2B3VA

Spermine spermidine acetyltransferase in complex with acetylcoa, k26r mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
167
structure length
167
Chain Sequence
b'FVIRPATAADCSDILRLIKELARYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 1
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 35
structure length 167
sequence length 167
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b3vA00
1S7FA 4H6UA 4OLLA 2OU2A 5KTCA 2FSRA 2C27A 2WPWA 1YLEA 3F8KA 2OZUA 1Y9KA 2PSWA 4AVBA 2B58A 4M85A 2NMTA 1XF8A 2OB0A 1Q2CA 5EBVA 2AJ6A 4KOYA 1K4JA 4HNWB 4FD6A 2K5TA 5IB0A 4KORA 4EVYA 2B3VA 1IYKA 4KUBA 2JDCA 4J3GA 2WPXA 4CS0B 5F46A 1BOBA 1KUYA 1NMTA 2DXQA 4RS2A 2VZZA 3R9GA 3D2PA 2QECA 3BJ7A 3CXQA 1XEBA 2B5GB 1B6BA 1IICA 3C26A 5FVJA 2OH1A 3TE4A 3BJ8A 4I49A 3FRMA 2JLMA 4OAEA 4NCZA 1GHEA 2CNMA 3EO4A 1FY7A 2HUZA 2VEZA 1YREA 2PDOA 3P2HA 4CAXA 2G3TA 4ZBGA 1MK4A 2R8VA 1Z4RA 4QC6A 2GE3A 4NEXA 1LRZA 1Q2YA 2Q04A 3GYAA 3JVNA 4KOSA 2ATRA 3WR7A 4KOUA 2ZW7A 5F47A 3JUWA 1YVOA 2PC1A 1Q2DA 1PU9A 3VWEA 3TOAA 2J8RA 5J8FA 4UBRA 4BMHA 3IWGA 2GIVA 3H4QA 2J8MA 2Z10A 3I3GA 1M44A 5JPHA 2B4BA 2FCKA 4LUAA 4IUSA 4UWIA 1BO4A 1I12A 3K9UA 2EUIA 4FD4A 4PV6A 4RI1A 1S7NA 1XMTA 1P4NA 2KCWA 4JXQA 3EFAA 2H5MA 1R57A 4R9MA 4PSWA 3SHPA 3N7ZA 2FE7A 4Y49C 4AVCA 1S3ZA 5DWNA 2EVNA 3FNCA 3DSBA 4R3LA 2REFA 4UA3A 2Q44A 4KLWA 2J8NA 1J4JA 2O28A 4CAWA 3EC4A 1MJBA 5IX3A 2ZW5A 1PUAA 4FD7A 3R1KA 1QSNA 1VHSA 1VKCA 2P6EA 2I00A 4XPDC 4LX9A 3TCVA 3F5BA 4F6AA 3FBUA 3S6GA 1V0CA 2B3UA 2PRBA 1RXTA 4YRHA 3R96A 1CM0A 2HV2A 2ZW6A 4JJXA 2B5GA 4HNXB 2R1IA 1UFHA 1IYLA 4L8AA 3LODA 3TO6A 4XPKA 2Z11A 3F0AA 3FIXA 2P6GA 4NSQA 2GANA 1YR0A 4M3SA 4KVOE 3CXPA 4Y49B 4B5OA 3UY5A 4R57A 1I1DA 1M1DA 5HH1A 5C82A 3CXSA 5I0CA 3E0KA 1RO5A 4L89A 3T9YA 3LD2A 1M4GA 3GY9A 1N71A 4XPDB 4UWJA 3ZJ0A 1WWZA 3R9FA 4KOWA 4YFJA 4CRYB 4CRZB 2BUEA 2A4NA 3TTHA 5J8CA 1QSTA 1CJWA 2G3AA 4K30A 2PR1A 4E2AA 1NE9A 2BEIA 1QSRA 3R9EA 3S6FA 3QB8A 3T90A 4QB9A 2ZPAA 2REEA 2JDDA 3KKWA 2FIWA 3R95A 5F49A 4B5PB 3S6KA 4HKFA 4KOVA 4MJ8A 4PK2A 2VI7A 4HNYB 2FS5A 4QBJA 1S7KA 2B4DA 4AG7A 4II9A 2HQYA 2QMLA 4U5YA 5E96A 1IIDA 3G8WA 2CNTA 4KVXA 1ON0A 3I9SA 2CNSA 5EC4A 1KUXA 1M4IA 2Y0MA 5DWMA 2D4PA 2R7HA 4NXYA 4QVTA 2OZGA 4H6ZA 4KLVA 4E0AA 1S5KA 1XE4A 3TO9A 2Q7BA 2ZW4A 3PZJA 4AG9A 4DNCA 4MHDA 1MJAA 3DDDA 3EXNA 5F48A 4FD5A 5HMNA 4JWPA 4R3KA 1WK4A 2BL1A 2PQ8A 4H89A 4ONUA 3W6XA 1YGHA 2P6FA 2Q0YA 1I21A 1S60A 3DR6A 4YGOA 4KVME 5GCNA 1Z4EA 4NF1A 2ZXVA 1NSLA 3SXNA 2RC4A 2X7BA 4U9ZA 1XIXA 3PP9A 3VWDA 4MI4A 4MBUA 3FXTA 1P0HA 4QUSA 4JLYA 2Q4VA 3QAHA 2I79A 4XNHC 2VBQA 3FYNA 1TIQA 1MJ9A 4E8OA 3D2MA 3D8PA 4JXRA 2FT0A 3FB3A 3OWCA 2R98A 1U6MA 5ISVA 5JQ4A 3P2FA 5KTAA 1L0CA 1YK3A 4GS4A 2Z0ZA 3MGDA 1SQHA 2AE6A 1B87A 3SXOA 3W91A 4AB7A 4JD6A 3DR8A 4CAVA 5H86A 4ORFA 1Y7RA 3TO7A 1IB1E 2P0WA 5KTDA 5CNPA 4AVAA 1QSMA 3EY5A 2D4OA 1S7LA 2JEVA 4OADA 4KOXA 4R87A 2OZHA 4XPLA 2FL4A 4IF5A 5C88A 1M4DA 4F0YA 1KUVA 5H84A 4B5PA 4MY3A 4XNHB 2IL4A 3D3SA 3GKRA 4MY0A 4KOTA 2VQYA 3V8IA 2VXKA 4KUAA 3RYOA 2FIAA 2VZYA 1QSOA 2CY2A 3W6SA 3TOBA 2BSWA 4KZTA 4U9YA 3TFYA 2F5IA 1Y9WA 3ZZIA 4PSXA 1KZFA 3BLNA 2B4DB 5IV0A 3NE7A 3TT2A 2ARHA 1YX0A 4X5KA 3B8GA 2QIRA 1Z9UA 2G0BA 3IGRA 3DNSA 1YVKA 2Q4YA 3PGPA 4PK3A 3S6HA 3G3SA 2FXFA 1OZPA 2PR8A
chains in the Genus database with same CATH superfamily
2PJ8A 1S7FA 2PJ1A 4H6UA 4OLLA 2OU2A 5KTCA 2FSRA 2C27A 3JTKA 4KSFA 2WPWA 1YLEA 4P6YA 3F8KA 2OZUA 3KASA 5JM6A 1Y9KA 2PSWA 2PJAA 4OKOA 4AVBA 2B58A 4M85A 1VHOA 2F7VA 2NMTA 3TC8A 3RO0A 4CAEA 5I4MA 1PCAA 1XF8A 2OB0A 1Q2CA 2PR8A 4R76A 3GLJA 2GREA 3WC5A 5EBVA 3KGQA 2AJ6A 4KOYA 1K4JA 2Z3OA 2ODFA 2PJ9A 3IWEA 4HNWB 2ZEDA 3D68A 4RN7A 3ISXA 1YLOA 3GB0A 1Z8XA 2K5TA 4FD6A 4UEEA 4WJBA 4A31A 3HLPA 4KORA 5IB0A 4MFJA 4EVYA 2B3VA 1IYKA 4KUBA 2JDCA 1VIXA 4J3GA 2WPXA 4CS0B 5F46A 3KQXA 1BOBA 1KUYA 1NMTA 1LFWA 2DXQA 3A9LA 4RS2A 2VZZA 3NA6A 4IK2A 3R9GA 3D2PA 3IU1A 4NGQA 1TXRA 4FAIA 2ZEHA 2PIYA 2QECA 2VL1A 1GYTA 3B3SA 3BJ7A 3CXQA 4P4JA 1CX8A 1XEBA 4GXHA 2B5GB 1B6BA 2C6CA 4NJRA 3WABA 