2G3AA

Crystal structure of putative acetyltransferase from agrobacterium tumefaciens
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
b'MNFVLSDVADAEAEKAIRDPLVAYNLARFGESDKRDLNITIRNDDNSVTGGLVGHTARGWLYVQLLFVPEAMRGQGIAPKLLAMAEEEARKRGCMGAYIDTMNPDALRTYERYGFTKIGSLGPLSSGQSITWLEKRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acetyltransferase
publication title Crystal structure of putative acetyltransferase from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Transferase
total genus 33
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2g3aA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2g3aA02
3IWGA 2PSWA 5H86A 3AECC 2R7HA 3P2FA 3SXOA 1PV3A 2PQ8A 2OU2A 4F0YA 2REEA 4CAXA 2R98A 3N7ZA 1QSRA 4XPLA 4KORA 4YGOA 2ZPAA 1KTMA 3WR7A 1IYLA 1RXTA 1N71A 3R1KA 3AEFC 1OW7A 1M4IA 3W91A 2HUZA 3SXNA 3AEEC 2WPWA 2P6GA 3R9EA 4XPDB 3LD2A 5F48A 1CJWA 3FBUA 1M4GA 2VZZA 3VWEA 1CM0A 3KKWA 4KZTA 3G3SA 2Q7BA 4KOUA 4NEXA 4KOVA 2VBQA 3DDDA 1XIXA 4EVYA 2G3AA 2AE6A 3JVNA 2RC4A 2NMTA 4CRZB 1M1DA 2Y0MA 1NSLA 3CXSA 3G8WA 2QECA 1UFHA 2EUIA 3BJ8A 3UY5A 4KVOE 2PRBA 2J8RA 4MY3A 2B4DB 1YX0A 4QC6A 3QAHA 5CNPA 4NCZA 4NSQA 1RO5A 2IL4A 5EC4A 4YXDC 1MJBA 5GCNA 4YTPC 2Q4YA 4KUBA 5FVJA 2Z11A 3I3GA 3FIXA 4U9YA 1SQHA 4KOWA 2I79A 1S7KA 3F5BA 2BL1A 2Z0ZA 1YLEA 1U6MA 3B71A 2WPXA 2O28A 1Q2DA 2KCWA 4OAEA 1IB1E 1OZPA 2Q0YA 1S60A 4PK3A 4M3SA 3QB8A 1K04A 4YRHA 3SHPA 4MY0A 5IX3A 3CXQA 4R3LA 1K05A 3ZZIA 4B5PB 2VXKA 1VHSA 4AVAA 5DWMA 2QIRA 1WWZA 1QSOA 3EC4A 2ARHA 1KUYA 1YR0A 4IUSA 1I1DA 1LRZA 4K30A 4PV6A 4L89A 2CNSA 3FNCA 1YQ4C 3TOBA 5C82A 2K5TA 4H89A 4FD5A 4MHDA 4HKFA 2FCKA 4KLVA 1YVOA 3NE7A 3S6FA 4KUAA 2Q44A 2HV2A 4B5PA 1ZOYC 4M85A 1S5KA 4JLYA 4KLWA 2OZGA 3AEAC 3AE6C 5KTAA 3AE9C 3R96A 3T90A 1Q2CA 1Y7RA 1L0CA 4ONUA 1QSTA 1QSMA 2AJ6A 5HH1A 1M4DA 3S9OA 4QBJA 2I00A 1YQ3C 5J8FA 3AE1C 1QSNA 5HMNA 1S3ZA 4AG7A 2HQYA 4MI4A 4JJXA 2GANA 4PSXA 2GIVA 3DNSA 3S6KA 5DWNA 3C26A 