2B3VA

Spermine spermidine acetyltransferase in complex with acetylcoa, k26r mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
167
structure length
167
Chain Sequence
FVIRPATAADCSDILRLIKELARYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Diamine acetyltransferase 1
publication title Structures of wild-type and mutant human spermidine/spermine N1-acetyltransferase, a potential therapeutic drug target.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 167
sequence length 167
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2005-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2b3vA00
3PGPA 2OU2A 4AG9A 2VBQA 4MY3A 3NE7A 2OZUA 3TE4A 2VXKA 4JJXA 3FIXA 2CNMA 1M44A 4QB9A 1GHEA 2QMLA 3TT2A 2PR1A 1S60A 2OB0A 1QSMA 1S7NA 3CXPA 4JD6A 3S6HA 3I9SA 3MGDA 3D3SA 4UWIA 1L0CA 3FXTA 2OZHA 1KUVA 1QSOA 3G8WA 4MHDA 4U9YA 5H86A 1QSTA 2FXFA 2CNSA 5F49A 4LUAA 4R57A 3TTHA 4F6AA 2FE7A 4KUAA 1UFHA 2ATRA 2PC1A 1Q2YA 1IICA 3F0AA 2A4NA 4B5PB 4JLYA 3CXSA 3DR8A 4KUBA 4JWPA 1YX0A 4J3GA 2HUZA 4JXQA 4R3KA 1SQHA 2VEZA 2JDCA 2J8NA 4KOTA 2REFA 3TFYA 1IYKA 5DWNA 1Z9UA 2WPXA 5KTAA 4PSWA 4FD6A 2HV2A 1B6BA 4MI4A 4KLWA 4IF5A 4KORA 3EO4A 4HNYB 4XNHB 5IX3A 4OLLA 2Z10A 2P6EA 1B87A 3F5BA 3ZJ0A 3W6SA 2GIVA 2B4DB 1U6MA 1OZPA 3GKRA 4XNHC 1VKCA 2JDDA 4L89A 5GCNA 1M1DA 2VI7A 1IIDA 2B3UA 3IGRA 2CY2A 4BMHA 2ARHA 4CRZB 4IUSA 1MJ9A 1MK4A 3PZJA 2P6FA 3IWGA 4KOYA 1RXTA 4MY0A 4HNWB 1M4IA 4QC6A 3BJ7A 1VHSA 1NE9A 3R9GA 4E2AA 5FVJA 1N71A 3TO9A 1ON0A 5F48A 4Y49B 3N7ZA 3UY5A 2PRBA 4XPDB 3EXNA 4ZBGA 1M4DA 2ZPAA 1S7KA 1Z4EA 2X7BA 3RYOA 4CRYB 4DNCA 3FRMA 4NF1A 4Y49C 1Z4RA 3SXOA 3R9FA 4XPDC 1LRZA 2B5GA 2B3VA 4H89A 3JUWA 3VWDA 5C82A 4R3LA 5I0CA 4H6UA 2RC4A 3EC4A 2PR8A 3R9EA 1QSNA 4KVXA 5JQ4A 4M3SA 1WWZA 2VQYA 3QAHA 5KTCA 3E0KA 2Q4YA 4KOVA 4GS4A 1YK3A 2PSWA 2GE3A 3B8GA 1S5KA 2ZW7A 5J8FA 1YREA 4KVOE 4H6ZA 3CXQA 5EBVA 1XIXA 3K9UA 4CAVA 2HQYA 3DDDA 3TCVA 3F8KA 2D4PA 1YLEA 1KUXA 4B5OA 1IB1E 2EUIA 5EC4A 4FD4A 4XPKA 3D2PA 1PU9A 1P4NA 2BL1A 3R96A 3T90A 2PQ8A 1J4JA 1R57A 5HMNA 3TOAA 2FIWA 1YVOA 1I21A 3WR7A 4RS2A 1I12A 2OH1A 4MJ8A 1TIQA 1S7FA 3DSBA 2GANA 2J8MA 4ORFA 4QBJA 4KVME 4KOUA 1RO5A 3P2HA 2KCWA 2BUEA 4AVAA 1YR0A 3W91A 4UWJA 1V0CA 4NXYA 1WK4A 4KZTA 2B4BA 2K5TA 2G3AA 2J8RA 2QIRA 3JVNA 3FBUA 1S3ZA 4PSXA 2B5GB 2FIAA 2ZW5A 3BJ8A 1YGHA 3P2FA 1XMTA 2BSWA 5HH1A 1XF8A 5CNPA 1MJAA 1CJWA 1XE4A 5KTDA 3FYNA 3FNCA 4LX9A 5J8CA 4L8AA 2VZZA 2EVNA 4II9A 5F47A 4B5PA 3R1KA 2NMTA 2VZYA 4AVCA 3TO6A 1I1DA 4U5YA 3EFAA 4PK2A 2D4OA 4AVBA 2C27A 4NEXA 4QVTA 2Y0MA 4RI1A 1FY7A 2G3TA 5JPHA 5F46A 3SHPA 3R95A 3PP9A 2OZGA 2DXQA 4UBRA 3VWEA 4ONUA 1MJBA 4K30A 1Y7RA 4E0AA 2ZXVA 3FB3A 2P0WA 4U9ZA 4KOWA 4PV6A 1K4JA 2O28A 5ISVA 2B58A 1BOBA 2B4DA 5H84A 4XPLA 4KOXA 4PK3A 5IB0A 4M85A 3LD2A 2Z0ZA 2FCKA 3TOBA 2Q4VA 4CS0B 3V8IA 2FS5A 2ZW4A 4I49A 2ZW6A 2F5IA 3S6KA 3BLNA 1YVKA 4NCZA 2Q7BA 2FSRA 3W6XA 4OADA 3OWCA 3H4QA 2IL4A 1P0HA 5E96A 1Q2DA 2R98A 2H5MA 4CAXA 3D2MA 1BO4A 1XEBA 1CM0A 1KZFA 2FL4A 3QB8A 3DNSA 3EY5A 4QUSA 3GYAA 2PDOA 4AG7A 4E8OA 2REEA 1IYLA 2Q44A 5IV0A 4YRHA 3LODA 1QSRA 4EVYA 3SXNA 4FD7A 4YFJA 5DWMA 4KLVA 2JEVA 2CNTA 3KKWA 2Q04A 3ZZIA 2WPWA 2AJ6A 2G0BA 1M4GA 3S6GA 4R87A 3T9YA 2P6GA 4MBUA 3S6FA 2I79A 2AE6A 2QECA 3D8PA 2Z11A 3GY9A 4UA3A 2JLMA 3G3SA 2R7HA 4HNXB 4YGOA 4OAEA 4NSQA 1NMTA 1Y9KA 1PUAA 3I3GA 4KOSA 1NSLA 4F0YA 2Q0YA 4JXRA 1Y9WA 1KUYA 2FT0A 3TO7A 4AB7A 3C26A 5C88A 2BEIA 4R9MA 2I00A 1Q2CA 1S7LA 4X5KA 2R1IA 4CAWA 4FD5A 3DR6A 2R8VA 4HKFA
chains in the Genus database with same CATH superfamily
