2B3VA

Spermine spermidine acetyltransferase in complex with acetylcoa, k26r mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
167
structure length
167
Chain Sequence
FVIRPATAADCSDILRLIKELARYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Diamine acetyltransferase 1
total genus 35
structure length 167
sequence length 167
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b3vA00
3T90A 1KUVA 5IB0A 2VBQA 2HUZA 5IX3A 5DWMA 1KUYA 2PR8A 1CM0A 1M4GA 2NMTA 4UWIA 5JQ4A 1N71A 2ZW4A 2P6FA 4F0YA 2B4DA 1M1DA 3TO6A 3F0AA 4CAVA 2B3VA 2GANA 4J3GA 3TCVA 2JEVA 3S6GA 3DDDA 3E0KA 5J8CA 3UY5A 1BO4A 3G8WA 2VZYA 2EVNA 2A4NA 3N7ZA 2Z0ZA 3CXQA 4II9A 2B4DB 4B5OA 5C82A 2K5TA 2B4BA 3PZJA 4U9ZA 1XMTA 2HQYA 4ZBGA 2ZW5A 2WPXA 3FYNA 3C26A 1RO5A 3TT2A 3QB8A 1NMTA 3TFYA 2Q04A 4JXQA 4R3KA 2D4PA 1V0CA 4NEXA 2OZUA 1XEBA 3ZZIA 3TO9A 1OZPA 3T9YA 3SHPA 2C27A 4QBJA 2Q4VA 1RXTA 4CS0B 1R57A 1I1DA 1S5KA 4Y49B 4YGOA 3KKWA 4JWPA 1IICA 2B58A 4XPDC 3TOAA 1QSRA 4HNXB 3QAHA 3FB3A 5CNPA 2H5MA 2O28A 1SQHA 1YGHA 5KTDA 4DNCA 4IUSA 3SXOA 2Q44A 2PDOA 4KUBA 5E96A 3F5BA 5JPHA 4OADA 4PK3A 4FD4A 4QVTA 4KVME 1M44A 3W6XA 1L0CA 1VHSA 4XPLA 4KOSA 2DXQA 3ZJ0A 2RC4A 3TOBA 2ZPAA 4LX9A 3VWDA 2J8RA 3LODA 3EY5A 3TTHA 1QSOA 2Q7BA 4KZTA 1ON0A 3DR6A 2P6GA 3FXTA 4HNWB 2X7BA 4MBUA 3SXNA 2CNSA 2QIRA 1GHEA 4K30A 2FL4A 4MI4A 1B6BA 3P2HA 3TO7A 1Q2DA 4MY3A 3FIXA 2PQ8A 4KOXA 4KVOE 4YRHA 3B8GA 3GY9A 2B5GA 2GE3A 2R7HA 4HNYB 3EFAA 3OWCA 1PUAA 2CNTA 1Z4EA 4FD5A 1XF8A 2P6EA 2BUEA 1MK4A 4JXRA 4KORA 4NSQA 4XNHB 2P0WA 4KOUA 3D3SA 1K4JA 3MGDA 5F49A 5J8FA 5KTAA 1Z9UA 2QMLA 4QUSA 4H89A 4M85A 4KLWA 4M3SA 2OB0A 2REFA 4R3LA 5F48A 1YLEA 4MJ8A 2AE6A 3FBUA 2ZW7A 4LUAA 2D4OA 2OZHA 5HH1A 2VEZA 1LRZA 2CY2A 4JJXA 1J4JA 4RI1A 1Y7RA 3F8KA 3CXPA 3PP9A 4FD6A 3DNSA 3VWEA 2PRBA 3BLNA 2B5GB 1KUXA 3D2PA 2R98A 2FXFA 3R9FA 5HMNA 3GKRA 3BJ8A 1IB1E 1Q2CA 2FS5A 1IYKA 2BSWA 2I00A 2VQYA 2ZW6A 1TIQA 4PV6A 3FRMA 2F5IA 2IL4A 2PC1A 4R87A 4UWJA 3S6KA 4QC6A 3R95A 4B5PA 4AVCA 3D8PA 1NSLA 1Z4RA 2G3TA 4U9YA 2ATRA 2ZXVA 5H84A 1VKCA 5EBVA 5EC4A 1KZFA 3LD2A 5C88A 2Z10A 4OLLA 1UFHA 2BEIA 4XPKA 3W6SA 4KOWA 1S60A 5FVJA 3DSBA 1WWZA 4PK2A 4XNHC 2J8MA 4CRZB 1YVOA 2OH1A 4OAEA 2FT0A 4IF5A 3D2MA 2G0BA 3EXNA 3IWGA 3NE7A 2Z11A 1QSNA 4UA3A 3CXSA 4NXYA 2FIAA 2FIWA 3RYOA 4X5KA 3R1KA 5F46A 1IYLA 3K9UA 4CAXA 3TE4A 1P4NA 4BMHA 5ISVA 2OZGA 2HV2A 4AB7A 3DR8A 3G3SA 2R8VA 2VZZA 1B87A 4GS4A 3I3GA 4XPDB 2VXKA 5KTCA 1S7KA 1S7NA 2Q4YA 4QB9A 1M4DA 4MHDA 4Y49C 1MJ9A 4H6UA 3I9SA 4B5PB 2Y0MA 5I0CA 1WK4A 4KLVA 2R1IA 3JUWA 2KCWA 2QECA 5GCNA 4KOVA 1YREA 1S7LA 1YK3A 1S7FA 4ONUA 2FSRA 1I21A 2I79A 1YX0A 3R9EA 5H86A 4E8OA 4AVBA 1IIDA 4JD6A 4E2AA 2FE7A 4EVYA 4KVXA 1PU9A 1NE9A 4H6ZA 4FD7A 2JDDA 2VI7A 3WR7A 4PSXA 2CNMA 2FCKA 1QSTA 3FNCA 1Y9KA 4L8AA 1Q2YA 4CRYB 1I12A 1M4IA 1S3ZA 3PGPA 2WPWA 3R9GA 4ORFA 2PSWA 5F47A 5IV0A 4MY0A 1MJBA 3W91A 4UBRA 1XE4A 1Y9WA 4PSWA 1XIXA 5DWNA 1FY7A 2OU2A 1U6MA 1P0HA 4KOYA 2EUIA 4NCZA 2BL1A 4E0AA 4I49A 3H4QA 4YFJA 4R57A 4U5YA 3EC4A 4KUAA 2PR1A 3S6FA 3S6HA 4AG9A 2JDCA 1YVKA 2JLMA 3JVNA 3IGRA 2ARHA 3BJ7A 2J8NA 4CAWA 1YR0A 4KOTA 2Q0YA 2REEA 4NF1A 1CJWA 1MJAA 3P2FA 4AVAA 4JLYA 4RS2A 4AG7A 2G3AA 4F6AA 2B3UA 3V8IA 1BOBA 3R96A 1QSMA 2GIVA 2AJ6A 4HKFA 3EO4A 4R9MA 4L89A 3GYAA
chains in the Genus database with same CATH superfamily
4LQGA 3T90A 4P6YA 1KUVA 5A28A 5IB0A 2VBQA 2HUZA 3GIUA 2YNCC 3RBUA 5IX3A 4NGNA 5DWMA 5D29A 1KUYA 2PR8A 4FBEA 3KL9A 3D4UA 4H2KA 1CM0A 1M4GA 2IJZA 2NMTA 3GB0A 3KQZA 4HPSA 4UWIA 4CAEA 5JQ4A 1N71A 2ZW4A 3FEEA 1YW6A 3DLJA 1X12A 4UCMA 3NFZA 2P6FA 4O23A 2B4DA 3KHXA 4F0YA 2PJ6A 2PIYA 1BPMA 2EBJA 3KZWA 1M1DA 2ZEGA 3TO6A 1YQEA 1Q7LA 3F0AA 5JM6A 4CAVA 3CPAA 4P4IA 2B3VA 3VH9A 4P44A 2AFUA 2AFWA 1XMBA 2GANA 4J3GA 3TCVA 2JEVA 3S6GA 3DDDA 3E0KA 5J8CA 3H8FA 2CF4A 3D7HA 4P10A 5LYDA 3UY5A 4A94A 1BO4A 2QYVA 4NFRA 3G8WA 3WC6A 4CYQA 2VZYA 3LWUA 2PRQA 4NJQA 5D8NA 1LAPA 5HVGA 2EVNA 1JQGA 2PE3A 3MN8A 4F9UA 3WABA 1F2PA 2A4NA 3N7ZA 4PQAA 2Z0ZA 1TKFA 3CXQA 4II9A 4WWVA 1TKJA 1ZLHA 2B4DB 3GLJA 4A37A 