2G3AA

Crystal structure of putative acetyltransferase from agrobacterium tumefaciens
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
MNFVLSDVADAEAEKAIRDPLVAYNLARFGESDKRDLNITIRNDDNSVTGGLVGHTARGWLYVQLLFVPEAMRGQGIAPKLLAMAEEEARKRGCMGAYIDTMNPDALRTYERYGFTKIGSLGPLSSGQSITWLEKRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative acetyltransferase from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Transferase
molecule keywords acetyltransferase
total genus 33
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2g3aA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2g3aA02
3T90A 5J8CA 2B4DA 4J3GA 4KOUA 4FD4A 3AE6C 1MJAA 1SQHA 2H88C 3C26A 4XNHB 1Y9KA 1GHEA 5EBVA 4JLYA 1OW7A 3F5BA 4E8OA 3P2HA 2C27A 1R57A 2OH1A 5I0CA 2JDCA 2K5TA 4UWJA 1V0CA 2B5GB 1BO4A 1VHSA 2QECA 3TOBA 4CRZB 2FS5A 4M85A 1RO5A 1YREA 3S9OA 4HNYB 1I12A 4NXYA 3AE5C 4YRHA 4E2AA 1Z4EA 4MJ8A 2ZW6A 4KOYA 3QB8A 2Q7BA 4NSQA 4YFJA 4EVYA 3IWGA 4B5PB 4KOXA 4LX9A 2ZPAA 2R98A 2F5IA 4IF5A 2WQYC 2VEZA 4DNCA 1Q2YA 4MBUA 1RXTA 2X7BA 5KTAA 4FD5A 2IL4A 3I9SA 1U6MA 2FIWA 3V8IA 3S6HA 2DXQA 4R57A 2PRBA 4OADA 5JPHA 4L8AA 4II9A 3AEFC 1QSOA 1K4JA 3G8WA 1TIQA 3VWEA 2P6EA 3JVNA 4AB7A 3D3SA 4U5YA 3S6FA 3AECC 1S7FA 3FBUA 4QVTA 2R8VA 2D4PA 1Y9WA 2FCKA 3WR7A 5J8FA 2BUEA 2OZGA 2Q4YA 1B87A 4U9ZA 4JWPA 3DSBA 4QUSA 1S60A 4QB9A 4XPKA 1ZOYC 2P6GA 1CM0A 4MY0A 3S6GA 3TO7A 3GKRA 1KZFA 2G3TA 3LD2A 4YXDC 2WPWA 4BMHA 5IX3A 2J8RA 2VI7A 1YQ4C 4R9MA 4IUSA 2ATRA 4LUAA 1S5KA 2CNTA 3AE9C 2FT0A 3D2MA 1PUAA 1QSRA 4FD6A 2Z11A 2ZXVA 2FXFA 3AEEC 2BEIA 3AE2C 4QC6A 2R1IA 1YR0A 2HQYA 4AVBA 3FXTA 4H6UA 2CNSA 1M44A 3AEBC 2H5MA 4CAWA 1WWZA 5CNPA 4MI4A 2Z0ZA 3ABVC 3FB3A 3GY9A 1S7LA 1P0HA 1YVOA 1S7NA 1YK3A 1L0CA 4M3SA 1I21A 2VXKA 2ZW5A 4CRYB 2REEA 3TOAA 4XNHC 1Q2DA 1IYKA 3BJ7A 4NF1A 4HNWB 4KVOE 3W6SA 4XPDC 3G3SA 3F0AA 1IIDA 3BJ8A 4ONUA 4B5OA 4R87A 4KOVA 4ORFA 3DDDA 1OW6A 3D2PA 2PDOA 3DR8A 3AE1C 2I79A 5H84A 3KKWA 1P4NA 2BL1A 4JJXA 1XEBA 3W6XA 5FVJA 1YX0A 4CAXA 2REFA 1WK4A 3F8KA 5ISVA 2JLMA 2CNMA 2ZW7A 4PSWA 3QAHA 3R9GA 2HV2A 2B3VA 2ARHA 3D8PA 1N71A 3CXSA 3OWCA 2PR8A 3TCVA 2QIRA 1YQ3C 2FBWC 1S3ZA 1XIXA 3CXQA 4F0YA 1IICA 1CJWA 1QSTA 4KOWA 3VWDA 4JXRA 5GCNA 2O28A 1KUYA 3FYNA 4CAVA 3W91A 2HUZA 1Q2CA 2B4DB 3FNCA 1NE9A 1M4DA 4UA3A 3BLNA 1M4IA 3EXNA 3TO6A 4AVCA 2CY2A 3AEDC 3I3GA 2OZHA 4AG9A 4KUBA 2VQYA 3RYOA 2GANA 4KORA 2EVNA 3EFAA 5EC4A 2P6FA 2JDDA 2B5GA 1IYLA 4JD6A 1PU9A 4HKFA 2Q4VA 2WPXA 1QSMA 3IGRA 3CXPA 5JQ4A 1KTMA 4XPDB 2B4BA 1YVKA 2B58A 2ZW4A 4PK2A 3B8GA 3SFDC 4KLWA 4B5PA 1FY7A 2EUIA 1M1DA 3TO9A 4AG7A 2OZUA 1MJ9A 4YTPC 2OU2A 5C88A 4NCZA 1XMTA 1XE4A 1KUVA 5C82A 2VBQA 3N7ZA 3PZJA 5DWNA 4KVME 2FSRA 4CS0B 1UFHA 4ZBGA 1LRZA 4R3KA 5F49A 2AJ6A 2FIAA 3AE8C 3GYAA 5KTDA 2KCWA 4AVAA 1NSLA 2NMTA 4OAEA 2J8NA 4RS2A 2R7HA 4KUAA 4U9YA 3K9UA 1VKCA 1J4JA 3R96A 1Y7RA 1B6BA 1IB1E 2JEVA 4X5KA 2Z10A 4XPLA 5IV0A 2PR1A 5KTCA 4FD7A 2G3AA 3S6KA 4MHDA 4KOTA 4KOSA 3ZZIA 3PGPA 4E0AA 1K05A 2FE7A 1K04A 3EY5A 4H6ZA 1S7KA 3AE3C 5F46A 4PV6A 2G0BA 1M4GA 2GIVA 5HMNA 2QMLA 1ON0A 3EO4A 1YLEA 4K30A 1KUXA 4F6AA 2PQ8A 5IB0A 1ZP0C 3SXOA 4GS4A 3AEAC 1Z4RA 1MJBA 5DWMA 3T9YA 2FL4A 1NMTA 3NE7A 3P2FA 3MGDA 3R1KA 4KVXA 3LODA 1MK4A 1OW8A 1PV3A 4MY3A 2GE3A 2PSWA 2AE6A 3TFYA 2A4NA 5F47A 3FIXA 3DNSA 2Y0MA 3R9EA 1QSNA 2B3UA 3AE4C 2VZYA 4RI1A 4UBRA 2PC1A 4Y49C 3AE7C 3TE4A 5H86A 2H89C 3TTHA 4UWIA 3SHPA 3R9FA 2P0WA 3DR6A 1XF8A 1YGHA 3FRMA 4L89A 4OLLA 4NEXA 3AEGC 4H89A 2Q44A 2OB0A 3TT2A 4KZTA 2J8MA 1I1DA 4QBJA 2RC4A 3EC4A 1BOBA 4YGOA 2I00A 3ZJ0A 2D4OA 5F48A 3JUWA 3H4QA 5HH1A 4Y49B 4PK3A 3R95A 2Q04A 2BSWA 2Q0YA 3E0KA 3UY5A 3SXNA 4HNXB 3SFEC 4KLVA 2VZZA 4JXQA 1Z9UA 1OZPA 5E96A 4R3LA 4PSXA 3PP9A 4I49A 3B71A
chains in the Genus database with same CATH superfamily
3S1KA 1FZFA 4WY4B 2B4DA 1HBWA 1Q90D 1WRGA 5E79E 3QAYA 2H88C 3USSA 1GDTA 1FZCB 3FEDA 3Q5SA 3JCUH 1PP9D 4WY4C 1S5LH 1Y9KA 1SQXG 4JQ0D 2KZIA 4Z65A 1OW7A 4M6IA 2KSJA 1AVYA 1R57A 2OH1A 1KYOH 2KZJA 4A37A 2JDCA 1BE3E 1PL5A 2AXCA 2E5YA 4UWJA 2HYNA 2W8ZA 4CPAA 1LT9A 3MTUE 4M85A 4M6HA 1YREA 2QG4A 1L0LG 4OC1A 1XOVA 1M57D 3GLMA 2KSEA 1CI6B 3P32A 1KFMA 1AA0A 5AG6A 4MJ8A 1ZV8A 1BGYE 3L72E 1FE6A 2ZW6A 4KOYA 1TF9A 2FFDC 2KS1B 3RBXA 2AXTH 1FJKA 5AVQB 1BPNA 4IFFA 4U7JA 2E74D 4JZ0A 1YTZT 1AMPA 1WT6A 4EMEA 3FMCA 2M5AB 1SQBG 2D2CD 4YXWH 2VEZA 4AUWA 2HG5D 2N1TC 3IC1A 1UIXA 1Q2YA 3WU2H 4MBUA 1KQGB 1RXTA 2X7BA 2OTLP 4PD4I 3G9RA 4PJ0E 1PYTB 2IL4A 3PHLA 3V8IA 3S6HA 3E7KA 2DXQA 4R57A 3P8MC 3H1LJ 5KJ7A 1N73A 5JPHA 2WT7A 3WT4A 1K4JA 4U3FE 1K9MQ 2ZEFA 3JTKA 2YNEA 2Y0DA 2PVVA 2EK9A 5AVRB 3JVNA 3D70A 3S6FA 2E74B 1KV4A 1Y7EA 1S7FA 3FBUA 1VQLP 3O6QB 4IFDK 1M1JA 2D4PA 3WR7A 5CCGC 2Q1KA 1QQ9A 2IPPA 1SQXK 3D6ZA 2NRGA 2FXPA 1GYTA 4JWPA 4QUSA 1ZOYC 3W67A 3BCCG 2P6GA 3RBZA 3PH0A 1NYHA 5KAIE 3RO0A 1LTJC 3TO7A 1JEKA 2ZOGA 1ZLHA 4NGSA 3GKRA 1HWTC 5L8RJ 1VGYA 4JYBA 3SJGA 4YXDC 5HVHA 2J9AA 4YPCA 1NTMK 3KR5A 4NGPA 3K9TA 2ATRA 2AFXA 3CCJP 3HTKA 4LUAA 1S5KA 4P10A 1K73Q 1ZR4A 2W83C 3D2MA 4BRYB 1QSRA 4Q38A 5CCHC 2Z11A 2ZXVA 5AG7A 3H1JE 1JUNA 5B5EE 5K8PA 3L75E 3P7KA 5KTBA 1CSBA 3AE2C 2YKPA 4M3LA 1L0LK 2KYVA 1FZCC 2OYIC 4H6UA 2CNSA 4NJRA 3FVLA 4H13D 1EDJA 1M44A 3AEBC 1JMMA 1SQVD 1EDLA 3NH8A 3GY9A 5APXA 2R3SA 1P0HA 1YK3A 3JRUA 2N1TA 2YXQB 4WBAA 1I21A 2VXKA 2REEA 3TOAA 3CXHI 5CBOA 1KFNA 4MHPA 2ITAA 3T97B 4HNWB 4KVOE 3KQXA 4XPDC 2KNCA 3D7DA 4HB1A 3CCVP 4MFPA 2P67A 4ONUA 3GMAA 5KLIC 4HJGH 1X10A 2F7VA 5G20A 4IOIH 3PB9X 1NTKE 2WUUA 3WC5A 1LTSC 3E1IA 4OIWA 1GK6A 2I79A 1NTKG 5H84A 2E76C 4F8ZA 1P4NA 2LXCB 2A45G 4RESB 5FVJA 1KILE 2N1TD 2XEGA 2ZEEA 4I7ZB 4PXDA 2XNDH 1WK4A 4UIAA 2M8RA 2N9BA 5ISVA 2B88A 2JLMA 3WUUA 4PPZA 1NTMJ 3QAHA 3R9GA 1QL2A 3H32A 5AVSB 2HV2A 1ZXGA 3L70E 3TNUB 1IFMA 1S3ZA 3CXQA 1AJYA 2R3CA 1CJWA 1QSTA 3V2QA 3VWDA 5CBNA 4IFMA 2P10A 3BASA 4PJ0H 1QEXA 1KUYA 3FYNA 4DUKA 4MFKA 3V2RA 3W91A 3FX0A 3MGNA 2YNDA 4UEFA 1BGYJ 3L72J 4NPDA 2B4DB 1N7LA 4DT0A 5HXDA 1HJBA 4CGLA 2FKWB 4JYWA 1H8LA 3IEHA 1CP7A 5KLIB 2CY2A 5G1ZA 5AW4B 2OYIA 2OZHA 2P1JA 3KR4A 3PJSK 3LIDA 1TF8A 2HC9A 1NU1D 1HGZA 2PAJA 2GANA 2C9NY 2YGWA 1NAFA 3CXHH 2L5GB 2R5BA 2P6FA 1IJDB 3B5NC 1HGVA 3BCCD 3G3ZA 4PV1C 4HKFA 1VQ7P 2VRSA 4ZKUA 3SI2A 4CYNA 3RL0C 1JCCA 1S9KD 2POKA 4UFXA 3RL0D 2XDJA 2WSFJ 4ZKPA 2E76D 3GHGA 4OIDA 4FBEA 3B8GA 3V2NA 4KLWA 4B5PA 2XZRA 3NH5A 1M1DA 1RF0C 1E5WA 3CI9A 5KAIH 1NHLA 1MJ9A 2JO1A 4YTPC 2IBZE 5K8OA 5C88A 4PD4D 1XMTA 3PB8X 4UEZA 2RH0A 5CHXA 1KUVA 2QVAA 1URQC 3H1KJ 3KZWA 3N7ZA 4MHNA 1PCAA 1ZR2A 3MZWB 3H25A 2Z3NA 4R4MA 1ARMA 3B3CA 1G1JA 1W2BO 1IO4A 4F9UA 2FYUK 3L74D 1VQPP 2M3BA 4MN4C 2E76B 2NPSC 4MFQA 3A0BH 2KCWA 3JSVC 3LIEA 3L71J 3M9BA 1SQQE 2NMTA 1W2EA 3FGAD 1G1IA 2ZEGA 2R7HA 4JF7A 3A7OA 4U9YA 2QRXA 4GKGA 1VKCA 1SQQG 1J4JA 3R96A 3CDXA 2O01H 4N78E 3HE5B 2WSAA 5IV0A 2FXOA 4M6GA 3PEIA 3KASA 1TXRA 3PRTA 3M9QA 1QX8A 2M3EA 4MHDA 4GDOA 4KOSA 3PGPA 2FYUJ 2FE7A 4AQRD 1K04A 1OMIA 1VQ8P 4DJLA 3KYQA 3B35A 2WITA 1QGKB 3D6YA 1CP6A 3D7GA 5APWA 5KLVG 1DIPA 2BASA 2PJ0A 1LAPA 1VQMP 2P2UA 1QL1A 1Y0YA 3ITKA 3VN0A 3GF7A 2O1JA 3MGDA 4PXCA 2LKMA 1MK4A 2I1KA 3SSUA 2EO8A 2PIYA 3PTZA 