3PGPA 2OU2A 1JQGA 4JYWA 4AG9A 1F57A 2YNEA 1X10A 4OIDA 2VBQA 4MY3A 3WC5A 3BHXA 1OBRA 3FH4A 3SJXA 3TC8A 3IU1A 2RFHA 2OZUA 3NE7A 4BINA 4MFJA 3TE4A 2PRQA 2VXKA 1HDQA 4JJXA 4RN7A 1KWMA 1IOIA 3FIXA 5AG4A 4M6GA 2CNMA 4OC1A 3S9NA 3RBUA 2GU2A 4UCPA 3SJEA 1M44A 3NA6A 4QB9A 3H8FA 4HPSA 1GHEA 2QMLA 3TT2A 2PR1A 1S60A 2OB0A 1QSMA 1S7NA 3CXPA 3FEEA 4NGNA 4FAIA 2Q4ZA 4JD6A 2PJ7A 2V77A 2ZEEA 3D3SA 3I9SA 3MGDA 2IJZA 3S6HA 5K8NA 4UWIA 1L0CA 4R7MA 3FXTA 1Z8XA 2OZHA 1KUVA 2AFUA 1QSOA 3G8WA 3QAYA 4MHDA 4U9YA 5H86A 4UF4A 1QSTA 2GLJA 2EBJA 2FXFA 2R8VA 4FBEA 3D7GA 5F49A 4LUAA 3HLPA 4B10A 4F8ZA 3KQZA 4R57A 5G22A 3TTHA 4F6AA 1XOVA 2FE7A 4KUAA 1UFHA 2ATRA 2PC1A 2JBJA 1Q2YA 1IICA 3F0AA 1YSJA 3LACA 3CDXA 3VATA 2A4NA 4B5PB 4JLYA 4F9UA 4CGMA 3QNVA 3CXSA 3PFEA 2ZEOA 4UFVA 3DR8A 4KUBA 5A28A 4JWPA 2ZEFA 4KSIA 1YX0A 2BCOA 3GB0A 4FWUA 2HUZA 4J3GA 2DEAA 2ZEGA 4JXQA 3SJFA 4B6ZA 3B3VA 3PFOA 5D29A 4R3KA 3PB6X 4W9YA 4CGLA 1SQHA 5J1QA 2VEZA 4UFXA 2F8HA 4P4BA 2NYQA 2V8VA 2JDCA 4H2KA 4C2ZA 2EK9A 2J8NA 3NH5A 4KOTA 2REFA 4UIAA 3TFYA 8CPAA 2YNDA 1IYKA 5DWNA 4ZI6A 2WUUA 1Z9UA 2WPXA 1LCPA 5KTAA 5LYIA 3PB7X 4CYNA 2Q7SA 2YNCA 4PSWA 4C7IA 4FD6A 2ZOGA 3SI0A 4NGMA 2HV2A 1B6BA 2PJ9A 4MI4A 2ZEDA 4R8FA 4UEFA 4KLWA 4IF5A 4KORA 3EO4A 2EO8A 4HNYB 4XNHB 5JH9A 3FMCA 3NH8A 3B3WA 5IX3A 3IWEA 2VL1A 4OLLA 1VHOA 1Y0RA 2P6EA 2Z10A 4HKFA 1B87A 3CZXA 4IAVA 2ZELA 2PJ5A 2V8GA 1Y0YA 1Q7LA 3F5BA 1ZLHA 3BXMA 3ZJ0A 3W6SA 2GIVA 4FUUA 4MHPA 4A30A 2B4DB 1U6MA 1OZPA 3GKRA 4XNHC 1VKCA 4A2ZA 1M4LA 2JDDA 3D66A 4L89A 5GCNA 4KS9A 1CPXA 1M1DA 2VI7A 3IFEA 4OKOA 4A33A 4C2XA 4CGNA 5HVGA 1IIDA 1Z8TA 2B3UA 4GXHA 4PXEA 3IGRA 3D68A 2AFWA 4MHZA 1CP7A 1HDUA 2CY2A 4C68A 2IQ6A 4PXCA 4ZX9A 4NGRA 4BMHA 4P4IA 1Z5RA 2ARHA 5ELYA 4DUKA 5LRGA 4CRZB 2JBKA 3B3CA 4IUSA 1MJ9A 1MK4A 3PZJA 3K9TA 2P6FA 3IWGA 4KOYA 1RXTA 4MY0A 1F2PA 4HNWB 1M4IA 2CIJA 4QC6A 3V38A 3BJ7A 3H8EA 1ZLIA 2PJ4A 1VHSA 2QYVA 2Z3NA 3B3TA 4OC3A 4P4FA 4EWTA 1NE9A 3R9GA 4E2AA 3IO1A 5FVJA 1N71A 3TO9A 1ON0A 4WWVA 4MHYA 3FECA 5F48A 3WC7A 3IU2A 4PPZA 3PRTA 1UWYA 4WJBA 4Y49B 1YMEA 1TKHA 2JEWA 3N7ZA 4K3NA 3UY5A 2PRBA 1ZG8A 3B35A 3EXNA 4NGQA 4XPDB 5HXDA 4ZBGA 2BOAA 2NSMA 1M4DA 2ZPAA 2PVVA 1S7KA 1Z4EA 2X7BA 5D8NA 4OMEA 3RYOA 4CRYB 4DNCA 2I3CA 3FRMA 4NF1A 1IOFA 1Z4RA 1FT7A 2QJ8A 4P4DA 4Y49C 2Z3OA 3SXOA 5K8PA 3R9FA 1BLLE 4NJRA 4XPDC 1LRZA 2AFMA 3NH4A 5K8MA 2CTBA 2B5GA 2B3VA 2O4HA 4H89A 3JUWA 2O53A 3VWDA 1Y7EA 5C82A 4R3LA 5I0CA 4TWEA 2YNCC 3RZAA 4H6UA 1AMPA 1VIXA 2RC4A 3PB9X 2PR8A 5AGEA 1ZG7A 1QSNA 4KVXA 4ONWA 3KQXA 3R9EA 7CPAA 2PCUA 4YWYA 3FX6A 4MCRA 3BI0A 5JQ4A 4P6YA 1ARLA 1WWZA 2VQYA 3QAHA 4M3SA 4B13A 5KTCA 3K2KA 5I4MA 3E0KA 2Q4YA 3RAMA 3CPAA 4GS4A 4KOVA 1YK3A 2PSWA 1PCAA 2GE3A 4OP4A 3VH9A 3B8GA 1S5KA 4MMOA 2ZW7A 5IB9A 5J8FA 1YLOA 2PJ1A 2V8HA 1YREA 4KVOE 4H6ZA 2F7VA 3CXQA 3KL9A 1XRYA 5EBVA 1GYTA 1XIXA 3K9UA 4CAVA 2HQYA 3DDDA 2Z3LA 3F8KA 3TCVA 3ISXA 2G9DA 4M6HA 3BI1A 4MCPA 4IHMA 4NGPA 4R76A 4MFLA 4M6IA 2D4PA 1Z2LA 1YLEA 1KUXA 2DPTA 4UEEA 4B5OA 1IB1E 1TF9A 3D4UA 3FJUA 3IJ3A 2GREA 4A31A 2EUIA 4G1PA 4MHNA 5EC4A 3ISZA 4FD4A 2XEJA 2ODFA 4XPKA 4P10A 1F2OA 3D2PA 4UCMA 2ZOFA 1PU9A 1P4NA 2BL1A 3R96A 3T90A 1H8LA 2PQ8A 1J4JA 4DYOA 4EFDA 4MFZA 1R57A 5HMNA 3TOAA 1XBUA 3H8GA 2FIWA 1YVOA 4ZYQA 3A9LA 1I21A 3N5FA 4RS2A 3WR7A 3FVLA 4OC5A 1I12A 1A2ZA 2OH1A 4MJ8A 1TIQA 4NJQA 1S7FA 5G1ZA 2AFZA 3DSBA 2Z3KA 2GANA 2J8MA 4ORFA 4CGOA 1ELLP 3FEDA 4QBJA 3KR4A 4KOUA 1RO5A 2PJCA 3P2HA 4KVME 4PXDA 2KCWA 2BUEA 1LAPA 4BBHA 4AVAA 1YR0A 2ANPA 3L2NA 1CP6A 3W91A 1XMBA 4ZGYB 3GIUA 2RB7A 4UWJA 1V0CA 4NXYA 5LYDA 2Q51A 1WK4A 4KZTA 2OOTA 2B4BA 2BO9A 2K5TA 2J8RA 2G3AA 1IY7A 2QIRA 3JVNA 2CF4A 3FBUA 1X12A 1S3ZA 1Z8LA 1CBXA 2B5GB 4PSXA 5HVFA 4PQAA 2FIAA 2PJAA 2ZW5A 2WSAA 1YGHA 3BJ8A 3H5ZA 4C2YA 2AFXA 3P2FA 1XMTA 4CAEA 2BSWA 5HH1A 1XF8A 3PB8X 2ABZA 5CNPA 5K8OA 1MJAA 4RUHA 5CPAA 3WC6A 1CJWA 3KASA 1XE4A 5KTDA 1LFWA 3LMSA 3FYNA 2XEGA 3FNCA 1DTDA 4LX9A 5J8CA 4L8AA 2VZZA 5LYLA 4A95A 2EVNA 4LQGA 3CT9A 4II9A 2ZENA 4EMEA 5F47A 4B5PA 3KGQA 1QQ9A 1BPMA 3B3SA 3R1KA 2HB6A 1DE4C 3PBEA 4ZY0A 2NMTA 2IMOA 2VZYA 3MN8A 4GM5A 4AVCA 3PB4X 3TO6A 1I1DA 2J9AA 1FNOA 2ZEHA 2Q43A 2EWBA 3EFAA 4IK2A 3KHZA 4U5YA 2DPSA 3I1UA 4PK2A 2D4OA 4AVBA 2PJ6A 1AYEA 2PJ0A 3D67A 2C27A 5LYFA 4MCQA 4NEXA 4QVTA 4PXBA 4UFWA 4Z65A 2Y0MA 2PJ8A 3HUVA 4RI1A 1FY7A 2G3TA 4FD5A 5G20A 5JPHA 5F46A 3SHPA 3R95A 4P44A 4TNUA 3PP9A 3B7IA 1YQEA 2OZGA 4OC2A 6CPAA 2DXQA 4UBRA 5AG6A 3VWEA 4R6TA 2GLFA 2Z3PA 4KSAA 4ONUA 1MJBA 3GLJA 4K30A 3D7FA 2PJ3A 1Y7RA 1PYTB 4E0AA 1HEEA 4UEZA 2ZXVA 3FB3A 2P0WA 1ELMP 1VHEA 4U9ZA 4KOWA 4PV6A 1K4JA 