1P4NA 2FSRA 4JXRA 4QUSA 4XNHB 3AEBC 2CNMA 2VI7A 3MGDA 1MJAA 2B4BA 4HNXB 5F49A 2FBWC 2DXQA 3R95A 4Y49C 3ABVC 4DNCA 3R9GA 3EFAA 4LUAA 3SFDC 4RS2A 1ZP0C 3FYNA 1V0CA 3GY9A 3V8IA 4U5YA 3B8GA 4AG9A 2OZHA 3TCVA 1B87A 1Q2YA 1Z4RA 3E0KA 2B3UA 5JQ4A 3P2HA 2B5GB 1R57A 2ZW5A 3IGRA 3H4QA 1WK4A 1P0HA 4J3GA 2PDOA 2JEVA 2FT0A 4FD4A 3OWCA 3AEDC 2G3TA 2QMLA 3AE2C 1KUXA 2BEIA 4HNYB 3AE3C 4BMHA 3DR8A 2F5IA 3F8KA 3VWDA 2PR1A 2R8VA 1ON0A 1S7NA 2X7BA 1KZFA 2B5GA 2FIAA 2JDDA 2C27A 3ZJ0A 1I21A 4KOSA 4OLLA 4UWJA 2Q04A 2FE7A 3DR6A 2FS5A 3GYAA 1S7FA 4KOXA 2ZW4A 3TO9A 4FD7A 4PSWA 2JDCA 4H6UA 4F6AA 2P6EA 3BJ7A 1XF8A 1Z4EA 4NXYA 2H88C 1XE4A 2B58A 4AB7A 4R3KA 1YGHA 4XPDC 1GHEA 2PC1A 4CAWA 2P0WA 1YK3A 2VEZA 2ZW7A 2ZXVA 2A4NA 3TT2A 3FB3A 4L8AA 3W6SA 4II9A 4UBRA 3S6HA 1IIDA 2JLMA 5KTCA 5KTDA 4OADA 4NF1A 3EY5A 4XPKA 5I0CA 2D4OA 3D2PA 4YFJA 2EVNA 1NMTA 2P6FA 3D2MA 4I49A 4JD6A 5IV0A 4GS4A 1S7LA 1BOBA 1Z9UA 3TE4A 3SFEC 1VKCA 2FXFA 5J8CA 2OZUA 3DSBA 2H89C 2D4PA 2FIWA 3S6GA 1PUAA 2CY2A 4E2AA 3TOAA 1MK4A 4R9MA 3CXPA 4KVME 3FXTA 3D8PA 2H5MA 3GKRA 4JXQA 3TO6A 3AE5C 1MJ9A 4MJ8A 3FRMA 3W6XA 4CS0B 1OW6A 2Q4VA 3I9SA 2G0BA 2VQYA 4U9ZA 1IICA 2BSWA 4FD6A 1FY7A 3EO4A 4H6ZA 5JPHA 3EXNA 5H84A 2ATRA 4R87A 2ZW6A 3PGPA 5F46A 4B5OA 4E0AA 2FL4A 3PZJA 4IF5A 1M44A 4CAVA 1IYKA 4RI1A 1Y9WA 2GE3A 4X5KA 4KVXA 3AE4C 1I12A 3RYOA 4HNWB 2OH1A 2PR8A 4UWIA 1B6BA 2Z10A 2B4DA 1XEBA 4QVTA 4Y49B 4JWPA 2R1IA 2J8NA 2OB0A 2WQYC 2B3VA 1YVKA 2REFA 1TIQA 1K4JA 1OW8A 1J4JA 2BUEA 4UA3A 4LX9A 1BO4A 3BLNA 1YREA 3AEGC 4KOYA 4AVBA 2CNTA 3D3SA 5F47A 4XNHC 2J8MA 5C88A 1Y9KA 3TTHA 4ORFA 1XMTA 4KOTA 3T9YA 3TO7A 4E8OA 4ZBGA 5ISVA 4AVCA 3AE8C 1NE9A 3K9UA 3AE7C 4PK2A 5IB0A 4QB9A 2VZYA 3PP9A 4R57A 3TFYA 3JUWA 1KUVA 3R9FA 5E96A 5EBVA 3LODA 4MBUA 3F0AA 1PU9A 4CRYB
chains in the Genus database with same CATH superfamily