3TYYA 2GE3A 1YBKA 3TFYA 2F8HA 2RFHA 2Q43A 3FIXA 5C39A 1VPCA 3BATA 4KT0J 4NPEA 1QSNA 4W7YA 3MUDC 2C0WA 2B3UA 3L74J 2YMYA 4N3YB 1P84D 1S2EA 3VP8A 3ISXA 5LYFA 1SFCD 1FT7A 3R2PA 2ZXXA 1X0TA 2P0WA 4FWUA 5M1BA 5K5GB 3D68A 4L89A 3FRMA 1OFCX 2AFOA 2Q44A 4H0LD 1LFWA 4OC0A 1M90Q 3Q5PA 2HODB 2JJLA 2KP8A 2BCCJ 3TT2A 2K9JA 4KZTA 1RY3A 3BVHA 4QBJA 3EC4A 3S9NA 2D2CB 2JR8A 3N7NA 1ZRTD 1YLOA 3CWBD 3ZJ0A 3VMAA 2D4OA 1FDOA 1MKMA 5D29A 4F9VA 1LP1B 1S9KE 5HH1A 2K37A 5H2FH 2OTJP 3CPWO 1TU3F 4A95A 1KQSO 1HEEA 4KLVA 2VZZA 1Z9UA 4KS9A 2BCOA 3D71A 3H1HJ 3H1ID 3OW2O 1EDIA 1RHZB 4KOUA 5THWA 5KAFE 4Y99B 3A0HH 3KDPB 4FD4A 1GTWA 3S9LA 3I5CA 4N78D 4UEEA 1USEA 2DF5A 1OVUA 1JB0J 4XNHB 1FC2C 2NPSB 2Z5IA 4C7NA 2V8HA 1T6AA 2CPSA 4X2TA 1L4AA 1Y8AA 1IGBA 2K9YA 1JM0A 2K5TA 2O1KA 1V0CA 1AUGA 3MD0A 2B5GB 5B66E 2PFXA 1VHSA 5AW1B 4GM5A 5CJ0A 1DD4A 4CRZB 1NTKJ 3Q3DA 5APQA 1H0TB 5LRGA 3TC8A 1RO5A 1NKNA 3S9OA 4HNYB 2RN0A 1DTDA 1M1KQ 1I12A 4OKOA 4YRHA 5D8NA 4YWYA 1SFCA 4PXBA 1VF5D 1OWAA 1EQ7A 1Z8XA 3HD7C 4PV1B 3CMAP 1JWQA 3IWGA 2A06D 4KOXA 4LX9A 5CJ4A 2AFUA 2WQYC 1EZVI 1AQ5A 2ZOFA 1NTKK 4FD5A 1SQBJ 1JCDA 5AVZB 1IFDA 2V8GA 4L8AA 1SQPK 1T8ZA 4ASWA 3BRTB 3CPAA 1XRYA 1TIQA 3HD7A 1L2PA 1NU1E 3B5ND 2KXPB 3PBEA 4AB7A 3D3SA 4D6TD 1OXZA 2Q3EA 3II6A 1PGQA 4WJBA 3SI0A 4QVTA 1LTTC 1LTAC 1NAYA 1ZW0A 4UB8H 2FCKA 3O6QA 3MP7B 5J8FA 3V7ZA 2DW3A 4UCMA 3M06A 1QVFO 1AV1A 2JWDA 4AXVA 3PB7X 1IU8A 1B87A 1KILC 2JWAA 3H1KE 3IWWA 1L0NK 4QB9A 4XPKA 2NSMA 4DYOA 5AGEA 1KZFA 1YYCA 3H1JJ 2WPWA 4JPZB 5IX3A 2J8RA 2WPVB 1GK4A 4CAEA 4XA4A 3L70J 2O4HA 4KJMA 2O01J 2CNTA 1PP9G 3AE9C 1Q2NA 3IU1A 2W6JH 3VMXA 2K1AA 3D67A 3AEEC 2AFSA 1BE3D 4P45A 2IFMA 4L76A 4QC6A 1R8EA 2CF4A 2QJPC 1YR0A 4AVBA 3C8VA 4GOFA 1SQQD 1XFOA 2XEIA 4K35A 2AEJA 3RK3E 4HH2A 2H5MA 3PBBA 1PGOA 1YJ9P 1VF5C 5CNPA 4MI4A 2Q7CA 1NWQA 4MFZA 2QIWA 1YVOA 1YTZI 1L0CA 4M3SA 2YNYA 2V8DA 2ZW5A 4A31A 1VQOP 3N4XA 2ZEPA 3H1KG 3L73D 1YSJA 1M4LA 2WSFH 5LRKA 4NF1A 3W6SA 4UF4A 1N73C 5KJ7C 4K3NA 3B2YA 1IIDA 4HPSA 3WU2E 3VH9A 3KHUA 1BE3J 1BSHA 1SFCC 3HE4A 4KHXA 1DD3A 4MHZA 4R87A 4KOVA 2FYUD 2PJ1A 1IK9A 4I7ZC 3KZIE 1RQVA 3KKWA 1N7SA 1YJNP 4NGRA 3GLJA 2BL1A 2I3CA 1JO5A 3W6XA 2Y0CA 3L70D 5KAFH 3TDKA 2REFA 2QM8A 2HPCB 1TKJA 3H1IG 2O01N 4PSWA 1VHOA 2B3VA 3OWCA 2PR8A 2Z5HA 3HE4B 3BRVB 2Q5UA 2Z3PA 4Z1MH 4RKUJ 4BD9A 4F0YA 5IB9A 1IICA 1IC2A 2KUBA 1ELLP 4HKZH 8CPAA 3H1LD 3TSIA 1KQFB 3BHXA 2ZT9D 1Q2CA 3FNCA 1SQQJ 3P8CD 2PJ3A 1W5CE 1XTCC 2WZNA 2NPSA 4LLHA 3KPEA 3BLNA 1RH5B 3EXNA 4BXLA 2WSCH 5AW2B 3AEDC 3CCSP 1NSAA 2ZENA 2OOTA 1R43A 4KUBA 2ZXEB 3PB6X 1J1DC 1KB9E 4Q36A 3HE5A 2GUSA 2BCCE 2EVNA 3B3WA 4R7MA 3H1HD 3H1IJ 3JC22 2E42A 3EFAA 1LWUB 2A06G 3SJXA 2JDDA 3NMDA 2B5GA 1PGPA 1H0TA 1GU4A 3CCLP 4JD6A 4NPFX 2JEWA 3RAMA 2OYHA 3TGUD 1YQEA 3H1IE 2OGUA 1QSMA 3IGRA 4UCNA 5JQ4A 1YI2P 4CGNA 5LYIA 3RGUA 1FZAA 1VQNP 2YNCC 2PRQA 1EZVD 2Y0EA 2WZ7A 4P4JA 3M0AA 1OZHA 3VOPA 1LJ2A 5BU8B 4D6TG 1CW5A 4YU9A 3BXMA 5TISH 3KZIH 3VATA 1LT9C 5C82A 3PP5A 1SQVJ 1KYOD 2FSRA 4CS0B 1ARLA 2HPCA 2ZYAA 5KLVK 4H13C 4NGQA 3KQGA 2H43A 3AE8C 1X79B 5CCGA 4CYPA 3GYAA 4OGQC 5AW6B 2DPTA 2ZEMA 3A3YB 1RQUA 3QH9A 1PPJG 3HD7B 4OWFA 5AVUB 4RS2A 4A7PA 4LGDE 1VDFA 3QNVA 3KHXA 4CGOA 3MUDA 4G1PA 1B6BA 1BLLE 2JEVA 1Z8WA 3RBUA 1QMUA 5KTCA 5KKZB 4ZYQA 5AW9B 1JQGA 4KOTA 3ZZIA 5K8NA 3EY5A 4R6TA 1BGYG 3L72G 3IF4A 3Q2YA 3L71D 3M0DC 1S7KA 4I2LC 4XE5B 3B7IA 3BI0A 2J59M 3SWYA 1M4GA 5HMNA 3H1HE 1EXIA 1S5LE 1ON0A 2QMLA 3RK2C 3EO4A 1LNQA 4RJTA 1FS0E 1NTZD 4WWIA 4K30A 1SFCB 4LC1A 4ZY1A 2XEFA 5AG5A 3NFZA 1X22A 5AW5B 5DWMA 2AEMA 3EQ2A 4ZX8A 1PFIA 3T9YA 2FL4A 2AXTE 3V4QA 3NXSA 2ZJSE 3P2FA 4KSFA 2OARA 1NJIQ 2KIKA 1OW8A 1Q7YQ 3ZDMA 1IFJA 3GW6A 3OJAB 5APSA 3CCRP 3TX8A 4H2KA 3RZAA 4U3FG 2AFMA 1YHQP 1L4AB 3KGQA 4CYOA 5LYDA 1RF0A 3B3SA 2IBZD 3CWBJ 2IJZA 4RI1A 5TJHA 2PC1A 2E75D 3AE7C 1S4XA 3TE4A 2KNCB 1X12A 2H89C 3SHPA 1RE4A 2IYOA 3VYIA 1KYOE 1T2KD 4CGPA 5B5EH 3DR6A 2PJ4A 1M1JC 1CBXA 3OAKA 1YGHA 3GHGB 3PFOA 3L71E 2IZ0A 3CWBE 1LAMA 4H89A 2D2CC 1ZMEC 4OH8B 1JY3O 3L71G 4C7HA 5GTIE 4R76A 3CCUP 2RC4A 1BOBA 5BU5A 2C1CA 3I55P 1KWMA 1X9VA 3JUWA 3H4QA 3B8EB 2R44A 4PD4H 3FWLA 1VQKP 1OVRA 3FECA 3H1LG 3VP9A 2JEEA 3VARA 3SFEC 1JMBA 2CXAA 2ZEHA 1OZPA 4L73A 2OYOA 4PSXA 1GL2C 3WABA 1L0ND 3T90A 4J3GA 3MHVA 4C2ZA 4OC3A 3BCCJ 1SQHA 1CPXA 3C26A 3RK3D 3IFEA 4GXHA 1J1DB 7CPAA 4R8FA 1GHEA 5AG4A 3F5BA 4E8OA 2FVGA 2QJKC 2PRRA 4IHMA 4UFVA 2C27A 2JKVA 5I0CA 2FY8A 1FNOA 5ELYA 1R5LA 3WUVA 1BO4A 1PZQA 3GHGC 3TOBA 2FS5A 1TKHA 2YIUB 1LTBC 1PIXA 1VIXA 3RL0g 1SQQK 3AE5C 3IO1A 5LRJA 1U7MA 4UB6H 1HDQA 2QM7A 1AYEA 3CCEP 1SQBD 3A0HE 1Z4EA 3CT9A 4E2AA 2PJ5A 3GF3A 4FUUA 4B86A 1EZVE 4EFDA 3QB8A 4P44A 4P4BA 3Q5RA 4NSQA 4EVYA 4B5PB 1EZVG 4BBHA 3L75J 1MUUA 2R98A 2PP6A 4BWNA 2FFDA 2F5IA 2E75C 3D7HA 1LTGC 1RF1A 4OC5A 4KSIA 4ONWA 3FWNA 4DNCA 1Q86Q 1UWYA 3HD7D 5KTAA 4EOTA 4CGMA 5DS0A 1U6MA 2W6AA 4A32A 1H89A 3SI1A 3IAOA 3AEFC 3G8WA 2M0BA 2KK7A 1BCCJ 4MCQA 2Z3MA 4CPGA 3AECC 2WPRA 1BCCG 4R4LA 2HR3A 5E79H 3B3TA 3L2NA 3HUVA 5AVXB 2R8VA 1ZRTE 1XMBA 1RE4C 3VTPC 2GFQA 4O23A 6CPAA 1BE3G 3L35A 1SQPG 2OZGA 3IN6A 1A02J 3CMEP 5CCGD 4RN7A 5KLVJ 2NZ2A 3DSBA 2WPQA 4IL6E 1YITP 4MY0A 3VMYA 3S6GA 3FH4A 1FU1A 4QMAA 5CBMA 2G3TA 3LD2A 1EDKA 2BEQD 1CPSA 5AW3B 4NGTA 4C2XA 3TGUJ 3GG2A 2R32A 1YQ4C 4R9MA 4IUSA 4UCPA 2JBJA 1S3JA 2IYPA 3NA6A 1K8AQ 1LT9B 1XBUA 1LTIC 2H7HA 2PCUA 2BEIA 4H44B 2ZT9B 3T8WA 2YKQA 2KOGA 1SS1A 3IU2A 3FXTA 1HVVA 1VQ9P 1OX3A 1SQVG 3UIAA 3H1JD 3HTKB 1BCCD 3U59A 4H0LC 4GOEA 2AFWA 2QEXP 3A9LA 4CAWA 1WWZA 4BRYA 4EWTA 2HLOA 4WVZA 3ABVC 2C0XA 2IMOA 2FYNB 3FB3A 4OVNF 1S7LA 1YW4A 5DJUB 4CRYB 2IBZI 4LQGA 1ZG7A 1T2KC 3D4UA 2K9JB 3BJ7A 3M91A 1NTMD 3L74G 4WB4A 2QE7H 4DJGA 3LWUA 1Z5RA 2HODA 2DEAA 3G3SA 4WY4A 3F0AA 1KILB 2BEZF 1NTKD 1GW3A 1P84H 4PV1D 4Y99C 1WMKA 1ZO0A 1Y47A 4H0LB 2GU2A 4B5OA 1NGMB 3BCCE 3OA7A 2XEJA 2I1JA 3DDDA 1OW6A 1IK7A 2LXBA 1PP9E 5AVTB 3AE1C 4BINA 1M1JB 2PJ9A 3M0DA 4CAXA 1QLED 1L0NG 2QJYC 4B12A 3F8KA 3GIUA 1NTZJ 5GTIH 2WSEH 1J1EC 1KN7A 2PJ7A 3RNZA 1SQVE 5G21A 1L0NE 2PE3A 1M56D 2ARHA 1N71A 3CXSA 4GODA 2QIRA 3NE8A 4C7NB 1P84E 4MCPA 5GCNA 2O28A 2OR4A 4C7IA 3L37A 1PGJA 2ZELA 1XTGB 4ZMDA 1URQA 1NTMG 1YIJP 3TO6A 2A45H 2JP3A 1Q82Q 4ZGYB 3I3GA 4AG9A 1JOCA 4PQAA 4UFWA 2EBJA 2VQYA 3RYOA 2P7JA 1LWUA 1LCPA 3RK3C 5EC4A 2WT7B 3HLPA 3WC7A 5AVVB 4ZY0A 1DX7A 4TT3H 1L0LJ 1CX8A 1PU9A 1FDMA 3FX6A 2GREA 3B5NA 1Q7LA 1JY3P 4B14A 3CXPA 3QWOC 3H8GA 2W27A 2GM4A 1S1CX 4A30A 2WMMA 1H8AA 2B58A 2ZW4A 4MXUA 4PK2A 4EI2A 4CAFA 1ZLLA 2ZEDA 1GU5A 3H1JG 1FY7A 2EUIA 4LQ6A 4NFRA 4P6YA 3TO9A 4AG7A 4HYTB 2HB6A 1RF1B 4NCZA 3SWKA 2OQQA 5APYA 2VBQA 3PZJA 1LGHB 4KVME 3L4FA 2LR2A 1L0LD 1SVFA 1UFHA 1LRZA 1BGYD 3L72D 5J1QA 2G9DA 1VL2A 3D7FA 3IIBA 5F49A 1T3UA 2AJ6A 2B9BA 1CZQA 2FIAA 3SJFA 2B87A 2YXRB 3S4RA 1BDDA 5CCHA 3IR9A 2PJ8A 1SQVK 4B13A 5KTDA 1HDUA 1IFIA 1LP1A 3B3VA 1Z8LA 2ZYDA 2PJ6A 4OAEA 1QVGO 2VL1A 2C6CA 2B87B 5CCHD 1FZCA 1Y7RA 1IB1E 1LTJA 2Z10A 2AFZA 2PR1A 1FZEA 4X8IA 4OMEA 1SQXJ 1K05A 2YO3A 3LMSA 3K2KA 5KKZC 5F46A 3G4SP 3GUXA 3CXHE 2GIVA 4OC4A 2MKVA 1YLEA 1KUXA 4NGNA 4MRIA 4F6AA 3CC7P 3H1HG 5IB0A 1VF5B 4XFJA 2QJ8A 