2Q4ZA 3K2KA 3CT9A 4MXUA 1IICA 3C26A 1ZG7A 5FVJA 1ZO0A 4MHPA 2OH1A 4CGPA 1CP7A 3FVLA 3BJ8A 4I49A 3TE4A 3T8WA 3FRMA 3KQZA 2YGWA 2JLMA 1JWQA 4OAEA 3SJGA 2GU2A 4UCMA 4NCZA 1GHEA 2CNMA 3EO4A 4KSAA 1IU8A 1FY7A 2HUZA 4B13A 5JH9A 2PIZA 3KZWA 2PJ5A 2Q7SA 4UIBA 2VEZA 1YREA 2PDOA 4B14A 3P2HA 4CAXA 2G3TA 4ZBGA 1MK4A 2PRQA 1R43A 1ARMA 2IJZA 2R8VA 1CP6A 4P4EA 1Z4RA 3CPXA 4CYNA 1XMBA 4WWVA 1AMPA 2C6PA 4MFLA 3JRUA 5D29A 4QC6A 2GE3A 4NEXA 1LRZA 3I1UA 4CAFA 3D7GA 1Q2YA 1TKJA 5LYIA 2Q04A 3WT4A 3GYAA 2PJ3A 3JVNA 4KOSA 2C6GA 1M4LA 2ATRA 3WR7A 4KOUA 3TX8A 4EFDA 2ZW7A 5F47A 4P45A 1VHEA 3JUWA 4C7IA 1YVOA 2PC1A 4TNUA 3BI0A 3NH5A 1Q2DA 4NJQA 3FEDA 5HVFA 1PU9A 4ZX8A 3VWEA 4FWUA 3TOAA 4OC5A 3SI2A 4ZX9A 2J8RA 1IOIA 1LANA 5J8FA 3IIBA 4UBRA 2CF4A 4BMHA 3IWGA 2GIVA 3D66A 3B3WA 2V8HA 3KR5A 4OC0A 3HUVA 3H4QA 2J8MA 5K8NA 5F09A 2Z10A 5G1ZA 2ZEEA 3I3GA 2CXAA 3B3VA 1LOKA 4MRIA 1M44A 3B3TA 3V7ZA 2B4BA 2FCKA 5JPHA 4OIDA 4LUAA 4IUSA 3L2NA 4UWIA 1BO4A 4UF4A 1XRYA 2EBJA 1ZG9A 3K9UA 1X10A 2ZOGA 3RNZA 2EUIA 4AXVA 4A2ZA 4FD4A 4PV6A 4RI1A 1QMUA 4MFPA 6CPAA 2CIJA 4BBHA 2GLFA 1S7NA 1XMTA 4OC2A 1H8LA 4P4DA 1P4NA 2KCWA 4UFVA 4DYOA 4JXQA 3EFAA 2H5MA 1R57A 2WSAA 4R9MA 1A2ZA 4MFKA 4MFZA 4MCSA 3H5ZA 4PSWA 3SHPA 3N7ZA 2FE7A 4Y49C 4AVCA 1S3ZA 5DWNA 2IQ6A 3S9NA 2EVNA 1YMEA 3PB6X 3FNCA 5BWAB 3DSBA 4R3LA 2REFA 4UA3A 2Q44A 1X12A 2J8NA 4KLWA 4OIWA 3GIUA 3WC6A 3B2YA 3IWWA 4NGMA 4P4IA 1DTDA 2WYRA 1J4JA 1LCPA 2O28A 4CAWA 3EC4A 1BPNA 2EK9A 3IO1A 2ZEOA 4PXDA 1MJBA 2YNCC 5IX3A 2ZW5A 5AG5A 5IB9A 2IMOA 1PUAA 3IU2A 3R1KA 4FD7A 4C7HA 3MRUA 1QSNA 1VHSA 1VKCA 2P6EA 2XEJA 4M6HA 4PXEA 2I00A 4XPDC 4LX9A 3TCVA 5EMIA 3F5BA 3LACA 4F6AA 4IHMA 3FBUA 1YQEA 4R8FA 3CDXA 1V0CA 2B3UA 3BI1A 3FEEA 3S6GA 2AFMA 2Z3NA 4ZY0A 4GM5A 1ELMP 2PRBA 3H8EA 4HPSA 1RXTA 4H2KA 4YRHA 3R96A 1ZLHA 1Z8LA 2V8GA 3D4UA 1CM0A 1F2OA 2HV2A 2ZW6A 3KHXA 1IY7A 4JJXA 4Z65A 2B5GA 4HNXB 2R1IA 1UFHA 5LRJA 4B11A 5G20A 1IYLA 4L8AA 3LODA 3TO6A 4XPKA 2Z11A 2Z3KA 3BHXA 3F0AA 1EE3P 2BCOA 2V8DA 3FIXA 4JYWA 2ZEGA 5D8NA 2P6GA 3IEHA 2RFHA 4DUKA 2XEFA 1HEEA 3QAYA 2GANA 4NSQA 2J9AA 1TKFA 4F0XA 1YR0A 3PB4X 3SJEA 4M3SA 4KVOE 3B7IA 3PFEA 1UWYA 3CXPA 4Y49B 4BINA 4UCPA 4B5OA 4FUUA 4YU9A 4ZY1A 4EMEA 3PBBA 2Q51A 4M6GA 3UY5A 4FBEA 4R57A 1CPXA 2QYVA 2ZELA 1I1DA 1M1DA 1CG2A 2PJ2A 5HH1A 4A38A 4A39A 2DEAA 5C82A 3CXSA 4A37A 5I0CA 3E0KA 1RO5A 2FVGA 1FT7A 4L89A 3T9YA 3LD2A 1PYTB 2Z3LA 1M4GA 3GY9A 4NGSA 4K3NA 3SJFA 2PJ0A 1XJOA 4MCPA 1N71A 2C1CA 1ELLP 4XPDB 4UWJA 3FF3A 5ELYA 3ZJ0A 2ZEFA 1JQGA 1WWZA 3R9FA 4KOWA 4YFJA 4CRYB 4CRZB 2BUEA 2A4NA 4MHZA 3TTHA 1F2PA 5A28A 5J8CA 1QSTA 5HVHA 2ZEMA 3RZAA 1CJWA 2G3AA 4K30A 2PR1A 4E2AA 2Q43A 1NE9A 2DPSA 1CBXA 2BEIA 1QSRA 1IOFA 3R9EA 3S6FA 3QB8A 3T90A 4QB9A 2ZPAA 2REEA 2JDDA 3KKWA 2JBJA 4KS9A 5AGEA 5LYDA 2FIWA 3R95A 3KL9A 5F49A 5THWA 4B5PB 2O53A 4NGPA 1NSAA 3S6KA 4BD9A 4CGMA 4HKFA 4KOVA 4PXBA 4MJ8A 1LAMA 4PK2A 2VI7A 4ZGYB 3D7DA 1TF9A 4HNYB 2FS5A 4QBJA 1S7KA 2B4DA 3PBEA 4AG7A 4II9A 2HQYA 2QMLA 1BPMA 4U5YA 5E96A 1IIDA 3FMCA 4YWYA 3G8WA 2CNTA 5LYLA 2HC9A 4KVXA 1BAVA 3PRTA 4UIAA 1XFOA 1ON0A 3H8FA 5K8MA 2O4HA 3I9SA 2CNSA 2CTBA 3PB7X 4P10A 4UFWA 5EC4A 4MCQA 5J1QA 1AYEA 1KUXA 1M4IA 2Y0MA 3SJXA 4CYOA 3N5FA 4LQGA 5DWMA 4C2XA 2DPTA 4MFQA 4UFXA 2D4PA 5A27A 3B35A 3KI9A 2AFOA 4P4BA 2R7HA 2POKA 4NGRA 4NXYA 4OMEA 4QVTA 2OZGA 3PEIA 3NE8A 4H6ZA 4X2TA 4KLVA 3IC1A 4E0AA 1S5KA 4DJLA 1XE4A 3TO9A 2Q7BA 1Z8TA 2ZW4A 3PZJA 4AG9A 4DNCA 4ONWA 2OR4A 2NSMA 4MHDA 4C2ZA 2AFXA 1Y0RA 4A32A 1MJAA 3DDDA 2WUUA 3EXNA 5CPAA 3DLJA 5F48A 4FD5A 1LAPA 5HMNA 4JWPA 4R3KA 4R7MA 1WK4A 2HB6A 2BL1A 2PQ8A 4H89A 4ONUA 4R6TA 3D7HA 3W6XA 4F8ZA 1YGHA 4UCNA 2ZENA 3MN8A 2P6FA 4OP4A 4NFRA 5G22A 2EO8A 2Q0YA 3FECA 4F9UA 1I21A 3IFEA 5CBMA 1S60A 3DR6A 5AG7A 3NFZA 4YGOA 4PQAA 2BO9A 4KVME 2AFSA 2PJ7A 5GCNA 4CGOA 3PB9X 5K8PA 3DGVA 1F57A 1Z4EA 1VGYA 2WZNA 4NF1A 2ZXVA 4MCRA 1NSLA 4A33A 3SXNA 2RC4A 2X7BA 1XOVA 4U9ZA 4OC3A 1XIXA 3PP9A 3VWDA 3CPAA 1TF8A 3H8GA 2I3CA 2PJ4A 1FNOA 2GFQA 4MBUA 4MI4A 4MHYA 3FXTA 1R3NA 4CGNA 4CPAA 2PJ6A 3V38A 1P0HA 