2G3AA

Crystal structure of putative acetyltransferase from agrobacterium tumefaciens
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
MNFVLSDVADAEAEKAIRDPLVAYNLARFGESDKRDLNITIRNDDNSVTGGLVGHTARGWLYVQLLFVPEAMRGQGIAPKLLAMAEEEARKRGCMGAYIDTMNPDALRTYERYGFTKIGSLGPLSSGQSITWLEKRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acetyltransferase
publication title Crystal structure of putative acetyltransferase from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Transferase
total genus 33
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2g3aA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2g3aA02
1PU9A 4KVXA 3ZZIA 1ZOYC 4YRHA 1MK4A 2PRBA 1YVKA 1FY7A 3R1KA 4KLWA 1ON0A 2EVNA 3AE8C 3GKRA 5KTDA 4II9A 2VQYA 3R96A 1QSTA 4CAXA 3TO7A 4B5PA 1Y9KA 5IV0A 2G3TA 3RYOA 2NMTA 2VEZA 4KVME 2BL1A 3IGRA 5ISVA 2FL4A 4KOWA 1S3ZA 2PQ8A 3KKWA 4L8AA 3D8PA 2J8MA 2WQYC 3F0AA 4JD6A 2Z10A 5HH1A 4JJXA 2OU2A 4J3GA 3TCVA 3AECC 1S5KA 1MJBA 4U9YA 3DR8A 4H89A 4E2AA 5F48A 1U6MA 2BSWA 3TT2A 3FNCA 5GCNA 2VBQA 4I49A 4KOSA 2FCKA 3H4QA 4JWPA 4FD6A 2PSWA 3WR7A 5EC4A 3R9EA 3FRMA 4B5PB 4KOTA 2Q04A 3FIXA 1L0CA 3SXOA 3E0KA 1SQHA 5I0CA 1MJ9A 1LRZA 4NCZA 4E0AA 2HUZA 3DNSA 1S7FA 4IF5A 2J8NA 2B5GA 3B71A 1Q2CA 2Z11A 4DNCA 2AE6A 4OAEA 3EO4A 4AVAA 3P2FA 4AG7A 1KZFA 2OZGA 4UWIA 2I79A 1OW8A 4Y49C 2IL4A 4HNXB 3R9FA 3DR6A 4QVTA 1IICA 3S6HA 3N7ZA 4KOUA 1GHEA 3PGPA 2JDDA 4CS0B 1XIXA 1RO5A 3CXPA 2GIVA 2JEVA 2R7HA 2CY2A 2R8VA 1WK4A 2FT0A 1IIDA 1Z4RA 2H89C 5HMNA 1BO4A 5C82A 4HKFA 3AEEC 3TOAA 4YFJA 1YQ3C 1QSNA 5J8FA 2REEA 1R57A 3ABVC 2BEIA 2ZW7A 4RS2A 1YX0A 1YR0A 4FD4A 1VKCA 5IX3A 4L89A 4XNHC 1KUXA 1S7KA 3S6KA 4KUBA 1P0HA 2FBWC 4YXDC 4KORA 1QSMA 3EFAA 4M85A 4KZTA 3BJ8A 5KTAA 3AEBC 1J4JA 4XNHB 4XPKA 4PK2A 3R95A 3LD2A 3R9GA 2FS5A 1B87A 1M44A 3DSBA 4LUAA 3D2MA 3AE3C 3VWDA 3TO9A 2OB0A 4NSQA 4H6ZA 1OZPA 2F5IA 4AVCA 3AEGC 3AE4C 1QSOA 2QIRA 4HNWB 1B6BA 2ZW6A 4AB7A 1PV3A 2GANA 2OH1A 4PK3A 2R98A 2VZZA 3AE6C 4R9MA 4ONUA 3TTHA 4CRYB 3TE4A 1I1DA 2CNTA 3TFYA 1I21A 1OW6A 4KUAA 3LODA 4KOVA 3SFDC 1VHSA 2JDCA 4KOYA 2Q44A 3BJ7A 3AE5C 2PR8A 2Q4YA 4QUSA 4U5YA 2G3AA 1WWZA 4AVBA 3I9SA 1K4JA 1MJAA 3SXNA 4MI4A 4PSWA 3ZJ0A 3F8KA 1XMTA 4KLVA 3EC4A 1ZP0C 2D4PA 2Q4VA 1CM0A 1IYLA 3AE9C 2DXQA 5IB0A 2HQYA 3S9OA 2FIWA 1I12A 2P6EA 2ARHA 1TIQA 2Y0MA 3AEDC 1NE9A 4FD7A 2JLMA 4R87A 1N71A 4LX9A 3W91A 2AJ6A 4RI1A 2C27A 4OLLA 2GE3A 4YGOA 4CRZB 1XF8A 3CXSA 4NXYA 2QMLA 3TO6A 2Q7BA 4PV6A 3GYAA 3FYNA 2RC4A 2CNSA 1QSRA 3C26A 2ATRA 1Q2DA 5EBVA 1KUVA 4GS4A 2B4DB 3AE1C 5KTCA 2B3UA 2P6GA 1Q2YA 4MHDA 3W6XA 3SHPA 2FE7A 4X5KA 2P0WA 4F6AA 2J8RA 3NE7A 1M4DA 3W6SA 2K5TA 4F0YA 3FB3A 3FBUA 3EXNA 3D2PA 1K04A 4HNYB 1OW7A 1BOBA 3PP9A 4MJ8A 2BUEA 1IYKA 3DDDA 4FD5A 2FIAA 4BMHA 4U9ZA 1M1DA 4NF1A 3K9UA 3S6FA 2H5MA 2PDOA 1RXTA 3IWGA 2HV2A 3D3SA 3AEAC 2OZHA 4PSXA 3CXQA 3OWCA 4MY0A 2REFA 4QBJA 2ZXVA 2PR1A 4OADA 4EVYA 2P6FA 1YVOA 4JXRA 1K05A 4KOXA 3AE2C 2B58A 2QECA 3MGDA 3VWEA 4MY3A 1UFHA 1CJWA 4R3LA 1YK3A 3I3GA 4KVOE 3AE7C 3JUWA 1YLEA 3S6GA 2Z0ZA 4B5OA 2A4NA 4AG9A 3F5BA 2KCWA 2WPWA 2PC1A 5J8CA 5JQ4A 4R3KA 1V0CA 4E8OA 2CNMA 2VXKA 4IUSA 3JVNA 1P4NA 5F46A 3G3SA 1PUAA 3QAHA 3UY5A 4M3SA 5E96A 2D4OA 2B4DA 5FVJA 3QB8A 1XEBA 1YQ4C 1S60A 3P2HA 4UWJA 3G8WA 1XE4A 3BLNA 2ZW5A 5CNPA 5DWNA 2B3VA 3FXTA 4H6UA 1Y9WA 4CAVA 2EUIA 2B4BA 2ZW4A 2O28A 5C88A 4JLYA 4YTPC 2FXFA 4JXQA 1NMTA 1M4GA 4R57A 4UBRA 1YREA 5F47A 4K30A 2Q0YA 2OZUA 1KUYA 3V8IA 1KTMA 2WPXA 1Z4EA 3GY9A 2FSRA 4XPLA 4CAWA 1S7LA 1Z9UA 5F49A 4Y49B 1S7NA 4QC6A 3T90A 4XPDC 2VZYA 3EY5A 4QB9A 3T9YA 2H88C 1YGHA 4NEXA 2B5GB 4MBUA 4XPDB 3PZJA 3AEFC 5DWMA 2VI7A 2G0BA 3SFEC 2R1IA 1Y7RA 2X7BA 5H84A 2I00A 3TOBA 1NSLA 5H86A 1M4IA 4UA3A 3B8GA 1IB1E 5JPHA 4ZBGA 4ORFA 2ZPAA
chains in the Genus database with same CATH superfamily
1PU9A 1M1JA 1MFZA 2A45H 3Q1MA 4M6IA 2VRSA 1Q7LA 3FEEA 3VMYA 4DYOA 2FYNB 1RE3C 5BU5A 2PRBA 3O6QB 1LTGC 1ON0A 2OTJP 3BI1A 3AE8C 3FEDA 3R2PA 3T97A 1L0LJ 3BHXA 2V4HA 4RUHA 1JOCA 1JEKA 2QM8A 1T2KD 2G3TA 3RYOA 3L72D 1Y8AA 3L72E 5ISVA 2FL4A 4NGMA 4A30A 2DF5A 2WQYC 1WRGA 4JD6A 1JY2N 1IU8A 4J3GA 1EQ7A 1FS0E 1PP9D 4GODA 1GL2B 3GHGA 3H1HJ 2C1CA 3P32A 1SQXD 1PP9E 5APUA 1FOSF 3L2NA 3TT2A 1SQXE 2ZYGA 5GCNA 2KIKA 2FCKA 4ZY1A 1MKMA 3H4QA 2PSWA 3WR7A 1H8AA 2WPRA 4D6TJ 4ZY2A 1DEEG 2IFMA 2Q04A 1L0CA 5KTBA 1IK9A 3GHGC 4BBHA 3IC1A 1LRZA 4R4MA 1N2DC 4E0AA 1VL2A 2HUZA 3W67A 3PB6X 3DNSA 3GIUA 1S7FA 1L0LK 4IF5A 1Q90D 3TX8A 3RNZA 3A0BH 4DNCA 2AE6A 4CGPA 3EO4A 4JYWA 4A7PA 1XJOA 1XMBA 2I79A 4WY4D 2DPSA 1QVFO 2E74C 1SQBJ 4HNXB 2VL1A 3JSVC 4QVTA 4UB6E 5AVZB 4PXBA 2FFDA 1LT1A 4KJMA 4KOUA 5AW9B 1CPXA 1CZQA 2ZYAA 3PBEA 1XFOA 3HE4B 4GDOA 1WK4A 3FXEA 1IIDA 1Z4RA 4PV1B 4CYOA 1GDTA 3MUDA 2YNCA 4PXEA 4A39A 1IY7A 1ZN5A 3CCJP 1VIXA 1R57A 4F8ZA 1YR0A 3PB4X 2FFDC 4R6TA 1LTSC 3CCQP 1TXRA 3LIEA 5LYLA 2JWDA 1S7KA 2QE7H 2AFUA 4KORA 4YXDC 3CPWO 3L71J 3L74G 5KAFE 3E1IA 5AW7B 4YXWH 2BCCD 3MUDC 2W27A 2YNCC 5AW3B 1LFWA 2KK7A 1SVFA 1QMUA 1Q86Q 3B7IA 1SQBK 3SSUA 4KT0J 2CPBA 4NGNA 3WU2E 2OB0A 2OR4A 1NTZK 1W5CE 3BCCJ 5K8NA 1LCPA 5CJ0A 3PRJA 4C2XA 4JZ0A 2KSJA 2R98A 2VZZA 1CG2A 4JF7A 1CSBA 5CMZA 2QJKC 2XEGA 4CRYB 2BASA 3H25A 3I56P 1R5LA 3TFYA 1I21A 2E76C 4KUAA 5AGEA 1YQEA 3PLNA 1MUUA 3SJEA 2EBJA 3FECA 1GK6A 1ZV8A 2OGUA 4PXCA 2A06D 3CWBJ 5HVFA 2Z3MA 2PP6A 1Z8WA 3M0DC 3D6ZA 1LAPA 5TJHA 1OFCX 2A06E 3ISXA 4U5YA 2R44A 5APWA 1OXZA 4P4FA 1FC2C 4A32A 2O01N 1ZG8A 3S1KA 3VH9A 2YNDA 4MI4A 5LYFA 1VQ6P 3B3TA 3FWNA 1T6AA 2ZFCA 4ASWA 1VQ7P 4GXHA 4KLVA 2K1AA 3L72G 4H44B 3RK3C 3P8MC 4BD9A 2D4PA 4OC4A 1VQKP 1OMIA 4EFDA 1CM0A 1HF9A 2HYNA 1Z56A 1FOSE 1IK7A 3QWOC 1HDUA 1NVOA 2RH0A 1NTMJ 3CDXA 1A2ZA 4A94A 1PP9G 3II6A 2Z3KA 1H88A 4AUWA 4R87A 3B3SA 4C7RA 3L75D 1Q82Q 1L0LD 4LX9A 2A45G 3ITKA 2E75B 2JP3A 3L75E 3GW6A 1L0LE 4YGOA 2E42A 4WY4A 3CXSA 4NXYA 2QMLA 1JCDA 3B8EB 1H8LA 4MRIA 3IU1A 2ZXEB 2ATRA 1NTKJ 1FZCB 4ZKPA 1KUVA 2KSEA 1BGYJ 1S5LH 2PCUA 1PPJG 2N1TD 2PVVA 4R76A 3W6XA 2L91A 5K8MA 5AVYB 1S9KD 1YJNP 2F8HA 2J8RA 1S9KE 3W6SA 1TKFA 2GA1A 2K5TA 4F0YA 3FB3A 5APQA 1LOKA 1BOBA 2W90A 3NFQA 2PGDA 2Q9IA 3PP9A 1NTMK 4A38A 4MJ8A 1PGOA 3KDPB 3G6EP 4OP4A 3DDDA 4BMHA 2I1JA 2ABZA 4L73A 4U9ZA 3K9UA 2PDOA 4PJ0E 1ZLHA 5KKZC 1HH0A 4OMEA 3KHZA 3LW5H 3D68A 2XEJA 2OZHA 5AW0B 1YJWP 1IFJA 1VQ9P 1SQBD 1JCCA 2OYIA 4OADA 3VARA 2P6FA 4JYBA 1NTKK 1SQBE 3V5BA 2WYRA 4GOEA 2BCCG 1NTZD 1N8RQ 4C46A 2YXQB 2QECA 1NTZE 3VWEA 3MN8A 4N6JA 2O1KA 1LT9A 2W83C 3FWLA 1CJWA 1M1KQ 3I3GA 4IOIH 4KVOE 2KLVA 4MFKA 2DEAA 3SWKA 2OYIC 3B3WA 1S3JA 2PJ8A 4B13A 1L2PA 3A7OA 3D67A 4Y99C 1JB0J 1YJ9P 1M1JB 2IDBA 4U3FJ 1KQLA 4Q7AA 2PC1A 4OIDA 1ZR4A 2Q5UA 5JQ4A 4W7ZA 4DZOA 1LT9C 4EOTA 1V0CA 4R3KA 3BXMA 2ZEHA 2WTYA 1S1CX 3TDKA 3T97B 1KD1Q 2Q3IA 2XEIA 2ZOFA 1ELLP 1PUAA 3QAHA 3UY5A 4C68A 3BRTB 1QL1A 1JY2P 4FUUA 3QB8A 3W68A 4CGNA 1YQ4C 4H0LD 4P44A 4HJGH 2ZELA 2ZEGA 3KHXA 5CNPA 4AXVA 2N9BA 4H6UA 3RL0g 4LQGA 3CXHD 3TGUD 2WSEJ 2AFWA 2ZW4A 4H13B 2A06G 3BCCD 3CXHE 4JQ0D 5C88A 4YTPC 3TGUE 1S2EA 4R57A 2AEMA 3BCCE 1N73C 1KUYA 2PJ0A 2L5GB 2WMMA 2B88A 3NMDA 4Y28J 3FF3A 3GY9A 1KB9D 1LTJA 4XPLA 3S9MA 1FNOA 1Z9UA 5F49A 1KB9E 