2G3AA

Crystal structure of putative acetyltransferase from agrobacterium tumefaciens
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
MNFVLSDVADAEAEKAIRDPLVAYNLARFGESDKRDLNITIRNDDNSVTGGLVGHTARGWLYVQLLFVPEAMRGQGIAPKLLAMAEEEARKRGCMGAYIDTMNPDALRTYERYGFTKIGSLGPLSSGQSITWLEKRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords acetyltransferase
publication title Crystal structure of putative acetyltransferase from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens str. c58
total genus 33
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2g3aA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2g3aA02
1K05A 1UFHA 2G3AA 2VZZA 4M3SA 4R57A 5DWMA 1S7FA 3P2FA 2KCWA 1J4JA 3RYOA 2D4PA 4FD4A 2ARHA 1YR0A 3D3SA 4KLWA 4FD7A 3JVNA 4HNXB 1M4DA 3V8IA 5C88A 3S6KA 2B3UA 2A4NA 5F47A 4MBUA 1IICA 3F0AA 2OZGA 1RO5A 1YX0A 4U5YA 1IIDA 2Z10A 4XNHB 4MY3A 1V0CA 2B4DA 4QVTA 4B5OA 2OZHA 1M1DA 4OADA 4R87A 4PSXA 1QSOA 3FB3A 5KTDA 2HV2A 4PSWA 4NF1A 4JWPA 3TE4A 4JD6A 3D2PA 4AVCA 2FSRA 3EO4A 4HKFA 4RS2A 2OU2A 4CAXA 4NEXA 2R1IA 1BOBA 1I21A 4F6AA 3K9UA 3SHPA 2J8RA 3AEAC 2ZW5A 4KVXA 2B5GB 4CAWA 5E96A 3I3GA 3VWDA 4U9ZA 2R8VA 3S6GA 2JEVA 3C26A 2GE3A 5JQ4A 4HNYB 2PC1A 3TTHA 1XIXA 3TCVA 2ZW6A 4FD5A 3T90A 3AEFC 4I49A 4KOUA 4FD6A 1M4IA 4OLLA 2K5TA 3B71A 5EBVA 5H86A 3AE1C 2H89C 2REEA 2GIVA 2CNMA 4AB7A 2Q44A 1R57A 2O28A 4XPDB 2VZYA 4JXQA 4UWJA 1K4JA 1ZP0C 4L89A 3W6XA 2CY2A 5KTCA 4IF5A 2WPWA 4OAEA 3F5BA 3TFYA 1RXTA 5J8CA 3BLNA 1KUVA 3VWEA 2J8MA 1GHEA 4GS4A 4KOSA 4K30A 4JXRA 2FT0A 1QSRA 5IX3A 2HUZA 3AE7C 4UWIA 3AEBC 2PRBA 2VXKA 2JLMA 3LODA 4F0YA 3FBUA 3DDDA 3FXTA 2QMLA 4QB9A 3E0KA 4ONUA 1PV3A 2VI7A 3PGPA 3S6HA 1XEBA 2Q0YA 1YK3A 4U9YA 4NSQA 3FIXA 3G8WA 2BUEA 2NMTA 1KUYA 2ZW4A 1B6BA 1YGHA 1QSNA 1P4NA 3TO7A 3TO6A 3D2MA 4PV6A 4QBJA 3R9FA 3H4QA 3BJ7A 4H6UA 3SFDC 4L8AA 1TIQA 4QUSA 4BMHA 4YTPC 1XE4A 5ISVA 1P0HA 1QSMA 2PR8A 1U6MA 3D8PA 2B4BA 3AE3C 4UA3A 2H5MA 4XPDC 3AE2C 3R9GA 5F49A 1YQ3C 4E8OA 2HQYA 2B3VA 4ORFA 3CXSA 3BJ8A 2FIAA 2I00A 5CNPA 3I9SA 2FIWA 5J8FA 1WWZA 1QSTA 4AG7A 4KZTA 4KVOE 2Z0ZA 3SXOA 3DSBA 3IGRA 3EY5A 3NE7A 1Y9WA 3GYAA 1WK4A 3F8KA 1I1DA 4PK2A 2R7HA 3W6SA 3KKWA 1M44A 1OZPA 2EUIA 4H6ZA 4AVBA 3G3SA 2F5IA 3AECC 2Z11A 3AE9C 4II9A 1Z9UA 3JUWA 1K04A 2ZW7A 4KOYA 4HNWB 4R3KA 2B5GA 2Q04A 5EC4A 3SXNA 1B87A 1S7LA 3AE5C 3IWGA 1Y7RA 3ABVC 1CJWA 3AEEC 3R9EA 4E2AA 2JDCA 5F46A 2AE6A 4XNHC 4YRHA 2FL4A 2FCKA 3TOAA 2VBQA 1VKCA 1IYLA 2REFA 3B8GA 1NMTA 3S6FA 2QECA 2Q7BA 1VHSA 1CM0A 2BSWA 4B5PB 4MHDA 4KOTA 1OW8A 2C27A 4KOXA 1NSLA 5HH1A 1SQHA 2GANA 2B58A 1S5KA 3AEGC 4MJ8A 4J3GA 4PK3A 2ATRA 2D4OA 2B4DB 2G0BA 4MY0A 2CNTA 3T9YA 2FBWC 5HMNA 1MK4A 2WPXA 3R96A 1ON0A 1S3ZA 1NE9A 3TO9A 1M4GA 4QC6A 4B5PA 1S60A 4LX9A 1XF8A 4YFJA 3UY5A 3AE8C 3AE6C 3PP9A 3TT2A 1PU9A 2IL4A 4NXYA 5DWNA 2JDDA 1Y9KA 3R1KA 4M85A 4KOWA 2OB0A 1BO4A 1Q2YA 1I12A 2DXQA 2OH1A 1S7NA 1YVOA 1Q2DA 4YGOA 3WR7A 3CXPA 3P2HA 4Y49B 4AG9A 1S7KA 4EVYA 1N71A 3DR6A 3N7ZA 2H88C 4X5KA 4MI4A 3PZJA 4CRYB 3DR8A 2EVNA 2FE7A 1XMTA 2CNSA 1YREA 3QB8A 4KLVA 4KOVA 4R9MA 1MJ9A 4JLYA 3CXQA 4XPKA 2P6GA 3R95A 3OWCA 3W91A 1Q2CA 2I79A 4DNCA 3FYNA 3EFAA 1KTMA 2PQ8A 3QAHA 4UBRA 2QIRA 1ZOYC 5F48A 5I0CA 3FRMA 1MJBA 2AJ6A 1YQ4C 3GY9A 3ZJ0A 2P6EA 2VEZA 2OZUA 4NCZA 1OW7A 1L0CA 4AVAA 5H84A 5KTAA 3DNSA 2BEIA 5JPHA 1OW6A 4E0AA 4CS0B 2P0WA 1IB1E 1Z4RA 2Y0MA 3MGDA 4KORA 5IB0A 4KUAA 1Z4EA 1IYKA 2FXFA 5FVJA 2WQYC 2P6FA 3S9OA 4XPLA 2FS5A 2Q4YA 4IUSA 3AE4C 3LD2A 4LUAA 3GKRA 4H89A 2VQYA 2PSWA 3FNCA 2PDOA 1YLEA 5GCNA 4ZBGA 2Q4VA 4JJXA 2X7BA 3ZZIA 4KVME 3TOBA 4CAVA 5IV0A 3AEDC 4CRZB 2RC4A 1FY7A 1PUAA 2G3TA 3EC4A 4RI1A 4R3LA 2J8NA 2R98A 1YVKA 1KZFA 1LRZA 4KUBA 2ZXVA 2PR1A 2ZPAA 3EXNA 4Y49C 5C82A 1MJAA 2BL1A 4YXDC 1KUXA 3SFEC
chains in the Genus database with same CATH superfamily
1K05A 2DEAA 2WTYA 1WRGA 1VQKP 5G1ZA 3KZIH 1L0NJ 5AW7B 1JY3P 3V6IA 4R57A 1R5SA 2YNYA 3B2YA 1N7SA 4FD4A 1NTKG 2PFXA 2KNCB 4RO0A 3M0AA 3FVLA 1M4DA 4OGQD 3V8IA 4U3FG 4PV1D 1D7MA 1RF0A 5F47A 1IICA 3F0AA 2OZGA 4LLHA 3LWUA 3RK3E 4UFVA 7CPAA 5AVXB 2Z3KA 1N73C 2KK7A 1EE3P 1YLOA 3HE5B 4BRYB 2W8ZA 3MP7B 2OGUA 2V8GA 3SI0A 2I1JA 1M1JB 2C0XA 3TE4A 3HUSB 3L75G 3RBXA 3TK1A 4PXBA 4AVCA 1GK4A 2E76B 4PXEA 1NYHA 2L91A 1FC2C 3CXHD 5AVWB 4A37A 4UCNA 1X9VA 3M91A 1ZR4A 1RQVA 4U3FD 1N7SC 3SWFA 1LTJB 5AW6B 4KVXA 1G2CB 1MV8A 4F8ZA 3VN0A 5CCHC 4CAWA 1L0LE 4OC0A 1RE4A 3I3GA 1LTBC 2O01J 4PD4I 1VQPP 5APWA 3S6GA 1QMUA 4EWTA 3C26A 1N7SD 4HNYB 5G20A 2PIZA 5G21A 4GODA 5KTBA 3HD7A 3NH5A 3RK2C 2JWDA 2EO8A 3IJ3A 4CYQA 2OYHA 2B88A 4OLLA 4AXVA 4K3AA 3AE1C 3V2QA 2REEA 4BWNA 2IX7C 1PPJD 1ARMA 2FYZA 3H32A 2O28A 1L0LJ 3GHGA 4I7ZB 5E79H 1T2KC 1CZQA 2PVVA 2VZYA 4EDFA 4JXQA 3OW2O 3FH4A 3CC4P 2C6CA 1TF8A 2CY2A 3TYYA 4IHMA 4DT0A 1T2KD 3A9LA 4R4LA 4IAVA 1RXTA 3FWNA 2JEWA 3GF3A 1HJ0A 1P84E 3NH4A 5C39A 2J8MA 2AEMA 1RE4C 4MHYA 1CI6A 5AVVB 1JTHB 2QJPC 4HYTB 1JQGA 1LCPA 2FT0A 2PJ1A 5IX3A 2HUZA 4AQRD 3AEBC 3LODA 3HD7C 1LTTC 1Z2LA 5B5EE 2CPSA 4F0YA 3VMAA 2ZYAA 5EFWB 3FXTA 2QMLA 4R6TA 2N1TC 1OWAA 3E0KA 1PV3A 3PB6X 3HD7D 1DEBA 1SQPK 4OIDA 2Q0YA 4Q38A 8CPAA 4HH2A 3CX5D 1IO4A 4CPGA 4Q36A 4CPAA 5AG4A 4MHNA 4P6YA 1RF1A 3TO6A 4JYCA 3D2MA 2JBKA 1KYOD 5AGEA 1EZVG 2IBZD 3R9FA 1Q2NA 3D67A 5HXDA 3BJ7A 1PGPA 3PB8X 3SFDC 4BMHA 1S5LE 1XE4A 5ISVA 4XFJA 1QSMA 1SQPG 1BGYG 2BEZF 3CCVP 3QAYA 4ZGYB 3I55P 4KS9A 2H5MA 1GMJA 3AE2C 2O1KA 1QX8A 3RNZA 1L2PA 3FJUA 2B3VA 4ORFA 3EFFK 2YKPA 2FIAA 4MFQA 3TSIA 2B89A 5CNPA 1GU5A 1WWZA 1AYEA 4AUWA 1SQXK 2YIUB 2EWBA 3NE8A 2GU2A 3CCMP 3W67A 4OGQB 2Z0ZA 1FJPA 4P4FA 2W6BA 2IPPA 4PV1B 5DJTB 5APXA 1EZVD 1J1EB 2XEGA 3IEHA 3L4FA 1KC8Q 1A02J 4LC1A 1OZPA 1T6AA 1FOSE 2EUIA 1GL2A 4AVBA 3KYQA 2F5IA 2M0BA 3AE9C 3VMXA 4B11A 1SQXG 5L8RJ 1JCCA 2ZW7A 3KQXA 4PXCA 1N73B 4B10A 1AUGA 2CXAA 3G4SP 5DJUB 1ZLLA 1B87A 2BCCG 2V7QH 6CPAA 2N9BA 5KLVD 3H1JG 1Y7RA 3IWGA 1CJWA 2KYVA 1SS1A 3G9RA 5H2FH 1XJOA 2JDCA 1YITP 4XNHC 2LKMA 3FEEA 1ZG8A 2PJCA 1FDMA 1DIPA 1PPJE 2REFA 3VMYA 2Z3NA 1GZLA 2ZXXA 4WJBA 3FEDA 2NPSA 5AVSB 4M6GA 1N7SB 1QLED 4FWUA 1T3JA 1PL5A 2WVRA 1PCAA 3BCCG 1NU1D 5CPAA 2Q4ZA 2WT7A 2YNEA 1JY2N 3II6A 3IWEA 2ATRA 2D4OA 3RBUA 3L70G 3CWBD 2XEIA 1GL2D 4MFZA 2FBWC 4B6ZA 3VARA 1MK4A 1VQ4P 1KD1Q 2FYUE 1SQQE 1NE9A 1FAVA 1K73Q 1S3ZA 5B66H 4CYPA 4OC2A 4TNUA 1XF8A 3H25A 2W90A 3UY5A 2E42A 3V38A 3D4UA 1ZRTD 3TT2A 3LACA 2LXCB 2JDDA 2H7HA 4D6TD 3R1KA 1L0NK 1JCDA 3D68A 2NPSC 1Q2YA 2UWJE 1PP9E 2BEQD 3L72E 3BCCD 1SQQJ 4A7PA 1YVOA 1S9KE 1Q2DA 3KHXA 2E74C 1KZUB 2YXRB 4ONWA 1P84I 1HEEA 4Q7AA 2QJPB 2Z3OA 3VH9A 3I1UA 4Y49B 3H1KG 1FS0E 2NPSD 3N7ZA 3MZWB 1S1CX 1NAYA 3RL0C 3HD7B 4PPZA 2EVNA 1XMTA 4R9MA 1YREA 3CXQA 4N3YB 4EI2A 3DGVA 1J1DC 4EMEA 3R95A 3PJSK 1Q7LA 3CMAP 3OWCA 1T8ZA 2OYHB 2I79A 4GXHA 3BI1A 4DNCA 2GFQA 3SWKA 2KSJA 3VP9A 1KB9D 1LAPA 1PP9J 3G3ZA 3RL0D 3EFAA 1L0NG 1KTMA 3L72J 2PQ8A 1PIXA 3M9HA 3H32B 4UBRA 1KV4A 2A06G 3KR5A 3GHGB 1BE3D 5BU8B 1W2BO 4CYNA 3FXDA 1ZOYC 4RJTA 3N7NA 4MFKA 4N78E 5AW4B 3GY9A 3L2NA 3PBBA 2VEZA 2OZUA 5HVHA 3PB7X 5LRKA 1Z5RA 4P4DA 1L0CA 4O23A 3O6QA 2V77A 5KTAA 2OTLP 3CCLP 3CCSP 3C8VA 1IFMA 2BEIA 3KGQA 1WMKA 5AG7A 1GD2E 