  1S5K A;  2REF A;  4H6Z A;  3CPA A;  4DNC A;  1H8L A;  3GYA A;  2AFO A;  5J8C A;  5H86 A;  2B3U A;  3K9U A;  4KOY A;  1IYK A;  4KOU A;  2G3A A;  1S60 A;  5HH1 A;  1K4J A;  1MK4 A;  3S6H A;  4A37 A;  1HDU A;  2GLF A;  4B10 A;  3EO4 A;  2HUZ A;  3WAB A;  4C2Y A;  2PQ8 A;  3PBB A;  4L8A A;  2FCK A;  5H84 A;  4CAE A;  1R3N A;  3JRU A;  3EY5 A;  3KGQ A;  4MCQ A;  3RYO A;  2ARH A;  4MY3 A;  1KWM A;  2BOA A;  2XEF A;  2RC4 A;  6CPA A;  2AFU A;  2Q0Y A;  4UWJ A;  4WWV A;  2GFQ A;  2D4O A;  1HDQ A;  2G9D A;  3F5B A;  1QSO A;  4JLY A;  4K3N A;  2NMT A;  4A30 A;  1IB1 E;  3CDX A;  5G22 A;  3F8K A;  3DGV A;  1GYT A;  3GIU A;  2DEA A;  2QVP A;  3FX6 A;  4P4J A;  5EBV A;  3B8G A;  2VQY A;  3D8P A;  4MCS A;  2ZEF A;  1X12 A;  1SQH A;  2OZU A;  3T9Y A;  1KUX A;  3KKW A;  4DYO A;  5LRK A;  4ZX9 A;  1Y9W A;  2HB6 A;  2XEI A;  3H8F A;  3R1K A;  4ZY2 A;  3GLJ A;  3SI2 A;  4OC4 A;  2IQ6 A;  1P4N A;  4FD5 A;  4CPA A;  5KTA A;  1WK4 A;  1YX0 A;  4MFZ A;  3QAY A;  4PQA A;  1MJ9 A;  1HEE A;  1Z2L A;  2B4D B;  5JH9 A;  4JZ0 A;  2FIA A;  4B11 A;  2XEJ A;  5HMN A;  4KSA A;  2VXK A;  5F48 A;  3CPX A;  5AG6 A;  2PJ0 A;  1Z8L A;  4RN7 A;  4ZY0 A;  4ZY1 A;  4CRZ B;  4KZT A;  4L89 A;  4U5Y A;  2PJB A;  3TOB A;  3L2N A;  2ZED A;  5D8N A;  2ZEN A;  1M4L A;  2GAN A;  1JWQ A;  5J1Q A;  2NYQ A;  4ZI6 A;  1XBU A;  2H5M A;  4KUB A;  4UEF A;  2Z3N A;  3LD2 A;  3BHX A;  4OKO A;  2CF4 A;  3IO1 A;  1ELM P;  1PUA A;  3FVL A;  4XPK A;  1CBX A;  1RTQ A;  3IFE A;  2C27 A;  1XRY A;  1AUG A;  4UCN A;  2P6F A;  4FD7 A;  4UEZ A;  4MFJ A;  4DJL A;  1Q2C A;  4MBU A;  3WR7 A;  3PB9 X;  3ZJ0 A;  5F47 A;  3K9T A;  2PJ9 A;  4IF5 A;  4R7M A;  4UFV A;  2PR8 A;  4LQ6 A;  3BLN A;  2OOT A;  1B6B A;  2ANP A;  4RI1 A;  2VZZ A;  3W6X A;  4MCR A;  2I3C A;  4CGM A;  4OC3 A;  2QJ8 A;  3CT9 A;  4B5P B;  5JGF A;  2ZEP A;  2PIY A;  2PJ1 A;  2PJA A;  4B12 A;  3FEC A;  2ZW5 A;  2B5G A;  5K8M A;  1Z8X A;  4II9 A;  2G0B A;  3DSB A;  4MJ8 A;  3GY9 A;  1Z4E A;  2FVG A;  2BEI A;  3PB4 X;  5F46 A;  5AG5 A;  2PSW A;  4NEX A;  5LYD A;  1ZO0 A;  3D7H A;  2FXF A;  4NGT A;  4NGN A;  2Q44 A;  5THW A;  4EME A;  1IGB A;  1LCP A;  2Z3L A;  4EWT A;  1CP7 A;  4J3G A;  4WJB A;  2OU2 A;  4OID