1S7NA 2E74B 4QC6A 2GM4A 2WPQA 4UFWA 4I6MC 4P10A 4P4IA 3WC5A 1ZLIA 2AEFA 3SWFA 1YGHA 1QEXA 4ZYQA 4NEXA 3CWBD 3M91A 1LTJC 3CWBE 2K9JA 1USDA 5AW6B 3PTZA 1X0TA 4NGPA 5LRGA 3H8EA 3MTUE 2IBZD 1U7JA 4Z65A 1PYTB 2ZAEB 5APXA 2IBZE 2FFDB 1NU1J 3L75G 5GTIE 2I3CA 1NSLA 3V2NA 2N1TA 1L0LG 3L70G 5CCGC 3KPEA 1IOIA 3KZIH 1JY3P 5TISH 1GTWA 2YNEA 1L4AB 3ISZA 3CC2P 3I55P 1KYOI 2KZJA 2YMYA 3UIAA 3WABA 2IJZA 2C6PA 4YRHA 1YVKA 1OVVA 4I2LC 1AUGA 1Q7YQ 4KLWA 1NTMD 2KI7B 3H1IG 1AYEA 1DX7A 1J1DC 3GKRA 3IWEA 1NTME 2VQYA 4IFDK 1QSTA 4B11A 4CAXA 1BLLE 3TO7A 4B5PA 1Y9KA 3CPAA 4B10A 4MFLA 4O9BA 3FMCA 3VP8A 4WB4A 1BCCD 4KVME 3HLPA 2BL1A 2Z3PA 1ZW0A 1NAFA 1CPSA 5AG7A 1BCCE 2AXTH 2M3BA 2IQ6A 2PQ8A 5GTHE 4B6ZA 3KGQA 3KKWA 2PIYA 2Z10A 5HH1A 2E74D 4JJXA 3HD7D 1NTKD 3KQXA 4Q38A 2OU2A 2IX7C 1S5KA 2OYHA 3PB7X 2PJ6A 1NTKE 4F0XA 1BGYD 1OWAA 2E76B 1BGYE 1U6MA 2BSWA 3JRUA 3FNCA 4UEFA 4FD6A 2XKMA 2YO2A 3R9EA 2PJ9A 4KOTA 4CYNA 3FIXA 2V7QJ 4HH2A 1NKZB 1HBWA 3KL9A 4TWEA 1SQHA 4WWVA 5I0CA 4PD4D 1NTZG 2NPSC 3RAMA 3TF5A 4X3RA 3T8WA 4PD4E 1PFIA 3B71A 2Z11A 3MIWA 5APTA 4YPCA 4XE5B 1HUCA 1BE3J 2HR3A 4MHZA 3B4SA 1SQQK 4CYQA 3V2RA 2XEFA 3JTKA 1IICA 2NZ2A 3RK3B 3S6HA 2PJ2A 4NPFX 3PGPA 2JDDA 2AFSA 4CS0B 2ZEMA 4MCPA 1R5SA 2R8VA 2A45I 4JBZA 4IHMA 4I1LA 1L0NG 3A9LA 1TKJA 2WSFJ 3DGVA 1QGKB 4LGDE 1RF0A 1IZNB 3NH5A 2YKQA 2Q7CA 3L37A 2ZW7A 4LQ6A 4UFXA 5IX3A 1LAMA 4L89A 1JY3O 1KUXA 4KUBA 1KORA 1P0HA 1KILD 2FBWC 3JC22 3EFAA 3TGUG 1RE3A 4C7HA 1KILE 4KZTA 1SQVD 2E76D 5KTAA 1J4JA 4XNHB 4PK2A 2P67A 1KV4A 4HKZH 1UWYA 1B87A 3L73J 3OAKA 3WT4A 2V8GA 2CTCA 1FBMA 3D2MA 1SP4A 3AE3C 3TO9A 4WY4B 3PRTA 4RN7A 3VWDA 2B87B 1NAYA 4NSQA 2M5AA 4TLFA 1FT7A 4FWUA 3PB9X 3HUVA 3V4WA 4H6ZA 1OZPA 5AW5B 1M56D 1S4XA 3A3YB 4AVCA 2FXOA 1Y0YA 1EXIA 1QSOA 1U7MA 1RE4C 5KLVK 1B6BA 2ZW6A 4DCKA 1AVOA 3HE5A 4CAEA 2ZT9C 3GMAA 2R5DA 5KKZB 3RK3D 3L35A 4ONUA 3TTHA 1QL2A 3TE4A 2IBZG 1W2BO 3RK3E 1FZFA 5G22A 3JCUE 2FYUK 4UB6H 4CPAA 2MJZA 1JNMA 1M4LA 4KOVA 2JEEA 2GUVA 3QH9A 1NWQA 4AQRD 3KI9A 1E79H 2KYVA 1H0TB 1SQPJ 1A02J 2JDCA 3CX5D 2Q44A 1AQ5A 2PJ7A 2D2CC 1XBUA 3CX5E 2O4HA 2G3AA 1WWZA 4AVBA 2Q4ZA 2BEZF 1NYHA 3HTKA 3CCLP 4W9YA 3QNVA 1CI6A 2JR8A 3HRNA 3HD7A 2OOTA 3FX0A 2OYIB 2QG4A 2OTKE 5KAFH 2PJ4A 3F8KA 1BCCG 3M9HA 1GW4A 2O1JA 1LT9B 5J1QA 5EMIA 2DXQA 3HD7C 3RK2C 3C8VA 2ZENA 2FIWA 4P4BA 5AW2B 2WVRA 3G9RA 2ARHA 1TIQA 3WU2H 2Y0MA 5AG4A 3AEDC 3RZAA 1ZG9A 4FD7A 2EK8A 2JLMA 1BGYG 3SJFA 1Y0RA 1KZUB 1A02F 1HJ0A 3IN6A 1AQTA 1SQPK 2C27A 1J2JB 4OWFA 3D7GA 5KLIC 1OX3A 4KHXA 3KR5A 4CRZB 4WVZA 1SQQD 1FZAA 4PV6A 1SFCA 2RC4A 1QSRA 1YI2P 1Q2DA 1SQQE 1URQA 1GZLA 3A5TA 4GS4A 4X8IA 4UB8E 3CD6P 3H1JJ 4ZX9A 5KTCA 2XZRA 2BEQD 5JGFA 1Q2YA 1KN7A 2FXMA 1DD3A 1S5LX 4RKUJ 3SJGA 3SWYA 4X5KA 3B5NC 4F9UA 5THWA 2AFZA 4ZGYB 3PB8X 1SFCC 1M4DA 5AVTB 1URQC 1VQNP 1BPMA 3CCVP 1KQGB 1K04A 5LRKA 1KILA 3WUVA 1LTJB 4A33A 2GLJA 3MGNA 2WSCJ 4NF1A 2H5MA 3CLQA 3IWGA 2FXPA 3MHVA 2HV2A 3DLJA 1X9VA 1IGBA 2CPSA 3LACA 4UCMA 4KS9A 1P84D 2QM7A 4W80A 3CXQA 4M6HA 4R8FA 2JO1A 3D71A 5ELYA 3H1LD 4NFRA 4OC3A 3M0DA 1P84E 4QBJA 6CPAA 4OC2A 1KILC 2LXCB 1FE6A 3H1LE 4ZMDA 4UIBA 1N7SD 2K88A 1EXJA 4EVYA 2GUSA 2PIZA 2P2UA 1YVOA 2NSMA 3WMM0 1FZGA 2MKVA 2WZNA 2PJ3A 2XNDH 3HUSA 3WC7A 1SQVG 5D8NA 3AE2C 1YW6A 3BVHA 5KLVD 4MY3A 3IEHA 1UFHA 2FVGA 2N1TB 5KLVE 3P7KA 1J1DB 1ZRTD 5B66E 3LMSA 3BATA 2Z3LA 2Z0ZA 5I4MA 2R32A 1ZRTE 2YIUB 1NOHA 1X8YA 2PJ5A 3F5BA 2LXBA 1S72P 3HUSC 2CXAA 2KCWA 3NA6A 2KLUA 3RBXA 1YHQP 2FYUD 1YYCA 5J8CA 3CC7P 2N9YB 3B3VA 2FYUE 5KJ7A 3TC8A 4MMOA 5JH9A 1LP1A 2GREA 4IUSA 1KQSO 1BAVA 1ELMP 1P4NA 5F46A 2ZEOA 3L73D 1GD2E 4M3SA 5FVJA 3L73E 1S60A 5BVZA 1VQMP 1EDKA 1LJ2A 3BLNA 4B12A 2SPZA 2B3VA 5KJ7C 1RH5B 1SQXG 2WT7A 5AW4B 2Y0CA 2OYHB 2FXFA 1NMTA 2WUUA 4ZI6A 4UBRA 2Y9ZA 4PJ0H 1YREA 5CCGD 2OZUA 3V8IA 4EWTA 3F89A 4DOJA 5H2FE 4EIJA 1KTMA 2E5TA 4CPGA 3TYYA 1KFMA 2HPCA 5AVRB 1LWUC 3T90A 4R7MA 1T3UA 4MFQA 4BRYA 1EC5A 3H1HD 3KASA 1SQPD 1OIPA 4W7YA 3H1HE 1ARMA 4MBUA 5K5GB 1M90Q 2DW3A 4Z1MH 4XPDB 1SQPE 3PZJA 1VQPP 4NGSA 3V4QA 4D6TD 2NRGA 1E5WA 2CF4A 4TNUA 4D6TE 2X7BA 2AFXA 4H0LB 4L74A 1LANA 4MHYA 3MRUA 1M4IA 2RB7A 4UA3A 3PH0A 1AV1A 5EFWB 4L76A 1BSHA 2HODA 5A27A 2OYOA 2YNYA 1R8EA 1KB9I 1SQQG 4P45A 4KVXA 1FDIA 5B5EH 5APVA 1ZLLA 4C7NB 1HDQA 4FBEA 2CK3H 1ZOYC 3FJUA 2JWAA 2ZYDA 3R1KA 2EVNA 1ZR2A 1GU4A 3VOPA 5KTDA 5DJTB 4II9A 3R96A 2W8ZA 2Q51A 2NPSD 3IR9A 3WUTA 5IV0A 1YBKA 2NMTA 3CXHH 3CC4P 1IFNA 3PBBA 3E7KA 2IBZI 2E5YA 4KOWA 1N7SA 3F0AA 4K35A 4LC1A 4MHPA 1BPNA 3TCVA 5A28A 2M5AB 1MJBA 3H1JD 1KB9H 3L71D 3IFMA 2H43A 1XOVA 2PE3A 2PRQA 3DR8A 3H1JE 4H89A 3L71E 4E2AA 3USSA 1EE3P 2Q43A 4I49A 3U59A 1FZEA 1DIPA 3H1LG 4BXLA 5B5EE 5EC4A 3GF7A 1N7SC 5AW1B 3M9QA 5AVVB 4FAIA 3HE5B 1N73A 2LKMA 3SXOA 2OARA 3E0KA 2PJAA 2D2CB 2O01J 3M9BA 4HPSA 1PGJA 3BI0A 1MJ9A 2XDJA 3IFEA 4NCZA 1FDOA 3V2PA 4C2ZA 2HG5D 4DJGA 5KLVG 2J8NA 2B5GA 3P8CD 1Q2CA 5GTIH 5M1BA 1EZVD 4OAEA 3SI0A 3GHGB 5AG5A 3P2FA 3P8CE 1KZFA 4AG7A 3GG2A 4AVAA 1EZVE 2IL4A 2B89A 3PEIA 2CIJA 3R9FA 3D66A 2K9YA 4PV1C 2Y0DA 3V38A 3GF3A 3HTKB 4KSFA 1J1EC 2FYUG 1WMKA 1CI6B 1XIXA 1W2EA 1EDJA 1RO5A 3CXPA 3HD7B 2GIVA 1NHLA 4HB1A 4U7JA 2R7HA 2CY2A 3I1UA 2FT0A 5HMNA 2H89C 3OJAB 3S4RA 1YW4A 5IB9A 1IC2A 4HKFA 3RL0C 1LTAC 5CCGA 3Q5PA 1YQ3C 1QSNA 5J8FA 3VATA 3ABVC 1N7LA 5LYDA 3Q3DA 1YX0A 3LWUA 4FD4A 3RO0A 1MFTA 2J59M 2ZT9D 3A0HE 3S6KA 5GTHH 2P1JA 1RF1A 3CCEP 2YMKA 1RY3A 4M85A 4M6GA 4DT0A 3G4SP 4PQAA 2LR2A 1VF5C 3R95A 5AG6A 2FS5A 1NH4A 2ZVNB 2RMZA 3RGUA 3DSBA 3EWKA 1X79B 2ZEFA 4JPZB 3FGAD 2D2CD 1IFMA 1PGPA 1HVVA 8CPAA 3VMZA 5CCHA 1RF1C 1SFCB 2F5IA 1T3JA 3ZDMA 1URQB 3AEGC 3CCRP 2FY8A 2GFQA 1IFPA 3AE4C 3TSIA 2QVPA 3H1HG 4CYPA 2V8DA 4PD4H 1IJDB 4PK3A 1Y9BA 2IPPA 2RN0A 2UWJE 2KP8A 2QJ8A 4I7ZC 4D6TG 5CCHC 4MFZA 3I5CA 1IO4A 1I1DA 1YLOA 1OW6A 3H1KJ 3RK2D 3LODA 3R4YA 2QJKB 1KILB 1NU1K 2JDIH 3SFDC 2NPSA 1JTHA 1JY2O 1R3NA 3PFOA 1RQVA 2QJPC 3BJ7A 2Q4YA 2ZVOB 1H89A 1G2CA 2Q7SA 1OVUA 1SQBG 2ODFA 1K4JA 1MJAA 3SXNA 3H6PA 1XTCC 1GW3A 2BCCJ 2C0WA 5CPAA 4BINA 2M0BA 7CPAA 2YO3A 4C2YA 5CBNA 3ZJ0A 2AFOA 4NGRA 4UCPA 3EC4A 4B86A 2JEWA 2XNXA 4ZKUA 1EDIA 4NJQA 4RO0A 1BDCA 2Q4VA 1K8AQ 1FZCA 2Q6QA 1IYLA 3AE9C 2XU6A 3B5ND 1FAVA 5IB0A 2HQYA 3GLJA 1KC8Q 4NJRA 3S9OA 1VQ5P 1MZ9A 1SFCD 4L75A 3KZWA 2E75C 3KXDA 1URQD 4AYCA 3H1JG 3L71G 1NE9A 1HTLC 1KWMA 3CX5I 4C7IA 1F57A 3W91A 2AJ6A 1DEBA 1HGZA 1FZCC 2WITA 1VQ4P 4B14A 1LP1B 1XF8A 3PP5A 3A2AA 3TO6A 2WSEH 3BRVB 4GOFA 1Y7EA 3GYAA 1KYOD 3FYNA 1X12A 5HXDA 3VYIA 1KYOE 1FDMA 2QRXA 4U3FD 2FKWB 3JCUH 4MHDA 4U3FE 1LNQA 3IIBA 3BCCG 1FU1A 1EZVG 4OC1A 4OGQC 1GU5A 4KSIA 4LLHA 2P0WA 2WT7B 1RE4A 2QSIA 2EK9A 4F6AA 2ITAA 1M7LA 4MCRA 1CBXA 3C9IA 3CX5H 1LTBC 4M3LA 5AVSB 4HNYB 1LGHB 1YSJA 4EYYQ 4FD5A 5C39A 3H8FA 1M8OB 5HVGA 2HPCB 3S9NA 1YTZT 2R5BA 1RXTA 2AFMA 1XRYA 3AEAC 2QIWA 2K3RA 2WZ7A 3CWBG 4BRYB 2KNCA 3OWCA 3OA7A 4MY0A 4NGTA 2Z3OA 4F9VA 1N86A 2AEJA 2WPSA 2C6CA 1JMMA 1Y47A 3V2QA 2Z5IA 3GLMA 3V7ZA 5K8OA 3L75J 2PFXA 3TK1A 3L70J 2B58A 2HFED 3MGDA 3CPXA 2KS1A 5KJ7D 3KR4A 2Z3NA 1M1JC 4R3LA 2DPTA 4OC5A 3AE7C 3JUWA 2BO9A 3NXSA 5K8PA 2QYVA 2HODB 1Z2LA 1AVYA 4B5OA 3U1AA 2KB7P 2A4NA 