1FZBA 3SXOA 2V4HA 2PIZA 4UB6E 4GS4A 1HJ0A 1NH4A 2OYHC 1J1EB 2NPSD 2ZYGA 2ZEOA 1MJBA 2IBZG 1A02F 4B11A 3VMZA 1NMTA 3NE7A 1UIIA 1GL2D 1BDCA 1RE3A 3LODA 4KSAA 5CMZA 1PV3A 4NGMA 2DPSA 2PSWA 3MN8A 3PP9A 1N7SC 2A4NA 2PJAA 1PPJE 1OBRA 1HH0A 3DNSA 2Y0MA 3TGUE 2IX7C 3TF5A 4JYCA 4OP4A 4UBRA 5A27A 3MRUA 5I4MA 1BPMA 5H86A 2J58A 3I56P 2OYHB 4RUHA 3R9FA 2AEFA 1XF8A 1FAVA 4NEXA 3H8FA 1CI6A 3V38A 1LOKA 4A38A 1NU1K 2OB0A 3T97A 2J8MA 2ZAEB 3FXEA 1AFOA 2Q6QA 2I00A 2XNXA 2PVWA 2PJCA 1L0LE 1F57A 3GB0A 1EC5A 4GIFA 4Y49B 4PK3A 3R95A 2Q04A 2BSWA 3KI9A 3WUTA 3A2AA 1SQBE 3E0KA 3KHZA 2ZT9C 3SXNA 4HNXB 1M8OB 4JXQA 2SPZA 1USDA 1S5LX 2IDBA 2UWJE 4R3LA 4WY4D 4I49A 3B4SA 5J8CA 1NVOA 4NJQA 2ZFCA 2CPBA 1HF9A 5TISE 2B89A 3AE6C 3TGUG 1MJAA 4P4IA 3U1CA 3CX5D 2QJPB 2EK8A 3M9HA 1FOSF 2Y9YA 2WSEJ 1H88A 5EBVA 4JLYA 2KB7P 3P2HA 3CWBG 2J5UA 2RMZA 4CYQA 1N8RQ 3SWFA 1BSNA 2QA4P 1T3JA 3H6PA 3TK1A 1RF1C 3L74E 2QECA 2N1TB 3K5BA 3PRJA 2IFNA 1KB9H 3D66A 2RKLA 5GTHH 1PP9J 5KJ7D 4NXYA 2CTBA 2WVRA 4A94A 3NTNA 1KZUB 3LACA 2QJKB 3E1RA 2Q7BA 1AQTA 3V5BA 1GW4A 2A45I 2Z4EA 4YFJA 3IJ3A 4H44D 5APUA 3FEEA 5JGFA 2ZPAA 4N6JA 5EFWB 1S72P 1L4AD 3WMM0 4AYCA 1TKFA 5GTHE 4IF5A 4ZX9A 2ZVNB 3O8ZA 2NYQA 3H1LE 1DE4C 1N73B 1GZLA 1SP4A 1KB9D 1N2DC 1J2JB 1NU1J 5HVFA 1GD2E 3I9SA 4IAVA 2FIWA 1R5SA 2O53A 2PRBA 4OADA 1GMJA 4II9A 1IFPA 1QSOA 3BI1A 2POHA 2WSSH 4DZOA 2ABZA 4Q7AA 3VWEA 2P6EA 4MFJA 1NKZB 4C2YA 4U5YA 2C9LY 2I8DA 3FJUA 1MZ9A 1VHEA 3L73E 2BO9A 1IZNB 2KLVA 1Y9WA 1BCCE 1FDIA 2BUEA 4C68A 3H1KD 2V7QJ 3L73G 2ANPA 1ELMP 1YMEA 4TNUA 4P4FA 4JBZA 2Q4YA 2WSCJ 2PGDA 3CPXA 4U9ZA 2BCCG 1SQPE 1S60A 4C46A 1BAVA 3I1UA 1DEBA 2YNCA 1CM0A 1ZG9A 3L36A 2QJYB 3PLNA 2OYIB 1IFNA 2Y9ZA 3PFEA 3HRNA 4C7RA 4H13B 4PXEA 5A28A 4BMHA 1SQPJ 1FBMA 4GT1A 4A39A 2VI7A 4IL6H 2C6GA 2FT0A 1Q81Q 4I1LA 1PUAA 4FD6A 3V2PA 2FXFA 1KORA 1R3NA 4MHYA 1OIPA 2OTKE 2CTCA 1EXJA 2R1IA 2HQYA 2CIJA 3CCMP 2QVPA 4H44C 3W68A 1SQXE 4FAIA 3CCQP 4RO0A 5BVZA 3RL0B 1NU1G 2Z0ZA 2GUVA 3G6EP 1JNMA 1S7NA 1KILA 1EE3P 1DEEG 4XNHC 2Z3LA 1IY7A 1Q2DA 4I6MC 3CC2P 1YJWP 1IYKA 4EIJA 4Y28J 2E74C 2FYUG 2H8PD 1FOSE 1N7SD 3BJ8A 2KS1A 3MIWA 1JY2P 2C6PA 4L74A 2QYVA 2FYUE 1NOHA 3KL9A 1XJOA 4ZY2A 4ORFA 3B5NB 1G2CA 2R5DA 4UB8E 1SQXD 4TLFA 3D2PA 1A2ZA 2PDOA 4A33A 4K3AA 5H2FE 3L75D 3DR8A 1HUCA 3S9MA 1U57A 1IOFA 4JJXA 3CD6P 1XEBA 1NTZK 1YX0A 3HUSB 2PJBA 3R4YA 3A5TA 3CX5H 1ZG8A 1SQPD 3F89A 1F2OA 4X3RA 3L70G 2BOAA 2CNMA 2ZW7A 2XV5A 3NFQA 2Z3OA 1KYOI 5JH9A 5AW0B 1FZGA 3D8PA 1JTHB 3TCVA 5LYLA 3C1LA 1Z2LA 2L91A 1YQ3C 2FBWC 3P8CE 1XIXA 3CZXA 1N86A 1ZN5A 1G2CB 1URQB 4KOWA 4JXRA 3G71P 2K3RA 3RK3B 2WTYA 4P4DA 4CAVA 3H5ZA 2HUZA 1HTLC 2ODFA 1MFZA 2XU6A 1NE9A 2E5TA 4U3FJ 1GL2B 1JTHA 3U1AA 1KD1Q 3N5FA 1SQBK 1M4DA 4UA3A 1M4IA 4AVCA 1FJPA 2IQ6A 3EFGA 2W6BA 5K8MA 1U7JA 2JDIH 1KC8Q 3L73J 2Q7SA 4IL6X 4KORA 1URQD 1YW6A 4DCKA 4W80A 4OGQB 1JY3N 5KLVD 2E75B 2BCCD 4O9BA 2HFED 4OGQD 1IYLA 3DGVA 2YIUC 4TWEA 2Q4VA 2WPXA 2FXMA 3LW5H 4ASVA 3KQZA 2YO2A 2WPSA 1KTMA 2W90A 2GA1A 4P4EA 4XPDB 3WC6A 2B4BA 2MJZA 2JBKA 1YVKA 3CX5E 3SFDC 1CG2A 3L75G 4W7ZA 2KLUA 2QSIA 1X8YA 2OZUA 1ZLIA 2FYZA 1KB9I 2OU2A 1F2PA 1L4AC 3C9IA 1XE4A 2Q3IA 1AVOA 2KI7B 3CX5I 2Q9IA 5KLVE 2K88A 5DWNA 1NTME 1JY2O 3V6IA 5HVGA 2E43A 4F0XA 4ZBGA 4B10A 3PB4X 4R3KA 2V77A 4WWVA 4U3FD 3H8EA 4MCSA 1JY2N 2GLFA 4ZI6A 4AVAA 1NSLA 3KXDA 2J8NA 4MFLA 2FYNC 4KUAA 1RTQA 1VQ6P 1PPJD 3K9UA 1Y9BA 1NO4A 4X5KA 4XPLA 1GL2A 3NH4A 1KQLA 3HUSC 5AW7B 4A2ZA 3IFMA 2V8VA 4FD7A 2G3AA 2GLJA 5G22A 3S6KA 5CPAA 3SJEA 4MMOA 1D7MA 4E0AA 3ISZA 4H6ZA 1LT1A 3AE3C 3F5HA 3TNUA 5AVWB 4PV6A 2N9YB 2V7QH 2G0BA 3LW5J 3FXDA 5DJTB 2RB7A 3DLJA 4L75A 1SLQA 2PQ8A 3V4WA 4IK2A 1ZP0C 4EDFA 2YKOA 5APTA 2G8YA 1NTZE 3AEAC 1LANA 1Z4RA 3CC4P 4D6TE 3EFFK 2ZVOB 4MCRA 5EMIA 1M7LA 2CK3H 1KILD 1L0NJ 1P84I 3R1KA 5JM6A 4KVXA 1VQ4P 1OVVA 4MY3A 5B66H 2WYRA 2Z3KA 2AE6A 1IOIA 5F47A 1RE3C 4D6TJ 3FF3A 1Z56A 2YMKA 3R9EA 2EWBA 3CXHD 2Q4ZA 3AE4C 3CL3D 2VZYA 4W9YA 4Y49C 3TTHA 4UWIA 1Y0RA 4OC2A 1LTJB 5BWAB 1E79H 2A06E 2IZ1A 4OLLA 5F09A 3AEGC 2FFDB 5AW8B 1KMIZ 4DOJA 3RK2D 2M5AA 1Z8TA 2PJ2A 2WWWA 3RK2B 2P58A 3EWKA 3IWEA 1DH3A 2Q51A 4UIBA 1I1DA 3A0BE 4YGOA 1LWUC 1MFTA 4EYYQ 5F48A 1NTZG 5APVA 5AVYB 3H32B 3Q1MA 1MV8A 2Q0YA 3CLQA 2XKMA 3UY5A 2O3JA 4ZNCA 4B6ZA 1VQ5P 5E96A 3HUSA 1N7SB 3JCUE 4PD4E 3B71A
chains in the Genus database with same CATH topology
3T90A 5J8CA 2B4DA 4J3GA 4KOUA 1HF9A 1Q90D 4C2ZA 4FD4A 3AE6C 1MJAA 1SQHA 2H88C 3C26A 1JB0J 3Q5SA 4XNHB 2WSEJ 1Y9KA 1GHEA 5EBVA 5AG4A 4JLYA 1OW7A 3F5BA 4E8OA 2QJKC 4UFVA 3P2HA 2C27A 1R57A 2J5UA 2K9YA 2OH1A 4CYQA 5I0CA 2JDCA 2K5TA 1PL5A 4UWJA 1V0CA 2B5GB 1BO4A 1VHSA 2QECA 1DD4A 3TOBA 4CRZB 3Q3DA 2FS5A 4M85A 1RO5A 1PIXA 1YREA 3S9OA 4HNYB 3RL0g 3GLMA 1I12A 4NXYA 3AE5C 4YRHA 4E2AA 1Z4EA 5AG6A 4MJ8A 3GF3A 2ZW6A 4KOYA 1VF5D 3QB8A 2Q7BA 3Q5RA 4NSQA 4PV1B 4YFJA 4EVYA 4H44D 3IWGA 4B5PB 4U7JA 4KOXA 4LX9A 2ZPAA 4BBHA 2R98A 2E74D 2F5IA 2E75C 4IF5A 2WQYC 2D2CD 2VEZA 4DNCA 1UIXA 1Q2YA 4MBUA 1KQGB 1RXTA 2X7BA 5KTAA 4CGMA 3G9RA 4FD5A 2IL4A 3I9SA 1U6MA 2FIWA 4A32A 3V8IA 3S6HA 2DXQA 4R57A 2PRBA 4OADA 1GMJA 3IAOA 5JPHA 4L8AA 4II9A 3AEFC 1QSOA 1K4JA 3G8WA 3JTKA 1TIQA 2YNEA 3VWEA 2P6EA 4MFJA 2Z3MA 3JVNA 3D70A 3D3SA 4U5YA 2E74B 3AECC 3S6FA 4AB7A 4C2YA 4R4LA 1S7FA 3FBUA 4QVTA 2R8VA 2D4PA 1Y9WA 2FCKA 1ZRTE 3O6QA 1FDIA 3WR7A 5J8FA 2BUEA 4C68A 4UCMA 2V7QJ 2OZGA 3D6ZA 2Q4YA 2WSCJ 3IN6A 1B87A 2FXPA 4U9ZA 2NZ2A 4JWPA 3DSBA 4QUSA 1S60A 4QB9A 4XPKA 1ZOYC 2YNCA 2P6GA 1CM0A 4MY0A 3S6GA 1NYHA 3TO7A 3GKRA 5AGEA 5L8RJ 1KZFA 2G3TA 3LD2A 4H13B 4YXDC 2BEQD 5A28A 2WPWA 4BMHA 5IX3A 2J8RA 2WPVB 4C2XA 2VI7A 4CAEA 1YQ4C 4R9MA 4IUSA 2ATRA 4UCPA 4LUAA 1S5KA 2O01J 2CNTA 3AE9C 2FT0A 3D2MA 1PUAA 1QSRA 3IU1A 4FD6A 4Q38A 2Z11A 2ZXVA 5AG7A 2FXFA 1KORA 3AEEC 2BEIA 4H44B 2ZT9B 3AE2C 4QC6A 1R8EA 2QJPC 1EXJA 2R1IA 1YR0A 2HQYA 4AVBA 3IU2A 3C8VA 3FXTA 4H6UA 2CNSA 4H44C 4H13D 1M44A 3AEBC 4H0LC 3RK3E 2H5MA 3A9LA 4CAWA 1VF5C 1WWZA 5CNPA 4MI4A 2Z0ZA 3ABVC 4MFZA 3FB3A 3GY9A 1S7LA 1P0HA 2QIWA 1S7NA 1YK3A 1YVOA 1L0CA 4M3SA 1I21A 2VXKA 4A31A 2ZW5A 4CRYB 2REEA 3TOAA 4XNHC 2Z3LA 1Q2DA 1IYKA 3T97B 3BJ7A 4NF1A 4HNWB 4KVOE 3W6SA 4XPDC 4Y28J 2E74C 3G3SA 3F0AA 1IIDA 2BEZF 3BJ8A 4PV1D 4MFPA 1WMKA 4ONUA 1ZO0A 3GMAA 5KLIC 5G20A 4H0LB 1DD3A 4B5OA 4R87A 1NGMB 4KOVA 4ORFA 3DDDA 1OW6A 1IK7A 2WUUA 3D2PA 4I7ZC 2PDOA 4A33A 1RQVA 3DR8A 3AE1C 2I79A 5H84A 3KKWA 2E76C 1U57A 1P4NA 2BL1A 4JJXA 1XEBA 3W6XA 5FVJA 1KILE 1YX0A 4CAXA 4I7ZB 3R4YA 2QJYC 2REFA 1WK4A 4B12A 3F8KA 5ISVA 2JLMA 2CNMA 2ZW7A 4PSWA 2Z3OA 3QAHA 5G21A 3R9GA 2HV2A 2B3VA 2ARHA 3D8PA 1N71A 3CXSA 3OWCA 2PR8A 3TCVA 2QIRA 2Z3PA 4Z1MH 4RKUJ 1YQ3C 2FBWC 1S3ZA 1XIXA 3CXQA 1AJYA 4F0YA 1IICA 1CJWA 1QSTA 4KOWA 3VWDA 4JXRA 2P10A 5GCNA 2O28A 1KUYA 3FYNA 4MFKA 4C7IA 4CAVA 3H5ZA 3W91A 2HUZA 1KQFB 2YNDA 2ZT9D 1Q2CA 2B4DB 3FNCA 1NE9A 4CGLA 1M4DA 4UA3A 3BLNA 2JP3A 1M4IA 3EXNA 3TO6A 4AVCA 2CY2A 5G1ZA 4ZGYB 3AEDC 3I3GA 2OZHA 4AG9A 4KUBA 4UFWA 2VQYA 3RYOA 4Q36A 2GANA 4IL6X 2YGWA 4KORA 2EVNA 3EFAA 5EC4A 4OGQB 2P6FA 2JDDA 2E75B 2B5GA 4OGQD 4TT3H 1IYLA 2YIUC 4JD6A 4PV1C 1PU9A 4HKFA 2Q4VA 2WPXA 1QSMA 3IGRA 