2B3VA

Spermine spermidine acetyltransferase in complex with acetylcoa, k26r mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
167
structure length
167
Chain Sequence
b'FVIRPATAADCSDILRLIKELARYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 1
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 35
structure length 167
sequence length 167
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b3vA00
3DR6A 4JLYA 2OB0A 4YFJA 1B87A 5J8FA 3CXPA 1MJ9A 2OU2A 4CAVA 4H6UA 4Y49B 2P6EA 4FD7A 2AE6A 3FB3A 3DSBA 5C88A 4FD5A 4K30A 3VWDA 2B4BA 4XNHB 5GCNA 1IIDA 4MBUA 5F48A 3S6GA 1M4GA 3I9SA 1I12A 3G8WA 1BOBA 2J8NA 3TE4A 3E0KA 3F8KA 3TOBA 1RO5A 3TT2A 1M1DA 2Q7BA 4QC6A 3SXOA 2PRBA 2Z11A 4F0YA 1KUXA 4R57A 2R7HA 4NXYA 2VQYA 4NF1A 5IV0A 2P0WA 4R9MA 5E96A 2C27A 2FT0A 1NE9A 3TFYA 1CJWA 4NCZA 1PU9A 2CY2A 3B8GA 4XPLA 3TOAA 4OAEA 3RYOA 5IX3A 1Z9UA 2B3VA 4AVBA 4XPDC 3T90A 4F6AA 4KOTA 1MJBA 1QSOA 5H86A 3FNCA 4DNCA 2P6GA 1YX0A 2B4DA 1M44A 3JUWA 4MI4A 1WWZA 2BUEA 2JDDA 2QECA 4II9A 1BO4A 1N71A 4UA3A 4JJXA 1R57A 3EFAA 4HNWB 4PK3A 4KOWA 4IUSA 2PQ8A 2JLMA 1S5KA 3PZJA 4KOVA 4RI1A 2B5GB 1Q2CA 2VBQA 3G3SA 4Y49C 1XF8A 4AG7A 4OADA 1P0HA 1XE4A 3PGPA 2OZGA 4XNHC 2VEZA 4PV6A 3EXNA 4PSXA 4U9YA 2D4PA 2ZPAA 3D2MA 3FXTA 1VKCA 3F0AA 2O28A 2PDOA 3W6XA 1VHSA 1S7NA 4PSWA 3W6SA 1YLEA 2NMTA 2Q04A 5CNPA 5C82A 1Y9WA 4E0AA 2VI7A 1TIQA 2REEA 2FXFA 3CXQA 4H89A 2EVNA 3N7ZA 2RC4A 3EC4A 1B6BA 4CAXA 3DNSA 1QSNA 5DWNA 4EVYA 1FY7A 2G3AA 2PC1A 4CS0B 1S60A 3TTHA 4M85A 4KOSA 4CAWA 4KOUA 3IGRA 4B5PB 3H4QA 3VWEA 4JXRA 3TO6A 3LD2A 4KUAA 5F49A 3R96A 1YR0A 4MY3A 1Q2DA 2GIVA 3FIXA 4RS2A 3QB8A 1S7FA 3K9UA 4YGOA 4UBRA 4J3GA 2G0BA 1QSMA 3BLNA 1NSLA 4CRZB 1Z4EA 4NSQA 4KOXA 1I1DA 2PSWA 3S6HA 1YK3A 1RXTA 2Q4YA 3CXSA 3DDDA 3BJ8A 4PK2A 2FIAA 5JQ4A 2VXKA 4H6ZA 4I49A 4KVXA 3ZZIA 4AVCA 2IL4A 3S6KA 2HV2A 2Q44A 4HNXB 4QBJA 2GE3A 3LODA 4L8AA 4L89A 4M3SA 2KCWA 3SXNA 4QB9A 4JXQA 2BEIA 3R9FA 1M4DA 1YGHA 4QUSA 3R9GA 5HH1A 1IICA 2AJ6A 1YREA 2B5GA 1IYLA 1IYKA 4X5KA 2QMLA 4GS4A 2H5MA 3S6FA 2P6FA 3C26A 1OZPA 3P2FA 5I0CA 2BSWA 3SHPA 1XMTA 4LX9A 3UY5A 1WK4A 1K4JA 4UWJA 2HUZA 2WPWA 2A4NA 1V0CA 3V8IA 2REFA 3D3SA 1QSTA 4CRYB 4E2AA 1ON0A 3T9YA 1KZFA 1Y9KA 3GKRA 5KTAA 2Z0ZA 3TO7A 5EBVA 2ZW5A 2D4OA 4LUAA 3TO9A 5KTDA 1S7KA 3BJ7A 4IF5A 1UFHA 4FD4A 2G3TA 1I21A 1PUAA 3F5BA 4U5YA 1Z4RA 2Q0YA 5IB0A 2CNMA 2B3UA 2OZHA 5JPHA 2B58A 4ORFA 4KVOE 2HQYA 4B5PA 2WPXA 4KUBA 2R1IA 1MK4A 2EUIA 2ATRA 1YVKA 2CNSA 3R1KA 2BL1A 2FCKA 2GANA 2DXQA 3EY5A 1NMTA 2CNTA 4QVTA 1J4JA 3NE7A 1U6MA 4FD6A 3OWCA 1IB1E 2FL4A 3TCVA 1P4NA 1YVOA 3D8PA 5KTCA 4R87A 3FBUA 1QSRA 2J8RA 2Q4VA 2Y0MA 5F46A 3P2HA 3W91A 4JD6A 2I79A 2OH1A 2ZXVA 4E8OA 5EC4A 3D2PA 2ARHA 3JVNA 1Q2YA 1KUVA 1S3ZA 4HNYB 4MJ8A 2R98A 1LRZA 4HKFA 4UWIA 3R9EA 3KKWA 3PP9A 2VZZA 2F5IA 1XIXA 2OZUA 2PR8A 4KZTA 2X7BA 2FIWA 1CM0A 3QAHA 2ZW6A 1XEBA 1Y7RA 2FE7A 3DR8A 5FVJA 4KLVA 5ISVA 2B4DB 4KOYA 4KLWA 2ZW7A 4KORA 4MY0A 4XPKA 5H84A 3ZJ0A 4KVME 4ZBGA 3WR7A 4B5OA 1M4IA 1SQHA 4YRHA 3R95A 1KUYA 2J8MA 4AG9A 5F47A 4AVAA 2JDCA 5J8CA 1S7LA 3IWGA 2QIRA 3MGDA 2K5TA 1L0CA 2Z10A 4BMHA 4NEXA 4JWPA 2FS5A 4AB7A 2ZW4A 1GHEA 2R8VA 3I3GA 5DWMA 5HMNA 2PR1A 4R3LA 4MHDA 4XPDB 2JEVA 2VZYA 4OLLA 3GYAA 3EO4A 2I00A 3GY9A 4ONUA 4R3KA 2FSRA 3FRMA 3FYNA 1MJAA 4U9ZA
chains in the Genus database with same CATH superfamily
5CPAA 1YW4A 3DR6A 4JLYA 3DGVA 2IJZA 2OB0A 1B87A 3IC1A 3KQXA 4P4JA 3CXPA 3SJGA 4YFJA 4P10A 5J8FA 1QMUA 5F09A 5DS0A 1MJ9A 2OU2A 4NGQA 4CAVA 4H6UA 4Y49B 2P6EA 2CTCA 5EMIA 3TC8A 3IWWA 4FD7A 2AE6A 3FB3A 3DSBA 4ZGYB 1CG2A 3D66A 3SJXA 5C88A 4FD5A 4K30A 4P44A 1VHOA 4ZY2A 3VWDA 3IFEA 4R6TA 3KR4A 2ABZA 2B4BA 4XNHB 5GCNA 1Z8TA 1IIDA 4MBUA 3H5ZA 5F48A 2Z3NA 3LMSA 3S6GA 1M4GA 3IO1A 1YMEA 3I9SA 4KSAA 1TKHA 4F9UA 1I12A 3G8WA 1BOBA 2J8NA 3K9TA 4UF4A 3TE4A 3E0KA 3F8KA 2ZOFA 4ONWA 3TOBA 1FT7A 1RO5A 1F2PA 2ZEMA 3TT2A 4RN7A 1M1DA 4C2YA 2Q7BA 3D4UA 4QC6A 3SXOA 2OOTA 1YQEA 4CPAA 5K8NA 2PRBA 2O4HA 2EO8A 3JTKA 4P4EA 3BI0A 4YWYA 2Z11A 2ANPA 4F0YA 3KHZA 1KUXA 2ZEHA 4UCNA 4BBHA 4MFKA 