2YKPA 1XTGB 4AG9A 3H1IJ 2GLFA 1NTMG 4IL6E 1VQLP 2J58A 2IFNA 1PZQA 4UB8H 2B9BA 1NU1D 4Y99B 1P84I 4E8OA 2KUBA 4UFVA 1IOFA 2CNMA 5KAIE 2VXKA 1HWTC 1NU1E 3JVNA 3CCMP 1NJIQ 3G3SA 1ZMEC 1QVGO 2Z4EA 3VP9A 2B4DA 2C6GA 4H13C 1GYTA 3P2HA 1NTKG 3G8WA 1RQUA 1ZG7A 1N7SB 2ZW5A 3M06A 2EUIA 5G20A 2B4BA 1PPJD 2ZOGA 4CGLA 2V7QH 2O28A 3M0AA 4JLYA 3D7DA 1PPJE 2EO8A 4OVNF 1HGVA 4K30A 2O3JA 3B5NA 1GMJA 4MN4C 1JUNA 2FSRA 4CAWA 1P84H 1S7LA 4WBAA 3Q5SA 1NTZJ 1VQOP 1N73B 2IMOA 3H1KD 2VZYA 3C1LA 4QB9A 3T9YA 1L4AA 3CCUP 3H1KE 1R43A 4Q36A 1J1EB 2V8HA 3D70A 1JY3N 2B5GB 3AEFC 1PL5A 5B66H 2VI7A 5JM6A 3EFFK 3RL0B 2WSFH 3CI9A 1GL2D 3LW5J 2R1IA 5H84A 1VPCA 1L4AC 2I00A 3TOBA 3H32A 3A0BE 1Z8XA 5H86A 4IFMA 1L0NJ 2BCCE 4P4DA 1IB1E 4EMEA 4N3YB 1TF9A 3GUXA 2ZPAA 1BE3D 3KQZA 3B3CA 4YWYA 1VF5B 3ZZIA 4IAVA 1BE3E 3K5BA 1MK4A 1Z5RA 4MHNA 2K9JB 4U3FG 1FY7A 4TT3H 3TGUJ 1JWQA 2V77A 1DE4C 4RESB 3K9TA 5DS0A 1RF1B 3G3ZA 4YU9A 1AA0A 1SLQA 2VEZA 1G1IA 4OH8B 3PHLA 3IGRA 2QJYC 2OQQA 1S3ZA 1CW5A 1VHEA 5H2FH 3D8PA 4L8AA 1CX8A 2J8MA 1NSAA 1VHOA 3AECC 3H5ZA 4GM5A 4I7ZB 4PV1D 3TNUA 2KZIA 3NH4A 3BASA 3F5HA 1L0NK 4U9YA 2I8DA 2PAJA 4K3NA 5F48A 2WSAA 2VBQA 4EI2A 4KOSA 1KMIZ 2W6AA 1PIXA 4MCQA 4JWPA 3SJXA 3FRMA 4B5PB 3RL0D 1F2OA 2R3SA 2QJPB 2Q1KA 5E79H 3MD0A 2NYQA 2J9AA 4CAFA 2QEXP 1T2KC 4UF4A 1LWUA 1JM0A 4NGQA 1GK4A 2NPSB 2OZGA 1JTHB 4UWIA 1TU3F 1OW8A 3N7NA 4Y49C 1VF5D 2POHA 5D29A 2ANPA 1JQGA 1T8ZA 2G9DA 3FH4A 3DR6A 1G2CB 3N7ZA 4DJLA 1GHEA 3KHUA 2ZEPA 5BU8B 5DJUB 4A37A 2JEVA 1NU1G 3L70D 1RHZB 5APSA 1BO4A 4P4JA 5C82A 1BCCJ 1YITP 4IK2A 3L70E 3AEEC 3TOAA 2P58A 4YFJA 2B87A 3IF4A 2REEA 2BEIA 4RS2A 3NFZA 5E79E 3O6QA 1VKCA 1AFOA 1AMPA 1QLED 4XNHC 2HC9A 2Q3EA 4NPDA 1BDDA 3QAYA 3CXHI 5CCHD 4MCSA 1QSMA 3CCSP 3H1ID 1EZVI 3BJ8A 3AEBC 3H1IE 4XPKA 4WY4C 4MFPA 2W6JH 3LD2A 5CBMA 2WPVB 3R9GA 4R4LA 1Z8LA 2FYNC 1M44A 4MXUA 4XFJA 4LUAA 4OGQB 3N5FA 4OC0A 3Q5RA 4UIAA 1AJYA 2Y9YA 1GL2A 4DUKA 1H0TA 3H1KG 3L74J 1DD4A 3VTPC 1FJKA 2QIRA 4H44D 1OVRA 4HNWB 4A31A 4AB7A 1PV3A 2GANA 3FVLA 2OH1A 2C9LY 3AE6C 2WSCH 2M8RA 4R9MA 4GKGA 1GL2C 1U57A 2CNTA 4CGMA 3G71P 1S5LE 3IO1A 2ZT9B 2ZJSE 2E75D 2IZ1A 4O23A 1USEA 1VHSA 4KOYA 2XV5A 2JKVA 1K9MQ 3AE5C 2PR8A 5AVUB 2C9NY 1BE3G 4QUSA 1TKHA 2OTLP 1D7MA 3I9SA 5F09A 2KNCB 1PGQA 4MFJA 3NE8A 2J5UA 3HE4A 1HJBA 2CTBA 1X10A 1ZO0A 4G1PA 3MP7B 3B2YA 1SQVJ 3A0HH 4PSWA 1K73Q 1M57D 1HEEA 1JMBA 1L0ND 1XMTA 1ZP0C 3GB0A 1OZHA 2IYPA 1L0NE 2KS1B 1UIIA 4HYTB 4OGQD 5APYA 1YIJP 3H8GA 2I1KA 3EFGA 1YMEA 1I12A 2P6EA 2BOAA 4WWIA 3VMAA 4PPZA 3PJSK 3CZXA 4PXDA 5BWAB 4WJBA 2FYZA 5AVXB 3SI2A 1TF8A 3NH8A 2EWBA 4ZX8A 3MZWB 2KOGA 4NPEA 5LYIA 3RK2B 2H7HA 1N71A 5L8RJ 4RI1A 3L72J 4OLLA 2PJ1A 5CJ4A 2GE3A 4CGOA 5AVWB 2GU2A 3PFEA 3L73G 1BSNA 3LIDA 2Q7BA 1QX8A 2CNSA 1LTIC 3C26A 3VMXA 4PD4I 5KLIB 4JYCA 3OW2O 5EBVA 5HVHA 1ARLA 4N78D 1PP9J 2B4DB 3D4UA 2K37A 3AE1C 1SQVK 3CMEP 2BCOA 2YXRB 2B3UA 1SQXJ 1SS1A 2RKLA 2P6GA 1MV8A 4N78E 4A2ZA 4A95A 4EDFA 3NTNA 1EDLA 3EQ2A 3SHPA 2FE7A 1RTQA 1VDFA 3KYQA 2O53A 3K2KA 3NE7A 3VN0A 2PJCA 1IFIA 2POKA 3FBUA 3EXNA 3D2PA 3Q2YA 3B5NB 1OW7A 2HLOA 4KSAA 3WC6A 4GIFA 2JBJA 4X2TA 2BUEA 3V6IA 1IYKA 2P7JA 2FIAA 3CL3D 4RJTA 1M1DA 3S6FA 1LTTC 2PJBA 3D3SA 4IL6X 1SQPG 4OKOA 2WSSH 5G21A 4PSXA 3IWWA 2ZEEA 2REFA 1OBRA 2WWWA 2ZXVA 3E1RA 2KXPB 2PR1A 1VGYA 3O8ZA 1NO4A 4JXRA 1UIXA 2QA4P 1K05A 2N1TC 3IAOA 4H13D 1Q81Q 2PVWA 1SQXK 4KOXA 4ASVA 3IJ3A 3L4FA 2YIUC 3H32B 2H8PD 1YK3A 1SQQJ 1X22A 1YLEA 3S6GA 3RBUA 1WT6A 4UEZA 5LRJA 3D7HA 4K3AA 3CT9A 2WPWA 2QJYB 1G1JA 4H44C 1IFDA 1KYOH 3KZIE 5TISE 4ZNCA 2YKOA 3B35A 2R3CA 2IYOA 4P4EA 3HUSB 4ZY0A 2W6BA 5G1ZA 3IU2A 5CBOA 2E43A 2F7VA 4P6YA 5E96A 2D4OA 4UCNA 3CMAP 2G8YA 2Y0EA 2PRRA 2OYHC 1XEBA 4UWJA 1DTDA 1XE4A 4OIWA 1FZBA 5DWNA 1QQ9A 3FXTA 2P10A 3L74D 1Y9WA 4CAVA 3S9LA 3L74E 1DH3A 3D6YA 2ZXXA 2JJLA 1L4AD 3TNUB 1CP6A 1Q2NA 1Z8TA 2O01H 2RFHA 4JXQA 1M4GA 3H1LJ 5F47A 4XA4A 1KFNA 1CP7A 2ZEDA 2AXTE 2Q0YA 4ONWA 3U1CA 2WPXA 1Z4EA 1NGMB 4QMAA 5CHXA 1PCAA 4Y49B 1JO5A 2C0XA 2M3EA 3FXDA 4XPDC 2HB6A 3EY5A 5KLVJ 3KQGA 2QVAA 2H88C 3WUUA 2V8VA 1F2PA 3N4XA 1VQ8P 1LWUB 4C7NA 4H2KA 5AVQB 2IZ0A 3SI1A 5DWMA 4H0LC 3RBZA 1FJPA 5AW8B 3L36A 2JBKA 2YGWA 1YTZI 3SFEC 2G0BA 2FYUJ 1Y7RA 1ZXGA 4GT1A 4IFFA 4IL6H 4BWNA 3D7FA 1RF0C 2AXCA 1SQVE 3FX6A 3B8GA 5JPHA 4UEEA 4ZBGA 1NKNA 1KQFB 2Z5HA 4ORFA 5KAIH
chains in the Genus database with same CATH topology
1PU9A 4KVXA 1FDIA 3Q1MA 1VF5B 3ZZIA 1ZOYC 4YRHA 1MK4A 2PRBA 1YVKA 1FY7A 3R1KA 4KLWA 4TT3H 1ON0A 2EVNA 3AE8C 3GKRA 3IWEA 5KTDA 4II9A 2VQYA 3R96A 1QSTA 4B11A 4CAXA 3TO7A 4B5PA 1Y9KA 5IV0A 2G3TA 4B10A 4MFLA 3RYOA 2NMTA 2VEZA 4KVME 2BL1A 2Z3PA 3IGRA 5AG7A 2QJYC 2OQQA 5ISVA 2FL4A 4A30A 4KOWA 1S3ZA 2PQ8A 3KKWA 4L8AA 3D8PA 2J8MA 2WQYC 3F0AA 4JD6A 2Z10A 5HH1A 2E74D 4JJXA 4Q38A 2OU2A 4J3GA 3TCVA 5A28A 3AECC 1S5KA 3H5ZA 1MJBA 4I7ZB 4PV1D 4F0XA 4U9YA 3DR8A 4H89A 2E76B 4E2AA 5F48A 1U6MA 2BSWA 2WSAA 3TT2A 3FNCA 5GCNA 2VBQA 4I49A 4KOSA 1DIPA 1KMIZ 2FCKA 1PIXA 1MKMA 3H4QA 4JWPA 4FD6A 2PSWA 3WR7A 5EC4A 3GF7A 3R9EA 3FRMA 4B5PB 4KOTA 4CYNA 2Q04A 3FIXA 1L0CA 3SXOA 3E0KA 2V7QJ 2D2CB 1SQHA 2O01J 5I0CA 4BBHA 1MJ9A 1LRZA 4R4MA 4NCZA 4E0AA 1VL2A 1FDOA 2HUZA 4C2ZA 3DNSA 4CAFA 1S7FA 4IF5A 1Q90D 2J8NA 2B5GA 3B71A 1Q2CA 2Z11A 5M1BA 4DNCA 2AE6A 4OAEA 4CGPA 3EO4A 5AG5A 3P2FA 4AG7A 1KZFA 2OZGA 4AVAA 4UWIA 2I79A 1TU3F 1OW8A 4Y49C 2IL4A 2DPSA 4CYQA 1VF5D 2E74C 4HNXB 3R9FA 3DR6A 3JTKA 4QVTA 1IICA 2K9YA 2NZ2A 4PV1C 3S6HA 3GF3A 3N7ZA 4KOUA 4KSFA 1GHEA 3PGPA 2JDDA 4CS0B 1WMKA 1XIXA 1RO5A 3CXPA 2GIVA 2JEVA 4U7JA 2R7HA 2CY2A 4GDOA 2R8VA 1WK4A 2FT0A 1IIDA 1Z4RA 2H89C 5HMNA 4PV1B 4CYOA 1BO4A 5C82A 3A9LA 2YNCA 4HKFA 2WSFJ 3AEEC 3TOAA 3Q5PA 4YFJA 1YQ3C 1QSNA 5J8FA 3ABVC 1R57A 2REEA 2BEIA 2ZW7A 4RS2A 3Q3DA 1YX0A 1YR0A 4FD4A 4UFXA 3O6QA 1VKCA 5IX3A 2ZT9D 4L89A 4XNHC 1KUXA 1S7KA 3S6KA 4KUBA 1KORA 1P0HA 2FBWC 4YXDC 4KORA 1QSMA 3EFAA 2YMKA 4C7HA 4M85A 1KILE 2YNCC 3BJ8A 4KZTA 2E76D 5KTAA 3AEBC 1J4JA 4XNHB 4XPKA 4PK2A 4MFPA 1VF5C 3R95A 5AG6A 3LD2A 2WPVB 3R9GA 4R4LA 2FYNC 2FS5A 1B87A 1M44A 3DSBA 3EWKA 4XFJA 4LUAA 3FGAD 3D2MA 3AE3C 4KT0J 2D2CD 4OGQB 3Q5RA 3TO9A 3VWDA 2OB0A 4NSQA 1AJYA 4H6ZA 1OZPA 1DD4A 2F5IA 4AVCA 3AEGC 3AE4C 1EXIA 1QSOA 2QIRA 4H44D 1B6BA 2ZW6A 4HNWB 4A31A 4AB7A 4CYPA 1PV3A 2GANA 4C2XA 2OH1A 4PK3A 1Y9BA 2R98A 2VZZA 2ZT9C 4CAEA 3GMAA 3AE6C 4R9MA 2QJKC 4I7ZC 4ONUA 3TTHA 4CRYB 4MFZA 3H25A 1U57A 3TE4A 1I1DA 2CNTA 4CGMA 3RK3E 3TFYA 1I21A 5G22A 1OW6A 2E76C 2ZT9B 4KUAA 5AGEA 3LODA 3R4YA 4KOVA 2E75D 3SFDC 1VHSA 2JDCA 2Z3MA 4KOYA 2Q44A 1RQVA 2QJPC 3BJ7A 3AE5C 3D6ZA 2PR8A 2Q4YA 2D2CC 4QUSA 4U5YA 2G3AA 1WWZA 4AVBA 3I9SA 2BEZF 1NYHA 1K4JA 1MJAA 4MFJA 3SXNA 2J5UA 4A32A 1ZO0A 2YNDA 4MI4A 4PSWA 4C2YA 3ZJ0A 3F8KA 4UCPA 1XMTA 4KLVA 3EC4A 1ZP0C 4H44B 2D4PA 1OMIA 2Q4VA 1CM0A 4OGQD 1HF9A 1IYLA 3AE9C 2DXQA 5IB0A 2HQYA 3C8VA 1IK7A 3S9OA 2FIWA 1I12A 2P6EA 3G9RA 2E75C 2ARHA 1TIQA 2Y0MA 5AG4A 3AEDC 5BWAB 1NE9A 2Z3KA 4FD7A 2JLMA 4R87A 1HJ0A 4C7IA 3IN6A 1N71A 4LX9A 3W91A 5L8RJ 2AJ6A 4RI1A 2C27A 2E75B 2JP3A 4OLLA 5KLIC 2GE3A 4YGOA 4CGOA 4CRZB 4B14A 1XF8A 3CXSA 4NXYA 2QMLA 3TO6A 2Q7BA 4PV6A 3IU1A 3GYAA 