2AEFA 3KHUA 2WSFJ 1RE3C 1TKHA 3BRTB 2Y0MA 5IB0A 3B5NC 3BATA 1CI6B 1IGBA 4MHPA 1KORA 1IYKA 2I3CA 5CHXA 1RH5B 4TT3H 1YTZT 1OVUA 1OVRA 4LUAA 3GKRA 3VATA 1NOHA 1AVOA 4H89A 1HJBA 1FZCC 2NSMA 1JO5A 3JCUE 3JTKA 4WWIA 1JOCA 2Q4VA 4GM5A 3ZZIA 4KVME 2WSCJ 2N9YB 4CAVA 2Q7CA 1FZGA 2I1KA 5AG5A 4WVZA 1KWMA 5EMIA 3AEDC 3IWWA 1F57A 2QIWA 1L0LK 4H13D 5APQA 3WU2E 2ZVOB 1NTZE 3PHLA 2FXPA 1KZFA 3EXNA 3U59A 2AFWA 2WMMA 1Y47A 5CCGA 5K8MA 2OR4A 1RF1B 3SFEC 2QG4A 1WT6A 5KKZC 3H1HE 1Z8TA 4L76A 2G3AA 2OYIA 2YGWA 2ZJSE 4B14A 1S7FA 3P2FA 3CXHI 1YMEA 3H1IE 4IFMA 3RYOA 5AW9B 2ARHA 1JY3O 5CBMA 1YQEA 2ZT9C 4UB8E 3CCEP 1YTZI 3WT4A 2WSAA 5LYLA 1NTZJ 2QJYB 4PQAA 3JC22 2B3UA 3S9NA 4JYBA 1VPCA 2POHA 1JY2P 3TGUG 4MBUA 1BSHA 4P4IA 5LYIA 2ZT9D 2BCOA 5JM6A 3H1HJ 1RO5A 3MRUA 4MMOA 4XNHB 2QA4P 2E43A 4MY3A 2B4DA 1VQOP 4QVTA 3P8CE 1BCCD 3A2AA 1ZG9A 1M1DA 2OZHA 4B5OA 4R87A 2QM8A 4PD4H 3NFZA 2R32A 3H1IJ 4PSXA 2I8DA 2CTCA 2CPBA 4OC3A 1NU1J 4NF1A 4JWPA 1N8RQ 1F2PA 2QEXP 3TC8A 5THWA 2LR2A 2KIKA 2OYIC 2M5AA 3EO4A 1GL2B 1LTAC 5BU5A 5TISH 2OU2A 5CCGD 4NEXA 1BOBA 1I21A 3L74E 4F6AA 4WY4A 1U57A 2ZEGA 4X2TA 4NGRA 1KFNA 3TGUD 1R43A 3G71P 2J9AA 3VWDA 2HPCA 2HLOA 5APYA 3JRUA 4HPSA 5JQ4A 3KASA 1HWTC 3TTHA 3IC1A 3L73D 2IMOA 2ZW6A 3T90A 1PZQA 1QVGO 1KB9E 2AXCA 1SQBK 3IN6A 1IK7A 3L74J 2K5TA 3B71A 4HB1A 2D2CC 2Y0CA 3U1AA 4WBAA 4GOEA 1AA0A 2NPSB 3IFEA 3IU1A 1YHQP 4P45A 2E75C 1FOSF 1K4JA 2XDJA 3IU2A 2Q6QA 2AEJA 4TWEA 5KTCA 4ZMDA 1Y0RA 3RL0B 4OAEA 2WT7B 4JF7A 1AQ5A 2E75D 1EDLA 1IFIA 3EWKA 1KYOI 1SQBG 4KSAA 1M90Q 2IBZI 3TX8A 5JGFA 2HYNA 4PJ0H 1ELLP 2YNCC 4GS4A 4KOSA 4K30A 5CMZA 2K1AA 4WY4D 4JXRA 3L37A 3KQGA 3LW5J 1LAMA 3SI2A 1ZLIA 1NTME 3L71E 2PRBA 2VXKA 3CD6P 3QH9A 3H1LE 1Q90D 5KJ7A 2OARA 2IFNA 4ONUA 3ISZA 2RB7A 4FBEA 3M0DC 5CCHA 3KR4A 2ANPA 2XEFA 2POKA 1E79H 5K5GB 1VQ5P 3A0BE 5KAFE 4NFRA 3FIXA 1IFJA 3PEIA 3CL3D 1OBRA 1SVFA 2P7JA 1NTMJ 2RN0A 3LIEA 3L71J 1PYTB 3K9TA 4NJQA 3H1LJ 1LNQA 3TO7A 3MHVA 2WPRA 4UFXA 4PV6A 1XMBA 2C9NY 1MKMA 3H4QA 4MFJA 4H13B 1LT1A 4K35A 4YTPC 2CF4A 1ELMP 5HVGA 1P0HA 3D8PA 4UA3A 1LT9A 4XPDC 1ZLHA 3RZAA 1NTKD 1KFMA 1YQ3C 3V5BA 2DW3A 2Z5HA 3IIBA 5KJ7C 1TKFA 4ZNCA 1HDUA 5J8FA 4C7IA 4R7MA 3O6QB 5KKZB 2YKQA 2M3BA 2QVPA 4KZTA 5KJ7D 4ZKUA 1ZG7A 1ZO0A 1SQVE 4KVOE 1J2JB 1KQLA 4NGSA 2FYUK 3HE4A 1SQQK 3HTKB 3DSBA 5CCHD 4IFDK 2ZT9B 3WUUA 2O01H 1Y9WA 1WK4A 1YI2P 1OMIA 1XTCC 2N1TA 3P8MC 1Q82Q 4L75A 1PFIA 2WZ7A 1RTQA 1VQ7P 2Q7SA 4H6ZA 3RK2D 1Z8LA 3L75D 3Q5SA 2KLUA 3D7FA 2Z11A 4MCRA 4YU9A 2Y0DA 1SQVJ 2B5GA 5EC4A 4C46A 2EK8A 1LT9C 1YYCA 3TNUA 2P10A 2FYUG 4A31A 1SQQG 2WSEJ 2YO3A 3S9LA 4AYCA 4KJMA 2W83C 2AFUA 3KI9A 2ZOGA 4IL6E 1IZNB 3R9EA 4E2AA 1S4XA 3GF7A 1UIXA 3WC6A 3SJEA 2FL4A 2FVGA 5K8PA 2YXQB 2OYIB 3TOAA 1VKCA 3E7KA 1Q81Q 2FXOA 1EXJA 2CTBA 1IC2A 3M06A 3HLPA 2Q7BA 4M6HA 1VHSA 1X0TA 3HRNA 4FUUA 4MHDA 1PP9G 1OW8A 3L72G 4NGQA 1NSLA 5HH1A 2WITA 1SQHA 3S4RA 4UF4A 1FDIA 4UIBA 2B58A 2QJKB 5APTA 1DTDA 3AEGC 1LTSC 3OJAB 1IOIA 4OKOA 2RMZA 3B4SA 4X8IA 4PK3A 1R5LA 2N1TD 1TXRA 2B4DB 4YPCA 1LWUC 2K9JA 5LRGA 2O3JA 2HFED 3T9YA 1BPMA 1P84H 2D2CB 4GDOA 3MGNA 2C9LY 1KB9I 1X8YA 3TO9A 4ZKPA 1YIJP 2A45I 4B5PA 4A2ZA 1URQC 1TKJA 2E75B 3AE8C 1GYTA 4WB4A 4XE5B 2NRGA 4A38A 1PU9A 4OC5A 2XEJA 2XZRA 2M5AB 5B5EH 5DWNA 1QGKB 3PLNA 2PP6A 2MJZA 4WY4B 1BO4A 2PJ2A 2KLVA 1OIPA 1ZW0A 2DXQA 4A33A 3A7OA 1GU4A 3B8EB 4YGOA 2HPCB 1M56D 4Y99B 2H8PD 2G8YA 3CXPA 3P2HA 4AG9A 2AXTE 3VOPA 1NTZK 3DR6A 2H88C 2GUSA 4A94A 3DR8A 2BOAA 2FE7A 2CNSA 3QB8A 1MJ9A 2ZEFA 1EDIA 2KZJA 1Q2CA 2Y9YA 2K37A 1Q7YQ 4GT1A 5KAIE 1S5LH 4BBHA 3QAHA 3IF4A 2GLJA 1NVOA 5AW3B 1KMIZ 3KDPB 2ZVNB 5GTIE 5F48A 3FRMA 1MJBA 3CCJP 2FYNC 3CXHE 1YQ4C 1SQPD 3WC5A 1BGYD 2P6EA 1NKNA 2PJ8A 5AVUB 4U3FE 5G22A 4Z1MH 1PGQA 4NCZA 5KLIC 5AVZB 1OW7A 5J1QA 1LTIC 4AVAA 5H84A 1OZHA 1S3JA 3H1HG 3D7DA 2XNDH 5JPHA 1FE6A 3KXDA 3GIUA 1OW6A 4CGLA 4E0AA 4KORA 1DD4A 1Z4EA 5FVJA 1JUNA 1FDOA 1X10A 3AE4C 2PJBA 1OX3A 5LYFA 4U3FJ 4OWFA 1KILA 2VQYA 2PSWA 1NAFA 2FXMA 1XTGB 2K9YA 2QE7H 3TOBA 4H2KA 5IV0A 2Q1KA 1KQSO 2AFOA 3EC4A 4BD9A 3CPXA 4R3LA 1SQXD 4H0LC 4ZX9A 1LTGC 1HUCA 4PD4D 4C7RA 2PR1A 3RBZA 2IZ1A 3RK2B 1ZR2A 1YJ9P 1M57D 2BCCD 2JBJA 1MJAA 2OTJP 3H1JD 2BL1A 2Z3PA 2HB6A 1M8OB 1KUXA 1G1IA 4DJLA 1VHOA 1VHEA 4M3SA 5DWMA 1Q86Q 4UCMA 1J4JA 3L74G 4QMAA 1R3NA 2D4PA 4DCKA 1QL1A 3D3SA 4OC4A 1LT9B 2PIYA 4HNXB 4DUKA 3TF5A 4MCPA 5C88A 1JNMA 4R4MA 1KILC 3S6KA 4MHZA 2A4NA 3EFGA 5AG6A 5AW0B 2Z5IA 3H6PA 3CX5E 1IIDA 2Z10A 5A27A 3B7IA 4CAEA 1HVVA 1JY2O 1V0CA 1KILD 4OADA 1RE3A 2ZEEA 1DH3A 5AW5B 3B5NA 2CK3H 1Y0YA 5APVA 3L70D 1KYOE 3HE4B 2ZOFA 5KTDA 3UIAA 2AFSA 2IBZE 1SP4A 2ODFA 1ZXGA 3S1KA 2IQ6A 1U7MA 3GMAA 2E74D 1NTMK 4L73A 4O9BA 1FZCA 3PH0A 3D2PA 2HC9A 2N1TB 1X22A 4ASWA 4XA4A 3NTNA 3USSA 4RS2A 4CAXA 2R1IA 3A0HE 2C6PA 3NA6A 5AVQB 2C1CA 2ZW5A 1VQLP 2B5GB 4GKGA 1QL2A 5E96A 2ZYGA 1EQ7A 2R8VA 3TNUB 3GW6A 3NXSA 2JEVA 2Q5UA 2F8HA 4W9YA 3H8FA 2W27A 2Z3MA 1N2DC 2FFDA 1Z8XA 1NTMG 2PC1A 3L71G 1XIXA 1Y8AA 3H1LG 3HUSA 3H1KD 4I49A 1HGZA 4KOUA 4FD6A 1M4IA 1EZVE 4UIAA 2QVAA 2QYVA 5H86A 3GG2A 2H89C 2GIVA 1AV1A 2CNMA 4AB7A 1R57A 1JM0A 2Z3LA 1BGYE 2WWWA 1TU3F 2WSFH 3CCQP 1LTJA 2MKVA 3B5ND 1L0ND 4MCSA 1ZP0C 2CIJA 1JEKA 3W6XA 2A06D 3PB9X 2V8HA 2IYPA 4UEZA 3TFYA 3D7HA 5KLVE 3FGAD 4I6MC 2K9JB 3BLNA 3V2NA 1CP7A 3VWEA 2WSCH 1SQVK 4R8FA 1OXZA 2LXBA 3CC7P 2IYOA 1BGYJ 2PJ6A 5GTHE 3KQZA 4BXLA 1QSRA 4NJRA 3ZDMA 4ZY2A 1H8LA 1CBXA 2FFDC 4ZI6A 2JLMA 1M1JC 1H0TA 1NSAA 4LGDE 1MUUA 3HUSC 3FBUA 3DDDA 4QB9A 2P67A 3GLMA 5KLIB 5KLVJ 2VI7A 2ZELA 3RK3C 2P1JA 3JCUH 1XEBA 4OMEA 5CBNA 1YK3A 4DJGA 1L0LG 1NU1E 3A3YB 1LANA 4CYOA 4U9YA 1NO4A 4NSQA 1LTJC 1SQVG 1MFZA 1ARLA 3RK3D 3WMM0 1YBKA 2NMTA 4C7HA 2YNDA 2WYRA 3WU2H 1KUYA 1TF9A 2M3EA 3PFOA 3CWBE 3BVHA 1B6BA 2EK9A 1YGHA 1QSNA 3GLJA 1FNOA 1P4NA 4KHXA 1NGMB 1VQ6P 2GA1A 3SJFA 2XU6A 1E5WA 3L36A 1FT7A 1M7LA 4L8AA 1TIQA 4QUSA 1CP6A 4RESB 2ZAEB 1ZRTE 5BVZA 2Q43A 1VF5C 3AE3C 2KSEA 4D6TE 2BCCJ 4UB8H 3O8ZA 5LYDA 3R9GA 3CWBJ 1AFOA 4E8OA 2PE3A 2FKWB 4C68A 4UB6E 1VF5D 3BCCE 2GM4A 1QSTA 3DLJA 3IFMA 4ASVA 1F2OA 4HJGH 4H44C 2SPZA 1USEA 4AG7A 4EYYQ 1MZ9A 2YNCA 2IDBA 4CGOA 3C9IA 3KHZA 4C2XA 3PP5A 4ZY0A 1YJNP 3SXOA 2YMYA 4H44D 4D6TJ 3EY5A 4GIFA 2PJ5A 1XFOA 3F8KA 1I1DA 4PK2A 1KILB 3BCCJ 2NYQA 4P4EA 1GW4A 2KUBA 1BE3E 3M0DA 4II9A 1Z9UA 1K04A 4KOYA 4HNWB 3CX5I 4MN4C 2D2CD 3D6ZA 2Q04A 2E74B 1Z56A 3SXNA 1AQTA 3ABVC 1P84D 3B35A 3AEEC 1S2EA 2QSIA 3E1RA 1J1DB 3E1IA 4NGPA 4CGNA 3NMDA 2XKMA 3M9BA 4MFLA 1BE3J 2VRSA 2ZXEB 2WPQA 1LOKA 5BWAB 1KB9H 1IYLA 3B8GA 1QQ9A 1NMTA 1DX7A 1CX8A 2A45H 1CM0A 1JMBA 1BLLE 4OH8B 2DPTA 3Q1MA 1S5LX 2GANA 1U7JA 2HR3A 1S5KA 1VIXA 4A39A 2JR8A 1GTWA 4I2LC 1JMMA 1EDKA 1RY3A 3SJGA 2G0BA 4MY0A 5AW2B 2CNTA 3WABA 3B5NB 2YIUC 4KT0J 2R3SA 1ON0A 3CDXA 1SQBD 1N86A 1EZVI 4OGQC 2BASA 4QC6A 2AFMA 4PV1C 4F9UA 2Z4EA 1S60A 3JSVC 4LX9A 2Q9IA 1G1JA 1J1EC 5APUA 1FZCB 3AE6C 3PP9A 4C2ZA 3G6EP 2IL4A 4NXYA 1VQ8P 1AVYA 1Y9KA 3IAOA 2ZEPA 1BAVA 3CPAA 1NH4A 3PRTA 3V7ZA 4KOWA 3EQ2A 1XRYA 4NPEA 2OB0A 2B87A 1CSBA 1I12A 3R2PA 2ZEDA 3SJXA 2R5BA 2Y9ZA 1S7NA 2KS1A 2PVWA 3RAMA 2WZNA 1GW3A 3A0BH 5KAFH 3WR7A 4EVYA 3FX0A 1LP1A 1S7KA 