4R57A 1BPNA 2R7HA 3FH4A 4NXYA 1CPSA 2VQYA 2YGWA 3B3VA 4NF1A 4UFXA 5IV0A 2P0WA 4R9MA 5E96A 2C27A 2QYVA 2EWBA 2FT0A 2JEWA 4P45A 3NH5A 2ZENA 2PIYA 1NE9A 3TFYA 1CJWA 4NCZA 1PU9A 2PJBA 4OC4A 2CY2A 3B8GA 4XPLA 4ZY1A 3TOAA 4OAEA 3RYOA 3B7IA 4FBEA 5AG5A 1LAPA 1Z9UA 5IX3A 5J1QA 2B3VA 3KHXA 3WABA 4AVBA 4XPDC 5G22A 3BHXA 2AFMA 3T90A 4F6AA 1R43A 4KOTA 2WUUA 4JYWA 1MJBA 1QSOA 1X12A 4B12A 5H86A 3FNCA 4DNCA 2P6GA 1ARMA 1YX0A 2B4DA 2YNEA 1M44A 1Y7EA 3B3WA 5BWAB 3JUWA 3QAYA 4MI4A 1WWZA 2BUEA 2JDDA 2QECA 3A9LA 1BO4A 1N71A 4UA3A 4JJXA 4R8FA 4II9A 8CPAA 4ZYQA 5LRKA 1R57A 3QNVA 4MFQA 4CGNA 4MXUA 3EFAA 3NFZA 4MRIA 4ZX8A 4HNWB 4PK3A 4UEEA 2NYQA 4KOWA 2AFUA 3H8EA 4IUSA 2PQ8A 2JLMA 1IOFA 1S5KA 5A27A 3PZJA 3NH8A 4KOVA 4RI1A 2B5GB 1Q2CA 4MFZA 2VBQA 5D8NA 3G3SA 1XBUA 4A32A 2PJ2A 4Y49C 1XF8A 1Z2LA 3VATA 4X2TA 2GLJA 4AG7A 4OADA 5A28A 2CF4A 3B3SA 1P0HA 4HPSA 1YSJA 3D7GA 3CPAA 1A2ZA 1XE4A 3PGPA 3KI9A 1LOKA 1BPMA 2OZGA 4TNUA 4XNHC 2VEZA 4PV6A 3EXNA 3SJEA 4DYOA 4PSXA 4U9YA 4MCSA 2D4PA 5LYDA 4MFPA 5JGFA 3IJ3A 3NH4A 4C2XA 4ZY0A 2BOAA 2ZPAA 3D2MA 3FXTA 3ISXA 1VKCA 3LACA 3F0AA 4OP4A 2O28A 2PDOA 3V7ZA 3W6XA 2ZELA 3DLJA 1VHSA 1XMBA 1Z8WA 3I1UA 1S7NA 4MHNA 4PSWA 4X8IA 1TKJA 3W6SA 1YLEA 2AFWA 2NMTA 3KGQA 2Q04A 4LQGA 5CNPA 5C82A 4A31A 1Y9WA 4E0AA 2VI7A 4MFLA 1TIQA 4MCQA 4P6YA 3S9NA 4IK2A 1VIXA 2Z3LA 2REEA 3PB8X 2FXFA 3D7DA 3CXQA 4H89A 4M6HA 3FJUA 4NGMA 2EVNA 3N7ZA 2RC4A 3PBEA 5IB9A 4NJRA 4EFDA 3EC4A 1B6BA 4CAXA 2GREA 3DNSA 1UWYA 5K8PA 1CX8A 4FUUA 1QSNA 1VGYA 2PJ3A 5DWNA 3D7FA 4Q36A 3HUVA 4EVYA 2XEGA 4KS9A 3PB4X 1FY7A 1R3NA 2ZEEA 2C6CA 1ZLHA 3IWEA 3FMCA 4PXBA 3D68A 2DPTA 2G3AA 4C7HA 4WWVA 2PC1A 3PEIA 3WC5A 4CS0B 1TF8A 3CT9A 2IQ6A 4G1PA 4O23A 3LWUA 1S60A 3FEEA 3TTHA 4M85A 4KOSA 4M6GA 5THWA 2F7VA 4CAWA 4KOUA 2YNCC 4PQAA 3IGRA 2PJ4A 3KASA 2PJ9A 2XEJA 4B5PB 2HC9A 2PJ1A 4YU9A 4DJLA 3H4QA 4NJQA 4B13A 2PRQA 3VWEA 2Q4ZA 4GM5A 4JXRA 4R7MA 3TO6A 2PVVA 3B35A 3LD2A 2ZEDA 2EK8A 4KUAA 5F49A 3R96A 1LFWA 4MHZA 1YR0A 4MY3A 4WJBA 4BINA 3IIBA 4A39A 2Q7SA 3IEHA 1Q2DA 2GIVA 3FIXA 4RS2A 2EK9A 3MN8A 3QB8A 4P4IA 1S7FA 3K9UA 4IHMA 4NGNA 4PXCA 3FEDA 4YGOA 4UBRA 4J3GA 2G0BA 1QSMA 3BLNA 1NSLA 4CRZB 4OIWA 1Z4EA 4NSQA 4KOXA 1I1DA 4C2ZA 4OIDA 4F8ZA 1IY7A 3N5FA 1ZG9A 2PSWA 5LRGA 1LAMA 3S6HA 3B3CA 4AXVA 4UIAA 1YK3A 1RXTA 2WSAA 4CYOA 3PB6X 2HB6A 1OBRA 2Q4YA 4CAFA 3CXSA 2PE3A 3DDDA 3BJ8A 4PK2A 2OR4A 3S9LA 1BLLE 2FIAA 1JWQA 3GUXA 2DEAA 1Y0YA 2VXKA 2YNCA 4H6ZA 5JQ4A 4I49A 2QVPA 4P4BA 4B10A 2AFZA 4KVXA 3ZZIA 4ZX9A 3SI2A 4AVCA 2IL4A 3S6KA 2HV2A 2Q44A 4HNXB 4QBJA 2GE3A 3LODA 3BXMA 4L8AA 4L89A 1EE3P 2G9DA 4M3SA 3RBUA 4FAIA 4Z65A 4OC5A 2KCWA 1LCPA 2CIJA 2J9AA 3KZWA 4UCMA 3SXNA 4QB9A 3B2YA 4OC1A 3FVLA 4JXQA 2BEIA 3R9FA 2ZEPA 1M4DA 1YGHA 2CXAA 4QUSA 1CP7A 5HH1A 3R9GA 1IICA 2AJ6A 4K3NA 4Q7AA 1YREA 4UEZA 2PJ5A 3RZAA 3MRUA 2B5GA 1IYLA 3S9MA 1IYKA 4X5KA 2QMLA 5AG7A 4GS4A 2H5MA 4PPZA 3S6FA 2PJ6A 2P6FA 2PJ7A 3C26A 2PJ8A 1F2OA 1OZPA 3P2FA 3VH9A 5I0CA 6CPAA 4A38A 2BSWA 5AGEA 3SHPA 1XMTA 4LX9A 3UY5A 4Q38A 1LANA 1WK4A 1K4JA 3PFEA 1ZLIA 4UWJA 4NGPA 3NA6A 3RNZA 2HUZA 2WPWA 2A4NA 1XFOA 5AG6A 2DPSA 1V0CA 3V8IA 2REFA 4EWTA 2C6GA 3D3SA 4IAVA 4CGLA 5JM6A 1QSTA 3B3TA 4B6ZA 4CRYB 4E2AA 1ON0A 4A2ZA 1ELLP 3T9YA 2ZEGA 5G1ZA 4BD9A 1KZFA 4MFJA 4DUKA 4NFRA 1Y9KA 2V77A 3GKRA 5LRJA 5KTAA 2Z0ZA 3TO7A 5EBVA 2ZW5A 2V8DA 2D4OA 3KR5A 4LUAA 4CYPA 2ZEFA 3TO9A 4CYQA 5KTDA 3JRUA 2PVWA 2ZOGA 1YLOA 1ELMP 3RO0A 1S7KA 3BJ7A 4MMOA 4IF5A 1YW6A 1F57A 1Z5RA 1RTQA 1UFHA 1AYEA 2GU2A 2XEIA 3D7HA 4FD4A 2G3TA 1I21A 5G21A 7CPAA 1PUAA 3F5BA 2CTBA 4U5YA 1H8LA 1Z4RA 1IGBA 2GFQA 2XEFA 2Q0YA 3PB7X 4A30A 5IB0A 5LYFA 2PJAA 4KSIA 3V38A 2AFSA 2CNMA 2B3UA 2ZEOA 4C7IA 3PBBA 2OZHA 2QJ8A 4UFWA 5JPHA 2B58A 4ORFA 2V8VA 2O53A 5G20A 4KVOE 2HQYA 4FWUA 4H2KA 4NGRA 4B5PA 3WC6A 1GYTA 1AUGA 2PJCA 2F8HA 2WPXA 3FF3A 1HDQA 2RFHA 1ZG8A 1MK4A 2R1IA 4KUBA 5HVGA 4CAEA 1M4LA 2EUIA 2ATRA 1YVKA 2CNSA 3R1KA 2BL1A 5LYLA 5K8MA 2FCKA 3GLJA 2Z3OA 1Y0RA 2VL1A 4B14A 2GANA 2BO9A 3H8FA 4CGMA 2DXQA 3H8GA 3EY5A 1JQGA 4UEFA 1NMTA 1ARLA 2CNTA 