4B5OA 2XEFA 5C82A 4DYOA 2EO8A 3PB7X 2K5TA 2B4BA 3PZJA 4ZY0A 4MMOA 4U9ZA 1XMTA 2HQYA 4UEFA 4ZBGA 2BO9A 2ZW5A 2WPXA 3FYNA 2PIZA 1RO5A 3C26A 3TT2A 2GLJA 1YSJA 3QB8A 5LYIA 1NMTA 4MFJA 4MCRA 3TFYA 2Q04A 4JXQA 4MCPA 2ZEPA 1QMUA 2V8VA 4R3KA 2D4PA 1V0CA 4NEXA 2OZUA 1F2OA 1XEBA 3ZZIA 3TO9A 1OZPA 2PVWA 4CYOA 3T9YA 4ONWA 3SHPA 2C27A 2QVPA 4QBJA 2Q4VA 1PCAA 1RXTA 4CS0B 1AUGA 3FMCA 1R57A 4CYNA 1I1DA 3NH8A 2PVVA 1S5KA 4Y49B 4YGOA 2ZELA 3KKWA 4JWPA 4BD9A 1VHOA 4UIBA 1ZG7A 4CGPA 2DPSA 4Q38A 4OC5A 2GU2A 4FAIA 2ZOFA 1IICA 2B58A 4XPDC 3TOAA 1QSRA 2ANPA 2RB7A 3QAHA 4HNXB 3FB3A 4PXBA 5CNPA 1Z5RA 2PJBA 2H5MA 2O28A 1BPNA 1SQHA 3GUXA 3SI2A 1LCPA 5LYFA 1ELLP 1YGHA 1ZLIA 2I3CA 3B35A 5KTDA 3SJFA 4DNCA 2QJ8A 3WC7A 3RZAA 4IUSA 3SXOA 3DGVA 3FF3A 3IO1A 2Q44A 2PDOA 3L2NA 4KUBA 2F8HA 5E96A 4F8ZA 4Q7AA 1CX8A 2WUUA 3F5BA 5JPHA 4OADA 3CDXA 4BINA 3CPXA 4PK3A 3KQXA 3QNVA 3SJEA 5K8NA 4FD4A 2C6GA 2RFHA 2IMOA 4QVTA 3MRUA 4KVME 4KSAA 4P4BA 4IK2A 1M44A 4R7MA 3W6XA 1L0CA 1BLLE 1A2ZA 1VHSA 1CG2A 5K8OA 1AMPA 4MHZA 4A38A 2GFQA 4OIWA 4X2TA 4XPLA 4CGNA 4MCQA 5LYLA 4KOSA 3CZXA 2DXQA 3ZJ0A 2RC4A 3PEIA 3IFEA 2PJ9A 3TOBA 2Z3PA 2ZPAA 4LX9A 4AXVA 4CPAA 3VWDA 2J8RA 3LODA 4YWYA 3EY5A 3FH4A 3TTHA 3IWWA 2Z3OA 4OC1A 1QSOA 2WYRA 3IJ3A 2Q7BA 3S9LA 4KZTA 4B14A 1ON0A 2YNDA 3DR6A 4MFZA 2P6GA 3B3SA 3FXTA 4A30A 4HNWB 5LRJA 1DE4C 2X7BA 4MBUA 2CTBA 3SXNA 4CGLA 1HDQA 2CNSA 2ODFA 4KSFA 4UCPA 2QIRA 1GHEA 3FECA 4K30A 5CPAA 3PBEA 2FL4A 4X3RA 4MI4A 1B6BA 3P2HA 3TO7A 2PJ0A 1XOVA 2WZNA 1Q2DA 3FIXA 4MY3A 2YNCA 2AFXA 4C68A 2PQ8A 2Q7SA 2VL1A 3D68A 3IU1A 2AFOA 4KOXA 4KVOE 4UEZA 4YRHA 5JH9A 4P4FA 3PB9X 3D7GA 3B8GA 3GY9A 3FEDA 4OMEA 2B5GA 4M6GA 2GE3A 2R7HA 3B2YA 4HNYB 3EFAA 4DUKA 3OWCA 1PUAA 2CNTA 1Z4EA 4FD5A 1XF8A 4YU9A 2P6EA 2BUEA 4A39A 1MK4A 4JXRA 4KORA 1M4LA 4NSQA 4XNHB 1EE3P 4JZ0A 1R3NA 3PBBA 2P0WA 2EK8A 4KOUA 2Q51A 4ZX9A 3LACA 4NGSA 1FNOA 3D3SA 1IOFA 1K4JA 1IY7A 4WJBA 3HLPA 3MGDA 4NGQA 4A31A 1Z8TA 5F49A 3D67A 5J8FA 5KTAA 1F57A 1LFWA 2AFZA 4CYPA 5HVHA 4OP4A 1Z9UA 3KGQA 1LOKA 3SI0A 2QMLA 1BAVA 4KSIA 4QUSA 4H89A 4UCNA 4M85A 4NGRA 1KWMA 4KLWA 4CGOA 4M3SA 2PJAA 1VGYA 4CGMA 3S9NA 2OB0A 2PJ4A 2REFA 4CAFA 2DF5A 2FVGA 4R3LA 3TC8A 2ZEMA 5F48A 2G9DA 4W9YA 2Q4ZA 5A27A 1YLEA 4FWUA 4MJ8A 4MHNA 4P4JA 2AE6A 3FBUA 4EFDA 4MCSA 2PJ2A 2ZW7A 4LUAA 1QQ9A 4OC3A 4ZGYB 5CBMA 2D4OA 4EWTA 2OZHA 3B3VA 5HH1A 5AG4A 4MFQA 4NGMA 2VEZA 5THWA 4OIDA 1LRZA 4LQ6A 5DS0A 1Y0RA 2O4HA 5BWAB 2CY2A 4JJXA 5G1ZA 1J4JA 3FJUA 3KR4A 4UFXA 4RI1A 1Y7RA 1HDUA 3F8KA 4A95A 3K2KA 3CXPA 3PP9A 4FD6A 3DNSA 2V77A 1IOIA 5HVFA 1YLOA 3VWEA 2PRBA 3BLNA 1CPXA 3ISXA 4MRIA 2B5GB 1ARMA 3KHZA 1CPSA 1KUXA 2R98A 3D2PA 2FXFA 3R9FA 3PB4X 5HMNA 4MHYA 3GKRA 3BJ8A 4MHPA 1ELMP 2XEJA 3H8EA 1IB1E 3FX6A 1Q2CA 3D66A 5AGEA 2FS5A 1IYKA 2BSWA 2O53A 2I00A 2VQYA 5HXDA 2ZW6A 4M6HA 1TIQA 4PV6A 2ZENA 3FRMA 3B3WA 2F5IA 2IL4A 2PC1A 4R87A 4UWJA 3S6KA 3B7IA 5K8PA 4QC6A 2DPTA 4C7HA 4GXHA 3WT4A 3NE8A 1XBUA 3R95A 4B5PA 7CPAA 2AFSA 4AVCA 3D8PA 1PYTB 1NSLA 3RAMA 1XJOA 1Z4RA 2G3TA 1TKHA 4U9YA 2ATRA 2Q43A 1UWYA 2ZXVA 3PFOA 5H84A 4MFKA 4ZYQA 2ZEDA 4C2YA 1VKCA 5EBVA 5EC4A 4P4EA 5J1QA 1KZFA 1XRYA 3LD2A 4R76A 3RO0A 5C88A 2J9AA 2Z10A 2PJ3A 3H8GA 4OLLA 1UFHA 2BEIA 3IWEA 4XPKA 3W6SA 4KOWA 1HEEA 1Y0YA 4OKOA 2WSAA 1S60A 5FVJA 3DSBA 1H8LA 1WWZA 4PK2A 4Q36A 1VIXA 1FT7A 4XNHC 2J8MA 2POKA 2XEIA 4CRZB 3SJGA 1TF8A 2ZEOA 1YVOA 2OH1A 4OAEA 2FT0A 1GYTA 3NH5A 4UIAA 4IF5A 3PRTA 3D2MA 1JWQA 3IC1A 4UFWA 2EWBA 3A9LA 3FVLA 2G0BA 3EXNA 3IWGA 3NE7A 2BOAA 3CT9A 2JBJA 2PJ8A 1QSNA 2Z11A 4ZX8A 4UA3A 3CXSA 4NXYA 2FIAA 2FIWA 1AYEA 3RYOA 5F09A 4X5KA 3ISZA 3R1KA 5IB9A 4PPZA 1TXRA 3IIBA 5F46A 4EMEA 1IYLA 5AG7A 3K9UA 4CAXA 3N5FA 2Z3KA 3D7DA 3TE4A 2OR4A 2C6PA 1P4NA 2NSMA 3PFEA 1R43A 1ZG9A 4BMHA 2OZGA 5ISVA 2HV2A 4IAVA 4AB7A 1ZO0A 2CTCA 3DR8A 3BI0A 3G3SA 3HUVA 2R8VA 3BI1A 2GLFA 2VZZA 4ZY1A 1B87A 1LANA 1Z2LA 1LAMA 3I3GA 3B3CA 3LMSA 4GS4A 3TX8A 4XPDB 4A33A 4B6ZA 4RN7A 1Z8XA 2VXKA 5KTCA 1S7KA 1S7NA 2Q4YA 1CP7A 4QB9A 1M4DA 4MFLA 3WC5A 2V8GA 4IHMA 4MHDA 1MJ9A 4Y49C 4G1PA 4H6UA 3KI9A 