2O1JA 2DF5A 1BCCE 1N71A 1JB0J 4MI4A 1ZN5A 3PZJA 4CRYB 3T8WA 2FFDB 2YO2A 2HODA 4KLVA 1HTLC 4JLYA 3Q2YA 3LIDA 5I4MA 2P6GA 1PPJG 4NPDA 4OP4A 3GB0A 1Y7EA 1AMPA 3FYNA 3RK3B 4P4JA 5E79E 5CBOA 2GUVA 3ITKA 1AJYA 1YSJA 1VL2A 4KSIA 2QIRA 1PGOA 3CZXA 2AJ6A 1BDCA 3Q5RA 3RO0A 1BCCJ 2RH0A 1FZAA 3SSUA 4B12A 3Q3DA 1FZFA 3TGUE 4LQGA 1RF0C 1LWUA 1KQGB 1RHZB 3DNSA 3K2KA 5AW8B 1M4LA 5HVFA 1H89A 2O53A 4CS0B 3QNVA 4KUAA 3L73E 2K3RA 4IFFA 2FXFA 5CJ4A 2V8VA 3T97A 1A2ZA 1URQA 3S9OA 1IFDA 4XPLA 2V4HA 3L35A 4HKZH 3RGUA 1IK9A 1VF5B 1IU8A 2Q4YA 5A28A 1T3UA 1LGHB 3LD2A 2WSEH 1H0TB 5LRJA 3TDKA 1SFCA 3D71A 3TGUJ 1YLEA 5GCNA 2X7BA 3U1CA 4H44B 1N7LA 2KXPB 5JH9A 2RC4A 1PUAA 1ZV8A 1IFPA 3L73J 4RI1A 4EFDA 4C2YA 2KOGA 2J8NA 4M3LA 1Y9BA 2R98A 3I56P 1DE4C 4KUBA 5K8NA 1FZEA 2IBZG 2ZXVA 2PGDA 2ZPAA 4Y49C 4CAFA 5C82A 2B9BA 2FYUD 1SQQD 2V8DA 4IL6H 3PBEA 1L4AA 1UFHA 4ZYQA 3WUTA 1VDFA 5AVRB 2VZZA 2G9DA 3D6YA 2PJ7A 2OYHC 4GOFA 2KCWA 4PXDA 4C7NA 5TJHA 2KI7B 1EC5A 4W80A 1YR0A 4NGTA 2Y0EA 4KLWA 4FD7A 3JVNA 4M6IA 3GHGC 3VYIA 3FWLA 1PP9D 1SFCC 2P2UA 2E5YA 2C6GA 1URQD 3L72D 4F0XA 3CCRP 1S9KD 4Z65A 1YX0A 2OYOA 4U5YA 3VTPC 5KLVK 1SFCD 3H5ZA 3MUDA 1IJDB 4L74A 1SQBE 3N4XA 1QSOA 2GREA 3FB3A 1XOVA 2HV2A 4PSWA 3KZWA 2PRQA 1H8AA 2YMKA 1CPXA 1S72P 4JD6A 1L4AC 4RN7A 2FSRA 2O01N 4HKFA 4N78D 2W6AA 3IO1A 1BDDA 3K9UA 2FY8A 3SHPA 2J8RA 4FAIA 3AEAC 1SQBJ 1NTKE 5KLVG 1L4AD 4UFWA 4UEFA 3MIWA 1NU1K 4K3NA 2EBJA 4U9ZA 2Q3EA 1NTZG 3VP8A 5DS0A 1CPSA 3FXEA 5APSA 2GE3A 5H2FE 1FBMA 2JWAA 2AXTH 2H43A 3ISXA 1BSNA 1HGVA 3TCVA 1ZMEC 4FD5A 3AEFC 4MCQA 1RF1C 4LQ6A 3MUDC 2J58A 5EBVA 3H1IG 1NTKJ 5F09A 2QJ8A 5K8OA 3PFEA 5M1BA 2J5UA 2Q44A 2V7QJ 5KAIH 3F5HA 4XPDB 3BHXA 1NU1G 3WUVA 3L75E 4UWJA 5GTIH 4L89A 1OVVA 3CXHH 2JO1A 2QJYC 4IF5A 1X79B 3CWBG 2WPWA 2IZ0A 3B3TA 3F5BA 5J8CA 1NTZD 2NZ2A 3H8EA 4JQ0D 3MTUE 1KUVA 5ELYA 2L5GB 1GHEA 3RL0g 5B66E 1HDQA 4UCPA 3H1HD 2KB7P 3L75J 4BINA 3AE7C 5AVTB 4UWIA 3CI9A 4H0LD 1QVFO 3M9QA 4D6TG 3CPWO 3H1ID 1IY7A 2AFZA 3WC7A 1VQMP 1GL2C 3FX6A 2RFHA 3PGPA 3S6HA 4YXWH 3I5CA 1R8EA 2JJLA 2B87B 5CJ0A 4JZ0A 2XV5A 2W6JH 2OOTA 3BI0A 2KS1B 3V2PA 3G8WA 3FECA 2BUEA 3P8CD 3PRJA 1EXIA 5AVYB 1LP1B 2ZW4A 2HODB 2PRRA 2ABZA 1GK6A 4QBJA 1UIIA 2A45G 4H6UA 1YW4A 3R4YA 1BE3G 2IFMA 1OFCX 5D8NA 1LJ2A 4WWVA 2JKVA 4JPZB 2PR8A 1U6MA 2Q3IA 1FJKA 2KNCA 3OAKA 4OC1A 2B4BA 3FF3A 3L74D 2JEEA 2FYUJ 1VGYA 5F49A 2DPSA 2HQYA 3BRVB 3CXSA 3BJ8A 2QM7A 2I00A 1QEXA 5IB9A 3I9SA 2FIWA 2ZEOA 1LWUB 3CX5H 2C0WA 4EOTA 4ZX8A 2OTKE 1UWYA 2ITAA 2F7VA 4RUHA 3HE5A 3V2RA 4BRYA 1Z8WA 3T97B 1URQB 3IGRA 1XBUA 1M1JA 1NWQA 1KYOH 1JWQA 1USDA 3NE7A 3Q5PA 1YJWP 3GYAA 4NGNA 2R7HA 4F9VA 3W6SA 1SFCB 3KKWA 1M44A 2R5DA 3CLQA 1CW5A 1K8AQ 3G3SA 2KP8A 3AECC 1IOFA 3QWOC 3JUWA 1SQPE 1KQFB 3GUXA 2WSSH 4X3RA 3A0HH 1G2CA 4R3KA 1RQUA 4IOIH 1S7LA 3AE5C 2PJ3A 1X12A 4DOJA 4MRIA 2VL1A 1HF9A 3HTKA 1LFWA 4W7YA 5F46A 3PB4X 2AE6A 1L4AB 1YW6A 4YRHA 2PJ4A 2FCKA 2VBQA 1NTMD 3KPEA 2ZYDA 3L71D 1SQPJ 3NFQA 3FMCA 2QECA 3H1LD 3S6FA 4A32A 2K88A 4C7NB 3D7GA 1JY3N 4B5PB 2BSWA 4H13C 4KOTA 3F89A 2FYNB 1FU1A 4TLFA 2C27A 1VQNP 4KOXA 3SI1A 1DD3A 2WPSA 1NKZB 2PJ9A 4JYWA 1DEEG 4KSFA 2E76C 1BCCG 4MJ8A 2OQQA 4A95A 4JBZA 4DYOA 4J3GA 3LMSA 1SQXE 4PD4E 2WUUA 4NGMA 2E76D 5HMNA 1H88A 3P32A 2BCCE 2E5TA 2Q51A 2WPXA 4DZOA 4MXUA 3R96A 3H1JE 2AFXA 2KZIA 1JTHA 2ZFCA 1M4GA 2PCUA 5GTHH 1NJIQ 4Y28J 5D29A 3H8GA 4YFJA 3PTZA 5TISE 2RKLA 1SQXJ 4YWYA 1W5CE 3B3WA 4M85A 2P58A 4I7ZC 3OA7A 2OH1A 4A30A 4H0LB 3H1JJ 1FZBA 3HUVA 3MN8A 3L73G 4W7ZA 1L0LD 1VQ9P 1KILE 3D70A 1MFTA 1GDTA 1KN7A 2BO9A 4P4BA 1SQVD 4X5KA 2PJAA 4U7JA 2M8RA 4KOVA 4XPKA 5CCGC 3CMEP 3VMZA 3L70E 4UEEA 3W91A 4B86A 3NH8A 3CCUP 4IK2A 3W68A 3K5BA 4IL6X 2PAJA 2WPVB 4RKUJ 2JDIH 3SWYA 1EDJA 2ZENA 4P10A 5I0CA 4B13A 1IFNA 2ZEHA 1K9MQ 3ZJ0A 3A5TA 2GLFA 1A02F 4G1PA 4I1LA 4OIWA 2PJ0A 2QJKC 3MD0A 3L70J 4UB6H 4EIJA 1M1KQ 3B3VA 4PJ0E 2O4HA 2QRXA 4OVNF 2J59M 3V4QA 2P0WA 1IB1E 1Z4RA 3MGDA 1W2EA 3IR9A 2WQYC 3H1KE 2P6FA 3B3SA 4CGPA 5AW1B 2FS5A 4IUSA 1CG2A 3KZIE 1HBWA 2XNXA 4N6JA 3N5FA 4CGMA 3FNCA 2PDOA 4P44A 1HH0A 4ZY1A 1PGJA 3P7KA 3D66A 4ZBGA 4JJXA 3CC2P 1L0NE 2A06E 1NTKK 1SLQA 3B3CA 3CT9A 1N73A 4WY4C 4CRZB 1BPNA 1FY7A 2G3TA 1NHLA 3LW5H 3H1KJ 2R3CA 3BASA 2JP3A 2IJZA 3S9MA 2YKOA 1YVKA 1LRZA 3BXMA 4MFPA 3V4WA 4Y99C 2R44A 4R76A 3KL9A 4NPFX 3C1LA 2ZEMA 4YXDC 2HG5D
chains in the Genus database with same CATH topology
5KKZC 1K05A 1UFHA 2G3AA 5G1ZA 2VZZA 2YGWA 4M3SA 4R57A 5DWMA 4B14A 1S7FA 3D6YA 3P2FA 2KCWA 4UCMA 1J4JA 3RYOA 2D4PA 4FD4A 2ARHA 1YR0A 3D3SA 2ZT9C 4KLWA 4FD7A 3JVNA 2WSAA 4HNXB 1M4DA 4OGQD 3V8IA 5C88A 4PV1D 4R4MA 3S6KA 2B3UA 2A4NA 5AG6A 5F47A 4MBUA 4F0XA 2ZT9D 1IICA 3F0AA 2OZGA 1RO5A 1YX0A 4U5YA 1IIDA 2Z10A 5A27A 3RK3E 4UFVA 4CAEA 2Z3KA 4XNHB 4MY3A 1V0CA 2B4DA 4QVTA 3H5ZA 4B5OA 2OZHA 1M1DA 4OADA 4R87A 4PSXA 1QSOA 3FB3A 5KTDA 2HV2A 4PSWA 4NF1A 4JWPA 3GMAA 3TE4A 2E74D 2YMKA 4JD6A 3D2PA 4AVCA 2FSRA 2E76B 3EO4A 1NYHA 4HKFA 4RS2A 2OU2A 4CAXA 4NEXA 2R1IA 1BOBA 1I21A 4F6AA 3K9UA 4UCNA 3SHPA 2J8RA 3AEAC 1U57A 1RQVA 2ZW5A 4UFWA 4KVXA 2B5GB 4CAWA 5E96A 3I3GA 3VWDA 4U9ZA 2R8VA 2O01J 3S6GA 2JEVA 3C26A 2GE3A 5JQ4A 2Z3MA 4HNYB 5G20A 5G21A 2PC1A 3TTHA 1XIXA 3TCVA 1ZMEC 2ZW6A 4FD5A 3T90A 3AEFC 4CYQA 4I49A 4KOUA 4FD6A 3IN6A 1M4IA 4OLLA 1IK7A 2K5TA 3B71A 5EBVA 5H86A 3AE1C 2H89C 2D2CC 2REEA 2GIVA 2CNMA 5M1BA 4AB7A 2J5UA 2Q44A 2V7QJ 1R57A 2O28A 4XPDB 2Z3LA 4I7ZB 1TU3F 2VZYA 3IU1A 4JXQA 2MKVA 2E75C 4UWJA 1K4JA 1ZP0C 3IU2A 4L89A 3W6XA 2CY2A 2JO1A 2QJYC 5KTCA 4IF5A 2WPWA 3A9LA 4OAEA 3F5BA 4R4LA 3TFYA 2E75D 1RXTA 5J8CA 3EWKA 3GF3A 2NZ2A 3FGAD 1HJ0A 4KSAA 3BLNA 1KUVA 3VWEA 2J8MA 1GHEA 3RL0g 2YNCC 4GS4A 4UCPA 4KOSA 4K30A 2QJPC 4JXRA 2FT0A 1QSRA 5IX3A 3LW5J 2HUZA 3AE7C 4UWIA 3AEBC 4H0LD 2PRBA 2VXKA 2JLMA 3LODA 4F0YA 3FBUA 3DDDA 3FXTA 1Q90D 2QMLA 4QB9A 3E0KA 4ONUA 3GLMA 1PV3A 2VI7A 3PGPA 3S6HA 1XEBA 1R8EA 2Q0YA 4Q38A 1YK3A 4CYOA 4U9YA 4NSQA 3FIXA 3G8WA 2BUEA 2NMTA 4C7HA 2YNDA 1EXIA 1KUYA 4Q36A 2ZW4A 1B6BA 5AG4A 1YGHA 1QSNA 1P4NA 3TO7A 3TO6A 3D2MA 4UFXA 1NGMB 4PV6A 5AGEA 4QBJA 3R9FA 1MKMA 3H4QA 4MFJA 3BJ7A 4H6UA 3SFDC 3R4YA 4L8AA 1TIQA 4QUSA 4BMHA 4H13B 2Z3PA 4YTPC 1XE4A 5ISVA 1P0HA 4XFJA 1QSMA 1ZRTE 2BEZF 4ZGYB 2PR8A 1U6MA 3D8PA 2B4BA 1VF5C 3AE3C 4KS9A 4UA3A 2H5MA 4XPDC 1GMJA 3AE2C 3R9GA 5F49A 1YQ3C 4E8OA 2DPSA 2HQYA 2B3VA 4ORFA 3CXSA 3BJ8A 4C68A 2FIAA 4MFQA 2I00A 1VF5D 5CNPA 3I9SA 2FIWA 5J8FA 1WWZA 4C7IA 1QSTA 4H44C 4AG7A 4KZTA 2YNCA 2IDBA 4CGOA 1ZO0A 4KVOE 2Z0ZA 4OGQB 4C2XA 4PV1B 3SXOA 3T97B 3DSBA 3IGRA 4H44D 3EY5A 2ZT9B 3NE7A 1Y9WA 3Q5PA 3GYAA 1WK4A 3F8KA 1OMIA 1I1DA 4PK2A 2R7HA 3W6SA 3KKWA 1M44A 1OZPA 2EUIA 4H6ZA 4AVBA 3Q5SA 3G3SA 2F5IA 3AECC 2Z11A 3AE9C 4II9A 1Z9UA 3JUWA 4B11A 1KQFB 1K04A 5L8RJ 2ZW7A 4KOYA 4HNWB 3D6ZA 2B5GA 2D2CD 4R3KA 4B10A 2Q04A 2E74B 5EC4A 2CXAA 3SXNA 1RQUA 2P10A 1B87A 1S7LA 3AE5C 3IWGA 1Y7RA 4A31A 2WSEJ 3ABVC 1CJWA 1HF9A 3AEEC 3G9RA 3R9EA 4E2AA 2QSIA 2JDCA 5F46A 4CGNA 3GF7A 1UIXA 4MFLA 2AE6A 4XNHC 4YRHA 2FL4A 5BWAB 2FCKA 1DIPA 2VBQA 3TOAA 1VKCA 1IYLA 2REFA 3B8GA 1EXJA 1NMTA 3S6FA 2QECA 2Z3NA 2Q7BA 4A32A 1VHSA 1CM0A 2BSWA 4B5PB 4MHDA 4H13C 4KOTA 