3FYNA 2RC4A 2CNSA 1QSRA 3C26A 2ATRA 1Q2DA 5EBVA 1KUVA 4GS4A 2B4DB 3AE1C 5KTCA 2BEQD 2B3UA 2P6GA 4A95A 1Q2YA 4MHDA 4A2ZA 3W6XA 1DD3A 1S5LX 4RKUJ 4OGQC 3SHPA 2FE7A 4X5KA 2P0WA 2QSIA 4F6AA 2J8RA 4ZGYB 3NE7A 1M4DA 3W6SA 2K5TA 4F0YA 3FB3A 3FBUA 3EXNA 1KQGB 3D2PA 1K04A 3Q2YA 4HNYB 1OW7A 1BOBA 3PP9A 4KSAA 4MJ8A 4A33A 2BUEA 1IYKA 3DDDA 4FD5A 2FIAA 4BMHA 4U9ZA 2WSCJ 1M1DA 4NF1A 3K9UA 3S6FA 2H5MA 2PDOA 1RXTA 3IWGA 2FXPA 2HV2A 3D3SA 3AEAC 5KKZC 4IL6X 2QIWA 4UCMA 5G21A 2OZHA 4KS9A 4PSXA 3CXQA 3OWCA 2JO1A 3D71A 4MY0A 2REFA 4QBJA 2Z3OA 2ZXVA 2PR1A 4OADA 4EVYA 2P6FA 1EXJA 1YVOA 4JXRA 1UIXA 1K05A 2MKVA 3IAOA 3GLMA 4H13D 4KOXA 3AE2C 2B58A 2QECA 3MGDA 3VWEA 4MY3A 2YIUC 1UFHA 2Z3NA 1CJWA 4R3LA 2DPTA 1YK3A 3I3GA 4KVOE 4MFKA 3AE7C 3JUWA 1YLEA 3S6GA 2Z3LA 2Z0ZA 4B13A 1ZRTE 4B5OA 2A4NA 4AG9A 1JB0J 3F5BA 2IDBA 2CXAA 2KCWA 2WPWA 2PC1A 4H44C 5J8CA 5JQ4A 4R3KA 1V0CA 4E8OA 4UFVA 1S1CX 2CNMA 3T97B 2VXKA 4IUSA 3JVNA 1P4NA 5G1ZA 5F46A 3G3SA 3IU2A 1PUAA 3QAHA 1ZMEC 3UY5A 4M3SA 5E96A 4C68A 2D4OA 4UCNA 2B4DA 5FVJA 4H13C 3QB8A 2G8YA 4CGNA 1XEBA 1YQ4C 4H0LD 1S60A 3P2HA 4UWJA 3G8WA 1RQUA 1XE4A 3BLNA 2ZW5A 5CNPA 5DWNA 4B12A 2B3VA 3FXTA 2P10A 4H6UA 3RL0g 1Y9WA 2EUIA 4CAVA 5G20A 2B4BA 2WSEJ 2ZW4A 4H13B 3D6YA 4CGLA 2O28A 5C88A 4JLYA 4YTPC 2FXFA 4JXQA 1NMTA 1M4GA 2WUUA 4R57A 4UBRA 1YREA 5F47A 4K30A 2Q0YA 2OZUA 1KUYA 3V8IA 1KTMA 2WPXA 1GMJA 1Z4EA 4Y28J 1NGMB 2FSRA 3GY9A 4XPLA 4CAWA 1S7LA 1Z9UA 5F49A 3Q5SA 4Y49B 1S7NA 2E74B 4QC6A 3T90A 4MFQA 4XPDC 2VZYA 3EY5A 4QB9A 3T9YA 4UFWA 2H88C 1YGHA 4Q36A 4NEXA 3D70A 2B5GB 4MBUA 4XPDB 4Z1MH 3PZJA 3AEFC 5DWMA 4H0LC 1PL5A 2VI7A 2YGWA 2G0BA 3SFEC 3LW5J 2R1IA 1Y7RA 2X7BA 5H84A 2I00A 4H0LB 3TOBA 1NSLA 5H86A 1M4IA 4UA3A 5A27A 3B8GA 1IB1E 5JPHA 4ZBGA 1KQFB 2YNEA 4ORFA 1R8EA 2ZPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PU9 A;  4KVX A;  3ZZI A;  1ZOY C;  4YRH A;  1MK4 A;  2PRB A;  1YVK A;  1FY7 A;  3R1K A;  4KLW A;  1ON0 A;  2EVN A;  3AE8 C;  3GKR A;  5KTD A;  4II9 A;  2VQY A;  3R96 A;  1QST A;  4CAX A;  3TO7 A;  4B5P A;  1Y9K A;  5IV0 A;  2G3T A;  3RYO A;  2NMT A;  2VEZ A;  4KVM E;  2BL1 A;  3IGR A;  5ISV A;  2FL4 A;  4KOW A;  1S3Z A;  2PQ8 A;  3KKW A;  4L8A A;  3D8P A;  2J8M A;  2WQY C;  3F0A A;  4JD6 A;  2Z10 A;  5HH1 A;  4JJX A;  2OU2 A;  4J3G A;  3TCV A;  3AEC C;  1S5K A;  1MJB A;  4U9Y A;  3DR8 A;  4H89 A;  4E2A A;  5F48 A;  1U6M A;  2BSW A;  3TT2 A;  3FNC A;  5GCN A;  2VBQ A;  4I49 A;  4KOS A;  2FCK A;  3H4Q A;  4JWP A;  4FD6 A;  2PSW A;  3WR7 A;  5EC4 A;  3R9E A;  3FRM A;  4B5P B;  4KOT A;  2Q04 A;  3FIX A;  1L0C A;  3SXO A;  3E0K A;  1SQH A;  5I0C A;  1MJ9 A;  1LRZ A;  4NCZ A;  4E0A A;  2HUZ A;  3DNS A;  1S7F A;  4IF5 A;  2J8N A;  2B5G A;  3B71 A;  1Q2C A;  2Z11 A;  4DNC A;  2AE6 A;  4OAE A;  3EO4 A;  4AVA A;  3P2F A;  4AG7 A;  1KZF A;  2OZG A;  4UWI A;  2I79 A;  1OW8 A;  4Y49 C;  2IL4 A;  4HNX B;  3R9F A;  3DR6 A;  4QVT A;  1IIC A;  3S6H A;  3N7Z A;  4KOU A;  1GHE A;  3PGP A;  2JDD A;  4CS0 B;  1XIX A;  1RO5 A;  3CXP A;  2GIV A;  2JEV A;  2R7H A;  2CY2 A;  2R8V A;  1WK4 A;  2FT0 A;  1IID A;  1Z4R A;  2H89 C;  5HMN A;  1BO4 A;  5C82 A;  4HKF A;  3AEE C;  3TOA A;  4YFJ A;  1YQ3 C;  1QSN A;  5J8F A;  2REE A;  1R57 A;  3ABV C;  2BEI A;  2ZW7 A;  4RS2 A;  1YX0 A;  1YR0 A;  4FD4 A;  1VKC A;  5IX3 A;  4L89 A;  4XNH C;  1KUX A;  1S7K A;  3S6K A;  4KUB A;  1P0H A;  2FBW C;  4YXD C;  4KOR A;  1QSM A;  3EFA A;  4M85 A;  4KZT A;  3BJ8 A;  5KTA A;  3AEB C;  1J4J A;  4XNH B;  4XPK A;  4PK2 A;  3R95 A;  3LD2 A;  3R9G A;  2FS5 A;  1B87 A;  1M44 A;  3DSB A;  4LUA A;  3D2M A;  3AE3 C;  3VWD A;  3TO9 A;  2OB0 A;  4NSQ A;  4H6Z A;  1OZP A;  2F5I A;  4AVC A;  3AEG C;  3AE4 C;  1QSO A;  2QIR A;  4HNW B;  1B6B A;  2ZW6 A;  4AB7 A;  1PV3 A;  2GAN A;  2OH1 A;  4PK3 A;  2R98 A;  2VZZ A;  3AE6 C;  4R9M A;  4ONU A;  3TTH A;  4CRY B;  3TE4 A;  1I1D A;  2CNT A;  3TFY A;  1I21 A;  1OW6 A;  4KUA A;  3LOD A;  4KOV A;  3SFD C;  1VHS A;  2JDC A;  4KOY A;  2Q44 A;  3BJ7 A;  3AE5 C;  2PR8 A;  2Q4Y A;  4QUS A;  4U5Y A;  2G3A A;  1WWZ A;  4AVB A;  3I9S A;  1K4J A;  1MJA A;  3SXN A;  4MI4 A;  4PSW A;  3ZJ0 A;  3F8K A;  1XMT A;  4KLV A;  3EC4 A;  1ZP0 C;  2D4P A;  2Q4V A;  1CM0 A;  1IYL A;  3AE9 C;  2DXQ A;  5IB0 A;  2HQY A;  3S9O A;  2FIW A;  1I12 A;  2P6E A;  2ARH A;  1TIQ A;  2Y0M A;  3AED C;  1NE9 A;  4FD7 A;  2JLM A;  4R87 A;  1N71 A;  4LX9 A;  3W91 A;  2AJ6 A;  4RI1 A;  2C27 A;  4OLL A;  2GE3 A;  4YGO A;  4CRZ B;  1XF8 A;  3CXS A;  4NXY A;  2QML A;  3TO6 A;  2Q7B A;  4PV6 A;  3GYA A;  3FYN A;  2RC4 A;  2CNS A;  1QSR A;  3C26 A;  2ATR A;  1Q2D A;  5EBV A;  1KUV A;  4GS4 A;  2B4D B;  3AE1 C;  5KTC A;  2B3U A;  2P6G A;  1Q2Y A;  4MHD A;  3W6X A;  3SHP A;  2FE7 A;  4X5K A;  2P0W A;  4F6A A;  2J8R A;  3NE7 A;  1M4D A;  3W6S A;  2K5T A;  4F0Y A;  3FB3 A;  3FBU A;  3EXN A;  3D2P A;  1K04 A;  4HNY B;  1OW7 A;  1BOB A;  3PP9 A;  4MJ8 A;  2BUE A;  1IYK A;  3DDD A;  4FD5 A;  2FIA A;  4BMH A;  4U9Z A;  1M1D A;  4NF1 A;  3K9U A;  3S6F A;  2H5M A;  2PDO A;  1RXT A;  3IWG A;  2HV2 A;  3D3S A;  3AEA C;  2OZH A;  4PSX A;  3CXQ A;  3OWC A;  4MY0 A;  2REF A;  4QBJ A;  2ZXV A;  2PR1 A;  4OAD A;  4EVY A;  2P6F A;  1YVO A;  4JXR A;  1K05 A;  4KOX A;  3AE2 C;  2B58 A;  2QEC A;  3MGD A;  3VWE A;  4MY3 A;  1UFH A;  1CJW A;  4R3L A;  1YK3 A;  3I3G A;  4KVO E;  3AE7 C;  3JUW A;  1YLE A;  3S6G A;  2Z0Z A;  4B5O A;  2A4N A;  4AG9 A;  3F5B A;  2KCW A;  2WPW A;  2PC1 A;  5J8C A;  5JQ4 A;  4R3K A;  1V0C A;  4E8O A;  2CNM A;  2VXK A;  4IUS A;  3JVN A;  1P4N A;  5F46 A;  3G3S A;  1PUA A;  3QAH A;  3UY5 A;  4M3S A;  5E96 A;  2D4O A;  2B4D A;  5FVJ A;  3QB8 A;  1XEB A;  1YQ4 C;  1S60 A;  3P2H A;  4UWJ A;  3G8W A;  1XE4 A;  3BLN A;  2ZW5 A;  5CNP A;  5DWN A;  2B3V A;  3FXT A;  4H6U A;  1Y9W A;  4CAV A;  2EUI A;  2B4B A;  2ZW4 A;  2O28 A;  5C88 A;  4JLY A;  4YTP C;  2FXF A;  4JXQ A;  1NMT A;  1M4G A;  4R57 A;  4UBR A;  1YRE A;  5F47 A;  4K30 A;  2Q0Y A;  2OZU A;  1KUY A;  3V8I A;  1KTM A;  2WPX A;  1Z4E A;  3GY9 A;  2FSR A;  4XPL A;  4CAW A;  1S7L A;  1Z9U A;  5F49 A;  4Y49 B;  1S7N A;  4QC6 A;  3T90 A;  4XPD C;  2VZY A;  3EY5 A;  4QB9 A;  3T9Y A;  2H88 C;  1YGH A;  4NEX A;  2B5G B;  4MBU A;  4XPD B;  3PZJ A;  3AEF C;  5DWM A;  2VI7 A;  2G0B A;  3SFE C;  2R1I A;  1Y7R A;  2X7B A;  5H84 A;  2I00 A;  3TOB A;  1NSL A;  5H86 A;  1M4I A;  4UA3 A;  3B8G A;  1IB1 E;  5JPH A;  4ZBG A;  4ORF A;  2ZPA A; 
#chains in the Genus database with same CATH topology