3D7FA 3I9SA 2Y0MA 4B5PB 5I0CA 2NYQA 1WK4A 4KLVA 4OC0A 2R1IA 3JUWA 1Z8WA 2KCWA 4TWEA 2QECA 2Z3LA 5LRKA 3BHXA 4NGTA 1XFOA 5AG6A 5GCNA 4X8IA 2PCUA 4KOVA 1YREA 1S7LA 1YK3A 2JEWA 1S7FA 4ONUA 2FSRA 1I21A 2I79A 4P45A 1YX0A 2OOTA 4A32A 4NJRA 3R9EA 5I4MA 5H86A 4E8OA 4FUUA 5ELYA 4AVBA 3T8WA 1IIDA 4JD6A 3KASA 5G22A 4E2AA 2FE7A 4EVYA 2ZEFA 3QAYA 4KVXA 4B10A 2BCOA 4TNUA 1PU9A 3IEHA 1Z8LA 1NE9A 4H6ZA 4B11A 4FD7A 2ZEEA 2JDDA 2VI7A 2DEAA 4UEEA 3H5ZA 3SJXA 4PSXA 3WR7A 2CNMA 3S9MA 2FCKA 1NSAA 5G20A 4C7IA 1QSTA 4UF4A 3FNCA 1Y9KA 3I1UA 4L8AA 1IGBA 1Q2YA 4PXCA 1I12A 2YGWA 4CRYB 1M4IA 1ARLA 1S3ZA 3PGPA 1Y7EA 1IU8A 4P4DA 3VARA 2PJ1A 2GREA 2WPWA 3NA6A 3R9GA 4OC2A 4ORFA 4BBHA 3IU2A 2PSWA 5F47A 5IV0A 4MY0A 2Z3MA 1MJBA 4PXEA 3W91A 4UBRA 1XE4A 1Y9WA 4PSWA 5AG5A 1XIXA 5DWNA 1FY7A 3RNZA 2OU2A 5K8MA 4R8FA 1U6MA 4MFPA 2C6CA 2F7VA 1P0HA 4KOYA 3PB8X 2ABZA 2EUIA 4Z65A 1ZG8A 2HB6A 4C2ZA 3V7ZA 4NCZA 4PXDA 1CP6A 2BL1A 4I49A 4E0AA 2JBKA 2V8DA 2PJ7A 5G21A 2PJ5A 4C2XA 3B3TA 3H4QA 1VHEA 4YFJA 4R57A 3BXMA 1X10A 4U5YA 3KR5A 3JTKA 3EC4A 3NH4A 2EK9A 2HC9A 2PR1A 4GM5A 4KUAA 3S6FA 2V8HA 4B12A 3S6HA 4AG9A 3V38A 2JDCA 4B13A 4M6IA 8CPAA 4MXUA 1OBRA 4OC4A 1YVKA 2AFMA 5JGFA 5EMIA 3PB6X 6CPAA 3JRUA 2ZEHA 2JLMA 3JVNA 1YMEA 3IGRA 2CIJA 2ARHA 2YNEA 3BJ7A 2J8NA 4CAWA 4DJLA 2Z3NA 4NGPA 1YR0A 4KOTA 4F9VA 2Q0YA 4K3NA 2REEA 4ZI6A 4NF1A 1CJWA 3SI1A 1CBXA 4ZY2A 1MJAA 3P2FA 4UFVA 4AVAA 2PJCA 4JLYA 4RS2A 4AG7A 4F0XA 4JYWA 3VATA 3K9TA 2CXAA 4R6TA 2G3AA 2XEGA 4F6AA 2B3UA 3V8IA 5LRGA 4KS9A 1BOBA 4A2ZA 3R96A 1QSMA 2C1CA 2GIVA 2AJ6A 1TF9A 2IQ6A 1RTQA 1YW4A 2ZOGA 4HKFA 3EO4A 4R9MA 1DTDA 4L89A 4RUHA 3GYAA
chains in the Genus database with same CATH topology
3T90A 1KUVA 5A28A 5IB0A 2VBQA 2HUZA 2YNCC 5IX3A 5DWMA 1KUYA 2PR8A 1CM0A 1M4GA 2NMTA 4UWIA 5JQ4A 4CAEA 1N71A 2ZW4A 4UCMA 2P6FA 4F0YA 2B4DA 1M1DA 3TO6A 3F0AA 4CAVA 2B3VA 2GANA 4J3GA 3TCVA 2JEVA 3S6GA 3DDDA 3E0KA 5J8CA 3UY5A 1BO4A 3G8WA 4CYQA 2VZYA 2EVNA 2A4NA 3N7ZA 2Z0ZA 3CXQA 4II9A 2B4DB 4B5OA 5C82A 2K5TA 2B4BA 3PZJA 4U9ZA 1XMTA 2HQYA 4ZBGA 2ZW5A 2WPXA 3FYNA 3C26A 1RO5A 3TT2A 3QB8A 1NMTA 4MFJA 3TFYA 2Q04A 4JXQA 4R3KA 2D4PA 4L89A 1V0CA 4NEXA 2OZUA 1XEBA 3ZZIA 3TO9A 1OZPA 4CYOA 3T9YA 3SHPA 2C27A 4QBJA 2Q4VA 1RXTA 4CS0B 1R57A 4CYNA 1I1DA 1S5KA 4Y49B 4YGOA 3KKWA 4JWPA 4CGPA 2DPSA 4Q38A 1IICA 2B58A 4XPDC 3TOAA 1QSRA 4HNXB 3QAHA 3FB3A 5CNPA 2H5MA 2O28A 1SQHA 1YGHA 5KTDA 4DNCA 4IUSA 3SXOA 2Q44A 2PDOA 4KUBA 5E96A 2WUUA 3F5BA 5JPHA 4OADA 4PK3A 4FD4A 4QVTA 4KVME 4KSAA 1M44A 3W6XA 1L0CA 1VHSA 4CGNA 4XPLA 4KOSA 2DXQA 3ZJ0A 2RC4A 3TOBA 2Z3PA 2ZPAA 4LX9A 3VWDA 2J8RA 3LODA 3EY5A 3TTHA 2Z3OA 1QSOA 2Q7BA 4KZTA 4B14A 1ON0A 2YNDA 3DR6A 4MFZA 2P6GA 3FXTA 4A30A 4HNWB 2X7BA 4MBUA 3SXNA 4CGLA 2CNSA 4KSFA 4UCPA 2QIRA 1GHEA 4K30A 2FL4A 4MI4A 1B6BA 3P2HA 3TO7A 1Q2DA 3FIXA 4MY3A 2YNCA 4C68A 2PQ8A 3IU1A 4KOXA 4KVOE 4YRHA 3B8GA 3GY9A 2B5GA 4HNYB 2GE3A 2R7HA 3EFAA 3OWCA 1PUAA 2CNTA 1Z4EA 4FD5A 1XF8A 2P6EA 2BUEA 1MK4A 4JXRA 4KORA 4NSQA 4XNHB 2P0WA 4KOUA 3D3SA 1K4JA 3MGDA 4A31A 5F49A 5J8FA 5KTAA 4CYPA 1Z9UA 2QMLA 4QUSA 4H89A 4UCNA 4M85A 4KLWA 4CGOA 4M3SA 4CGMA 2OB0A 2REFA 4CAFA 4R3LA 5F48A 5A27A 1YLEA 4MJ8A 2AE6A 3FBUA 2ZW7A 4LUAA 4ZGYB 2D4OA 2OZHA 5HH1A 5AG4A 4MFQA 2VEZA 1LRZA 5BWAB 2CY2A 4JJXA 5G1ZA 1J4JA 4UFXA 4RI1A 1Y7RA 3F8KA 4A95A 3CXPA 3PP9A 4FD6A 3DNSA 3VWEA 2PRBA 3BLNA 2B5GB 1KUXA 3D2PA 2R98A 2FXFA 3R9FA 5HMNA 3GKRA 3BJ8A 1IB1E 1Q2CA 5AGEA 2FS5A 1IYKA 2BSWA 2I00A 2VQYA 2ZW6A 1TIQA 4PV6A 3FRMA 2F5IA 2IL4A 2PC1A 4R87A 4UWJA 3S6KA 4QC6A 2DPTA 4C7HA 3R95A 4B5PA 4AVCA 3D8PA 1NSLA 1Z4RA 2G3TA 4U9YA 2ATRA 2ZXVA 5H84A 4MFKA 4C2YA 1VKCA 5EBVA 5EC4A 1KZFA 3LD2A 5C88A 2Z10A 4OLLA 1UFHA 2BEIA 3IWEA 4XPKA 3W6SA 4KOWA 2WSAA 1S60A 5FVJA 3DSBA 1WWZA 4PK2A 4Q36A 4XNHC 2J8MA 4CRZB 1YVOA 2OH1A 4OAEA 2FT0A 4IF5A 4UFWA 3D2MA 3A9LA 2G0BA 3EXNA 3IWGA 3NE7A 2Z11A 1QSNA 4UA3A 3CXSA 4NXYA 2FIAA 2FIWA 3RYOA 4X5KA 3R1KA 5F46A 1IYLA 5AG7A 3K9UA 4CAXA 3TE4A 2Z3KA 1P4NA 4BMHA 5ISVA 2OZGA 2HV2A 4AB7A 1ZO0A 3DR8A 3G3SA 2R8VA 2VZZA 1B87A 