2G3AA

Crystal structure of putative acetyltransferase from agrobacterium tumefaciens
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
MNFVLSDVADAEAEKAIRDPLVAYNLARFGESDKRDLNITIRNDDNSVTGGLVGHTARGWLYVQLLFVPEAMRGQGIAPKLLAMAEEEARKRGCMGAYIDTMNPDALRTYERYGFTKIGSLGPLSSGQSITWLEKRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative acetyltransferase from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Transferase
molecule keywords acetyltransferase
total genus 33
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2g3aA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2g3aA02
5KTCA 2H88C 2DXQA 2GIVA 4XPLA 1S3ZA 2G3TA 4DNCA 2OZHA 3R95A 1YVKA 4JLYA 4FD7A 2CY2A 4CAWA 2IL4A 3FIXA 2JDCA 2GE3A 3AE5C 2J8MA 2ATRA 1QSNA 1UFHA 4R87A 4NF1A 3B71A 3TO9A 5ISVA 4L89A 3TT2A 2OB0A 5F47A 4RS2A 3SHPA 2ARHA 1Q2YA 2KCWA 1S7NA 4QUSA 3TO7A 3D2MA 2O28A 4UBRA 4NEXA 1IICA 3SXNA 3T90A 4H6ZA 3AEBC 2RC4A 2B3VA 4PK3A 1P0HA 1R57A 3AECC 1I12A 2WPXA 4PV6A 3W91A 2FS5A 4OAEA 2FT0A 2GANA 4XPDB 4YTPC 3R96A 4QB9A 3FB3A 3VWEA 4UWIA 1I1DA 3AEGC 2B58A 2F5IA 4NXYA 1VKCA 3S6FA 4OLLA 4JXRA 5J8FA 1S5KA 4KOXA 3W6XA 3TO6A 2BSWA 4IUSA 3WR7A 4KLVA 3DR6A 3DNSA 1KTMA 3P2FA 3FXTA 5JQ4A 1V0CA 3ABVC 3JUWA 4QC6A 1QSTA 4AVCA 1IYLA 4CRYB 1S7LA 2PR8A 4AVAA 4U9YA 2BEIA 3ZZIA 1WWZA 1Z9UA 4MY3A 3TCVA 3AE6C 1XMTA 2BUEA 3EC4A 4E8OA 2R8VA 3S6KA 3GKRA 4KZTA 3S9OA 3NE7A 3H4QA 2G0BA 2EVNA 5HH1A 4Y49B 1L0CA 4KOSA 3N7ZA 3MGDA 1MJAA 1M4DA 4Y49C 4AG7A 1PUAA 4ONUA 4U9ZA 3VWDA 3KKWA 3E0KA 5IV0A 2AJ6A 3P2HA 4F0YA 2FL4A 2EUIA 2Q4VA 3AEAC 1Y9WA 3D3SA 1N71A 5C82A 4R9MA 2H5MA 3SFEC 2CNTA 2R98A 2VBQA 2QECA 4U5YA 4RI1A 3TOAA 4LX9A 4QBJA 2WPWA 1S7FA 1TIQA 4XPDC 2R1IA 3F8KA 5JPHA 1FY7A 4KUBA 4XPKA 4E0AA 3AE1C 4KVXA 5EBVA 4GS4A 3D2PA 3FYNA 2B4BA 4KLWA 3AE2C 5FVJA 1S7KA 1OW6A 4JJXA 3TTHA 4FD6A 3K9UA 2VZYA 4MBUA 3JVNA 1SQHA 4CRZB 1IYKA 1YQ4C 2VI7A 1K4JA 5DWNA 3CXSA 1BO4A 3AE8C 2ZW7A 3DSBA 3PGPA 1YLEA 4QVTA 3BLNA 4II9A 3IWGA 3IGRA 5GCNA 4R3LA 3R1KA 2Q4YA 4AG9A 3BJ8A 5HMNA 4YXDC 1PV3A 2QIRA 1ZOYC 1Q2DA 2ZW4A 4MY0A 2HUZA 1YREA 1KZFA 1MJ9A 1NE9A 3EFAA 1YQ3C 2Y0MA 4KUAA 2ZXVA 1PU9A 2JLMA 1KUYA 1M4GA 4HNWB 4KVOE 2Z0ZA 2ZPAA 5H84A 1ON0A 2CNSA 2WQYC 3SXOA 3S6GA 1Z4RA 3EY5A 2REEA 1XE4A 5KTAA 4M3SA 4UA3A 2PR1A 4KOWA 1RO5A 2Z10A 4I49A 2B4DB 3EO4A 4X5KA 1YX0A 2I00A 2NMTA 2R7HA 2B4DA 4ORFA 2QMLA 3BJ7A 1Z4EA 4MJ8A 5KTDA 2PC1A 4HNXB 1YR0A 4R3KA 4CS0B 2Q7BA 4XNHB 1Q2CA 1K04A 4AVBA 3B8GA 3F0AA 4H89A 4CAVA 1K05A 3TFYA 4LUAA 4KOVA 4M85A 4JD6A 4MI4A 1S60A 2VXKA 4B5PA 3S6HA 2FIWA 4MHDA 3RYOA 4KORA 2A4NA 3DR8A 1OW8A 1YK3A 3W6SA 3AE4C 4ZBGA 1B6BA 2CNMA 2Z11A 2B5GA 3FRMA 4CAXA 1I21A 2ZW5A 2OH1A 2PQ8A 4JXQA 4YFJA 3AE9C 2BL1A 2FCKA 3R9FA 3CXQA 3AEDC 3SFDC 1Y9KA 2P6GA 2REFA 2AE6A 3G3SA 5IB0A 4UWJA 1IIDA 2FSRA 4OADA 4HNYB 1CM0A 2VZZA 1NSLA 4JWPA 3V8IA 3D8PA 2B3UA 5J8CA 1YVOA 4PSXA 4B5PB 1XF8A 1WK4A 4PK2A 2ZW6A 4AB7A 2H89C 3C26A 3DDDA 4XNHC 2FIAA 4FD4A 3QAHA 2D4OA 3PP9A 5C88A 5F48A 4K30A 1B87A 1VHSA 2K5TA 1J4JA 1MK4A 4FD5A 4EVYA 4YGOA 1QSMA 2P6EA 2PRBA 1M44A 1XIXA 2P6FA 4R57A 2FXFA 1P4NA 5EC4A 3AE7C 1M1DA 2FE7A 2X7BA 5F49A 4HKFA 1U6MA 3LD2A 3LODA 4NCZA 4E2AA 1GHEA 1NMTA 2Q44A 3OWCA 1YGHA 1QSOA 2PDOA 5DWMA 2B5GB 3PZJA 3ZJ0A 4F6AA 1Y7RA 4IF5A 4J3GA 4BMHA 5IX3A 3GY9A 3FNCA 2C27A 2JEVA 4H6UA 3AEEC 2PSWA 3I9SA 4KOTA 3UY5A 4KOUA 3T9YA 3TOBA 5I0CA 4YRHA 1BOBA 2HQYA 2J8RA 5F46A 1KUVA 2FBWC 3AEFC 2VEZA 3G8WA 2OZGA 1CJWA 1XEBA 3R9GA 4B5OA 1OW7A 1LRZA 2D4PA 2J8NA 2Q04A 3FBUA 3TE4A 3I3GA 2HV2A 5CNPA 1QSRA 1KUXA 1OZPA 2OZUA 2P0WA 2G3AA 3R9EA 2Q0YA 3QB8A 1IB1E 5H86A 1RXTA 2VQYA 2OU2A 2I79A 1ZP0C 3EXNA 4L8AA 5E96A 3F5BA 3GYAA 3AE3C 1MJBA 1M4IA 4KVME 3CXPA 4NSQA 2JDDA 4PSWA 4KOYA
chains in the Genus database with same CATH superfamily
1LJ2A 1VQKP 4NJRA 2H88C 2E76D 2DXQA 3HUSA 2ZAEB 3EFFK 2FYUG 5KAFE 2G3TA 2BCCG 3G6EP 1M57D 4MHYA 1HGZA 2W8ZA 5KLIB 4XE5B 2PJ6A 3H1IE 4FD7A 3IAOA 3FIXA 2YNYA 2R44A 2I1KA 2ATRA 2NRGA 3MTUE 2E43A 4YWYA 5CBNA 3NA6A 3B71A 1SQBE 4F9VA 4L89A 1JY3O 2YGWA 3SHPA 1JY2N 3VOPA 4NGTA 4ZY1A 1NGMB 4QUSA 1ZRTE 3L36A 1FDOA 3D4UA 4UBRA 1YW6A 4C7NA 1IICA 1NTME 4PV1D 4PJ0E 2KLVA 5AVRB 1JOCA 3IFEA 4H6ZA 2RC4A 1MUUA 2Z3NA 4PK3A 4XFJA 3AECC 2YMKA 3W91A 1Z56A 2E5TA 4OAEA 4PD4D 2Q3IA 1S9KE 1Y47A 4M6HA 3L70E 2ZEEA 4YTPC 8CPAA 3R96A 1IFJA 4UFWA 4UWIA 3FEEA 1GW4A 3VATA 1AQTA 3OA7A 3CX5D 1LCPA 3PP5A 4A38A 3S6FA 3HD7A 2MJZA 1IY7A 2FYUK 1PPJD 5CBOA 1KB9E 2B87A 3KZIE 3RL0C 3BHXA 3CDXA 3NFZA 1KYOH 3A0BH 1VGYA 3WR7A 1GYTA 3L75E 4FUUA 4AQRD 1VQLP 1SFCA 1L4AB 4CGLA 3I5CA 1IOIA 2QM7A 1ZG7A 3FXTA 5GTHE 3RK3E 1PP9J 1KZUB 4QC6A 3OAKA 2B88A 3CCQP 1HDUA 3V38A 1IYLA 2KNCB 1LGHB 4WY4C 1W2BO 1LAPA 2I3CA 2M3BA 1NAYA 4AVAA 4U9YA 1SQQG 4OIWA 4X2TA 3W67A 1TXRA 1Z9UA 1GZLA 1FDMA 1Y0RA 1NTKK 3H1IG 1URQC 4W80A 3EC4A 2PVVA 3PH0A 2Q3EA 3GKRA 1HGVA 4PXEA 4NPEA 1JQGA 3NE7A 3IU1A 2JP3A 4NGQA 2YMYA 3CL3D 3PB7X 3D71A 1M4LA 2XNXA 1RF0C 2D2CD 4CYQA 1VQ8P 4KOSA 1MJAA 5CJ0A 1VQMP 2DEAA 4GOFA 4ONUA 5KJ7A 3CC7P 1VQ6P 3KKWA 4ZGYB 3E0KA 1EDLA 4NJQA 2AJ6A 3P2HA 2BOAA 3L73G 3D6YA 2FL4A 3ISZA 3VP9A 5KAIE 2Q7CA 5HXDA 1CW5A 3SFEC 2CNTA 3M0AA 4MFQA 4RI1A 1JY3P 4CAEA 4OC5A 3A9LA 3ZDMA 1LT1A 2R1IA 6CPAA 3H1LD 4WWVA 5JPHA 1XTCC 1N73B 1FZFA 1L0LE 5B5EH 3V2PA 2GREA 3N7NA 2M8RA 3BI1A 4KVXA 2ZVOB 1JY2P 3FYNA 1XBUA 1WMKA 1FE6A 3HD7B 2BEZF 4P45A 1LOKA 4JJXA 1BDDA 1J2JB 3CX5E 4L73A 1BLLE 4PPZA 1L0NG 3TYYA 2FFDB 1IYKA 1N2DC 1Z8WA 2EO8A 2WSEJ 1JUNA 2IQ6A 1PYTB 5THWA 1QVGO 1N7SD 1K4JA 2WTYA 1BO4A 1P84E 1QL2A 2NPSC 3JCUH 1OZHA 4F8ZA 4DJGA 1NTZE 2P7JA 2OTLP 3LACA 3WMM0 3PGPA 1YLEA 2N1TA 3H1KJ 4TLFA 5APWA 5AW6B 3GB0A 1URQB 1ZR2A 3IC1A 3R1KA 4BINA 1T8ZA 3NH5A 4AG9A 1AJYA 1PL5A 3BJ8A 1EDJA 2C0XA 2KS1A 1BE3D 1FJKA 3P32A 1Q2DA 1NTZK 2QM8A 5CCGD 3BCCE 1KZFA 1NE9A 4DJLA 1MFZA 1R5LA 2ZYDA 1SQBG 1RY3A 2J58A 4IFDK 2JLMA 2FKWB 2K1AA 2IDBA 5CCHA 3JCUE 2IYOA 1ZLIA 2Z0ZA 2ZPAA 3VP8A 4HNWB 4XA4A 1X79B 3S6GA 3A7OA 1SQPJ 1BCCG 4HH2A 3VN0A 2I1JA 4C7HA 2REEA 1BAVA 5KTAA 4K3AA 4UB6E 2C6GA 5CPAA 1BGYD 3FH4A 4UA3A 2B4DB 4X5KA 2YXRB 1YX0A 4FBEA 3DGVA 2YXQB 2NMTA 2HPCA 4DZOA 4D6TJ 3HLPA 3KPEA 4LQGA 1AA0A 2PVWA 1L0LK 3C8VA 3Q5PA 4IFMA 5AW0B 2GLJA 1L4AD 5LYFA 4AVBA 3BRVB 4H89A 4U7JA 2KXPB 1RE3A 3LIDA 2FVGA 2ZEDA 4TWEA 4PD4I 2VXKA 1M1JB 3TNUA 1YIJP 1LTBC 4WY4B 1QLED 3RYOA 1CX8A 4KORA 1BGYE 4P4IA 3HTKB 4IL6E 4CYPA 1NU1G 3D68A 5LRKA 4BRYA 3W6SA 4ZBGA 2N1TD 1B6BA 2CNMA 2Z11A 2OTKE 1I21A 2ZW5A 4YFJA 2Z3OA 1TKFA 3AEDC 2XU6A 2A06E 1Y9KA 2XDJA 3P8CD 1IIDA 1LNQA 2QYVA 1RF0A 3F5HA 1VL2A 1SLQA 4PXDA 2KP8A 2LKMA 3HD7C 2C9NY 3L71E 2H43A 2EK9A 2ZW6A 4EMEA 1N73C 1A02F 4P4JA 1SQPD 4XNHC 3USSA 1SFCD 5A27A 1NTKD 3WU2H 2O1KA 3V2NA 4GODA 1VHEA 1Q7LA 3H32B 1KYOE 1R5SA 1KD1Q 4EVYA 4OWFA 2P6EA 4UEEA 1XIXA 5ELYA 5CCHD 3BCCD 3H1JJ 4C2YA 3B4SA 1P4NA 3AE7C 4JYWA 3H5ZA 1LTAC 4HKFA 4A2ZA 1TKJA 1MZ9A 2Q6QA 3HD7D 2PFXA 1KORA 4E2AA 1NMTA 2ABZA 2ZENA 4LC1A 3OWCA 1QSOA 1SQVD 3FEDA 5DWMA 3N4XA 4ZY2A 5BWAB 1Y7RA 4PQAA 5B5EE 2K3RA 1IZNB 3G9RA 3E1IA 2JEVA 1KILE 3GF3A 4WY4A 1H88A 1P84I 1U57A 4ZKUA 4KOTA 1N7SB 3UY5A 3CWBG 3H1LG 5I0CA 1ZR4A 