3IWGA 2PSWA 1KQLA 4JQ0D 2Z5IA 1NTMK 4MCQA 3PBBA 2YMYA 2PP6A 3USSA 1FOSE 2PQ8A 4F0YA 1PP9G 1DTDA 2G8YA 3L2NA 1QSRA 2PJBA 2KOGA 5TISH 1KTMA 1BE3G 2LKMA 3L73D 1H0TB 2P7JA 2ZELA 2KP8A 1N7SC 3RK2B 1XTGB 1E5WA 1ZN5A 3JCUE 1EC5A 4FWUA 4Q38A 1YJNP 2ABZA 1H88A 1CJWA 3FBUA 1NTMJ 1FE6A 4LLHA 2Q7BA 2JDIH 3EQ2A 4KOVA 1J1EB 3CWBE 1PGOA 3L74D 2PJ2A 4HYTB 1NSLA 1HBWA 3G8WA 5CCGD 4DJGA 3BJ8A 2HODB 2E74D 1LTGC 2J8RA 2XKMA 2B4DB 3BI1A 1YX0A 4QC6A 2R3SA 1VQKP 3QAHA 3D71A 4UCNA 1YTZT 2CTBA 1VF5C 4DT0A 1MJBA 4X8IA 3IWWA 5GCNA 1SP4A 3TF5A 2Z11A 1QLED 1N2DC 1JB0J 1L0LE 4KOWA 1JCDA 2Z0ZA 1YLEA 2JBKA 1X9VA 3HLPA 1SQVE 3B71A 1OVRA 5LYDA 3RK2D 1Q2DA 1OZPA 2O01N 2ZT9C 5CBOA 4PXDA 2K88A 5TJHA 4RJTA 2WSCH 2N9BA 1VHSA 3WUUA 2M0BA 5AVYB 3SWKA 2YKPA 4PJ0E 2PJ9A 3GHGB 2ZEEA 1YR0A 3HTKA 4IUSA 2AEJA 1JMBA 3WUVA 3MHVA 3FNCA 4MXUA 3OAKA 3FGAD 3Q5RA 1NTKE 4L75A 3W67A 2K5TA 1N7SA 3HE4A 1GL2D 4PD4I 3I56P 4GDOA 1VQ9P 2MKVA 2F7VA 3Q2YA 4L73A 2I8DA 2HV2A 1T2KD 2XU6A 3CMAP 2XNXA 1S9KD 1LWUB 1Q7YQ 4JLYA 4KLWA 5HVFA 3AEAC 2C9LY 1NWQA 3LW5J 3M9BA 3A3YB 3GLMA 3L36A 4DOJA 1TF8A 3RK3C 3L71J 2FYUG 1YIJP 1AUGA 3S9OA 5APTA 2AFSA 1HVVA 3PLNA 3DLJA 3TNUA 2R32A 2I00A 4YWYA 1RE3C 4WB4A 4BINA 1EQ7A 1ZV8A 3M9HA 4KSFA 5APXA 3V2PA 1CG2A 4JJXA 3RZAA 1QVGO 4BRYB 4PSXA 3CD6P 2GIVA 2YNYA 3L71G 1GDTA 1R5LA 3C26A 1Z56A 1U7MA 3I1UA 3H1ID 4QUSA 5E79H 4XNHB 1R43A 2CPBA 2DEAA 3JTKA 2POHA 4HNXB 5F49A 1VQMP 2J58A 4O23A 3C8VA 3R95A 4PD4H 1S1CX 3ABVC 4H0LB 1NU1D 1RHZB 2WZ7A 3IJ3A 3PFOA 3CCRP 3RL0B 4UEEA 4A33A 2XEGA 1SQQJ 5I4MA 3GY9A 1PPJG 4U5YA 3IR9A 4AG9A 3MIWA 1FS0E 1JTHB 5KLVE 3VP8A 1HJ0A 3IN6A 2Y9YA 2ANPA 3PBEA 2B3UA 2EBJA 2QA4P 3P2HA 2WPVB 1R57A 5GTHE 4KJMA 1PYTB 3CDXA 1EDIA 4KSAA 2R5BA 4ASWA 1SQQG 2FT0A 1ZRTE 2JEVA 3AEDC 2ZAEB 2JO1A 2AXTH 3AE2C 3P8MC 2ZYAA 2BEIA 1EZVG 4HNYB 4BMHA 3KHUA 5CCGC 4RESB 2HYNA 2DW3A 3VWDA 2PR1A 1Q81Q 2E74C 1T3JA 3RBUA 1LT1A 4H13B 2FFDB 2X7BA 2B5GA 3BI0A 5AGEA 3PB7X 2C27A 2C0XA 1WT6A 4UWJA 3U59A 2Q04A 2AFMA 2GLJA 2CPSA 3GYAA 4KOXA 2OYOA 3L4FA 3HUSC 2M8RA 3UIAA 1JO5A 