A;  3V38 A;  5C88 A;  1YW4 A;  5AG7 A;  4CAV A;  4KOV A;  4P45 A;  5C82 A;  2C6C A;  2QYV A;  4PXC A;  4P4B A;  3C26 A;  1WWZ A;  2KCW A;  2DPT A;  4W9Y A;  3VH9 A;  4KS9 A;  1TKJ A;  2GRE A;  5F49 A;  2J8M A;  3FYN A;  1I12 A;  4HNW B;  5HVG A;  5CBM A;  1YVK A;  1N71 A;  3NE7 A;  3VAR A;  3SI0 A;  2OB0 A;  3D2M A;  1TKH A;  3PRT A;  2C6G A;  3PB7 X;  3MGD A;  3TCV A;  4E8O A;  2IL4 A;  4MHY A;  5JPH A;  1VHS A;  3G3S A;  2I79 A;  2WSA A;  3HUV A;  4KVX A;  4JWP A;  2B3V A;  5KTC A;  3MRU A;  2FSR A;  1M4G A;  2DXQ A;  1ZG7 A;  2Z3M A;  4P44 A;  3FMC A;  1QST A;  2EBJ A;  4PSX A;  1IU8 A;  5CPA A;  2ZEO A;  4HPS A;  1XOV A;  4MXU A;  3ZZI A;  1FY7 A;  1QSM A;  1CPS A;  1ZG8 A;  2P0W A;  4MFQ A;  5DWM A;  2PIZ A;  1CM0 A;  2B58 A;  1TKF A;  5DS0 A;  1V0C A;  3IWW A;  4FBE A;  3BI1 A;  4Y49 B;  4R87 A;  4OLL A;  4NGP A;  4OC1 A;  1VGY A;  3LOD A;  3SJX A;  1DE4 C;  3KHX A;  2P6G A;  3R9E A;  3R9G A;  2CNS A;  3LAC A;  4KLW A;  2J8R A;  5F09 A;  1RO5 A;  4UBR A;  3S9L A;  1Q2D A;  1PU9 A;  2EK9 A;  2EWB A;  2JLM A;  4LUA A;  2O53 A;  2JDD A;  2EK8 A;  3NH5 A;  4NJQ A;  4R9M A;  4M85 A;  4A2Z A;  1NSA A;  4Q7A A;  5HXD A;  4HKF A;  4R3L A;  2HV2 A;  3S9M A;  5J8F A;  2BO9 A;  3CXP A;  3EC4 A;  2GIV A;  1XMB A;  2EVN A;  3TO6 A;  4Z65 A;  1BPN A;  4UFX A;  1XIX A;  4U9Z A;  5FVJ A;  4MFL A;  2X7B A;  1Z8W A;  4UEE A;  1KUY A;  1Z8T A;  1PYT B;  2PJ4 A;  1YW6 A;  3NFZ A;  2WZN A;  3B3C A;  2GLJ A;  1QMU A;  4P4E A;  5EMI A;  1YGH A;  4JD6 A;  3DDD A;  2B4D A;  5DWN A;  4OC0 A;  4IUS A; 
#chains in the Genus database with same CATH homology
 4YRH A;  4AG9 A;  2YNE A;  1BO4 A;  2AE6 A;  4AVA A;  2PR1 A;  3QAH A;  4BMH A;  1KUV A;  4A32 A;  2CNM A;  2HQY A;  2OZH A;  3S6K A;  2JEV A;  4PSW A;  1YR0 A;  4C2Z A;  2PDO A;  4ORF A;  4FD4 A;  3S6G A;  3DR6 A;  1M4I A;  4CYQ A;  4FD6 A;  1RXT A;  3D3S A;  4UCM A;  4CGL A;  4QVT A;  3TE4 A;  1QSR A;  4RS2 A;  2BUE A;  3JTK A;  1S7L A;  4GS4 A;  4UWI A;  4OAD A;  2OZG A;  4PK3 A;  1S7N A;  5I0C A;  2YND A;  4CAF A;  3W6S A;  2PC1 A;  2AJ6 A;  5G21 A;  3E0K A;  3JUW A;  5EC4 A;  4B5P A;  3FNC A;  1S3Z A;  1Y7R A;  5KTD A;  1VKC A;  2OH1 A;  2REE A;  1GHE A;  2FT0 A;  