3U1AA 3H8EA 4HJGH 2OTJP 3RBZA 3CCJP 2ITAA 1ZG9A 2JWAA 3AEFC 3BVHA 1CP7A 1YJ9P 1AVYA 1URQD 2D4PA 3MN8A 3TE4A 4EI2A 1RE4A 5KAIH 3LMSA 1FZGA 1QSRA 1KUXA 5CNPA 1L4AC 4BXLA 2G9DA 4B13A 2QJKB 1IO4A 1PGQA 5LRGA 2OZUA 4B6ZA 1UIXA 2G3AA 3FX6A 3IFMA 3H1LE 2V8VA 3QB8A 1IB1E 5H86A 1KFMA 2OYIA 1RXTA 5BU8B 1EZVI 2OU2A 2XEIA 2O1JA 2YIUC 1RF1C 4CGOA 1SQVG 3PFEA 1LTJB 1KQLA 1H89A 2QG4A 3BCCJ 1GTWA 2B89A 4H2KA 2WSAA 2YKPA 2IJZA 2PJ5A 4L74A 2AXCA 4WB4A 4H0LC 4A31A 2XEGA 3MUDA 4PXCA 3RK2C 3VH9A 1BCCJ 1S3ZA 1AQ5A 4RJTA 5J1QA 4P44A 2DW3A 1DX7A 1YVKA 3L72E 3HE5B 4M6IA 1X9VA 1USDA 1FJPA 2K9YA 1Y9BA 2OYOA 1HDQA 3AE5C 2R5BA 1N7LA 3SJGA 4JF7A 2E74B 5APQA 2BO9A 4R87A 4PD4E 3L73E 4A94A 4CGPA 3L74E 1GD2E 3NMDA 4EWTA 2WWWA 4GXHA 1DTDA 3TT2A 5F47A 1J1DB 1Q2YA 2KYVA 3LW5H 4DYOA 3HE4A 2O28A 2ZT9D 1ELMP 1X12A 4YXWH 5CCGA 4AXVA 2Z3KA 5D29A 4MFKA 1KMIZ 1OX3A 2A06D 3M06A 3B3TA 4B10A 3P7KA 1FZEA 4U3FD 5GTHH 3ISXA 3H1HG 3VTPC 2WPXA 4KSAA 4UCNA 2FS5A 1Q7YQ 4UCMA 2FXMA 3PBBA 1SQXE 5AVVB 5AVZB 4OGQC 1K73Q 2M5AB 3EQ2A 2YIUB 3FB3A 2FXOA 2QJYB 3KQXA 3QNVA 3TF5A 2F5IA 1ZRTD 1QVFO 2WZNA 2OGUA 1JCDA 2QSIA 5AW2B 1BPMA 1YTZI 3U59A 1S5KA 4O23A 3L75G 1SQVK 4U3FJ 1SFCB 3TO6A 4IUSA 3RNZA 2H8PD 2Q51A 1JTHB 1KTMA 1K9MQ 1ZLLA 4PD4H 2PRRA 5F09A 4C68A 2Y0EA 3NE8A 2WUUA 2CF4A 4CRYB 3WUVA 3H8GA 2GFQA 3KZWA 3G4SP 2OYIB 1S3JA 1EZVG 4MY3A 3M9HA 3AE6C 4Y28J 3NXSA 2R3SA 3KHXA 4E8OA 2WVRA 2R8VA 2Q4ZA 1NTKG 5GTIH 1WT6A 3B5ND 3CPWO 3H4QA 1X8YA 1NHLA 4CGMA 1FZBA 3L35A 5KAFH 1NU1E 1E5WA 3MIWA 1LTSC 3N7ZA 1U7JA 1M4DA 4IAVA 1W5CE 1AVOA 4F0YA 3RGUA 3I55P 1IK9A 3AEAC 4H44B 1NO4A 3D3SA 4DOJA 1NJIQ 5C82A 4NGMA 1OBRA 2H5MA 1NU1J 2AFXA 3S9LA 1GW3A 2K37A 4LX9A 3P8MC 1SQPE 3A0HE 3L70G 5AG4A 2PCUA 2RB7A 2M5AA 1FY7A 5A28A 1YYCA 3GW6A 5B66H 3S4RA 3HUSB 3R4YA 1KWMA 2Q43A 3AE1C 3PFOA 2FYNC 2B4BA 4KLWA 1GL2C 5FVJA 1NU1D 3CD6P 5AW8B 5AVXB 4FD6A 1IFIA 4JPZB 4OVNF 2L5GB 3PRTA 2VZYA 3GHGB 2PIYA 1RH5B 1SQHA 1YQ4C 1AV1A 3L73D 4UIAA 3JSVC 1BE3J 1U7MA 3IJ3A 1M90Q 2IMOA 1ZN5A 4NGNA 1NYHA 4B86A 1ZMEC 2W90A 3MGNA 3DSBA 3KZIH 3HTKA 2E74D 4W7ZA 3H1HE 3BLNA 4TNUA 3CCMP 3IGRA 4R4MA 4UFXA 5M1BA 2BCCE 1IFNA 2Q4YA 1Z8LA 3RBXA 4FAIA 1HVVA 5HMNA 1T2KD 5KKZB 1M1KQ 2QIRA 1ZOYC 1PIXA 1X22A 2E75D 3D6ZA 2HUZA 1YREA 4IL6X 3GHGA 1L0NE 1H8AA 1GU4A 3EFAA 1YQ3C 4R8FA 3L74G 3QWOC 1KUYA 1M4GA 3PB9X 2C0WA 2C1CA 4KVOE 3FXEA 5AVTB 3RL0B 5KLIC 1IOFA 1JNMA 5AW3B 1ON0A 1M1JA 2ZJSE 2WQYC 3S9MA 2WSSH 1EDIA 2AEMA 3B7IA 3KASA 2NPSD 2QJYC 4BWNA 3H8FA 2E76B 2FYNB 3WUUA 2PR1A 1KILA 2LXBA 3V4QA 1Z8TA 2I00A 1VQNP 2I8DA 2PJBA 2CK3H 2WPQA 3D70A 2FY8A 2QMLA 5KTDA 5G21A 1L0LD 4HNXB 4UB6H 7CPAA 2YO2A 3WC5A 4B12A 3TDKA 4U3FG 1XTGB 2P58A 1XMBA 3B3CA 4KOVA 4UEFA 1OFCX 4CPAA 4AUWA 2KB7P 1NTMJ 1RF1B 3K5BA 2PJ0A 4JZ0A 1A02J 3FVLA 3KR4A 3S6HA 1VQOP 1J1DC 4KSIA 2QJPB 4MXUA 3B5NC 1CPXA 1OW8A 4IHMA 2CTBA 2B5GA 3FRMA 1L0LJ 2PQ8A 3PBEA 4JXQA 1Q2NA 3FMCA 1G1JA 2P6GA 2AE6A 4ZKPA 5IB0A 4UWJA 2KS1B 3M0DC 3B5NB 4EYYQ 4F9UA 1YSJA 2QE7H 1BCCE 1SQVJ 2BASA 1XOVA 4PSXA 2V8DA 2D2CC 1H0TA 3H1KG 1HH0A 1SS1A 5CHXA 2JBKA 2Z3LA 2A45H 2HODB 3L75J 2A45I 5LYIA 3EWKA 3DDDA 4UB8H 1LT9C 2K9JA 2YNCA 4HB1A 3CCUP 2D4OA 3QAHA 5K8OA 1NTZJ 1GK6A 1SQVE 3NFQA 5I4MA 5JH9A 1B87A 5K8MA 3P8CE 3VMXA 3H1KE 4N78E 4MCQA 1JMBA 4CPGA 5AG7A 4OGQD 3VMAA 1IC2A 4H0LD 2XKMA 2EWBA 2P6FA 1VF5B 2W6BA 2WT7A 1NH4A 4HYTB 1VQ7P 4K35A 1JCCA 5AW4B 5AVYB 1HF9A 3LODA 1BCCD 3D66A 3NTNA 3SSUA 4MMOA 3SWYA 1H0TB 2PDOA 4MCRA 3CCVP 1KN7A 2JR8A 3K2KA 2GUSA 1PP9D 3ZJ0A 4GDOA 4BMHA 5IX3A 3GY9A 2C27A 3L74J 1YTZT 3H1HD 3K9TA 1IFDA 3L71G 1F57A 3TOBA 3MRUA 2QVPA 3M9QA 2KUBA 2PRQA 4DUKA 2IZ0A 2O4HA 5F46A 2FBWC 5BU5A 1BE3E 2VEZA 4Q7AA 1ZXGA 2C6PA 2NYQA 1XEBA 4A32A 1PPJE 1F2PA 2JO1A 2YO3A 3FBUA 4NPFX 1L0ND 1CBXA 4OH8B 2GLFA 1MKMA 3L75D 3A5TA 1OZPA 3RZAA 2O01N 3GHGC 4A37A 1HUCA 2QJPC 1T6AA 3KDPB 2Q0YA 3KYQA 2HLOA 2Y0CA 1KB9I 2R32A 4A7PA 2ZEOA 2I79A 1M1JC 4NGRA 1FBMA 2L91A 2WSFJ 5APXA 1ZP0C 3EXNA 3JRUA 4L8AA 2WSCH 4D6TD 1KILD 1L0NJ 4KVME 4CYNA 3D7GA 3CXPA 4KS9A 1JB0J 1LANA 5KTCA 1GL2A 2GIVA 1SQPG 2RKLA 1KV4A 2XV5A 4DNCA 4UFVA 2V4HA 2EBJA 4CAWA 1VDFA 2JDCA 5APSA 2GE3A 4IK2A 5IB9A 4WBAA 4R6TA 3CI9A 1PPJG 1QSNA 3GLMA 1UFHA 4NPDA 2BEQD 2WZ7A 1ZG8A 3V4WA 3TO9A 5ISVA 4MCSA 2KCWA 1BGYG 1FZCA 4RKUJ 3L37A 2OR4A 3D2MA 3L4FA 3HUVA 4WWIA 4H13C 4NEXA 1YBKA 5KLVE 3CLQA 1FT7A 3D7HA 3U1CA 2N1TC 1FZAA 2PJ9A 2B3VA 3GG2A 4ZY0A 1I12A 4PV6A 3CWBJ 4UEZA 1L2PA 5APYA 3FGAD 2GANA 1HEEA 4DT0A 1CI6A 4X8IA 4MCPA 4QB9A 4F0XA 2IPPA 1I1DA 5K8PA 2V7QH 2WMMA 4NXYA 5APVA 1RQUA 2F8HA 4JQ0D 1SQPK 2Y9YA 2P1JA 3CWBE 5J8FA 4KOXA 4EOTA 2M3EA 1KILC 1S5LX 4ASWA 3W6XA 2AFMA 1XFOA 1KQFB 1DIPA 2V77A 4C2ZA 1CPSA 3TGUJ 3DR6A 4EIJA 3FX0A 1XRYA 2PJ1A 1EQ7A 3FJUA 3SI1A 5JQ4A 1V0CA 3ABVC 3CXHH 3O8ZA 3JUWA 2NSMA 4H0LB 1QSTA 3BRTB 3S9NA 3CC2P 4OMEA 3L72J 1YMEA 1Z5RA 4HKZH 1S7LA 1BSHA 1TKHA 2PR8A 3D67A 2Q5UA 2QIWA 2WSCJ 3TGUE 2BEIA 3H1LJ 5KJ7D 4JYBA 3L73J 2J59M 3B5NA 2CXAA 1X0TA 1XMTA 1QGKB 3T97A 3B2YA 3Q1MA 4MRIA 1KB9H 4KZTA 4UCPA 3S9OA 2G0BA 2JWDA 4GKGA 2EVNA 5AVUB 3O6QA 3B3SA 5E79E 1P84H 2XNDH 3RK2D 1DEEG 4Y49C 2Q9IA 1YI2P 1FOSE 4AG7A 2GA1A 5APUA 1M56D 4MFPA 2EUIA 1YW4A 1S1CX 1Y9WA 3QAYA 1N71A 4R9MA 2YKOA 2VBQA 3KL9A 3LW5J 1SQXK 3TOAA 4OKOA 1ELLP 1G1IA 1LTJA 1L0LG 1D7MA 3SWFA 1S7FA 4OP4A 4XPDC 4H13B 2A06G 1SQXG 1EZVD 1SQQD 3HUSC 1BE3G 4E0AA 3CX5H 5AW1B 3KI9A 5BVZA 2ZOGA 2B87B 2PJ4A 5JGFA 3D2PA 3VMYA 1SFCC 4OIDA 3TTHA 2HC9A 2XEFA 1RE3C 1FAVA 1HWTC 2GU2A 2M0BA 3K9UA 4MBUA 1CI6B 4CRZB 3CT9A 3L2NA 2Q1KA 3IR9A 2CPBA 1A2ZA 4BBHA 2PJ3A 2AEFA 1J1EC 2AFWA 2R3CA 1QEXA 2DPSA 3CXSA 3AE8C 4I6MC 2AFZA 3IF4A 2ZW7A 1FS0E 1LTIC 3II6A 3Q5RA 2IBZG 4QVTA 3L72G 4OC3A 2IFMA 5GTIE 1NTMK 3IU2A 1SQQE 1FZCB 1RTQA 1Q86Q 3QH9A 3E1RA 1NTMG 4YXDC 4KJMA 3OJAB 1LAMA 1KC8Q 2OYIC 1GL2D 1JY2O 1SQBK 2ZW4A 1Y7EA 1JMMA 2N9BA 3IWEA 3S1KA 4NGPA 3HE5A 1SP4A 2ZXVA 1R3NA 5K5GB 1Z8XA 1S72P 1Q81Q 1TF8A 4DCKA 2PJCA 4CGNA 5H2FE 1L4AA 5CMZA 2CNSA 3PB6X 2OYHB 4ASVA 1RHZB 2J5UA 2FYUJ 1Z4RA 2HR3A 1NWQA 1IFPA 2PJAA 1LTTC 5LYDA 2KSEA 4M3SA 2UWJE 4IOIH 1RO5A 2Z10A 4I49A 1PP9G 3EO4A 1DD4A 1QQ9A 4ORFA 1KB9D 2ZEPA 2W83C 4TT3H 4EDFA 2BCOA 1NU1K 1YR0A 3L71D 5EMIA 4CYOA 4R3KA 3SJFA 1Q2CA 2LXCB 2QVAA 2POKA 3F0AA 2C9LY 1K05A 4A33A 3V6IA 1R8EA 4JD6A 4M85A 4GM5A 4MI4A 1NTKJ 3CPAA 4H44C 4LLHA 3SI2A 4B5PA 5JM6A 4MHDA 1T3JA 2ZT9B 3DR8A 2IFNA 3AE4C 3MP7B 4CAXA 2IZ1A 2OH1A 1ZLHA 3AE9C 3H1HJ 4PV1C 2BL1A 2FCKA 3R9FA 3CXQA 1SQXJ 5G20A 1NTKE 5DJUB 2REFA 2FXPA 3V2QA 2XZRA 1IFMA 5KKZC 1NTZD 1LP1B 1QX8A 4Q38A 1URQA 1YHQP 1KYOD 4HNYB 1BGYJ 1N7SA 1CM0A 1RE4C 1NSLA 3RK3B 4JWPA 4GOEA 3D8PA 4NFRA 2D2CB 5B66E 3WT4A 5J8CA 4I1LA 1YVOA 4OC0A 1WK4A 2ANPA 1NSAA 4MHPA 2GUVA 4AB7A 4OC1A 2H89C 4ZMDA 3C26A 3RAMA 2FYUD 4PJ0H 1YQEA 4FD4A 2PGDA 2RMZA 5C88A 1KQGB 3BXMA 1MFTA 1Y8AA 2DPTA 2XEJA 2Z5HA 3WC7A 4KSFA 1VIXA 3R2PA 4FD5A 4YGOA 4B11A 1QSMA 3T8WA 3MUDC 3TSIA 2PRBA 4GT1A 1M44A 1CSBA 3L74D 3BASA 4R57A 5AVSB 2Y9ZA 4IFFA 2FXFA 1WRGA 3GIUA 4L76A 1M1DA 1G2CA 4UF4A 1HTLC 3RO0A 3H1IJ 3IO1A 3LD2A 5K8NA 2KLUA 2B9BA 3A3YB 2HODA 1H8LA 1GHEA 1AUGA 2Q44A 2ZT9C 2Y0DA 3PZJA 3Q5SA 