4GS4A 3I3GA 4XPDB 4A33A 2VXKA 5KTCA 1S7KA 1S7NA 2Q4YA 4QB9A 1M4DA 4MFLA 4MHDA 4Y49C 1MJ9A 4H6UA 3I9SA 4B5PB 2Y0MA 5I0CA 1WK4A 4KLVA 2R1IA 3JUWA 2KCWA 2QECA 2Z3LA 5AG6A 5GCNA 4KOVA 1YREA 1S7LA 1YK3A 1S7FA 4ONUA 2FSRA 1I21A 2I79A 4A32A 1YX0A 3R9EA 5H86A 4E8OA 4AVBA 1IIDA 4JD6A 5G22A 4E2AA 2FE7A 4EVYA 4KVXA 4B10A 1PU9A 1NE9A 4H6ZA 4B11A 4FD7A 2JDDA 2VI7A 3H5ZA 3WR7A 4PSXA 2CNMA 2FCKA 5G20A 4C7IA 1QSTA 3FNCA 4L8AA 1Y9KA 1Q2YA 4CRYB 1I12A 2YGWA 1M4IA 1S3ZA 3PGPA 2WPWA 3R9GA 4ORFA 4BBHA 3IU2A 2PSWA 5F47A 5IV0A 4MY0A 2Z3MA 1MJBA 3W91A 4UBRA 1XE4A 1Y9WA 4PSWA 5AG5A 1XIXA 5DWNA 1FY7A 2OU2A 1U6MA 1P0HA 4KOYA 2EUIA 4C2ZA 4NCZA 2BL1A 4E0AA 4I49A 5G21A 4C2XA 3H4QA 4YFJA 4R57A 4U5YA 3JTKA 3EC4A 4KUAA 2PR1A 3S6FA 4B12A 3S6HA 4AG9A 2JDCA 4B13A 1YVKA 2JLMA 3JVNA 3IGRA 2ARHA 2YNEA 3BJ7A 2J8NA 4CAWA 2Z3NA 1YR0A 4KOTA 2Q0YA 2REEA 4NF1A 1CJWA 1MJAA 3P2FA 4UFVA 4AVAA 4JLYA 4RS2A 4AG7A 4F0XA 2CXAA 2G3AA 4F6AA 2B3UA 3V8IA 4KS9A 1BOBA 4A2ZA 3R96A 1QSMA 2GIVA 2AJ6A 4HKFA 3EO4A 4R9MA 4MFPA 3GYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T90 A;  1KUV A;  5IB0 A;  2VBQ A;  2HUZ A;  5IX3 A;  5DWM A;  1KUY A;  2PR8 A;  1CM0 A;  1M4G A;  2NMT A;  4UWI A;  5JQ4 A;  1N71 A;  2ZW4 A;  2P6F A;  4F0Y A;  2B4D A;  1M1D A;  3TO6 A;  3F0A A;  4CAV A;  2B3V A;  2GAN A;  4J3G A;  3TCV A;  2JEV A;  3S6G A;  3DDD A;  3E0K A;  5J8C A;  3UY5 A;  1BO4 A;  3G8W A;  2VZY A;  2EVN A;  2A4N A;  3N7Z A;  2Z0Z A;  3CXQ A;  4II9 A;  2B4D B;  4B5O A;  5C82 A;  2K5T A;  2B4B A;  3PZJ A;  4U9Z A;  1XMT A;  2HQY A;  4ZBG A;  2ZW5 A;  2WPX A;  3FYN A;  3C26 A;  1RO5 A;  3TT2 A;  3QB8 A;  1NMT A;  3TFY A;  2Q04 A;  4JXQ A;  4R3K A;  2D4P A;  1V0C A;  4NEX A;  2OZU A;  1XEB A;  3ZZI A;  3TO9 A;  1OZP A;  3T9Y A;  3SHP A;  2C27 A;  4QBJ A;  2Q4V A;  1RXT A;  4CS0 B;  1R57 A;  1I1D A;  1S5K A;  4Y49 B;  4YGO A;  3KKW A;  4JWP A;  1IIC A;  2B58 A;  4XPD C;  3TOA A;  1QSR A;  4HNX B;  3QAH A;  3FB3 A;  5CNP A;  2H5M A;  2O28 A;  1SQH A;  1YGH A;  5KTD A;  4DNC A;  4IUS A;  3SXO A;  2Q44 A;  2PDO A;  4KUB A;  5E96 A;  3F5B A;  5JPH A;  4OAD A;  4PK3 A;  4FD4 A;  4QVT A;  4KVM E;  1M44 A;  3W6X A;  1L0C A;  1VHS A;  4XPL A;  4KOS A;  2DXQ A;  3ZJ0 A;  2RC4 A;  3TOB A;  2ZPA A;  4LX9 A;  3VWD A;  2J8R A;  3LOD A;  3EY5 A;  3TTH A;  1QSO A;  2Q7B A;  4KZT A;  1ON0 A;  3DR6 A;  2P6G A;  3FXT A;  4HNW B;  2X7B A;  4MBU A;  3SXN A;  2CNS A;  2QIR A;  1GHE A;  4K30 A;  2FL4 A;  4MI4 A;  1B6B A;  3P2H A;  3TO7 A;  1Q2D A;  4MY3 A;  3FIX A;  2PQ8 A;  4KOX A;  4KVO E;  4YRH A;  3B8G A;  3GY9 A;  2B5G A;  2GE3 A;  2R7H A;  4HNY B;  3EFA A;  3OWC A;  1PUA A;  2CNT A;  1Z4E A;  4FD5 A;  1XF8 A;  2P6E A;  2BUE A;  1MK4 A;  4JXR A;  4KOR A;  4NSQ A;  4XNH B;  2P0W A;  4KOU A;  3D3S A;  1K4J A;  3MGD A;  5F49 A;  5J8F A;  5KTA A;  1Z9U A;  2QML A;  4QUS A;  4H89 A;  4M85 A;  4KLW A;  4M3S A;  2OB0 A;  2REF A;  4R3L A;  5F48 A;  1YLE A;  4MJ8 A;  2AE6 A;  3FBU A;  2ZW7 A;  4LUA A;  2D4O A;  2OZH A;  5HH1 A;  2VEZ A;  1LRZ A;  2CY2 A;  4JJX A;  1J4J A;  4RI1 A;  1Y7R A;  3F8K A;  3CXP A;  3PP9 A;  4FD6 A;  3DNS A;  3VWE A;  2PRB A;  3BLN A;  2B5G B;  1KUX A;  3D2P A;  2R98 A;  2FXF A;  3R9F A;  5HMN A;  3GKR A;  3BJ8 A;  1IB1 E;  1Q2C A;  2FS5 A;  1IYK A;  2BSW A;  2I00 A;  2VQY A;  2ZW6 A;  1TIQ A;  4PV6 A;  3FRM A;  2F5I A;  2IL4 A;  2PC1 A;  4R87 A;  4UWJ A;  3S6K A;  4QC6 A;  3R95 A;  4B5P A;  4AVC A;  3D8P A;  1NSL A;  1Z4R A;  2G3T A;  4U9Y A;  2ATR A;  2ZXV A;  5H84 A;  1VKC A;  5EBV A;  5EC4 A;  1KZF A;  3LD2 A;  5C88 A;  2Z10 A;  4OLL A;  1UFH A;  2BEI A;  4XPK A;  3W6S A;  4KOW A;  1S60 A;  5FVJ A;  3DSB A;  1WWZ A;  4PK2 A;  4XNH C;  2J8M A;  4CRZ B;  1YVO A;  2OH1 A;  4OAE A;  2FT0 A;  4IF5 A;  3D2M A;  2G0B A;  3EXN A;  3IWG A;  3NE7 A;  2Z11 A;  1QSN A;  4UA3 A;  3CXS A;  4NXY A;  2FIA A;  2FIW A;  3RYO A;  4X5K A;  3R1K A;  5F46 A;  1IYL A;  3K9U A;  4CAX A;  3TE4 A;  1P4N A;  4BMH A;  5ISV A;  2OZG A;  2HV2 A;  4AB7 A;  