4UCNA 4B14A 3CXPA 5JQ4A 4CGNA 4CYNA 1KTMA 4XPDB 4UFXA 1S1CX 2B4BA 4A30A 2WSFJ 1YVKA 2E76D 2B58A 2YNCC 2ZW4A 4PK2A 3B8GA 4CAFA 3SFDC 4KLWA 4B5PA 1FY7A 2EUIA 1M1DA 3TO9A 2QSIA 4AG7A 2OZUA 1MJ9A 2JO1A 4YTPC 2OU2A 5C88A 4NCZA 2OQQA 1XE4A 1XMTA 1KUVA 5C82A 2VBQA 3N7ZA 3PZJA 5DWNA 4KVME 3H25A 2FSRA 4CS0B 4F0XA 1UFHA 2Z3NA 4ZBGA 1LRZA 4B10A 4R4MA 1VL2A 4R3KA 5F49A 4H13C 2AJ6A 2FIAA 3AE8C 2E76B 4CYPA 3GYAA 4MFQA 4B13A 4OGQC 2DPTA 2KCWA 5KTDA 4AVAA 1NSLA 1RQUA 2NMTA 4OAEA 2J8NA 4MFLA 2FYNC 3FGAD 4RS2A 2R7HA 4KUAA 4U9YA 3K9UA 1VKCA 4CGOA 1J4JA 3R96A 1Y7RA 1B6BA 1Y9BA 1IB1E 2JEVA 4X5KA 2WSAA 2Z10A 4XPLA 5IV0A 2PR1A 5KTCA 4A2ZA 4FD7A 2G3AA 5G22A 3S6KA 4MHDA 4GDOA 4KOTA 4KOSA 3ZZIA 3PGPA 4E0AA 1K05A 2FE7A 1K04A 3EY5A 4H6ZA 1OMIA 3Q2YA 1S7KA 3AE3C 5KKZC 5F46A 4PV6A 2G0BA 1M4GA 3LW5J 3D6YA 2GIVA 5HMNA 1EXIA 1ON0A 2QMLA 3EO4A 1DIPA 2MKVA 1YLEA 4K30A 1KUXA 4F6AA 2PQ8A 5IB0A 1VF5B 1ZP0C 4XFJA 5AG5A 3SXOA 2G8YA 4GS4A 1HJ0A 3AEAC 1Z4RA 1MJBA 5DWMA 4B11A 3T9YA 2FL4A 1NMTA 3NE7A 3P2FA 3GF7A 3MGDA 3R1KA 4KSFA 4KVXA 3LODA 1MK4A 4KSAA 1OW8A 1PV3A 4MY3A 2GE3A 2DPSA 2PSWA 2Z3KA 2AE6A 3TFYA 2A4NA 5F47A 3FIXA 2YMKA 3DNSA 2Y0MA 3R9EA 4CYOA 4KT0J 1QSNA 2B3UA 3AE4C 2VZYA 4RI1A 4UBRA 2PC1A 5A27A 2E75D 4Y49C 3AE7C 3TE4A 5H86A 2H89C 3TTHA 4UWIA 3SHPA 4CGPA 3R9FA 2P0WA 3DR6A 5M1BA 1XF8A 5BWAB 1YGHA 3FRMA 4L89A 4OLLA 4NEXA 3AEGC 4H89A 2Q44A 1KMIZ 4H0LD 2D2CC 3Q5PA 1ZMEC 2OB0A 4C7HA 3TT2A 3IWEA 3EWKA 4KZTA 2J8MA 1I1DA 4QBJA 2RC4A 3EC4A 2D2CB 1BOBA 4YGOA 2I00A 3ZJ0A 2D4OA 1FDOA 1MKMA 5F48A 3JUWA 3H4QA 5HH1A 4Y49B 4PK3A 3R95A 2Q04A 2BSWA 1TU3F 4A95A 3Q1MA 2Q0YA 3E0KA 2ZT9C 3UY5A 3SXNA 4HNXB 3SFEC 4KLVA 2VZZA 4JXQA 1Z9UA 2IDBA 1S5LX 2CXAA 1OZPA 5E96A 4KS9A 4R3LA 4PSXA 3D71A 3PP9A 4I49A 3B71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T90 A;  5J8C A;  2B4D A;  4J3G A;  4KOU A;  4FD4 A;  3AE6 C;  1MJA A;  1SQH A;  2H88 C;  3C26 A;  4XNH B;  1Y9K A;  1GHE A;  5EBV A;  4JLY A;  1OW7 A;  3F5B A;  4E8O A;  3P2H A;  2C27 A;  1R57 A;  2OH1 A;  5I0C A;  2JDC A;  2K5T A;  4UWJ A;  1V0C A;  2B5G B;  1BO4 A;  1VHS A;  2QEC A;  3TOB A;  4CRZ B;  2FS5 A;  4M85 A;  1RO5 A;  1YRE A;  3S9O A;  4HNY B;  1I12 A;  4NXY A;  3AE5 C;  4YRH A;  4E2A A;  1Z4E A;  4MJ8 A;  2ZW6 A;  4KOY A;  3QB8 A;  2Q7B A;  4NSQ A;  4YFJ A;  4EVY A;  3IWG A;  4B5P B;  4KOX A;  4LX9 A;  2ZPA A;  2R98 A;  2F5I A;  4IF5 A;  2WQY C;  2VEZ A;  4DNC A;  1Q2Y A;  4MBU A;  1RXT A;  2X7B A;  5KTA A;  4FD5 A;  2IL4 A;  3I9S A;  1U6M A;  2FIW A;  3V8I A;  3S6H A;  2DXQ A;  4R57 A;  2PRB A;  4OAD A;  5JPH A;  4L8A A;  4II9 A;  3AEF C;  1QSO A;  1K4J A;  3G8W A;  1TIQ A;  3VWE A;  2P6E A;  3JVN A;  4AB7 A;  3D3S A;  4U5Y A;  3S6F A;  3AEC C;  1S7F A;  3FBU A;  4QVT A;  2R8V A;  2D4P A;  1Y9W A;  2FCK A;  3WR7 A;  5J8F A;  2BUE A;  2OZG A;  2Q4Y A;  1B87 A;  4U9Z A;  4JWP A;  3DSB A;  4QUS A;  1S60 A;  4QB9 A;  4XPK A;  1ZOY C;  2P6G A;  1CM0 A;  4MY0 A;  3S6G A;  3TO7 A;  3GKR A;  1KZF A;  2G3T A;  3LD2 A;  4YXD C;  2WPW A;  4BMH A;  5IX3 A;  2J8R A;  2VI7 A;  1YQ4 C;  4R9M A;  4IUS A;  2ATR A;  4LUA A;  1S5K A;  2CNT A;  3AE9 C;  2FT0 A;  3D2M A;  1PUA A;  1QSR A;  4FD6 A;  2Z11 A;  2ZXV A;  2FXF A;  3AEE C;  2BEI A;  3AE2 C;  4QC6 A;  2R1I A;  1YR0 A;  2HQY A;  4AVB A;  3FXT A;  4H6U A;  2CNS A;  1M44 A;  3AEB C;  2H5M A;  4CAW A;  1WWZ A;  5CNP A;  4MI4 A;  2Z0Z A;  3ABV C;  3FB3 A;  3GY9 A;  1S7L A;  1P0H A;  1YVO A;  1S7N A;  1YK3 A;  1L0C A;  4M3S A;  1I21 A;  2VXK A;  2ZW5 A;  4CRY B;  2REE A;  3TOA A;  4XNH C;  1Q2D A;  1IYK A;  3BJ7 A;  4NF1 A;  4HNW B;  4KVO E;  3W6S A;  4XPD C;  3G3S A;  3F0A A;  1IID A;  3BJ8 A;  4ONU A;  4B5O A;  4R87 A;  4KOV A;  4ORF A;  3DDD A;  1OW6 A;  3D2P A;  2PDO A;  3DR8 A;  3AE1 C;  2I79 A;  5H84 A;  3KKW A;  1P4N A;  2BL1 A;  4JJX A;  1XEB A;  3W6X A;  5FVJ A;  1YX0 A;  4CAX A;  2REF A;  1WK4 A;  3F8K A;  5ISV A;  2JLM A;  2CNM A;  2ZW7 A;  4PSW A;  3QAH A;  3R9G A;  2HV2 A;  2B3V A;  2ARH A;  3D8P A;  1N71 A;  3CXS A;  3OWC A;  2PR8 A;  3TCV A;  2QIR A;  1YQ3 C;  2FBW C;  1S3Z A;  1XIX A;  3CXQ A;  4F0Y A;  1IIC A;  1CJW A;  1QST A;  4KOW A;  3VWD A;  4JXR A;  5GCN A;  2O28 A;  1KUY A;  3FYN A;  4CAV A;  3W91 A;  2HUZ A;  1Q2C A;  2B4D B;  3FNC A;  1NE9 A;  1M4D A;  4UA3 A;  3BLN A;  1M4I A;  3EXN A;  3TO6 A;  4AVC A;  2CY2 A;  3AED C;  3I3G A;  2OZH A;  4AG9 A;  4KUB A;  2VQY A;  3RYO A;  2GAN A;  4KOR A;  2EVN A;  3EFA A;  5EC4 A;  2P6F A;  2JDD A;  2B5G A;  1IYL A;  4JD6 A;  1PU9 A;  4HKF A;  2Q4V A;  2WPX A;  1QSM A;  3IGR A;  3CXP A;  5JQ4 A;  1KTM A;  4XPD B;  2B4B A;  1YVK A;  2B58 A;  2ZW4 A;  4PK2 A;  3B8G A;  3SFD C;  4KLW A;  4B5P A;  1FY7 A;  2EUI A;  1M1D A;  3TO9 A;  4AG7 A;  2OZU A;  1MJ9 A;  4YTP C;  2OU2 A;  5C88 A;  4NCZ A;  1XMT A;  1XE4 A;  1KUV A;  5C82 A;  2VBQ A;  3N7Z A;  3PZJ A;  5DWN A;  4KVM E;  2FSR A;  4CS0 B;  1UFH A;  4ZBG A;  1LRZ A;  4R3K A;  5F49 A;  2AJ6 A;  2FIA A;  3AE8 C;  3GYA A;  5KTD A;  2KCW A;  4AVA A;  1NSL A;  2NMT A;  4OAE A;  2J8N A;  4RS2 A;  2R7H A;  4KUA A;  4U9Y A;  3K9U A;  1VKC A;  1J4J A;  3R96 A;  1Y7R A;  1B6B A;  1IB1 E;  2JEV A;  4X5K A;  2Z10 A;  4XPL A;  5IV0 A;  2PR1 A;  5KTC A;  4FD7 A;  2G3A A;  3S6K A;  4MHD A;  4KOT A;  4KOS A;  3ZZI A;  3PGP A;  4E0A A;  1K05 A;  2FE7 A;  1K04 A;  3EY5 A;  4H6Z A;  1S7K A;  3AE3 C;  5F46 A;  4PV6 A;  2G0B A;  1M4G A;  2GIV A;  5HMN A;  2QML A;  1ON0 A;  3EO4 A;  1YLE A;  4K30 A;  1KUX A;  4F6A A;  2PQ8 A;  5IB0 A;  1ZP0 C;  3SXO A;  4GS4 A;  3AEA C;  1Z4R A;  1MJB A;  5DWM A;  3T9Y A;  2FL4 A;  1NMT A;  3NE7 A;  3P2F A;  3MGD A;  3R1K A;  4KVX A;  3LOD A;  1MK4 A;  1OW8 A;  1PV3 A;  4MY3 A;  2GE3 A;  2PSW A;  2AE6 A;  3TFY A;  2A4N A;  5F47 A;  3FIX A;  3DNS A;  2Y0M A;  3R9E A;  1QSN A;  2B3U A;  3AE4 C;  2VZY A;  4RI1 A;  4UBR A;  2PC1 A;  4Y49 C;  3AE7 C;  3TE4 A;  5H86 A;  2H89 C;  3TTH A;  4UWI A;  3SHP A;  3R9F A;  2P0W A;  3DR6 A;  1XF8 A;  1YGH A;  3FRM A;  4L89 A;  4OLL A;  4NEX A;  3AEG C;  4H89 A;  2Q44 A;  2OB0 A;  3TT2 A;  4KZT A;  2J8M A;  1I1D A;  4QBJ A;  2RC4 A;  3EC4 A;  1BOB A;  4YGO A;  2I00 A;  3ZJ0 A;  2D4O A;  5F48 A;  3JUW A;  3H4Q A;  5HH1 A;  4Y49 B;  4PK3 A;  3R95 A;  2Q04 A;  2BSW A;  2Q0Y A;  3E0K A;  3UY5 A;  3SXN A;  4HNX B;  3SFE C;  4KLV A;  2VZZ A;  4JXQ A;  1Z9U A;  1OZP A;  5E96 A;  4R3L A;  4PSX A;  3PP9 A;  4I49 A;  3B71 A; 
#chains in the Genus database with same CATH topology