2O28A 3IEHA 5ISVA 4YU9A 5BWAB 5AG5A 2B58A 3D7HA 4B14A 1EE3P 4Q38A 4X3RA 1BOBA 2B4DA 3SI2A 1CG2A 4LQ6A 1JWQA 2PJBA 5H84A 4MXUA 4XPLA 3DGVA 4KOXA 4MFKA 4NGTA 4PK3A 2PJ2A 3KZWA 5IB0A 2V8DA 4M85A 3LD2A 4MFQA 2Z0ZA 4UCNA 2PIZA 2FCKA 3T8WA 3TOBA 4A39A 2Q4VA 4CS0B 3V8IA 2FS5A 4DJLA 4CYQA 2ZW4A 1LOKA 1NSAA 4I49A 2ZW6A 2F5IA 3S6KA 3BLNA 1YVKA 5JGFA 2C6GA 4NCZA 1R3NA 2Q7BA 2FSRA 3W6XA 3B2YA 4OADA 4OIWA 3OWCA 4Q36A 3H4QA 4OC4A 2IL4A 1P0HA 2PVWA 1XJOA 1Q2DA 5E96A 2R98A 4AXVA 2H5MA 4B12A 3JRUA 4BD9A 1BAVA 2WYRA 3FF3A 3RNZA 4CAXA 3D2MA 2QVPA 1BO4A 1ZO0A 1XEBA 1CM0A 4CAFA 4MCSA 4CGPA 2GFQA 3TX8A 1KZFA 2DF5A 2FL4A 3QB8A 2XEFA 3DNSA 3EY5A 5F09A 4QUSA 2CXAA 3GYAA 2PDOA 2WZNA 4AG7A 4E8OA 4ZX8A 2REEA 3JTKA 1IYLA 2Q44A 1LAMA 4C7HA 3KHXA 5IV0A 2CTCA 2FVGA 4YRHA 1Z8WA 2OR4A 1RTQA 2C6PA 1YW4A 3KI9A 3LWUA 3LODA 4A37A 2YGWA 1QSRA 4EVYA 3SXNA 3PEIA 4FD7A 5THWA 4YFJA 4NGSA 2C1CA 4P4EA 5G21A 5DWMA 2EK8A 4KLVA 5JM6A 2JEVA 3V7ZA 1R43A 3MRUA 3PBBA 2CNTA 3KKWA 4Q7AA 2Q04A 3NFZA 3NE8A 4KSFA 5EMIA 3CPXA 5DS0A 3ZZIA 3WABA 2WPWA 3S9MA 4MRIA 4JZ0A 2PIYA 2AJ6A 2C6CA 2G0BA 1VGYA 3IWWA 1M4GA 3S6GA 4R87A 3T9YA 2P6GA 4MBUA 4X2TA 4A32A 3S6FA 4F0XA 3D7DA 1IU8A 1AUGA 2I79A 3SJGA 1TF8A 2AE6A 2QECA 3IC1A 4OC0A 1CX8A 3D8PA 1BPNA 2Z11A 5CBMA 3KR5A 4B11A 4P45A 3GUXA 2PE3A 3GY9A 4UA3A 1QMUA 5A27A 2JLMA 4MFPA 4X8IA 3G3SA 2AFSA 2R7HA 4A94A 4HNXB 3S9LA 4YGOA 4P4JA 1TXRA 4O23A 4CPAA 1XFOA 1CPSA 4F9VA 1TKJA 4OAEA 4ZY2A 1IGBA 1YW6A 4NFRA 4NSQA 1NMTA 1Y9KA 1PUAA 3I3GA 4KOSA 2HC9A 1NSLA 4F0YA 2Q0YA 2Z3MA 3SI1A 4CYPA 4JXRA 1Y9WA 1KUYA 2FT0A 2XEIA 4A38A 4CYOA 3VARA 3TO7A 4AB7A 3IIBA 5AG7A 5LRKA 3C26A 5HVHA 1ARMA 1TKFA 5C88A 2BEIA 3DLJA 5LRJA 3RO0A 4R9MA 4ZY1A 1ZG9A 3WT4A 2I00A 1Q2CA 1S7LA 4X5KA 2POKA 4UIBA 2R1IA 2ZEMA 4CAWA 2AFOA 3EC4A 3DR6A 2CNSA 2ZEPA 1LANA
chains in the Genus database with same CATH topology
3PGPA 2OU2A 4AG9A 2YNEA 2VBQA 4MY3A 3IU1A 3NE7A 2OZUA 4MFJA 3TE4A 2VXKA 4JJXA 3FIXA 5AG4A 2CNMA 4UCPA 1M44A 4QB9A 1GHEA 2QMLA 3TT2A 2PR1A 1S60A 2OB0A 1QSMA 1S7NA 3CXPA 4JD6A 3S6HA 3I9SA 3MGDA 3D3SA 4UWIA 1L0CA 3FXTA 2OZHA 1KUVA 1QSOA 3G8WA 4MHDA 4U9YA 5H86A 1QSTA 2FXFA 2CNSA 5F49A 4LUAA 4B10A 4R57A 5G22A 3TTHA 4F6AA 2FE7A 4KUAA 1UFHA 2ATRA 2PC1A 1Q2YA 1IICA 3F0AA 2A4NA 4B5PB 4JLYA 4CGMA 3CXSA 4UFVA 5A28A 3DR8A 4KUBA 4JWPA 1YX0A 4J3GA 2HUZA 4JXQA 4R3KA 4CGLA 1SQHA 2VEZA 4UFXA 2JDCA 4C2ZA 2J8NA 4KOTA 2REFA 3TFYA 2YNDA 1IYKA 5DWNA 2WUUA 1Z9UA 2WPXA 5KTAA 4CYNA 4PSWA 2YNCA 4C7IA 4FD6A 2HV2A 1B6BA 4MI4A 4KLWA 4IF5A 4KORA 3EO4A 4HNYB 4XNHB 5IX3A 3IWEA 4OLLA 2Z10A 2P6EA 1B87A 3F5BA 3ZJ0A 3W6SA 2GIVA 4A30A 2B4DB 1U6MA 1OZPA 3GKRA 4XNHC 1VKCA 4A2ZA 2JDDA 4L89A 5GCNA 4KS9A 1M1DA 2VI7A 4CGNA 4A33A 4C2XA 1IIDA 2B3UA 3IGRA 2CY2A 4C68A 4BMHA 2ARHA 4CRZB 4IUSA 1MJ9A 1MK4A 3PZJA 2P6FA 3IWGA 4KOYA 1RXTA 4MY0A 4HNWB 1M4IA 4QC6A 3BJ7A 1VHSA 2Z3NA 1NE9A 3R9GA 4E2AA 5FVJA 1N71A 3TO9A 1ON0A 5F48A 3IU2A 4Y49B 3N7ZA 3UY5A 2PRBA 4XPDB 3EXNA 4ZBGA 1M4DA 2ZPAA 1S7KA 1Z4EA 2X7BA 3RYOA 4CRYB 4DNCA 3FRMA 4NF1A 4Y49C 1Z4RA 2Z3OA 3SXOA 3R9FA 4XPDC 1LRZA 2B5GA 2B3VA 4H89A 3JUWA 3VWDA 5C82A 4R3LA 5I0CA 2YNCC 4H6UA 2RC4A 3EC4A 5AGEA 2PR8A 3R9EA 1QSNA 4KVXA 5JQ4A 4M3SA 1WWZA 2VQYA 3QAHA 4B13A 5KTCA 3E0KA 2Q4YA 4KOVA 4GS4A 1YK3A 2PSWA 2GE3A 3B8GA 1S5KA 2ZW7A 5J8FA 1YREA 4KVOE 4H6ZA 3CXQA 5EBVA 1XIXA 3K9UA 4CAVA 2HQYA 3DDDA 2Z3LA 3F8KA 3TCVA 4MFLA 2D4PA 1YLEA 1KUXA 2DPTA 4B5OA 1IB1E 4A31A 2EUIA 5EC4A 4FD4A 4XPKA 3D2PA 4UCMA 1PU9A 1P4NA 2BL1A 3R96A 3T90A 2PQ8A 1J4JA 4MFZA 1R57A 5HMNA 3TOAA 2FIWA 1YVOA 3A9LA 1I21A 3WR7A 4RS2A 1I12A 2OH1A 4MJ8A 1TIQA 1S7FA 5G1ZA 3DSBA 2Z3KA 2GANA 2J8MA 4ORFA 4CGOA 4QBJA 4KVME 4KOUA 1RO5A 3P2HA 2KCWA 2BUEA 4BBHA 4AVAA 1YR0A 3W91A 4ZGYB 4UWJA 1V0CA 4NXYA 1WK4A 4KZTA 2B4BA 2K5TA 2G3AA 2J8RA 2QIRA 3JVNA 3FBUA 4CYOA 1S3ZA 4PSXA 2B5GB 2FIAA 3H5ZA 2WSAA 1YGHA 2ZW5A 3BJ8A 4C2YA 3P2FA 1XMTA 4CAEA 2BSWA 5HH1A 1XF8A 5CNPA 1MJAA 1CJWA 1XE4A 5KTDA 3FYNA 3FNCA 4LX9A 5J8CA 4L8AA 2VZZA 4A95A 2EVNA 4II9A 5F47A 4B5PA 3R1KA 2NMTA 2VZYA 4AVCA 3TO6A 1I1DA 4U5YA 3EFAA 2DPSA 