1OW8A 2DPTA 2C27A 1PL5A 3Q1MA 1S5LX 4KOXA 1NSLA 5HH1A 1SQHA 1DD3A 2GANA 1FDIA 2B58A 4KSFA 1S5KA 2E76C 3AEGC 4MJ8A 2OQQA 4A95A 4J3GA 2YNEA 4PK3A 3IWEA 2ATRA 2D4OA 2WUUA 2B4DB 2G0BA 4MY0A 2CNTA 2E76D 3T9YA 2YIUC 2D2CB 4KT0J 2FBWC 4MFZA 4GDOA 5HMNA 1MK4A 2WPXA 3R96A 1ON0A 1S3ZA 1NE9A 3TO9A 4CYPA 4OGQC 1M4GA 4QC6A 4PV1C 4B5PA 4A2ZA 4Y28J 1S60A 4LX9A 1XF8A 3H25A 2E75B 3UY5A 4YFJA 3AE8C 3AE6C 3PP9A 3TT2A 4C2ZA 1PU9A 2IL4A 4NXYA 5DWNA 2JDDA 1Y9KA 3IAOA 3R1KA 4M85A 4KOWA 2OB0A 1BO4A 1Q2YA 1I12A 2BEQD 4I7ZC 2DXQA 4A33A 2OH1A 4A30A 4H0LB 1S7NA 1YVOA 1Q2DA 4YGOA 2E74C 3WR7A 2Z3OA 2G8YA 3CXPA 3P2HA 4Y49B 4AG9A 1S7KA 4EVYA 1KILE 1N71A 3D70A 1JB0J 3DR6A 2H88C 3N7ZA 4X5KA 4MI4A 1S1CX 3PZJA 4CRYB 4U7JA 3DR8A 2EVNA 2FE7A 1XMTA 2CNSA 1YREA 3QB8A 4KLVA 4KOVA 4R9MA 1MJ9A 4JLYA 3Q2YA 3CXQA 4XPKA 2P6GA 3R95A 3OWCA 3W91A 1Q2CA 2I79A 4DNCA 3FYNA 4IL6X 3EFAA 4BBHA 1KTMA 2WPVB 4RKUJ 1PIXA 1AJYA 2PQ8A 1VL2A 3QAHA 4UBRA 2QIRA 1KMIZ 4CYNA 1ZOYC 4MFKA 5F48A 5I0CA 3FRMA 1MJBA 4B13A 2AJ6A 2FYNC 3Q5RA 1YQ4C 3GY9A 3ZJ0A 2P6EA 5G22A 4Z1MH 4B12A 2VEZA 3Q3DA 2OZUA 4NCZA 2QJKC 5KLIC 1OW7A 1L0CA 3O6QA 4AVAA 1KQGB 5H84A 5KTAA 3DNSA 2BEIA 3C8VA 5JPHA 1WMKA 5AG7A 1OW6A 4CGLA 4E0AA 4CS0B 2P0WA 2WSFJ 1IB1E 1Z4RA 1DD4A 2Y0MA 3MGDA 4KORA 4KUAA 5IB0A 1Z4EA 1KORA 1IYKA 2FXFA 5FVJA 2WQYC 2P6FA 4CGPA 3S9OA 4TT3H 1FDOA 4XPLA 2FS5A 1VF5B 2Q4YA 4IUSA 3AE4C 5A28A 3LD2A 4LUAA 3GKRA 3D71A 4H89A 2VQYA 2PSWA 3FNCA 4CGMA 2PDOA 1YLEA 3JTKA 5GCNA 4ZBGA 2Q4VA 4JJXA 2X7BA 2K9YA 4KVME 2WSCJ 3TOBA 3ZZIA 4CAVA 4H44B 5AG5A 5IV0A 3AEDC 4CRZB 2RC4A 1FY7A 1PUAA 2G3TA 3EC4A 4RI1A 2QIWA 4R3LA 4C2YA 4H13D 2J8NA 4H0LC 1Y9BA 2JP3A 2R98A 1YVKA 1KZFA 1LRZA 2FXPA 4MFPA 4KUBA 2ZXVA 2PR1A 2ZPAA 3EXNA 4Y49C 4CAFA 5C82A 1MJAA 2BL1A 4YXDC 1KUXA 3SFEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K05 A;  1UFH A;  2G3A A;  2VZZ A;  4M3S A;  4R57 A;  5DWM A;  1S7F A;  3P2F A;  2KCW A;  1J4J A;  3RYO A;  2D4P A;  4FD4 A;  2ARH A;  1YR0 A;  3D3S A;  4KLW A;  4FD7 A;  3JVN A;  4HNX B;  1M4D A;  3V8I A;  5C88 A;  3S6K A;  2B3U A;  2A4N A;  5F47 A;  4MBU A;  1IIC A;  3F0A A;  2OZG A;  1RO5 A;  1YX0 A;  4U5Y A;  1IID A;  2Z10 A;  4XNH B;  4MY3 A;  1V0C A;  2B4D A;  4QVT A;  4B5O A;  2OZH A;  1M1D A;  4OAD A;  4R87 A;  4PSX A;  1QSO A;  3FB3 A;  5KTD A;  2HV2 A;  4PSW A;  4NF1 A;  4JWP A;  3TE4 A;  4JD6 A;  3D2P A;  4AVC A;  2FSR A;  3EO4 A;  4HKF A;  4RS2 A;  2OU2 A;  4CAX A;  4NEX A;  2R1I A;  1BOB A;  1I21 A;  4F6A A;  3K9U A;  3SHP A;  2J8R A;  3AEA C;  2ZW5 A;  4KVX A;  2B5G B;  4CAW A;  5E96 A;  3I3G A;  3VWD A;  4U9Z A;  2R8V A;  3S6G A;  2JEV A;  3C26 A;  2GE3 A;  5JQ4 A;  4HNY B;  2PC1 A;  3TTH A;  1XIX A;  3TCV A;  2ZW6 A;  4FD5 A;  3T90 A;  3AEF C;  4I49 A;  4KOU A;  4FD6 A;  1M4I A;  4OLL A;  2K5T A;  3B71 A;  5EBV A;  5H86 A;  3AE1 C;  2H89 C;  2REE A;  2GIV A;  2CNM A;  4AB7 A;  2Q44 A;  1R57 A;  2O28 A;  4XPD B;  2VZY A;  4JXQ A;  4UWJ A;  1K4J A;  1ZP0 C;  4L89 A;  3W6X A;  2CY2 A;  5KTC A;  4IF5 A;  2WPW A;  4OAE A;  3F5B A;  3TFY A;  1RXT A;  5J8C A;  3BLN A;  1KUV A;  3VWE A;  2J8M A;  1GHE A;  4GS4 A;  4KOS A;  4K30 A;  4JXR A;  2FT0 A;  1QSR A;  5IX3 A;  2HUZ A;  3AE7 C;  4UWI A;  3AEB C;  2PRB A;  2VXK A;  2JLM A;  3LOD A;  4F0Y A;  3FBU A;  3DDD A;  3FXT A;  2QML A;  4QB9 A;  3E0K A;  4ONU A;  1PV3 A;  2VI7 A;  3PGP A;  3S6H A;  1XEB A;  2Q0Y A;  1YK3 A;  4U9Y A;  4NSQ A;  3FIX A;  3G8W A;  2BUE A;  2NMT A;  1KUY A;  2ZW4 A;  1B6B A;  1YGH A;  1QSN A;  1P4N A;  3TO7 A;  3TO6 A;  3D2M A;  4PV6 A;  4QBJ A;  3R9F A;  3H4Q A;  3BJ7 A;  4H6U A;  3SFD C;  4L8A A;  1TIQ A;  4QUS A;  4BMH A;  4YTP C;  1XE4 A;  5ISV A;  1P0H A;  1QSM A;  2PR8 A;  1U6M A;  3D8P A;  2B4B A;  3AE3 C;  4UA3 A;  2H5M A;  4XPD C;  3AE2 C;  3R9G A;  5F49 A;  1YQ3 C;  4E8O A;  2HQY A;  2B3V A;  4ORF A;  3CXS A;  3BJ8 A;  2FIA A;  2I00 A;  5CNP A;  3I9S A;  2FIW A;  5J8F A;  1WWZ A;  1QST A;  4AG7 A;  4KZT A;  4KVO E;  2Z0Z A;  3SXO A;  3DSB A;  3IGR A;  3EY5 A;  3NE7 A;  1Y9W A;  3GYA A;  1WK4 A;  3F8K A;  1I1D A;  4PK2 A;  2R7H A;  3W6S A;  3KKW A;  1M44 A;  1OZP A;  2EUI A;  4H6Z A;  4AVB A;  3G3S A;  2F5I A;  3AEC C;  2Z11 A;  3AE9 C;  4II9 A;  1Z9U A;  3JUW A;  1K04 A;  2ZW7 A;  4KOY A;  4HNW B;  4R3K A;  2B5G A;  2Q04 A;  5EC4 A;  3SXN A;  1B87 A;  1S7L A;  3AE5 C;  3IWG A;  1Y7R A;  3ABV C;  1CJW A;  3AEE C;  3R9E A;  4E2A A;  2JDC A;  5F46 A;  2AE6 A;  4XNH C;  4YRH A;  2FL4 A;  2FCK A;  3TOA A;  2VBQ A;  1VKC A;  1IYL A;  2REF A;  3B8G A;  1NMT A;  3S6F A;  2QEC A;  2Q7B A;  1VHS A;  1CM0 A;  2BSW A;  4B5P B;  4MHD A;  4KOT A;  1OW8 A;  2C27 A;  4KOX A;  1NSL A;  5HH1 A;  1SQH A;  2GAN A;  2B58 A;  1S5K A;  3AEG C;  4MJ8 A;  4J3G A;  4PK3 A;  2ATR A;  2D4O A;  2B4D B;  2G0B A;  4MY0 A;  2CNT A;  3T9Y A;  2FBW C;  5HMN A;  1MK4 A;  2WPX A;  3R96 A;  1ON0 A;  1S3Z A;  1NE9 A;  3TO9 A;  1M4G A;  4QC6 A;  4B5P A;  1S60 A;  4LX9 A;  1XF8 A;  4YFJ A;  3UY5 A;  3AE8 C;  3AE6 C;  3PP9 A;  3TT2 A;  1PU9 A;  2IL4 A;  4NXY A;  5DWN A;  2JDD A;  1Y9K A;  3R1K A;  4M85 A;  4KOW A;  2OB0 A;  1BO4 A;  1Q2Y A;  1I12 A;  2DXQ A;  2OH1 A;  1S7N A;  1YVO A;  1Q2D A;  4YGO A;  3WR7 A;  3CXP A;  3P2H A;  4Y49 B;  4AG9 A;  1S7K A;  4EVY A;  1N71 A;  3DR6 A;  3N7Z A;  2H88 C;  4X5K A;  4MI4 A;  3PZJ A;  4CRY B;  3DR8 A;  2EVN A;  2FE7 A;  1XMT A;  2CNS A;  1YRE A;  3QB8 A;  4KLV A;  4KOV A;  4R9M A;  1MJ9 A;  4JLY A;  3CXQ A;  4XPK A;  2P6G A;  3R95 A;  3OWC A;  3W91 A;  1Q2C A;  2I79 A;  4DNC A;  3FYN A;  3EFA A;  1KTM A;  2PQ8 A;  3QAH A;  4UBR A;  2QIR A;  1ZOY C;  5F48 A;  5I0C A;  3FRM A;  1MJB A;  2AJ6 A;  1YQ4 C;  3GY9 A;  3ZJ0 A;  2P6E A;  2VEZ A;  2OZU A;  4NCZ A;  1OW7 A;  1L0C A;  4AVA A;  5H84 A;  5KTA A;  3DNS A;  2BEI A;  5JPH A;  1OW6 A;  4E0A A;  4CS0 B;  2P0W A;  1IB1 E;  1Z4R A;  2Y0M A;  3MGD A;  4KOR A;  5IB0 A;  4KUA A;  1Z4E A;  1IYK A;  2FXF A;  5FVJ A;  2WQY C;  2P6F A;  3S9O A;  4XPL A;  2FS5 A;  2Q4Y A;  4IUS A;  3AE4 C;  3LD2 A;  4LUA A;  3GKR A;  4H89 A;  2VQY A;  2PSW A;  3FNC A;  2PDO A;  1YLE A;  5GCN A;  4ZBG A;  2Q4V A;  4JJX A;  2X7B A;  3ZZI A;  4KVM E;  3TOB A;  4CAV A;  5IV0 A;  3AED C;  4CRZ B;  2RC4 A;  1FY7 A;  1PUA A;  2G3T A;  3EC4 A;  4RI1 A;  4R3L A;  2J8N A;  2R98 A;  1YVK A;  1KZF A;  1LRZ A;  4KUB A;  2ZXV A;  2PR1 A;  2ZPA A;  3EXN A;  4Y49 C;  5C82 A;  1MJA A;  2BL1 A;  4YXD C;  1KUX A;  3SFE C; 
#chains in the Genus database with same CATH topology