2ZYAA 4HPSA 4J3GA 3H1KD 1USEA 3Q2YA 2WPSA 3PB4X 3FNCA 2WSFH 1SQBJ 1AYEA 4H6UA 3AEEC 3I9SA 4K3NA 3CCSP 1SQXD 3T9YA 2AXTH 2ZXEB 2PJ2A 1VQPP 1BOBA 2HQYA 2J8RA 3DLJA 3KQZA 2MKVA 4L75A 3RK3C 1KUVA 2IBZE 3I56P 1VQ4P 2OZGA 4H44D 2V8GA 1CJWA 3R9GA 3UIAA 2N9YB 1S4XA 3MZWB 1OW7A 4B5OA 1L0NK 3M0DA 1GMJA 3I3GA 1PP9E 3IN6A 2QJ8A 3CXHD 2HV2A 4C7RA 2LR2A 3TNUB 5AG5A 4GIFA 5LYLA 1GL2B 2P0WA 4X3RA 3WUTA 4YU9A 2DF5A 5AVQB 2HYNA 1NKZB 5AG6A 3M9BA 2A45G 4G1PA 1G2CB 1JO5A 3A0HH 3C9IA 3FF3A 1GDTA 1S5LE 5KLVG 1S2EA 2KNCA 5H2FH 3V2RA 5E96A 2Z3PA 3F5BA 3GYAA 3AE3C 4P10A 4Q36A 1MJBA 1M4IA 1IGBA 3VYIA 5CCHC 2CTCA 4NSQA 2JDDA 4OC4A 4PSWA 2O53A 1DH3A 4XPLA 3CCEP 1NTMD 2K9JB 2OZHA 1JY3N 5AW5B 1XJOA 3R95A 4JLYA 1AMPA 2CY2A 2E75C 1EXJA 2IL4A 2JEWA 1FDIA 2J8MA 2R5DA 3M91A 3SWKA 2KI7B 3I1UA 4R76A 1OVRA 1T3UA 3JTKA 1NKNA 1CP6A 1LP1A 4NF1A 4ZNCA 1IK7A 2OB0A 4RS2A 1LT9B 2ARHA 2ZEGA 2JEEA 3D7FA 4WY4D 1S7NA 1AFOA 3B8EB 1W2EA 3TO7A 2KSJA 2ZOFA 1Q82Q 2OARA 2KOGA 4N3YB 3W68A 4JBZA 2N1TB 3SXNA 3G71P 3T90A 5LRJA 1VQ5P 2EK8A 1OVVA 3AEBC 1PFIA 5G22A 1FU1A 5G1ZA 4MHNA 5EFWB 2AFSA 2F7VA 4C7IA 2KZJA 1P0HA 2ZEMA 5HVGA 1R57A 4IL6H 3T97B 3TGUD 3RK3D 1EDKA 2FT0A 2YNEA 3VARA 1UWYA 4XPDB 1HJ0A 1BDCA 4JYCA 2ZYGA 5APTA 1VQ9P 1BSNA 3VWEA 1OVUA 4P4DA 3AEGC 2B58A 2G8YA 1ARMA 4Y99B 1QMUA 4UB8E 1LWUA 1VKCA 3CMAP 4OLLA 2POHA 2W6JH 2NZ2A 4P4BA 1Q90D 3FWLA 3RBUA 2ZELA 4JXRA 1TU3F 3CCLP 2KIKA 1X10A 2V8HA 2O3JA 2BSWA 1N73A 1SQQJ 5TISH 2JBJA 4Y99C 2OYHA 4KLVA 4RN7A 4R4LA 3B3WA 4MFZA 3LIEA 1K8AQ 4A95A 2QJKC 4OC2A 1PGOA 2KZIA 3DNSA 3BATA 3H25A 3P2FA 2P10A 3CZXA 1BPNA 2HPCB 1RQVA 3EFGA 4AVCA 2Z4EA 1KFNA 1DE4C 5AW7B 3O6QB 3H1JE 3HE4B 3ZZIA 1WWZA 4EFDA 4ZYQA 3TCVA 2BUEA 3TGUG 3B35A 5D8NA 1T2KC 1E79H 3S6KA 1NAFA 4BRYB 3KR5A 2AXTE 5HH1A 1OXZA 4Y49B 2JKVA 1L0CA 4B14A 3BCCG 2FFDC 3MGDA 2E76C 1QL1A 3CXHE 1OIPA 1LT9A 2IBZI 1PUAA 2PE3A 3VWDA 4U9ZA 4FWUA 4N6JA 2IX7C 5IV0A 1IJDB 2E42A 2E74C 2Q4VA 5C39A 2CIJA 5E79H 2PP6A 1DEBA 1N7SC 1MV8A 2R98A 2JJLA 2QECA 4U5YA 4MFJA 4WVZA 3D7DA 3H1JG 4QBJA 2WPWA 3PTZA 1TIQA 1NVOA 2FYUE 4OGQB 4RESB 3F8KA 2WYRA 4P4EA 3PJSK 1FC2C 4Z65A 1P84D 2KK7A 4C46A 4KUBA 4XPKA 1VF5D 4A39A 4M3LA 2ZFCA 3CX5I 2OQQA 5EBVA 4GS4A 2PJ8A 2WSEH 1S9KD 3AE2C 3FECA 1S7KA 1OW6A 5KLVK 2YNDA 1EC5A 3WC6A 3PHLA 3JVNA 1LTGC 3L71J 2RH0A 3F89A 3HRNA 3CCRP 1PZQA 2VI7A 2HG5D 3V5BA 1CG2A 3PRJA 5DWNA 3PLNA 4D6TG 4PXBA 4BD9A 3WABA 3SJXA 4II9A 3IWGA 1YJNP 5GCNA 4R3LA 1S5LH 2VL1A 3CPXA 1HJBA 3E7KA 1PV3A 4QMAA 3V7ZA 3NH8A 5L8RJ 3TC8A 4MHZA 1PGJA 2ODFA 5HVFA 4MY0A 4P6YA 1J1EB 1MJ9A 1DD3A 4Z1MH 1PCAA 2YNCC 2Y0MA 2PJ7A 1F2OA 4NGSA 4KUAA 2W6AA 1PU9A 2GM4A 4N78D 1FOSF 4RUHA 1GU5A 2ZEHA 1KILB 1NOHA 5H84A 1IU8A 1JTHA 4P4FA 1LWUC 3SXOA 4CAFA 1EE3P 3PEIA 3SI0A 5KTBA 3IEHA 3EY5A 2W27A 2WT7B 3OW2O 1XE4A 2V7QJ 5TJHA 3PB8X 5DS0A 1JEKA 4KOWA 2H7HA 3TX8A 1YITP 3A0BE 1JM0A 1PGPA 3C1LA 3L72D 5CBMA 2R7HA 2B4DA 2Z5IA 3BJ7A 1Z4EA 3CMEP 4MJ8A 2PC1A 4YPCA 1HBWA 1KYOI 3IIBA 2HB6A 4CS0B 2ZEFA 2Q7BA 4XNHB 1K04A 4MN4C 3B8GA 3KXDA 4CAVA 2AEJA 2AFUA 3TFYA 4LUAA 3A2AA 1R43A 5KLVJ 1S60A 1YJWP 2FIWA 3LWUA 2A4NA 1ARLA 1YK3A 4PV1B 3CC4P 5CJ4A 4LGDE 3KHUA 3RL0g 3BI0A 3SFDC 3L70J 4W9YA 3G3SA 2FSRA 4OADA 4KT0J 5KLVD 2VZZA 2ZXXA 3V8IA 3KQGA 3CXHI 2Z3MA 2B3UA 1ZW0A 1Z2LA 3GUXA 2FYZA 2Q7SA 4B5PB 1XF8A 2O01H 3VMZA 3KHZA 3FXDA 4PK2A 2HFED 2OOTA 1TF9A 4ONWA 1RF1A 3H1ID 2FIAA 1UIIA 3CWBD 2IYPA 3PP9A 1ZV8A 2C6CA 5F48A 4I7ZB 4K30A 1VF5C 1VHSA 2QA4P 2K5TA 3GF7A 2QRXA 1J4JA 1Y0YA 1MK4A 4WJBA 2P67A 3H32A 2OYHC 1LWUB 3N5FA 1SQBD 4ZX8A 3G3ZA 2JDIH 1EZVE 1M7LA 3Q3DA 1VPCA 2E5YA 5EC4A 2FE7A 2ZVNB 2X7BA 5F49A 1NTZG 3MD0A 2RN0A 1N8RQ 1U6MA 4NCZA 2NPSA 3KGQA 5HVHA 1SVFA 2CPSA 3B3VA 1M8OB 2QEXP 2SPZA 1YGHA 2B5GB 4I2LC 3GLJA 1SQQK 2O01J 1YLOA 5DJTB 4F6AA 4IF5A 4ZI6A 5AVWB 3TK1A 2WPVB 4KHXA 3H1JD 1FZCC 4M6GA 4C7NB 2PSWA 4W7YA 2PIZA 2WPRA 3L70D 5CCGC 3SJEA 4KOUA 3RK2B 1N86A 4YRHA 2BCCD 4C2XA 4U3FE 2VRSA 4R7MA 1ZO0A 2FFDA 1OWAA 3G8WA 1VHOA 4D6TE 2J9AA 2WITA 3JC22 1CZQA 2P2UA 5TISE 5KJ7C 3GMAA 4MFLA 1LRZA 2J8NA 2Q04A 2AFOA 4AYCA 2YKQA 3WU2E 1FNOA 3MHVA 3IWWA 1LFWA 1OMIA 4H13D 3R9EA 2BCCJ 1EXIA 2E75B 1GK4A 3ITKA 5AW9B 2RFHA 4UIBA 1JWQA 4ZX9A 2VQYA 4A30A 5AGEA 2IBZD 4RO0A 2K88A 4O9BA 1KQSO 3RL0D 3NH4A 1LTJC 2PAJA 3FWNA 4LQ6A 2NPSB 3H6PA 4I7ZC 4KOYA
chains in the Genus database with same CATH topology
5KTCA 4A31A 2H88C 2E76D 2DXQA 2GIVA 4XPLA 1S3ZA 2G3TA 4DNCA 2OZHA 3R95A 1YVKA 4JLYA 4UFVA 4FD7A 3IAOA 2CY2A 2K9YA 2E75C 4CAWA 1EXJA 1Y9BA 2IL4A 2JDCA 1FDIA 2GE3A 3FIXA 3AE5C 2J8MA 2ATRA 1QSNA 2E74B 3GLMA 1UFHA 3JTKA 4R87A 2BEQD 4NF1A 3B71A 3TO9A 4CGPA 5ISVA 4L89A 3TT2A 1IK7A 2OB0A 5F47A 2YGWA 4RS2A 3SHPA 2ARHA 1Q2YA 2KCWA 1S7NA 1NGMB 4RKUJ 4QUSA 1ZRTE 3TO7A 3D2MA 2O28A 2ZT9D 4H13C 1FDOA 4UBRA 4NEXA 1IICA 4PV1D 3SXNA 2Z3KA 4MFKA 3T90A 4H6ZA 1KMIZ 3AEBC 4B10A 2RC4A 5G22A 5G1ZA 2Z3NA 2B3VA 4C7IA 4PK3A 1P0HA 4XFJA 1R57A 3AECC 2YMKA 1I12A 2WPXA 4PV6A 3W91A 4KSAA 3T97B 4UCNA 2FS5A 4OAEA 2FT0A 3FGAD 2GANA 2YNEA 4UCMA 4XPDB 1HJ0A 4OGQC 4YTPC 3R96A 4QB9A 3FB3A 4UFWA 4UWIA 3VWEA 4F0XA 1I1DA 3AEGC 2B58A 2G8YA 2F5IA 4NXYA 1VKCA 3S6FA 4OLLA 1RQUA 2QSIA 2NZ2A 1Q90D 4JXRA 1TU3F 1S5KA 4KOXA 5J8FA 1S5LX 3W6XA 3TO6A 2BSWA 4IUSA 3WR7A 1KQFB 1DIPA 4KLVA 4C2ZA 3DR6A 4R4LA 4MFZA 4CGLA 4A95A 2QJKC 3DNSA 3H25A 1KTMA 3FXTA 3P2FA 3RK3E 5JQ4A 1V0CA 2P10A 3ABVC 3JUWA 4C68A 1RQVA 4QC6A 4H0LB 1QSTA 2WUUA 4AVCA 1IYLA 4CRYB 1S7LA 2PR8A 2QIWA 2WSCJ 4AVAA 4U9YA 2BEIA 3ZZIA 1WWZA 1Z9UA 4MY3A 2CXAA 3AE6C 3TCVA 4Y28J 1XMTA 2BUEA 3EC4A 4E8OA 2R8VA 3S6KA 3Q1MA 3GKRA 4KZTA 4UCPA 3S9OA 3NE7A 3H4QA 2G0BA 2EVNA 2JP3A 3IU1A 4CGMA 3O6QA 5HH1A 3D71A 2D2CD 4Y49B 1L0CA 4KOSA 4B14A 4CYQA 3N7ZA 3MGDA 1MJAA 2E76C 1M4DA 4Y49C 4AG7A 1PUAA 4ONUA 4U9ZA 3VWDA 3KKWA 4ZGYB 3E0KA 5IV0A 2AJ6A 3P2HA 4F0YA 3D6YA 2FL4A 4MFPA 2EUIA 2Q4VA 2E74C 3AEAC 1S1CX 4H44B 1Y9WA 3D3SA 1N71A 5C82A 4R9MA 2H5MA 3SFEC 2CNTA 2R98A 2VBQA 3LW5J 2QECA 4U5YA 4MFQA 4RI1A 4MFJA 4CAEA 3TOAA 3A9LA 4LX9A 4QBJA 2WPWA 1S7FA 1TIQA 4XPDC 4H13B 5AG4A 4OGQB 2R1IA 3F8KA 5JPHA 1FY7A 5A28A 4KUBA 4XPKA 1VF5D 4E0AA 3R4YA 3AE1C 4KVXA 2OQQA 5EBVA 4GS4A 3D2PA 2FYNC 3FYNA 2B4BA 4KLWA 1WMKA 3AE2C 2BEZF 5FVJA 1S7KA 1OW6A 2YNDA 4JJXA 3TTHA 4FD6A 3K9UA 2VZYA 4MBUA 3JVNA 1SQHA 4CRZB 1YQ4C 1IYKA 4BBHA 2VI7A 2WSEJ 2DPSA 1K4JA 5DWNA 3CXSA 1BO4A 3AE8C 1NYHA 2ZW7A 1ZMEC 3DSBA 3Q5RA 3PGPA 1YLEA 2E74D 4QVTA 4I7ZC 3BLNA 4II9A 3IWGA 3IGRA 5GCNA 4R4MA 3IU2A 4UFXA 4R3LA 5M1BA 3R1KA 2Q4YA 4AG9A 1AJYA 1PL5A 3BJ8A 5HMNA 4YXDC 1PV3A 2QIRA 5L8RJ 1ZOYC 1Q2DA 1PIXA 2ZW4A 4MY0A 2E75D 3D6ZA 2HUZA 1YREA 4IL6X 1KZFA 1MJ9A 1DD3A 1NE9A 3IWEA 3EFAA 4Z1MH 1YQ3C 2YNCC 2Y0MA 4KUAA 2ZXVA 1PU9A 2JLMA 1KUYA 1M4GA 2IDBA 4HNWB 4KVOE 2Z0ZA 2ZPAA 4CGNA 5KLIC 5H84A 1ON0A 2CNSA 2WQYC 4CAFA 3SXOA 3S6GA 2J5UA 1Z4RA 3EY5A 2QJYC 2REEA 4C7HA 1XE4A 2V7QJ 5KTAA 2E76B 4M3SA 4UA3A 2PR1A 1RO5A 2Z10A 4I49A 4KOWA 2B4DB 3EO4A 4X5KA 1YX0A 1DD4A 2I00A 2NMTA 2R7HA 2B4DA 4ORFA 2QMLA 3D70A 3BJ7A 1Z4EA 4MJ8A 4TT3H 5KTDA 3C8VA 5G21A 3Q5PA 2PC1A 4HNXB 1YR0A 4B12A 4CYOA 4R3KA 4CS0B 2Q7BA 4XNHB 1Q2CA 1K04A 4AVBA 3B8GA 3F0AA 