3PGP A;  5IX3 A;  4KOS A;  1KZF A;  2EUI A;  1IIC A;  4C68 A;  4JJX A;  2K5T A;  4AG7 A;  4CGP A;  3CXQ A;  4KOT A;  3BJ8 A;  3JVN A;  4K30 A;  1LRZ A;  1L0C A;  5AG4 A;  2VEZ A;  4NF1 A;  4CYN A;  4YFJ A;  4R3K A;  5E96 A;  4H6U A;  3SXN A;  1Z4R A;  4CS0 B;  1UFH A;  3FIX A;  5G1Z A;  4U9Y A;  1ON0 A;  4Q38 A;  4UCP A;  4BBH A;  3CXS A;  4B5O A;  1IYL A;  3T90 A;  5IV0 A;  1Z9U A;  4CAW A;  2O28 A;  4CRY B;  2FS5 A;  4CAX A;  4F0Y A;  4CGN A;  3OWC A;  1BOB A;  1YLE A;  4R57 A;  1YVO A;  4MHD A;  4MY0 A;  4QBJ A;  4KVM E;  3TTH A;  3TFY A;  2Z3P A;  2FL4 A;  3QB8 A;  3IWG A;  2P6E A;  1YK3 A;  4Q36 A;  1M4D A;  5AGE A;  4EVY A;  1J4J A;  5G20 A;  1XMT A;  2VZY A;  4ZGY B;  3DR8 A;  1CJW A;  1TIQ A;  4QUS A;  5ISV A;  4NSQ A;  5A28 A;  2R7H A;  2A4N A;  2ZPA A;  1P0H A;  5BWA B;  3P2H A;  4KSF A;  3TT2 A;  4KOW A;  2R8V A;  4C2X A;  2YGW A;  4NXY A;  2WPX A;  5GCN A;  2Z0Z A;  3EFA A;  2BSW A;  1R57 A;  2B4B A;  3W91 A;  5A27 A;  2WPW A;  2GE3 A;  2CXA A;  2QEC A;  4CYP A;  4LX9 A;  3R9F A;  4E2A A;  1M1D A;  3P2F A;  2CY2 A;  4AB7 A;  4XPD B;  2DPS A;  4F6A A;  1YRE A;  4MFK A;  2ZW4 A;  3SHP A;  3R96 A;  1OZP A;  1Q2Y A;  2QML A;  2J8N A;  4CYO A;  4C7I A;  4X5K A;  4I49 A;  4C7H A;  2F5I A;  5CNP A;  3TO9 A;  2ZW6 A;  4ZBG A;  2Z10 A;  1M44 A;  3I3G A;  4AVB A;  2VI7 A;  3N7Z A;  3IGR A;  4Y49 C;  3SXO A;  3FXT A;  4UFW A;  3G8W A;  4KVO E;  3VWE A;  4KOR A;  3IWE A;  2QIR A;  2PRB A;  4UA3 A;  2ZW7 A;  3UY5 A;  4AVC A;  4ONU A;  4KUA A;  3F0A A;  1MJB A;  2ZXV A;  1XE4 A;  2Q4Y A;  4A95 A;  2YNC C;  3PP9 A;  2G3T A;  3FRM A;  4F0X A;  1U6M A;  1XEB A;  1NSL A;  1NE9 A;  2ATR A;  4JXQ A;  1XF8 A;  1I1D A;  2JDC A;  4MI4 A;  4YGO A;  3I9S A;  2Z3O A;  3A9L A;  3IU1 A;  4XPD C;  4HNX B;  4XPL A;  4E0A A;  4KLV A;  3TOA A;  1IID A;  3VWD A;  4XNH B;  2WUU A;  3S6F A;  1MJA A;  1QSN A;  2Q7B A;  1I21 A;  4A33 A;  3DNS A;  1B87 A;  3BJ7 A;  2Z11 A;  4B13 A;  3TO7 A;  2Z3K A;  4KOX A;  2Q04 A;  3R95 A;  4JXR A;  2CNT A;  3PZJ A;  4QC6 A;  4QB9 A;  3H4Q A;  1NMT A;  4OAE A;  1Y9K A;  1S7K A;  2FIW A;  2B5G B;  2R1I A;  3GKR A;  4NCZ A;  2FE7 A;  3EXN A;  5IB0 A;  1S7F A;  4HNY B;  2VBQ A;  5JQ4 A;  3V8I A;  