 1K05 A;  2DEA A;  2WTY A;  1WRG A;  1VQK P;  5G1Z A;  3KZI H;  1L0N J;  5AW7 B;  1JY3 P;  3V6I A;  4R57 A;  1R5S A;  2YNY A;  3B2Y A;  1N7S A;  4FD4 A;  1NTK G;  2PFX A;  2KNC B;  4RO0 A;  3M0A A;  3FVL A;  1M4D A;  4OGQ D;  3V8I A;  4U3F G;  4PV1 D;  1D7M A;  1RF0 A;  5F47 A;  1IIC A;  3F0A A;  2OZG A;  4LLH A;  3LWU A;  3RK3 E;  4UFV A;  7CPA A;  5AVX B;  2Z3K A;  1N73 C;  2KK7 A;  1EE3 P;  1YLO A;  3HE5 B;  4BRY B;  2W8Z A;  3MP7 B;  2OGU A;  2V8G A;  3SI0 A;  2I1J A;  1M1J B;  2C0X A;  3TE4 A;  3HUS B;  3L75 G;  3RBX A;  3TK1 A;  4PXB A;  4AVC A;  1GK4 A;  2E76 B;  4PXE A;  1NYH A;  2L91 A;  1FC2 C;  3CXH D;  5AVW B;  4A37 A;  4UCN A;  1X9V A;  3M91 A;  1ZR4 A;  1RQV A;  4U3F D;  1N7S C;  3SWF A;  1LTJ B;  5AW6 B;  4KVX A;  1G2C B;  1MV8 A;  4F8Z A;  3VN0 A;  5CCH C;  4CAW A;  1L0L E;  4OC0 A;  1RE4 A;  3I3G A;  1LTB C;  2O01 J;  4PD4 I;  1VQP P;  5APW A;  3S6G A;  1QMU A;  4EWT A;  3C26 A;  1N7S D;  4HNY B;  5G20 A;  2PIZ A;  5G21 A;  4GOD A;  5KTB A;  3HD7 A;  3NH5 A;  3RK2 C;  2JWD A;  2EO8 A;  3IJ3 A;  4CYQ A;  2OYH A;  2B88 A;  4OLL A;  4AXV A;  4K3A A;  3AE1 C;  3V2Q A;  2REE A;  4BWN A;  2IX7 C;  1PPJ D;  1ARM A;  2FYZ A;  3H32 A;  2O28 A;  1L0L J;  3GHG A;  4I7Z B;  5E79 H;  1T2K C;  1CZQ A;  2PVV A;  2VZY A;  4EDF A;  4JXQ A;  3OW2 O;  3FH4 A;  3CC4 P;  2C6C A;  1TF8 A;  2CY2 A;  3TYY A;  4IHM A;  4DT0 A;  1T2K D;  3A9L A;  4R4L A;  4IAV A;  1RXT A;  3FWN A;  2JEW A;  3GF3 A;  1HJ0 A;  1P84 E;  3NH4 A;  5C39 A;  2J8M A;  2AEM A;  1RE4 C;  4MHY A;  1CI6 A;  5AVV B;  1JTH B;  2QJP C;  4HYT B;  1JQG A;  1LCP A;  2FT0 A;  2PJ1 A;  5IX3 A;  2HUZ A;  4AQR D;  3AEB C;  3LOD A;  3HD7 C;  1LTT C;  1Z2L A;  5B5E E;  2CPS A;  4F0Y A;  3VMA A;  2ZYA A;  5EFW B;  3FXT A;  2QML A;  4R6T A;  2N1T C;  1OWA A;  3E0K A;  1PV3 A;  3PB6 X;  3HD7 D;  1DEB A;  1SQP K;  4OID A;  2Q0Y A;  4Q38 A;  8CPA A;  4HH2 A;  3CX5 D;  1IO4 A;  4CPG A;  4Q36 A;  4CPA A;  5AG4 A;  4MHN A;  4P6Y A;  1RF1 A;  3TO6 A;  4JYC A;  3D2M A;  2JBK A;  1KYO D;  5AGE A;  1EZV G;  2IBZ D;  3R9F A;  1Q2N A;  3D67 A;  5HXD A;  3BJ7 A;  1PGP A;  3PB8 X;  3SFD C;  4BMH A;  1S5L E;  1XE4 A;  5ISV A;  4XFJ A;  1QSM A;  1SQP G;  1BGY G;  2BEZ F;  3CCV P;  3QAY A;  4ZGY B;  3I55 P;  4KS9 A;  2H5M A;  1GMJ A;  3AE2 C;  2O1K A;  1QX8 A;  3RNZ A;  1L2P A;  3FJU A;  2B3V A;  4ORF A;  3EFF K;  2YKP A;  2FIA A;  4MFQ A;  3TSI A;  2B89 A;  5CNP A;  1GU5 A;  1WWZ A;  1AYE A;  4AUW A;  1SQX K;  2YIU B;  2EWB A;  3NE8 A;  2GU2 A;  3CCM P;  3W67 A;  4OGQ B;  2Z0Z A;  1FJP A;  4P4F A;  2W6B A;  2IPP A;  4PV1 B;  5DJT B;  5APX A;  1EZV D;  1J1E B;  2XEG A;  3IEH A;  3L4F A;  1KC8 Q;  1A02 J;  4LC1 A;  1OZP A;  1T6A A;  1FOS E;  2EUI A;  1GL2 A;  4AVB A;  3KYQ A;  2F5I A;  2M0B A;  3AE9 C;  3VMX A;  4B11 A;  1SQX G;  5L8R J;  1JCC A;  2ZW7 A;  3KQX A;  4PXC A;  1N73 B;  4B10 A;  1AUG A;  2CXA A;  3G4S P;  5DJU B;  1ZLL A;  1B87 A;  2BCC G;  2V7Q H;  6CPA A;  2N9B A;  5KLV D;  3H1J G;  1Y7R A;  3IWG A;  1CJW A;  2KYV A;  1SS1 A;  3G9R A;  5H2F H;  1XJO A;  2JDC A;  1YIT P;  4XNH C;  2LKM A;  3FEE A;  1ZG8 A;  2PJC A;  1FDM A;  1DIP A;  1PPJ E;  2REF A;  3VMY A;  2Z3N A;  1GZL A;  2ZXX A;  4WJB A;  3FED A;  2NPS A;  5AVS B;  4M6G A;  1N7S B;  1QLE D;  4FWU A;  1T3J A;  1PL5 A;  2WVR A;  1PCA A;  3BCC G;  1NU1 D;  5CPA A;  2Q4Z A;  2WT7 A;  2YNE A;  1JY2 N;  3II6 A;  3IWE A;  2ATR A;  2D4O A;  3RBU A;  3L70 G;  3CWB D;  2XEI A;  1GL2 D;  4MFZ A;  2FBW C;  4B6Z A;  3VAR A;  1MK4 A;  1VQ4 P;  1KD1 Q;  2FYU E;  1SQQ E;  1NE9 A;  1FAV A;  1K73 Q;  1S3Z A;  5B66 H;  4CYP A;  4OC2 A;  4TNU A;  1XF8 A;  3H25 A;  2W90 A;  3UY5 A;  2E42 A;  3V38 A;  3D4U A;  1ZRT D;  3TT2 A;  3LAC A;  2LXC B;  2JDD A;  2H7H A;  4D6T D;  3R1K A;  1L0N K;  1JCD A;  3D68 A;  2NPS C;  1Q2Y A;  2UWJ E;  1PP9 E;  2BEQ D;  3L72 E;  3BCC D;  1SQQ J;  4A7P A;  1YVO A;  1S9K E;  1Q2D A;  3KHX A;  2E74 C;  1KZU B;  2YXR B;  4ONW A;  1P84 I;  1HEE A;  4Q7A A;  2QJP B;  2Z3O A;  3VH9 A;  3I1U A;  4Y49 B;  3H1K G;  1FS0 E;  2NPS D;  3N7Z A;  3MZW B;  1S1C X;  1NAY A;  3RL0 C;  3HD7 B;  4PPZ A;  2EVN A;  1XMT A;  4R9M A;  1YRE A;  3CXQ A;  4N3Y B;  4EI2 A;  3DGV A;  1J1D C;  4EME A;  3R95 A;  3PJS K;  1Q7L A;  3CMA P;  3OWC A;  1T8Z A;  2OYH B;  2I79 A;  4GXH A;  3BI1 A;  4DNC A;  2GFQ A;  3SWK A;  2KSJ A;  3VP9 A;  1KB9 D;  1LAP A;  1PP9 J;  3G3Z A;  3RL0 D;  3EFA A;  1L0N G;  1KTM A;  3L72 J;  2PQ8 A;  1PIX A;  3M9H A;  3H32 B;  4UBR A;  1KV4 A;  2A06 G;  3KR5 A;  3GHG B;  1BE3 D;  5BU8 B;  1W2B O;  4CYN A;  3FXD A;  1ZOY C;  4RJT A;  3N7N A;  4MFK A;  4N78 E;  5AW4 B;  3GY9 A;  3L2N A;  3PBB A;  2VEZ A;  2OZU A;  5HVH A;  3PB7 X;  5LRK A;  1Z5R A;  4P4D A;  1L0C A;  4O23 A;  3O6Q A;  2V77 A;  5KTA A;  2OTL P;  3CCL P;  3CCS P;  3C8V A;  1IFM A;  2BEI A;  3KGQ A;  1WMK A;  5AG7 A;  1GD2 E;  2AEF A;  3KHU A;  2WSF J;  1RE3 C;  1TKH A;  3BRT B;  2Y0M A;  5IB0 A;  3B5N C;  3BAT A;  1CI6 B;  1IGB A;  4MHP A;  1KOR A;  1IYK A;  2I3C A;  5CHX A;  1RH5 B;  4TT3 H;  1YTZ T;  1OVU A;  1OVR A;  4LUA A;  3GKR A;  3VAT A;  1NOH A;  1AVO A;  4H89 A;  1HJB A;  1FZC C;  2NSM A;  1JO5 A;  3JCU E;  3JTK A;  4WWI A;  1JOC A;  2Q4V A;  4GM5 A;  3ZZI A;  4KVM E;  2WSC J;  2N9Y B;  4CAV A;  2Q7C A;  1FZG A;  2I1K A;  5AG5 A;  4WVZ A;  1KWM A;  5EMI A;  3AED C;  3IWW A;  1F57 A;  2QIW A;  1L0L K;  4H13 D;  5APQ A;  3WU2 E;  2ZVO B;  1NTZ E;  3PHL A;  2FXP A;  1KZF A;  3EXN A;  3U59 A;  2AFW A;  2WMM A;  1Y47 A;  5CCG A;  5K8M A;  2OR4 A;  1RF1 B;  3SFE C;  2QG4 A;  1WT6 A;  5KKZ C;  3H1H E;  1Z8T A;  4L76 A;  2G3A A;  2OYI A;  2YGW A;  2ZJS E;  4B14 A;  1S7F A;  3P2F A;  3CXH I;  1YME A;  3H1I E;  4IFM A;  3RYO A;  5AW9 B;  2ARH A;  1JY3 O;  5CBM A;  1YQE A;  2ZT9 C;  4UB8 E;  3CCE P;  1YTZ I;  3WT4 A;  2WSA A;  5LYL A;  1NTZ J;  2QJY B;  4PQA A;  3JC2 2;  2B3U A;  3S9N A;  4JYB A;  1VPC A;  2POH A;  1JY2 P;  3TGU G;  4MBU A;  1BSH A;  4P4I A;  5LYI A;  2ZT9 D;  2BCO A;  5JM6 A;  3H1H J;  1RO5 A;  3MRU A;  4MMO A;  4XNH B;  2QA4 P;  2E43 A;  4MY3 A;  2B4D A;  1VQO P;  4QVT A;  3P8C E;  1BCC D;  3A2A A;  1ZG9 A;  1M1D A;  2OZH A;  4B5O A;  4R87 A;  2QM8 A;  4PD4 H;  3NFZ A;  2R32 A;  3H1I J;  4PSX A;  2I8D A;  2CTC A;  2CPB A;  4OC3 A;  1NU1 J;  4NF1 A;  4JWP A;  1N8R Q;  1F2P A;  2QEX P;  3TC8 A;  5THW A;  2LR2 A;  2KIK A;  2OYI C;  2M5A A;  3EO4 A;  1GL2 B;  1LTA C;  5BU5 A;  5TIS H;  2OU2 A;  5CCG D;  4NEX A;  1BOB A;  1I21 A;  3L74 E;  4F6A A;  4WY4 A;  1U57 A;  2ZEG A;  4X2T A;  4NGR A;  1KFN A;  3TGU D;  1R43 A;  3G71 P;  2J9A A;  3VWD A;  2HPC A;  2HLO A;  5APY A;  3JRU A;  4HPS A;  5JQ4 A;  3KAS A;  1HWT C;  3TTH A;  3IC1 A;  3L73 D;  2IMO A;  2ZW6 A;  3T90 A;  1PZQ A;  1QVG O;  1KB9 E;  2AXC A;  1SQB K;  3IN6 A;  1IK7 A;  3L74 J;  2K5T A;  3B71 A;  4HB1 A;  2D2C C;  2Y0C A;  3U1A A;  4WBA A;  4GOE A;  1AA0 A;  2NPS B;  3IFE A;  3IU1 A;  1YHQ P;  4P45 A;  2E75 C;  1FOS F;  1K4J A;  2XDJ A;  3IU2 A;  2Q6Q A;  2AEJ A;  4TWE A;  5KTC A;  4ZMD A;  1Y0R A;  3RL0 B;  4OAE A;  2WT7 B;  4JF7 A;  1AQ5 A;  2E75 D;  1EDL A;  1IFI A;  3EWK A;  1KYO I;  1SQB G;  4KSA A;  1M90 Q;  2IBZ I;  3TX8 A;  5JGF A;  2HYN A;  4PJ0 H;  1ELL P;  2YNC C;  4GS4 A;  4KOS A;  4K30 A;  5CMZ A;  2K1A A;  4WY4 D;  4JXR A;  3L37 A;  3KQG A;  3LW5 J;  1LAM A;  3SI2 A;  1ZLI A;  1NTM E;  3L71 E;  2PRB A;  2VXK A;  3CD6 P;  3QH9 A;  3H1L E;  1Q90 D;  5KJ7 A;  2OAR A;  2IFN A;  4ONU A;  3ISZ A;  2RB7 A;  4FBE A;  3M0D C;  5CCH A;  3KR4 A;  2ANP A;  2XEF A;  2POK A;  1E79 