 1PU9 A;  1M1J A;  1MFZ A;  2A45 H;  3Q1M A;  4M6I A;  2VRS A;  1Q7L A;  3FEE A;  3VMY A;  4DYO A;  2FYN B;  1RE3 C;  5BU5 A;  2PRB A;  3O6Q B;  1LTG C;  1ON0 A;  2OTJ P;  3BI1 A;  3AE8 C;  3FED A;  3R2P A;  3T97 A;  1L0L J;  3BHX A;  2V4H A;  4RUH A;  1JOC A;  1JEK A;  2QM8 A;  1T2K D;  2G3T A;  3RYO A;  3L72 D;  1Y8A A;  3L72 E;  5ISV A;  2FL4 A;  4NGM A;  4A30 A;  2DF5 A;  2WQY C;  1WRG A;  4JD6 A;  1JY2 N;  1IU8 A;  4J3G A;  1EQ7 A;  1FS0 E;  1PP9 D;  4GOD A;  1GL2 B;  3GHG A;  3H1H J;  2C1C A;  3P32 A;  1SQX D;  1PP9 E;  5APU A;  1FOS F;  3L2N A;  3TT2 A;  1SQX E;  2ZYG A;  5GCN A;  2KIK A;  2FCK A;  4ZY1 A;  1MKM A;  3H4Q A;  2PSW A;  3WR7 A;  1H8A A;  2WPR A;  4D6T J;  4ZY2 A;  1DEE G;  2IFM A;  2Q04 A;  1L0C A;  5KTB A;  1IK9 A;  3GHG C;  4BBH A;  3IC1 A;  1LRZ A;  4R4M A;  1N2D C;  4E0A A;  1VL2 A;  2HUZ A;  3W67 A;  3PB6 X;  3DNS A;  3GIU A;  1S7F A;  1L0L K;  4IF5 A;  1Q90 D;  3TX8 A;  3RNZ A;  3A0B H;  4DNC A;  2AE6 A;  4CGP A;  3EO4 A;  4JYW A;  4A7P A;  1XJO A;  1XMB A;  2I79 A;  4WY4 D;  2DPS A;  1QVF O;  2E74 C;  1SQB J;  4HNX B;  2VL1 A;  3JSV C;  4QVT A;  4UB6 E;  5AVZ B;  4PXB A;  2FFD A;  1LT1 A;  4KJM A;  4KOU A;  5AW9 B;  1CPX A;  1CZQ A;  2ZYA A;  3PBE A;  1XFO A;  3HE4 B;  4GDO A;  1WK4 A;  3FXE A;  1IID A;  1Z4R A;  4PV1 B;  4CYO A;  1GDT A;  3MUD A;  2YNC A;  4PXE A;  4A39 A;  1IY7 A;  1ZN5 A;  3CCJ P;  1VIX A;  1R57 A;  4F8Z A;  1YR0 A;  3PB4 X;  2FFD C;  4R6T A;  1LTS C;  3CCQ P;  1TXR A;  3LIE A;  5LYL A;  2JWD A;  1S7K A;  2QE7 H;  2AFU A;  4KOR A;  4YXD C;  3CPW O;  3L71 J;  3L74 G;  5KAF E;  3E1I A;  5AW7 B;  4YXW H;  2BCC D;  3MUD C;  2W27 A;  2YNC C;  5AW3 B;  1LFW A;  2KK7 A;  1SVF A;  1QMU A;  1Q86 Q;  3B7I A;  1SQB K;  3SSU A;  4KT0 J;  2CPB A;  4NGN A;  3WU2 E;  2OB0 A;  2OR4 A;  1NTZ K;  1W5C E;  3BCC J;  5K8N A;  1LCP A;  5CJ0 A;  3PRJ A;  4C2X A;  4JZ0 A;  2KSJ A;  2R98 A;  2VZZ A;  1CG2 A;  4JF7 A;  1CSB A;  5CMZ A;  2QJK C;  2XEG A;  4CRY B;  2BAS A;  3H25 A;  3I56 P;  1R5L A;  3TFY A;  1I21 A;  2E76 C;  4KUA A;  5AGE A;  1YQE A;  3PLN A;  1MUU A;  3SJE A;  2EBJ A;  3FEC A;  1GK6 A;  1ZV8 A;  2OGU A;  4PXC A;  2A06 D;  3CWB J;  5HVF A;  2Z3M A;  2PP6 A;  1Z8W A;  3M0D C;  3D6Z A;  1LAP A;  5TJH A;  1OFC X;  2A06 E;  3ISX A;  4U5Y A;  2R44 A;  5APW A;  1OXZ A;  4P4F A;  1FC2 C;  4A32 A;  2O01 N;  1ZG8 A;  3S1K A;  3VH9 A;  2YND A;  4MI4 A;  5LYF A;  1VQ6 P;  3B3T A;  3FWN A;  1T6A A;  2ZFC A;  4ASW A;  1VQ7 P;  4GXH A;  4KLV A;  2K1A A;  3L72 G;  4H44 B;  3RK3 C;  3P8M C;  4BD9 A;  2D4P A;  4OC4 A;  1VQK P;  1OMI A;  4EFD A;  1CM0 A;  1HF9 A;  2HYN A;  1Z56 A;  1FOS E;  1IK7 A;  3QWO C;  1HDU A;  1NVO A;  2RH0 A;  1NTM J;  3CDX A;  1A2Z A;  4A94 A;  1PP9 G;  3II6 A;  2Z3K A;  1H88 A;  4AUW A;  4R87 A;  3B3S A;  4C7R A;  3L75 D;  1Q82 Q;  1L0L D;  4LX9 A;  2A45 G;  3ITK A;  2E75 B;  2JP3 A;  3L75 E;  3GW6 A;  1L0L E;  4YGO A;  2E42 A;  4WY4 A;  3CXS A;  4NXY A;  2QML A;  1JCD A;  3B8E B;  1H8L A;  4MRI A;  3IU1 A;  2ZXE B;  2ATR A;  1NTK J;  1FZC B;  4ZKP A;  1KUV A;  2KSE A;  1BGY J;  1S5L H;  2PCU A;  1PPJ G;  2N1T D;  2PVV A;  4R76 A;  3W6X A;  2L91 A;  5K8M A;  5AVY B;  1S9K D;  1YJN P;  2F8H A;  2J8R A;  1S9K E;  3W6S A;  1TKF A;  2GA1 A;  2K5T A;  4F0Y A;  3FB3 A;  5APQ A;  1LOK A;  1BOB A;  2W90 A;  3NFQ A;  2PGD A;  2Q9I A;  3PP9 A;  1NTM K;  4A38 A;  4MJ8 A;  1PGO A;  3KDP B;  3G6E P;  4OP4 A;  3DDD A;  4BMH A;  2I1J A;  2ABZ A;  4L73 A;  4U9Z A;  3K9U A;  2PDO A;  4PJ0 E;  1ZLH A;  5KKZ C;  1HH0 A;  4OME A;  3KHZ A;  3LW5 H;  3D68 A;  2XEJ A;  2OZH A;  5AW0 B;  1YJW P;  1IFJ A;  1VQ9 P;  1SQB D;  1JCC A;  2OYI A;  4OAD A;  3VAR A;  2P6F A;  4JYB A;  1NTK K;  1SQB E;  3V5B A;  2WYR A;  4GOE A;  2BCC G;  1NTZ D;  1N8R Q;  4C46 A;  2YXQ B;  2QEC A;  1NTZ E;  3VWE A;  3MN8 A;  4N6J A;  2O1K A;  1LT9 A;  2W83 C;  3FWL A;  1CJW A;  1M1K Q;  3I3G A;  4IOI H;  4KVO E;  2KLV A;  4MFK A;  2DEA A;  3SWK A;  2OYI C;  3B3W A;  1S3J A;  2PJ8 A;  4B13 A;  1L2P A;  3A7O A;  3D67 A;  4Y99 C;  1JB0 J;  1YJ9 P;  1M1J B;  2IDB A;  4U3F J;  1KQL A;  4Q7A A;  2PC1 A;  4OID A;  1ZR4 A;  2Q5U A;  5JQ4 A;  4W7Z A;  4DZO A;  1LT9 C;  4EOT A;  1V0C A;  4R3K A;  3BXM A;  2ZEH A;  2WTY A;  1S1C X;  3TDK A;  3T97 B;  1KD1 Q;  2Q3I A;  2XEI A;  2ZOF A;  1ELL P;  1PUA A;  3QAH A;  3UY5 A;  4C68 A;  3BRT B;  1QL1 A;  1JY2 P;  4FUU A;  3QB8 A;  3W68 A;  4CGN A;  1YQ4 C;  4H0L D;  4P44 A;  4HJG H;  2ZEL A;  2ZEG A;  3KHX A;  5CNP A;  4AXV A;  2N9B A;  4H6U A;  3RL0 g;  4LQG A;  3CXH D;  3TGU D;  2WSE J;  2AFW A;  2ZW4 A;  4H13 B;  2A06 G;  3BCC D;  3CXH E;  4JQ0 D;  5C88 A;  4YTP C;  3TGU E;  1S2E A;  4R57 A;  2AEM A;  3BCC E;  1N73 C;  1KUY A;  2PJ0 A;  2L5G B;  2WMM A;  2B88 A;  3NMD A;  4Y28 J;  3FF3 A;  3GY9 A;  1KB9 D;  1LTJ A;  4XPL A;  3S9M A;  1FNO A;  1Z9U A;  5F49 A;  1KB9 E;  1S7N A;  2E74 B;  4QC6 A;  2GM4 A;  2WPQ A;  4UFW A;  4I6M C;  4P10 A;  4P4I A;  3WC5 A;  1ZLI A;  2AEF A;  3SWF A;  1YGH A;  1QEX A;  4ZYQ A;  4NEX A;  3CWB D;  3M91 A;  1LTJ C;  3CWB E;  2K9J A;  1USD A;  5AW6 B;  3PTZ A;  1X0T A;  4NGP A;  5LRG A;  3H8E A;  3MTU E;  2IBZ D;  1U7J A;  4Z65 A;  1PYT B;  2ZAE B;  5APX A;  2IBZ E;  2FFD B;  1NU1 J;  3L75 G;  5GTI E;  2I3C A;  1NSL A;  3V2N A;  2N1T A;  1L0L G;  3L70 G;  5CCG C;  3KPE A;  1IOI A;  3KZI H;  1JY3 P;  5TIS H;  1GTW A;  2YNE A;  1L4A B;  3ISZ A;  3CC2 P;  3I55 P;  1KYO I;  2KZJ A;  2YMY A;  3UIA A;  3WAB A;  2IJZ A;  2C6P A;  4YRH A;  1YVK A;  1OVV A;  4I2L C;  1AUG A;  1Q7Y Q;  4KLW A;  1NTM D;  2KI7 B;  3H1I G;  1AYE A;  1DX7 A;  1J1D C;  3GKR A;  3IWE A;  1NTM E;  2VQY A;  4IFD K;  1QST A;  4B11 A;  4CAX A;  1BLL E;  3TO7 A;  4B5P A;  1Y9K A;  3CPA A;  4B10 A;  4MFL A;  4O9B A;  3FMC A;  3VP8 A;  4WB4 A;  1BCC D;  4KVM E;  3HLP A;  2BL1 A;  2Z3P A;  1ZW0 A;  1NAF A;  1CPS A;  5AG7 A;  1BCC E;  2AXT H;  2M3B A;  2IQ6 A;  2PQ8 A;  5GTH E;  4B6Z A;  3KGQ A;  3KKW A;  2PIY A;  2Z10 A;  5HH1 A;  2E74 D;  4JJX A;  3HD7 D;  1NTK D;  3KQX A;  4Q38 A;  2OU2 A;  2IX7 C;  1S5K A;  2OYH A;  3PB7 X;  2PJ6 A;  1NTK E;  4F0X A;  1BGY D;  1OWA A;  2E76 B;  1BGY E;  1U6M A;  2BSW A;  3JRU A;  3FNC A;  4UEF A;  4FD6 A;  2XKM A;  2YO2 A;  3R9E A;  2PJ9 A;  4KOT A;  4CYN A;  3FIX A;  2V7Q J;  4HH2 A;  1NKZ B;  1HBW A;  3KL9 A;  4TWE A;  1SQH A;  4WWV A;  5I0C A;  4PD4 D;  1NTZ G;  2NPS C;  3RAM A;  3TF5 A;  4X3R A;  3T8W A;  4PD4 E;  1PFI A;  3B71 A;  2Z11 A;  3MIW A;  5APT A;  4YPC A;  4XE5 B;  1HUC A;  1BE3 J;  2HR3 A;  4MHZ A;  3B4S A;  1SQQ K;  4CYQ A;  3V2R A;  2XEF A;  3JTK A;  1IIC A;  2NZ2 A;  3RK3 B;  3S6H A;  2PJ2 A;  4NPF X;  3PGP A;  2JDD A;  2AFS A;  4CS0 B;  2ZEM A;  4MCP A;  1R5S A;  2R8V A;  2A45 I;  4JBZ A;  4IHM A;  4I1L A;  1L0N G;  3A9L A;  1TKJ A;  2WSF J;  3DGV A;  1QGK B;  4LGD E;  1RF0 A;  1IZN B;  3NH5 A;  2YKQ A;  2Q7C A;  3L37 A;  2ZW7 A;  4LQ6 A;  4UFX A;  5IX3 A;  1LAM A;  4L89 A;  1JY3 O;  1KUX A;  4KUB A;  1KOR A;  1P0H A;  1KIL D;  2FBW C;  3JC2 2;  3EFA A;  3TGU G;  1RE3 A;  4C7H A;  1KIL E;  4KZT A;  1SQV D;  2E76 D;  5KTA A;  1J4J A;  4XNH B;  4PK2 A;  2P67 A;  1KV4 A;  4HKZ H;  1UWY A;  1B87 A;  3L73 J;  3OAK A;  3WT4 A;  2V8G A;  2CTC A;  1FBM A;  3D2M A;  1SP4 A;  3AE3 C;  3TO9 A;  4WY4 B;  3PRT A;  4RN7 A;  3VWD A;  2B87 B;  1NAY A;  4NSQ A;  2M5A A;  4TLF A;  1FT7 A;  4FWU A;  3PB9 X;  3HUV A;  3V4W A;  4H6Z A;  1OZP A;  5AW5 B;  1M56 D;  1S4X A;  3A3Y B;  4AVC A;  2FXO A;  1Y0Y A;  1EXI A;  1QSO A;  1U7M A;  1RE4 C;  5KLV K;  1B6B A;  2ZW6 A;  4DCK A;  1AVO A;  3HE5 A;  4CAE A;  2ZT9 C;  3GMA A;  2R5D A;  5KKZ B;  3RK3 D;  3L35 A;  4ONU A;  3TTH A;  1QL2 A;  3TE4 A;  2IBZ G;  1W2B O;  3RK3 E;  1FZF A;  5G22 A;  3JCU E;  2FYU K;  4UB6 H;  4CPA A;  2MJZ A;  1JNM A;  1M4L A;  4KOV A;  2JEE A;  2GUV A;  3QH9 A;  1NWQ A;  4AQR D;  3KI9 A;  1E79 H;  2KYV A;  1H0T B;  1SQP J;  1A02 J;  2JDC A;  3CX5 D;  2Q44 A;  1AQ5 A;  2PJ7 A;  2D2C C;  1XBU A;  3CX5 E;  2O4H A;  2G3A A;  1WWZ A;  4AVB A;  2Q4Z A;  2BEZ F;  1NYH A;  3HTK A;  3CCL P;  4W9Y A;  3QNV A;  1CI6 A;  2JR8 A;  3HRN A;  3HD7 A;  2OOT A;  3FX0 A;  2OYI B;  2QG4 A;  2OTK E;  5KAF H;  2PJ4 A;  3F8K A;  1BCC G;  3M9H A;  1GW4 A;  2O1J A;  1LT9 B;  5J1Q A;  5EMI A;  2DXQ A;  3HD7 C;  3RK2 C;  3C8V A;  2ZEN A;  2FIW A;  4P4B A;  5AW2 B;  2WVR A;  3G9R A;  2ARH A;  1TIQ A;  3WU2 H;  2Y0M A;  5AG4 A;  3AED C;  3RZA A;  1ZG9 A;  4FD7 A;  2EK8 A;  2JLM A;  1BGY G;  3SJF A;  1Y0R A;  1KZU B;  1A02 F;  1HJ0 A;  3IN6 A;  1AQT A;  1SQP K;  2C27 A;  1J2J B;  4OWF A;  3D7G A;  5KLI C;  1OX3 A;  4KHX A;  3KR5 A;  4CRZ B;  4WVZ A;  1SQQ D;  1FZA A;  4PV6 A;  1SFC A;  2RC4 A;  1QSR A;  1YI2 P;  1Q2D A;  1SQQ E;  1URQ A;  1GZL A;  3A5T A;  4GS4 A;  4X8I A;  4UB8 E;  3CD6 P;  3H1J J;  4ZX9 A;  5KTC A;  2XZR A;  2BEQ D;  5JGF A;  1Q2Y A;  1KN7 A;  2FXM A;  1DD3 A;  1S5L X;  4RKU J;  3SJG A;  3SWY A;  4X5K A;  3B5N C;  4F9U A;  5THW A;  2AFZ A;  4ZGY B;  3PB8 X;  1SFC C;  1M4D A;  5AVT B;  1URQ C;  1VQN P;  1BPM A;  3CCV P;  1KQG B;  1K04 A;  5LRK A;  1KIL A;  3WUV A;  1LTJ B;  4A33 A;  2GLJ A;  3MGN A;  2WSC J;  4NF1 A;  2H5M A;  3CLQ A;  3IWG A;  2FXP A;  3MHV A;  2HV2 A;  3DLJ A;  1X9V A;  1IGB A;  2CPS A;  3LAC A;  4UCM A;  4KS9 A;  1P84 D;  2QM7 A;  4W80 A;  3CXQ A;  4M6H A;  4R8F A;  2JO1 A;  3D71 A;  5ELY A;  3H1L D;  4NFR A;  4OC3 A;  3M0D A;  1P84 E;  4QBJ A;  6CPA A;  4OC2 A;  1KIL C;  2LXC B;  1FE6 A;  3H1L E;  4ZMD A;  4UIB A;  1N7S D;  2K88 A;  1EXJ A;  4EVY A;  2GUS A;  2PIZ A;  2P2U A;  1YVO A;  2NSM A;  3WMM 0;  1FZG A;  2MKV A;  2WZN A;  2PJ3 A;  2XND H;  3HUS A;  3WC7 A;  1SQV G;  5D8N A;  3AE2 C;  1YW6 A;  3BVH A;  5KLV D;  4MY3 A;  3IEH A;  1UFH A;  2FVG A;  2N1T B;  5KLV E;  3P7K A;  1J1D B;  1ZRT D;  5B66 E;  3LMS A;  3BAT A;  2Z3L A;  2Z0Z A;  5I4M A;  2R32 A;  1ZRT E;  2YIU B;  1NOH A;  1X8Y A;  2PJ5 A;  3F5B A;  2LXB A;  1S72 P;  3HUS C;  2CXA A;  2KCW A;  3NA6 A;  2KLU A;  3RBX A;  1YHQ P;  2FYU D;  1YYC A;  5J8C A;  3CC7 P;  2N9Y B;  3B3V A;  2FYU E;  5KJ7 A;  3TC8 A;  4MMO A;  5JH9 A;  1LP1 A;  2GRE A;  4IUS A;  1KQS O;  1BAV A;  1ELM P;  1P4N A;  5F46 A;  2ZEO A;  3L73 D;  1GD2 E;  4M3S A;  5FVJ A;  3L73 E;  1S60 A;  5BVZ A;  1VQM P;  1EDK A;  1LJ2 A;  3BLN A;  4B12 A;  2SPZ A;  2B3V A;  5KJ7 C;  1RH5 B;  1SQX G;  2WT7 A;  5AW4 B;  2Y0C A;  2OYH B;  2FXF A;  1NMT A;  2WUU A;  4ZI6 A;  4UBR A;  2Y9Z A;  4PJ0 H;  1YRE A;  5CCG D;  2OZU A;  3V8I A;  4EWT A;  3F89 A;  4DOJ A;  5H2F E;  4EIJ A;  1KTM A;  2E5T A;  4CPG A;  3TYY A;  1KFM A;  2HPC A;  5AVR B;  1LWU C;  3T90 A;  4R7M A;  1T3U A;  4MFQ A;  4BRY A;  1EC5 A;  3H1H D;  3KAS A;  1SQP D;  1OIP A;  4W7Y A;  3H1H E;  1ARM A;  4MBU A;  5K5G B;  1M90 Q;  2DW3 A;  4Z1M H;  4XPD B;  1SQP E;  3PZJ A;  1VQP P;  4NGS A;  3V4Q A;  4D6T D;  2NRG A;  1E5W A;  2CF4 A;  4TNU A;  4D6T E;  2X7B A;  2AFX A;  4H0L B;  4L74 A;  1LAN A;  4MHY A;  3MRU A;  1M4I A;  2RB7 A;  4UA3 A;  3PH0 A;  1AV1 A;  5EFW B;  4L76 A;  1BSH A;  2HOD A;  5A27 A;  2OYO A;  2YNY A;  1R8E A;  1KB9 I;  1SQQ G;  4P45 A;  4KVX A;  1FDI A;  5B5E H;  5APV A;  1ZLL A;  4C7N B;  1HDQ A;  4FBE A;  2CK3 H;  1ZOY C;  3FJU A;  2JWA A;  2ZYD A;  3R1K A;  2EVN A;  1ZR2 A;  1GU4 A;  3VOP A;  5KTD A;  5DJT B;  4II9 A;  3R96 A;  2W8Z A;  2Q51 A;  2NPS D;  3IR9 A;  3WUT A;  5IV0 A;  1YBK A;  2NMT A;  3CXH H;  3CC4 P;  1IFN A;  3PBB A;  3E7K A;  2IBZ I;  2E5Y A;  4KOW A;  1N7S A;  3F0A A;  4K35 A;  4LC1 A;  4MHP A;  1BPN A;  3TCV A;  5A28 A;  2M5A B;  1MJB A;  3H1J D;  1KB9 H;  3L71 D;  3IFM A;  2H43 A;  1XOV A;  2PE3 A;  2PRQ A;  3DR8 A;  3H1J E;  4H89 A;  3L71 E;  4E2A A;  3USS A;  1EE3 P;  2Q43 A;  4I49 A;  3U59 A;  1FZE A;  1DIP A;  3H1L G;  4BXL A;  5B5E E;  5EC4 A;  3GF7 A;  1N7S C;  5AW1 B;  3M9Q A;  5AVV B;  4FAI A;  3HE5 B;  1N73 A;  2LKM A;  3SXO A;  2OAR A;  3E0K A;  2PJA A;  2D2C B;  2O01 J;  3M9B A;  4HPS A;  1PGJ A;  3BI0 A;  1MJ9 A;  2XDJ A;  3IFE A;  4NCZ A;  1FDO A;  3V2P A;  4C2Z A;  2HG5 D;  4DJG A;  5KLV G;  2J8N A;  2B5G A;  3P8C D;  1Q2C A;  5GTI H;  5M1B A;  1EZV D;  4OAE A;  3SI0 A;  3GHG B;  5AG5 A;  3P2F A;  3P8C E;  1KZF A;  4AG7 A;  3GG2 A;  4AVA A;  1EZV E;  2IL4 A;  2B89 A;  3PEI A;  2CIJ A;  3R9F A;  3D66 A;  2K9Y A;  4PV1 C;  2Y0D A;  3V38 A;  3GF3 A;  3HTK B;  4KSF A;  1J1E C;  2FYU G;  1WMK A;  1CI6 B;  1XIX A;  1W2E A;  1EDJ A;  1RO5 A;  3CXP A;  3HD7 B;  2GIV A;  1NHL A;  4HB1 A;  4U7J A;  2R7H A;  2CY2 A;  3I1U A;  2FT0 A;  5HMN A;  2H89 C;  3OJA B;  3S4R A;  1YW4 A;  5IB9 A;  1IC2 A;  4HKF A;  3RL0 C;  1LTA C;  5CCG A;  3Q5P A;  1YQ3 C;  1QSN A;  5J8F A;  3VAT A;  3ABV C;  1N7L A;  5LYD A;  3Q3D A;  1YX0 A;  3LWU A;  4FD4 A;  3RO0 A;  1MFT A;  2J59 M;  2ZT9 D;  3A0H E;  3S6K A;  5GTH H;  2P1J A;  1RF1 A;  3CCE P;  2YMK A;  1RY3 A;  4M85 A;  4M6G A;  4DT0 A;  3G4S P;  4PQA A;  2LR2 A;  1VF5 C;  3R95 A;  5AG6 A;  2FS5 A;  1NH4 A;  2ZVN B;  2RMZ A;  3RGU A;  3DSB A;  3EWK A;  1X79 B;  2ZEF A;  4JPZ B;  3FGA D;  2D2C D;  1IFM A;  1PGP A;  1HVV A;  8CPA A;  3VMZ A;  5CCH A;  1RF1 C;  1SFC B;  2F5I A;  1T3J A;  3ZDM A;  1URQ B;  3AEG C;  3CCR P;  2FY8 A;  2GFQ A;  1IFP A;  3AE4 C;  3TSI A;  2QVP A;  3H1H G;  4CYP A;  2V8D A;  4PD4 H;  1IJD B;  4PK3 A;  1Y9B A;  2IPP A;  2RN0 A;  2UWJ E;  2KP8 A;  2QJ8 A;  4I7Z C;  4D6T G;  5CCH C;  4MFZ A;  3I5C A;  1IO4 A;  1I1D A;  1YLO A;  1OW6 A;  3H1K J;  3RK2 D;  3LOD A;  3R4Y A;  2QJK B;  1KIL B;  1NU1 K;  2JDI H;  3SFD C;  2NPS A;  1JTH A;  1JY2 O;  1R3N A;  3PFO A;  1RQV A;  2QJP C;  3BJ7 A;  2Q4Y A;  2ZVO B;  1H89 A;  1G2C A;  2Q7S A;  1OVU A;  1SQB G;  2ODF A;  1K4J A;  1MJA A;  3SXN A;  3H6P A;  1XTC C;  1GW3 A;  2BCC J;  2C0W A;  5CPA A;  4BIN A;  2M0B A;  7CPA A;  2YO3 A;  4C2Y A;  5CBN A;  3ZJ0 A;  2AFO A;  4NGR A;  4UCP A;  3EC4 A;  4B86 A;  2JEW A;  2XNX A;  4ZKU A;  1EDI A;  4NJQ A;  4RO0 A;  1BDC A;  2Q4V A;  1K8A Q;  1FZC A;  2Q6Q A;  1IYL A;  3AE9 C;  2XU6 A;  3B5N D;  1FAV A;  5IB0 A;  2HQY A;  3GLJ A;  1KC8 Q;  4NJR A;  3S9O A;  1VQ5 P;  1MZ9 A;  1SFC D;  4L75 A;  3KZW A;  2E75 C;  3KXD A;  1URQ D;  4AYC A;  3H1J G;  3L71 G;  1NE9 A;  1HTL C;  1KWM A;  3CX5 I;  4C7I A;  1F57 A;  3W91 A;  2AJ6 A;  1DEB A;  1HGZ A;  1FZC C;  2WIT A;  1VQ4 P;  4B14 A;  1LP1 B;  1XF8 A;  3PP5 A;  3A2A A;  3TO6 A;  2WSE H;  3BRV B;  4GOF A;  1Y7E A;  3GYA A;  1KYO D;  3FYN A;  1X12 A;  5HXD A;  3VYI A;  1KYO E;  1FDM A;  2QRX A;  4U3F D;  2FKW B;  3JCU H;  4MHD A;  4U3F E;  1LNQ A;  3IIB A;  3BCC G;  1FU1 A;  1EZV G;  4OC1 