4QUSA 4JLYA 2YNEA 8CPAA 1RTQA 4ZI6A 1Z2LA 2Q4VA 3QAHA 5DS0A 2I79A 4XNHC 4O23A 4Q36A 2VBQA 3FYNA 2PVVA 1TIQA 1MJ9A 4E8OA 4EWTA 3D2MA 4JZ0A 5JGFA 3D8PA 3FJUA 2FT0A 4JXRA 2PCUA 1TKHA 5LRGA 3FB3A 1CPSA 3OWCA 4LQ6A 2R98A 4UEFA 1IGBA 1U6MA 4PXCA 5LRKA 5ISVA 5JQ4A 3KHZA 4A94A 4UEZA 3P2FA 4CGLA 3WC7A 2V8VA 2ZEPA 5KTAA 1DE4C 4P4FA 4OC1A 4A30A 1L0CA 3S9MA 1YK3A 4GS4A 2Z0ZA 2NYQA 3MGDA 5K8OA 3FH4A 1SQHA 2AE6A 1B87A 3IJ3A 2PJBA 4NGNA 3SXOA 3W91A 2YNDA 2YNCA 4JD6A 3BXMA 3DR8A 4NGTA 4AB7A 3D67A 1Z8WA 4CAVA 5H86A 1YW6A 4MHNA 1Y7RA 1Z5RA 4ORFA 1IB1E 4P44A 3TO7A 2P0WA 5KTDA 3B3CA 5CNPA 3RBUA 2AFWA 3NH8A 1KWMA 2AFUA 1YW4A 2CTCA 7CPAA 2XEGA 4F9VA 1Y0YA 3KR4A 4AVAA 1QSMA 1Y7EA 3EY5A 4A95A 2DF5A 2D4OA 5AG6A 1S7LA 2JEVA 4OADA 2PVWA 3GUXA 4KOXA 2OZHA 4R87A 4X3RA 4XPLA 4IAVA 2FL4A 4X8IA 4TWEA 4IF5A 5C88A 4C68A 1M4DA 1ARLA 4F0YA 4ZYQA 2JBKA 5HXDA 1KUVA 5H84A 4B5PA 4MY3A 1XBUA 4G1PA 5G21A 3SI0A 4XNHB 4OC4A 4Q7AA 4B6ZA 2IL4A 2GLJA 3K9TA 3D3SA 3GKRA 4MY0A 2G9DA 4KOTA 2VQYA 3V8IA 3VH9A 5AG4A 2F8HA 4PPZA 2VXKA 2OOTA 4KUAA 2PE3A 3PFOA 3RYOA 1ZLIA 2FIAA 1OBRA 2V77A 2VZYA 2JEWA 3VARA 1QSOA 2CY2A 3SI1A 3W6SA 4RUHA 3TOBA 2EK8A 2BSWA 2AFZA 4KZTA 3S9LA 4Q38A 4U9YA 2QJ8A 3QNVA 1HDQA 1Q7LA 2EWBA 4W9YA 2ZOFA 2RB7A 1AUGA 1ZG8A 3TFYA 2F5IA 3NH4A 1Y9WA 4M6IA 3ZZIA 4CYPA 4PSXA 1KZFA 2Z3MA 3BLNA 4MMOA 2B4DB 3LMSA 5IV0A 2ANPA 3CZXA 1QQ9A 3NE7A 3TT2A 2ARHA 3D7FA 4C2YA 4CYQA 1YX0A 4ZY2A 2Z3PA 4X5KA 5HVGA 3B8GA 1YSJA 4KSIA 2QVPA 4B12A 2QIRA 3FX6A 2BOAA 1Z9UA 2G0BA 4B10A 3IGRA 3DNSA 1YVKA 2ABZA 2PJCA 5LYFA 1BLLE 3PB8X 2Q4YA 3PGPA 4PK3A 3ISZA 3S6HA 3G3SA 1HDUA 3LWUA 3RAMA 2FXFA 2XEIA 1OZPA 3VATA 1I12A
chains in the Genus database with same CATH topology
1S7FA 4H6UA 4OLLA 2OU2A 5KTCA 2FSRA 2C27A 3JTKA 4KSFA 2WPWA 1YLEA 3F8KA 2OZUA 1Y9KA 2PSWA 4AVBA 2B58A 4M85A 2NMTA 4CAEA 1XF8A 2OB0A 1Q2CA 5EBVA 2AJ6A 4KOYA 1K4JA 2Z3OA 3IWEA 4HNWB 4FD6A 2K5TA 5IB0A 4A31A 4KORA 4MFJA 4EVYA 2B3VA 1IYKA 4KUBA 2JDCA 4J3GA 2WPXA 4CS0B 5F46A 1BOBA 1KUYA 1NMTA 2DXQA 3A9LA 4RS2A 2VZZA 3R9GA 3D2PA 3IU1A 2QECA 3BJ7A 3CXQA 1XEBA 2B5GB 1B6BA 1IICA 3C26A 5FVJA 1ZO0A 4CGPA 2OH1A 3TE4A 4I49A 3BJ8A 3FRMA 2YGWA 2JLMA 4OAEA 4UCMA 4NCZA 1GHEA 2CNMA 3EO4A 4KSAA 1FY7A 2HUZA 4B13A 2VEZA 1YREA 2PDOA 4B14A 3P2HA 4CAXA 2G3TA 4ZBGA 1MK4A 2R8VA 1Z4RA 4CYNA 4MFLA 4QC6A 2GE3A 4NEXA 1LRZA 4CAFA 1Q2YA 2Q04A 3GYAA 3JVNA 4KOSA 2ATRA 3WR7A 4KOUA 2ZW7A 5F47A 3JUWA 4C7IA 1YVOA 2PC1A 1Q2DA 1PU9A 3VWEA 3TOAA 2J8RA 5J8FA 4UBRA 4BMHA 3IWGA 2GIVA 3H4QA 2J8MA 2Z10A 5G1ZA 3I3GA 2CXAA 1M44A 5JPHA 2B4BA 2FCKA 4LUAA 4IUSA 4UWIA 1BO4A 1I12A 3K9UA 2EUIA 4A2ZA 4FD4A 4PV6A 4RI1A 4MFPA 4BBHA 1S7NA 1XMTA 1P4NA 2KCWA 4UFVA 4JXQA 3EFAA 2H5MA 1R57A 2WSAA 4R9MA 4MFKA 4MFZA 4PSWA 3H5ZA 3SHPA 3N7ZA 2FE7A 4Y49C 4AVCA 1S3ZA 5DWNA 2EVNA 3FNCA 5BWAB 3DSBA 4R3LA 2REFA 4UA3A 2Q44A 4KLWA 2J8NA 1J4JA 2O28A 4CAWA 3EC4A 1MJBA 2YNCC 5IX3A 2ZW5A 5AG5A 3IU2A 1PUAA 4FD7A 3R1KA 4C7HA 1QSNA 1VHSA 1VKCA 2P6EA 2I00A 4XPDC 4LX9A 3TCVA 3F5BA 4F6AA 3FBUA 3S6GA 1V0CA 2B3UA 2Z3NA 2PRBA 1RXTA 4YRHA 3R96A 1CM0A 2HV2A 2ZW6A 4JJXA 2B5GA 4HNXB 2R1IA 1UFHA 4B11A 5G20A 1IYLA 4L8AA 3LODA 3TO6A 4XPKA 2Z11A 2Z3KA 3F0AA 3FIXA 2P6GA 4NSQA 2GANA 4F0XA 1YR0A 4M3SA 4KVOE 3CXPA 4Y49B 4UCPA 4B5OA 3UY5A 4R57A 1I1DA 1M1DA 5HH1A 5C82A 3CXSA 5I0CA 3E0KA 1RO5A 4L89A 3T9YA 3LD2A 2Z3LA 1M4GA 3GY9A 1N71A 4XPDB 4UWJA 3ZJ0A 1WWZA 3R9FA 4KOWA 4YFJA 4CRYB 4CRZB 2BUEA 2A4NA 3TTHA 5J8CA 5A28A 1QSTA 1CJWA 2G3AA 4K30A 2PR1A 4E2AA 1NE9A 2DPSA 2BEIA 1QSRA 3R9EA 3S6FA 3QB8A 3T90A 4QB9A 2ZPAA 2REEA 2JDDA 3KKWA 4KS9A 5AGEA 2FIWA 3R95A 5F49A 4B5PB 3S6KA 4CGMA 4HKFA 4KOVA 4MJ8A 4PK2A 4ZGYB 2VI7A 4HNYB 2FS5A 4QBJA 1S7KA 2B4DA 4AG7A 4II9A 2HQYA 2QMLA 4U5YA 5E96A 1IIDA 3G8WA 2CNTA 4KVXA 1ON0A 4UFWA 3I9SA 2CNSA 5EC4A 1KUXA 1M4IA 4CYOA 2Y0MA 5DWMA 4C2XA 2DPTA 4MFQA 4UFXA 2D4PA 5A27A 2R7HA 4NXYA 4QVTA 2OZGA 4H6ZA 4KLVA 4E0AA 1S5KA 1XE4A 3TO9A 2Q7BA 2ZW4A 3PZJA 4AG9A 4DNCA 4C2ZA 4MHDA 4A32A 1MJAA 3DDDA 2WUUA 3EXNA 5F48A 4FD5A 5HMNA 4JWPA 4R3KA 1WK4A 2BL1A 2PQ8A 