H;  5K5G B;  1VQ5 P;  3A0B E;  5KAF E;  4NFR A;  3FIX A;  1IFJ A;  3PEI A;  3CL3 D;  1OBR A;  1SVF A;  2P7J A;  1NTM J;  2RN0 A;  3LIE A;  3L71 J;  1PYT B;  3K9T A;  4NJQ A;  3H1L J;  1LNQ A;  3TO7 A;  3MHV A;  2WPR A;  4UFX A;  4PV6 A;  1XMB A;  2C9N Y;  1MKM A;  3H4Q A;  4MFJ A;  4H13 B;  1LT1 A;  4K35 A;  4YTP C;  2CF4 A;  1ELM P;  5HVG A;  1P0H A;  3D8P A;  4UA3 A;  1LT9 A;  4XPD C;  1ZLH A;  3RZA A;  1NTK D;  1KFM A;  1YQ3 C;  3V5B A;  2DW3 A;  2Z5H A;  3IIB A;  5KJ7 C;  1TKF A;  4ZNC A;  1HDU A;  5J8F A;  4C7I A;  4R7M A;  3O6Q B;  5KKZ B;  2YKQ A;  2M3B A;  2QVP A;  4KZT A;  5KJ7 D;  4ZKU A;  1ZG7 A;  1ZO0 A;  1SQV E;  4KVO E;  1J2J B;  1KQL A;  4NGS A;  2FYU K;  3HE4 A;  1SQQ K;  3HTK B;  3DSB A;  5CCH D;  4IFD K;  2ZT9 B;  3WUU A;  2O01 H;  1Y9W A;  1WK4 A;  1YI2 P;  1OMI A;  1XTC C;  2N1T A;  3P8M C;  1Q82 Q;  4L75 A;  1PFI A;  2WZ7 A;  1RTQ A;  1VQ7 P;  2Q7S A;  4H6Z A;  3RK2 D;  1Z8L A;  3L75 D;  3Q5S A;  2KLU A;  3D7F A;  2Z11 A;  4MCR A;  4YU9 A;  2Y0D A;  1SQV J;  2B5G A;  5EC4 A;  4C46 A;  2EK8 A;  1LT9 C;  1YYC A;  3TNU A;  2P10 A;  2FYU G;  4A31 A;  1SQQ G;  2WSE J;  2YO3 A;  3S9L A;  4AYC A;  4KJM A;  2W83 C;  2AFU A;  3KI9 A;  2ZOG A;  4IL6 E;  1IZN B;  3R9E A;  4E2A A;  1S4X A;  3GF7 A;  1UIX A;  3WC6 A;  3SJE A;  2FL4 A;  2FVG A;  5K8P A;  2YXQ B;  2OYI B;  3TOA A;  1VKC A;  3E7K A;  1Q81 Q;  2FXO A;  1EXJ A;  2CTB A;  1IC2 A;  3M06 A;  3HLP A;  2Q7B A;  4M6H A;  1VHS A;  1X0T A;  3HRN A;  4FUU A;  4MHD A;  1PP9 G;  1OW8 A;  3L72 G;  4NGQ A;  1NSL A;  5HH1 A;  2WIT A;  1SQH A;  3S4R A;  4UF4 A;  1FDI A;  4UIB A;  2B58 A;  2QJK B;  5APT A;  1DTD A;  3AEG C;  1LTS C;  3OJA B;  1IOI A;  4OKO A;  2RMZ A;  3B4S A;  4X8I A;  4PK3 A;  1R5L A;  2N1T D;  1TXR A;  2B4D B;  4YPC A;  1LWU C;  2K9J A;  5LRG A;  2O3J A;  2HFE D;  3T9Y A;  1BPM A;  1P84 H;  2D2C B;  4GDO A;  3MGN A;  2C9L Y;  1KB9 I;  1X8Y A;  3TO9 A;  4ZKP A;  1YIJ P;  2A45 I;  4B5P A;  4A2Z A;  1URQ C;  1TKJ A;  2E75 B;  3AE8 C;  1GYT A;  4WB4 A;  4XE5 B;  2NRG A;  4A38 A;  1PU9 A;  4OC5 A;  2XEJ A;  2XZR A;  2M5A B;  5B5E H;  5DWN A;  1QGK B;  3PLN A;  2PP6 A;  2MJZ A;  4WY4 B;  1BO4 A;  2PJ2 A;  2KLV A;  1OIP A;  1ZW0 A;  2DXQ A;  4A33 A;  3A7O A;  1GU4 A;  3B8E B;  4YGO A;  2HPC B;  1M56 D;  4Y99 B;  2H8P D;  2G8Y A;  3CXP A;  3P2H A;  4AG9 A;  2AXT E;  3VOP A;  1NTZ K;  3DR6 A;  2H88 C;  2GUS A;  4A94 A;  3DR8 A;  2BOA A;  2FE7 A;  2CNS A;  3QB8 A;  1MJ9 A;  2ZEF A;  1EDI A;  2KZJ A;  1Q2C A;  2Y9Y A;  2K37 A;  1Q7Y Q;  4GT1 A;  5KAI E;  1S5L H;  4BBH A;  3QAH A;  3IF4 A;  2GLJ A;  1NVO A;  5AW3 B;  1KMI Z;  3KDP B;  2ZVN B;  5GTI E;  5F48 A;  3FRM A;  1MJB A;  3CCJ P;  2FYN C;  3CXH E;  1YQ4 C;  1SQP D;  3WC5 A;  1BGY D;  2P6E A;  1NKN A;  2PJ8 A;  5AVU B;  4U3F E;  5G22 A;  4Z1M H;  1PGQ A;  4NCZ A;  5KLI C;  5AVZ B;  1OW7 A;  5J1Q A;  1LTI C;  4AVA A;  5H84 A;  1OZH A;  1S3J A;  3H1H G;  3D7D A;  2XND H;  5JPH A;  1FE6 A;  3KXD A;  3GIU A;  1OW6 A;  4CGL A;  4E0A A;  4KOR A;  1DD4 A;  1Z4E A;  5FVJ A;  1JUN A;  1FDO A;  1X10 A;  3AE4 C;  2PJB A;  1OX3 A;  5LYF A;  4U3F J;  4OWF A;  1KIL A;  2VQY A;  2PSW A;  1NAF A;  2FXM A;  1XTG B;  2K9Y A;  2QE7 H;  3TOB A;  4H2K A;  5IV0 A;  2Q1K A;  1KQS O;  2AFO A;  3EC4 A;  4BD9 A;  3CPX A;  4R3L A;  1SQX D;  4H0L C;  4ZX9 A;  1LTG C;  1HUC A;  4PD4 D;  4C7R A;  2PR1 A;  3RBZ A;  2IZ1 A;  3RK2 B;  1ZR2 A;  1YJ9 P;  1M57 D;  2BCC D;  2JBJ A;  1MJA A;  2OTJ P;  3H1J D;  2BL1 A;  2Z3P A;  2HB6 A;  1M8O B;  1KUX A;  1G1I A;  4DJL A;  1VHO A;  1VHE A;  4M3S A;  5DWM A;  1Q86 Q;  4UCM A;  1J4J A;  3L74 G;  4QMA A;  1R3N A;  2D4P A;  4DCK A;  1QL1 A;  3D3S A;  4OC4 A;  1LT9 B;  2PIY A;  4HNX B;  4DUK A;  3TF5 A;  4MCP A;  5C88 A;  1JNM A;  4R4M A;  1KIL C;  3S6K A;  4MHZ A;  2A4N A;  3EFG A;  5AG6 A;  5AW0 B;  2Z5I A;  3H6P A;  3CX5 E;  1IID A;  2Z10 A;  5A27 A;  3B7I A;  4CAE A;  1HVV A;  1JY2 O;  1V0C A;  1KIL D;  4OAD A;  1RE3 A;  2ZEE A;  1DH3 A;  5AW5 B;  3B5N A;  2CK3 H;  1Y0Y A;  5APV A;  3L70 D;  1KYO E;  3HE4 B;  2ZOF A;  5KTD A;  3UIA A;  2AFS A;  2IBZ E;  1SP4 A;  2ODF A;  1ZXG A;  3S1K A;  2IQ6 A;  1U7M A;  3GMA A;  2E74 D;  1NTM K;  4L73 A;  4O9B A;  1FZC A;  3PH0 A;  3D2P A;  2HC9 A;  2N1T B;  1X22 A;  4ASW A;  4XA4 A;  3NTN A;  3USS A;  4RS2 A;  4CAX A;  2R1I A;  3A0H E;  2C6P A;  3NA6 A;  5AVQ B;  2C1C A;  2ZW5 A;  1VQL P;  2B5G B;  4GKG A;  1QL2 A;  5E96 A;  2ZYG A;  1EQ7 A;  2R8V A;  3TNU B;  3GW6 A;  3NXS A;  2JEV A;  2Q5U A;  2F8H A;  4W9Y A;  3H8F A;  2W27 A;  2Z3M A;  1N2D C;  2FFD A;  1Z8X A;  1NTM G;  2PC1 A;  3L71 G;  1XIX A;  1Y8A A;  3H1L G;  3HUS A;  3H1K D;  4I49 A;  1HGZ A;  4KOU A;  4FD6 A;  1M4I A;  1EZV E;  4UIA A;  2QVA A;  2QYV A;  5H86 A;  3GG2 A;  2H89 C;  2GIV A;  1AV1 A;  2CNM A;  4AB7 A;  1R57 A;  1JM0 A;  2Z3L A;  1BGY E;  2WWW A;  1TU3 F;  2WSF H;  3CCQ P;  1LTJ A;  2MKV A;  3B5N D;  1L0N D;  4MCS A;  1ZP0 C;  2CIJ A;  1JEK A;  3W6X A;  2A06 D;  3PB9 X;  2V8H A;  2IYP A;  4UEZ A;  3TFY A;  3D7H A;  5KLV E;  3FGA D;  4I6M C;  2K9J B;  3BLN A;  3V2N A;  1CP7 A;  3VWE A;  2WSC H;  1SQV K;  4R8F A;  1OXZ A;  2LXB A;  3CC7 P;  2IYO A;  1BGY J;  2PJ6 A;  5GTH E;  3KQZ A;  4BXL A;  1QSR A;  4NJR A;  3ZDM A;  4ZY2 A;  1H8L A;  1CBX A;  2FFD C;  4ZI6 A;  2JLM A;  1M1J C;  1H0T A;  1NSA A;  4LGD E;  1MUU A;  3HUS C;  3FBU A;  3DDD A;  4QB9 A;  2P67 A;  3GLM A;  5KLI B;  5KLV J;  2VI7 A;  2ZEL A;  3RK3 C;  2P1J A;  3JCU H;  1XEB A;  4OME A;  5CBN A;  1YK3 A;  4DJG A;  1L0L G;  1NU1 E;  3A3Y B;  1LAN A;  4CYO A;  4U9Y A;  1NO4 A;  4NSQ A;  1LTJ C;  1SQV G;  1MFZ A;  1ARL A;  3RK3 D;  3WMM 0;  1YBK A;  2NMT A;  4C7H A;  2YND A;  2WYR A;  3WU2 H;  1KUY A;  1TF9 A;  2M3E A;  3PFO A;  3CWB E;  3BVH A;  1B6B A;  2EK9 A;  1YGH A;  1QSN A;  3GLJ A;  1FNO A;  1P4N A;  4KHX A;  1NGM B;  1VQ6 P;  2GA1 A;  3SJF A;  2XU6 A;  1E5W A;  3L36 A;  1FT7 A;  1M7L A;  4L8A A;  1TIQ A;  4QUS A;  1CP6 A;  4RES B;  2ZAE B;  1ZRT E;  5BVZ A;  2Q43 A;  1VF5 C;  3AE3 C;  2KSE A;  4D6T E;  2BCC J;  4UB8 H;  3O8Z A;  5LYD A;  3R9G A;  3CWB J;  1AFO A;  4E8O A;  2PE3 A;  2FKW B;  4C68 A;  4UB6 E;  1VF5 D;  3BCC E;  2GM4 A;  1QST A;  3DLJ A;  3IFM A;  4ASV A;  1F2O A;  4HJG H;  4H44 C;  2SPZ A;  1USE A;  4AG7 A;  4EYY Q;  1MZ9 A;  2YNC A;  2IDB A;  4CGO A;  3C9I A;  3KHZ A;  4C2X A;  3PP5 A;  4ZY0 A;  1YJN P;  3SXO A;  2YMY A;  4H44 D;  4D6T J;  3EY5 A;  4GIF A;  2PJ5 A;  1XFO A;  3F8K A;  1I1D A;  4PK2 A;  1KIL B;  3BCC J;  2NYQ A;  4P4E A;  1GW4 A;  2KUB A;  1BE3 E;  3M0D A;  4II9 A;  1Z9U A;  1K04 A;  4KOY A;  4HNW B;  3CX5 I;  4MN4 C;  2D2C D;  3D6Z A;  2Q04 A;  2E74 B;  1Z56 A;  3SXN A;  1AQT A;  3ABV C;  1P84 D;  3B35 A;  3AEE C;  1S2E A;  2QSI A;  3E1R A;  1J1D B;  3E1I A;  4NGP A;  4CGN A;  3NMD A;  2XKM A;  3M9B A;  4MFL A;  1BE3 J;  2VRS A;  2ZXE B;  2WPQ A;  1LOK A;  5BWA B;  1KB9 H;  1IYL A;  3B8G A;  1QQ9 A;  1NMT A;  1DX7 A;  1CX8 A;  2A45 H;  1CM0 A;  1JMB A;  1BLL E;  4OH8 