3SJFA 4QVTA 4PXEA 4MHYA 1CP6A 1J4JA 3HLPA 3NE7A 5LYIA 1U6MA 4FD6A 1Z8LA 2POKA 1QQ9A 2FVGA 1X10A 1IB1E 2FL4A 1PYTB 3IU1A 1P4NA 3OWCA 2ODFA 3T8WA 3TCVA 4NGSA 1YVOA 3D8PA 4R76A 4A94A 4R87A 3FBUA 5KTCA 1QSRA 2J8RA 5JH9A 2EBJA 4KSFA 4LQ6A 4CYNA 2Q4VA 1XRYA 2Y0MA 1HEEA 5F46A 3P2HA 3GIUA 3W91A 5HVHA 4JZ0A 4JD6A 2I79A 3RAMA 2OH1A 2ZXVA 4E8OA 2Q43A 2Z3PA 5EC4A 3D2PA 3FECA 4A37A 2ARHA 1HDUA 3JVNA 4M6IA 4P4FA 4OC0A 5HXDA 5ELYA 1Q2YA 1KUVA 1S3ZA 1TF9A 3K2KA 3IU2A 4HNYB 4MJ8A 3TX8A 4A95A 1ZG7A 3VARA 1NSAA 2R98A 1LRZA 4MCRA 4F9VA 4HKFA 1XJOA 3ISZA 4UWIA 3D67A 5I4MA 3R9EA 3KKWA 1TXRA 2PJ0A 3PP9A 1Z8XA 2VZZA 1AMPA 2F5IA 1XIXA 2OZUA 3SI0A 4P4DA 4A33A 2PR8A 5CBMA 3PRTA 4KZTA 3SI1A 2X7BA 2FIWA 5D29A 1CM0A 3QAHA 4ZI6A 2ZW6A 2DF5A 1XEBA 4F0XA 1BAVA 4PXDA 1Y7RA 2GLFA 4B11A 3WC7A 4CGPA 1CBXA 2FE7A 3NE8A 3DR8A 4UIBA 5FVJA 4NGTA 4KLVA 5ISVA 2IMOA 2B4DB 2V8HA 1IOIA 1DTDA 2BCOA 4KLWA 4KOYA 2JBJA 2ZW7A 5HVFA 4KORA 3BI1A 4MY0A 4XPKA 5H84A 3ZJ0A 4KVME 1Q7LA 4ZBGA 4RUHA 3WR7A 3CDXA 4B5OA 4C68A 2Z3MA 1ZO0A 3CPXA 1M4IA 3CZXA 1SQHA 4YRHA 3R95A 3KQZA 1DE4C 1KUYA 2J8MA 4AG9A 3WT4A 5F47A 4AVAA 2JDCA 3FX6A 3PFOA 1S7LA 3IWGA 2Z3KA 2V8GA 4UFVA 5J8CA 2QIRA 3MGDA 1TKFA 2K5TA 3L2NA 1L0CA 4MHPA 2Z10A 2AFOA 4BMHA 1CPXA 4TWEA 4NEXA 2PCUA 4JWPA 2FS5A 4AB7A 2ZW4A 1GHEA 2R8VA 3I3GA 3KL9A 3GB0A 5DWMA 5AG4A 1IU8A 2WZNA 5HMNA 2C1CA 2PR1A 4R3LA 4MHDA 4UCPA 2JEVA 4XPDB 2PIZA 4EMEA 1XOVA 2VZYA 4CGOA 2WYRA 3PB9X 2C6PA 4OLLA 4OMEA 3GYAA 3EO4A 2I00A 1VHEA 3GY9A 4OKOA 4ONUA 4MCPA 2YNDA 4OC3A 4R3KA 4X3RA 1PCAA 2NSMA 2JBKA 1KWMA 2FSRA 3FRMA 2I3CA 4GXHA 2RB7A 1FNOA 3FYNA 1MJAA 4OC2A 2Q51A 5K8OA 2AFXA 4W9YA 4U9ZA
chains in the Genus database with same CATH topology
3DR6A 4JLYA 2OB0A 4YFJA 1B87A 5J8FA 3CXPA 1MJ9A 2OU2A 4CAVA 4H6UA 4Y49B 2P6EA 4FD7A 2AE6A 3FB3A 3DSBA 4ZGYB 5C88A 4FD5A 4K30A 3VWDA 2B4BA 4XNHB 5GCNA 1IIDA 4MBUA 3H5ZA 5F48A 2Z3NA 3S6GA 1M4GA 3I9SA 4KSAA 1I12A 3G8WA 1BOBA 2J8NA 3TE4A 3E0KA 3F8KA 3TOBA 1RO5A 3TT2A 1M1DA 4C2YA 2Q7BA 4QC6A 3SXOA 2PRBA 3JTKA 2Z11A 4F0YA 1KUXA 4UCNA 4BBHA 4MFKA 4R57A 2R7HA 4NXYA 2VQYA 2YGWA 4NF1A 4UFXA 5IV0A 2P0WA 4R9MA 5E96A 2C27A 2FT0A 1NE9A 3TFYA 1CJWA 4NCZA 1PU9A 2CY2A 3B8GA 4XPLA 3TOAA 4OAEA 3RYOA 5AG5A 5IX3A 1Z9UA 2B3VA 4AVBA 4XPDC 5G22A 3T90A 4F6AA 4KOTA 2WUUA 1MJBA 1QSOA 4B12A 5H86A 3FNCA 4DNCA 2P6GA 1YX0A 2B4DA 2YNEA 1M44A 5BWAB 3JUWA 4MI4A 1WWZA 2BUEA 2JDDA 2QECA 3A9LA 1BO4A 1N71A 4UA3A 4JJXA 4II9A 1R57A 4MFQA 4CGNA 3EFAA 4HNWB 4PK3A 4KOWA 4IUSA 2PQ8A 2JLMA 1S5KA 5A27A 3PZJA 4KOVA 4RI1A 2B5GB 1Q2CA 4MFZA 2VBQA 3G3SA 4A32A 4Y49C 1XF8A 4AG7A 4OADA 5A28A 1P0HA 1XE4A 3PGPA 2OZGA 4XNHC 2VEZA 4PV6A 3EXNA 4PSXA 4U9YA 2D4PA 4MFPA 4C2XA 2ZPAA 3D2MA 3FXTA 1VKCA 3F0AA 2O28A 2PDOA 3W6XA 1VHSA 1S7NA 4PSWA 3W6SA 1YLEA 2NMTA 2Q04A 5CNPA 5C82A 4A31A 1Y9WA 4E0AA 2VI7A 4MFLA 1TIQA 2Z3LA 2REEA 2FXFA 3CXQA 4H89A 2EVNA 3N7ZA 2RC4A 3EC4A 1B6BA 4CAXA 3DNSA 1QSNA 5DWNA 4Q36A 4EVYA 4KS9A 1FY7A 3IWEA 4C7HA 2DPTA 2G3AA 2PC1A 4CS0B 1S60A 3TTHA 4M85A 4KOSA 4CAWA 4KOUA 2YNCC 3IGRA 4B5PB 3H4QA 4B13A 3VWEA 4JXRA 3TO6A 3LD2A 4KUAA 5F49A 3R96A 1YR0A 4MY3A 1Q2DA 2GIVA 3FIXA 4RS2A 3QB8A 1S7FA 3K9UA 4YGOA 4UBRA 4J3GA 2G0BA 1QSMA 3BLNA 1NSLA 4CRZB 1Z4EA 4NSQA 4KOXA 1I1DA 4C2ZA 2PSWA 3S6HA 1YK3A 1RXTA 2WSAA 4CYOA 2Q4YA 4CAFA 3CXSA 3DDDA 3BJ8A 4PK2A 2FIAA 2YNCA 2VXKA 4H6ZA 5JQ4A 4I49A 4B10A 4KVXA 3ZZIA 4AVCA 2IL4A 3S6KA 2HV2A 2Q44A 4HNXB 4QBJA 2GE3A 3LODA 4L8AA 4L89A 4M3SA 2KCWA 4UCMA 3SXNA 4QB9A 4JXQA 2BEIA 3R9FA 1M4DA 1YGHA 2CXAA 4QUSA 3R9GA 5HH1A 1IICA 2AJ6A 1YREA 2B5GA 1IYLA 1IYKA 4X5KA 2QMLA 5AG7A 4GS4A 2H5MA 3S6FA 2P6FA 3C26A 1OZPA 3P2FA 5I0CA 2BSWA 5AGEA 3SHPA 1XMTA 4LX9A 3UY5A 4Q38A 1WK4A 1K4JA 4UWJA 2HUZA 2WPWA 2A4NA 5AG6A 2DPSA 1V0CA 3V8IA 2REFA 3D3SA 4CGLA 1QSTA 4CRYB 4E2AA 1ON0A 4A2ZA 3T9YA 5G1ZA 1KZFA 4MFJA 1Y9KA 3GKRA 5KTAA 2Z0ZA 3TO7A 5EBVA 2ZW5A 2D4OA 4LUAA 4CYPA 3TO9A 4CYQA 5KTDA 1S7KA 3BJ7A 4IF5A 1UFHA 4FD4A 2G3TA 1I21A 5G21A 1PUAA 3F5BA 4U5YA 1Z4RA 4A30A 2Q0YA 5IB0A 2CNMA 2B3UA 4C7IA 2OZHA 4UFWA 5JPHA 