 3S1K A;  1FZF A;  4WY4 B;  2B4D A;  1HBW A;  1Q90 D;  1WRG A;  5E79 E;  3QAY A;  2H88 C;  3USS A;  1GDT A;  1FZC B;  3FED A;  3Q5S A;  3JCU H;  1PP9 D;  4WY4 C;  1S5L H;  1Y9K A;  1SQX G;  4JQ0 D;  2KZI A;  4Z65 A;  1OW7 A;  4M6I A;  2KSJ A;  1AVY A;  1R57 A;  2OH1 A;  1KYO H;  2KZJ A;  4A37 A;  2JDC A;  1BE3 E;  1PL5 A;  2AXC A;  2E5Y A;  4UWJ A;  2HYN A;  2W8Z A;  4CPA A;  1LT9 A;  3MTU E;  4M85 A;  4M6H A;  1YRE A;  2QG4 A;  1L0L G;  4OC1 A;  1XOV A;  1M57 D;  3GLM A;  2KSE A;  1CI6 B;  3P32 A;  1KFM A;  1AA0 A;  5AG6 A;  4MJ8 A;  1ZV8 A;  1BGY E;  3L72 E;  1FE6 A;  2ZW6 A;  4KOY A;  1TF9 A;  2FFD C;  2KS1 B;  3RBX A;  2AXT H;  1FJK A;  5AVQ B;  1BPN A;  4IFF A;  4U7J A;  2E74 D;  4JZ0 A;  1YTZ T;  1AMP A;  1WT6 A;  4EME A;  3FMC A;  2M5A B;  1SQB G;  2D2C D;  4YXW H;  2VEZ A;  4AUW A;  2HG5 D;  2N1T C;  3IC1 A;  1UIX A;  1Q2Y A;  3WU2 H;  4MBU A;  1KQG B;  1RXT A;  2X7B A;  2OTL P;  4PD4 I;  3G9R A;  4PJ0 E;  1PYT B;  2IL4 A;  3PHL A;  3V8I A;  3S6H A;  3E7K A;  2DXQ A;  4R57 A;  3P8M C;  3H1L J;  5KJ7 A;  1N73 A;  5JPH A;  2WT7 A;  3WT4 A;  1K4J A;  4U3F E;  1K9M Q;  2ZEF A;  3JTK A;  2YNE A;  2Y0D A;  2PVV A;  2EK9 A;  5AVR B;  3JVN A;  3D70 A;  3S6F A;  2E74 B;  1KV4 A;  1Y7E A;  1S7F A;  3FBU A;  1VQL P;  3O6Q B;  4IFD K;  1M1J A;  2D4P A;  3WR7 A;  5CCG C;  2Q1K A;  1QQ9 A;  2IPP A;  1SQX K;  3D6Z A;  2NRG A;  2FXP A;  1GYT A;  4JWP A;  4QUS A;  1ZOY C;  3W67 A;  3BCC G;  2P6G A;  3RBZ A;  3PH0 A;  1NYH A;  5KAI E;  3RO0 A;  1LTJ C;  3TO7 A;  1JEK A;  2ZOG A;  1ZLH A;  4NGS A;  3GKR A;  1HWT C;  5L8R J;  1VGY A;  4JYB A;  3SJG A;  4YXD C;  5HVH A;  2J9A A;  4YPC A;  1NTM K;  3KR5 A;  4NGP A;  3K9T A;  2ATR A;  2AFX A;  3CCJ P;  3HTK A;  4LUA A;  1S5K A;  4P10 A;  1K73 Q;  1ZR4 A;  2W83 C;  3D2M A;  4BRY B;  1QSR A;  4Q38 A;  5CCH C;  2Z11 A;  2ZXV A;  5AG7 A;  3H1J E;  1JUN A;  5B5E E;  5K8P A;  3L75 E;  3P7K A;  5KTB A;  1CSB A;  3AE2 C;  2YKP A;  4M3L A;  1L0L K;  2KYV A;  1FZC C;  2OYI C;  4H6U A;  2CNS A;  4NJR A;  3FVL A;  4H13 D;  1EDJ A;  1M44 A;  3AEB C;  1JMM A;  1SQV D;  1EDL A;  3NH8 A;  3GY9 A;  5APX A;  2R3S A;  1P0H A;  1YK3 A;  3JRU A;  2N1T A;  2YXQ B;  4WBA A;  1I21 A;  2VXK A;  2REE A;  3TOA A;  3CXH I;  5CBO A;  1KFN A;  4MHP A;  2ITA A;  3T97 B;  4HNW B;  4KVO E;  3KQX A;  4XPD C;  2KNC A;  3D7D A;  4HB1 A;  3CCV P;  4MFP A;  2P67 A;  4ONU A;  3GMA A;  5KLI C;  4HJG H;  1X10 A;  2F7V A;  5G20 A;  4IOI H;  3PB9 X;  1NTK E;  2WUU A;  3WC5 A;  1LTS C;  3E1I A;  4OIW A;  1GK6 A;  2I79 A;  1NTK G;  5H84 A;  2E76 C;  4F8Z A;  1P4N A;  2LXC B;  2A45 G;  4RES B;  5FVJ A;  1KIL E;  2N1T D;  2XEG A;  2ZEE A;  4I7Z B;  4PXD A;  2XND H;  1WK4 A;  4UIA A;  2M8R A;  2N9B A;  5ISV A;  2B88 A;  2JLM A;  3WUU A;  4PPZ A;  1NTM J;  3QAH A;  3R9G A;  1QL2 A;  3H32 A;  5AVS B;  2HV2 A;  1ZXG A;  3L70 E;  3TNU B;  1IFM A;  1S3Z A;  3CXQ A;  1AJY A;  2R3C A;  1CJW A;  1QST A;  3V2Q A;  3VWD A;  5CBN A;  4IFM A;  2P10 A;  3BAS A;  4PJ0 H;  1QEX A;  1KUY A;  3FYN A;  4DUK A;  4MFK A;  3V2R A;  3W91 A;  3FX0 A;  3MGN A;  2YND A;  4UEF A;  1BGY J;  3L72 J;  4NPD A;  2B4D B;  1N7L A;  4DT0 A;  5HXD A;  1HJB A;  4CGL A;  2FKW B;  4JYW A;  1H8L A;  3IEH A;  1CP7 A;  5KLI B;  2CY2 A;  5G1Z A;  5AW4 B;  2OYI A;  2OZH A;  2P1J A;  3KR4 A;  3PJS K;  3LID A;  1TF8 A;  2HC9 A;  1NU1 D;  1HGZ A;  2PAJ A;  2GAN A;  2C9N Y;  2YGW A;  1NAF A;  3CXH H;  2L5G B;  2R5B A;  2P6F A;  1IJD B;  3B5N C;  1HGV A;  3BCC D;  3G3Z A;  4PV1 C;  4HKF A;  1VQ7 P;  2VRS A;  4ZKU A;  3SI2 A;  4CYN A;  3RL0 C;  1JCC A;  1S9K D;  2POK A;  4UFX A;  3RL0 D;  2XDJ A;  2WSF J;  4ZKP A;  2E76 D;  3GHG A;  4OID A;  4FBE A;  3B8G A;  3V2N A;  4KLW A;  4B5P A;  2XZR A;  3NH5 A;  1M1D A;  1RF0 C;  1E5W A;  3CI9 A;  5KAI H;  1NHL A;  1MJ9 A;  2JO1 A;  4YTP C;  2IBZ E;  5K8O A;  5C88 A;  4PD4 D;  1XMT A;  3PB8 X;  4UEZ A;  2RH0 A;  5CHX A;  1KUV A;  2QVA A;  1URQ C;  3H1K J;  3KZW A;  3N7Z A;  4MHN A;  1PCA A;  1ZR2 A;  3MZW B;  3H25 A;  2Z3N A;  4R4M A;  1ARM A;  3B3C A;  1G1J A;  1W2B O;  1IO4 A;  4F9U A;  2FYU K;  3L74 D;  1VQP P;  2M3B A;  4MN4 C;  2E76 B;  2NPS C;  4MFQ A;  3A0B H;  2KCW A;  3JSV C;  3LIE A;  3L71 J;  3M9B A;  1SQQ E;  2NMT A;  1W2E A;  3FGA D;  1G1I A;  2ZEG A;  2R7H A;  4JF7 A;  3A7O A;  4U9Y A;  2QRX A;  4GKG A;  1VKC A;  1SQQ G;  1J4J A;  3R96 A;  3CDX A;  2O01 H;  4N78 E;  3HE5 B;  2WSA A;  5IV0 A;  2FXO A;  4M6G A;  3PEI A;  3KAS A;  1TXR A;  3PRT A;  3M9Q A;  1QX8 A;  2M3E A;  4MHD A;  4GDO A;  4KOS A;  3PGP A;  2FYU J;  2FE7 A;  4AQR D;  1K04 A;  1OMI A;  1VQ8 P;  4DJL A;  3KYQ A;  3B35 A;  2WIT A;  1QGK B;  3D6Y A;  1CP6 A;  3D7G A;  5APW A;  5KLV G;  1DIP A;  2BAS A;  2PJ0 A;  1LAP A;  1VQM P;  2P2U A;  1QL1 A;  1Y0Y A;  3ITK A;  3VN0 A;  3GF7 A;  2O1J A;  3MGD A;  4PXC A;  2LKM A;  1MK4 A;  2I1K A;  3SSU A;  2EO8 A;  2PIY A;  3PTZ A;  3TYY A;  2GE3 A;  1YBK A;  3TFY A;  2F8H A;  2RFH A;  2Q43 A;  3FIX A;  5C39 A;  1VPC A;  3BAT A;  4KT0 J;  4NPE A;  1QSN A;  4W7Y A;  3MUD C;  2C0W A;  2B3U A;  3L74 J;  2YMY A;  4N3Y B;  1P84 D;  1S2E A;  3VP8 A;  3ISX A;  5LYF A;  1SFC D;  1FT7 A;  3R2P A;  2ZXX A;  1X0T A;  2P0W A;  4FWU A;  5M1B A;  5K5G B;  3D68 A;  4L89 A;  3FRM A;  1OFC X;  2AFO A;  2Q44 A;  4H0L D;  1LFW A;  4OC0 A;  1M90 Q;  3Q5P A;  2HOD B;  2JJL A;  2KP8 A;  2BCC J;  3TT2 A;  2K9J A;  4KZT A;  1RY3 A;  3BVH A;  4QBJ A;  3EC4 A;  3S9N A;  2D2C B;  2JR8 A;  3N7N A;  1ZRT D;  1YLO A;  3CWB D;  3ZJ0 A;  3VMA A;  2D4O A;  1FDO A;  1MKM A;  5D29 A;  4F9V A;  1LP1 B;  1S9K E;  5HH1 A;  2K37 A;  5H2F H;  2OTJ P;  3CPW O;  1TU3 F;  4A95 A;  1KQS O;  1HEE A;  4KLV A;  2VZZ A;  1Z9U A;  4KS9 A;  2BCO A;  3D71 A;  3H1H J;  3H1I D;  3OW2 O;  1EDI A;  1RHZ B;  4KOU A;  5THW A;  5KAF E;  4Y99 B;  3A0H H;  3KDP B;  4FD4 A;  1GTW A;  3S9L A;  3I5C A;  4N78 D;  4UEE A;  1USE A;  2DF5 A;  1OVU A;  1JB0 J;  4XNH B;  1FC2 C;  2NPS B;  2Z5I A;  4C7N A;  2V8H A;  1T6A A;  2CPS A;  4X2T A;  1L4A A;  1Y8A A;  1IGB A;  2K9Y A;  1JM0 A;  2K5T A;  2O1K A;  1V0C A;  1AUG A;  3MD0 A;  2B5G B;  5B66 E;  2PFX A;  1VHS A;  5AW1 B;  4GM5 A;  5CJ0 A;  1DD4 A;  4CRZ B;  1NTK J;  3Q3D A;  5APQ A;  1H0T B;  5LRG A;  3TC8 A;  1RO5 A;  1NKN A;  3S9O A;  4HNY B;  2RN0 A;  1DTD A;  1M1K Q;  1I12 A;  4OKO A;  4YRH A;  5D8N A;  4YWY A;  1SFC A;  4PXB A;  1VF5 D;  1OWA A;  1EQ7 A;  1Z8X A;  3HD7 C;  4PV1 B;  3CMA P;  1JWQ A;  3IWG A;  2A06 D;  4KOX A;  4LX9 A;  5CJ4 A;  2AFU A;  2WQY C;  1EZV I;  1AQ5 A;  2ZOF A;  1NTK K;  4FD5 A;  1SQB J;  1JCD A;  5AVZ B;  1IFD A;  2V8G A;  4L8A A;  1SQP K;  1T8Z A;  4ASW A;  3BRT B;  3CPA A;  1XRY A;  1TIQ A;  3HD7 A;  1L2P A;  1NU1 E;  3B5N D;  2KXP B;  3PBE A;  4AB7 A;  3D3S A;  4D6T D;  1OXZ A;  2Q3E A;  3II6 A;  1PGQ A;  4WJB A;  3SI0 A;  4QVT A;  1LTT C;  1LTA C;  1NAY A;  1ZW0 A;  4UB8 H;  2FCK A;  3O6Q A;  3MP7 B;  5J8F A;  3V7Z A;  2DW3 A;  4UCM A;  3M06 A;  1QVF O;  1AV1 A;  2JWD A;  4AXV A;  3PB7 X;  1IU8 A;  1B87 A;  1KIL C;  2JWA A;  3H1K E;  3IWW A;  1L0N K;  4QB9 A;  4XPK A;  2NSM A;  4DYO A;  5AGE A;  1KZF A;  1YYC A;  3H1J J;  2WPW A;  4JPZ B;  5IX3 A;  2J8R A;  2WPV B;  1GK4 A;  4CAE A;  4XA4 A;  3L70 J;  2O4H A;  4KJM A;  2O01 J;  2CNT A;  1PP9 G;  3AE9 C;  1Q2N A;  3IU1 A;  2W6J H;  3VMX A;  2K1A A;  3D67 A;  3AEE C;  2AFS A;  1BE3 D;  4P45 A;  2IFM A;  4L76 A;  4QC6 A;  1R8E A;  2CF4 A;  2QJP C;  1YR0 A;  4AVB A;  3C8V A;  4GOF A;  1SQQ D;  1XFO A;  2XEI A;  4K35 A;  2AEJ A;  3RK3 E;  4HH2 A;  2H5M A;  3PBB A;  1PGO