4PSWA 2EK8A 4H6UA 2O3JA 2Q3EA 4UB6E 3BJ7A 1XF8A 3RK2C 4ONWA 1YGHA 3CCMP 1L4AD 1LCPA 2Z3LA 2WTYA 4CAWA 1EDJA 1YK3A 2ZW7A 1EDLA 5AG5A 4L8AA 2OYIA 4L74A 3L74E 3NH4A 4NGSA 4R6TA 1HTLC 4WWVA 1FDMA 1J1EC 4XFJA 2JLMA 5KTCA 5KTDA 3A0HE 2J5UA 2KSEA 2YKOA 3H1HD 2KNCB 4NF1A 5B66H 3O6QB 4GT1A 4P4FA 5DJUB 1VQ7P 1KYOH 1T2KC 1DX7A 1NMTA 3D2MA 1FZCB 3E7KA 3L75D 2PJ0A 1R8EA 5KAIE 1W2BO 2PJAA 2KLVA 3V4WA 3WU2E 2FVGA 1W5CE 4CPAA 3LIDA 1VGYA 4NFRA 1Z9UA 5LRKA 2GA1A 3BVHA 4P45A 2YIUB 3TE4A 2I1JA 1KB9H 3IU2A 3DSBA 1T3UA 2ZEHA 2IQ6A 2FIWA 3S6GA 5CCGA 2GUVA 4CYPA 4E2AA 2A45G 4U7JA 2WSFH 1NGMB 2FYNB 1HDQA 4R9MA 2KSJA 1F2PA 4KVME 3BXMA 2WT7B 3GMAA 2YNDA 1L0LK 3CWBJ 2YMKA 4M6HA 4BD9A 4RKUJ 3B3CA 3FXTA 3FWNA 1GU4A 2I3CA 1FZGA 3IWEA 1ZLIA 1SQVK 2BCCD 1M90Q 1BGYD 5B5EE 3HUSA 1G2CB 4BXLA 3SJFA 1OW6A 3I9SA 1H0TA 2G0BA 4JYWA 4ZKUA 4FD6A 2V8GA 3CWBG 4EIJA 2PVWA 5JPHA 5KLIC 4AQRD 1S9KE 4CPGA 1RQUA 2QJPB 2ATRA 3NH8A 1NTKK 4R87A 1L0LJ 1LWUC 3PGPA 4LQGA 5AVTB 3H32B 1USDA 2C6CA 1AMPA 1SQVJ 3IFMA 1RF1A 5AW0B 3KPEA 2KK7A 4C7NB 1BE3J 2CTCA 2F8HA 3CCEP 2KI7B 1I12A 2PJ4A 2WPRA 4HNWB 1TU3F 3MTUE 2HODA 1L0LG 2Q51A 1JM0A 2B87B 1F57A 2B4DA 4N6JA 2ZFCA 4Y49B 4WJBA 2MJZA 2UWJE 1HF9A 1SQVG 3VMZA 2R1IA 2KS1A 3CZXA 3NFQA 2ZOFA 3CCUP 1NTKJ 3C1LA 4Y99B 1YVKA 1CBXA 2REFA 4G1PA 2L91A 1G1IA 1K4JA 1TKFA 1QGKB 3H1IE 1IFNA 4N3YB 3FMCA 3BATA 3KASA 5DJTB 1YREA 3AEGC 2GFQA 3D3SA 4XNHC 3D66A 4W7ZA 4CGMA 3VN0A 1VQ5P 1NTKG 5BU5A 1NTZD 3IF4A 4CGNA 1NU1E 1LTTC 1S5LE 5ISVA 4IL6H 3V2NA 5IB0A 3RNZA 5AW6B 2OTLP 1Q86Q 1NKZB 2ZEMA 3BCCD 3R9FA 7CPAA 2E5YA 1FT7A 3VARA 3VYIA 2FYZA 3TGUE 4CRYB 2PJ5A 4NPEA 2IX7C 2HPCB 3EWKA 2R7HA 3SXOA 2LXBA 2EO8A 3ISZA 4R7MA 1XTCC 2REEA 4CAXA 1CP6A 4GKGA 2ZXEB 2R98A 3N7ZA 2IBZI 5KLVK 1LWUA 4YGOA 2ZXXA 2OTJP 2ZPAA 3FX0A 3S4RA 3KR5A 4P4DA 1BCCE 2BOAA 1IYLA 2C1CA 3PH0A 1JY2O 3R1KA 5APWA 3AEFC 1OW7A 2FFDC 1DEBA 3SXNA 1ZXGA 3A0BE 3L35A 1VF5D 2VZZA 3VWEA 1SQXD 4MHPA 3KZIE 