4H89A 4U7JA 4CAVA 1K05A 3TFYA 4LUAA 4KOVA 4A33A 1R8EA 4M85A 4JD6A 4MI4A 1S60A 4H44C 2VXKA 4B5PA 3S6HA 2FIWA 4MHDA 3RYOA 4KORA 4CYPA 2ZT9B 2A4NA 3DR8A 1OW8A 1YK3A 3W6SA 3AE4C 4ZBGA 4PV1B 1B6BA 2CNMA 2Z11A 2B5GA 3FRMA 4CAXA 1I21A 2ZW5A 2OH1A 2PQ8A 2Z3OA 4JXQA 3AE9C 4YFJA 4PV1C 2BL1A 2FCKA 3RL0g 3R9FA 3CXQA 3AEDC 3SFDC 5G20A 1Y9KA 2P6GA 2REFA 2AE6A 3G3SA 2FXPA 5IB0A 4UWJA 1IIDA 5KKZC 2FSRA 4Q38A 4OADA 4HNYB 4KT0J 1CM0A 2VZZA 1NSLA 1VL2A 4JWPA 3V8IA 3D8PA 2D2CB 2Z3MA 2B3UA 5J8CA 1YVOA 4PSXA 2D2CC 4B5PB 1XF8A 1WK4A 4PK2A 2Z3LA 2ZW6A 4AB7A 2H89C 3EWKA 3C26A 3DDDA 4XNHC 2YNCA 2FIAA 4FD4A 3QAHA 2D4OA 5A27A 3PP9A 5C88A 5F48A 4I7ZB 1KQGB 1VF5C 1B87A 4K30A 2DPTA 1VHSA 2K5TA 3GF7A 1J4JA 4KSFA 1MK4A 4FD5A 4B11A 4YGOA 4EVYA 1QSMA 2P6EA 2PRBA 5AG7A 4OGQD 1M44A 1XIXA 4C2YA 4H0LD 2P6FA 4R57A 3Q3DA 1VF5B 2FXFA 1P4NA 5EC4A 3AE7C 1M1DA 2FE7A 2X7BA 3H5ZA 5F49A 4HKFA 1HF9A 1U6MA 3LD2A 3LODA 4A2ZA 4NCZA 1KORA 4E2AA 1GHEA 1NMTA 2Q44A 3OWCA 1YGHA 1QSOA 2ZT9C 2PDOA 5DWMA 2B5GB 3PZJA 3ZJ0A 4F6AA 2O01J 1Y7RA 3Q5SA 5BWAB 4GDOA 4IF5A 4J3GA 4BMHA 3Q2YA 5IX3A 2WPVB 3G9RA 3FNCA 3GY9A 2C27A 2JEVA 1KILE 3GF3A 4H6UA 3AEEC 2PSWA 1U57A 3I9SA 4KOTA 3UY5A 4KOUA 3T9YA 3TOBA 5I0CA 4YRHA 4C2XA 1BOBA 2HQYA 2J8RA 1ZO0A 2MKVA 5F46A 1KUVA 2FBWC 3AEFC 2VEZA 3G8WA 2OZGA 4H44D 1CJWA 1XEBA 3R9GA 3GMAA 4A32A 4B5OA 1OW7A 2JO1A 4MFLA 1LRZA 2D4PA 2J8NA 2Q04A 3FBUA 1GMJA 3I3GA 3IN6A 3TE4A 2HV2A 5CNPA 1MKMA 1QSRA 1KUXA 1OZPA 4B13A 5AG5A 2QJPC 1OMIA 2OZUA 4H13D 2P0WA 1UIXA 2G3AA 3R9EA 1EXIA 5AG6A 2Q0YA 2E75B 3QB8A 1IB1E 5H86A 1RXTA 2VQYA 2OU2A 2I79A 4A30A 2YIUC 4CGOA 5AGEA 2WSFJ 1ZP0C 3EXNA 4L8AA 5E96A 2Z3PA 3F5BA 3GYAA 3AE3C 2WSAA 4Q36A 1MJBA 1M4IA 4KVME 4CYNA 3CXPA 4NSQA 4KS9A 2JDDA 1JB0J 4PSWA 4KOYA 4H0LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KTC A;  2H88 C;  2DXQ A;  2GIV A;  4XPL A;  1S3Z A;  2G3T A;  4DNC A;  2OZH A;  3R95 A;  1YVK A;  4JLY A;  4FD7 A;  2CY2 A;  4CAW A;  2IL4 A;  3FIX A;  2JDC A;  2GE3 A;  3AE5 C;  2J8M A;  2ATR A;  1QSN A;  1UFH A;  4R87 A;  4NF1 A;  3B71 A;  3TO9 A;  5ISV A;  4L89 A;  3TT2 A;  2OB0 A;  5F47 A;  4RS2 A;  3SHP A;  2ARH A;  1Q2Y A;  2KCW A;  1S7N A;  4QUS A;  3TO7 A;  3D2M A;  2O28 A;  4UBR A;  4NEX A;  1IIC A;  3SXN A;  3T90 A;  4H6Z A;  3AEB C;  2RC4 A;  2B3V A;  4PK3 A;  1P0H A;  1R57 A;  3AEC C;  1I12 A;  2WPX A;  4PV6 A;  3W91 A;  2FS5 A;  4OAE A;  2FT0 A;  2GAN A;  4XPD B;  4YTP C;  3R96 A;  4QB9 A;  3FB3 A;  3VWE A;  4UWI A;  1I1D A;  3AEG C;  2B58 A;  2F5I A;  4NXY A;  1VKC A;  3S6F A;  4OLL A;  4JXR A;  5J8F A;  1S5K A;  4KOX A;  3W6X A;  3TO6 A;  2BSW A;  4IUS A;  3WR7 A;  4KLV A;  3DR6 A;  3DNS A;  1KTM A;  3P2F A;  3FXT A;  5JQ4 A;  1V0C A;  3ABV C;  3JUW A;  4QC6 A;  1QST A;  4AVC A;  1IYL A;  4CRY B;  1S7L A;  2PR8 A;  4AVA A;  4U9Y A;  2BEI A;  3ZZI A;  1WWZ A;  1Z9U A;  4MY3 A;  3TCV A;  3AE6 C;  1XMT A;  2BUE A;  3EC4 A;  4E8O A;  2R8V A;  3S6K A;  3GKR A;  4KZT A;  3S9O A;  3NE7 A;  3H4Q A;  2G0B A;  2EVN A;  5HH1 A;  4Y49 B;  1L0C A;  4KOS A;  3N7Z A;  3MGD A;  1MJA A;  1M4D A;  4Y49 C;  4AG7 A;  1PUA A;  4ONU A;  4U9Z A;  3VWD A;  3KKW A;  3E0K A;  5IV0 A;  2AJ6 A;  3P2H A;  4F0Y A;  2FL4 A;  2EUI A;  2Q4V A;  3AEA C;  1Y9W A;  3D3S A;  1N71 A;  5C82 A;  4R9M A;  2H5M A;  3SFE C;  2CNT A;  2R98 A;  2VBQ A;  2QEC A;  4U5Y A;  4RI1 A;  3TOA A;  4LX9 A;  4QBJ A;  2WPW A;  1S7F A;  1TIQ A;  4XPD C;  2R1I A;  3F8K A;  5JPH A;  1FY7 A;  4KUB A;  4XPK A;  4E0A A;  3AE1 C;  4KVX A;  5EBV A;  4GS4 A;  3D2P A;  3FYN A;  2B4B A;  4KLW A;  3AE2 C;  5FVJ A;  1S7K A;  1OW6 A;  4JJX A;  3TTH A;  4FD6 A;  3K9U A;  2VZY A;  4MBU A;  3JVN A;  1SQH A;  4CRZ B;  1IYK A;  1YQ4 C;  2VI7 A;  1K4J A;  5DWN A;  3CXS A;  1BO4 A;  3AE8 C;  2ZW7 A;  3DSB A;  3PGP A;  1YLE A;  4QVT A;  3BLN A;  4II9 A;  3IWG A;  3IGR A;  5GCN A;  4R3L A;  3R1K A;  2Q4Y A;  4AG9 A;  3BJ8 A;  5HMN A;  4YXD C;  1PV3 A;  2QIR A;  1ZOY C;  1Q2D A;  2ZW4 A;  4MY0 A;  2HUZ A;  1YRE A;  1KZF A;  1MJ9 A;  1NE9 A;  3EFA A;  1YQ3 C;  2Y0M A;  4KUA A;  2ZXV A;  1PU9 A;  2JLM A;  1KUY A;  1M4G A;  4HNW B;  4KVO E;  2Z0Z A;  2ZPA A;  5H84 A;  1ON0 A;  2CNS A;  2WQY C;  3SXO A;  3S6G A;  1Z4R A;  3EY5 A;  2REE A;  1XE4 A;  5KTA A;  4M3S A;  4UA3 A;  2PR1 A;  4KOW A;  1RO5 A;  2Z10 A;  4I49 A;  2B4D B;  3EO4 A;  4X5K A;  1YX0 A;  2I00 A;  2NMT A;  2R7H A;  2B4D A;  4ORF A;  2QML A;  3BJ7 A;  1Z4E A;  4MJ8 A;  5KTD A;  2PC1 A;  4HNX B;  1YR0 A;  4R3K A;  4CS0 B;  2Q7B A;  4XNH B;  1Q2C A;  1K04 A;  4AVB A;  3B8G A;  3F0A A;  4H89 A;  4CAV A;  1K05 A;  3TFY A;  4LUA A;  4KOV A;  4M85 A;  4JD6 A;  4MI4 A;  1S60 A;  2VXK A;  4B5P A;  3S6H A;  2FIW A;  4MHD A;  3RYO A;  4KOR A;  2A4N A;  3DR8 A;  1OW8 A;  1YK3 A;  3W6S A;  3AE4 C;  4ZBG A;  1B6B A;  2CNM A;  2Z11 A;  2B5G A;  3FRM A;  4CAX A;  1I21 A;  2ZW5 A;  2OH1 A;  2PQ8 A;  4JXQ A;  4YFJ A;  3AE9 C;  2BL1 A;  2FCK A;  3R9F A;  3CXQ A;  3AED C;  3SFD C;  1Y9K A;  2P6G A;  2REF A;  2AE6 A;  3G3S A;  5IB0 A;  4UWJ A;  1IID A;  2FSR A;  4OAD A;  4HNY B;  1CM0 A;  2VZZ A;  1NSL A;  4JWP A;  3V8I A;  3D8P A;  2B3U A;  5J8C A;  1YVO A;  4PSX A;  4B5P B;  1XF8 A;  1WK4 A;  4PK2 A;  2ZW6 A;  4AB7 A;  2H89 C;  3C26 A;  3DDD A;  4XNH C;  2FIA A;  4FD4 A;  3QAH A;  2D4O A;  3PP9 A;  5C88 A;  5F48 A;  4K30 A;  1B87 A;  1VHS A;  2K5T A;  1J4J A;  1MK4 A;  4FD5 A;  4EVY A;  4YGO A;  1QSM A;  2P6E A;  2PRB A;  1M44 A;  1XIX A;  2P6F A;  4R57 A;  2FXF A;  1P4N A;  5EC4 A;  3AE7 C;  1M1D A;  2FE7 A;  2X7B A;  5F49 A;  4HKF A;  1U6M A;  3LD2 A;  3LOD A;  4NCZ A;  4E2A A;  1GHE A;  1NMT A;  2Q44 A;  3OWC A;  1YGH A;  1QSO A;  2PDO A;  5DWM A;  2B5G B;  3PZJ A;  3ZJ0 A;  4F6A A;  1Y7R A;  4IF5 A;  4J3G A;  4BMH A;  5IX3 A;  3GY9 A;  3FNC A;  2C27 A;  2JEV A;  4H6U A;  3AEE C;  2PSW A;  3I9S A;  4KOT A;  3UY5 A;  4KOU A;  3T9Y A;  3TOB A;  5I0C A;  4YRH A;  1BOB A;  2HQY A;  2J8R A;  5F46 A;  1KUV A;  2FBW C;  3AEF C;  2VEZ A;  3G8W A;  2OZG A;  1CJW A;  1XEB A;  3R9G A;  4B5O A;  1OW7 A;  1LRZ A;  2D4P A;  2J8N A;  2Q04 A;  3FBU A;  3TE4 A;  3I3G A;  2HV2 A;  5CNP A;  1QSR A;  1KUX A;  1OZP A;  2OZU A;  2P0W A;  2G3A A;  3R9E A;  2Q0Y A;  3QB8 A;  1IB1 E;  5H86 A;  1RXT A;  2VQY A;  2OU2 A;  2I79 A;  1ZP0 C;  3EXN A;  4L8A A;  5E96 A;  3F5B A;  3GYA A;  3AE3 C;  1MJB A;  1M4I A;  4KVM E;  3CXP A;  4NSQ A;  2JDD A;  4PSW A;  4KOY A; 
#chains in the Genus database with same CATH topology