4PK2A 2D4OA 4AVBA 2C27A 4NEXA 4QVTA 4UFWA 2Y0MA 4RI1A 1FY7A 2G3TA 5G20A 5JPHA 5F46A 3SHPA 3R95A 3PP9A 2OZGA 2DXQA 4UBRA 5AG6A 3VWEA 2Z3PA 4KSAA 4ONUA 1MJBA 4K30A 1Y7RA 4E0AA 2ZXVA 3FB3A 2P0WA 4U9ZA 4KOWA 4PV6A 1K4JA 2O28A 5ISVA 5BWAB 5AG5A 2B58A 4B14A 4Q38A 1BOBA 2B4DA 5H84A 4XPLA 4MFKA 4KOXA 4PK3A 5IB0A 4M85A 3LD2A 4MFQA 2Z0ZA 4UCNA 2FCKA 3TOBA 2Q4VA 4CS0B 3V8IA 2FS5A 4CYQA 2ZW4A 4I49A 2ZW6A 2F5IA 3S6KA 3BLNA 1YVKA 4NCZA 2Q7BA 2FSRA 3W6XA 4OADA 3OWCA 4Q36A 3H4QA 2IL4A 1P0HA 5E96A 1Q2DA 2R98A 4B12A 2H5MA 4CAXA 3D2MA 1BO4A 1ZO0A 1XEBA 1CM0A 4CAFA 4CGPA 1KZFA 2FL4A 3QB8A 3DNSA 3EY5A 4QUSA 2CXAA 3GYAA 2PDOA 4AG7A 4E8OA 2REEA 3JTKA 1IYLA 2Q44A 4C7HA 5IV0A 4YRHA 3LODA 2YGWA 1QSRA 4EVYA 3SXNA 4FD7A 4YFJA 5G21A 5DWMA 4KLVA 2JEVA 2CNTA 3KKWA 2Q04A 4KSFA 3ZZIA 2WPWA 2AJ6A 2G0BA 1M4GA 3S6GA 4R87A 3T9YA 2P6GA 4MBUA 4A32A 3S6FA 4F0XA 2I79A 2AE6A 2QECA 3D8PA 2Z11A 4B11A 3GY9A 4UA3A 5A27A 2JLMA 4MFPA 3G3SA 2R7HA 4HNXB 4YGOA 4OAEA 4NSQA 1NMTA 1Y9KA 1PUAA 3I3GA 4KOSA 1NSLA 4F0YA 2Q0YA 2Z3MA 4CYPA 4JXRA 1Y9WA 1KUYA 2FT0A 3TO7A 4AB7A 5AG7A 3C26A 5C88A 2BEIA 4R9MA 2I00A 1Q2CA 1S7LA 4X5KA 2R1IA 4CAWA 4FD5A 3DR6A 2R8VA 4HKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PGP A;  2OU2 A;  4AG9 A;  2VBQ A;  4MY3 A;  3NE7 A;  2OZU A;  3TE4 A;  2VXK A;  4JJX A;  3FIX A;  2CNM A;  1M44 A;  4QB9 A;  1GHE A;  2QML A;  3TT2 A;  2PR1 A;  1S60 A;  2OB0 A;  1QSM A;  1S7N A;  3CXP A;  4JD6 A;  3S6H A;  3I9S A;  3MGD A;  3D3S A;  4UWI A;  1L0C A;  3FXT A;  2OZH A;  1KUV A;  1QSO A;  3G8W A;  4MHD A;  4U9Y A;  5H86 A;  1QST A;  2FXF A;  2CNS A;  5F49 A;  4LUA A;  4R57 A;  3TTH A;  4F6A A;  2FE7 A;  4KUA A;  1UFH A;  2ATR A;  2PC1 A;  1Q2Y A;  1IIC A;  3F0A A;  2A4N A;  4B5P B;  4JLY A;  3CXS A;  3DR8 A;  4KUB A;  4JWP A;  1YX0 A;  4J3G A;  2HUZ A;  4JXQ A;  4R3K A;  1SQH A;  2VEZ A;  2JDC A;  2J8N A;  4KOT A;  2REF A;  3TFY A;  1IYK A;  5DWN A;  1Z9U A;  2WPX A;  5KTA A;  4PSW A;  4FD6 A;  2HV2 A;  1B6B A;  4MI4 A;  4KLW A;  4IF5 A;  4KOR A;  3EO4 A;  4HNY B;  4XNH B;  5IX3 A;  4OLL A;  2Z10 A;  2P6E A;  1B87 A;  3F5B A;  3ZJ0 A;  3W6S A;  2GIV A;  2B4D B;  1U6M A;  1OZP A;  3GKR A;  4XNH C;  1VKC A;  2JDD A;  4L89 A;  5GCN A;  1M1D A;  2VI7 A;  1IID A;  2B3U A;  3IGR A;  2CY2 A;  4BMH A;  2ARH A;  4CRZ B;  4IUS A;  1MJ9 A;  1MK4 A;  3PZJ A;  2P6F A;  3IWG A;  4KOY A;  1RXT A;  4MY0 A;  4HNW B;  1M4I A;  4QC6 A;  3BJ7 A;  1VHS A;  1NE9 A;  3R9G A;  4E2A A;  5FVJ A;  1N71 A;  3TO9 A;  1ON0 A;  5F48 A;  4Y49 B;  3N7Z A;  3UY5 A;  2PRB A;  4XPD B;  3EXN A;  4ZBG A;  1M4D A;  2ZPA A;  1S7K A;  1Z4E A;  2X7B A;  3RYO A;  4CRY B;  4DNC A;  3FRM A;  4NF1 A;  4Y49 C;  1Z4R A;  3SXO A;  3R9F A;  4XPD C;  1LRZ A;  2B5G A;  2B3V A;  4H89 A;  3JUW A;  3VWD A;  5C82 A;  4R3L A;  5I0C A;  4H6U A;  2RC4 A;  3EC4 A;  2PR8 A;  3R9E A;  1QSN A;  4KVX A;  5JQ4 A;  4M3S A;  1WWZ A;  2VQY A;  3QAH A;  5KTC A;  3E0K A;  2Q4Y A;  4KOV A;  4GS4 A;  1YK3 A;  2PSW A;  2GE3 A;  3B8G A;  1S5K A;  2ZW7 A;  5J8F A;  1YRE A;  4KVO E;  4H6Z A;  3CXQ A;  5EBV A;  1XIX A;  3K9U A;  4CAV A;  2HQY A;  3DDD A;  3TCV A;  3F8K A;  2D4P A;  1YLE A;  1KUX A;  4B5O A;  1IB1 E;  2EUI A;  5EC4 A;  4FD4 A;  4XPK A;  3D2P A;  1PU9 A;  1P4N A;  2BL1 A;  3R96 A;  3T90 A;  2PQ8 A;  1J4J A;  1R57 A;  5HMN A;  3TOA A;  2FIW A;  1YVO A;  1I21 A;  3WR7 A;  4RS2 A;  1I12 A;  2OH1 A;  4MJ8 A;  1TIQ A;  1S7F A;  3DSB A;  2GAN A;  2J8M A;  4ORF A;  4QBJ A;  4KVM E;  4KOU A;  1RO5 A;  3P2H A;  2KCW A;  2BUE A;  4AVA A;  1YR0 A;  3W91 A;  4UWJ A;  1V0C A;  4NXY A;  1WK4 A;  4KZT A;  2B4B A;  2K5T A;  2G3A A;  2J8R A;  2QIR A;  3JVN A;  3FBU A;  1S3Z A;  4PSX A;  2B5G B;  2FIA A;  2ZW5 A;  3BJ8 A;  1YGH A;  3P2F A;  1XMT A;  2BSW A;  5HH1 A;  1XF8 A;  5CNP A;  1MJA A;  1CJW A;  1XE4 A;  5KTD A;  3FYN A;  3FNC A;  4LX9 A;  5J8C A;  4L8A A;  2VZZ A;  2EVN A;  4II9 A;  5F47 A;  4B5P A;  3R1K A;  2NMT A;  2VZY A;  4AVC A;  3TO6 A;  1I1D A;  4U5Y A;  3EFA A;  4PK2 A;  2D4O A;  4AVB A;  