A;  4OGQ C;  1GU5 A;  4KSI A;  4LLH A;  2P0W A;  2WT7 B;  1RE4 A;  2QSI A;  2EK9 A;  4F6A A;  2ITA A;  1M7L A;  4MCR A;  1CBX A;  3C9I A;  3CX5 H;  1LTB C;  4M3L A;  5AVS B;  4HNY B;  1LGH B;  1YSJ A;  4EYY Q;  4FD5 A;  5C39 A;  3H8F A;  1M8O B;  5HVG A;  2HPC B;  3S9N A;  1YTZ T;  2R5B A;  1RXT A;  2AFM A;  1XRY A;  3AEA C;  2QIW A;  2K3R A;  2WZ7 A;  3CWB G;  4BRY B;  2KNC A;  3OWC A;  3OA7 A;  4MY0 A;  4NGT A;  2Z3O A;  4F9V A;  1N86 A;  2AEJ A;  2WPS A;  2C6C A;  1JMM A;  1Y47 A;  3V2Q A;  2Z5I A;  3GLM A;  3V7Z A;  5K8O A;  3L75 J;  2PFX A;  3TK1 A;  3L70 J;  2B58 A;  2HFE D;  3MGD A;  3CPX A;  2KS1 A;  5KJ7 D;  3KR4 A;  2Z3N A;  1M1J C;  4R3L A;  2DPT A;  4OC5 A;  3AE7 C;  3JUW A;  2BO9 A;  3NXS A;  5K8P A;  2QYV A;  2HOD B;  1Z2L A;  1AVY A;  4B5O A;  3U1A A;  2KB7 P;  2A4N A;  2YKP A;  1XTG B;  4AG9 A;  3H1I J;  2GLF A;  1NTM G;  4IL6 E;  1VQL P;  2J58 A;  2IFN A;  1PZQ A;  4UB8 H;  2B9B A;  1NU1 D;  4Y99 B;  1P84 I;  4E8O A;  2KUB A;  4UFV A;  1IOF A;  2CNM A;  5KAI E;  2VXK A;  1HWT C;  1NU1 E;  3JVN A;  3CCM P;  1NJI Q;  3G3S A;  1ZME C;  1QVG O;  2Z4E A;  3VP9 A;  2B4D A;  2C6G A;  4H13 C;  1GYT A;  3P2H A;  1NTK G;  3G8W A;  1RQU A;  1ZG7 A;  1N7S B;  2ZW5 A;  3M06 A;  2EUI A;  5G20 A;  2B4B A;  1PPJ D;  2ZOG A;  4CGL A;  2V7Q H;  2O28 A;  3M0A A;  4JLY A;  3D7D A;  1PPJ E;  2EO8 A;  4OVN F;  1HGV A;  4K30 A;  2O3J A;  3B5N A;  1GMJ A;  4MN4 C;  1JUN A;  2FSR A;  4CAW A;  1P84 H;  1S7L A;  4WBA A;  3Q5S A;  1NTZ J;  1VQO P;  1N73 B;  2IMO A;  3H1K D;  2VZY A;  3C1L A;  4QB9 A;  3T9Y A;  1L4A A;  3CCU P;  3H1K E;  1R43 A;  4Q36 A;  1J1E B;  2V8H A;  3D70 A;  1JY3 N;  2B5G B;  3AEF C;  1PL5 A;  5B66 H;  2VI7 A;  5JM6 A;  3EFF K;  3RL0 B;  2WSF H;  3CI9 A;  1GL2 D;  3LW5 J;  2R1I A;  5H84 A;  1VPC A;  1L4A C;  2I00 A;  3TOB A;  3H32 A;  3A0B E;  1Z8X A;  5H86 A;  4IFM A;  1L0N J;  2BCC E;  4P4D A;  1IB1 E;  4EME A;  4N3Y B;  1TF9 A;  3GUX A;  2ZPA A;  1BE3 D;  3KQZ A;  3B3C A;  4YWY A;  1VF5 B;  3ZZI A;  4IAV A;  1BE3 E;  3K5B A;  1MK4 A;  1Z5R A;  4MHN A;  2K9J B;  4U3F G;  1FY7 A;  4TT3 H;  3TGU J;  1JWQ A;  2V77 A;  1DE4 C;  4RES B;  3K9T A;  5DS0 A;  1RF1 B;  3G3Z A;  4YU9 A;  1AA0 A;  1SLQ A;  2VEZ A;  1G1I A;  4OH8 B;  3PHL A;  3IGR A;  2QJY C;  2OQQ A;  1S3Z A;  1CW5 A;  1VHE A;  5H2F H;  3D8P A;  4L8A A;  1CX8 A;  2J8M A;  1NSA A;  1VHO A;  3AEC C;  3H5Z A;  4GM5 A;  4I7Z B;  4PV1 D;  3TNU A;  2KZI A;  3NH4 A;  3BAS A;  3F5H A;  1L0N K;  4U9Y A;  2I8D A;  2PAJ A;  4K3N A;  5F48 A;  2WSA A;  2VBQ A;  4EI2 A;  4KOS A;  1KMI Z;  2W6A A;  1PIX A;  4MCQ A;  4JWP A;  3SJX A;  3FRM A;  4B5P B;  3RL0 D;  1F2O A;  2R3S A;  2QJP B;  2Q1K A;  5E79 H;  3MD0 A;  2NYQ A;  2J9A A;  4CAF A;  2QEX P;  1T2K C;  4UF4 A;  1LWU A;  1JM0 A;  4NGQ A;  1GK4 A;  2NPS B;  2OZG A;  1JTH B;  4UWI A;  1TU3 F;  1OW8 A;  3N7N A;  4Y49 C;  1VF5 D;  2POH A;  5D29 A;  2ANP A;  1JQG A;  1T8Z A;  2G9D A;  3FH4 A;  3DR6 A;  1G2C B;  3N7Z A;  4DJL A;  1GHE A;  3KHU A;  2ZEP A;  5BU8 B;  5DJU B;  4A37 A;  2JEV A;  1NU1 G;  3L70 D;  1RHZ B;  5APS A;  1BO4 A;  4P4J A;  5C82 A;  1BCC J;  1YIT P;  4IK2 A;  3L70 E;  3AEE C;  3TOA A;  2P58 A;  4YFJ A;  2B87 A;  3IF4 A;  2REE A;  2BEI A;  4RS2 A;  3NFZ A;  5E79 E;  3O6Q A;  1VKC A;  1AFO A;  1AMP A;  1QLE D;  4XNH C;  2HC9 A;  2Q3E A;  4NPD A;  1BDD A;  3QAY A;  3CXH I;  5CCH D;  4MCS A;  1QSM A;  3CCS P;  3H1I D;  1EZV I;  3BJ8 A;  3AEB C;  3H1I E;  4XPK A;  4WY4 C;  4MFP A;  2W6J H;  3LD2 A;  5CBM A;  2WPV B;  3R9G A;  4R4L A;  1Z8L A;  2FYN C;  1M44 A;  4MXU A;  4XFJ A;  4LUA A;  4OGQ B;  3N5F A;  4OC0 A;  3Q5R A;  4UIA A;  1AJY A;  2Y9Y A;  1GL2 A;  4DUK A;  1H0T A;  3H1K G;  3L74 J;  1DD4 A;  3VTP C;  1FJK A;  2QIR A;  4H44 D;  1OVR A;  4HNW B;  4A31 A;  4AB7 A;  1PV3 A;  2GAN A;  3FVL A;  2OH1 A;  2C9L Y;  3AE6 C;  2WSC H;  2M8R A;  4R9M A;  4GKG A;  1GL2 C;  1U57 A;  2CNT A;  4CGM A;  3G71 P;  1S5L E;  3IO1 A;  2ZT9 B;  2ZJS E;  2E75 D;  2IZ1 A;  4O23 A;  1USE A;  1VHS A;  4KOY A;  2XV5 A;  2JKV A;  1K9M Q;  3AE5 C;  2PR8 A;  5AVU B;  2C9N Y;  1BE3 G;  4QUS A;  1TKH A;  2OTL P;  1D7M A;  3I9S A;  5F09 A;  2KNC B;  1PGQ A;  4MFJ A;  3NE8 A;  2J5U A;  3HE4 A;  1HJB A;  2CTB A;  1X10 A;  1ZO0 A;  4G1P A;  3MP7 B;  3B2Y A;  1SQV J;  3A0H H;  4PSW A;  1K73 Q;  1M57 D;  1HEE A;  1JMB A;  1L0N D;  1XMT A;  1ZP0 C;  3GB0 A;  1OZH A;  2IYP A;  1L0N E;  2KS1 B;  1UII A;  4HYT B;  4OGQ D;  5APY A;  1YIJ P;  3H8G A;  2I1K A;  3EFG A;  1YME A;  1I12 A;  2P6E A;  2BOA A;  4WWI A;  3VMA A;  4PPZ A;  3PJS K;  3CZX A;  4PXD A;  5BWA B;  4WJB A;  2FYZ A;  5AVX B;  3SI2 A;  1TF8 A;  3NH8 A;  2EWB A;  4ZX8 A;  3MZW B;  2KOG A;  4NPE A;  5LYI A;  3RK2 B;  2H7H A;  1N71 A;  5L8R J;  4RI1 A;  3L72 J;  4OLL A;  2PJ1 A;  5CJ4 A;  2GE3 A;  4CGO A;  5AVW B;  2GU2 A;  3PFE A;  3L73 G;  1BSN A;  3LID A;  2Q7B A;  1QX8 A;  2CNS A;  1LTI C;  3C26 A;  3VMX A;  4PD4 I;  5KLI B;  4JYC A;  3OW2 O;  5EBV A;  5HVH A;  1ARL A;  4N78 D;  1PP9 J;  2B4D B;  3D4U A;  2K37 A;  3AE1 C;  1SQV K;  3CME P;  2BCO A;  2YXR B;  2B3U A;  1SQX J;  1SS1 A;  2RKL A;  2P6G A;  1MV8 A;  4N78 E;  4A2Z A;  4A95 A;  4EDF A;  3NTN A;  1EDL A;  3EQ2 A;  3SHP A;  2FE7 A;  1RTQ A;  1VDF A;  3KYQ A;  2O53 A;  3K2K A;  3NE7 A;  3VN0 A;  2PJC A;  1IFI A;  2POK A;  3FBU A;  3EXN A;  3D2P A;  3Q2Y A;  3B5N B;  1OW7 A;  2HLO A;  4KSA A;  3WC6 A;  4GIF A;  2JBJ A;  4X2T A;  2BUE A;  3V6I A;  1IYK A;  2P7J A;  2FIA A;  3CL3 D;  4RJT A;  1M1D A;  3S6F A;  1LTT C;  2PJB A;  3D3S A;  4IL6 X;  1SQP G;  4OKO A;  2WSS H;  5G21 A;  4PSX A;  3IWW A;  2ZEE A;  2REF A;  1OBR A;  2WWW A;  2ZXV A;  3E1R A;  2KXP B;  2PR1 A;  1VGY A;  3O8Z A;  1NO4 A;  4JXR A;  1UIX A;  2QA4 P;  1K05 A;  2N1T C;  3IAO A;  4H13 D;  1Q81 Q;  2PVW A;  1SQX K;  4KOX A;  4ASV A;  3IJ3 A;  3L4F A;  2YIU C;  3H32 B;  2H8P D;  1YK3 A;  1SQQ J;  1X22 A;  1YLE A;  3S6G A;  3RBU A;  1WT6 A;  4UEZ A;  5LRJ A;  3D7H A;  4K3A A;  3CT9 A;  2WPW A;  2QJY B;  1G1J A;  4H44 C;  1IFD A;  1KYO H;  3KZI E;  5TIS E;  4ZNC A;  2YKO A;  3B35 A;  2R3C A;  2IYO A;  4P4E A;  3HUS B;  4ZY0 A;  2W6B A;  5G1Z A;  3IU2 A;  5CBO A;  2E43 A;  2F7V A;  4P6Y A;  5E96 A;  2D4O A;  4UCN A;  3CMA P;  2G8Y A;  2Y0E A;  2PRR A;  2OYH C;  1XEB A;  4UWJ A;  1DTD A;  1XE4 A;  4OIW A;  1FZB A;  5DWN A;  1QQ9 A;  3FXT A;  2P10 A;  3L74 D;  1Y9W A;  4CAV A;  3S9L A;  3L74 E;  1DH3 A;  3D6Y A;  2ZXX A;  2JJL A;  1L4A D;  3TNU B;  1CP6 A;  1Q2N A;  1Z8T A;  2O01 H;  2RFH A;  4JXQ A;  1M4G A;  3H1L J;  5F47 A;  4XA4 A;  1KFN A;  1CP7 A;  2ZED A;  2AXT E;  2Q0Y A;  4ONW A;  3U1C A;  2WPX A;  1Z4E A;  1NGM B;  4QMA A;  5CHX A;  1PCA A;  4Y49 B;  1JO5 A;  2C0X A;  2M3E A;  3FXD A;  4XPD C;  2HB6 A;  3EY5 A;  5KLV J;  3KQG A;  2QVA A;  2H88 C;  3WUU A;  2V8V A;  1F2P A;  3N4X A;  1VQ8 P;  1LWU B;  4C7N A;  4H2K A;  5AVQ B;  2IZ0 A;  3SI1 A;  5DWM A;  4H0L C;  3RBZ A;  1FJP A;  5AW8 B;  3L36 A;  2JBK A;  2YGW A;  1YTZ I;  3SFE C;  2G0B A;  2FYU J;  1Y7R A;  1ZXG A;  4GT1 A;  4IFF A;  4IL6 H;  4BWN A;  3D7F A;  1RF0 C;  2AXC A;  1SQV E;  3FX6 A;  3B8G A;  5JPH A;  4UEE A;  4ZBG A;  1NKN A;  1KQF B;  2Z5H A;  4ORF A;  5KAI H; 