2B58A 4ORFA 5G20A 4KVOE 2HQYA 4B5PA 2WPXA 4KUBA 2R1IA 1MK4A 4CAEA 2EUIA 2ATRA 1YVKA 2CNSA 3R1KA 2BL1A 2FCKA 2Z3OA 4B14A 2GANA 4CGMA 2DXQA 3EY5A 1NMTA 2CNTA 4QVTA 1J4JA 3NE7A 1U6MA 4FD6A 3OWCA 3IU1A 1IB1E 2FL4A 3TCVA 1P4NA 1YVOA 3D8PA 5KTCA 4R87A 3FBUA 1QSRA 2J8RA 4KSFA 4CYNA 2Q4VA 2Y0MA 5F46A 3P2HA 3W91A 4JD6A 2I79A 2OH1A 2ZXVA 4E8OA 2Z3PA 5EC4A 3D2PA 2ARHA 3JVNA 1Q2YA 1KUVA 1S3ZA 4HNYB 3IU2A 4MJ8A 4A95A 2R98A 1LRZA 4HKFA 4UWIA 3R9EA 3KKWA 3PP9A 2VZZA 2F5IA 1XIXA 2OZUA 4A33A 2PR8A 4KZTA 2X7BA 2FIWA 1CM0A 3QAHA 2ZW6A 1XEBA 4F0XA 1Y7RA 4B11A 4CGPA 2FE7A 3DR8A 5FVJA 4KLVA 5ISVA 2B4DB 4KOYA 4KLWA 2ZW7A 4KORA 4MY0A 4XPKA 5H84A 3ZJ0A 4KVME 4ZBGA 3WR7A 4B5OA 4C68A 2Z3MA 1ZO0A 1M4IA 1SQHA 4YRHA 3R95A 1KUYA 2J8MA 4AG9A 5F47A 4AVAA 2JDCA 5J8CA 1S7LA 3IWGA 2Z3KA 4UFVA 2QIRA 3MGDA 2K5TA 1L0CA 2Z10A 4BMHA 4NEXA 4JWPA 2FS5A 4AB7A 2ZW4A 1GHEA 2R8VA 3I3GA 5DWMA 5AG4A 5HMNA 2PR1A 4R3LA 4MHDA 4UCPA 2JEVA 4XPDB 2VZYA 4CGOA 4OLLA 3GYAA 3EO4A 2I00A 3GY9A 4ONUA 2YNDA 4R3KA 2FSRA 3FRMA 3FYNA 1MJAA 4U9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DR6 A;  4JLY A;  2OB0 A;  4YFJ A;  1B87 A;  5J8F A;  3CXP A;  1MJ9 A;  2OU2 A;  4CAV A;  4H6U A;  4Y49 B;  2P6E A;  4FD7 A;  2AE6 A;  3FB3 A;  3DSB A;  5C88 A;  4FD5 A;  4K30 A;  3VWD A;  2B4B A;  4XNH B;  5GCN A;  1IID A;  4MBU A;  5F48 A;  3S6G A;  1M4G A;  3I9S A;  1I12 A;  3G8W A;  1BOB A;  2J8N A;  3TE4 A;  3E0K A;  3F8K A;  3TOB A;  1RO5 A;  3TT2 A;  1M1D A;  2Q7B A;  4QC6 A;  3SXO A;  2PRB A;  2Z11 A;  4F0Y A;  1KUX A;  4R57 A;  2R7H A;  4NXY A;  2VQY A;  4NF1 A;  5IV0 A;  2P0W A;  4R9M A;  5E96 A;  2C27 A;  2FT0 A;  1NE9 A;  3TFY A;  1CJW A;  4NCZ A;  1PU9 A;  2CY2 A;  3B8G A;  4XPL A;  3TOA A;  4OAE A;  3RYO A;  5IX3 A;  1Z9U A;  2B3V A;  4AVB A;  4XPD C;  3T90 A;  4F6A A;  4KOT A;  1MJB A;  1QSO A;  5H86 A;  3FNC A;  4DNC A;  2P6G A;  1YX0 A;  2B4D A;  1M44 A;  3JUW A;  4MI4 A;  1WWZ A;  2BUE A;  2JDD A;  2QEC A;  4II9 A;  1BO4 A;  1N71 A;  4UA3 A;  4JJX A;  1R57 A;  3EFA A;  4HNW B;  4PK3 A;  4KOW A;  4IUS A;  2PQ8 A;  2JLM A;  1S5K A;  3PZJ A;  4KOV A;  4RI1 A;  2B5G B;  1Q2C A;  2VBQ A;  3G3S A;  4Y49 C;  1XF8 A;  4AG7 A;  4OAD A;  1P0H A;  1XE4 A;  3PGP A;  2OZG A;  4XNH C;  2VEZ A;  4PV6 A;  3EXN A;  4PSX A;  4U9Y A;  2D4P A;  2ZPA A;  3D2M A;  3FXT A;  1VKC A;  3F0A A;  2O28 A;  2PDO A;  3W6X A;  1VHS A;  1S7N A;  4PSW A;  3W6S A;  1YLE A;  2NMT A;  2Q04 A;  5CNP A;  5C82 A;  1Y9W A;  4E0A A;  2VI7 A;  1TIQ A;  2REE A;  2FXF A;  3CXQ A;  4H89 A;  2EVN A;  3N7Z A;  2RC4 A;  3EC4 A;  1B6B A;  4CAX A;  3DNS A;  1QSN A;  5DWN A;  4EVY A;  1FY7 A;  2G3A A;  2PC1 A;  4CS0 B;  1S60 A;  3TTH A;  4M85 A;  4KOS A;  4CAW A;  4KOU A;  3IGR A;  4B5P B;  3H4Q A;  3VWE A;  4JXR A;  3TO6 A;  3LD2 A;  4KUA A;  5F49 A;  3R96 A;  1YR0 A;  4MY3 A;  1Q2D A;  2GIV A;  3FIX A;  4RS2 A;  3QB8 A;  1S7F A;  3K9U A;  4YGO A;  4UBR A;  4J3G A;  2G0B A;  1QSM A;  3BLN A;  1NSL A;  4CRZ B;  1Z4E A;  4NSQ A;  4KOX A;  1I1D A;  2PSW A;  3S6H A;  1YK3 A;  1RXT A;  2Q4Y A;  3CXS A;  3DDD A;  3BJ8 A;  4PK2 A;  2FIA A;  5JQ4 A;  2VXK A;  4H6Z A;  4I49 A;  4KVX A;  3ZZI A;  4AVC A;  2IL4 A;  3S6K A;  2HV2 A;  2Q44 A;  4HNX B;  4QBJ A;  2GE3 A;  3LOD A;  4L8A A;  4L89 A;  4M3S A;  2KCW A;  3SXN A;  4QB9 A;  4JXQ A;  2BEI A;  3R9F A;  1M4D A;  1YGH A;  4QUS A;  3R9G A;  5HH1 A;  1IIC A;  2AJ6 A;  1YRE A;  2B5G A;  1IYL A;  1IYK A;  4X5K A;  2QML A;  4GS4 A;  2H5M A;  3S6F A;  2P6F A;  3C26 A;  1OZP A;  3P2F A;  5I0C A;  2BSW A;  3SHP A;  1XMT A;  4LX9 A;  3UY5 A;  1WK4 A;  1K4J A;  4UWJ A;  2HUZ A;  2WPW A;  2A4N A;  1V0C A;  3V8I A;  2REF A;  3D3S A;  1QST A;  4CRY B;  4E2A A;  1ON0 A;  3T9Y A;  1KZF A;  1Y9K A;  3GKR A;  5KTA A;  2Z0Z A;  3TO7 A;  5EBV A;  2ZW5 A;  2D4O A;  4LUA A;  3TO9 A;  5KTD A;  1S7K A;  3BJ7 A;  4IF5 A;  1UFH A;  4FD4 A;  2G3T A;  1I21 A;  1PUA A;  3F5B A;  4U5Y A;  1Z4R A;  2Q0Y A;  5IB0 A;  2CNM A;  2B3U A;  2OZH A;  5JPH A;  2B58 A;  