A;  1YJ9 P;  1VF5 C;  5CNP A;  4MI4 A;  2Q7C A;  1NWQ A;  4MFZ A;  2QIW A;  1YVO A;  1YTZ I;  1L0C A;  4M3S A;  2YNY A;  2V8D A;  2ZW5 A;  4A31 A;  1VQO P;  3N4X A;  2ZEP A;  3H1K G;  3L73 D;  1YSJ A;  1M4L A;  2WSF H;  5LRK A;  4NF1 A;  3W6S A;  4UF4 A;  1N73 C;  5KJ7 C;  4K3N A;  3B2Y A;  1IID A;  4HPS A;  3WU2 E;  3VH9 A;  3KHU A;  1BE3 J;  1BSH A;  1SFC C;  3HE4 A;  4KHX A;  1DD3 A;  4MHZ A;  4R87 A;  4KOV A;  2FYU D;  2PJ1 A;  1IK9 A;  4I7Z C;  3KZI E;  1RQV A;  3KKW A;  1N7S A;  1YJN P;  4NGR A;  3GLJ A;  2BL1 A;  2I3C A;  1JO5 A;  3W6X A;  2Y0C A;  3L70 D;  5KAF H;  3TDK A;  2REF A;  2QM8 A;  2HPC B;  1TKJ A;  3H1I G;  2O01 N;  4PSW A;  1VHO A;  2B3V A;  3OWC A;  2PR8 A;  2Z5H A;  3HE4 B;  3BRV B;  2Q5U A;  2Z3P A;  4Z1M H;  4RKU J;  4BD9 A;  4F0Y A;  5IB9 A;  1IIC A;  1IC2 A;  2KUB A;  1ELL P;  4HKZ H;  8CPA A;  3H1L D;  3TSI A;  1KQF B;  3BHX A;  2ZT9 D;  1Q2C A;  3FNC A;  1SQQ J;  3P8C D;  2PJ3 A;  1W5C E;  1XTC C;  2WZN A;  2NPS A;  4LLH A;  3KPE A;  3BLN A;  1RH5 B;  3EXN A;  4BXL A;  2WSC H;  5AW2 B;  3AED C;  3CCS P;  1NSA A;  2ZEN A;  2OOT A;  1R43 A;  4KUB A;  2ZXE B;  3PB6 X;  1J1D C;  1KB9 E;  4Q36 A;  3HE5 A;  2GUS A;  2BCC E;  2EVN A;  3B3W A;  4R7M A;  3H1H D;  3H1I J;  3JC2 2;  2E42 A;  3EFA A;  1LWU B;  2A06 G;  3SJX A;  2JDD A;  3NMD A;  2B5G A;  1PGP A;  1H0T A;  1GU4 A;  3CCL P;  4JD6 A;  4NPF X;  2JEW A;  3RAM A;  2OYH A;  3TGU D;  1YQE A;  3H1I E;  2OGU A;  1QSM A;  3IGR A;  4UCN A;  5JQ4 A;  1YI2 P;  4CGN A;  5LYI A;  3RGU A;  1FZA A;  1VQN P;  2YNC C;  2PRQ A;  1EZV D;  2Y0E A;  2WZ7 A;  4P4J A;  3M0A A;  1OZH A;  3VOP A;  1LJ2 A;  5BU8 B;  4D6T G;  1CW5 A;  4YU9 A;  3BXM A;  5TIS H;  3KZI H;  3VAT A;  1LT9 C;  5C82 A;  3PP5 A;  1SQV J;  1KYO D;  2FSR A;  4CS0 B;  1ARL A;  2HPC A;  2ZYA A;  5KLV K;  4H13 C;  4NGQ A;  3KQG A;  2H43 A;  3AE8 C;  1X79 B;  5CCG A;  4CYP A;  3GYA A;  4OGQ C;  5AW6 B;  2DPT A;  2ZEM A;  3A3Y B;  1RQU A;  3QH9 A;  1PPJ G;  3HD7 B;  4OWF A;  5AVU B;  4RS2 A;  4A7P A;  4LGD E;  1VDF A;  3QNV A;  3KHX A;  4CGO A;  3MUD A;  4G1P A;  1B6B A;  1BLL E;  2JEV A;  1Z8W A;  3RBU A;  1QMU A;  5KTC A;  5KKZ B;  4ZYQ A;  5AW9 B;  1JQG A;  4KOT A;  3ZZI A;  5K8N A;  3EY5 A;  4R6T A;  1BGY G;  3L72 G;  3IF4 A;  3Q2Y A;  3L71 D;  3M0D C;  1S7K A;  4I2L C;  4XE5 B;  3B7I A;  3BI0 A;  2J59 M;  3SWY A;  1M4G A;  5HMN A;  3H1H E;  1EXI A;  1S5L E;  1ON0 A;  2QML A;  3RK2 C;  3EO4 A;  1LNQ A;  4RJT A;  1FS0 E;  1NTZ D;  4WWI A;  4K30 A;  1SFC B;  4LC1 A;  4ZY1 A;  2XEF A;  5AG5 A;  3NFZ A;  1X22 A;  5AW5 B;  5DWM A;  2AEM A;  3EQ2 A;  4ZX8 A;  1PFI A;  3T9Y A;  2FL4 A;  2AXT E;  3V4Q A;  3NXS A;  2ZJS E;  3P2F A;  4KSF A;  2OAR A;  1NJI Q;  2KIK A;  1OW8 A;  1Q7Y Q;  3ZDM A;  1IFJ A;  3GW6 A;  3OJA B;  5APS A;  3CCR P;  3TX8 A;  4H2K A;  3RZA A;  4U3F G;  2AFM A;  1YHQ P;  1L4A B;  3KGQ A;  4CYO A;  5LYD A;  1RF0 A;  3B3S A;  2IBZ D;  3CWB J;  2IJZ A;  4RI1 A;  5TJH A;  2PC1 A;  2E75 D;  3AE7 C;  1S4X A;  3TE4 A;  2KNC B;  1X12 A;  2H89 C;  3SHP A;  1RE4 A;  2IYO A;  3VYI A;  1KYO E;  1T2K D;  4CGP A;  5B5E H;  3DR6 A;  2PJ4 A;  1M1J C;  1CBX A;  3OAK A;  1YGH A;  3GHG B;  3PFO A;  3L71 E;  2IZ0 A;  3CWB E;  1LAM A;  4H89 A;  2D2C C;  1ZME C;  4OH8 B;  1JY3 O;  3L71 G;  4C7H A;  5GTI E;  4R76 A;  3CCU P;  2RC4 A;  1BOB A;  5BU5 A;  2C1C A;  3I55 P;  1KWM A;  1X9V A;  3JUW A;  3H4Q A;  3B8E B;  2R44 A;  4PD4 H;  3FWL A;  1VQK P;  1OVR A;  3FEC A;  3H1L G;  3VP9 A;  2JEE A;  3VAR A;  3SFE C;  1JMB A;  2CXA A;  2ZEH A;  1OZP A;  4L73 A;  2OYO A;  4PSX A;  1GL2 C;  3WAB A;  1L0N D;  3T90 A;  4J3G A;  3MHV A;  4C2Z A;  4OC3 A;  3BCC J;  1SQH A;  1CPX A;  3C26 A;  3RK3 D;  3IFE A;  4GXH A;  1J1D B;  7CPA A;  4R8F A;  1GHE A;  5AG4 A;  3F5B A;  4E8O A;  2FVG A;  2QJK C;  2PRR A;  4IHM A;  4UFV A;  2C27 A;  2JKV A;  5I0C A;  2FY8 A;  1FNO A;  5ELY A;  1R5L A;  3WUV A;  1BO4 A;  1PZQ A;  3GHG C;  3TOB A;  2FS5 A;  1TKH A;  2YIU B;  1LTB C;  1PIX A;  1VIX A;  3RL0 g;  1SQQ K;  3AE5 C;  3IO1 A;  5LRJ A;  1U7M A;  4UB6 H;  1HDQ A;  2QM7 A;  1AYE A;  3CCE P;  1SQB D;  3A0H E;  1Z4E A;  3CT9 A;  4E2A A;  2PJ5 A;  3GF3 A;  4FUU A;  4B86 A;  1EZV E;  4EFD A;  3QB8 A;  4P44 A;  4P4B A;  3Q5R A;  4NSQ A;  4EVY A;  4B5P B;  1EZV G;  4BBH A;  3L75 J;  1MUU A;  2R98 A;  2PP6 A;  4BWN A;  2FFD A;  2F5I A;  2E75 C;  3D7H A;  1LTG C;  1RF1 A;  4OC5 A;  4KSI A;  4ONW A;  3FWN A;  4DNC A;  1Q86 Q;  1UWY A;  3HD7 D;  5KTA A;  4EOT A;  4CGM A;  5DS0 A;  1U6M A;  2W6A A;  4A32 A;  1H89 A;  3SI1 A;  3IAO A;  3AEF C;  3G8W A;  2M0B A;  2KK7 A;  1BCC J;  4MCQ A;  2Z3M A;  4CPG A;  3AEC C;  2WPR A;  1BCC G;  4R4L A;  2HR3 A;  5E79 H;  3B3T A;  3L2N A;  3HUV A;  5AVX B;  2R8V A;  1ZRT E;  1XMB A;  1RE4 C;  3VTP C;  2GFQ A;  4O23 A;  6CPA A;  1BE3 G;  3L35 A;  1SQP G;  2OZG A;  3IN6 A;  1A02 J;  3CME P;  5CCG D;  4RN7 A;  5KLV J;  2NZ2 A;  3DSB A;  2WPQ A;  4IL6 E;  1YIT P;  4MY0 A;  3VMY A;  3S6G A;  3FH4 A;  1FU1 A;  4QMA A;  5CBM A;  2G3T A;  3LD2 A;  1EDK A;  2BEQ D;  1CPS A;  5AW3 B;  4NGT A;  4C2X A;  3TGU J;  3GG2 A;  2R32 A;  1YQ4 C;  4R9M A;  4IUS A;  4UCP A;  2JBJ A;  1S3J A;  2IYP A;  3NA6 A;  1K8A Q;  1LT9 B;  1XBU A;  1LTI C;  2H7H A;  2PCU A;  2BEI A;  4H44 B;  2ZT9 B;  3T8W A;  2YKQ A;  2KOG A;  1SS1 A;  3IU2 A;  3FXT A;  1HVV A;  1VQ9 P;  1OX3 A;  1SQV G;  3UIA A;  3H1J D;  3HTK B;  1BCC D;  3U59 A;  4H0L C;  4GOE A;  2AFW A;  2QEX P;  3A9L A;  4CAW A;  1WWZ A;  4BRY A;  4EWT A;  2HLO A;  4WVZ A;  3ABV C;  2C0X A;  2IMO A;  2FYN B;  3FB3 A;  4OVN F;  1S7L A;  1YW4 A;  5DJU B;  4CRY B;  2IBZ I;  4LQG A;  1ZG7 A;  1T2K C;  3D4U A;  2K9J B;  3BJ7 A;  3M91 A;  1NTM D;  3L74 G;  4WB4 A;  2QE7 H;  4DJG A;  3LWU A;  1Z5R A;  2HOD A;  2DEA A;  3G3S A;  4WY4 A;  3F0A A;  1KIL B;  2BEZ F;  1NTK D;  1GW3 A;  1P84 H;  4PV1 D;  4Y99 C;  1WMK A;  1ZO0 A;  1Y47 A;  4H0L B;  2GU2 A;  4B5O A;  1NGM B;  3BCC E;  3OA7 A;  2XEJ A;  2I1J A;  3DDD A;  1OW6 A;  1IK7 A;  2LXB A;  1PP9 E;  5AVT B;  3AE1 C;  4BIN A;  1M1J B;  2PJ9 A;  3M0D A;  4CAX A;  1QLE D;  1L0N G;  2QJY C;  4B12 A;  3F8K A;  3GIU A;  1NTZ J;  5GTI H;  2WSE H;  1J1E C;  1KN7 A;  2PJ7 A;  3RNZ A;  1SQV E;  5G21 A;  1L0N E;  2PE3 A;  1M56 D;  2ARH A;  1N71 A;  3CXS A;  4GOD A;  2QIR A;  3NE8 A;  4C7N B;  1P84 E;  4MCP A;  5GCN A;  2O28 A;  2OR4 A;  4C7I A;  3L37 A;  1PGJ A;  2ZEL A;  1XTG B;  4ZMD A;  1URQ A;  1NTM G;  1YIJ P;  3TO6 A;  2A45 H;  2JP3 A;  1Q82 Q;  4ZGY B;  3I3G A;  4AG9 A;  1JOC A;  4PQA A;  4UFW A;  2EBJ A;  2VQY A;  3RYO A;  2P7J A;  1LWU A;  1LCP A;  3RK3 C;  5EC4 A;  2WT7 B;  3HLP A;  3WC7 A;  5AVV B;  4ZY0 A;  1DX7 A;  4TT3 H;  1L0L J;  1CX8 A;  1PU9 A;  1FDM A;  3FX6 A;  2GRE A;  3B5N A;  1Q7L A;  1JY3 P;  4B14 A;  3CXP A;  3QWO C;  3H8G A;  2W27 A;  2GM4 A;  1S1C X;  4A30 A;  2WMM A;  1H8A A;  2B58 A;  2ZW4 A;  4MXU A;  4PK2 A;  4EI2 A;  4CAF A;  1ZLL A;  2ZED A;  1GU5 A;  3H1J G;  1FY7 A;  2EUI A;  4LQ6 A;  4NFR A;  4P6Y