4H89A 4ONUA 3W6XA 1YGHA 4UCNA 2P6FA 5G22A 2Q0YA 1I21A 1S60A 3DR6A 5AG7A 4YGOA 4KVME 5GCNA 4CGOA 1Z4EA 4NF1A 2ZXVA 1NSLA 4A33A 3SXNA 2RC4A 2X7BA 4U9ZA 1XIXA 3PP9A 3VWDA 4MI4A 4MBUA 3FXTA 4CGNA 1P0HA 4QUSA 4JLYA 2YNEA 2Q4VA 3QAHA 2I79A 4XNHC 4Q36A 2VBQA 3FYNA 1TIQA 1MJ9A 4E8OA 3D2MA 3D8PA 4JXRA 2FT0A 3FB3A 3OWCA 2R98A 1U6MA 5ISVA 5JQ4A 3P2FA 4CGLA 5KTAA 4A30A 1L0CA 1YK3A 4GS4A 2Z0ZA 3MGDA 1SQHA 2AE6A 1B87A 3SXOA 3W91A 4AB7A 2YNDA 2YNCA 4JD6A 3DR8A 4CAVA 5H86A 4ORFA 1Y7RA 3TO7A 1IB1E 2P0WA 5KTDA 5CNPA 4AVAA 1QSMA 3EY5A 4A95A 2D4OA 5AG6A 1S7LA 2JEVA 4OADA 4KOXA 4R87A 2OZHA 4XPLA 2FL4A 4IF5A 5C88A 4C68A 1M4DA 4F0YA 1KUVA 5H84A 4B5PA 4MY3A 5G21A 4XNHB 2IL4A 3D3SA 3GKRA 4MY0A 4KOTA 2VQYA 3V8IA 5AG4A 2VXKA 4KUAA 3RYOA 2FIAA 2VZYA 1QSOA 2CY2A 3W6SA 3TOBA 2BSWA 4KZTA 4Q38A 4U9YA 3TFYA 2F5IA 1Y9WA 3ZZIA 4CYPA 4PSXA 1KZFA 2Z3MA 3BLNA 2B4DB 5IV0A 3NE7A 3TT2A 2ARHA 4C2YA 4CYQA 1YX0A 2Z3PA 4X5KA 3B8GA 4B12A 2QIRA 1Z9UA 2G0BA 4B10A 3IGRA 3DNSA 1YVKA 2Q4YA 3PGPA 4PK3A 3S6HA 3G3SA 2FXFA 1OZPA 2PR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7F A;  4H6U A;  4OLL A;  2OU2 A;  5KTC A;  2FSR A;  2C27 A;  2WPW A;  1YLE A;  3F8K A;  2OZU A;  1Y9K A;  2PSW A;  4AVB A;  2B58 A;  4M85 A;  2NMT A;  1XF8 A;  2OB0 A;  1Q2C A;  5EBV A;  2AJ6 A;  4KOY A;  1K4J A;  4HNW B;  4FD6 A;  2K5T A;  5IB0 A;  4KOR A;  4EVY A;  2B3V A;  1IYK A;  4KUB A;  2JDC A;  4J3G A;  2WPX A;  4CS0 B;  5F46 A;  1BOB A;  1KUY A;  1NMT A;  2DXQ A;  4RS2 A;  2VZZ A;  3R9G A;  3D2P A;  2QEC A;  3BJ7 A;  3CXQ A;  1XEB A;  2B5G B;  1B6B A;  1IIC A;  3C26 A;  5FVJ A;  2OH1 A;  3TE4 A;  3BJ8 A;  4I49 A;  3FRM A;  2JLM A;  4OAE A;  4NCZ A;  1GHE A;  2CNM A;  3EO4 A;  1FY7 A;  2HUZ A;  2VEZ A;  1YRE A;  2PDO A;  3P2H A;  4CAX A;  2G3T A;  4ZBG A;  1MK4 A;  2R8V A;  1Z4R A;  4QC6 A;  2GE3 A;  4NEX A;  1LRZ A;  1Q2Y A;  2Q04 A;  3GYA A;  3JVN A;  4KOS A;  2ATR A;  3WR7 A;  4KOU A;  2ZW7 A;  5F47 A;  3JUW A;  1YVO A;  2PC1 A;  1Q2D A;  1PU9 A;  3VWE A;  3TOA A;  2J8R A;  5J8F A;  4UBR A;  4BMH A;  3IWG A;  2GIV A;  3H4Q A;  2J8M A;  2Z10 A;  3I3G A;  1M44 A;  5JPH A;  2B4B A;  2FCK A;  4LUA A;  4IUS A;  4UWI A;  1BO4 A;  1I12 A;  3K9U A;  2EUI A;  4FD4 A;  4PV6 A;  4RI1 A;  1S7N A;  1XMT A;  1P4N A;  2KCW A;  4JXQ A;  3EFA A;  2H5M A;  1R57 A;  4R9M A;  4PSW A;  3SHP A;  3N7Z A;  2FE7 A;  4Y49 C;  4AVC A;  1S3Z A;  5DWN A;  2EVN A;  3FNC A;  3DSB A;  4R3L A;  2REF A;  4UA3 A;  2Q44 A;  4KLW A;  2J8N A;  1J4J A;  2O28 A;  4CAW A;  3EC4 A;  1MJB A;  5IX3 A;  2ZW5 A;  1PUA A;  4FD7 A;  3R1K A;  1QSN A;  1VHS A;  1VKC A;  2P6E A;  2I00 A;  4XPD C;  4LX9 A;  3TCV A;  3F5B A;  4F6A A;  3FBU A;  3S6G A;  1V0C A;  2B3U A;  2PRB A;  1RXT A;  4YRH A;  3R96 A;  1CM0 A;  2HV2 A;  2ZW6 A;  4JJX A;  2B5G A;  4HNX B;  2R1I A;  1UFH A;  1IYL A;  4L8A A;  3LOD A;  3TO6 A;  4XPK A;  2Z11 A;  3F0A A;  3FIX A;  2P6G A;  4NSQ A;  2GAN A;  1YR0 A;  4M3S A;  4KVO E;  3CXP A;  4Y49 B;  4B5O A;  3UY5 A;  4R57 A;  1I1D A;  1M1D A;  5HH1 A;  5C82 A;  3CXS A;  5I0C A;  3E0K A;  1RO5 A;  4L89 A;  3T9Y A;  3LD2 A;  1M4G A;  3GY9 A;  1N71 A;  4XPD B;  4UWJ A;  3ZJ0 A;  1WWZ A;  3R9F A;  4KOW A;  4YFJ A;  4CRY B;  4CRZ B;  2BUE A;  2A4N A;  3TTH A;  5J8C A;  1QST A;  1CJW A;  2G3A A;  4K30 A;  2PR1 A;  4E2A A;  1NE9 A;  2BEI A;  1QSR A;  3R9E A;  3S6F A;  3QB8 A;  3T90 A;  4QB9 A;  2ZPA A;  2REE A;  2JDD A;  3KKW A;  2FIW A;  3R95 A;  5F49 A;  4B5P B;  3S6K A;  4HKF A;  4KOV A;  4MJ8 A;  4PK2 A;  2VI7 A;  4HNY B;  2FS5 A;  4QBJ A;  1S7K A;  2B4D A;  4AG7 A;  4II9 A;  2HQY A;  2QML A;  4U5Y A;  5E96 A;  1IID A;  3G8W A;  2CNT A;  4KVX A;  1ON0 A;  3I9S A;  2CNS A;  5EC4 A;  1KUX A;  1M4I A;  2Y0M A;  5DWM A;  2D4P A;  2R7H A;  4NXY A;  4QVT A;  2OZG A;  4H6Z A;  4KLV A;  4E0A A;  1S5K A;  1XE4 A;  3TO9 A;  2Q7B A;  2ZW4 A;  3PZJ A;  4AG9 A;  4DNC A;  4MHD A;  1MJA A;  3DDD A;  3EXN A;  5F48 A;  4FD5 A;  5HMN A;  4JWP A;  4R3K A;  1WK4 A;  2BL1 A;  2PQ8 A;  