4ORF A;  4KVO E;  2HQY A;  4B5P A;  2WPX A;  4KUB A;  2R1I A;  1MK4 A;  2EUI A;  2ATR A;  1YVK A;  2CNS A;  3R1K A;  2BL1 A;  2FCK A;  2GAN A;  2DXQ A;  3EY5 A;  1NMT A;  2CNT A;  4QVT A;  1J4J A;  3NE7 A;  1U6M A;  4FD6 A;  3OWC A;  1IB1 E;  2FL4 A;  3TCV A;  1P4N A;  1YVO A;  3D8P A;  5KTC A;  4R87 A;  3FBU A;  1QSR A;  2J8R A;  2Q4V A;  2Y0M A;  5F46 A;  3P2H A;  3W91 A;  4JD6 A;  2I79 A;  2OH1 A;  2ZXV A;  4E8O A;  5EC4 A;  3D2P A;  2ARH A;  3JVN A;  1Q2Y A;  1KUV A;  1S3Z A;  4HNY B;  4MJ8 A;  2R98 A;  1LRZ A;  4HKF A;  4UWI A;  3R9E A;  3KKW A;  3PP9 A;  2VZZ A;  2F5I A;  1XIX A;  2OZU A;  2PR8 A;  4KZT A;  2X7B A;  2FIW A;  1CM0 A;  3QAH A;  2ZW6 A;  1XEB A;  1Y7R A;  2FE7 A;  3DR8 A;  5FVJ A;  4KLV A;  5ISV A;  2B4D B;  4KOY A;  4KLW A;  2ZW7 A;  4KOR A;  4MY0 A;  4XPK A;  5H84 A;  3ZJ0 A;  4KVM E;  4ZBG A;  3WR7 A;  4B5O A;  1M4I A;  1SQH A;  4YRH A;  3R95 A;  1KUY A;  2J8M A;  4AG9 A;  5F47 A;  4AVA A;  2JDC A;  5J8C A;  1S7L A;  3IWG A;  2QIR A;  3MGD A;  2K5T A;  1L0C A;  2Z10 A;  4BMH A;  4NEX A;  4JWP A;  2FS5 A;  4AB7 A;  2ZW4 A;  1GHE A;  2R8V A;  3I3G A;  5DWM A;  5HMN A;  2PR1 A;  4R3L A;  4MHD A;  4XPD B;  2JEV A;  2VZY A;  4OLL A;  3GYA A;  3EO4 A;  2I00 A;  3GY9 A;  4ONU A;  4R3K A;  2FSR A;  3FRM A;  3FYN A;  1MJA A;  4U9Z A; 
#chains in the Genus database with same CATH topology
 5CPA A;  1YW4 A;  3DR6 A;  4JLY A;  3DGV A;  2IJZ A;  2OB0 A;  1B87 A;  3IC1 A;  3KQX A;  4P4J A;  3CXP A;  3SJG A;  4YFJ A;  4P10 A;  5J8F A;  1QMU A;  5F09 A;  5DS0 A;  1MJ9 A;  2OU2 A;  4NGQ A;  4CAV A;  4H6U A;  4Y49 B;  2P6E A;  2CTC A;  5EMI A;  3TC8 A;  3IWW A;  4FD7 A;  2AE6 A;  3FB3 A;  3DSB A;  4ZGY B;  1CG2 A;  3D66 A;  3SJX A;  5C88 A;  4FD5 A;  4K30 A;  4P44 A;  1VHO A;  4ZY2 A;  3VWD A;  3IFE A;  4R6T A;  3KR4 A;  2ABZ A;  2B4B A;  4XNH B;  5GCN A;  1Z8T A;  1IID A;  4MBU A;  3H5Z A;  5F48 A;  2Z3N A;  3LMS A;  3S6G A;  1M4G A;  3IO1 A;  1YME A;  3I9S A;  4KSA A;  1TKH A;  4F9U A;  1I12 A;  3G8W A;  1BOB A;  2J8N A;  3K9T A;  4UF4 A;  3TE4 A;  3E0K A;  3F8K A;  2ZOF A;  4ONW A;  3TOB A;  1FT7 A;  1RO5 A;  1F2P A;  2ZEM A;  3TT2 A;  4RN7 A;  1M1D A;  4C2Y A;  2Q7B A;  3D4U A;  4QC6 A;  3SXO A;  2OOT A;  1YQE A;  4CPA A;  5K8N A;  2PRB A;  2O4H A;  2EO8 A;  3JTK A;  4P4E A;  3BI0 A;  4YWY A;  2Z11 A;  2ANP A;  4F0Y A;  3KHZ A;  1KUX A;  2ZEH A;  4UCN A;  4BBH A;  4MFK A;  4R57 A;  1BPN A;  2R7H A;  3FH4 A;  4NXY A;  1CPS A;  2VQY A;  2YGW A;  3B3V A;  4NF1 A;  4UFX A;  5IV0 A;  2P0W A;  4R9M A;  5E96 A;  2C27 A;  2QYV A;  2EWB A;  2FT0 A;  2JEW A;  4P45 A;  3NH5 A;  2ZEN A;  2PIY A;  1NE9 A;  3TFY A;  1CJW A;  4NCZ A;  1PU9 A;  2PJB A;  4OC4 A;  2CY2 A;  3B8G A;  4XPL A;  4ZY1 A;  3TOA A;  4OAE A;  3RYO A;  3B7I A;  4FBE A;  5AG5 A;  1LAP A;  1Z9U A;  5IX3 A;  5J1Q A;  2B3V A;  3KHX A;  3WAB A;  4AVB A;  4XPD C;  5G22 A;  3BHX A;  2AFM A;  3T90 A;  4F6A A;  1R43 A;  4KOT A;  2WUU A;  4JYW A;  1MJB A;  1QSO A;  1X12 A;  4B12 A;  5H86 A;  3FNC A;  4DNC A;  2P6G A;  1ARM A;  1YX0 A;  2B4D A;  2YNE A;  1M44 A;  1Y7E A;  3B3W A;  5BWA B;  3JUW A;  3QAY A;  4MI4 A;  1WWZ A;  2BUE A;  2JDD A;  2QEC A;  3A9L A;  1BO4 A;  1N71 A;  4UA3 A;  4JJX A;  4R8F A;  4II9 A;  8CPA A;  4ZYQ A;  5LRK A;  1R57 A;  3QNV A;  4MFQ A;  4CGN A;  4MXU A;  3EFA A;  3NFZ A;  4MRI A;  4ZX8 A;  4HNW B;  4PK3 A;  4UEE A;  2NYQ A;  4KOW A;  2AFU A;  3H8E A;  4IUS A;  2PQ8 A;  2JLM A;  1IOF A;  1S5K A;  5A27 A;  3PZJ A;  3NH8 A;  4KOV A;  4RI1 A;  2B5G B;  1Q2C A;  4MFZ A;  2VBQ A;  5D8N A;  3G3S A;  1XBU A;  4A32 A;  2PJ2 A;  4Y49 C;  1XF8 A;  1Z2L A;  3VAT A;  4X2T A;  2GLJ A;  4AG7 A;  4OAD A;  5A28 A;  2CF4 A;  3B3S A;  1P0H A;  4HPS A;  1YSJ A;  3D7G A;  3CPA A;  1A2Z A;  1XE4 A;  3PGP A;  3KI9 A;  1LOK A;  1BPM A;  2OZG A;  4TNU A;  4XNH C;  2VEZ A;  4PV6 A;  3EXN A;  3SJE A;  4DYO A;  4PSX A;  4U9Y A;  4MCS A;  2D4P A;  5LYD A;  4MFP A;  5JGF A;  3IJ3 A;  3NH4 A;  4C2X A;  4ZY0 A;  2BOA