3DR8 A;  3G3S A;  2R8V A;  2VZZ A;  1B87 A;  4GS4 A;  3I3G A;  4XPD B;  2VXK A;  5KTC A;  1S7K A;  1S7N A;  2Q4Y A;  4QB9 A;  1M4D A;  4MHD A;  4Y49 C;  1MJ9 A;  4H6U A;  3I9S A;  4B5P B;  2Y0M A;  5I0C A;  1WK4 A;  4KLV A;  2R1I A;  3JUW A;  2KCW A;  2QEC A;  5GCN A;  4KOV A;  1YRE A;  1S7L A;  1YK3 A;  1S7F A;  4ONU A;  2FSR A;  1I21 A;  2I79 A;  1YX0 A;  3R9E A;  5H86 A;  4E8O A;  4AVB A;  1IID A;  4JD6 A;  4E2A A;  2FE7 A;  4EVY A;  4KVX A;  1PU9 A;  1NE9 A;  4H6Z A;  4FD7 A;  2JDD A;  2VI7 A;  3WR7 A;  4PSX A;  2CNM A;  2FCK A;  1QST A;  3FNC A;  1Y9K A;  4L8A A;  1Q2Y A;  4CRY B;  1I12 A;  1M4I A;  1S3Z A;  3PGP A;  2WPW A;  3R9G A;  4ORF A;  2PSW A;  5F47 A;  5IV0 A;  4MY0 A;  1MJB A;  3W91 A;  4UBR A;  1XE4 A;  1Y9W A;  4PSW A;  1XIX A;  5DWN A;  1FY7 A;  2OU2 A;  1U6M A;  1P0H A;  4KOY A;  2EUI A;  4NCZ A;  2BL1 A;  4E0A A;  4I49 A;  3H4Q A;  4YFJ A;  4R57 A;  4U5Y A;  3EC4 A;  4KUA A;  2PR1 A;  3S6F A;  3S6H A;  4AG9 A;  2JDC A;  1YVK A;  2JLM A;  3JVN A;  3IGR A;  2ARH A;  3BJ7 A;  2J8N A;  4CAW A;  1YR0 A;  4KOT A;  2Q0Y A;  2REE A;  4NF1 A;  1CJW A;  1MJA A;  3P2F A;  4AVA A;  4JLY A;  4RS2 A;  4AG7 A;  2G3A A;  4F6A A;  2B3U A;  3V8I A;  1BOB A;  3R96 A;  1QSM A;  2GIV A;  2AJ6 A;  4HKF A;  3EO4 A;  4R9M A;  4L89 A;  3GYA A; 
#chains in the Genus database with same CATH topology
 4LQG A;  3T90 A;  4P6Y A;  1KUV A;  5A28 A;  5IB0 A;  2VBQ A;  2HUZ A;  3GIU A;  2YNC C;  3RBU A;  5IX3 A;  4NGN A;  5DWM A;  5D29 A;  1KUY A;  2PR8 A;  4FBE A;  3KL9 A;  3D4U A;  4H2K A;  1CM0 A;  1M4G A;  2IJZ A;  2NMT A;  3GB0 A;  3KQZ A;  4HPS A;  4UWI A;  4CAE A;  5JQ4 A;  1N71 A;  2ZW4 A;  3FEE A;  1YW6 A;  3DLJ A;  1X12 A;  4UCM A;  3NFZ A;  2P6F A;  4O23 A;  2B4D A;  3KHX A;  4F0Y A;  2PJ6 A;  2PIY A;  1BPM A;  2EBJ A;  3KZW A;  1M1D A;  2ZEG A;  3TO6 A;  1YQE A;  1Q7L A;  3F0A A;  5JM6 A;  4CAV A;  3CPA A;  4P4I A;  2B3V A;  3VH9 A;  4P44 A;  2AFU A;  2AFW A;  1XMB A;  2GAN A;  4J3G A;  3TCV A;  2JEV A;  3S6G A;  3DDD A;  3E0K A;  5J8C A;  3H8F A;  2CF4 A;  3D7H A;  4P10 A;  5LYD A;  3UY5 A;  4A94 A;  1BO4 A;  2QYV A;  4NFR A;  3G8W A;  3WC6 A;  4CYQ A;  2VZY A;  3LWU A;  2PRQ A;  4NJQ A;  5D8N A;  1LAP A;  5HVG A;  2EVN A;  1JQG A;  2PE3 A;  3MN8 A;  4F9U A;  3WAB A;  1F2P A;  2A4N A;  3N7Z A;  4PQA A;  2Z0Z A;  1TKF A;  3CXQ A;  4II9 A;  4WWV A;  1TKJ A;  1ZLH A;  2B4D B;  3GLJ A;  4A37 A;  4B5O A;  2XEF A;  5C82 A;  4DYO A;  2EO8 A;  3PB7 X;  2K5T A;  2B4B A;  3PZJ A;  4ZY0 A;  4MMO A;  4U9Z A;  1XMT A;  2HQY A;  4UEF A;  4ZBG A;  2BO9 A;  2ZW5 A;  2WPX A;  3FYN A;  2PIZ A;  1RO5 A;  3C26 A;  3TT2 A;  2GLJ A;  1YSJ A;  3QB8 A;  5LYI A;  1NMT A;  4MFJ A;  4MCR A;  3TFY A;  2Q04 A;  4JXQ A;  4MCP A;  2ZEP A;  1QMU A;  2V8V A;  4R3K A;  2D4P A;  1V0C A;  4NEX A;  2OZU A;  1F2O A;  1XEB A;  3ZZI A;  3TO9 A;  1OZP A;  2PVW A;  4CYO A;  3T9Y A;  4ONW A;  3SHP A;  2C27 A;  2QVP A;  4QBJ A;  2Q4V A;  1PCA A;  1RXT A;  4CS0 B;  1AUG A;  3FMC A;  1R57 A;  4CYN A;  1I1D A;  3NH8 A;  2PVV A;  1S5K A;  4Y49 B;  4YGO A;  2ZEL A;  3KKW A;  4JWP A;  4BD9 A;  1VHO A;  4UIB A;  1ZG7 A;  4CGP A;  2DPS A;  4Q38 A;  4OC5 A;  2GU2 A;  4FAI A;  2ZOF A;  1IIC A;  2B58 A;  4XPD C;  3TOA A;  1QSR A;  2ANP A;  2RB7 A;  3QAH A;  4HNX B;  3FB3 A;  4PXB A;  5CNP A;  1Z5R A;  2PJB A;  2H5M A;  2O28 A;  1BPN A;  1SQH A;  3GUX A;  3SI2 A;  1LCP A;  5LYF A;  1ELL P;  1YGH A;  1ZLI A;  2I3C A;  3B35 A;  5KTD A;  3SJF A;  4DNC A;  2QJ8 A;  3WC7 A;  3RZA A;  4IUS A;  3SXO A;  3DGV A;  3FF3 A;  3IO1 A;  2Q44 A;  2PDO A;  3L2N A;  4KUB A;  2F8H A;  5E96 A;  4F8Z A;  4Q7A A;  1CX8 A;  2WUU A;  3F5B A;  5JPH A;  4OAD A;  3CDX A;  4BIN A;  3CPX A;  4PK3 A;  3KQX A;  3QNV A;  3SJE A;  5K8N A;  4FD4 A;  2C6G A;  2RFH A;  2IMO A;  4QVT A;  3MRU A;  4KVM E;  4KSA A;  4P4B A;  4IK2 A;  1M44 A;  4R7M A;  3W6X A;  1L0C A;  1BLL E;  1A2Z A;  1VHS A;  1CG2 A;  5K8O A;  1AMP A;  4MHZ A;  4A38 A;  2GFQ A;  4OIW A;  4X2T