2C27 A;  4NEX A;  4QVT A;  2Y0M A;  4RI1 A;  1FY7 A;  2G3T A;  5JPH A;  5F46 A;  3SHP A;  3R95 A;  3PP9 A;  2OZG A;  2DXQ A;  4UBR A;  3VWE A;  4ONU A;  1MJB A;  4K30 A;  1Y7R A;  4E0A A;  2ZXV A;  3FB3 A;  2P0W A;  4U9Z A;  4KOW A;  4PV6 A;  1K4J A;  2O28 A;  5ISV A;  2B58 A;  1BOB A;  2B4D A;  5H84 A;  4XPL A;  4KOX A;  4PK3 A;  5IB0 A;  4M85 A;  3LD2 A;  2Z0Z A;  2FCK A;  3TOB A;  2Q4V A;  4CS0 B;  3V8I A;  2FS5 A;  2ZW4 A;  4I49 A;  2ZW6 A;  2F5I A;  3S6K A;  3BLN A;  1YVK A;  4NCZ A;  2Q7B A;  2FSR A;  3W6X A;  4OAD A;  3OWC A;  3H4Q A;  2IL4 A;  1P0H A;  5E96 A;  1Q2D A;  2R98 A;  2H5M A;  4CAX A;  3D2M A;  1BO4 A;  1XEB A;  1CM0 A;  1KZF A;  2FL4 A;  3QB8 A;  3DNS A;  3EY5 A;  4QUS A;  3GYA A;  2PDO A;  4AG7 A;  4E8O A;  2REE A;  1IYL A;  2Q44 A;  5IV0 A;  4YRH A;  3LOD A;  1QSR A;  4EVY A;  3SXN A;  4FD7 A;  4YFJ A;  5DWM A;  4KLV A;  2JEV A;  2CNT A;  3KKW A;  2Q04 A;  3ZZI A;  2WPW A;  2AJ6 A;  2G0B A;  1M4G A;  3S6G A;  4R87 A;  3T9Y A;  2P6G A;  4MBU A;  3S6F A;  2I79 A;  2AE6 A;  2QEC A;  3D8P A;  2Z11 A;  3GY9 A;  4UA3 A;  2JLM A;  3G3S A;  2R7H A;  4HNX B;  4YGO A;  4OAE A;  4NSQ A;  1NMT A;  1Y9K A;  1PUA A;  3I3G A;  4KOS A;  1NSL A;  4F0Y A;  2Q0Y A;  4JXR A;  1Y9W A;  1KUY A;  2FT0 A;  3TO7 A;  4AB7 A;  3C26 A;  5C88 A;  2BEI A;  4R9M A;  2I00 A;  1Q2C A;  1S7L A;  4X5K A;  2R1I A;  4CAW A;  4FD5 A;  3DR6 A;  2R8V A;  4HKF A; 
#chains in the Genus database with same CATH topology
 3PGP A;  2OU2 A;  1JQG A;  4JYW A;  4AG9 A;  1F57 A;  2YNE A;  1X10 A;  4OID A;  2VBQ A;  4MY3 A;  3WC5 A;  3BHX A;  1OBR A;  3FH4 A;  3SJX A;  3TC8 A;  3IU1 A;  2RFH A;  2OZU A;  3NE7 A;  4BIN A;  4MFJ A;  3TE4 A;  2PRQ A;  2VXK A;  1HDQ A;  4JJX A;  4RN7 A;  1KWM A;  1IOI A;  3FIX A;  5AG4 A;  4M6G A;  2CNM A;  4OC1 A;  3S9N A;  3RBU A;  2GU2 A;  4UCP A;  3SJE A;  1M44 A;  3NA6 A;  4QB9 A;  3H8F A;  4HPS A;  1GHE A;  2QML A;  3TT2 A;  2PR1 A;  1S60 A;  2OB0 A;  1QSM A;  1S7N A;  3CXP A;  3FEE A;  4NGN A;  4FAI A;  2Q4Z A;  4JD6 A;  2PJ7 A;  2V77 A;  2ZEE A;  3D3S A;  3I9S A;  3MGD A;  2IJZ A;  3S6H A;  5K8N A;  4UWI A;  1L0C A;  4R7M A;  3FXT A;  1Z8X A;  2OZH A;  1KUV A;  2AFU A;  1QSO A;  3G8W A;  3QAY A;  4MHD A;  4U9Y A;  5H86 A;  4UF4 A;  1QST A;  2GLJ A;  2EBJ A;  2FXF A;  2R8V A;  4FBE A;  3D7G A;  5F49 A;  4LUA A;  3HLP A;  4B10 A;  4F8Z A;  3KQZ A;  4R57 A;  5G22 A;  3TTH A;  4F6A A;  1XOV A;  2FE7 A;  4KUA A;  1UFH A;  2ATR A;  2PC1 A;  2JBJ A;  1Q2Y A;  1IIC A;  3F0A A;  1YSJ A;  3LAC A;  3CDX A;  3VAT A;  2A4N A;  4B5P B;  4JLY A;  4F9U A;  4CGM A;  3QNV A;  3CXS A;  3PFE A;  2ZEO A;  4UFV A;  3DR8 A;  4KUB A;  5A28 A;  4JWP A;  2ZEF A;  4KSI A;  1YX0 A;  2BCO A;  3GB0 A;  4FWU A;  2HUZ A;  4J3G A;  2DEA A;  2ZEG A;  4JXQ A;  3SJF A;  4B6Z A;  3B3V A;  3PFO A;  5D29 A;  4R3K A;  3PB6 X;  4W9Y A;  4CGL A;  1SQH A;  5J1Q A;  2VEZ A;  4UFX A;  2F8H A;  4P4B A;  2NYQ A;  2V8V A;  2JDC A;  4H2K A;  4C2Z A;  2EK9 A;  2J8N A;  3NH5 A;  4KOT A;  2REF A;  4UIA A;  3TFY A;  8CPA A;  2YND A;  1IYK A;  5DWN A;  4ZI6 A;  2WUU A;  1Z9U A;  2WPX A;  1LCP A;  5KTA A;  5LYI A;  3PB7 X;  4CYN A;  2Q7S A;  2YNC A;  4PSW A;  4C7I A;  4FD6 A;  2ZOG A;  3SI0 A;  4NGM A;  2HV2 A;  1B6B A;  2PJ9 A;  4MI4 A;  2ZED A;  4R8F A;  4UEF A;  4KLW A;  4IF5 A;  4KOR A;  3EO4 A;  2EO8 A;  4HNY B;  4XNH B;  5JH9 A;  3FMC A;  3NH8 A;  3B3W A;  5IX3 A;  3IWE A;  2VL1 A;  4OLL A;  1VHO A;  1Y0R A;  2P6E A;  2Z10 A;  4HKF A;  1B87 A;  3CZX A;  4IAV A;  2ZEL A;  2PJ5 A;  2V8G A;  1Y0Y A;  1Q7L A;  3F5B A;  1ZLH A;  3BXM A;  3ZJ0 A;  3W6S A;  2GIV A;  4FUU A;  4MHP A;  4A30 A;  2B4D B;  1U6M A;  1OZP A;  3GKR A;  4XNH C;  1VKC A;  4A2Z A;  1M4L A;  2JDD A;  3D66 A;  4L89 A;  5GCN A;  4KS9 A;  1CPX A;  1M1D A;  2VI7 A;  3IFE A;  4OKO A;  4A33 A;  4C2X A;  4CGN A;  5HVG A;  1IID A;  1Z8T A;  2B3U A;  4GXH A;  4PXE A;  3IGR A;  3D68 A;  2AFW A;  4MHZ A;  1CP7 A;  1HDU A;  2CY2 A;  4C68 A;  2IQ6 A;  4PXC A;  4ZX9 A;  4NGR A;  