B;  2DPT A;  3Q1M A;  1S5L X;  2GAN A;  1U7J A;  2HR3 A;  1S5K A;  1VIX A;  4A39 A;  2JR8 A;  1GTW A;  4I2L C;  1JMM A;  1EDK A;  1RY3 A;  3SJG A;  2G0B A;  4MY0 A;  5AW2 B;  2CNT A;  3WAB A;  3B5N B;  2YIU C;  4KT0 J;  2R3S A;  1ON0 A;  3CDX A;  1SQB D;  1N86 A;  1EZV I;  4OGQ C;  2BAS A;  4QC6 A;  2AFM A;  4PV1 C;  4F9U A;  2Z4E A;  1S60 A;  3JSV C;  4LX9 A;  2Q9I A;  1G1J A;  1J1E C;  5APU A;  1FZC B;  3AE6 C;  3PP9 A;  4C2Z A;  3G6E P;  2IL4 A;  4NXY A;  1VQ8 P;  1AVY A;  1Y9K A;  3IAO A;  2ZEP A;  1BAV A;  3CPA A;  1NH4 A;  3PRT A;  3V7Z A;  4KOW A;  3EQ2 A;  1XRY A;  4NPE A;  2OB0 A;  2B87 A;  1CSB A;  1I12 A;  3R2P A;  2ZED A;  3SJX A;  2R5B A;  2Y9Z A;  1S7N A;  2KS1 A;  2PVW A;  3RAM A;  2WZN A;  1GW3 A;  3A0B H;  5KAF H;  3WR7 A;  4EVY A;  3FX0 A;  1LP1 A;  1S7K A;  2O1J A;  2DF5 A;  1BCC E;  1N71 A;  1JB0 J;  4MI4 A;  1ZN5 A;  3PZJ A;  4CRY B;  3T8W A;  2FFD B;  2YO2 A;  2HOD A;  4KLV A;  1HTL C;  4JLY A;  3Q2Y A;  3LID A;  5I4M A;  2P6G A;  1PPJ G;  4NPD A;  4OP4 A;  3GB0 A;  1Y7E A;  1AMP A;  3FYN A;  3RK3 B;  4P4J A;  5E79 E;  5CBO A;  2GUV A;  3ITK A;  1AJY A;  1YSJ A;  1VL2 A;  4KSI A;  2QIR A;  1PGO A;  3CZX A;  2AJ6 A;  1BDC A;  3Q5R A;  3RO0 A;  1BCC J;  2RH0 A;  1FZA A;  3SSU A;  4B12 A;  3Q3D A;  1FZF A;  3TGU E;  4LQG A;  1RF0 C;  1LWU A;  1KQG B;  1RHZ B;  3DNS A;  3K2K A;  5AW8 B;  1M4L A;  5HVF A;  1H89 A;  2O53 A;  4CS0 B;  3QNV A;  4KUA A;  3L73 E;  2K3R A;  4IFF A;  2FXF A;  5CJ4 A;  2V8V A;  3T97 A;  1A2Z A;  1URQ A;  3S9O A;  1IFD A;  4XPL A;  2V4H A;  3L35 A;  4HKZ H;  3RGU A;  1IK9 A;  1VF5 B;  1IU8 A;  2Q4Y A;  5A28 A;  1T3U A;  1LGH B;  3LD2 A;  2WSE H;  1H0T B;  5LRJ A;  3TDK A;  1SFC A;  3D71 A;  3TGU J;  1YLE A;  5GCN A;  2X7B A;  3U1C A;  4H44 B;  1N7L A;  2KXP B;  5JH9 A;  2RC4 A;  1PUA A;  1ZV8 A;  1IFP A;  3L73 J;  4RI1 A;  4EFD A;  4C2Y A;  2KOG A;  2J8N A;  4M3L A;  1Y9B A;  2R98 A;  3I56 P;  1DE4 C;  4KUB A;  5K8N A;  1FZE A;  2IBZ G;  2ZXV A;  2PGD A;  2ZPA A;  4Y49 C;  4CAF A;  5C82 A;  2B9B A;  2FYU D;  1SQQ D;  2V8D A;  4IL6 H;  3PBE A;  1L4A A;  1UFH A;  4ZYQ A;  3WUT A;  1VDF A;  5AVR B;  2VZZ A;  2G9D A;  3D6Y A;  2PJ7 A;  2OYH C;  4GOF A;  2KCW A;  4PXD A;  4C7N A;  5TJH A;  2KI7 B;  1EC5 A;  4W80 A;  1YR0 A;  4NGT A;  2Y0E A;  4KLW A;  4FD7 A;  3JVN A;  4M6I A;  3GHG C;  3VYI A;  3FWL A;  1PP9 D;  1SFC C;  2P2U A;  2E5Y A;  2C6G A;  1URQ D;  3L72 D;  4F0X A;  3CCR P;  1S9K D;  4Z65 A;  1YX0 A;  2OYO A;  4U5Y A;  3VTP C;  5KLV K;  1SFC D;  3H5Z A;  3MUD A;  1IJD B;  4L74 A;  1SQB E;  3N4X A;  1QSO A;  2GRE A;  3FB3 A;  1XOV A;  2HV2 A;  4PSW A;  3KZW A;  2PRQ A;  1H8A A;  2YMK A;  1CPX A;  1S72 P;  4JD6 A;  1L4A C;  4RN7 A;  2FSR A;  2O01 N;  4HKF A;  4N78 D;  2W6A A;  3IO1 A;  1BDD A;  3K9U A;  2FY8 A;  3SHP A;  2J8R A;  4FAI A;  3AEA C;  1SQB J;  1NTK E;  5KLV G;  1L4A D;  4UFW A;  4UEF A;  3MIW A;  1NU1 K;  4K3N A;  2EBJ A;  4U9Z A;  2Q3E A;  1NTZ G;  3VP8 A;  5DS0 A;  1CPS A;  3FXE A;  5APS A;  2GE3 A;  5H2F E;  1FBM A;  2JWA A;  2AXT H;  2H43 A;  3ISX A;  1BSN A;  1HGV A;  3TCV A;  1ZME C;  4FD5 A;  3AEF C;  4MCQ A;  1RF1 C;  4LQ6 A;  3MUD C;  2J58 A;  5EBV A;  3H1I G;  1NTK J;  5F09 A;  2QJ8 A;  5K8O A;  3PFE A;  5M1B A;  2J5U A;  2Q44 A;  2V7Q J;  5KAI H;  3F5H A;  4XPD B;  3BHX A;  1NU1 G;  3WUV A;  3L75 E;  4UWJ A;  5GTI H;  4L89 A;  1OVV A;  3CXH H;  2JO1 A;  2QJY C;  4IF5 A;  1X79 B;  3CWB G;  2WPW A;  2IZ0 A;  3B3T A;  3F5B A;  5J8C A;  1NTZ D;  2NZ2 A;  3H8E A;  4JQ0 D;  3MTU E;  1KUV A;  5ELY A;  2L5G B;  1GHE A;  3RL0 g;  5B66 E;  1HDQ A;  4UCP A;  3H1H D;  2KB7 P;  3L75 J;  4BIN A;  3AE7 C;  5AVT B;  4UWI A;  3CI9 A;  4H0L D;  1QVF O;  3M9Q A;  4D6T G;  3CPW O;  3H1I D;  1IY7 A;  2AFZ A;  3WC7 A;  1VQM P;  1GL2 C;  3FX6 A;  2RFH A;  3PGP A;  3S6H A;  4YXW H;  3I5C A;  1R8E A;  2JJL A;  2B87 B;  5CJ0 A;  4JZ0 A;  2XV5 A;  2W6J H;  2OOT A;  3BI0 A;  2KS1 B;  3V2P A;  3G8W A;  3FEC A;  2BUE A;  3P8C D;  3PRJ A;  1EXI A;  5AVY B;  1LP1 B;  2ZW4 A;  2HOD B;  2PRR A;  2ABZ A;  1GK6 A;  4QBJ A;  1UII A;  2A45 G;  4H6U A;  1YW4 A;  3R4Y A;  1BE3 G;  2IFM A;  1OFC X;  5D8N A;  1LJ2 A;  4WWV A;  2JKV A;  4JPZ B;  2PR8 A;  1U6M A;  2Q3I A;  1FJK A;  2KNC A;  3OAK A;  4OC1 A;  2B4B A;  3FF3 A;  3L74 D;  2JEE A;  2FYU J;  1VGY A;  5F49 A;  2DPS A;  2HQY A;  3BRV B;  3CXS A;  3BJ8 A;  2QM7 A;  2I00 A;  1QEX A;  5IB9 A;  3I9S A;  2FIW A;  2ZEO A;  1LWU B;  3CX5 H;  2C0W A;  4EOT A;  4ZX8 A;  2OTK E;  1UWY A;  2ITA A;  2F7V A;  4RUH A;  3HE5 A;  3V2R A;  4BRY A;  1Z8W A;  3T97 B;  1URQ B;  3IGR A;  1XBU A;  1M1J A;  1NWQ A;  1KYO H;  1JWQ A;  1USD A;  3NE7 A;  3Q5P A;  1YJW P;  3GYA A;  4NGN A;  2R7H A;  4F9V A;  3W6S A;  1SFC B;  3KKW A;  1M44 A;  2R5D A;  3CLQ A;  1CW5 A;  1K8A Q;  3G3S A;  2KP8 A;  3AEC C;  1IOF A;  3QWO C;  3JUW A;  1SQP E;  1KQF B;  3GUX A;  2WSS H;  4X3R A;  3A0H H;  1G2C A;  4R3K A;  1RQU A;  4IOI H;  1S7L A;  3AE5 C;  2PJ3 A;  1X12 A;  4DOJ A;  4MRI A;  2VL1 A;  1HF9 A;  3HTK A;  1LFW A;  4W7Y A;  5F46 A;  3PB4 X;  2AE6 A;  1L4A B;  1YW6 A;  4YRH A;  2PJ4 A;  2FCK A;  2VBQ A;  1NTM D;  3KPE A;  2ZYD A;  3L71 D;  1SQP J;  3NFQ A;  3FMC A;  2QEC A;  3H1L D;  3S6F A;  4A32 A;  2K88 A;  4C7N B;  3D7G A;  1JY3 N;  4B5P B;  2BSW A;  4H13 C;  4KOT A;  3F89 A;  2FYN B;  1FU1 A;  4TLF A;  2C27 A;  1VQN P;  4KOX A;  3SI1 A;  1DD3 A;  2WPS A;  1NKZ B;  2PJ9 A;  4JYW A;  1DEE G;  4KSF A;  2E76 C;  1BCC G;  4MJ8 A;  2OQQ A;  4A95 A;  4JBZ A;  4DYO A;  4J3G A;  3LMS A;  1SQX E;  4PD4 E;  2WUU A;  4NGM A;  2E76 D;  5HMN A;  1H88 A;  3P32 A;  2BCC E;  2E5T A;  2Q51 A;  2WPX A;  4DZO A;  4MXU A;  3R96 A;  3H1J E;  2AFX A;  2KZI A;  1JTH A;  2ZFC A;  1M4G A;  2PCU A;  5GTH H;  1NJI Q;  4Y28 J;  5D29 A;  3H8G A;  4YFJ A;  3PTZ A;  5TIS E;  2RKL A;  1SQX J;  4YWY A;  1W5C E;  3B3W A;  4M85 A;  2P58 A;  4I7Z C;  3OA7 A;  2OH1 A;  4A30 A;  4H0L B;  3H1J J;  1FZB A;  3HUV A;  3MN8 A;  3L73 G;  4W7Z A;  1L0L D;  1VQ9 P;  1KIL E;  3D70 A;  1MFT A;  1GDT A;  1KN7 A;  2BO9 A;  4P4B A;  1SQV D;  4X5K A;  2PJA A;  4U7J A;  2M8R A;  4KOV A;  4XPK A;  5CCG C;  3CME P;  3VMZ A;  3L70 E;  4UEE A;  3W91 A;  4B86 A;  3NH8 A;  3CCU P;  4IK2 A;  3W68 A;  3K5B A;  4IL6 X;  2PAJ A;  2WPV B;  4RKU J;  2JDI H;  3SWY A;  1EDJ A;  2ZEN A;  4P10 A;  5I0C A;  4B13 A;  1IFN A;  2ZEH A;  1K9M Q;  3ZJ0 A;  3A5T A;  2GLF A;  1A02 F;  4G1P A;  4I1L A;  4OIW A;  2PJ0 A;  2QJK C;  3MD0 A;  3L70 J;  4UB6 H;  4EIJ A;  1M1K Q;  3B3V A;  4PJ0 E;  2O4H A;  2QRX A;  4OVN F;  2J59 M;  3V4Q A;  2P0W A;  1IB1 E;  1Z4R A;  3MGD A;  1W2E A;  3IR9 A;  2WQY C;  3H1K E;  2P6F A;  3B3S A;  4CGP A;  5AW1 B;  2FS5 A;  4IUS A;  1CG2 A;  3KZI E;  1HBW A;  2XNX A;  4N6J A;  3N5F A;  4CGM A;  3FNC A;  2PDO A;  4P44 A;  1HH0 A;  4ZY1 A;  1PGJ A;  3P7K A;  3D66 A;  4ZBG A;  4JJX A;  3CC2 P;  1L0N E;  2A06 E;  1NTK K;  1SLQ A;  3B3C A;  3CT9 A;  1N73 A;  4WY4 C;  4CRZ B;  1BPN A;  1FY7 A;  2G3T A;  1NHL A;  3LW5 H;  3H1K J;  2R3C A;  3BAS A;  2JP3 A;  2IJZ A;  3S9M A;  2YKO A;  1YVK A;  1LRZ A;  3BXM A;  4MFP A;  3V4W A;  4Y99 C;  2R44 A;  4R76 A;  3KL9 A;  4NPF X;  3C1L A;  2ZEM A;  4YXD C;  2HG5 D; 