A;  2ZPA A;  3D2M A;  3FXT A;  3ISX A;  1VKC A;  3LAC A;  3F0A A;  4OP4 A;  2O28 A;  2PDO A;  3V7Z A;  3W6X A;  2ZEL A;  3DLJ A;  1VHS A;  1XMB A;  1Z8W A;  3I1U A;  1S7N A;  4MHN A;  4PSW A;  4X8I A;  1TKJ A;  3W6S A;  1YLE A;  2AFW A;  2NMT A;  3KGQ A;  2Q04 A;  4LQG A;  5CNP A;  5C82 A;  4A31 A;  1Y9W A;  4E0A A;  2VI7 A;  4MFL A;  1TIQ A;  4MCQ A;  4P6Y A;  3S9N A;  4IK2 A;  1VIX A;  2Z3L A;  2REE A;  3PB8 X;  2FXF A;  3D7D A;  3CXQ A;  4H89 A;  4M6H A;  3FJU A;  4NGM A;  2EVN A;  3N7Z A;  2RC4 A;  3PBE A;  5IB9 A;  4NJR A;  4EFD A;  3EC4 A;  1B6B A;  4CAX A;  2GRE A;  3DNS A;  1UWY A;  5K8P A;  1CX8 A;  4FUU A;  1QSN A;  1VGY A;  2PJ3 A;  5DWN A;  3D7F A;  4Q36 A;  3HUV A;  4EVY A;  2XEG A;  4KS9 A;  3PB4 X;  1FY7 A;  1R3N A;  2ZEE A;  2C6C A;  1ZLH A;  3IWE A;  3FMC A;  4PXB A;  3D68 A;  2DPT A;  2G3A A;  4C7H A;  4WWV A;  2PC1 A;  3PEI A;  3WC5 A;  4CS0 B;  1TF8 A;  3CT9 A;  2IQ6 A;  4G1P A;  4O23 A;  3LWU A;  1S60 A;  3FEE A;  3TTH A;  4M85 A;  4KOS A;  4M6G A;  5THW A;  2F7V A;  4CAW A;  4KOU A;  2YNC C;  4PQA A;  3IGR A;  2PJ4 A;  3KAS A;  2PJ9 A;  2XEJ A;  4B5P B;  2HC9 A;  2PJ1 A;  4YU9 A;  4DJL A;  3H4Q A;  4NJQ A;  4B13 A;  2PRQ A;  3VWE A;  2Q4Z A;  4GM5 A;  4JXR A;  4R7M A;  3TO6 A;  2PVV A;  3B35 A;  3LD2 A;  2ZED A;  2EK8 A;  4KUA A;  5F49 A;  3R96 A;  1LFW A;  4MHZ A;  1YR0 A;  4MY3 A;  4WJB A;  4BIN A;  3IIB A;  4A39 A;  2Q7S A;  3IEH A;  1Q2D A;  2GIV A;  3FIX A;  4RS2 A;  2EK9 A;  3MN8 A;  3QB8 A;  4P4I A;  1S7F A;  3K9U A;  4IHM A;  4NGN A;  4PXC A;  3FED A;  4YGO A;  4UBR A;  4J3G A;  2G0B A;  1QSM A;  3BLN A;  1NSL A;  4CRZ B;  4OIW A;  1Z4E A;  4NSQ A;  4KOX A;  1I1D A;  4C2Z A;  4OID A;  4F8Z A;  1IY7 A;  3N5F A;  1ZG9 A;  2PSW A;  5LRG A;  1LAM A;  3S6H A;  3B3C A;  4AXV A;  4UIA A;  1YK3 A;  1RXT A;  2WSA A;  4CYO A;  3PB6 X;  2HB6 A;  1OBR A;  2Q4Y A;  4CAF A;  3CXS A;  2PE3 A;  3DDD A;  3BJ8 A;  4PK2 A;  2OR4 A;  3S9L A;  1BLL E;  2FIA A;  1JWQ A;  3GUX A;  2DEA A;  1Y0Y A;  2VXK A;  2YNC A;  4H6Z A;  5JQ4 A;  4I49 A;  2QVP A;  4P4B A;  4B10 A;  2AFZ A;  4KVX A;  3ZZI A;  4ZX9 A;  3SI2 A;  4AVC A;  2IL4 A;  3S6K A;  2HV2 A;  2Q44 A;  4HNX B;  4QBJ A;  2GE3 A;  3LOD A;  3BXM A;  4L8A A;  4L89 A;  1EE3 P;  2G9D A;  4M3S A;  3RBU A;  4FAI A;  4Z65 A;  4OC5 A;  2KCW A;  1LCP A;  2CIJ A;  2J9A A;  3KZW A;  4UCM A;  3SXN A;  4QB9 A;  3B2Y A;  4OC1 A;  3FVL A;  4JXQ A;  2BEI A;  3R9F A;  2ZEP A;  1M4D A;  1YGH A;  2CXA A;  4QUS A;  1CP7 A;  5HH1 A;  3R9G A;  1IIC A;  2AJ6 A;  4K3N A;  4Q7A A;  1YRE A;  4UEZ A;  2PJ5 A;  3RZA A;  3MRU A;  2B5G A;  1IYL A;  3S9M A;  1IYK A;  4X5K A;  2QML A;  5AG7 A;  4GS4 A;  2H5M A;  4PPZ A;  3S6F A;  2PJ6 A;  2P6F A;  2PJ7 A;  3C26 A;  2PJ8 A;  1F2O A;  1OZP A;  3P2F A;  3VH9 A;  5I0C A;  6CPA A;  4A38 A;  2BSW A;  5AGE A;  3SHP A;  1XMT A;  4LX9 A;  3UY5 A;  4Q38 A;  1LAN A;  1WK4 A;  1K4J A;  3PFE A;  1ZLI A;  4UWJ A;  4NGP A;  3NA6 A;  3RNZ A;  2HUZ A;  2WPW A;  2A4N A;  1XFO A;  5AG6 A;  2DPS A;  1V0C A;  3V8I A;  2REF A;  4EWT A;  2C6G A;  3D3S A;  4IAV A;  4CGL A;  5JM6 A;  1QST A;  3B3T A;  4B6Z A;  4CRY B;  4E2A A;  1ON0 A;  4A2Z A;  1ELL P;  3T9Y A;  2ZEG A;  5G1Z A;  4BD9 A;  1KZF A;  4MFJ A;  4DUK A;  4NFR A;  1Y9K A;  2V77 A;  3GKR A;  5LRJ A;  5KTA A;  2Z0Z A;  3TO7 A;  5EBV A;  2ZW5 A;  2V8D A;  2D4O A;  3KR5 A;  4LUA A;  4CYP A;  2ZEF A;  3TO9 A;  4CYQ A;  5KTD A;  3JRU A;  2PVW A;  2ZOG A;  1YLO A;  1ELM P;  3RO0 A;  1S7K A;  3BJ7 A;  4MMO A;  4IF5 A;  1YW6 A;  1F57 A;  1Z5R A;  1RTQ A;  1UFH A;  1AYE A;  2GU2 A;  2XEI A;  3D7H A;  4FD4 A;  2G3T A;  1I21 A;  5G21 A;  7CPA A;  1PUA A;  3F5B A;  2CTB A;  4U5Y A;  1H8L A;  1Z4R A;  1IGB A;  2GFQ A;  2XEF A;  2Q0Y A;  3PB7 X;  4A30 A;  5IB0 A;  5LYF A;  2PJA A;  4KSI A;  3V38 A;  2AFS A;  2CNM A;  2B3U A;  2ZEO A;  4C7I A;  3PBB A;  2OZH A;  2QJ8 A;  4UFW A;  5JPH A;  2B58 A;  4ORF A;  2V8V A;  2O53 A;  5G20 A;  4KVO E;  2HQY A;  4FWU A;  4H2K A;  