 1LJ2 A;  1VQK P;  4NJR A;  2H88 C;  2E76 D;  2DXQ A;  3HUS A;  2ZAE B;  3EFF K;  2FYU G;  5KAF E;  2G3T A;  2BCC G;  3G6E P;  1M57 D;  4MHY A;  1HGZ A;  2W8Z A;  5KLI B;  4XE5 B;  2PJ6 A;  3H1I E;  4FD7 A;  3IAO A;  3FIX A;  2YNY A;  2R44 A;  2I1K A;  2ATR A;  2NRG A;  3MTU E;  2E43 A;  4YWY A;  5CBN A;  3NA6 A;  3B71 A;  1SQB E;  4F9V A;  4L89 A;  1JY3 O;  2YGW A;  3SHP A;  1JY2 N;  3VOP A;  4NGT A;  4ZY1 A;  1NGM B;  4QUS A;  1ZRT E;  3L36 A;  1FDO A;  3D4U A;  4UBR A;  1YW6 A;  4C7N A;  1IIC A;  1NTM E;  4PV1 D;  4PJ0 E;  2KLV A;  5AVR B;  1JOC A;  3IFE A;  4H6Z A;  2RC4 A;  1MUU A;  2Z3N A;  4PK3 A;  4XFJ A;  3AEC C;  2YMK A;  3W91 A;  1Z56 A;  2E5T A;  4OAE A;  4PD4 D;  2Q3I A;  1S9K E;  1Y47 A;  4M6H A;  3L70 E;  2ZEE A;  4YTP C;  8CPA A;  3R96 A;  1IFJ A;  4UFW A;  4UWI A;  3FEE A;  1GW4 A;  3VAT A;  1AQT A;  3OA7 A;  3CX5 D;  1LCP A;  3PP5 A;  4A38 A;  3S6F A;  3HD7 A;  2MJZ A;  1IY7 A;  2FYU K;  1PPJ D;  5CBO A;  1KB9 E;  2B87 A;  3KZI E;  3RL0 C;  3BHX A;  3CDX A;  3NFZ A;  1KYO H;  3A0B H;  1VGY A;  3WR7 A;  1GYT A;  3L75 E;  4FUU A;  4AQR D;  1VQL P;  1SFC A;  1L4A B;  4CGL A;  3I5C A;  1IOI A;  2QM7 A;  1ZG7 A;  3FXT A;  5GTH E;  3RK3 E;  1PP9 J;  1KZU B;  4QC6 A;  3OAK A;  2B88 A;  3CCQ P;  1HDU A;  3V38 A;  1IYL A;  2KNC B;  1LGH B;  4WY4 C;  1W2B O;  1LAP A;  2I3C A;  2M3B A;  1NAY A;  4AVA A;  4U9Y A;  1SQQ G;  4OIW A;  4X2T A;  3W67 A;  1TXR A;  1Z9U A;  1GZL A;  1FDM A;  1Y0R A;  1NTK K;  3H1I G;  1URQ C;  4W80 A;  3EC4 A;  2PVV A;  3PH0 A;  2Q3E A;  3GKR A;  1HGV A;  4PXE A;  4NPE A;  1JQG A;  3NE7 A;  3IU1 A;  2JP3 A;  4NGQ A;  2YMY A;  3CL3 D;  3PB7 X;  3D71 A;  1M4L A;  2XNX A;  1RF0 C;  2D2C D;  4CYQ A;  1VQ8 P;  4KOS A;  1MJA A;  5CJ0 A;  1VQM P;  2DEA A;  4GOF A;  4ONU A;  5KJ7 A;  3CC7 P;  1VQ6 P;  3KKW A;  4ZGY B;  3E0K A;  1EDL A;  4NJQ A;  2AJ6 A;  3P2H A;  2BOA A;  3L73 G;  3D6Y A;  2FL4 A;  3ISZ A;  3VP9 A;  5KAI E;  2Q7C A;  5HXD A;  1CW5 A;  3SFE C;  2CNT A;  3M0A A;  4MFQ A;  4RI1 A;  1JY3 P;  4CAE A;  4OC5 A;  3A9L A;  3ZDM A;  1LT1 A;  2R1I A;  6CPA A;  3H1L D;  4WWV A;  5JPH A;  1XTC C;  1N73 B;  1FZF A;  1L0L E;  5B5E H;  3V2P A;  2GRE A;  3N7N A;  2M8R A;  3BI1 A;  4KVX A;  2ZVO B;  1JY2 P;  3FYN A;  1XBU A;  1WMK A;  1FE6 A;  3HD7 B;  2BEZ F;  4P45 A;  1LOK A;  4JJX A;  1BDD A;  1J2J B;  3CX5 E;  4L73 A;  1BLL E;  4PPZ A;  1L0N G;  3TYY A;  2FFD B;  1IYK A;  1N2D C;  1Z8W A;  2EO8 A;  2WSE J;  1JUN A;  2IQ6 A;  1PYT B;  5THW A;  1QVG O;  1N7S D;  1K4J A;  2WTY A;  1BO4 A;  1P84 E;  1QL2 A;  2NPS C;  3JCU H;  1OZH A;  4F8Z A;  4DJG A;  1NTZ E;  2P7J A;  2OTL P;  3LAC A;  3WMM 0;  3PGP A;  1YLE A;  2N1T A;  3H1K J;  4TLF A;  5APW A;  5AW6 B;  3GB0 A;  1URQ B;  1ZR2 A;  3IC1 A;  3R1K A;  4BIN A;  1T8Z A;  3NH5 A;  4AG9 A;  1AJY A;  1PL5 A;  3BJ8 A;  1EDJ A;  2C0X A;  2KS1 A;  1BE3 D;  1FJK A;  3P32 A;  1Q2D A;  1NTZ K;  2QM8 A;  5CCG D;  3BCC E;  1KZF A;  1NE9 A;  4DJL A;  1MFZ A;  1R5L A;  2ZYD A;  1SQB G;  1RY3 A;  2J58 A;  4IFD K;  2JLM A;  2FKW B;  2K1A A;  2IDB A;  5CCH A;  3JCU E;  2IYO A;  1ZLI A;  2Z0Z A;  2ZPA A;  3VP8 A;  4HNW B;  4XA4 A;  1X79 B;  3S6G A;  3A7O A;  1SQP J;  1BCC G;  4HH2 A;  3VN0 A;  2I1J A;  4C7H A;  2REE A;  1BAV A;  5KTA A;  4K3A A;  4UB6 E;  2C6G A;  5CPA A;  1BGY D;  3FH4 A;  4UA3 A;  2B4D B;  4X5K A;  2YXR B;  1YX0 A;  4FBE A;  3DGV A;  2YXQ B;  2NMT A;  2HPC A;  4DZO A;  4D6T J;  3HLP A;  3KPE A;  4LQG A;  1AA0 A;  2PVW A;  1L0L K;  3C8V A;  3Q5P A;  4IFM A;  5AW0 B;  2GLJ A;  1L4A D;  5LYF A;  4AVB A;  3BRV B;  4H89 A;  4U7J A;  2KXP B;  1RE3 A;  3LID A;  2FVG A;  2ZED A;  4TWE A;  4PD4 I;  2VXK A;  1M1J B;  3TNU A;  1YIJ P;  1LTB C;  4WY4 B;  1QLE D;  3RYO A;  1CX8 A;  4KOR A;  1BGY E;  4P4I A;  3HTK B;  4IL6 E;  4CYP A;  1NU1 G;  3D68 A;  5LRK A;  4BRY A;  3W6S A;  4ZBG A;  2N1T D;  1B6B A;  2CNM A;  2Z11 A;  2OTK E;  1I21 A;  2ZW5 A;  4YFJ A;  2Z3O A;  1TKF A;  3AED C;  2XU6 A;  2A06 E;  1Y9K A;  2XDJ A;  3P8C D;  1IID A;  1LNQ A;  2QYV A;  1RF0 A;  3F5H A;  1VL2 A;  1SLQ A;  4PXD A;  2KP8 A;  2LKM A;  3HD7 C;  2C9N Y;  3L71 E;  2H43 A;  2EK9 A;  2ZW6 A;  4EME A;  1N73 C;  1A02 F;  4P4J A;  1SQP D;  4XNH C;  3USS A;  1SFC D;  5A27 A;  1NTK D;  3WU2 H;  2O1K A;  3V2N A;  4GOD A;  1VHE A;  1Q7L A;  3H32 B;  1KYO E;  1R5S A;  1KD1 Q;  4EVY A;  4OWF A;  2P6E A;  4UEE A;  1XIX A;  5ELY A;  5CCH D;  3BCC D;  3H1J J;  4C2Y A;  3B4S A;  1P4N A;  3AE7 C;  4JYW A;  3H5Z A;  1LTA C;  4HKF A;  4A2Z A;  1TKJ A;  1MZ9 A;  2Q6Q A;  3HD7 D;  2PFX A;  1KOR A;  4E2A A;  1NMT A;  2ABZ A;  2ZEN A;  4LC1 A;  3OWC A;  1QSO A;  1SQV D;  3FED A;  5DWM A;  3N4X A;  4ZY2 A;  5BWA B;  1Y7R A;  4PQA A;  5B5E E;  2K3R A;  1IZN B;  3G9R A;  3E1I A;  2JEV A;  1KIL E;  3GF3 A;  4WY4 A;  1H88 A;  1P84 I;  1U57 A;  4ZKU A;  4KOT A;  1N7S B;  3UY5 A;  3CWB G;  3H1L G;  5I0C A;  1ZR4 A;  3U1A A;  3H8E A;  4HJG H;  2OTJ P;  3RBZ A;  3CCJ P;  2ITA A;  1ZG9 A;  2JWA A;  3AEF C;  3BVH A;  1CP7 A;  1YJ9 P;  1AVY A;  1URQ D;  2D4P A;  3MN8 A;  3TE4 A;  4EI2 A;  1RE4 A;  5KAI H;  3LMS A;  1FZG A;  1QSR A;  1KUX A;  5CNP A;  1L4A C;  4BXL A;  2G9D A;  4B13 A;  2QJK B;  1IO4 A;  1PGQ A;  5LRG A;  2OZU A;  4B6Z A;  1UIX A;  2G3A A;  3FX6 A;  3IFM A;  3H1L E;  2V8V A;  3QB8 A;  1IB1 E;  5H86 A;  1KFM A;  2OYI A;  1RXT A;  5BU8 B;  1EZV I;  2OU2 A;  2XEI A;  2O1J A;  2YIU C;  1RF1 C;  4CGO A;  1SQV G;  3PFE A;  1LTJ B;  1KQL A;  1H89 A;  2QG4 A;  3BCC J;  1GTW A;  2B89 A;  4H2K A;  2WSA A;  2YKP A;  2IJZ A;  2PJ5 A;  4L74 A;  2AXC A;  4WB4 A;  4H0L C;  4A31 A;  2XEG A;  3MUD A;  4PXC A;  3RK2 C;  3VH9 A;  1BCC J;  1S3Z A;  1AQ5 A;  4RJT A;  5J1Q A;  4P44 A;  2DW3 A;  1DX7 A;  1YVK A;  3L72 E;  3HE5 B;  4M6I A;  1X9V A;  1USD A;  1FJP A;  2K9Y A;  1Y9B A;  2OYO A;  1HDQ A;  3AE5 C;  2R5B A;  1N7L A;  3SJG A;  4JF7 A;  2E74 B;  5APQ A;  2BO9 A;  4R87 A;  4PD4 E;  3L73 E;  4A94 A;  4CGP A;  3L74 E;  1GD2 E;  3NMD A;  4EWT A;  2WWW A;  4GXH A;  1DTD A;  3TT2 A;  5F47 A;  1J1D B;  1Q2Y A;  2KYV A;  3LW5 H;  4DYO A;  3HE4 A;  2O28 A;  2ZT9 D;  1ELM P;  1X12 A;  4YXW H;  5CCG A;  4AXV A;  2Z3K A;  5D29 A;  4MFK A;  1KMI Z;  1OX3 A;  2A06 D;  3M06 A;  3B3T A;  4B10 A;  3P7K A;  1FZE A;  4U3F D;  5GTH H;  3ISX A;  3H1H G;  3VTP C;  2WPX A;  4KSA A;  4UCN A;  2FS5 A;  1Q7Y Q;  4UCM A;  2FXM A;  3PBB A;  1SQX E;  5AVV B;  5AVZ B;  4OGQ C;  1K73 Q;  2M5A B;  3EQ2 A;  2YIU B;  3FB3 A;  2FXO A;  2QJY B;  3KQX A;  3QNV A;  3TF5 A;  2F5I A;  1ZRT D;  1QVF O;  2WZN A;  2OGU A;  1JCD A;  2QSI A;  5AW2 B;  1BPM A;  1YTZ I;  3U59 A;  1S5K A;  4O23 A;  3L75 G;  1SQV K;  4U3F J;  1SFC B;  3TO6 A;  4IUS A;  3RNZ A;  2H8P D;  2Q51 A;  1JTH B;  1KTM A;  1K9M Q;  1ZLL A;  4PD4 H;  2PRR A;  5F09 A;  4C68 A;  2Y0E A;  3NE8 A;  2WUU A;  2CF4 A;  4CRY B;  3WUV A;  3H8G A;  2GFQ A;  3KZW A;  3G4S P;  2OYI B;  1S3J A;  1EZV G;  4MY3 A;  3M9H A;  3AE6 C;  4Y28 J;  3NXS A;  2R3S A;  3KHX A;  4E8O A;  2WVR A;  2R8V A;  2Q4Z A;  1NTK G;  5GTI H;  1WT6 A;  3B5N D;  3CPW O;  3H4Q A;  1X8Y A;  1NHL A;  4CGM A;  1FZB A;  3L35 A;  5KAF H;  1NU1 E;  1E5W A;  3MIW A;  1LTS C;  3N7Z A;  1U7J A;  1M4D A;  4IAV A;  1W5C E;  1AVO A;  4F0Y A;  3RGU A;  3I55 P;  1IK9 A;  3AEA C;  4H44 B;  1NO4 A;  3D3S A;  4DOJ A;  1NJI Q;  5C82 A;  4NGM A;  1OBR A;  2H5M A;  1NU1 J;  2AFX A;  3S9L A;  1GW3 A;  2K37 A;  4LX9 A;  3P8M C;  1SQP E;  3A0H E;  3L70 G;  5AG4 A;  2PCU A;  2RB7 A;  2M5A A;  1FY7 A;  5A28 A;  1YYC A;  3GW6 A;  5B66 H;  3S4R A;  3HUS B;  3R4Y