4BMH A;  4P4I A;  1Z5R A;  2ARH A;  5ELY A;  4DUK A;  5LRG A;  4CRZ B;  2JBK A;  3B3C A;  4IUS A;  1MJ9 A;  1MK4 A;  3PZJ A;  3K9T A;  2P6F A;  3IWG A;  4KOY A;  1RXT A;  4MY0 A;  1F2P A;  4HNW B;  1M4I A;  2CIJ A;  4QC6 A;  3V38 A;  3BJ7 A;  3H8E A;  1ZLI A;  2PJ4 A;  1VHS A;  2QYV A;  2Z3N A;  3B3T A;  4OC3 A;  4P4F A;  4EWT A;  1NE9 A;  3R9G A;  4E2A A;  3IO1 A;  5FVJ A;  1N71 A;  3TO9 A;  1ON0 A;  4WWV A;  4MHY A;  3FEC A;  5F48 A;  3WC7 A;  3IU2 A;  4PPZ A;  3PRT A;  1UWY A;  4WJB A;  4Y49 B;  1YME A;  1TKH A;  2JEW A;  3N7Z A;  4K3N A;  3UY5 A;  2PRB A;  1ZG8 A;  3B35 A;  3EXN A;  4NGQ A;  4XPD B;  5HXD A;  4ZBG A;  2BOA A;  2NSM A;  1M4D A;  2ZPA A;  2PVV A;  1S7K A;  1Z4E A;  2X7B A;  5D8N A;  4OME A;  3RYO A;  4CRY B;  4DNC A;  2I3C A;  3FRM A;  4NF1 A;  1IOF A;  1Z4R A;  1FT7 A;  2QJ8 A;  4P4D A;  4Y49 C;  2Z3O A;  3SXO A;  5K8P A;  3R9F A;  1BLL E;  4NJR A;  4XPD C;  1LRZ A;  2AFM A;  3NH4 A;  5K8M A;  2CTB A;  2B5G A;  2B3V A;  2O4H A;  4H89 A;  3JUW A;  2O53 A;  3VWD A;  1Y7E A;  5C82 A;  4R3L A;  5I0C A;  4TWE A;  2YNC C;  3RZA A;  4H6U A;  1AMP A;  1VIX A;  2RC4 A;  3PB9 X;  2PR8 A;  5AGE A;  1ZG7 A;  1QSN A;  4KVX A;  4ONW A;  3KQX A;  3R9E A;  7CPA A;  2PCU A;  4YWY A;  3FX6 A;  4MCR A;  3BI0 A;  5JQ4 A;  4P6Y A;  1ARL A;  1WWZ A;  2VQY A;  3QAH A;  4M3S A;  4B13 A;  5KTC A;  3K2K A;  5I4M A;  3E0K A;  2Q4Y A;  3RAM A;  3CPA A;  4GS4 A;  4KOV A;  1YK3 A;  2PSW A;  1PCA A;  2GE3 A;  4OP4 A;  3VH9 A;  3B8G A;  1S5K A;  4MMO A;  2ZW7 A;  5IB9 A;  5J8F A;  1YLO A;  2PJ1 A;  2V8H A;  1YRE A;  4KVO E;  4H6Z A;  2F7V A;  3CXQ A;  3KL9 A;  1XRY A;  5EBV A;  1GYT A;  1XIX A;  3K9U A;  4CAV A;  2HQY A;  3DDD A;  2Z3L A;  3F8K A;  3TCV A;  3ISX A;  2G9D A;  4M6H A;  3BI1 A;  4MCP A;  4IHM A;  4NGP A;  4R76 A;  4MFL A;  4M6I A;  2D4P A;  1Z2L A;  1YLE A;  1KUX A;  2DPT A;  4UEE A;  4B5O A;  1IB1 E;  1TF9 A;  3D4U A;  3FJU A;  3IJ3 A;  2GRE A;  4A31 A;  2EUI A;  4G1P A;  4MHN A;  5EC4 A;  3ISZ A;  4FD4 A;  2XEJ A;  2ODF A;  4XPK A;  4P10 A;  1F2O A;  3D2P A;  4UCM A;  2ZOF A;  1PU9 A;  1P4N A;  2BL1 A;  3R96 A;  3T90 A;  1H8L A;  2PQ8 A;  1J4J A;  4DYO A;  4EFD A;  4MFZ A;  1R57 A;  5HMN A;  3TOA A;  1XBU A;  3H8G A;  2FIW A;  1YVO A;  4ZYQ A;  3A9L A;  1I21 A;  3N5F A;  4RS2 A;  3WR7 A;  3FVL A;  4OC5 A;  1I12 A;  1A2Z A;  2OH1 A;  4MJ8 A;  1TIQ A;  4NJQ A;  1S7F A;  5G1Z A;  2AFZ A;  3DSB A;  2Z3K A;  2GAN A;  2J8M A;  4ORF A;  4CGO A;  1ELL P;  3FED A;  4QBJ A;  3KR4 A;  4KOU A;  1RO5 A;  2PJC A;  3P2H A;  4KVM E;  4PXD A;  2KCW A;  2BUE A;  1LAP A;  4BBH A;  4AVA A;  1YR0 A;  2ANP A;  3L2N A;  1CP6 A;  3W91 A;  1XMB A;  4ZGY B;  3GIU A;  2RB7 A;  4UWJ A;  1V0C A;  4NXY A;  5LYD A;  2Q51 A;  1WK4 A;  4KZT A;  2OOT A;  2B4B A;  2BO9 A;  2K5T A;  2J8R A;  2G3A A;  1IY7 A;  2QIR A;  3JVN A;  2CF4 A;  3FBU A;  1X12 A;  1S3Z A;  1Z8L A;  1CBX A;  2B5G B;  4PSX A;  5HVF A;  4PQA A;  2FIA A;  2PJA A;  2ZW5 A;  2WSA A;  1YGH A;  3BJ8 A;  3H5Z A;  4C2Y A;  2AFX A;  3P2F A;  1XMT A;  4CAE A;  2BSW A;  5HH1 A;  1XF8 A;  3PB8 X;  2ABZ A;  5CNP A;  5K8O A;  1MJA A;  4RUH A;  5CPA A;  3WC6 A;  1CJW A;  3KAS A;  1XE4 A;  5KTD A;  1LFW A;  3LMS A;  3FYN A;  2XEG A;  3FNC A;  1DTD A;  4LX9 A;  5J8C A;  4L8A A;  2VZZ A;  5LYL A;  4A95 A;  2EVN A;  4LQG A;  3CT9 A;  4II9 A;  2ZEN A;  4EME A;  5F47 A;  4B5P A;  3KGQ A;  1QQ9 A;  1BPM A;  3B3S A;  3R1K A;  2HB6 A;  1DE4 C;  3PBE A;  4ZY0 A;  2NMT A;  2IMO A;  2VZY A;  3MN8 A;  4GM5 A;  4AVC A;  3PB4 X;  3TO6 A;  1I1D A;  2J9A A;  1FNO A;  2ZEH A;  2Q43 A;  2EWB A;  3EFA A;  4IK2 A;  3KHZ A;  4U5Y A;  2DPS A;  3I1U A;  4PK2 A;  2D4O A;  4AVB A;  2PJ6 A;  1AYE A;  2PJ0 A;  3D67 A;  2C27 A;  5LYF A;  4MCQ A;  4NEX A;  4QVT A;  4PXB A;  4UFW A;  4Z65 A;  2Y0M A;  2PJ8 A;  3HUV A;  4RI1 A;  1FY7 A;  2G3T A;  4FD5 A;  5G20 A;  5JPH A;  5F46 A;  3SHP A;  3R95 A;  4P44 A;  4TNU A;  3PP9 A;  3B7I A;  1YQE A;  2OZG A;  4OC2 A;  6CPA A;  2DXQ A;  4UBR A;  5AG6 A;  3VWE