#chains in the Genus database with same CATH homology
 1PU9 A;  4KVX A;  1FDI A;  3Q1M A;  1VF5 B;  3ZZI A;  1ZOY C;  4YRH A;  1MK4 A;  2PRB A;  1YVK A;  1FY7 A;  3R1K A;  4KLW A;  4TT3 H;  1ON0 A;  2EVN A;  3AE8 C;  3GKR A;  3IWE A;  5KTD A;  4II9 A;  2VQY A;  3R96 A;  1QST A;  4B11 A;  4CAX A;  3TO7 A;  4B5P A;  1Y9K A;  5IV0 A;  2G3T A;  4B10 A;  4MFL A;  3RYO A;  2NMT A;  2VEZ A;  4KVM E;  2BL1 A;  2Z3P A;  3IGR A;  5AG7 A;  2QJY C;  2OQQ A;  5ISV A;  2FL4 A;  4A30 A;  4KOW A;  1S3Z A;  2PQ8 A;  3KKW A;  4L8A A;  3D8P A;  2J8M A;  2WQY C;  3F0A A;  4JD6 A;  2Z10 A;  5HH1 A;  2E74 D;  4JJX A;  4Q38 A;  2OU2 A;  4J3G A;  3TCV A;  5A28 A;  3AEC C;  1S5K A;  3H5Z A;  1MJB A;  4I7Z B;  4PV1 D;  4F0X A;  4U9Y A;  3DR8 A;  4H89 A;  2E76 B;  4E2A A;  5F48 A;  1U6M A;  2BSW A;  2WSA A;  3TT2 A;  3FNC A;  5GCN A;  2VBQ A;  4I49 A;  4KOS A;  1DIP A;  1KMI Z;  2FCK A;  1PIX A;  1MKM A;  3H4Q A;  4JWP A;  4FD6 A;  2PSW A;  3WR7 A;  5EC4 A;  3GF7 A;  3R9E A;  3FRM A;  4B5P B;  4KOT A;  4CYN A;  2Q04 A;  3FIX A;  1L0C A;  3SXO A;  3E0K A;  2V7Q J;  2D2C B;  1SQH A;  2O01 J;  5I0C A;  4BBH A;  1MJ9 A;  1LRZ A;  4R4M A;  4NCZ A;  4E0A A;  1VL2 A;  1FDO A;  2HUZ A;  4C2Z A;  3DNS A;  4CAF A;  1S7F A;  4IF5 A;  1Q90 D;  2J8N A;  2B5G A;  3B71 A;  1Q2C A;  2Z11 A;  5M1B A;  4DNC A;  2AE6 A;  4OAE A;  4CGP A;  3EO4 A;  5AG5 A;  3P2F A;  4AG7 A;  1KZF A;  2OZG A;  4AVA A;  4UWI A;  2I79 A;  1TU3 F;  1OW8 A;  4Y49 C;  2IL4 A;  2DPS A;  4CYQ A;  1VF5 D;  2E74 C;  4HNX B;  3R9F A;  3DR6 A;  3JTK A;  4QVT A;  1IIC A;  2K9Y A;  2NZ2 A;  4PV1 C;  3S6H A;  3GF3 A;  3N7Z A;  4KOU A;  4KSF A;  1GHE A;  3PGP A;  2JDD A;  4CS0 B;  1WMK A;  1XIX A;  1RO5 A;  3CXP A;  2GIV A;  2JEV A;  4U7J A;  2R7H A;  2CY2 A;  4GDO A;  2R8V A;  1WK4 A;  2FT0 A;  1IID A;  1Z4R A;  2H89 C;  5HMN A;  4PV1 B;  4CYO A;  1BO4 A;  5C82 A;  3A9L A;  2YNC A;  4HKF A;  2WSF J;  3AEE C;  3TOA A;  3Q5P A;  4YFJ A;  1YQ3 C;  1QSN A;  5J8F A;  3ABV C;  1R57 A;  2REE A;  2BEI A;  2ZW7 A;  4RS2 A;  3Q3D A;  1YX0 A;  1YR0 A;  4FD4 A;  4UFX A;  3O6Q A;  1VKC A;  5IX3 A;  2ZT9 D;  4L89 A;  4XNH C;  1KUX A;  1S7K A;  3S6K A;  4KUB A;  1KOR A;  1P0H A;  2FBW C;  4YXD C;  4KOR A;  1QSM A;  3EFA A;  2YMK A;  4C7H A;  4M85 A;  1KIL E;  2YNC C;  3BJ8 A;  4KZT A;  2E76 D;  5KTA A;  3AEB C;  1J4J A;  4XNH B;  4XPK A;  4PK2 A;  4MFP A;  1VF5 C;  3R95 A;  5AG6 A;  3LD2 A;  2WPV B;  3R9G A;  4R4L A;  2FYN C;  2FS5 A;  1B87 A;  1M44 A;  3DSB A;  3EWK A;  4XFJ A;  4LUA A;  3FGA D;  3D2M A;  3AE3 C;  4KT0 J;  2D2C D;  4OGQ B;  3Q5R A;  3TO9 A;  3VWD A;  2OB0 A;  4NSQ A;  1AJY A;  4H6Z A;  1OZP A;  1DD4 A;  2F5I A;  4AVC A;  3AEG C;  3AE4 C;  1EXI A;  1QSO A;  2QIR A;  4H44 D;  1B6B A;  2ZW6 A;  4HNW B;  4A31 A;  4AB7 A;  4CYP A;  1PV3 A;  2GAN A;  4C2X A;  2OH1 A;  4PK3 A;  1Y9B A;  2R98 A;  2VZZ A;  2ZT9 C;  4CAE A;  3GMA A;  3AE6 C;  4R9M A;  2QJK C;  4I7Z C;  4ONU A;  3TTH A;  4CRY B;  4MFZ A;  3H25 A;  1U57 A;  3TE4 A;  1I1D A;  2CNT A;  4CGM A;  3RK3 E;  3TFY A;  1I21 A;  5G22 A;  1OW6 A;  2E76 C;  2ZT9 B;  4KUA A;  5AGE A;  3LOD A;  3R4Y A;  4KOV A;  2E75 D;  3SFD C;  1VHS A;  2JDC A;  2Z3M A;  4KOY A;  2Q44 A;  1RQV A;  2QJP C;  3BJ7 A;  3AE5 C;  3D6Z A;  2PR8 A;  2Q4Y A;  2D2C C;  4QUS A;  4U5Y A;  2G3A A;  1WWZ A;  4AVB A;  3I9S A;  2BEZ F;  1NYH A;  1K4J A;  1MJA A;  4MFJ A;  3SXN A;  2J5U A;  4A32 A;  1ZO0 A;  2YND A;  4MI4 A;  4PSW A;  4C2Y A;  3ZJ0 A;  3F8K A;  4UCP A;  1XMT A;  4KLV A;  3EC4 A;  1ZP0 C;  4H44 B;  2D4P A;  1OMI A;  2Q4V A;  1CM0 A;  4OGQ D;  1HF9 A;  1IYL A;  3AE9 C;  2DXQ A;  5IB0 A;  2HQY A;  3C8V A;  1IK7 A;  3S9O A;  2FIW A;  1I12 A;  2P6E A;  3G9R A;  2E75 C;  2ARH A;  1TIQ A;  2Y0M A;  5AG4 A;  3AED C;  5BWA B;  1NE9 A;  2Z3K A;  4FD7 A;  2JLM A;  4R87 A;  1HJ0 A;  4C7I A;  3IN6 A;  1N71 A;  4LX9 A;  3W91 A;  5L8R J;  2AJ6 A;  4RI1 A;  2C27 A;  2E75 B;  2JP3 A;  4OLL A;  5KLI C;  2GE3 A;  4YGO A;  4CGO A;  4CRZ B;  4B14 A;  1XF8 A;  3CXS A;  4NXY A;  2QML A;  3TO6 A;  2Q7B A;  4PV6 A;  3IU1 A;  3GYA A;  3FYN A;  2RC4 A;  2CNS A;  1QSR A;  3C26 A;  2ATR A;  1Q2D A;  5EBV A;  1KUV A;  4GS4 A;  2B4D B;  3AE1 C;  5KTC A;  2BEQ D;  2B3U A;  2P6G A;  4A95 A;  1Q2Y A;  4MHD A;  4A2Z A;  3W6X A;  1DD3 A;  1S5L X;  4RKU J;  4OGQ C;  3SHP A;  2FE7 A;  4X5K A;  2P0W A;  2QSI A;  4F6A A;  2J8R A;  4ZGY B;  3NE7 A;  1M4D A;  3W6S A;  2K5T A;  4F0Y A;  3FB3 A;  3FBU A;  3EXN A;  1KQG B;  3D2P A;  1K04 A;  3Q2Y A;  4HNY B;  1OW7 A;  1BOB A;  3PP9 A;  4KSA A;  4MJ8 A;  4A33 A;  2BUE A;  1IYK A;  3DDD A;  4FD5 A;  2FIA A;  4BMH A;  4U9Z A;  2WSC J;  1M1D A;  4NF1 A;  3K9U A;  3S6F A;  2H5M A;  2PDO A;  1RXT A;  3IWG A;  2FXP A;  2HV2 A;  3D3S A;  3AEA C;  5KKZ C;  4IL6 X;  2QIW A;  4UCM A;  5G21 A;  2OZH A;  4KS9 A;  4PSX A;  3CXQ A;  3OWC A;  2JO1 A;  3D71 A;  4MY0 A;  2REF A;  4QBJ A;  2Z3O A;  2ZXV A;  2PR1 A;  4OAD A;  4EVY A;  2P6F A;  1EXJ A;  1YVO A;  4JXR A;  1UIX A;  1K05 A;  2MKV A;  3IAO A;  3GLM A;  4H13 D;  4KOX A;  3AE2 C;  2B58 A;  2QEC A;  3MGD A;  3VWE A;  4MY3 A;  2YIU C;  1UFH A;  2Z3N A;  1CJW A;  4R3L A;  2DPT A;  1YK3 A;  3I3G A;  4KVO E;  4MFK A;  3AE7 C;  3JUW A;  1YLE A;  3S6G A;  2Z3L A;  2Z0Z A;  4B13 A;  1ZRT E;  4B5O A;  2A4N A;  4AG9 A;  1JB0 J;  3F5B A;  2IDB A;  2CXA A;  2KCW A;  2WPW A;  2PC1 A;  4H44 C;  5J8C A;  5JQ4 A;  4R3K A;  1V0C A;  4E8O A;  4UFV A;  1S1C X;  2CNM A;  3T97 B;  2VXK A;  4IUS A;  3JVN A;  1P4N A;  5G1Z A;  5F46 A;  3G3S A;  3IU2 A;  1PUA A;  3QAH A;  1ZME C;  3UY5 A;  4M3S A;  5E96 A;  4C68 A;  2D4O A;  4UCN A;  2B4D A;  5FVJ A;  4H13 C;  3QB8 A;  2G8Y A;  4CGN A;  1XEB A;  1YQ4 C;  4H0L D;  1S60 A;  3P2H A;  4UWJ A;  3G8W A;  1RQU A;  1XE4 A;  3BLN A;  2ZW5 A;  5CNP A;  5DWN A;  4B12 A;  2B3V A;  3FXT A;  2P10 A;  4H6U A;  3RL0 g;  1Y9W A;  2EUI A;  4CAV A;  5G20 A;  2B4B A;  2WSE J;  2ZW4 A;  4H13 B;  3D6Y A;  4CGL A;  2O28 A;  5C88 A;  4JLY A;  4YTP C;  2FXF A;  4JXQ A;  1NMT A;  1M4G A;  2WUU A;  4R57 A;  4UBR A;  1YRE A;  5F47 A;  4K30 A;  2Q0Y A;  2OZU A;  1KUY A;  3V8I A;  1KTM A;  2WPX A;  1GMJ A;  1Z4E A;  4Y28 J;  1NGM B;  2FSR A;  3GY9 A;  4XPL A;  4CAW A;  1S7L A;  1Z9U A;  5F49 A;  3Q5S A;  4Y49 B;  1S7N A;  2E74 B;  4QC6 A;  3T90 A;  4MFQ A;  4XPD C;  2VZY A;  3EY5 A;  4QB9 A;  3T9Y A;  4UFW A;  2H88 C;  1YGH A;  4Q36 A;  4NEX A;  3D70 A;  2B5G B;  4MBU A;  4XPD B;  4Z1M H;  3PZJ A;  3AEF C;  5DWM A;  4H0L C;  1PL5 A;  2VI7 A;  2YGW A;  2G0B A;  3SFE C;  3LW5 J;  2R1I A;  1Y7R A;  2X7B A;  5H84 A;  2I00 A;  4H0L B;  3TOB A;  1NSL A;  5H86 A;  1M4I A;  4UA3 A;  5A27 A;  3B8G A;  1IB1 E;  5JPH A;  4ZBG A;  1KQF B;  2YNE A;  4ORF A;  1R8E A;  2ZPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...