A;  4XPL A;  4CGN A;  4MCQ A;  5LYL A;  4KOS A;  3CZX A;  2DXQ A;  3ZJ0 A;  2RC4 A;  3PEI A;  3IFE A;  2PJ9 A;  3TOB A;  2Z3P A;  2ZPA A;  4LX9 A;  4AXV A;  4CPA A;  3VWD A;  2J8R A;  3LOD A;  4YWY A;  3EY5 A;  3FH4 A;  3TTH A;  3IWW A;  2Z3O A;  4OC1 A;  1QSO A;  2WYR A;  3IJ3 A;  2Q7B A;  3S9L A;  4KZT A;  4B14 A;  1ON0 A;  2YND A;  3DR6 A;  4MFZ A;  2P6G A;  3B3S A;  3FXT A;  4A30 A;  4HNW B;  5LRJ A;  1DE4 C;  2X7B A;  4MBU A;  2CTB A;  3SXN A;  4CGL A;  1HDQ A;  2CNS A;  2ODF A;  4KSF A;  4UCP A;  2QIR A;  1GHE A;  3FEC A;  4K30 A;  5CPA A;  3PBE A;  2FL4 A;  4X3R A;  4MI4 A;  1B6B A;  3P2H A;  3TO7 A;  2PJ0 A;  1XOV A;  2WZN A;  1Q2D A;  3FIX A;  4MY3 A;  2YNC A;  2AFX A;  4C68 A;  2PQ8 A;  2Q7S A;  2VL1 A;  3D68 A;  3IU1 A;  2AFO A;  4KOX A;  4KVO E;  4UEZ A;  4YRH A;  5JH9 A;  4P4F A;  3PB9 X;  3D7G A;  3B8G A;  3GY9 A;  3FED A;  4OME A;  2B5G A;  4M6G A;  2GE3 A;  2R7H A;  3B2Y A;  4HNY B;  3EFA A;  4DUK A;  3OWC A;  1PUA A;  2CNT A;  1Z4E A;  4FD5 A;  1XF8 A;  4YU9 A;  2P6E A;  2BUE A;  4A39 A;  1MK4 A;  4JXR A;  4KOR A;  1M4L A;  4NSQ A;  4XNH B;  1EE3 P;  4JZ0 A;  1R3N A;  3PBB A;  2P0W A;  2EK8 A;  4KOU A;  2Q51 A;  4ZX9 A;  3LAC A;  4NGS A;  1FNO A;  3D3S A;  1IOF A;  1K4J A;  1IY7 A;  4WJB A;  3HLP A;  3MGD A;  4NGQ A;  4A31 A;  1Z8T A;  5F49 A;  3D67 A;  5J8F A;  5KTA A;  1F57 A;  1LFW A;  2AFZ A;  4CYP A;  5HVH A;  4OP4 A;  1Z9U A;  3KGQ A;  1LOK A;  3SI0 A;  2QML A;  1BAV A;  4KSI A;  4QUS A;  4H89 A;  4UCN A;  4M85 A;  4NGR A;  1KWM A;  4KLW A;  4CGO A;  4M3S A;  2PJA A;  1VGY A;  4CGM A;  3S9N A;  2OB0 A;  2PJ4 A;  2REF A;  4CAF A;  2DF5 A;  2FVG A;  4R3L A;  3TC8 A;  2ZEM A;  5F48 A;  2G9D A;  4W9Y A;  2Q4Z A;  5A27 A;  1YLE A;  4FWU A;  4MJ8 A;  4MHN A;  4P4J A;  2AE6 A;  3FBU A;  4EFD A;  4MCS A;  2PJ2 A;  2ZW7 A;  4LUA A;  1QQ9 A;  4OC3 A;  4ZGY B;  5CBM A;  2D4O A;  4EWT A;  2OZH A;  3B3V A;  5HH1 A;  5AG4 A;  4MFQ A;  4NGM A;  2VEZ A;  5THW A;  4OID A;  1LRZ A;  4LQ6 A;  5DS0 A;  1Y0R A;  2O4H A;  5BWA B;  2CY2 A;  4JJX A;  5G1Z A;  1J4J A;  3FJU A;  3KR4 A;  4UFX A;  4RI1 A;  1Y7R A;  1HDU A;  3F8K A;  4A95 A;  3K2K A;  3CXP A;  3PP9 A;  4FD6 A;  3DNS A;  2V77 A;  1IOI A;  5HVF A;  1YLO A;  3VWE A;  2PRB A;  3BLN A;  1CPX A;  3ISX A;  4MRI A;  2B5G B;  1ARM A;  3KHZ A;  1CPS A;  1KUX A;  2R98 A;  3D2P A;  2FXF A;  3R9F A;  3PB4 X;  5HMN A;  4MHY A;  3GKR A;  3BJ8 A;  4MHP A;  1ELM P;  2XEJ A;  3H8E A;  1IB1 E;  3FX6 A;  1Q2C A;  3D66 A;  5AGE A;  2FS5 A;  1IYK A;  2BSW A;  2O53 A;  2I00 A;  2VQY A;  5HXD A;  2ZW6 A;  4M6H A;  1TIQ A;  4PV6 A;  2ZEN A;  3FRM A;  3B3W A;  2F5I A;  2IL4 A;  2PC1 A;  4R87 A;  4UWJ A;  3S6K A;  3B7I A;  5K8P A;  4QC6 A;  2DPT A;  4C7H A;  4GXH A;  3WT4 A;  3NE8 A;  1XBU A;  3R95 A;  4B5P A;  7CPA A;  2AFS A;  4AVC A;  3D8P A;  1PYT B;  1NSL A;  3RAM A;  1XJO A;  1Z4R A;  2G3T A;  1TKH A;  4U9Y A;  2ATR A;  2Q43 A;  1UWY A;  2ZXV A;  3PFO A;  5H84 A;  4MFK A;  4ZYQ A;  2ZED A;  4C2Y A;  1VKC A;  5EBV A;  5EC4 A;  4P4E A;  5J1Q A;  1KZF A;  1XRY A;  3LD2 A;  4R76 A;  3RO0 A;  5C88 A;  2J9A A;  2Z10 A;  2PJ3 A;  3H8G A;  4OLL A;  1UFH A;  2BEI A;  3IWE A;  4XPK A;  3W6S A;  4KOW A;  1HEE A;  1Y0Y A;  4OKO A;  2WSA A;  1S60 A;  5FVJ A;  3DSB A;  1H8L A;  1WWZ A;  4PK2 A;  4Q36 A;  1VIX A;  1FT7 A;  4XNH C;  2J8M A;  2POK A;  2XEI A;  4CRZ B;  3SJG A;  1TF8 A;  2ZEO A;  1YVO A;  2OH1 A;  4OAE A;  2FT0 A;  1GYT A;  3NH5 A;  4UIA A;  4IF5 A;  3PRT A;  3D2M A;  1JWQ A;  3IC1 A;  4UFW A;  2EWB A;  3A9L A;  3FVL A;  2G0B A;  3EXN A;  3IWG A;  3NE7 A;  2BOA A;  3CT9 A;  2JBJ A;  2PJ8 A;  1QSN A;  2Z11 A;  4ZX8 A;  4UA3 A;  3CXS A;  4NXY A;  2FIA A;  2FIW A;  1AYE A;  3RYO A;  5F09 A;  4X5K A;  3ISZ A;  3R1K A;  5IB9 A;  4PPZ A;  1TXR A;  3IIB A;  5F46 A;  4EME A;  1IYL A;  5AG7 A;  3K9U A;  4CAX A;  3N5F A;  2Z3K A;  3D7D A;  3TE4 A;  2OR4 A;  2C6P A;  1P4N A;  2NSM A;  3PFE A;  1R43 A;  1ZG9 A;  4BMH A;  2OZG A;  5ISV