#chains in the Genus database with same CATH homology
 5KKZ C;  1K05 A;  1UFH A;  2G3A A;  5G1Z A;  2VZZ A;  2YGW A;  4M3S A;  4R57 A;  5DWM A;  4B14 A;  1S7F A;  3D6Y A;  3P2F A;  2KCW A;  4UCM A;  1J4J A;  3RYO A;  2D4P A;  4FD4 A;  2ARH A;  1YR0 A;  3D3S A;  2ZT9 C;  4KLW A;  4FD7 A;  3JVN A;  2WSA A;  4HNX B;  1M4D A;  4OGQ D;  3V8I A;  5C88 A;  4PV1 D;  4R4M A;  3S6K A;  2B3U A;  2A4N A;  5AG6 A;  5F47 A;  4MBU A;  4F0X A;  2ZT9 D;  1IIC A;  3F0A A;  2OZG A;  1RO5 A;  1YX0 A;  4U5Y A;  1IID A;  2Z10 A;  5A27 A;  3RK3 E;  4UFV A;  4CAE A;  2Z3K A;  4XNH B;  4MY3 A;  1V0C A;  2B4D A;  4QVT A;  3H5Z A;  4B5O A;  2OZH A;  1M1D A;  4OAD A;  4R87 A;  4PSX A;  1QSO A;  3FB3 A;  5KTD A;  2HV2 A;  4PSW A;  4NF1 A;  4JWP A;  3GMA A;  3TE4 A;  2E74 D;  2YMK A;  4JD6 A;  3D2P A;  4AVC A;  2FSR A;  2E76 B;  3EO4 A;  1NYH A;  4HKF A;  4RS2 A;  2OU2 A;  4CAX A;  4NEX A;  2R1I A;  1BOB A;  1I21 A;  4F6A A;  3K9U A;  4UCN A;  3SHP A;  2J8R A;  3AEA C;  1U57 A;  1RQV A;  2ZW5 A;  4UFW A;  4KVX A;  2B5G B;  4CAW A;  5E96 A;  3I3G A;  3VWD A;  4U9Z A;  2R8V A;  2O01 J;  3S6G A;  2JEV A;  3C26 A;  2GE3 A;  5JQ4 A;  2Z3M A;  4HNY B;  5G20 A;  5G21 A;  2PC1 A;  3TTH A;  1XIX A;  3TCV A;  1ZME C;  2ZW6 A;  4FD5 A;  3T90 A;  3AEF C;  4CYQ A;  4I49 A;  4KOU A;  4FD6 A;  3IN6 A;  1M4I A;  4OLL A;  1IK7 A;  2K5T A;  3B71 A;  5EBV A;  5H86 A;  3AE1 C;  2H89 C;  2D2C C;  2REE A;  2GIV A;  2CNM A;  5M1B A;  4AB7 A;  2J5U A;  2Q44 A;  2V7Q J;  1R57 A;  2O28 A;  4XPD B;  2Z3L A;  4I7Z B;  1TU3 F;  2VZY A;  3IU1 A;  4JXQ A;  2MKV A;  2E75 C;  4UWJ A;  1K4J A;  1ZP0 C;  3IU2 A;  4L89 A;  3W6X A;  2CY2 A;  2JO1 A;  2QJY C;  5KTC A;  4IF5 A;  2WPW A;  3A9L A;  4OAE A;  3F5B A;  4R4L A;  3TFY A;  2E75 D;  1RXT A;  5J8C A;  3EWK A;  3GF3 A;  2NZ2 A;  3FGA D;  1HJ0 A;  4KSA A;  3BLN A;  1KUV A;  3VWE A;  2J8M A;  1GHE A;  3RL0 g;  2YNC C;  4GS4 A;  4UCP A;  4KOS A;  4K30 A;  2QJP C;  4JXR A;  2FT0 A;  1QSR A;  5IX3 A;  3LW5 J;  2HUZ A;  3AE7 C;  4UWI A;  3AEB C;  4H0L D;  2PRB A;  2VXK A;  2JLM A;  3LOD A;  4F0Y A;  3FBU A;  3DDD A;  3FXT A;  1Q90 D;  2QML A;  4QB9 A;  3E0K A;  4ONU A;  3GLM A;  1PV3 A;  2VI7 A;  3PGP A;  3S6H A;  1XEB A;  1R8E A;  2Q0Y A;  4Q38 A;  1YK3 A;  4CYO A;  4U9Y A;  4NSQ A;  3FIX A;  3G8W A;  2BUE A;  2NMT A;  4C7H A;  2YND A;  1EXI A;  1KUY A;  4Q36 A;  2ZW4 A;  1B6B A;  5AG4 A;  1YGH A;  1QSN A;  1P4N A;  3TO7 A;  3TO6 A;  3D2M A;  4UFX A;  1NGM B;  4PV6 A;  5AGE A;  4QBJ A;  3R9F A;  1MKM A;  3H4Q A;  4MFJ A;  3BJ7 A;  4H6U A;  3SFD C;  3R4Y A;  4L8A A;  1TIQ A;  4QUS A;  4BMH A;  4H13 B;  2Z3P A;  4YTP C;  1XE4 A;  5ISV A;  1P0H A;  4XFJ A;  1QSM A;  1ZRT E;  2BEZ F;  4ZGY B;  2PR8 A;  1U6M A;  3D8P A;  2B4B A;  1VF5 C;  3AE3 C;  4KS9 A;  4UA3 A;  2H5M A;  4XPD C;  1GMJ A;  3AE2 C;  3R9G A;  5F49 A;  1YQ3 C;  4E8O A;  2DPS A;  2HQY A;  2B3V A;  4ORF A;  3CXS A;  3BJ8 A;  4C68 A;  2FIA A;  4MFQ A;  2I00 A;  1VF5 D;  5CNP A;  3I9S A;  2FIW A;  5J8F A;  1WWZ A;  4C7I A;  1QST A;  4H44 C;  4AG7 A;  4KZT A;  2YNC A;  2IDB A;  4CGO A;  1ZO0 A;  4KVO E;  2Z0Z A;  4OGQ B;  4C2X A;  4PV1 B;  3SXO A;  3T97 B;  3DSB A;  3IGR A;  4H44 D;  3EY5 A;  2ZT9 B;  3NE7 A;  1Y9W A;  3Q5P A;  3GYA A;  1WK4 A;  3F8K A;  1OMI A;  1I1D A;  4PK2 A;  2R7H A;  3W6S A;  3KKW A;  1M44 A;  1OZP A;  2EUI A;  4H6Z A;  4AVB A;  3Q5S A;  3G3S A;  2F5I A;  3AEC C;  2Z11 A;  3AE9 C;  4II9 A;  1Z9U A;  3JUW A;  4B11 A;  1KQF B;  1K04 A;  5L8R J;  2ZW7 A;  4KOY A;  4HNW B;  3D6Z A;  2B5G A;  2D2C D;  4R3K A;  4B10 A;  2Q04 A;  2E74 B;  5EC4 A;  2CXA A;  3SXN A;  1RQU A;  2P10 A;  1B87 A;  1S7L A;  3AE5 C;  3IWG A;  1Y7R A;  4A31 A;  2WSE J;  3ABV C;  1CJW A;  1HF9 A;  3AEE C;  3G9R A;  3R9E A;  4E2A A;  2QSI A;  2JDC A;  5F46 A;  4CGN A;  3GF7 A;  1UIX A;  4MFL A;  2AE6 A;  4XNH C;  4YRH A;  2FL4 A;  5BWA B;  2FCK A;  1DIP A;  2VBQ A;  3TOA A;  1VKC A;  1IYL A;  2REF A;  3B8G A;  1EXJ A;  1NMT A;  3S6F A;  2QEC A;  2Z3N A;  2Q7B A;  4A32 A;  1VHS A;  1CM0 A;  2BSW A;  4B5P B;  4MHD A;  4H13 C;  4KOT A;  1OW8 A;  2DPT A;  2C27 A;  1PL5 A;  3Q1M A;  1S5L X;  4KOX A;  1NSL A;  5HH1 A;  1SQH A;  1DD3 A;  2GAN A;  1FDI A;  2B58 A;  4KSF A;  1S5K A;  2E76 C;  3AEG C;  4MJ8 A;  2OQQ A;  4A95 A;  4J3G A;  2YNE A;  4PK3 A;  3IWE A;  2ATR A;  2D4O A;  2WUU A;  2B4D B;  2G0B A;  4MY0 A;  2CNT A;  2E76 D;  3T9Y A;  2YIU C;  2D2C B;  4KT0 J;  2FBW C;  4MFZ A;  4GDO A;  5HMN A;  1MK4 A;  2WPX A;  3R96 A;  1ON0 A;  1S3Z A;  1NE9 A;  3TO9 A;  4CYP A;  4OGQ C;  1M4G A;  4QC6 A;  4PV1 C;  4B5P A;  4A2Z A;  4Y28 J;  1S60 A;  4LX9 A;  1XF8 A;  3H25 A;  2E75 B;  3UY5 A;  4YFJ A;  3AE8 C;  3AE6 C;  3PP9 A;  3TT2 A;  4C2Z A;  1PU9 A;  2IL4 A;  4NXY A;  5DWN A;  2JDD A;  1Y9K A;  3IAO A;  3R1K A;  4M85 A;  4KOW A;  2OB0 A;  1BO4 A;  1Q2Y A;  1I12 A;  2BEQ D;  4I7Z C;  2DXQ A;  4A33 A;  2OH1 A;  4A30 A;  4H0L B;  1S7N A;  1YVO A;  1Q2D A;  4YGO A;  2E74 C;  3WR7 A;  2Z3O A;  2G8Y A;  3CXP A;  3P2H A;  4Y49 B;  4AG9 A;  1S7K A;  4EVY A;  1KIL E;  1N71 A;  3D70 A;  1JB0 J;  3DR6 A;  2H88 C;  3N7Z A;  4X5K A;  4MI4 A;  1S1C X;  3PZJ A;  4CRY B;  4U7J A;  3DR8 A;  2EVN A;  2FE7 A;  1XMT A;  2CNS A;  1YRE A;  3QB8 A;  4KLV A;  4KOV A;  4R9M A;  1MJ9 A;  4JLY A;  3Q2Y A;  3CXQ A;  4XPK A;  2P6G A;  3R95 A;  3OWC A;  3W91 A;  1Q2C A;  2I79 A;  4DNC A;  3FYN A;  4IL6 X;  3EFA A;  4BBH A;  1KTM A;  2WPV B;  4RKU J;  1PIX A;  1AJY A;  2PQ8 A;  1VL2 A;  3QAH A;  4UBR A;  2QIR A;  1KMI Z;  4CYN A;  1ZOY C;  4MFK A;  5F48 A;  5I0C A;  3FRM A;  1MJB A;  4B13 A;  2AJ6 A;  2FYN C;  3Q5R A;  1YQ4 C;  3GY9 A;  3ZJ0 A;  2P6E A;  5G22 A;  4Z1M H;  4B12 A;  2VEZ A;  3Q3D A;  2OZU A;  4NCZ A;  2QJK C;  5KLI C;  1OW7 A;  1L0C A;  3O6Q A;  4AVA A;  1KQG B;  5H84 A;  5KTA A;  3DNS A;  2BEI A;  3C8V A;  5JPH A;  1WMK A;  5AG7 A;  1OW6 A;  4CGL A;  4E0A A;  4CS0 B;  2P0W A;  2WSF J;  1IB1 E;  1Z4R A;  1DD4 A;  2Y0M A;  3MGD A;  4KOR A;  4KUA A;  5IB0 A;  1Z4E A;  1KOR A;  1IYK A;  2FXF A;  5FVJ A;  2WQY C;  2P6F A;  4CGP A;  3S9O A;  4TT3 H;  1FDO A;  4XPL A;  2FS5 A;  1VF5 B;  2Q4Y A;  4IUS A;  3AE4 C;  5A28 A;  3LD2 A;  4LUA A;  3GKR A;  3D71 A;  4H89 A;  2VQY A;  2PSW A;  3FNC A;  4CGM A;  2PDO A;  1YLE A;  3JTK A;  5GCN A;  4ZBG A;  2Q4V A;  4JJX A;  2X7B A;  2K9Y A;  4KVM E;  2WSC J;  3TOB A;  3ZZI A;  4CAV A;  4H44 B;  5AG5 A;  5IV0 A;  3AED C;  4CRZ B;  2RC4 A;  1FY7 A;  1PUA A;  2G3T A;  3EC4 A;  4RI1 A;  2QIW A;  4R3L A;  4C2Y A;  4H13 D;  2J8N A;  4H0L C;  1Y9B A;  2JP3 A;  2R98 A;  1YVK A;  1KZF A;  1LRZ A;  2FXP A;  4MFP A;  4KUB A;  2ZXV A;  2PR1 A;  2ZPA A;  3EXN A;  4Y49 C;  4CAF A;  5C82 A;  1MJA A;  2BL1 A;  4YXD C;  1KUX A;  3SFE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...