4MFP A;  2Q4V A;  3H5Z A;  4B14 A;  2D4P A;  2Y0M A;  2YNC A;  4PV6 A;  2R98 A;  3FB3 A;  4XNH C;  4H89 A;  3D2P A;  2I00 A;  4A31 A;  3IU2 A;  3FBU A;  4CGO A;  2BL1 A;  4PK2 A;  4M3S A;  1S5K A;  2REF A;  4H6Z A;  4DNC A;  3GYA A;  5J8C A;  5H86 A;  2B3U A;  3K9U A;  4KOY A;  1IYK A;  4KOU A;  2G3A A;  1S60 A;  5HH1 A;  1K4J A;  1MK4 A;  3S6H A;  4B10 A;  3EO4 A;  2HUZ A;  4C2Y A;  2PQ8 A;  4L8A A;  2FCK A;  5H84 A;  4CAE A;  3EY5 A;  3RYO A;  2ARH A;  4MY3 A;  2RC4 A;  2Q0Y A;  4UWJ A;  2D4O A;  3F5B A;  1QSO A;  4JLY A;  2NMT A;  4A30 A;  1IB1 E;  5G22 A;  3F8K A;  5EBV A;  3B8G A;  2VQY A;  3D8P A;  1SQH A;  2OZU A;  3T9Y A;  1KUX A;  3KKW A;  1Y9W A;  3R1K A;  1P4N A;  4FD5 A;  5KTA A;  1WK4 A;  1YX0 A;  4MFZ A;  1MJ9 A;  2B4D B;  4B11 A;  2FIA A;  5HMN A;  4KSA A;  2VXK A;  5F48 A;  5AG6 A;  4CRZ B;  4KZT A;  4L89 A;  4U5Y A;  3TOB A;  2GAN A;  2H5M A;  4KUB A;  2Z3N A;  3LD2 A;  1PUA A;  4XPK A;  2C27 A;  4UCN A;  2P6F A;  4FD7 A;  4MFJ A;  1Q2C A;  4MBU A;  3WR7 A;  3ZJ0 A;  5F47 A;  4IF5 A;  4UFV A;  2PR8 A;  3BLN A;  1B6B A;  4RI1 A;  2VZZ A;  3W6X A;  4CGM A;  4B5P B;  4B12 A;  2ZW5 A;  2B5G A;  4II9 A;  2G0B A;  3DSB A;  4MJ8 A;  3GY9 A;  1Z4E A;  2BEI A;  5F46 A;  5AG5 A;  2PSW A;  4NEX A;  1ZO0 A;  2FXF A;  2Q44 A;  2Z3L A;  4J3G A;  2OU2 A;  5C88 A;  5AG7 A;  4CAV A;  4KOV A;  5C82 A;  3C26 A;  1WWZ A;  2KCW A;  2DPT A;  4KS9 A;  5F49 A;  2J8M A;  3FYN A;  1I12 A;  4HNW B;  1YVK A;  1N71 A;  3NE7 A;  2OB0 A;  3D2M A;  3MGD A;  3TCV A;  4E8O A;  2IL4 A;  5JPH A;  1VHS A;  3G3S A;  2I79 A;  2WSA A;  4KVX A;  4JWP A;  2B3V A;  5KTC A;  1M4G A;  2FSR A;  2DXQ A;  2Z3M A;  1QST A;  4PSX A;  3ZZI A;  1FY7 A;  1QSM A;  5DWM A;  2P0W A;  4MFQ A;  1CM0 A;  2B58 A;  1V0C A;  4Y49 B;  4R87 A;  4OLL A;  3LOD A;  2P6G A;  3R9E A;  3R9G A;  2CNS A;  4KLW A;  2J8R A;  1RO5 A;  4UBR A;  1Q2D A;  1PU9 A;  2JLM A;  4LUA A;  2JDD A;  4R9M A;  4M85 A;  4A2Z A;  4HKF A;  4R3L A;  2HV2 A;  5J8F A;  3CXP A;  3EC4 A;  2GIV A;  2EVN A;  3TO6 A;  4UFX A;  1XIX A;  4U9Z A;  5FVJ A;  4MFL A;  2X7B A;  1KUY A;  1YGH A;  4JD6 A;  3DDD A;  2B4D A;  5DWN A;  4IUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...