A;  2HV2 A;  4IAV A;  4AB7 A;  1ZO0 A;  2CTC A;  3DR8 A;  3BI0 A;  3G3S A;  3HUV A;  2R8V A;  3BI1 A;  2GLF A;  2VZZ A;  4ZY1 A;  1B87 A;  1LAN A;  1Z2L A;  1LAM A;  3I3G A;  3B3C A;  3LMS A;  4GS4 A;  3TX8 A;  4XPD B;  4A33 A;  4B6Z A;  4RN7 A;  1Z8X A;  2VXK A;  5KTC A;  1S7K A;  1S7N A;  2Q4Y A;  1CP7 A;  4QB9 A;  1M4D A;  4MFL A;  3WC5 A;  2V8G A;  4IHM A;  4MHD A;  1MJ9 A;  4Y49 C;  4G1P A;  4H6U A;  3KI9 A;  3D7F A;  3I9S A;  2Y0M A;  4B5P B;  5I0C A;  2NYQ A;  1WK4 A;  4KLV A;  4OC0 A;  2R1I A;  3JUW A;  1Z8W A;  2KCW A;  4TWE A;  2QEC A;  2Z3L A;  5LRK A;  3BHX A;  4NGT A;  1XFO A;  5AG6 A;  5GCN A;  4X8I A;  2PCU A;  4KOV A;  1YRE A;  1S7L A;  1YK3 A;  2JEW A;  1S7F A;  4ONU A;  2FSR A;  1I21 A;  2I79 A;  4P45 A;  1YX0 A;  2OOT A;  4A32 A;  4NJR A;  3R9E A;  5I4M A;  5H86 A;  4E8O A;  4FUU A;  5ELY A;  4AVB A;  3T8W A;  1IID A;  4JD6 A;  3KAS A;  5G22 A;  4E2A A;  2FE7 A;  4EVY A;  2ZEF A;  3QAY A;  4KVX A;  4B10 A;  2BCO A;  4TNU A;  1PU9 A;  3IEH A;  1Z8L A;  1NE9 A;  4H6Z A;  4B11 A;  4FD7 A;  2ZEE A;  2JDD A;  2VI7 A;  2DEA A;  4UEE A;  3H5Z A;  3SJX A;  4PSX A;  3WR7 A;  2CNM A;  3S9M A;  2FCK A;  1NSA A;  5G20 A;  4C7I A;  1QST A;  4UF4 A;  3FNC A;  1Y9K A;  3I1U A;  4L8A A;  1IGB A;  1Q2Y A;  4PXC A;  1I12 A;  2YGW A;  4CRY B;  1M4I A;  1ARL A;  1S3Z A;  3PGP A;  1Y7E A;  1IU8 A;  4P4D A;  3VAR A;  2PJ1 A;  2GRE A;  2WPW A;  3NA6 A;  3R9G A;  4OC2 A;  4ORF A;  4BBH A;  3IU2 A;  2PSW A;  5F47 A;  5IV0 A;  4MY0 A;  2Z3M A;  1MJB A;  4PXE A;  3W91 A;  4UBR A;  1XE4 A;  1Y9W A;  4PSW A;  5AG5 A;  1XIX A;  5DWN A;  1FY7 A;  3RNZ A;  2OU2 A;  5K8M A;  4R8F A;  1U6M A;  4MFP A;  2C6C A;  2F7V A;  1P0H A;  4KOY A;  3PB8 X;  2ABZ A;  2EUI A;  4Z65 A;  1ZG8 A;  2HB6 A;  4C2Z A;  3V7Z A;  4NCZ A;  4PXD A;  1CP6 A;  2BL1 A;  4I49 A;  4E0A A;  2JBK A;  2V8D A;  2PJ7 A;  5G21 A;  2PJ5 A;  4C2X A;  3B3T A;  3H4Q A;  1VHE A;  4YFJ A;  4R57 A;  3BXM A;  1X10 A;  4U5Y A;  3KR5 A;  3JTK A;  3EC4 A;  3NH4 A;  2EK9 A;  2HC9 A;  2PR1 A;  4GM5 A;  4KUA A;  3S6F A;  2V8H A;  4B12 A;  3S6H A;  4AG9 A;  3V38 A;  2JDC A;  4B13 A;  4M6I A;  8CPA A;  4MXU A;  1OBR A;  4OC4 A;  1YVK A;  2AFM A;  5JGF A;  5EMI A;  3PB6 X;  6CPA A;  3JRU A;  2ZEH A;  2JLM A;  3JVN A;  1YME A;  3IGR A;  2CIJ A;  2ARH A;  2YNE A;  3BJ7 A;  2J8N A;  4CAW A;  4DJL A;  2Z3N A;  4NGP A;  1YR0 A;  4KOT A;  4F9V A;  2Q0Y A;  4K3N A;  2REE A;  4ZI6 A;  4NF1 A;  1CJW A;  3SI1 A;  1CBX A;  4ZY2 A;  1MJA A;  3P2F A;  4UFV A;  4AVA A;  2PJC A;  4JLY A;  4RS2 A;  4AG7 A;  4F0X A;  4JYW A;  3VAT A;  3K9T A;  2CXA A;  4R6T A;  2G3A A;  2XEG A;  4F6A A;  2B3U A;  3V8I A;  5LRG A;  4KS9 A;  1BOB A;  4A2Z A;  3R96 A;  1QSM A;  2C1C A;  2GIV A;  2AJ6 A;  1TF9 A;  2IQ6 A;  1RTQ A;  1YW4 A;  2ZOG A;  4HKF A;  3EO4 A;  4R9M A;  1DTD A;  4L89 A;  4RUH A;  3GYA A; 
#chains in the Genus database with same CATH homology
 3T90 A;  1KUV A;  5A28 A;  5IB0 A;  2VBQ A;  2HUZ A;  2YNC C;  5IX3 A;  5DWM A;  1KUY A;  2PR8 A;  1CM0 A;  1M4G A;  2NMT A;  4UWI A;  5JQ4 A;  4CAE A;  1N71 A;  2ZW4 A;  4UCM A;  2P6F A;  4F0Y A;  2B4D A;  1M1D A;  3TO6 A;  3F0A A;  4CAV A;  2B3V A;  2GAN A;  4J3G A;  3TCV A;  2JEV A;  3S6G A;  3DDD A;  3E0K A;  5J8C A;  3UY5 A;  1BO4 A;  3G8W A;  4CYQ A;  2VZY A;  2EVN A;  2A4N A;  3N7Z A;  2Z0Z A;  3CXQ A;  4II9 A;  2B4D B;  4B5O A;  5C82 A;  2K5T A;  2B4B A;  3PZJ A;  4U9Z A;  1XMT A;  2HQY A;  4ZBG A;  2ZW5 A;  2WPX A;  3FYN A;  3C26 A;  1RO5 A;  3TT2 A;  3QB8 A;  1NMT A;  4MFJ A;  3TFY A;  2Q04 A;  4JXQ A;  4R3K A;  2D4P A;  4L89 A;  1V0C A;  4NEX A;  2OZU A;  1XEB A;  3ZZI A;  3TO9 A;  1OZP A;  4CYO A;  3T9Y A;  3SHP A;  2C27 A;  4QBJ A;  2Q4V A;  1RXT A;  4CS0 B;  1R57 A;  4CYN A;  1I1D A;  1S5K A;  4Y49 B;  4YGO A;  3KKW A;  4JWP A;  4CGP A;  2DPS A;  4Q38 A;  1IIC A;  2B58 A;  4XPD C;  3TOA A;  1QSR A;  4HNX B;  3QAH A;  3FB3 A;  5CNP A;  2H5M A;  2O28 A;  1SQH A;  1YGH A;  5KTD A;  4DNC A;  4IUS