A;  4R6T A;  2GLF A;  2Z3P A;  4KSA A;  4ONU A;  1MJB A;  3GLJ A;  4K30 A;  3D7F A;  2PJ3 A;  1Y7R A;  1PYT B;  4E0A A;  1HEE A;  4UEZ A;  2ZXV A;  3FB3 A;  2P0W A;  1ELM P;  1VHE A;  4U9Z A;  4KOW A;  4PV6 A;  1K4J A;  2O28 A;  3IEH A;  5ISV A;  4YU9 A;  5BWA B;  5AG5 A;  2B58 A;  3D7H A;  4B14 A;  1EE3 P;  4Q38 A;  4X3R A;  1BOB A;  2B4D A;  3SI2 A;  1CG2 A;  4LQ6 A;  1JWQ A;  2PJB A;  5H84 A;  4MXU A;  4XPL A;  3DGV A;  4KOX A;  4MFK A;  4NGT A;  4PK3 A;  2PJ2 A;  3KZW A;  5IB0 A;  2V8D A;  4M85 A;  3LD2 A;  4MFQ A;  2Z0Z A;  4UCN A;  2PIZ A;  2FCK A;  3T8W A;  3TOB A;  4A39 A;  2Q4V A;  4CS0 B;  3V8I A;  2FS5 A;  4DJL A;  4CYQ A;  2ZW4 A;  1LOK A;  1NSA A;  4I49 A;  2ZW6 A;  2F5I A;  3S6K A;  3BLN A;  1YVK A;  5JGF A;  2C6G A;  4NCZ A;  1R3N A;  2Q7B A;  2FSR A;  3W6X A;  3B2Y A;  4OAD A;  4OIW A;  3OWC A;  4Q36 A;  3H4Q A;  4OC4 A;  2IL4 A;  1P0H A;  2PVW A;  1XJO A;  1Q2D A;  5E96 A;  2R98 A;  4AXV A;  2H5M A;  4B12 A;  3JRU A;  4BD9 A;  1BAV A;  2WYR A;  3FF3 A;  3RNZ A;  4CAX A;  3D2M A;  2QVP A;  1BO4 A;  1ZO0 A;  1XEB A;  1CM0 A;  4CAF A;  4MCS A;  4CGP A;  2GFQ A;  3TX8 A;  1KZF A;  2DF5 A;  2FL4 A;  3QB8 A;  2XEF A;  3DNS A;  3EY5 A;  5F09 A;  4QUS A;  2CXA A;  3GYA A;  2PDO A;  2WZN A;  4AG7 A;  4E8O A;  4ZX8 A;  2REE A;  3JTK A;  1IYL A;  2Q44 A;  1LAM A;  4C7H A;  3KHX A;  5IV0 A;  2CTC A;  2FVG A;  4YRH A;  1Z8W A;  2OR4 A;  1RTQ A;  2C6P A;  1YW4 A;  3KI9 A;  3LWU A;  3LOD A;  4A37 A;  2YGW A;  1QSR A;  4EVY A;  3SXN A;  3PEI A;  4FD7 A;  5THW A;  4YFJ A;  4NGS A;  2C1C A;  4P4E A;  5G21 A;  5DWM A;  2EK8 A;  4KLV A;  5JM6 A;  2JEV A;  3V7Z A;  1R43 A;  3MRU A;  3PBB A;  2CNT A;  3KKW A;  4Q7A A;  2Q04 A;  3NFZ A;  3NE8 A;  4KSF A;  5EMI A;  3CPX A;  5DS0 A;  3ZZI A;  3WAB A;  2WPW A;  3S9M A;  4MRI A;  4JZ0 A;  2PIY A;  2AJ6 A;  2C6C A;  2G0B A;  1VGY A;  3IWW A;  1M4G A;  3S6G A;  4R87 A;  3T9Y A;  2P6G A;  4MBU A;  4X2T A;  4A32 A;  3S6F A;  4F0X A;  3D7D A;  1IU8 A;  1AUG A;  2I79 A;  3SJG A;  1TF8 A;  2AE6 A;  2QEC A;  3IC1 A;  4OC0 A;  1CX8 A;  3D8P A;  1BPN A;  2Z11 A;  5CBM A;  3KR5 A;  4B11 A;  4P45 A;  3GUX A;  2PE3 A;  3GY9 A;  4UA3 A;  1QMU A;  5A27 A;  2JLM A;  4MFP A;  4X8I A;  3G3S A;  2AFS A;  2R7H A;  4A94 A;  4HNX B;  3S9L A;  4YGO A;  4P4J A;  1TXR A;  4O23 A;  4CPA A;  1XFO A;  1CPS A;  4F9V A;  1TKJ A;  4OAE A;  4ZY2 A;  1IGB A;  1YW6 A;  4NFR A;  4NSQ A;  1NMT A;  1Y9K A;  1PUA A;  3I3G A;  4KOS A;  2HC9 A;  1NSL A;  4F0Y A;  2Q0Y A;  2Z3M A;  3SI1 A;  4CYP A;  4JXR A;  1Y9W A;  1KUY A;  2FT0 A;  2XEI A;  4A38 A;  4CYO A;  3VAR A;  3TO7 A;  4AB7 A;  3IIB A;  5AG7 A;  5LRK A;  3C26 A;  5HVH A;  1ARM A;  1TKF A;  5C88 A;  2BEI A;  3DLJ A;  5LRJ A;  3RO0 A;  4R9M A;  4ZY1 A;  1ZG9 A;  3WT4 A;  2I00 A;  1Q2C A;  1S7L A;  4X5K A;  2POK A;  4UIB A;  2R1I A;  2ZEM A;  4CAW A;  2AFO A;  3EC4 A;  3DR6 A;  2CNS A;  2ZEP A;  1LAN A; 
#chains in the Genus database with same CATH homology
 3PGP A;  2OU2 A;  4AG9 A;  2YNE A;  2VBQ A;  4MY3 A;  3IU1 A;  3NE7 A;  2OZU A;  4MFJ A;  3TE4 A;  2VXK A;  4JJX A;  3FIX A;  5AG4 A;  2CNM A;  4UCP A;  1M44 A;  4QB9 A;  1GHE A;  2QML A;  3TT2 A;  2PR1 A;  1S60 A;  2OB0 A;  1QSM A;  1S7N A;  3CXP A;  4JD6 A;  3S6H A;  3I9S A;  3MGD A;  3D3S A;  4UWI A;  1L0C A;  3FXT A;  2OZH A;  1KUV A;  1QSO A;  3G8W A;  4MHD A;  4U9Y A;  5H86 A;  1QST A;  2FXF A;  2CNS A;  5F49 A;  4LUA A;  4B10 A;  4R57 A;  5G22 A;  3TTH A;  4F6A A;  2FE7 A;  4KUA A;  1UFH A;  2ATR A;  2PC1 A;  1Q2Y A;  1IIC A;  3F0A A;  2A4N A;  4B5P B;  4JLY A;  4CGM A;  3CXS A;  4UFV A;  5A28 A;  3DR8 A;  4KUB A;  4JWP A;  1YX0 A;  4J3G A;  2HUZ A;  4JXQ A;  4R3K A;  4CGL A;  1SQH A;  2VEZ A;  4UFX A;  2JDC A;  4C2Z A;  2J8N A;  4KOT A;  2REF A;  3TFY A;  2YND A;  1IYK A;  5DWN A;  2WUU A;  1Z9U A;  2WPX A;  5KTA A;  4CYN A;  4PSW A;  2YNC A;  4C7I A;  4FD6 A;  2HV2 A;  1B6B A;  4MI4 A;  4KLW A;  4IF5 A;  4KOR A;  3EO4 A;  4HNY B;  4XNH B;  5IX3 A;  3IWE A;  4OLL A;  2Z10 