4H89 A;  4ONU A;  3W6X A;  1YGH A;  2P6F A;  2Q0Y A;  1I21 A;  1S60 A;  3DR6 A;  4YGO A;  4KVM E;  5GCN A;  1Z4E A;  4NF1 A;  2ZXV A;  1NSL A;  3SXN A;  2RC4 A;  2X7B A;  4U9Z A;  1XIX A;  3PP9 A;  3VWD A;  4MI4 A;  4MBU A;  3FXT A;  1P0H A;  4QUS A;  4JLY A;  2Q4V A;  3QAH A;  2I79 A;  4XNH C;  2VBQ A;  3FYN A;  1TIQ A;  1MJ9 A;  4E8O A;  3D2M A;  3D8P A;  4JXR A;  2FT0 A;  3FB3 A;  3OWC A;  2R98 A;  1U6M A;  5ISV A;  5JQ4 A;  3P2F A;  5KTA A;  1L0C A;  1YK3 A;  4GS4 A;  2Z0Z A;  3MGD A;  1SQH A;  2AE6 A;  1B87 A;  3SXO A;  3W91 A;  4AB7 A;  4JD6 A;  3DR8 A;  4CAV A;  5H86 A;  4ORF A;  1Y7R A;  3TO7 A;  1IB1 E;  2P0W A;  5KTD A;  5CNP A;  4AVA A;  1QSM A;  3EY5 A;  2D4O A;  1S7L A;  2JEV A;  4OAD A;  4KOX A;  4R87 A;  2OZH A;  4XPL A;  2FL4 A;  4IF5 A;  5C88 A;  1M4D A;  4F0Y A;  1KUV A;  5H84 A;  4B5P A;  4MY3 A;  4XNH B;  2IL4 A;  3D3S A;  3GKR A;  4MY0 A;  4KOT A;  2VQY A;  3V8I A;  2VXK A;  4KUA A;  3RYO A;  2FIA A;  2VZY A;  1QSO A;  2CY2 A;  3W6S A;  3TOB A;  2BSW A;  4KZT A;  4U9Y A;  3TFY A;  2F5I A;  1Y9W A;  3ZZI A;  4PSX A;  1KZF A;  3BLN A;  2B4D B;  5IV0 A;  3NE7 A;  3TT2 A;  2ARH A;  1YX0 A;  4X5K A;  3B8G A;  2QIR A;  1Z9U A;  2G0B A;  3IGR A;  3DNS A;  1YVK A;  2Q4Y A;  3PGP A;  4PK3 A;  3S6H A;  3G3S A;  2FXF A;  1OZP A;  2PR8 A; 
#chains in the Genus database with same CATH topology
 2PJ8 A;  1S7F A;  2PJ1 A;  4H6U A;  4OLL A;  2OU2 A;  5KTC A;  2FSR A;  2C27 A;  3JTK A;  4KSF A;  2WPW A;  1YLE A;  4P6Y A;  3F8K A;  2OZU A;  3KAS A;  5JM6 A;  1Y9K A;  2PSW A;  2PJA A;  4OKO A;  4AVB A;  2B58 A;  4M85 A;  1VHO A;  2F7V A;  2NMT A;  3TC8 A;  3RO0 A;  4CAE A;  5I4M A;  1PCA A;  1XF8 A;  2OB0 A;  1Q2C A;  2PR8 A;  4R76 A;  3GLJ A;  2GRE A;  3WC5 A;  5EBV A;  3KGQ A;  2AJ6 A;  4KOY A;  1K4J A;  2Z3O A;  2ODF A;  2PJ9 A;  3IWE A;  4HNW B;  2ZED A;  3D68 A;  4RN7 A;  3ISX A;  1YLO A;  3GB0 A;  1Z8X A;  2K5T A;  4FD6 A;  4UEE A;  4WJB A;  4A31 A;  3HLP A;  4KOR A;  5IB0 A;  4MFJ A;  4EVY A;  2B3V A;  1IYK A;  4KUB A;  2JDC A;  1VIX A;  4J3G A;  2WPX A;  4CS0 B;  5F46 A;  3KQX A;  1BOB A;  1KUY A;  1NMT A;  1LFW A;  2DXQ A;  3A9L A;  4RS2 A;  2VZZ A;  3NA6 A;  4IK2 A;  3R9G A;  3D2P A;  3IU1 A;  4NGQ A;  1TXR A;  4FAI A;  2ZEH A;  2PIY A;  2QEC A;  2VL1 A;  1GYT A;  3B3S A;  3BJ7 A;  3CXQ A;  4P4J A;  1CX8 A;  1XEB A;  4GXH A;  2B5G B;  1B6B A;  2C6C A;  4NJR A;  3WAB A;  2Q4Z A;  3K2K A;  3CT9 A;  4MXU A;  1IIC A;  3C26 A;  1ZG7 A;  5FVJ A;  1ZO0 A;  4MHP A;  2OH1 A;  4CGP A;  1CP7 A;  3FVL A;  3BJ8 A;  4I49 A;  3TE4 A;  3T8W A;  3FRM A;  3KQZ A;  2YGW A;  2JLM A;  1JWQ A;  4OAE A;  3SJG A;  2GU2 A;  4UCM A;  4NCZ A;  1GHE A;  2CNM A;  3EO4 A;  4KSA A;  1IU8 A;  1FY7 A;  2HUZ A;  4B13 A;  5JH9 A;  2PIZ A;  3KZW A;  2PJ5 A;  2Q7S A;  4UIB A;  2VEZ A;  1YRE A;  2PDO A;  4B14 A;  3P2H A;  4CAX A;  2G3T A;  4ZBG A;  1MK4 A;  2PRQ A;  1R43 A;  1ARM A;  2IJZ A;  2R8V A;  1CP6 A;  4P4E A;  1Z4R A;  3CPX A;  4CYN A;  1XMB A;  4WWV A;  1AMP A;  2C6P A;  4MFL A;  3JRU A;  5D29 A;  4QC6 A;  2GE3 A;  4NEX A;  1LRZ A;  3I1U A;  4CAF A;  3D7G A;  1Q2Y A;  1TKJ A;  5LYI A;  2Q04 A;  3WT4 A;  3GYA A;  2PJ3 A;  3JVN A;  4KOS A;  2C6G A;  1M4L A;  2ATR A;  3WR7 A;  4KOU A;  3TX8 A;  4EFD A;  2ZW7 A;  5F47 A;  4P45 A;  1VHE A;  3JUW A;  4C7I A;  1YVO A;  2PC1 A;  4TNU A;  3BI0 A;  3NH5 A;  1Q2D A;  4NJQ A;  3FED A;  5HVF A;  1PU9 A;  4ZX8 A;  3VWE A;  4FWU A;  3TOA A;  4OC5 A;  3SI2 A;  4ZX9 A;  2J8R A;  1IOI A;  1LAN A;  5J8F A;  3IIB A;  4UBR A;  2CF4 A;  4BMH A;  3IWG A;  2GIV A;  3D66 A;  3B3W A;  2V8H A;  3KR5 A;  4OC0 A;  3HUV A;  3H4Q A;  2J8M A;  5K8N A;  5F09 A;  2Z10 A;  5G1Z A;  2ZEE A;  3I3G A;  2CXA A;  3B3V A;  1LOK A;  4MRI A;  1M44 A;  3B3T A;  3V7Z A;  2B4B A;  2FCK A;  5JPH A;  4OID A;  4LUA A;  4IUS A;  3L2N A;  4UWI A;  1BO4 A;  4UF4 A;  1XRY A;  2EBJ A;  1ZG9 A;  3K9U A;  1X10 A;  2ZOG A;  3RNZ A;  2EUI A;  4AXV A;  4A2Z A;  4FD4 A;  4PV6 A;  4RI1 A;  1QMU