A;  3SXO A;  2Q44 A;  2PDO A;  4KUB A;  5E96 A;  2WUU A;  3F5B A;  5JPH A;  4OAD A;  4PK3 A;  4FD4 A;  4QVT A;  4KVM E;  4KSA A;  1M44 A;  3W6X A;  1L0C A;  1VHS A;  4CGN A;  4XPL A;  4KOS A;  2DXQ A;  3ZJ0 A;  2RC4 A;  3TOB A;  2Z3P A;  2ZPA A;  4LX9 A;  3VWD A;  2J8R A;  3LOD A;  3EY5 A;  3TTH A;  2Z3O A;  1QSO A;  2Q7B A;  4KZT A;  4B14 A;  1ON0 A;  2YND A;  3DR6 A;  4MFZ A;  2P6G A;  3FXT A;  4A30 A;  4HNW B;  2X7B A;  4MBU A;  3SXN A;  4CGL A;  2CNS A;  4KSF A;  4UCP A;  2QIR A;  1GHE A;  4K30 A;  2FL4 A;  4MI4 A;  1B6B A;  3P2H A;  3TO7 A;  1Q2D A;  3FIX A;  4MY3 A;  2YNC A;  4C68 A;  2PQ8 A;  3IU1 A;  4KOX A;  4KVO E;  4YRH A;  3B8G A;  3GY9 A;  2B5G A;  4HNY B;  2GE3 A;  2R7H A;  3EFA A;  3OWC A;  1PUA A;  2CNT A;  1Z4E A;  4FD5 A;  1XF8 A;  2P6E A;  2BUE A;  1MK4 A;  4JXR A;  4KOR A;  4NSQ A;  4XNH B;  2P0W A;  4KOU A;  3D3S A;  1K4J A;  3MGD A;  4A31 A;  5F49 A;  5J8F A;  5KTA A;  4CYP A;  1Z9U A;  2QML A;  4QUS A;  4H89 A;  4UCN A;  4M85 A;  4KLW A;  4CGO A;  4M3S A;  4CGM A;  2OB0 A;  2REF A;  4CAF A;  4R3L A;  5F48 A;  5A27 A;  1YLE A;  4MJ8 A;  2AE6 A;  3FBU A;  2ZW7 A;  4LUA A;  4ZGY B;  2D4O A;  2OZH A;  5HH1 A;  5AG4 A;  4MFQ A;  2VEZ A;  1LRZ A;  5BWA B;  2CY2 A;  4JJX A;  5G1Z A;  1J4J A;  4UFX A;  4RI1 A;  1Y7R A;  3F8K A;  4A95 A;  3CXP A;  3PP9 A;  4FD6 A;  3DNS A;  3VWE A;  2PRB A;  3BLN A;  2B5G B;  1KUX A;  3D2P A;  2R98 A;  2FXF A;  3R9F A;  5HMN A;  3GKR A;  3BJ8 A;  1IB1 E;  1Q2C A;  5AGE A;  2FS5 A;  1IYK A;  2BSW A;  2I00 A;  2VQY A;  2ZW6 A;  1TIQ A;  4PV6 A;  3FRM A;  2F5I A;  2IL4 A;  2PC1 A;  4R87 A;  4UWJ A;  3S6K A;  4QC6 A;  2DPT A;  4C7H A;  3R95 A;  4B5P A;  4AVC A;  3D8P A;  1NSL A;  1Z4R A;  2G3T A;  4U9Y A;  2ATR A;  2ZXV A;  5H84 A;  4MFK A;  4C2Y A;  1VKC A;  5EBV A;  5EC4 A;  1KZF A;  3LD2 A;  5C88 A;  2Z10 A;  4OLL A;  1UFH A;  2BEI A;  3IWE A;  4XPK A;  3W6S A;  4KOW A;  2WSA A;  1S60 A;  5FVJ A;  3DSB A;  1WWZ A;  4PK2 A;  4Q36 A;  4XNH C;  2J8M A;  4CRZ B;  1YVO A;  2OH1 A;  4OAE A;  2FT0 A;  4IF5 A;  4UFW A;  3D2M A;  3A9L A;  2G0B A;  3EXN A;  3IWG A;  3NE7 A;  2Z11 A;  1QSN A;  4UA3 A;  3CXS A;  4NXY A;  2FIA A;  2FIW A;  3RYO A;  4X5K A;  3R1K A;  5F46 A;  1IYL A;  5AG7 A;  3K9U A;  4CAX A;  3TE4 A;  2Z3K A;  1P4N A;  4BMH A;  5ISV A;  2OZG A;  2HV2 A;  4AB7 A;  1ZO0 A;  3DR8 A;  3G3S A;  2R8V A;  2VZZ A;  1B87 A;  4GS4 A;  3I3G A;  4XPD B;  4A33 A;  2VXK A;  5KTC A;  1S7K A;  1S7N A;  2Q4Y A;  4QB9 A;  1M4D A;  4MFL A;  4MHD A;  4Y49 C;  1MJ9 A;  4H6U A;  3I9S A;  4B5P B;  2Y0M A;  5I0C A;  1WK4 A;  4KLV A;  2R1I A;  3JUW A;  2KCW A;  2QEC A;  2Z3L A;  5AG6 A;  5GCN A;  4KOV A;  1YRE A;  1S7L A;  1YK3 A;  1S7F A;  4ONU A;  2FSR A;  1I21 A;  2I79 A;  4A32 A;  1YX0 A;  3R9E A;  5H86 A;  4E8O A;  4AVB A;  1IID A;  4JD6 A;  5G22 A;  4E2A A;  2FE7 A;  4EVY A;  4KVX A;  4B10 A;  1PU9 A;  1NE9 A;  4H6Z A;  4B11 A;  4FD7 A;  2JDD A;  2VI7 A;  3H5Z A;  3WR7 A;  4PSX A;  2CNM A;  2FCK A;  5G20 A;  4C7I A;  1QST A;  3FNC A;  4L8A A;  1Y9K A;  1Q2Y A;  4CRY B;  1I12 A;  2YGW A;  1M4I A;  1S3Z A;  3PGP A;  2WPW A;  3R9G A;  4ORF A;  4BBH A;  3IU2 A;  2PSW A;  5F47 A;  5IV0 A;  4MY0 A;  2Z3M A;  1MJB A;  3W91 A;  4UBR A;  1XE4 A;  1Y9W A;  4PSW A;  5AG5 A;  1XIX A;  5DWN A;  1FY7 A;  2OU2 A;  1U6M A;  1P0H A;  4KOY A;  2EUI A;  4C2Z A;  4NCZ A;  2BL1 A;  4E0A A;  4I49 A;  5G21 A;  4C2X A;  3H4Q A;  4YFJ A;  4R57 A;  4U5Y A;  3JTK A;  3EC4 A;  4KUA A;  2PR1 A;  3S6F A;  4B12 A;  3S6H A;  4AG9 A;  2JDC A;  4B13 A;  1YVK A;  2JLM A;  3JVN A;  3IGR A;  2ARH A;  2YNE A;  3BJ7 A;  2J8N A;  4CAW A;  2Z3N A;  1YR0 A;  4KOT A;  2Q0Y A;  2REE A;  4NF1 A;  1CJW A;  1MJA A;  3P2F A;  4UFV A;  4AVA A;  4JLY A;  4RS2 A;  4AG7 A;  4F0X A;  2CXA A;  2G3A A;  4F6A A;  2B3U A;  3V8I A;  4KS9 A;  1BOB A;  4A2Z A;  3R96 A;  1QSM A;  2GIV A;  2AJ6 A;  4HKF A;  3EO4 A;  4R9M A;  4MFP A;  3GYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...