A;  1KWM A;  2Q43 A;  3AE1 C;  3PFO A;  2FYN C;  2B4B A;  4KLW A;  1GL2 C;  5FVJ A;  1NU1 D;  3CD6 P;  5AW8 B;  5AVX B;  4FD6 A;  1IFI A;  4JPZ B;  4OVN F;  2L5G B;  3PRT A;  2VZY A;  3GHG B;  2PIY A;  1RH5 B;  1SQH A;  1YQ4 C;  1AV1 A;  3L73 D;  4UIA A;  3JSV C;  1BE3 J;  1U7M A;  3IJ3 A;  1M90 Q;  2IMO A;  1ZN5 A;  4NGN A;  1NYH A;  4B86 A;  1ZME C;  2W90 A;  3MGN A;  3DSB A;  3KZI H;  3HTK A;  2E74 D;  4W7Z A;  3H1H E;  3BLN A;  4TNU A;  3CCM P;  3IGR A;  4R4M A;  4UFX A;  5M1B A;  2BCC E;  1IFN A;  2Q4Y A;  1Z8L A;  3RBX A;  4FAI A;  1HVV A;  5HMN A;  1T2K D;  5KKZ B;  1M1K Q;  2QIR A;  1ZOY C;  1PIX A;  1X22 A;  2E75 D;  3D6Z A;  2HUZ A;  1YRE A;  4IL6 X;  3GHG A;  1L0N E;  1H8A A;  1GU4 A;  3EFA A;  1YQ3 C;  4R8F A;  3L74 G;  3QWO C;  1KUY A;  1M4G A;  3PB9 X;  2C0W A;  2C1C A;  4KVO E;  3FXE A;  5AVT B;  3RL0 B;  5KLI C;  1IOF A;  1JNM A;  5AW3 B;  1ON0 A;  1M1J A;  2ZJS E;  2WQY C;  3S9M A;  2WSS H;  1EDI A;  2AEM A;  3B7I A;  3KAS A;  2NPS D;  2QJY C;  4BWN A;  3H8F A;  2E76 B;  2FYN B;  3WUU A;  2PR1 A;  1KIL A;  2LXB A;  3V4Q A;  1Z8T A;  2I00 A;  1VQN P;  2I8D A;  2PJB A;  2CK3 H;  2WPQ A;  3D70 A;  2FY8 A;  2QML A;  5KTD A;  5G21 A;  1L0L D;  4HNX B;  4UB6 H;  7CPA A;  2YO2 A;  3WC5 A;  4B12 A;  3TDK A;  4U3F G;  1XTG B;  2P58 A;  1XMB A;  3B3C A;  4KOV A;  4UEF A;  1OFC X;  4CPA A;  4AUW A;  2KB7 P;  1NTM J;  1RF1 B;  3K5B A;  2PJ0 A;  4JZ0 A;  1A02 J;  3FVL A;  3KR4 A;  3S6H A;  1VQO P;  1J1D C;  4KSI A;  2QJP B;  4MXU A;  3B5N C;  1CPX A;  1OW8 A;  4IHM A;  2CTB A;  2B5G A;  3FRM A;  1L0L J;  2PQ8 A;  3PBE A;  4JXQ A;  1Q2N A;  3FMC A;  1G1J A;  2P6G A;  2AE6 A;  4ZKP A;  5IB0 A;  4UWJ A;  2KS1 B;  3M0D C;  3B5N B;  4EYY Q;  4F9U A;  1YSJ A;  2QE7 H;  1BCC E;  1SQV J;  2BAS A;  1XOV A;  4PSX A;  2V8D A;  2D2C C;  1H0T A;  3H1K G;  1HH0 A;  1SS1 A;  5CHX A;  2JBK A;  2Z3L A;  2A45 H;  2HOD B;  3L75 J;  2A45 I;  5LYI A;  3EWK A;  3DDD A;  4UB8 H;  1LT9 C;  2K9J A;  2YNC A;  4HB1 A;  3CCU P;  2D4O A;  3QAH A;  5K8O A;  1NTZ J;  1GK6 A;  1SQV E;  3NFQ A;  5I4M A;  5JH9 A;  1B87 A;  5K8M A;  3P8C E;  3VMX A;  3H1K E;  4N78 E;  4MCQ A;  1JMB A;  4CPG A;  5AG7 A;  4OGQ D;  3VMA A;  1IC2 A;  4H0L D;  2XKM A;  2EWB A;  2P6F A;  1VF5 B;  2W6B A;  2WT7 A;  1NH4 A;  4HYT B;  1VQ7 P;  4K35 A;  1JCC A;  5AW4 B;  5AVY B;  1HF9 A;  3LOD A;  1BCC D;  3D66 A;  3NTN A;  3SSU A;  4MMO A;  3SWY A;  1H0T B;  2PDO A;  4MCR A;  3CCV P;  1KN7 A;  2JR8 A;  3K2K A;  2GUS A;  1PP9 D;  3ZJ0 A;  4GDO A;  4BMH A;  5IX3 A;  3GY9 A;  2C27 A;  3L74 J;  1YTZ T;  3H1H D;  3K9T A;  1IFD A;  3L71 G;  1F57 A;  3TOB A;  3MRU A;  2QVP A;  3M9Q A;  2KUB A;  2PRQ A;  4DUK A;  2IZ0 A;  2O4H A;  5F46 A;  2FBW C;  5BU5 A;  1BE3 E;  2VEZ A;  4Q7A A;  1ZXG A;  2C6P A;  2NYQ A;  1XEB A;  4A32 A;  1PPJ E;  1F2P A;  2JO1 A;  2YO3 A;  3FBU A;  4NPF X;  1L0N D;  1CBX A;  4OH8 B;  2GLF A;  1MKM A;  3L75 D;  3A5T A;  1OZP A;  3RZA A;  2O01 N;  3GHG C;  4A37 A;  1HUC A;  2QJP C;  1T6A A;  3KDP B;  2Q0Y A;  3KYQ A;  2HLO A;  2Y0C A;  1KB9 I;  2R32 A;  4A7P A;  2ZEO A;  2I79 A;  1M1J C;  4NGR A;  1FBM A;  2L91 A;  2WSF J;  5APX A;  1ZP0 C;  3EXN A;  3JRU A;  4L8A A;  2WSC H;  4D6T D;  1KIL D;  1L0N J;  4KVM E;  4CYN A;  3D7G A;  3CXP A;  4KS9 A;  1JB0 J;  1LAN A;  5KTC A;  1GL2 A;  2GIV A;  1SQP G;  2RKL A;  1KV4 A;  2XV5 A;  4DNC A;  4UFV A;  2V4H A;  2EBJ A;  4CAW A;  1VDF A;  2JDC A;  5APS A;  2GE3 A;  4IK2 A;  5IB9 A;  4WBA A;  4R6T A;  3CI9 A;  1PPJ G;  1QSN A;  3GLM A;  1UFH A;  4NPD A;  2BEQ D;  2WZ7 A;  1ZG8 A;  3V4W A;  3TO9 A;  5ISV A;  4MCS A;  2KCW A;  1BGY G;  1FZC A;  4RKU J;  3L37 A;  2OR4 A;  3D2M A;  3L4F A;  3HUV A;  4WWI A;  4H13 C;  4NEX A;  1YBK A;  5KLV E;  3CLQ A;  1FT7 A;  3D7H A;  3U1C A;  2N1T C;  1FZA A;  2PJ9 A;  2B3V A;  3GG2 A;  4ZY0 A;  1I12 A;  4PV6 A;  3CWB J;  4UEZ A;  1L2P A;  5APY A;  3FGA D;  2GAN A;  1HEE A;  4DT0 A;  1CI6 A;  4X8I A;  4MCP A;  4QB9 A;  4F0X A;  2IPP A;  1I1D A;  5K8P A;  2V7Q H;  2WMM A;  4NXY A;  5APV A;  1RQU A;  2F8H A;  4JQ0 D;  1SQP K;  2Y9Y A;  2P1J A;  3CWB E;  5J8F A;  4KOX A;  4EOT A;  2M3E A;  1KIL C;  1S5L X;  4ASW A;  3W6X A;  2AFM A;  1XFO A;  1KQF B;  1DIP A;  2V77 A;  4C2Z A;  1CPS A;  3TGU J;  3DR6 A;  4EIJ A;  3FX0 A;  1XRY A;  2PJ1 A;  1EQ7 A;  3FJU A;  3SI1 A;  5JQ4 A;  1V0C A;  3ABV C;  3CXH H;  3O8Z A;  3JUW A;  2NSM A;  4H0L B;  1QST A;  3BRT B;  3S9N A;  3CC2 P;  4OME A;  3L72 J;  1YME A;  1Z5R A;  4HKZ H;  1S7L A;  1BSH A;  1TKH A;  2PR8 A;  3D67 A;  2Q5U A;  2QIW A;  2WSC J;  3TGU E;  2BEI A;  3H1L J;  5KJ7 D;  4JYB A;  3L73 J;  2J59 M;  3B5N A;  2CXA A;  1X0T A;  1XMT A;  1QGK B;  3T97 A;  3B2Y A;  3Q1M A;  4MRI A;  1KB9 H;  4KZT A;  4UCP A;  3S9O A;  2G0B A;  2JWD A;  4GKG A;  2EVN A;  5AVU B;  3O6Q A;  3B3S A;  5E79 E;  1P84 H;  2XND H;  3RK2 D;  1DEE G;  4Y49 C;  2Q9I A;  1YI2 P;  1FOS E;  4AG7 A;  2GA1 A;  5APU A;  1M56 D;  4MFP A;  2EUI A;  1YW4 A;  1S1C X;  1Y9W A;  3QAY A;  1N71 A;  4R9M A;  2YKO A;  2VBQ A;  3KL9 A;  3LW5 J;  1SQX K;  3TOA A;  4OKO A;  1ELL P;  1G1I A;  1LTJ A;  1L0L G;  1D7M A;  3SWF A;  1S7F A;  4OP4 A;  4XPD C;  4H13 B;  2A06 G;  1SQX G;  1EZV D;  1SQQ D;  3HUS C;  1BE3 G;  4E0A A;  3CX5 H;  5AW1 B;  3KI9 A;  5BVZ A;  2ZOG A;  2B87 B;  2PJ4 A;  5JGF A;  3D2P A;  3VMY A;  1SFC C;  4OID A;  3TTH A;  2HC9 A;  2XEF A;  1RE3 C;  1FAV A;  1HWT C;  2GU2 A;  2M0B A;  3K9U A;  4MBU A;  1CI6 B;  4CRZ B;  3CT9 A;  3L2N A;  2Q1K A;  3IR9 A;  2CPB A;  1A2Z A;  4BBH A;  2PJ3 A;  2AEF A;  1J1E C;  2AFW A;  2R3C A;  1QEX A;  2DPS A;  3CXS A;  3AE8 C;  4I6M C;  2AFZ A;  3IF4 A;  2ZW7 A;  1FS0 E;  1LTI C;  3II6 A;  3Q5R A;  2IBZ G;  4QVT A;  3L72 G;  4OC3 A;  2IFM A;  5GTI E;  1NTM K;  3IU2 A;  1SQQ E;  1FZC B;  1RTQ A;  1Q86 Q;  3QH9 A;  3E1R A;  1NTM G;  4YXD C;  4KJM A;  3OJA B;  1LAM A;  1KC8 Q;  2OYI C;  1GL2 D;  1JY2 O;  1SQB K;  2ZW4 A;  1Y7E A;  1JMM A;  2N9B A;  3IWE A;  3S1K A;  4NGP A;  3HE5 A;  1SP4 A;  2ZXV A;  1R3N A;  5K5G B;  1Z8X A;  1S72 P;  1Q81 Q;  1TF8 A;  4DCK A;  2PJC A;  4CGN A;  5H2F E;  1L4A A;  5CMZ A;  2CNS A;  3PB6 X;  2OYH B;  4ASV A;  1RHZ B;  2J5U A;  2FYU J;  1Z4R A;  2HR3 A;  1NWQ A;  1IFP A;  2PJA A;  1LTT C;  5LYD A;  2KSE A;  4M3S A;  2UWJ E;  4IOI H;  1RO5 A;  2Z10 A;  4I49 A;  1PP9 G;  3EO4 A;  1DD4 A;  1QQ9 A;  4ORF A;  1KB9 D;  2ZEP A;  2W83 C;  4TT3 H;  4EDF A;  2BCO A;  1NU1 K;  1YR0 A;  3L71 D;  5EMI A;  4CYO A;  4R3K A;  3SJF A;  1Q2C A;  2LXC B;  2QVA A;  2POK A;  3F0A A;  2C9L Y;  1K05 A;  4A33 A;  3V6I A;  1R8E A;  4JD6 A;  4M85 A;  4GM5 A;  4MI4 A;  1NTK J;  3CPA A;  4H44 C;  4LLH A;  3SI2 A;  4B5P A;  5JM6 A;  4MHD A;  1T3J A;  2ZT9 B;  3DR8 A;  2IFN A;  3AE4 C;  3MP7 B;  4CAX A;  2IZ1 A;  2OH1 A;  1ZLH A;  3AE9 C;  3H1H J;  4PV1 C;  2BL1 A;  2FCK A;  3R9F A;  3CXQ A;  1SQX J;  5G20 A;  1NTK E;  5DJU B;  2REF A;  2FXP A;  3V2Q A;  2XZR A;  1IFM A;  5KKZ C;  1NTZ D;  1LP1 B;  1QX8 A;  4Q38 A;  1URQ A;  1YHQ P;  1KYO D;  4HNY B;  1BGY J;  1N7S A;  1CM0 A;  1RE4 C;  1NSL A;  3RK3 B;  4JWP A;  4GOE A;  3D8P A;  4NFR A;  2D2C B;  5B66 E;  3WT4 A;  5J8C A;  4I1L A;  1YVO A;  4OC0 A;  1WK4 A;  2ANP A;  1NSA A;  4MHP A;  2GUV A;  4AB7 A;  4OC1 A;  2H89 C;  4ZMD A;  3C26 A;  3RAM A;  2FYU D;  4PJ0 H;  1YQE A;  4FD4 A;  2PGD A;  2RMZ A;  5C88 A;  1KQG B;  3BXM A;  1MFT A;  1Y8A A;  2DPT A;  2XEJ A;  2Z5H A;  3WC7 A;  4KSF A;  1VIX A;  3R2P A;  4FD5 A;  4YGO A;  4B11 A;  1QSM A;  3T8W A;  3MUD C;  3TSI A;  2PRB A;  4GT1 A;  1M44 A;  1CSB A;  3L74 D;  3BAS A;  4R57 A;  5AVS B;  2Y9Z A;  4IFF A;  2FXF A;  1WRG A;  3GIU A;  4L76 A;  1M1D A;  1G2C A;  4UF4 A;  1HTL C;  3RO0 A;  3H1I J;  3IO1 A;  3LD2 A;  5K8N A;  2KLU A;  2B9B A;  3A3Y B;  2HOD A;  1H8L A;  1GHE A;  1AUG A;  2Q44 A;  2ZT9 C;  2Y0D A;  3PZJ A;  3Q5S A;  2ZYA A;  4HPS A;  4J3G A;  3H1K D;  1USE A;  3Q2Y A;  2WPS A;  3PB4 X;  3FNC A;  2WSF H;  1SQB J;  1AYE A;  4H6U A;  3AEE C;  3I9S A;  4K3N A;  3CCS P;  1SQX D;  3T9Y A;  2AXT H;  2ZXE B;  2PJ2 A;  1VQP P;  1BOB A;  2HQY A;  2J8R A;  3DLJ A;  3KQZ A;  2MKV A;  4L75 A;  3RK3 C;  1KUV A;  2IBZ E;  3I56 P;  1VQ4 P;  2OZG A;  4H44 D;  2V8G A;  1CJW A;  3R9G A;  3UIA A;  2N9Y B;  1S4X A;  3MZW B;  1OW7 A;  4B5O A;  1L0N K;  3M0D A;  1GMJ A;  3I3G A;  1PP9 E;  3IN6 A;  2QJ8 A;  3CXH D;  2HV2 A;  4C7R A;  2LR2 A;  3TNU B;  5AG5 A;  4GIF A;  5LYL A;  1GL2 B;  2P0W A;  4X3R A;  3WUT A;  4YU9 A;  2DF5 A;  5AVQ B;  2HYN A;  1NKZ B;  5AG6 A;  3M9B A;  2A45 G;  4G1P A;  1G2C B;  1JO5 A;  3A0H H;  3C9I A;  3FF3 A;  1GDT A;  1S5L E;  5KLV G;  1S2E A;  2KNC A;  5H2F H;  3V2R A;  5E96 A;  2Z3P A;  3F5B A;  3GYA A;  3AE3 C;  4P10 A;  4Q36 A;  1MJB A;  1M4I A;  1IGB A;  3VYI A;  5CCH C;  2CTC A;  4NSQ A;  2JDD A;  4OC4 A;  4PSW A;  2O53 A;  1DH3 A;  4XPL A;  3CCE P;  1NTM D;  2K9J B;  2OZH A;  1JY3 N;  5AW5 B;  1XJO A;  3R95 A;  4JLY A;  1AMP A;  2CY2 A;  2E75 C;  1EXJ A;  2IL4 A;  2JEW A;  1FDI A;  2J8M A;  2R5D A;  3M91 A;  3SWK A;  2KI7 B;  3I1U A;  4R76 A;  1OVR A;  1T3U A;  3JTK A;  1NKN A;  1CP6 A;  1LP1 A;  4NF1 A;  4ZNC A;  1IK7 A;  2OB0 A;  4RS2 A;  1LT9 B;  2ARH A;  2ZEG A;  2JEE A;  3D7F A;  4WY4 D;  1S7N A;  1AFO A;  3B8E B;  1W2E A;  3TO7 A;  2KSJ A;  2ZOF A;  1Q82 Q;  2OAR A;  2KOG A;  4N3Y B;  3W68 A;  4JBZ A;  2N1T B;  3SXN A;  3G71 P;  3T90 A;  5LRJ A;  1VQ5 P;  2EK8 A;  1OVV A;  3AEB C;  1PFI A;  5G22 A;  1FU1 A;  5G1Z A;  4MHN A;  5EFW B;  2AFS A;  2F7V A;  4C7I A;  2KZJ A;  1P0H A;  2ZEM A;  5HVG A;  1R57 A;  4IL6 H;  3T97 B;  3TGU D;  3RK3 D;  1EDK A;  2FT0 A;  2YNE A;  3VAR A;  1UWY A;  4XPD B;  1HJ0 A;  1BDC A;  4JYC A;  2ZYG A;  5APT A;  1VQ9 P;  1BSN A;  3VWE A;  1OVU A;  4P4D A;  3AEG C;  2B58 A;  2G8Y A;  1ARM A;  4Y99 B;  1QMU A;  4UB8 E;  1LWU A;  1VKC A;  3CMA P;  4OLL A;  2POH A;  2W6J H;  2NZ2 A;  4P4B A;  1Q90 D;  3FWL A;  3RBU A;  2ZEL A;  4JXR A;  1TU3 F;  3CCL P;  2KIK A;  1X10 A;  2V8H A;  2O3J A;  2BSW A;  1N73 A;  1SQQ J;  5TIS H;  2JBJ A;  4Y99 C;  2OYH A;  4KLV A;  4RN7 A;  4R4L A;  3B3W A;  4MFZ A;  3LIE A;  1K8A Q;  4A95 A;  2QJK C;  4OC2 A;  1PGO A;  2KZI A;  3DNS A;  3BAT A;  3H25 A;  3P2F A;  2P10 A;  3CZX A;  1BPN A;  2HPC B;  1RQV A;  3EFG A;  4AVC A;  2Z4E A;  1KFN A;  1DE4 C;  5AW7 B;  3O6Q B;  3H1J E;  3HE4 B;  3ZZI A;  1WWZ A;  4EFD A;  4ZYQ A;  3TCV A;  2BUE A;  3TGU G;  3B35 A;  5D8N A;  1T2K C;  1E79 H;  3S6K A;  1NAF A;  4BRY B;  3KR5 A;  2AXT E;  5HH1 A;  1OXZ A;  4Y49 B;  2JKV A;  1L0C A;  4B14 A;  3BCC G;  2FFD C;  3MGD A;  2E76 C;  1QL1 A;  3CXH E;  1OIP A;  1LT9 A;  2IBZ I;  1PUA A;  2PE3 A;  3VWD A;  4U9Z A;  4FWU A;  4N6J A;  2IX7 C;  5IV0 A;  1IJD B;  2E42 A;  2E74 C;  2Q4V A;  5C39 A;  2CIJ A;  5E79 H;  2PP6 A;  1DEB A;  1N7S C;  1MV8 A;  2R98 A;  2JJL A;  2QEC A;  4U5Y A;  4MFJ A;  4WVZ A;  3D7D A;  3H1J G;  4QBJ A;  2WPW A;  3PTZ A;  1TIQ A;  1NVO A;  2FYU E;  4OGQ B;  4RES B;  3F8K A;  2WYR A;  4P4E A;  3PJS K;  1FC2 C;  4Z65 A;  1P84 D;  2KK7 A;  4C46 A;  4KUB A;  4XPK A;  1VF5 D;  4A39 A;  4M3L A;  2ZFC A;  3CX5 I;  2OQQ A;  5EBV A;  4GS4 A;  2PJ8 A;  2WSE H;  1S9K D;  3AE2 C;  3FEC A;  1S7K A;  1OW6 A;  5KLV K;  2YND A;  1EC5 A;  3WC6 A;  3PHL A;  3JVN A;  1LTG C;  3L71 J;  2RH0 A;  3F89 A;  3HRN A;  3CCR P;  1PZQ A;  2VI7 A;  2HG5 D;  3V5B A;  1CG2 A;  3PRJ A;  5DWN A;  3PLN A;  4D6T G;  4PXB A;  4BD9 A;  3WAB A;  3SJX A;  4II9 A;  3IWG A;  1YJN P;  5GCN A;  4R3L A;  1S5L H;  2VL1 A;  3CPX A;  1HJB A;  3E7K A;  1PV3 A;  4QMA A;  3V7Z A;  3NH8 A;  5L8R J;  3TC8 A;  4MHZ A;  1PGJ A;  2ODF A;  5HVF A;  4MY0 A;  4P6Y A;  1J1E B;  1MJ9 A;  1DD3 A;  4Z1M H;  1PCA A;  2YNC C;  2Y0M A;  2PJ7 A;  1F2O A;  4NGS A;  4KUA A;  2W6A A;  1PU9 A;  2GM4 A;  4N78 D;  1FOS F;  4RUH A;  1GU5 A;  2ZEH A;  1KIL B;  1NOH A;  5H84 A;  1IU8 A;  1JTH A;  4P4F A;  1LWU C;  3SXO A;  4CAF A;  1EE3 P;  3PEI A;  3SI0 A;  5KTB A;  3IEH A;  3EY5 A;  2W27 A;  2WT7 B;  3OW2 O;  1XE4 A;  2V7Q J;  5TJH A;  3PB8 X;  5DS0 A;  1JEK A;  4KOW A;  2H7H A;  3TX8 A;  1YIT P;  3A0B E;  1JM0 A;  1PGP A;  3C1L A;  3L72 D;  5CBM A;  2R7H A;  2B4D A;  2Z5I A;  3BJ7 A;  1Z4E A;  3CME P;  4MJ8 A;  2PC1 A;  4YPC A;  1HBW A;  1KYO I;  3IIB A;  2HB6 A;  4CS0 B;  2ZEF A;  2Q7B A;  4XNH B;  1K04 A;  4MN4 C;  3B8G A;  3KXD A;  4CAV A;  2AEJ A;  2AFU A;  3TFY A;  4LUA A;  3A2A A;  1R43 A;  5KLV J;  1S60 A;  1YJW P;  2FIW A;  3LWU A;  2A4N A;  1ARL A;  1YK3 A;  4PV1 B;  3CC4 P;  5CJ4 A;  4LGD E;  3KHU A;  3RL0 g;  3BI0 A;  3SFD C;  3L70 J;  4W9Y A;  3G3S A;  2FSR A;  4OAD A;  4KT0 J;  5KLV D;  2VZZ A;  2ZXX A;  3V8I A;  3KQG A;  3CXH I;  2Z3M A;  2B3U A;  1ZW0 A;  1Z2L A;  3GUX A;  2FYZ A;  2Q7S A;  4B5P B;  1XF8 A;  2O01 H;  3VMZ A;  3KHZ A;  3FXD A;  4PK2 A;  2HFE D;  2OOT A;  1TF9 A;  4ONW A;  1RF1 A;  3H1I D;  2FIA A;  1UII A;  3CWB D;  2IYP A;  3PP9 A;  1ZV8 A;  2C6C A;  5F48 A;  4I7Z B;  4K30 A;  1VF5 C;  1VHS A;  2QA4 P;  2K5T A;  3GF7 A;  2QRX A;  1J4J A;  1Y0Y A;  1MK4 A;  4WJB A;  2P67 A;  3H32 A;  2OYH C;  1LWU B;  3N5F A;  1SQB D;  4ZX8 A;  3G3Z A;  2JDI H;  1EZV E;  1M7L A;  3Q3D A;  1VPC A;  2E5Y A;  5EC4 A;  2FE7 A;  2ZVN B;  2X7B A;  5F49 A;  1NTZ G;  3MD0 A;  2RN0 A;  1N8R Q;  1U6M A;  4NCZ A;  2NPS A;  3KGQ A;  5HVH A;  1SVF A;  2CPS A;  3B3V A;  1M8O B;  2QEX P;  2SPZ A;  1YGH A;  2B5G B;  4I2L C;  3GLJ A;  1SQQ K;  2O01 J;  1YLO A;  5DJT B;  4F6A A;  4IF5 A;  4ZI6 A;  5AVW B;  3TK1 A;  2WPV B;  4KHX A;  3H1J D;  1FZC C;  4M6G A;  4C7N B;  2PSW A;  4W7Y A;  2PIZ A;  2WPR A;  3L70 D;  5CCG C;  3SJE A;  4KOU A;  3RK2 B;  1N86 A;  4YRH A;  2BCC D;  4C2X A;  4U3F E;  2VRS A;  4R7M A;  1ZO0 A;  2FFD A;  1OWA A;  3G8W A;  1VHO A;  4D6T E;  2J9A A;  2WIT A;  3JC2 2;  1CZQ A;  2P2U A;  5TIS E;  5KJ7 C;  3GMA A;  4MFL A;  1LRZ A;  2J8N A;  2Q04 A;  2AFO A;  4AYC A;  2YKQ A;  3WU2 E;  1FNO A;  3MHV A;  3IWW A;  1LFW A;  1OMI A;  4H13 D;  3R9E A;  2BCC J;  1EXI A;  2E75 B;  1GK4 A;  3ITK A;  5AW9 B;  2RFH A;  4UIB A;  1JWQ A;  4ZX9 A;  2VQY A;  4A30 A;  5AGE A;  2IBZ D;  4RO0 A;  2K88 A;  4O9B A;  1KQS O;  3RL0 D;  3NH4 A;  1LTJ C;  2PAJ A;  3FWN A;  4LQ6 A;  2NPS B;  3H6P A;  4I7Z C;  4KOY A; 