A;  4MFP A;  6CPA A;  2CIJ A;  4BBH A;  2GLF A;  1S7N A;  1XMT A;  4OC2 A;  1H8L A;  4P4D A;  1P4N A;  2KCW A;  4UFV A;  4DYO A;  4JXQ A;  3EFA A;  2H5M A;  1R57 A;  2WSA A;  4R9M A;  1A2Z A;  4MFK A;  4MFZ A;  4MCS A;  3H5Z A;  4PSW A;  3SHP A;  3N7Z A;  2FE7 A;  4Y49 C;  4AVC A;  1S3Z A;  5DWN A;  2IQ6 A;  3S9N A;  2EVN A;  1YME A;  3PB6 X;  3FNC A;  5BWA B;  3DSB A;  4R3L A;  2REF A;  4UA3 A;  2Q44 A;  1X12 A;  2J8N A;  4KLW A;  4OIW A;  3GIU A;  3WC6 A;  3B2Y A;  3IWW A;  4NGM A;  4P4I A;  1DTD A;  2WYR A;  1J4J A;  1LCP A;  2O28 A;  4CAW A;  3EC4 A;  1BPN A;  2EK9 A;  3IO1 A;  2ZEO A;  4PXD A;  1MJB A;  2YNC C;  5IX3 A;  2ZW5 A;  5AG5 A;  5IB9 A;  2IMO A;  1PUA A;  3IU2 A;  3R1K A;  4FD7 A;  4C7H A;  3MRU A;  1QSN A;  1VHS A;  1VKC A;  2P6E A;  2XEJ A;  4M6H A;  4PXE A;  2I00 A;  4XPD C;  4LX9 A;  3TCV A;  5EMI A;  3F5B A;  3LAC A;  4F6A A;  4IHM A;  3FBU A;  1YQE A;  4R8F A;  3CDX A;  1V0C A;  2B3U A;  3BI1 A;  3FEE A;  3S6G A;  2AFM A;  2Z3N A;  4ZY0 A;  4GM5 A;  1ELM P;  2PRB A;  3H8E A;  4HPS A;  1RXT A;  4H2K A;  4YRH A;  3R96 A;  1ZLH A;  1Z8L A;  2V8G A;  3D4U A;  1CM0 A;  1F2O A;  2HV2 A;  2ZW6 A;  3KHX A;  1IY7 A;  4JJX A;  4Z65 A;  2B5G A;  4HNX B;  2R1I A;  1UFH A;  5LRJ A;  4B11 A;  5G20 A;  1IYL A;  4L8A A;  3LOD A;  3TO6 A;  4XPK A;  2Z11 A;  2Z3K A;  3BHX A;  3F0A A;  1EE3 P;  2BCO A;  2V8D A;  3FIX A;  4JYW A;  2ZEG A;  5D8N A;  2P6G A;  3IEH A;  2RFH A;  4DUK A;  2XEF A;  1HEE A;  3QAY A;  2GAN A;  4NSQ A;  2J9A A;  1TKF A;  4F0X A;  1YR0 A;  3PB4 X;  3SJE A;  4M3S A;  4KVO E;  3B7I A;  3PFE A;  1UWY A;  3CXP A;  4Y49 B;  4BIN A;  4UCP A;  4B5O A;  4FUU A;  4YU9 A;  4ZY1 A;  4EME A;  3PBB A;  2Q51 A;  4M6G A;  3UY5 A;  4FBE A;  4R57 A;  1CPX A;  2QYV A;  2ZEL A;  1I1D A;  1M1D A;  1CG2 A;  2PJ2 A;  5HH1 A;  4A38 A;  4A39 A;  2DEA A;  5C82 A;  3CXS A;  4A37 A;  5I0C A;  3E0K A;  1RO5 A;  2FVG A;  1FT7 A;  4L89 A;  3T9Y A;  3LD2 A;  1PYT B;  2Z3L A;  1M4G A;  3GY9 A;  4NGS A;  4K3N A;  3SJF A;  2PJ0 A;  1XJO A;  4MCP A;  1N71 A;  2C1C A;  1ELL P;  4XPD B;  4UWJ A;  3FF3 A;  5ELY A;  3ZJ0 A;  2ZEF A;  1JQG A;  1WWZ A;  3R9F A;  4KOW A;  4YFJ A;  4CRY B;  4CRZ B;  2BUE A;  2A4N A;  4MHZ A;  3TTH A;  1F2P A;  5A28 A;  5J8C A;  1QST A;  5HVH A;  2ZEM A;  3RZA A;  1CJW A;  2G3A A;  4K30 A;  2PR1 A;  4E2A A;  2Q43 A;  1NE9 A;  2DPS A;  1CBX A;  2BEI A;  1QSR A;  1IOF A;  3R9E A;  3S6F A;  3QB8 A;  3T90 A;  4QB9 A;  2ZPA A;  2REE A;  2JDD A;  3KKW A;  2JBJ A;  4KS9 A;  5AGE A;  5LYD A;  2FIW A;  3R95 A;  3KL9 A;  5F49 A;  5THW A;  4B5P B;  2O53 A;  4NGP A;  1NSA A;  3S6K A;  4BD9 A;  4CGM A;  4HKF A;  4KOV A;  4PXB A;  4MJ8 A;  1LAM A;  4PK2 A;  2VI7 A;  4ZGY B;  3D7D A;  1TF9 A;  4HNY B;  2FS5 A;  4QBJ A;  1S7K A;  2B4D A;  3PBE A;  4AG7 A;  4II9 A;  2HQY A;  2QML A;  1BPM A;  4U5Y A;  5E96 A;  1IID A;  3FMC A;  4YWY A;  3G8W A;  2CNT A;  5LYL A;  2HC9 A;  4KVX A;  1BAV A;  3PRT A;  4UIA A;  1XFO A;  1ON0 A;  3H8F A;  5K8M A;  2O4H A;  3I9S A;  2CNS A;  2CTB A;  3PB7 X;  4P10 A;  4UFW A;  5EC4 A;  4MCQ A;  5J1Q A;  1AYE A;  1KUX A;  1M4I A;  2Y0M A;  3SJX A;  4CYO A;  3N5F A;  4LQG A;  5DWM A;  4C2X A;  2DPT A;  4MFQ A;  4UFX A;  2D4P A;  5A27 A;  3B35 A;  3KI9 A;  2AFO A;  4P4B A;  2R7H A;  2POK A;  4NGR A;  4NXY A;  4OME A;  4QVT A;  2OZG A;  3PEI A;  3NE8 A;  4H6Z A;  4X2T A;  4KLV A;  3IC1 A;  4E0A A;  1S5K A;  4DJL A;  1XE4 A;  3TO9 A;  2Q7B A;  1Z8T A;  2ZW4 A;  3PZJ A;  4AG9 A;  4DNC A;  4ONW A;  2OR4 A;  2NSM A;  4MHD A;  4C2Z A;  2AFX A;  1Y0R A;  4A32 A;  1MJA A;  3DDD A;  2WUU A;  3EXN A;  5CPA A;  3DLJ A;  5F48 A;  4FD5 A;  1LAP A;  5HMN A;  4JWP A;  4R3K A;  4R7M A;  1WK4 A;  2HB6 A;  2BL1 A;  2PQ8 A;  4H89 A;  4ONU A;  4R6T A;  3D7H A;  3W6X A;  4F8Z A;  1YGH A;  4UCN A;  2ZEN A;  3MN8 A;  2P6F A;  4OP4 A;  4NFR A;  5G22 A;  2EO8 A;  2Q0Y A;  3FEC A;  4F9U A;  1I21 A;  3IFE A;  5CBM A;  1S60 A;  3DR6 A;  5AG7 A;  3NFZ A;  4YGO A;  4PQA A;  