A;  3TO9 A;  4AG7 A;  4HYT B;  2HB6 A;  1RF1 B;  4NCZ A;  3SWK A;  2OQQ A;  5APY A;  2VBQ A;  3PZJ A;  1LGH B;  4KVM E;  3L4F A;  2LR2 A;  1L0L D;  1SVF A;  1UFH A;  1LRZ A;  1BGY D;  3L72 D;  5J1Q A;  2G9D A;  1VL2 A;  3D7F A;  3IIB A;  5F49 A;  1T3U A;  2AJ6 A;  2B9B A;  1CZQ A;  2FIA A;  3SJF A;  2B87 A;  2YXR B;  3S4R A;  1BDD A;  5CCH A;  3IR9 A;  2PJ8 A;  1SQV K;  4B13 A;  5KTD A;  1HDU A;  1IFI A;  1LP1 A;  3B3V A;  1Z8L A;  2ZYD A;  2PJ6 A;  4OAE A;  1QVG O;  2VL1 A;  2C6C A;  2B87 B;  5CCH D;  1FZC A;  1Y7R A;  1IB1 E;  1LTJ A;  2Z10 A;  2AFZ A;  2PR1 A;  1FZE A;  4X8I A;  4OME A;  1SQX J;  1K05 A;  2YO3 A;  3LMS A;  3K2K A;  5KKZ C;  5F46 A;  3G4S P;  3GUX A;  3CXH E;  2GIV A;  4OC4 A;  2MKV A;  1YLE A;  1KUX A;  4NGN A;  4MRI A;  4F6A A;  3CC7 P;  3H1H G;  5IB0 A;  1VF5 B;  4XFJ A;  2QJ8 A;  1FZB A;  3SXO A;  2V4H A;  2PIZ A;  4UB6 E;  4GS4 A;  1HJ0 A;  1NH4 A;  2OYH C;  1J1E B;  2NPS D;  2ZYG A;  2ZEO A;  1MJB A;  2IBZ G;  1A02 F;  4B11 A;  3VMZ A;  1NMT A;  3NE7 A;  1UII A;  1GL2 D;  1BDC A;  1RE3 A;  3LOD A;  4KSA A;  5CMZ A;  1PV3 A;  4NGM A;  2DPS A;  2PSW A;  3MN8 A;  3PP9 A;  1N7S C;  2A4N A;  2PJA A;  1PPJ E;  1OBR A;  1HH0 A;  3DNS A;  2Y0M A;  3TGU E;  2IX7 C;  3TF5 A;  4JYC A;  4OP4 A;  4UBR A;  5A27 A;  3MRU A;  5I4M A;  1BPM A;  5H86 A;  2J58 A;  3I56 P;  2OYH B;  4RUH A;  3R9F A;  2AEF A;  1XF8 A;  1FAV A;  4NEX A;  3H8F A;  1CI6 A;  3V38 A;  1LOK A;  4A38 A;  1NU1 K;  2OB0 A;  3T97 A;  2J8M A;  2ZAE B;  3FXE A;  1AFO A;  2Q6Q A;  2I00 A;  2XNX A;  2PVW A;  2PJC A;  1L0L E;  1F57 A;  3GB0 A;  1EC5 A;  4GIF A;  4Y49 B;  4PK3 A;  3R95 A;  2Q04 A;  2BSW A;  3KI9 A;  3WUT A;  3A2A A;  1SQB E;  3E0K A;  3KHZ A;  2ZT9 C;  3SXN A;  4HNX B;  1M8O B;  4JXQ A;  2SPZ A;  1USD A;  1S5L X;  2IDB A;  2UWJ E;  4R3L A;  4WY4 D;  4I49 A;  3B4S A;  5J8C A;  1NVO A;  4NJQ A;  2ZFC A;  2CPB A;  1HF9 A;  5TIS E;  2B89 A;  3AE6 C;  3TGU G;  1MJA A;  4P4I A;  3U1C A;  3CX5 D;  2QJP B;  2EK8 A;  3M9H A;  1FOS F;  2Y9Y A;  2WSE J;  1H88 A;  5EBV A;  4JLY A;  2KB7 P;  3P2H A;  3CWB G;  2J5U A;  2RMZ A;  4CYQ A;  1N8R Q;  3SWF A;  1BSN A;  2QA4 P;  1T3J A;  3H6P A;  3TK1 A;  1RF1 C;  3L74 E;  2QEC A;  2N1T B;  3K5B A;  3PRJ A;  2IFN A;  1KB9 H;  3D66 A;  2RKL A;  5GTH H;  1PP9 J;  5KJ7 D;  4NXY A;  2CTB A;  2WVR A;  4A94 A;  3NTN A;  1KZU B;  3LAC A;  2QJK B;  3E1R A;  2Q7B A;  1AQT A;  3V5B A;  1GW4 A;  2A45 I;  2Z4E A;  4YFJ A;  3IJ3 A;  4H44 D;  5APU A;  3FEE A;  5JGF A;  2ZPA A;  4N6J A;  5EFW B;  1S72 P;  1L4A D;  3WMM 0;  4AYC A;  1TKF A;  5GTH E;  4IF5 A;  4ZX9 A;  2ZVN B;  3O8Z A;  2NYQ A;  3H1L E;  1DE4 C;  1N73 B;  1GZL A;  1SP4 A;  1KB9 D;  1N2D C;  1J2J B;  1NU1 J;  5HVF A;  1GD2 E;  3I9S A;  4IAV A;  2FIW A;  1R5S A;  2O53 A;  2PRB A;  4OAD A;  1GMJ A;  4II9 A;  1IFP A;  1QSO A;  3BI1 A;  2POH A;  2WSS H;  4DZO A;  2ABZ A;  4Q7A A;  3VWE A;  2P6E A;  4MFJ A;  1NKZ B;  4C2Y A;  4U5Y A;  2C9L Y;  2I8D A;  3FJU A;  1MZ9 A;  1VHE A;  3L73 E;  2BO9 A;  1IZN B;  2KLV A;  1Y9W A;  1BCC E;  1FDI A;  2BUE A;  4C68 A;  3H1K D;  2V7Q J;  3L73 G;  2ANP A;  1ELM P;  1YME A;  4TNU A;  4P4F A;  4JBZ A;  2Q4Y A;  2WSC J;  2PGD A;  3CPX A;  4U9Z A;  2BCC G;  1SQP E;  1S60 A;  4C46 A;  1BAV A;  3I1U A;  1DEB A;  2YNC A;  1CM0 A;  1ZG9 A;  3L36 A;  2QJY B;  3PLN A;  2OYI B;  1IFN A;  2Y9Z A;  3PFE A;  3HRN A;  4C7R A;  4H13 B;  4PXE A;  5A28 A;  4BMH A;  1SQP J;  1FBM A;  4GT1 A;  4A39 A;  2VI7 A;  4IL6 H;  2C6G A;  2FT0 A;  1Q81 Q;  4I1L A;  1PUA A;  4FD6 A;  3V2P A;  2FXF A;  1KOR A;  1R3N A;  4MHY A;  1OIP A;  2OTK E;  2CTC A;  1EXJ A;  2R1I A;  2HQY A;  2CIJ A;  3CCM P;  2QVP A;  4H44 C;  3W68 A;  1SQX E;  4FAI A;  3CCQ P;  4RO0 A;  5BVZ A;  3RL0 B;  1NU1 G;  2Z0Z A;  2GUV A;  3G6E P;  1JNM A;  1S7N A;  1KIL A;  1EE3 P;  1DEE G;  4XNH C;  2Z3L A;  1IY7 A;  1Q2D A;  4I6M C;  3CC2 P;  1YJW P;  1IYK A;  4EIJ A;  4Y28 J;  2E74 C;  2FYU G;  2H8P D;  1FOS E;  1N7S D;  3BJ8 A;  2KS1 A;  3MIW A;  1JY2 P;  2C6P A;  4L74 A;  2QYV A;  2FYU E;  1NOH A;  3KL9 A;  1XJO A;  4ZY2 A;  4ORF A;  3B5N B;  1G2C A;  2R5D A;  4UB8 E;  1SQX D;  4TLF A;  3D2P A;  1A2Z A;  2PDO A;  4A33 A;  4K3A A;  5H2F E;  3L75 D;  3DR8 A;  1HUC A;  3S9M A;  1U57 A;  1IOF A;  4JJX A;  3CD6 P;  1XEB A;  1NTZ K;  1YX0 A;  3HUS B;  2PJB A;  3R4Y A;  3A5T A;  3CX5 H;  1ZG8 A;  1SQP D;  3F89 A;  1F2O A;  4X3R A;  3L70 G;  2BOA A;  2CNM A;  2ZW7 A;  2XV5 A;  3NFQ A;  2Z3O A;  1KYO I;  5JH9 A;  5AW0 B;  1FZG A;  3D8P A;  1JTH B;  3TCV A;  5LYL A;  3C1L A;  1Z2L A;  2L91 A;  1YQ3 C;  2FBW C;  3P8C E;  1XIX A;  3CZX A;  1N86 A;  1ZN5 A;  1G2C B;  1URQ B;  4KOW A;  4JXR A;  3G71 P;  2K3R A;  3RK3 B;  2WTY A;  4P4D A;  4CAV A;  3H5Z A;  2HUZ A;  1HTL C;  2ODF A;  1MFZ A;  2XU6 A;  1NE9 A;  2E5T A;  4U3F J;  1GL2 B;  1JTH A;  3U1A A;  1KD1 Q;  3N5F A;  1SQB K;  1M4D A;  4UA3 A;  1M4I A;  4AVC A;  1FJP A;  2IQ6 A;  3EFG A;  2W6B A;  5K8M A;  1U7J A;  2JDI H;  1KC8 Q;  3L73 J;  2Q7S A;  4IL6 X;  4KOR A;  1URQ D;  1YW6 A;  4DCK A;  4W80 A;  4OGQ B;  1JY3 N;  5KLV D;  2E75 B;  2BCC D;  4O9B A;  2HFE D;  4OGQ D;  1IYL A;  3DGV A;  2YIU C;  4TWE A;  2Q4V A;  2WPX A;  2FXM A;  3LW5 H;  4ASV A;  3KQZ A;  2YO2 A;  2WPS A;  1KTM A;  2W90 A;  2GA1 A;  4P4E A;  4XPD B;  3WC6 A;  2B4B A;  2MJZ A;  2JBK A;  1YVK A;  3CX5 E;  3SFD C;  1CG2 A;  3L75 G;  4W7Z A;  2KLU A;  2QSI A;  1X8Y A;  2OZU A;  1ZLI A;  2FYZ A;  1KB9 I;  2OU2 A;  1F2P A;  1L4A C;  3C9I A;  1XE4 A;  2Q3I A;  1AVO A;  2KI7 B;  3CX5 I;  2Q9I A;  5KLV E;  2K88 A;  5DWN A;  1NTM E;  1JY2 O;  3V6I A;  5HVG A;  2E43 A;  4F0X A;  4ZBG A;  4B10 A;  3PB4 X;  4R3K A;  2V77 A;  4WWV A;  4U3F D;  3H8E A;  4MCS A;  1JY2 N;  2GLF A;  4ZI6 A;  4AVA A;  1NSL A;  3KXD A;  2J8N A;  4MFL A;  2FYN C;  4KUA A;  1RTQ A;  1VQ6 P;  1PPJ D;  3K9U A;  1Y9B A;  1NO4 A;  4X5K A;  4XPL A;  1GL2 A;  3NH4 A;  1KQL A;  3HUS C;  5AW7 B;  4A2Z A;  3IFM A;  2V8V A;  4FD7 A;  2G3A A;  2GLJ A;  5G22 A;  3S6K A;  5CPA A;  3SJE A;  4MMO A;  1D7M A;  4E0A A;  3ISZ A;  4H6Z A;  1LT1 A;  3AE3 C;  3F5H A;  3TNU A;  5AVW B;  4PV6 A;  2N9Y B;  2V7Q H;  2G0B A;  3LW5 J;  3FXD A;  5DJT B;  2RB7 A;  3DLJ A;  4L75 A;  1SLQ A;  2PQ8 A;  3V4W A;  4IK2 A;  1ZP0 C;  4EDF A;  2YKO A;  5APT A;  2G8Y A;  1NTZ E;  3AEA C;  1LAN A;  1Z4R A;  3CC4 P;  4D6T E;  3EFF K;  2ZVO B;  4MCR A;  5EMI A;  1M7L A;  2CK3 H;  1KIL D;  1L0N J;  1P84 I;  3R1K A;  5JM6 A;  4KVX A;  1VQ4 P;  1OVV A;  4MY3 A;  5B66 H;  2WYR A;  2Z3K A;  2AE6 A;  1IOI A;  5F47 A;  1RE3 C;  4D6T J;  3FF3 A;  1Z56 A;  2YMK A;  3R9E A;  2EWB A;  3CXH D;  2Q4Z A;  3AE4 C;  3CL3 D;  2VZY A;  4W9Y A;  4Y49 C;  3TTH A;  4UWI A;  1Y0R A;  4OC2 A;  1LTJ B;  5BWA B;  1E79 H;  2A06 E;  2IZ1 A;  4OLL A;  5F09 A;  3AEG C;  2FFD B;  5AW8 B;  1KMI Z;  4DOJ A;  3RK2 D;  2M5A A;  1Z8T A;  2PJ2 A;  2WWW A;  3RK2 B;  2P58 A;  3EWK A;  3IWE A;  1DH3 A;  2Q51 A;  4UIB A;  1I1D A;  3A0B E;  4YGO A;  1LWU C;  1MFT A;  4EYY Q;  5F48 A;  1NTZ G;  5APV A;  5AVY B;  3H32 B;  3Q1M A;  1MV8 A;  2Q0Y A;  3CLQ A;  2XKM A;  3UY5 A;  2O3J A;  4ZNC A;  4B6Z A;  1VQ5 P;  5E96 A;  3HUS A;  1N7S B;  3JCU E;  4PD4 E;  3B71 A; 