#chains in the Genus database with same CATH homology
 5KTC A;  4A31 A;  2H88 C;  2E76 D;  2DXQ A;  2GIV A;  4XPL A;  1S3Z A;  2G3T A;  4DNC A;  2OZH A;  3R95 A;  1YVK A;  4JLY A;  4UFV A;  4FD7 A;  3IAO A;  2CY2 A;  2K9Y A;  2E75 C;  4CAW A;  1EXJ A;  1Y9B A;  2IL4 A;  2JDC A;  1FDI A;  2GE3 A;  3FIX A;  3AE5 C;  2J8M A;  2ATR A;  1QSN A;  2E74 B;  3GLM A;  1UFH A;  3JTK A;  4R87 A;  2BEQ D;  4NF1 A;  3B71 A;  3TO9 A;  4CGP A;  5ISV A;  4L89 A;  3TT2 A;  1IK7 A;  2OB0 A;  5F47 A;  2YGW A;  4RS2 A;  3SHP A;  2ARH A;  1Q2Y A;  2KCW A;  1S7N A;  1NGM B;  4RKU J;  4QUS A;  1ZRT E;  3TO7 A;  3D2M A;  2O28 A;  2ZT9 D;  4H13 C;  1FDO A;  4UBR A;  4NEX A;  1IIC A;  4PV1 D;  3SXN A;  2Z3K A;  4MFK A;  3T90 A;  4H6Z A;  1KMI Z;  3AEB C;  4B10 A;  2RC4 A;  5G22 A;  5G1Z A;  2Z3N A;  2B3V A;  4C7I A;  4PK3 A;  1P0H A;  4XFJ A;  1R57 A;  3AEC C;  2YMK A;  1I12 A;  2WPX A;  4PV6 A;  3W91 A;  4KSA A;  3T97 B;  4UCN A;  2FS5 A;  4OAE A;  2FT0 A;  3FGA D;  2GAN A;  2YNE A;  4UCM A;  4XPD B;  1HJ0 A;  4OGQ C;  4YTP C;  3R96 A;  4QB9 A;  3FB3 A;  4UFW A;  4UWI A;  3VWE A;  4F0X A;  1I1D A;  3AEG C;  2B58 A;  2G8Y A;  2F5I A;  4NXY A;  1VKC A;  3S6F A;  4OLL A;  1RQU A;  2QSI A;  2NZ2 A;  1Q90 D;  4JXR A;  1TU3 F;  1S5K A;  4KOX A;  5J8F A;  1S5L X;  3W6X A;  3TO6 A;  2BSW A;  4IUS A;  3WR7 A;  1KQF B;  1DIP A;  4KLV A;  4C2Z A;  3DR6 A;  4R4L A;  4MFZ A;  4CGL A;  4A95 A;  2QJK C;  3DNS A;  3H25 A;  1KTM A;  3FXT A;  3P2F A;  3RK3 E;  5JQ4 A;  1V0C A;  2P10 A;  3ABV C;  3JUW A;  4C68 A;  1RQV A;  4QC6 A;  4H0L B;  1QST A;  2WUU A;  4AVC A;  1IYL A;  4CRY B;  1S7L A;  2PR8 A;  2QIW A;  2WSC J;  4AVA A;  4U9Y A;  2BEI A;  3ZZI A;  1WWZ A;  1Z9U A;  4MY3 A;  2CXA A;  3AE6 C;  3TCV A;  4Y28 J;  1XMT A;  2BUE A;  3EC4 A;  4E8O A;  2R8V A;  3S6K A;  3Q1M A;  3GKR A;  4KZT A;  4UCP A;  3S9O A;  3NE7 A;  3H4Q A;  2G0B A;  2EVN A;  2JP3 A;  3IU1 A;  4CGM A;  3O6Q A;  5HH1 A;  3D71 A;  2D2C D;  4Y49 B;  1L0C A;  4KOS A;  4B14 A;  4CYQ A;  3N7Z A;  3MGD A;  1MJA A;  2E76 C;  1M4D A;  4Y49 C;  4AG7 A;  1PUA A;  4ONU A;  4U9Z A;  3VWD A;  3KKW A;  4ZGY B;  3E0K A;  5IV0 A;  2AJ6 A;  3P2H A;  4F0Y A;  3D6Y A;  2FL4 A;  4MFP A;  2EUI A;  2Q4V A;  2E74 C;  3AEA C;  1S1C X;  4H44 B;  1Y9W A;  3D3S A;  1N71 A;  5C82 A;  4R9M A;  2H5M A;  3SFE C;  2CNT A;  2R98 A;  2VBQ A;  3LW5 J;  2QEC A;  4U5Y A;  4MFQ A;  4RI1 A;  4MFJ A;  4CAE A;  3TOA A;  3A9L A;  4LX9 A;  4QBJ A;  2WPW A;  1S7F A;  1TIQ A;  4XPD C;  4H13 B;  5AG4 A;  4OGQ B;  2R1I A;  3F8K A;  5JPH A;  1FY7 A;  5A28 A;  4KUB A;  4XPK A;  1VF5 D;  4E0A A;  3R4Y A;  3AE1 C;  4KVX A;  2OQQ A;  5EBV A;  4GS4 A;  3D2P A;  2FYN C;  3FYN A;  2B4B A;  4KLW A;  1WMK A;  3AE2 C;  2BEZ F;  5FVJ A;  1S7K A;  1OW6 A;  2YND A;  4JJX A;  3TTH A;  4FD6 A;  3K9U A;  2VZY A;  4MBU A;  3JVN A;  1SQH A;  4CRZ B;  1YQ4 C;  1IYK A;  4BBH A;  2VI7 A;  2WSE J;  2DPS A;  1K4J A;  5DWN A;  3CXS A;  1BO4 A;  3AE8 C;  1NYH A;  2ZW7 A;  1ZME C;  3DSB A;  3Q5R A;  3PGP A;  1YLE A;  2E74 D;  4QVT A;  4I7Z C;  3BLN A;  4II9 A;  3IWG A;  3IGR A;  5GCN A;  4R4M A;  3IU2 A;  4UFX A;  4R3L A;  5M1B A;  3R1K A;  2Q4Y A;  4AG9 A;  1AJY A;  1PL5 A;  3BJ8 A;  5HMN A;  4YXD C;  1PV3 A;  2QIR A;  5L8R J;  1ZOY C;  1Q2D A;  1PIX A;  2ZW4 A;  4MY0 A;  2E75 D;  3D6Z A;  2HUZ A;  1YRE A;  4IL6 X;  1KZF A;  1MJ9 A;  1DD3 A;  1NE9 A;  3IWE A;  3EFA A;  4Z1M H;  1YQ3 C;  2YNC C;  2Y0M A;  4KUA A;  2ZXV A;  1PU9 A;  2JLM A;  1KUY A;  1M4G A;  2IDB A;  4HNW B;  4KVO E;  2Z0Z A;  2ZPA A;  4CGN A;  5KLI C;  5H84 A;  1ON0 A;  2CNS A;  2WQY C;  4CAF A;  3SXO A;  3S6G A;  2J5U A;  1Z4R A;  3EY5 A;  2QJY C;  2REE A;  4C7H A;  1XE4 A;  2V7Q J;  5KTA A;  2E76 B;  4M3S A;  4UA3 A;  2PR1 A;  1RO5 A;  2Z10 A;  4I49 A;  4KOW A;  2B4D B;  3EO4 A;  4X5K A;  1YX0 A;  1DD4 A;  2I00 A;  2NMT A;  2R7H A;  2B4D A;  4ORF A;  2QML A;  3D70 A;  3BJ7 A;  1Z4E A;  4MJ8 A;  4TT3 H;  5KTD A;  3C8V A;  5G21 A;  3Q5P A;  2PC1 A;  4HNX B;  1YR0 A;  4B12 A;  4CYO A;  4R3K A;  4CS0 B;  2Q7B A;  4XNH B;  1Q2C A;  1K04 A;  4AVB A;  3B8G A;  3F0A A;  4H89 A;  4U7J A;  4CAV A;  1K05 A;  3TFY A;  4LUA A;  4KOV A;  4A33 A;  1R8E A;  4M85 A;  4JD6 A;  4MI4 A;  1S60 A;  4H44 C;  2VXK A;  4B5P A;  3S6H A;  2FIW A;  4MHD A;  3RYO A;  4KOR A;  4CYP A;  2ZT9 B;  2A4N A;  3DR8 A;  1OW8 A;  1YK3 A;  3W6S A;  3AE4 C;  4ZBG A;  4PV1 B;  1B6B A;  2CNM A;  2Z11 A;  2B5G A;  3FRM A;  4CAX A;  1I21 A;  2ZW5 A;  2OH1 A;  2PQ8 A;  2Z3O A;  4JXQ A;  3AE9 C;  4YFJ A;  4PV1 C;  2BL1 A;  2FCK A;  3RL0 g;  3R9F A;  3CXQ A;  3AED C;  3SFD C;  5G20 A;  1Y9K A;  2P6G A;  2REF A;  2AE6 A;  3G3S A;  2FXP A;  5IB0 A;  4UWJ A;  1IID A;  5KKZ C;  2FSR A;  4Q38 A;  4OAD A;  4HNY B;  4KT0 J;  1CM0 A;  2VZZ A;  1NSL A;  1VL2 A;  4JWP A;  3V8I A;  3D8P A;  2D2C B;  2Z3M A;  2B3U A;  5J8C A;  1YVO A;  4PSX A;  2D2C C;  4B5P B;  1XF8 A;  1WK4 A;  4PK2 A;  2Z3L A;  2ZW6 A;  4AB7 A;  2H89 C;  3EWK A;  3C26 A;  3DDD A;  4XNH C;  2YNC A;  2FIA A;  4FD4 A;  3QAH A;  2D4O A;  5A27 A;  3PP9 A;  5C88 A;  5F48 A;  4I7Z B;  1KQG B;  1VF5 C;  1B87 A;  4K30 A;  2DPT A;  1VHS A;  2K5T A;  3GF7 A;  1J4J A;  4KSF A;  1MK4 A;  4FD5 A;  4B11 A;  4YGO A;  4EVY A;  1QSM A;  2P6E A;  2PRB A;  5AG7 A;  4OGQ D;  1M44 A;  1XIX A;  4C2Y A;  4H0L D;  2P6F A;  4R57 A;  3Q3D A;  1VF5 B;  2FXF A;  1P4N A;  5EC4 A;  3AE7 C;  1M1D A;  2FE7 A;  2X7B A;  3H5Z A;  5F49 A;  4HKF A;  1HF9 A;  1U6M A;  3LD2 A;  3LOD A;  4A2Z A;  4NCZ A;  1KOR A;  4E2A A;  1GHE A;  1NMT A;  2Q44 A;  3OWC A;  1YGH A;  1QSO A;  2ZT9 C;  2PDO A;  5DWM A;  2B5G B;  3PZJ A;  3ZJ0 A;  4F6A A;  2O01 J;  1Y7R A;  3Q5S A;  5BWA B;  4GDO A;  4IF5 A;  4J3G A;  4BMH A;  3Q2Y A;  5IX3 A;  2WPV B;  3G9R A;  3FNC A;  3GY9 A;  2C27 A;  2JEV A;  1KIL E;  3GF3 A;  4H6U A;  3AEE C;  2PSW A;  1U57 A;  3I9S A;  4KOT A;  3UY5 A;  4KOU A;  3T9Y A;  3TOB A;  5I0C A;  4YRH A;  4C2X A;  1BOB A;  2HQY A;  2J8R A;  1ZO0 A;  2MKV A;  5F46 A;  1KUV A;  2FBW C;  3AEF C;  2VEZ A;  3G8W A;  2OZG A;  4H44 D;  1CJW A;  1XEB A;  3R9G A;  3GMA A;  4A32 A;  4B5O A;  1OW7 A;  2JO1 A;  4MFL A;  1LRZ A;  2D4P A;  2J8N A;  2Q04 A;  3FBU A;  1GMJ A;  3I3G A;  3IN6 A;  3TE4 A;  2HV2 A;  5CNP A;  1MKM A;  1QSR A;  1KUX A;  1OZP A;  4B13 A;  5AG5 A;  2QJP C;  1OMI A;  2OZU A;  4H13 D;  2P0W A;  1UIX A;  2G3A A;  3R9E A;  1EXI A;  5AG6 A;  2Q0Y A;  2E75 B;  3QB8 A;  1IB1 E;  5H86 A;  1RXT A;  2VQY A;  2OU2 A;  2I79 A;  4A30 A;  2YIU C;  4CGO A;  5AGE A;  2WSF J;  1ZP0 C;  3EXN A;  4L8A A;  5E96 A;  2Z3P A;  3F5B A;  3GYA A;  3AE3 C;  2WSA A;  4Q36 A;  1MJB A;  1M4I A;  4KVM E;  4CYN A;  3CXP A;  4NSQ A;  4KS9 A;  2JDD A;  1JB0 J;  4PSW A;  4KOY A;  4H0L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...