2BO9 A;  4KVM E;  2AFS A;  2PJ7 A;  5GCN A;  4CGO A;  3PB9 X;  5K8P A;  3DGV A;  1F57 A;  1Z4E A;  1VGY A;  2WZN A;  4NF1 A;  2ZXV A;  4MCR A;  1NSL A;  4A33 A;  3SXN A;  2RC4 A;  2X7B A;  1XOV A;  4U9Z A;  4OC3 A;  1XIX A;  3PP9 A;  3VWD A;  3CPA A;  1TF8 A;  3H8G A;  2I3C A;  2PJ4 A;  1FNO A;  2GFQ A;  4MBU A;  4MI4 A;  4MHY A;  3FXT A;  1R3N A;  4CGN A;  4CPA A;  2PJ6 A;  3V38 A;  1P0H A;  4QUS A;  4JLY A;  2YNE A;  8CPA A;  1RTQ A;  4ZI6 A;  1Z2L A;  2Q4V A;  3QAH A;  5DS0 A;  2I79 A;  4XNH C;  4O23 A;  4Q36 A;  2VBQ A;  3FYN A;  2PVV A;  1TIQ A;  1MJ9 A;  4E8O A;  4EWT A;  3D2M A;  4JZ0 A;  5JGF A;  3D8P A;  3FJU A;  2FT0 A;  4JXR A;  2PCU A;  1TKH A;  5LRG A;  3FB3 A;  1CPS A;  3OWC A;  4LQ6 A;  2R98 A;  4UEF A;  1IGB A;  1U6M A;  4PXC A;  5LRK A;  5ISV A;  5JQ4 A;  3KHZ A;  4A94 A;  4UEZ A;  3P2F A;  4CGL A;  3WC7 A;  2V8V A;  2ZEP A;  5KTA A;  1DE4 C;  4P4F A;  4OC1 A;  4A30 A;  1L0C A;  3S9M A;  1YK3 A;  4GS4 A;  2Z0Z A;  2NYQ A;  3MGD A;  5K8O A;  3FH4 A;  1SQH A;  2AE6 A;  1B87 A;  3IJ3 A;  2PJB A;  4NGN A;  3SXO A;  3W91 A;  2YND A;  2YNC A;  4JD6 A;  3BXM A;  3DR8 A;  4NGT A;  4AB7 A;  3D67 A;  1Z8W A;  4CAV A;  5H86 A;  1YW6 A;  4MHN A;  1Y7R A;  1Z5R A;  4ORF A;  1IB1 E;  4P44 A;  3TO7 A;  2P0W A;  5KTD A;  3B3C A;  5CNP A;  3RBU A;  2AFW A;  3NH8 A;  1KWM A;  2AFU A;  1YW4 A;  2CTC A;  7CPA A;  2XEG A;  4F9V A;  1Y0Y A;  3KR4 A;  4AVA A;  1QSM A;  1Y7E A;  3EY5 A;  4A95 A;  2DF5 A;  2D4O A;  5AG6 A;  1S7L A;  2JEV A;  4OAD A;  2PVW A;  3GUX A;  4KOX A;  2OZH A;  4R87 A;  4X3R A;  4XPL A;  4IAV A;  2FL4 A;  4X8I A;  4TWE A;  4IF5 A;  5C88 A;  4C68 A;  1M4D A;  1ARL A;  4F0Y A;  4ZYQ A;  2JBK A;  5HXD A;  1KUV A;  5H84 A;  4B5P A;  4MY3 A;  1XBU A;  4G1P A;  5G21 A;  3SI0 A;  4XNH B;  4OC4 A;  4Q7A A;  4B6Z A;  2IL4 A;  2GLJ A;  3K9T A;  3D3S A;  3GKR A;  4MY0 A;  2G9D A;  4KOT A;  2VQY A;  3V8I A;  3VH9 A;  5AG4 A;  2F8H A;  4PPZ A;  2VXK A;  2OOT A;  4KUA A;  2PE3 A;  3PFO A;  3RYO A;  1ZLI A;  2FIA A;  1OBR A;  2V77 A;  2VZY A;  2JEW A;  3VAR A;  1QSO A;  2CY2 A;  3SI1 A;  3W6S A;  4RUH A;  3TOB A;  2EK8 A;  2BSW A;  2AFZ A;  4KZT A;  3S9L A;  4Q38 A;  4U9Y A;  2QJ8 A;  3QNV A;  1HDQ A;  1Q7L A;  2EWB A;  4W9Y A;  2ZOF A;  2RB7 A;  1AUG A;  1ZG8 A;  3TFY A;  2F5I A;  3NH4 A;  1Y9W A;  4M6I A;  3ZZI A;  4CYP A;  4PSX A;  1KZF A;  2Z3M A;  3BLN A;  4MMO A;  2B4D B;  3LMS A;  5IV0 A;  2ANP A;  3CZX A;  1QQ9 A;  3NE7 A;  3TT2 A;  2ARH A;  3D7F A;  4C2Y A;  4CYQ A;  1YX0 A;  4ZY2 A;  2Z3P A;  4X5K A;  5HVG A;  3B8G A;  1YSJ A;  4KSI A;  2QVP A;  4B12 A;  2QIR A;  3FX6 A;  2BOA A;  1Z9U A;  2G0B A;  4B10 A;  3IGR A;  3DNS A;  1YVK A;  2ABZ A;  2PJC A;  5LYF A;  1BLL E;  3PB8 X;  2Q4Y A;  3PGP A;  4PK3 A;  3ISZ A;  3S6H A;  3G3S A;  1HDU A;  3LWU A;  3RAM A;  2FXF A;  2XEI A;  1OZP A;  3VAT A;  1I12 A; 
#chains in the Genus database with same CATH homology
 1S7F A;  4H6U A;  4OLL A;  2OU2 A;  5KTC A;  2FSR A;  2C27 A;  3JTK A;  4KSF A;  2WPW A;  1YLE A;  3F8K A;  2OZU A;  1Y9K A;  2PSW A;  4AVB A;  2B58 A;  4M85 A;  2NMT A;  4CAE A;  1XF8 A;  2OB0 A;  1Q2C A;  5EBV A;  2AJ6 A;  4KOY A;  1K4J A;  2Z3O A;  3IWE A;  4HNW B;  4FD6 A;  2K5T A;  5IB0 A;  4A31 A;  4KOR A;  4MFJ A;  4EVY A;  2B3V A;  1IYK A;  4KUB A;  2JDC A;  4J3G A;  2WPX A;  4CS0 B;  5F46 A;  1BOB A;  1KUY A;  1NMT A;  2DXQ A;  3A9L A;  4RS2 A;  2VZZ A;  3R9G A;  3D2P A;  3IU1 A;  2QEC A;  3BJ7 A;  3CXQ A;  1XEB A;  2B5G B;  1B6B A;  1IIC A;  3C26 A;  5FVJ A;  1ZO0 A;  4CGP A;  2OH1 A;  3TE4 A;  4I49 A;  3BJ8 A;  3FRM A;  2YGW A;  2JLM A;  4OAE A;  4UCM A;  4NCZ A;  1GHE A;  2CNM A;  3EO4 A;  4KSA A;  1FY7 A;  2HUZ A;  4B13 A;  2VEZ A;  1YRE A;  2PDO A;  4B14 A;  3P2H A;  4CAX A;  2G3T A;  4ZBG A;  1MK4 A;  2R8V A;  1Z4R A;  4CYN A;  4MFL A;  4QC6 A;  2GE3 A;  4NEX A;  1LRZ A;  4CAF A;  1Q2Y A;  2Q04 A;  3GYA A;  3JVN A;  4KOS A;  2ATR A;  3WR7 A;  4KOU A;  2ZW7 A;  5F47 A;  3JUW A;  4C7I A;  