4NGR A;  4B5P A;  3WC6 A;  1GYT A;  1AUG A;  2PJC A;  2F8H A;  2WPX A;  3FF3 A;  1HDQ A;  2RFH A;  1ZG8 A;  1MK4 A;  2R1I A;  4KUB A;  5HVG A;  4CAE A;  1M4L A;  2EUI A;  2ATR A;  1YVK A;  2CNS A;  3R1K A;  2BL1 A;  5LYL A;  5K8M A;  2FCK A;  3GLJ A;  2Z3O A;  1Y0R A;  2VL1 A;  4B14 A;  2GAN A;  2BO9 A;  3H8F A;  4CGM A;  2DXQ A;  3H8G A;  3EY5 A;  1JQG A;  4UEF A;  1NMT A;  1ARL A;  2CNT A;  3SJF A;  4QVT A;  4PXE A;  4MHY A;  1CP6 A;  1J4J A;  3HLP A;  3NE7 A;  5LYI A;  1U6M A;  4FD6 A;  1Z8L A;  2POK A;  1QQ9 A;  2FVG A;  1X10 A;  1IB1 E;  2FL4 A;  1PYT B;  3IU1 A;  1P4N A;  3OWC A;  2ODF A;  3T8W A;  3TCV A;  4NGS A;  1YVO A;  3D8P A;  4R76 A;  4A94 A;  4R87 A;  3FBU A;  5KTC A;  1QSR A;  2J8R A;  5JH9 A;  2EBJ A;  4KSF A;  4LQ6 A;  4CYN A;  2Q4V A;  1XRY A;  2Y0M A;  1HEE A;  5F46 A;  3P2H A;  3GIU A;  3W91 A;  5HVH A;  4JZ0 A;  4JD6 A;  2I79 A;  3RAM A;  2OH1 A;  2ZXV A;  4E8O A;  2Q43 A;  2Z3P A;  5EC4 A;  3D2P A;  3FEC A;  4A37 A;  2ARH A;  1HDU A;  3JVN A;  4M6I A;  4P4F A;  4OC0 A;  5HXD A;  5ELY A;  1Q2Y A;  1KUV A;  1S3Z A;  1TF9 A;  3K2K A;  3IU2 A;  4HNY B;  4MJ8 A;  3TX8 A;  4A95 A;  1ZG7 A;  3VAR A;  1NSA A;  2R98 A;  1LRZ A;  4MCR A;  4F9V A;  4HKF A;  1XJO A;  3ISZ A;  4UWI A;  3D67 A;  5I4M A;  3R9E A;  3KKW A;  1TXR A;  2PJ0 A;  3PP9 A;  1Z8X A;  2VZZ A;  1AMP A;  2F5I A;  1XIX A;  2OZU A;  3SI0 A;  4P4D A;  4A33 A;  2PR8 A;  5CBM A;  3PRT A;  4KZT A;  3SI1 A;  2X7B A;  2FIW A;  5D29 A;  1CM0 A;  3QAH A;  4ZI6 A;  2ZW6 A;  2DF5 A;  1XEB A;  4F0X A;  1BAV A;  4PXD A;  1Y7R A;  2GLF A;  4B11 A;  3WC7 A;  4CGP A;  1CBX A;  2FE7 A;  3NE8 A;  3DR8 A;  4UIB A;  5FVJ A;  4NGT A;  4KLV A;  5ISV A;  2IMO A;  2B4D B;  2V8H A;  1IOI A;  1DTD A;  2BCO A;  4KLW A;  4KOY A;  2JBJ A;  2ZW7 A;  5HVF A;  4KOR A;  3BI1 A;  4MY0 A;  4XPK A;  5H84 A;  3ZJ0 A;  4KVM E;  1Q7L A;  4ZBG A;  4RUH A;  3WR7 A;  3CDX A;  4B5O A;  4C68 A;  2Z3M A;  1ZO0 A;  3CPX A;  1M4I A;  3CZX A;  1SQH A;  4YRH A;  3R95 A;  3KQZ A;  1DE4 C;  1KUY A;  2J8M A;  4AG9 A;  3WT4 A;  5F47 A;  4AVA A;  2JDC A;  3FX6 A;  3PFO A;  1S7L A;  3IWG A;  2Z3K A;  2V8G A;  4UFV A;  5J8C A;  2QIR A;  3MGD A;  1TKF A;  2K5T A;  3L2N A;  1L0C A;  4MHP A;  2Z10 A;  2AFO A;  4BMH A;  1CPX A;  4TWE A;  4NEX A;  2PCU A;  4JWP A;  2FS5 A;  4AB7 A;  2ZW4 A;  1GHE A;  2R8V A;  3I3G A;  3KL9 A;  3GB0 A;  5DWM A;  5AG4 A;  1IU8 A;  2WZN A;  5HMN A;  2C1C A;  2PR1 A;  4R3L A;  4MHD A;  4UCP A;  2JEV A;  4XPD B;  2PIZ A;  4EME A;  1XOV A;  2VZY A;  4CGO A;  2WYR A;  3PB9 X;  2C6P A;  4OLL A;  4OME A;  3GYA A;  3EO4 A;  2I00 A;  1VHE A;  3GY9 A;  4OKO A;  4ONU A;  4MCP A;  2YND A;  4OC3 A;  4R3K A;  4X3R A;  1PCA A;  2NSM A;  2JBK A;  1KWM A;  2FSR A;  3FRM A;  2I3C A;  4GXH A;  2RB7 A;  1FNO A;  3FYN A;  1MJA A;  4OC2 A;  2Q51 A;  5K8O A;  2AFX A;  4W9Y A;  4U9Z A; 
#chains in the Genus database with same CATH homology
 3DR6 A;  4JLY A;  2OB0 A;  4YFJ A;  1B87 A;  5J8F A;  3CXP A;  1MJ9 A;  2OU2 A;  4CAV A;  4H6U A;  4Y49 B;  2P6E A;  4FD7 A;  2AE6 A;  3FB3 A;  3DSB A;  4ZGY B;  5C88 A;  4FD5 A;  4K30 A;  3VWD A;  2B4B A;  4XNH B;  5GCN A;  1IID A;  4MBU A;  3H5Z A;  5F48 A;  2Z3N A;  3S6G A;  1M4G A;  3I9S A;  4KSA A;  1I12 A;  3G8W A;  1BOB A;  2J8N A;  3TE4 A;  3E0K A;  3F8K A;  3TOB A;  1RO5 A;  3TT2 A;  1M1D A;  4C2Y A;  2Q7B A;  4QC6 A;  3SXO A;  2PRB A;  3JTK A;  2Z11 A;  4F0Y A;  1KUX A;  4UCN A;  4BBH A;  4MFK A;  4R57 A;  2R7H A;  4NXY A;  2VQY A;  2YGW A;  4NF1 A;  4UFX A;  5IV0 A;  2P0W A;  4R9M A;  5E96 A;  2C27 A;  2FT0 A;  1NE9 A;  3TFY A;  1CJW A;  4NCZ A;  1PU9 A;  2CY2 A;  3B8G A;  4XPL A;  3TOA A;  4OAE A;  3RYO A;  5AG5 A;  5IX3 A;  1Z9U A;  2B3V A;  4AVB A;  4XPD C;  5G22 A;  3T90 A;  4F6A A;  4KOT A;  2WUU A;  1MJB A;  1QSO A;  4B12 A;  5H86 A;  3FNC A;  4DNC A;  2P6G A;  1YX0 A;  2B4D A;  2YNE A;  1M44 A;  5BWA B;  3JUW A;  4MI4 A;  1WWZ A;  2BUE A;  2JDD A;  2QEC A;  3A9L A;  1BO4 A;  1N71 A;  