#chains in the Genus database with same CATH homology
 3T90 A;  5J8C A;  2B4D A;  4J3G A;  4KOU A;  1HF9 A;  1Q90 D;  4C2Z A;  4FD4 A;  3AE6 C;  1MJA A;  1SQH A;  2H88 C;  3C26 A;  1JB0 J;  3Q5S A;  4XNH B;  2WSE J;  1Y9K A;  1GHE A;  5EBV A;  5AG4 A;  4JLY A;  1OW7 A;  3F5B A;  4E8O A;  2QJK C;  4UFV A;  3P2H A;  2C27 A;  1R57 A;  2J5U A;  2K9Y A;  2OH1 A;  4CYQ A;  5I0C A;  2JDC A;  2K5T A;  1PL5 A;  4UWJ A;  1V0C A;  2B5G B;  1BO4 A;  1VHS A;  2QEC A;  1DD4 A;  3TOB A;  4CRZ B;  3Q3D A;  2FS5 A;  4M85 A;  1RO5 A;  1PIX A;  1YRE A;  3S9O A;  4HNY B;  3RL0 g;  3GLM A;  1I12 A;  4NXY A;  3AE5 C;  4YRH A;  4E2A A;  1Z4E A;  5AG6 A;  4MJ8 A;  3GF3 A;  2ZW6 A;  4KOY A;  1VF5 D;  3QB8 A;  2Q7B A;  3Q5R A;  4NSQ A;  4PV1 B;  4YFJ A;  4EVY A;  4H44 D;  3IWG A;  4B5P B;  4U7J A;  4KOX A;  4LX9 A;  2ZPA A;  4BBH A;  2R98 A;  2E74 D;  2F5I A;  2E75 C;  4IF5 A;  2WQY C;  2D2C D;  2VEZ A;  4DNC A;  1UIX A;  1Q2Y A;  4MBU A;  1KQG B;  1RXT A;  2X7B A;  5KTA A;  4CGM A;  3G9R A;  4FD5 A;  2IL4 A;  3I9S A;  1U6M A;  2FIW A;  4A32 A;  3V8I A;  3S6H A;  2DXQ A;  4R57 A;  2PRB A;  4OAD A;  1GMJ A;  3IAO A;  5JPH A;  4L8A A;  4II9 A;  3AEF C;  1QSO A;  1K4J A;  3G8W A;  3JTK A;  1TIQ A;  2YNE A;  3VWE A;  2P6E A;  4MFJ A;  2Z3M A;  3JVN A;  3D70 A;  3D3S A;  4U5Y A;  2E74 B;  3AEC C;  3S6F A;  4AB7 A;  4C2Y A;  4R4L A;  1S7F A;  3FBU A;  4QVT A;  2R8V A;  2D4P A;  1Y9W A;  2FCK A;  1ZRT E;  3O6Q A;  1FDI A;  3WR7 A;  5J8F A;  2BUE A;  4C68 A;  4UCM A;  2V7Q J;  2OZG A;  3D6Z A;  2Q4Y A;  2WSC J;  3IN6 A;  1B87 A;  2FXP A;  4U9Z A;  2NZ2 A;  4JWP A;  3DSB A;  4QUS A;  1S60 A;  4QB9 A;  4XPK A;  1ZOY C;  2YNC A;  2P6G A;  1CM0 A;  4MY0 A;  3S6G A;  1NYH A;  3TO7 A;  3GKR A;  5AGE A;  5L8R J;  1KZF A;  2G3T A;  3LD2 A;  4H13 B;  4YXD C;  2BEQ D;  5A28 A;  2WPW A;  4BMH A;  5IX3 A;  2J8R A;  2WPV B;  4C2X A;  2VI7 A;  4CAE A;  1YQ4 C;  4R9M A;  4IUS A;  2ATR A;  4UCP A;  4LUA A;  1S5K A;  2O01 J;  2CNT A;  3AE9 C;  2FT0 A;  3D2M A;  1PUA A;  1QSR A;  3IU1 A;  4FD6 A;  4Q38 A;  2Z11 A;  2ZXV A;  5AG7 A;  2FXF A;  1KOR A;  3AEE C;  2BEI A;  4H44 B;  2ZT9 B;  3AE2 C;  4QC6 A;  1R8E A;  2QJP C;  1EXJ A;  2R1I A;  1YR0 A;  2HQY A;  4AVB A;  3IU2 A;  3C8V A;  3FXT A;  4H6U A;  2CNS A;  4H44 C;  4H13 D;  1M44 A;  3AEB C;  4H0L C;  3RK3 E;  2H5M A;  3A9L A;  4CAW A;  1VF5 C;  1WWZ A;  5CNP A;  4MI4 A;  2Z0Z A;  3ABV C;  4MFZ A;  3FB3 A;  3GY9 A;  1S7L A;  1P0H A;  2QIW A;  1S7N A;  1YK3 A;  1YVO A;  1L0C A;  4M3S A;  1I21 A;  2VXK A;  4A31 A;  2ZW5 A;  4CRY B;  2REE A;  3TOA A;  4XNH C;  2Z3L A;  1Q2D A;  1IYK A;  3T97 B;  3BJ7 A;  4NF1 A;  4HNW B;  4KVO E;  3W6S A;  4XPD C;  4Y28 J;  2E74 C;  3G3S A;  3F0A A;  1IID A;  2BEZ F;  3BJ8 A;  4PV1 D;  4MFP A;  1WMK A;  4ONU A;  1ZO0 A;  3GMA A;  5KLI C;  5G20 A;  4H0L B;  1DD3 A;  4B5O A;  4R87 A;  1NGM B;  4KOV A;  4ORF A;  3DDD A;  1OW6 A;  1IK7 A;  2WUU A;  3D2P A;  4I7Z C;  2PDO A;  4A33 A;  1RQV A;  3DR8 A;  3AE1 C;  2I79 A;  5H84 A;  3KKW A;  2E76 C;  1U57 A;  1P4N A;  2BL1 A;  4JJX A;  1XEB A;  3W6X A;  5FVJ A;  1KIL E;  1YX0 A;  4CAX A;  4I7Z B;  3R4Y A;  2QJY C;  2REF A;  1WK4 A;  4B12 A;  3F8K A;  5ISV A;  2JLM A;  2CNM A;  2ZW7 A;  4PSW A;  2Z3O A;  3QAH A;  5G21 A;  3R9G A;  2HV2 A;  2B3V A;  2ARH A;  3D8P A;  1N71 A;  3CXS A;  3OWC A;  2PR8 A;  3TCV A;  2QIR A;  2Z3P A;  4Z1M H;  4RKU J;  1YQ3 C;  2FBW C;  1S3Z A;  1XIX A;  3CXQ A;  1AJY A;  4F0Y A;  1IIC A;  1CJW A;  1QST A;  4KOW A;  3VWD A;  4JXR A;  2P10 A;  5GCN A;  2O28 A;  1KUY A;  3FYN A;  4MFK A;  4C7I A;  4CAV A;  3H5Z A;  3W91 A;  2HUZ A;  1KQF B;  2YND A;  2ZT9 D;  1Q2C A;  2B4D B;  3FNC A;  1NE9 A;  4CGL A;  1M4D A;  4UA3 A;  3BLN A;  2JP3 A;  1M4I A;  3EXN A;  3TO6 A;  4AVC A;  2CY2 A;  5G1Z A;  4ZGY B;  3AED C;  3I3G A;  2OZH A;  4AG9 A;  4KUB A;  4UFW A;  2VQY A;  3RYO A;  4Q36 A;  2GAN A;  4IL6 X;  2YGW A;  4KOR A;  2EVN A;  3EFA A;  5EC4 A;  4OGQ B;  2P6F A;  2JDD A;  2E75 B;  2B5G A;  4OGQ D;  4TT3 H;  1IYL A;  2YIU C;  4JD6 A;  4PV1 C;  1PU9 A;  4HKF A;  2Q4V A;  2WPX A;  1QSM A;  3IGR A;  4UCN A;  4B14 A;  3CXP A;  5JQ4 A;  4CGN A;  4CYN A;  1KTM A;  4XPD B;  4UFX A;  1S1C X;  2B4B A;  4A30 A;  2WSF J;  1YVK A;  2E76 D;  2B58 A;  2YNC C;  2ZW4 A;  4PK2 A;  3B8G A;  4CAF A;  3SFD C;  4KLW A;  4B5P A;  1FY7 A;  2EUI A;  1M1D A;  3TO9 A;  2QSI A;  4AG7 A;  2OZU A;  1MJ9 A;  2JO1 A;  4YTP C;  2OU2 A;  5C88 A;  4NCZ A;  2OQQ A;  1XE4 A;  1XMT A;  1KUV A;  5C82 A;  2VBQ A;  3N7Z A;  3PZJ A;  5DWN A;  4KVM E;  3H25 A;  2FSR A;  4CS0 B;  4F0X A;  1UFH A;  2Z3N A;  4ZBG A;  1LRZ A;  4B10 A;  4R4M A;  1VL2 A;  4R3K A;  5F49 A;  4H13 C;  2AJ6 A;  2FIA A;  3AE8 C;  2E76 B;  4CYP A;  3GYA A;  4MFQ A;  4B13 A;  4OGQ C;  2DPT A;  2KCW A;  5KTD A;  4AVA A;  1NSL A;  1RQU A;  2NMT A;  4OAE A;  2J8N A;  4MFL A;  2FYN C;  3FGA D;  4RS2 A;  2R7H A;  4KUA A;  4U9Y A;  3K9U A;  1VKC A;  4CGO A;  1J4J A;  3R96 A;  1Y7R A;  1B6B A;  1Y9B A;  1IB1 E;  2JEV A;  4X5K A;  2WSA A;  2Z10 A;  4XPL A;  5IV0 A;  2PR1 A;  5KTC A;  4A2Z A;  4FD7 A;  2G3A A;  5G22 A;  3S6K A;  4MHD A;  4GDO A;  4KOT A;  4KOS A;  3ZZI A;  3PGP A;  4E0A A;  1K05 A;  2FE7 A;  1K04 A;  3EY5 A;  4H6Z A;  1OMI A;  3Q2Y A;  1S7K A;  3AE3 C;  5KKZ C;  5F46 A;  4PV6 A;  2G0B A;  1M4G A;  3LW5 J;  3D6Y A;  2GIV A;  5HMN A;  1EXI A;  1ON0 A;  2QML A;  3EO4 A;  1DIP A;  2MKV A;  1YLE A;  4K30 A;  1KUX A;  4F6A A;  2PQ8 A;  5IB0 A;  1VF5 B;  1ZP0 C;  4XFJ A;  5AG5 A;  3SXO A;  2G8Y A;  4GS4 A;  1HJ0 A;  3AEA C;  1Z4R A;  1MJB A;  5DWM A;  4B11 A;  3T9Y A;  2FL4 A;  1NMT A;  3NE7 A;  3P2F A;  3GF7 A;  3MGD A;  3R1K A;  4KSF A;  4KVX A;  3LOD A;  1MK4 A;  4KSA A;  1OW8 A;  1PV3 A;  4MY3 A;  2GE3 A;  2DPS A;  2PSW A;  2Z3K A;  2AE6 A;  3TFY A;  2A4N A;  5F47 A;  3FIX A;  2YMK A;  3DNS A;  2Y0M A;  3R9E A;  4CYO A;  4KT0 J;  1QSN A;  2B3U A;  3AE4 C;  2VZY A;  4RI1 A;  4UBR A;  2PC1 A;  5A27 A;  2E75 D;  4Y49 C;  3AE7 C;  3TE4 A;  5H86 A;  2H89 C;  3TTH A;  4UWI A;  3SHP A;  4CGP A;  3R9F A;  2P0W A;  3DR6 A;  5M1B A;  1XF8 A;  5BWA B;  1YGH A;  3FRM A;  4L89 A;  4OLL A;  4NEX A;  3AEG C;  4H89 A;  2Q44 A;  1KMI Z;  4H0L D;  2D2C C;  3Q5P A;  1ZME C;  2OB0 A;  4C7H A;  3TT2 A;  3IWE A;  3EWK A;  4KZT A;  2J8M A;  1I1D A;  4QBJ A;  2RC4 A;  3EC4 A;  2D2C B;  1BOB A;  4YGO A;  2I00 A;  3ZJ0 A;  2D4O A;  1FDO A;  1MKM A;  5F48 A;  3JUW A;  3H4Q A;  5HH1 A;  4Y49 B;  4PK3 A;  3R95 A;  2Q04 A;  2BSW A;  1TU3 F;  4A95 A;  3Q1M A;  2Q0Y A;  3E0K A;  2ZT9 C;  3UY5 A;  3SXN A;  4HNX B;  3SFE C;  4KLV A;  2VZZ A;  4JXQ A;  1Z9U A;  2IDB A;  1S5L X;  2CXA A;  1OZP A;  5E96 A;  4KS9 A;  4R3L A;  4PSX A;  3D71 A;  3PP9 A;  4I49 A;  3B71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...