A;  2P6E A;  1B87 A;  3F5B A;  3ZJ0 A;  3W6S A;  2GIV A;  4A30 A;  2B4D B;  1U6M A;  1OZP A;  3GKR A;  4XNH C;  1VKC A;  4A2Z A;  2JDD A;  4L89 A;  5GCN A;  4KS9 A;  1M1D A;  2VI7 A;  4CGN A;  4A33 A;  4C2X A;  1IID A;  2B3U A;  3IGR A;  2CY2 A;  4C68 A;  4BMH A;  2ARH A;  4CRZ B;  4IUS A;  1MJ9 A;  1MK4 A;  3PZJ A;  2P6F A;  3IWG A;  4KOY A;  1RXT A;  4MY0 A;  4HNW B;  1M4I A;  4QC6 A;  3BJ7 A;  1VHS A;  2Z3N A;  1NE9 A;  3R9G A;  4E2A A;  5FVJ A;  1N71 A;  3TO9 A;  1ON0 A;  5F48 A;  3IU2 A;  4Y49 B;  3N7Z A;  3UY5 A;  2PRB A;  4XPD B;  3EXN A;  4ZBG A;  1M4D A;  2ZPA A;  1S7K A;  1Z4E A;  2X7B A;  3RYO A;  4CRY B;  4DNC A;  3FRM A;  4NF1 A;  4Y49 C;  1Z4R A;  2Z3O A;  3SXO A;  3R9F A;  4XPD C;  1LRZ A;  2B5G A;  2B3V A;  4H89 A;  3JUW A;  3VWD A;  5C82 A;  4R3L A;  5I0C A;  2YNC C;  4H6U A;  2RC4 A;  3EC4 A;  5AGE A;  2PR8 A;  3R9E A;  1QSN A;  4KVX A;  5JQ4 A;  4M3S A;  1WWZ A;  2VQY A;  3QAH A;  4B13 A;  5KTC A;  3E0K A;  2Q4Y A;  4KOV A;  4GS4 A;  1YK3 A;  2PSW A;  2GE3 A;  3B8G A;  1S5K A;  2ZW7 A;  5J8F A;  1YRE A;  4KVO E;  4H6Z A;  3CXQ A;  5EBV A;  1XIX A;  3K9U A;  4CAV A;  2HQY A;  3DDD A;  2Z3L A;  3F8K A;  3TCV A;  4MFL A;  2D4P A;  1YLE A;  1KUX A;  2DPT A;  4B5O A;  1IB1 E;  4A31 A;  2EUI A;  5EC4 A;  4FD4 A;  4XPK A;  3D2P A;  4UCM A;  1PU9 A;  1P4N A;  2BL1 A;  3R96 A;  3T90 A;  2PQ8 A;  1J4J A;  4MFZ A;  1R57 A;  5HMN A;  3TOA A;  2FIW A;  1YVO A;  3A9L A;  1I21 A;  3WR7 A;  4RS2 A;  1I12 A;  2OH1 A;  4MJ8 A;  1TIQ A;  1S7F A;  5G1Z A;  3DSB A;  2Z3K A;  2GAN A;  2J8M A;  4ORF A;  4CGO A;  4QBJ A;  4KVM E;  4KOU A;  1RO5 A;  3P2H A;  2KCW A;  2BUE A;  4BBH A;  4AVA A;  1YR0 A;  3W91 A;  4ZGY B;  4UWJ A;  1V0C A;  4NXY A;  1WK4 A;  4KZT A;  2B4B A;  2K5T A;  2G3A A;  2J8R A;  2QIR A;  3JVN A;  3FBU A;  4CYO A;  1S3Z A;  4PSX A;  2B5G B;  2FIA A;  3H5Z A;  2WSA A;  1YGH A;  2ZW5 A;  3BJ8 A;  4C2Y A;  3P2F A;  1XMT A;  4CAE A;  2BSW A;  5HH1 A;  1XF8 A;  5CNP A;  1MJA A;  1CJW A;  1XE4 A;  5KTD A;  3FYN A;  3FNC A;  4LX9 A;  5J8C A;  4L8A A;  2VZZ A;  4A95 A;  2EVN A;  4II9 A;  5F47 A;  4B5P A;  3R1K A;  2NMT A;  2VZY A;  4AVC A;  3TO6 A;  1I1D A;  4U5Y A;  3EFA A;  2DPS A;  4PK2 A;  2D4O A;  4AVB A;  2C27 A;  4NEX A;  4QVT A;  4UFW A;  2Y0M A;  4RI1 A;  1FY7 A;  2G3T A;  5G20 A;  5JPH A;  5F46 A;  3SHP A;  3R95 A;  3PP9 A;  2OZG A;  2DXQ A;  4UBR A;  5AG6 A;  3VWE A;  2Z3P A;  4KSA A;  4ONU A;  1MJB A;  4K30 A;  1Y7R A;  4E0A A;  2ZXV A;  3FB3 A;  2P0W A;  4U9Z A;  4KOW A;  4PV6 A;  1K4J A;  2O28 A;  5ISV A;  5BWA B;  5AG5 A;  2B58 A;  4B14 A;  4Q38 A;  1BOB A;  2B4D A;  5H84 A;  4XPL A;  4MFK A;  4KOX A;  4PK3 A;  5IB0 A;  4M85 A;  3LD2 A;  4MFQ A;  2Z0Z A;  4UCN A;  2FCK A;  3TOB A;  2Q4V A;  4CS0 B;  3V8I A;  2FS5 A;  4CYQ A;  2ZW4 A;  4I49 A;  2ZW6 A;  2F5I A;  3S6K A;  3BLN A;  1YVK A;  4NCZ A;  2Q7B A;  2FSR A;  3W6X A;  4OAD A;  3OWC A;  4Q36 A;  3H4Q A;  2IL4 A;  1P0H A;  5E96 A;  1Q2D A;  2R98 A;  4B12 A;  2H5M A;  4CAX A;  3D2M A;  1BO4 A;  1ZO0 A;  1XEB A;  1CM0 A;  4CAF A;  4CGP A;  1KZF A;  2FL4 A;  3QB8 A;  3DNS A;  3EY5 A;  4QUS A;  2CXA A;  3GYA A;  2PDO A;  4AG7 A;  4E8O A;  2REE A;  3JTK A;  1IYL A;  2Q44 A;  4C7H A;  5IV0 A;  4YRH A;  3LOD A;  2YGW A;  1QSR A;  4EVY A;  3SXN A;  4FD7 A;  4YFJ A;  5G21 A;  5DWM A;  4KLV A;  2JEV A;  2CNT A;  3KKW A;  2Q04 A;  4KSF A;  3ZZI A;  2WPW A;  2AJ6 A;  2G0B A;  1M4G A;  3S6G A;  4R87 A;  3T9Y A;  2P6G A;  4MBU A;  4A32 A;  3S6F A;  4F0X A;  2I79 A;  2AE6 A;  2QEC A;  3D8P A;  2Z11 A;  4B11 A;  3GY9 A;  4UA3 A;  5A27 A;  2JLM A;  4MFP A;  3G3S A;  2R7H A;  4HNX B;  4YGO A;  4OAE A;  4NSQ A;  1NMT A;  1Y9K A;  1PUA A;  3I3G A;  4KOS A;  1NSL A;  4F0Y A;  2Q0Y A;  2Z3M A;  4CYP A;  4JXR A;  1Y9W A;  1KUY A;  2FT0 A;  3TO7 A;  4AB7 A;  5AG7 A;  3C26 A;  5C88 A;  2BEI A;  4R9M A;  2I00 A;  1Q2C A;  1S7L A;  4X5K A;  2R1I A;  4CAW A;  4FD5 A;  3DR6 A;  2R8V A;  4HKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...