4UA3 A;  4JJX A;  4II9 A;  1R57 A;  4MFQ A;  4CGN A;  3EFA A;  4HNW B;  4PK3 A;  4KOW A;  4IUS A;  2PQ8 A;  2JLM A;  1S5K A;  5A27 A;  3PZJ A;  4KOV A;  4RI1 A;  2B5G B;  1Q2C A;  4MFZ A;  2VBQ A;  3G3S A;  4A32 A;  4Y49 C;  1XF8 A;  4AG7 A;  4OAD A;  5A28 A;  1P0H A;  1XE4 A;  3PGP A;  2OZG A;  4XNH C;  2VEZ A;  4PV6 A;  3EXN A;  4PSX A;  4U9Y A;  2D4P A;  4MFP A;  4C2X A;  2ZPA A;  3D2M A;  3FXT A;  1VKC A;  3F0A A;  2O28 A;  2PDO A;  3W6X A;  1VHS A;  1S7N A;  4PSW A;  3W6S A;  1YLE A;  2NMT A;  2Q04 A;  5CNP A;  5C82 A;  4A31 A;  1Y9W A;  4E0A A;  2VI7 A;  4MFL A;  1TIQ A;  2Z3L A;  2REE A;  2FXF A;  3CXQ A;  4H89 A;  2EVN A;  3N7Z A;  2RC4 A;  3EC4 A;  1B6B A;  4CAX A;  3DNS A;  1QSN A;  5DWN A;  4Q36 A;  4EVY A;  4KS9 A;  1FY7 A;  3IWE A;  4C7H A;  2DPT A;  2G3A A;  2PC1 A;  4CS0 B;  1S60 A;  3TTH A;  4M85 A;  4KOS A;  4CAW A;  4KOU A;  2YNC C;  3IGR A;  4B5P B;  3H4Q A;  4B13 A;  3VWE A;  4JXR A;  3TO6 A;  3LD2 A;  4KUA A;  5F49 A;  3R96 A;  1YR0 A;  4MY3 A;  1Q2D A;  2GIV A;  3FIX A;  4RS2 A;  3QB8 A;  1S7F A;  3K9U A;  4YGO A;  4UBR A;  4J3G A;  2G0B A;  1QSM A;  3BLN A;  1NSL A;  4CRZ B;  1Z4E A;  4NSQ A;  4KOX A;  1I1D A;  4C2Z A;  2PSW A;  3S6H A;  1YK3 A;  1RXT A;  2WSA A;  4CYO A;  2Q4Y A;  4CAF A;  3CXS A;  3DDD A;  3BJ8 A;  4PK2 A;  2FIA A;  2YNC A;  2VXK A;  4H6Z A;  5JQ4 A;  4I49 A;  4B10 A;  4KVX A;  3ZZI A;  4AVC A;  2IL4 A;  3S6K A;  2HV2 A;  2Q44 A;  4HNX B;  4QBJ A;  2GE3 A;  3LOD A;  4L8A A;  4L89 A;  4M3S A;  2KCW A;  4UCM A;  3SXN A;  4QB9 A;  4JXQ A;  2BEI A;  3R9F A;  1M4D A;  1YGH A;  2CXA A;  4QUS A;  3R9G A;  5HH1 A;  1IIC A;  2AJ6 A;  1YRE A;  2B5G A;  1IYL A;  1IYK A;  4X5K A;  2QML A;  5AG7 A;  4GS4 A;  2H5M A;  3S6F A;  2P6F A;  3C26 A;  1OZP A;  3P2F A;  5I0C A;  2BSW A;  5AGE A;  3SHP A;  1XMT A;  4LX9 A;  3UY5 A;  4Q38 A;  1WK4 A;  1K4J A;  4UWJ A;  2HUZ A;  2WPW A;  2A4N A;  5AG6 A;  2DPS A;  1V0C A;  3V8I A;  2REF A;  3D3S A;  4CGL A;  1QST A;  4CRY B;  4E2A A;  1ON0 A;  4A2Z A;  3T9Y A;  5G1Z A;  1KZF A;  4MFJ A;  1Y9K A;  3GKR A;  5KTA A;  2Z0Z A;  3TO7 A;  5EBV A;  2ZW5 A;  2D4O A;  4LUA A;  4CYP A;  3TO9 A;  4CYQ A;  5KTD A;  1S7K A;  3BJ7 A;  4IF5 A;  1UFH A;  4FD4 A;  2G3T A;  1I21 A;  5G21 A;  1PUA A;  3F5B A;  4U5Y A;  1Z4R A;  4A30 A;  2Q0Y A;  5IB0 A;  2CNM A;  2B3U A;  4C7I A;  2OZH A;  4UFW A;  5JPH A;  2B58 A;  4ORF A;  5G20 A;  4KVO E;  2HQY A;  4B5P A;  2WPX A;  4KUB A;  2R1I A;  1MK4 A;  4CAE A;  2EUI A;  2ATR A;  1YVK A;  2CNS A;  3R1K A;  2BL1 A;  2FCK A;  2Z3O A;  4B14 A;  2GAN A;  4CGM A;  2DXQ A;  3EY5 A;  1NMT A;  2CNT A;  4QVT A;  1J4J A;  3NE7 A;  1U6M A;  4FD6 A;  3OWC A;  3IU1 A;  1IB1 E;  2FL4 A;  3TCV A;  1P4N A;  1YVO A;  3D8P A;  5KTC A;  4R87 A;  3FBU A;  1QSR A;  2J8R A;  4KSF A;  4CYN A;  2Q4V A;  2Y0M A;  5F46 A;  3P2H A;  3W91 A;  4JD6 A;  2I79 A;  2OH1 A;  2ZXV A;  4E8O A;  2Z3P A;  5EC4 A;  3D2P A;  2ARH A;  3JVN A;  1Q2Y A;  1KUV A;  1S3Z A;  4HNY B;  3IU2 A;  4MJ8 A;  4A95 A;  2R98 A;  1LRZ A;  4HKF A;  4UWI A;  3R9E A;  3KKW A;  3PP9 A;  2VZZ A;  2F5I A;  1XIX A;  2OZU A;  4A33 A;  2PR8 A;  4KZT A;  2X7B A;  2FIW A;  1CM0 A;  3QAH A;  2ZW6 A;  1XEB A;  4F0X A;  1Y7R A;  4B11 A;  4CGP A;  2FE7 A;  3DR8 A;  5FVJ A;  4KLV A;  5ISV A;  2B4D B;  4KOY A;  4KLW A;  2ZW7 A;  4KOR A;  4MY0 A;  4XPK A;  5H84 A;  3ZJ0 A;  4KVM E;  4ZBG A;  3WR7 A;  4B5O A;  4C68 A;  2Z3M A;  1ZO0 A;  1M4I A;  1SQH A;  4YRH A;  3R95 A;  1KUY A;  2J8M A;  4AG9 A;  5F47 A;  4AVA A;  2JDC A;  5J8C A;  1S7L A;  3IWG A;  2Z3K A;  4UFV A;  2QIR A;  3MGD A;  2K5T A;  1L0C A;  2Z10 A;  4BMH A;  4NEX A;  4JWP A;  2FS5 A;  4AB7 A;  2ZW4 A;  1GHE A;  2R8V A;  3I3G A;  5DWM A;  5AG4 A;  5HMN A;  2PR1 A;  4R3L A;  4MHD A;  4UCP A;  2JEV A;  4XPD B;  2VZY A;  4CGO A;  4OLL A;  3GYA A;  3EO4 A;  2I00 A;  3GY9 A;  4ONU A;  2YND A;  4R3K A;  2FSR A;  3FRM A;  3FYN A;  1MJA A;  4U9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...