1YVO A;  2PC1 A;  1Q2D A;  1PU9 A;  3VWE A;  3TOA A;  2J8R A;  5J8F A;  4UBR A;  4BMH A;  3IWG A;  2GIV A;  3H4Q A;  2J8M A;  2Z10 A;  5G1Z A;  3I3G A;  2CXA A;  1M44 A;  5JPH A;  2B4B A;  2FCK A;  4LUA A;  4IUS A;  4UWI A;  1BO4 A;  1I12 A;  3K9U A;  2EUI A;  4A2Z A;  4FD4 A;  4PV6 A;  4RI1 A;  4MFP A;  4BBH A;  1S7N A;  1XMT A;  1P4N A;  2KCW A;  4UFV A;  4JXQ A;  3EFA A;  2H5M A;  1R57 A;  2WSA A;  4R9M A;  4MFK A;  4MFZ A;  4PSW A;  3H5Z A;  3SHP A;  3N7Z A;  2FE7 A;  4Y49 C;  4AVC A;  1S3Z A;  5DWN A;  2EVN A;  3FNC A;  5BWA B;  3DSB A;  4R3L A;  2REF A;  4UA3 A;  2Q44 A;  4KLW A;  2J8N A;  1J4J A;  2O28 A;  4CAW A;  3EC4 A;  1MJB A;  2YNC C;  5IX3 A;  2ZW5 A;  5AG5 A;  3IU2 A;  1PUA A;  4FD7 A;  3R1K A;  4C7H A;  1QSN A;  1VHS A;  1VKC A;  2P6E A;  2I00 A;  4XPD C;  4LX9 A;  3TCV A;  3F5B A;  4F6A A;  3FBU A;  3S6G A;  1V0C A;  2B3U A;  2Z3N A;  2PRB A;  1RXT A;  4YRH A;  3R96 A;  1CM0 A;  2HV2 A;  2ZW6 A;  4JJX A;  2B5G A;  4HNX B;  2R1I A;  1UFH A;  4B11 A;  5G20 A;  1IYL A;  4L8A A;  3LOD A;  3TO6 A;  4XPK A;  2Z11 A;  2Z3K A;  3F0A A;  3FIX A;  2P6G A;  4NSQ A;  2GAN A;  4F0X A;  1YR0 A;  4M3S A;  4KVO E;  3CXP A;  4Y49 B;  4UCP A;  4B5O A;  3UY5 A;  4R57 A;  1I1D A;  1M1D A;  5HH1 A;  5C82 A;  3CXS A;  5I0C A;  3E0K A;  1RO5 A;  4L89 A;  3T9Y A;  3LD2 A;  2Z3L A;  1M4G A;  3GY9 A;  1N71 A;  4XPD B;  4UWJ A;  3ZJ0 A;  1WWZ A;  3R9F A;  4KOW A;  4YFJ A;  4CRY B;  4CRZ B;  2BUE A;  2A4N A;  3TTH A;  5J8C A;  5A28 A;  1QST A;  1CJW A;  2G3A A;  4K30 A;  2PR1 A;  4E2A A;  1NE9 A;  2DPS A;  2BEI A;  1QSR A;  3R9E A;  3S6F A;  3QB8 A;  3T90 A;  4QB9 A;  2ZPA A;  2REE A;  2JDD A;  3KKW A;  4KS9 A;  5AGE A;  2FIW A;  3R95 A;  5F49 A;  4B5P B;  3S6K A;  4CGM A;  4HKF A;  4KOV A;  4MJ8 A;  4PK2 A;  4ZGY B;  2VI7 A;  4HNY B;  2FS5 A;  4QBJ A;  1S7K A;  2B4D A;  4AG7 A;  4II9 A;  2HQY A;  2QML A;  4U5Y A;  5E96 A;  1IID A;  3G8W A;  2CNT A;  4KVX A;  1ON0 A;  4UFW A;  3I9S A;  2CNS A;  5EC4 A;  1KUX A;  1M4I A;  4CYO A;  2Y0M A;  5DWM A;  4C2X A;  2DPT A;  4MFQ A;  4UFX A;  2D4P A;  5A27 A;  2R7H A;  4NXY A;  4QVT A;  2OZG A;  4H6Z A;  4KLV A;  4E0A A;  1S5K A;  1XE4 A;  3TO9 A;  2Q7B A;  2ZW4 A;  3PZJ A;  4AG9 A;  4DNC A;  4C2Z A;  4MHD A;  4A32 A;  1MJA A;  3DDD A;  2WUU A;  3EXN A;  5F48 A;  4FD5 A;  5HMN A;  4JWP A;  4R3K A;  1WK4 A;  2BL1 A;  2PQ8 A;  4H89 A;  4ONU A;  3W6X A;  1YGH A;  4UCN A;  2P6F A;  5G22 A;  2Q0Y A;  1I21 A;  1S60 A;  3DR6 A;  5AG7 A;  4YGO A;  4KVM E;  5GCN A;  4CGO A;  1Z4E A;  4NF1 A;  2ZXV A;  1NSL A;  4A33 A;  3SXN A;  2RC4 A;  2X7B A;  4U9Z A;  1XIX A;  3PP9 A;  3VWD A;  4MI4 A;  4MBU A;  3FXT A;  4CGN A;  1P0H A;  4QUS A;  4JLY A;  2YNE A;  2Q4V A;  3QAH A;  2I79 A;  4XNH C;  4Q36 A;  2VBQ A;  3FYN A;  1TIQ A;  1MJ9 A;  4E8O A;  3D2M A;  3D8P A;  4JXR A;  2FT0 A;  3FB3 A;  3OWC A;  2R98 A;  1U6M A;  5ISV A;  5JQ4 A;  3P2F A;  4CGL A;  5KTA A;  4A30 A;  1L0C A;  1YK3 A;  4GS4 A;  2Z0Z A;  3MGD A;  1SQH A;  2AE6 A;  1B87 A;  3SXO A;  3W91 A;  4AB7 A;  2YND A;  2YNC A;  4JD6 A;  3DR8 A;  4CAV A;  5H86 A;  4ORF A;  1Y7R A;  3TO7 A;  1IB1 E;  2P0W A;  5KTD A;  5CNP A;  4AVA A;  1QSM A;  3EY5 A;  4A95 A;  2D4O A;  5AG6 A;  1S7L A;  2JEV A;  4OAD A;  4KOX A;  4R87 A;  2OZH A;  4XPL A;  2FL4 A;  4IF5 A;  5C88 A;  4C68 A;  1M4D A;  4F0Y A;  1KUV A;  5H84 A;  4B5P A;  4MY3 A;  5G21 A;  4XNH B;  2IL4 A;  3D3S A;  3GKR A;  4MY0 A;  4KOT A;  2VQY A;  3V8I A;  5AG4 A;  2VXK A;  4KUA A;  3RYO A;  2FIA A;  2VZY A;  1QSO A;  2CY2 A;  3W6S A;  3TOB A;  2BSW A;  4KZT A;  4Q38 A;  4U9Y A;  3TFY A;  2F5I A;  1Y9W A;  3ZZI A;  4CYP A;  4PSX A;  1KZF A;  2Z3M A;  3BLN A;  2B4D B;  5IV0 A;  3NE7 A;  3TT2 A;  2ARH A;  4C2Y A;  4CYQ A;  1YX0 A;  2Z3P A;  4X5K A;  3B8G A;  4B12 A;  2QIR A;  1Z9U A;  2G0B A;  4B10 A;  3IGR A;  3DNS A;  1YVK A;  2Q4Y A;  3PGP A;  4PK3 A;  3S6H A;  3G3S A;  2FXF A;  1OZP A;  2PR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...