2QIWA 4AXVA 4EVYA 2G3AA 5KLVJ 3JVNA 2W83C 1LT9B 3NXSA 1NOHA 4C2ZA 2JKVA 5THWA 2Y0MA 1UFHA 1S4XA 4KVOE 4X3RA 1ELLP 2C6GA 4MY3A 4B12A 2YNCC 2E5TA 5KLVG 5GTIE 6CPAA 1RO5A 2W27A 2IL4A 5EC4A 4YXDC 1LTJB 2Q6QA 4A7PA 4OH8B 2A45H 1FJKA 3I3GA 4F9VA 3H1HE 1NYHA 3CCQP 4FBEA 1S7KA 3F5BA 2CK3H 4WY4B 2IFMA 4IHMA 3JCUH 1SQBE 4C2YA 2WPXA 1JTHA 2KCWA 3L75E 2Q5UA 1L4AA 2O01J 1LANA 2N9YB 1FZCC 3QB8A 4EI2A 4YRHA 4AUWA 2PRQA 2QVPA 4MY0A 2Z3PA 3DGVA 4A37A 2ARHA 2YIUC 4GXHA 1I1DA 1LRZA 4K30A 4PV6A 4L89A 5HXDA 2D2CB 3OJAB 5G1ZA 3RK3D 1YQ4C 1AQ5A 4FD5A 4UIAA 4MHDA 4KLVA 2FCKA 5APVA 5EMIA 3S6FA 2FFDA 3NTNA 3K2KA 4EYYQ 3L74J 1DE4C 3R4YA 4B5PA 2H8PD 4O9BA 2BCCE 1JCCA 1BGYE 3AE6C 3CI9A 1CX8A 2XV5A 2YO3A 3U1CA 5KTAA 1JQGA 3R96A 3T90A 1Y7RA 1QL1A 4ONUA 2FXMA 1ZG7A 3QNVA 1QSMA 5CBNA 4RUHA 4WY4D 5CHXA 4XA4A 2AFOA 2WMMA 4QBJA 1Z8XA 3AE1C 2XEIA 4UFWA 5HMNA 2YNCA 4ZKPA 1S3ZA 3DNSA 2PJCA 2V8HA 3L70D 3CCLP 4OVNF 4TLFA 5AVUB 5DWNA 1P4NA 1Y9BA 2NPSD 2V7QJ 2KNCA 4JXRA 3A9LA 1UWYA 3O6QA 2VI7A 3KR4A 3L72D 4K3NA 1YYCA 1QVFO 2B4BA 2FBWC 2YO2A 5JH9A 3I5CA 5AG6A 1FZCA 3B35A 4FAIA 2QE7H 1OX3A 1ZR2A 4UEZA 4Y49C 2EWBA 2P10A 3GUXA 2NZ2A 1LAPA 3EFAA 2PIYA 3VTPC 4Y99C 4RS2A 1UIXA 1IZNB 1JY2N 1NTMG 1OVVA 2XDJA 4PD4D 1V0CA 4OC0A 3V8IA 3IIBA 3B8GA 1GW3A 4K35A 1CSBA 2PIZA 1CI6B 3IFEA 3CC4P 2ZEDA 3HE5B 2DPTA 2ZW5A 1WK4A 1PP9D 3NA6A 3CPWO 3M0AA 4OGQB 2G3TA 2QSIA 2PVVA 1BE3D 2WZNA 3LIEA 3DR8A 1G2CA 4EWTA 1YSJA 1NU1K 2P58A 3PRJA 2R8VA 2LXCB 1S7NA 3D6ZA 2JBJA 5JGFA 3U1AA 2C6PA 4NGNA 3PEIA 3D68A 4P4IA 2JWDA 3H1IJ 2FS5A 1VIXA 2IYPA 2Q7CA 2ZW4A 1OWAA 2JP3A 2C0WA 4F6AA 3MD0A 1JY3P 5TISE 2P6EA 1Z4EA 4C7NA 1CZQA 2W6JH 2YNEA 2K3RA 1NU1J 3PTZA 1SQPD 4MFKA 4R3KA 3PJSK 1YHQP 1N86A 5GTHH 1GHEA 5J1QA 1QL2A 1SQXE 2WYRA 2B87A 3KI9A 1IOFA 3F89A 2A4NA 3CCSP 3TT2A 4II9A 1QQ9A 4OGQD 2OR4A 1E79H 4A30A 1NU1G 3TGUJ 3BHXA 1LT9C 4OADA 4B14A 3TSIA 4XPKA 3KXDA 3D2PA 4YFJA 2J59M 4NGMA 3GIUA 1LOKA 1X10A 1YW6A 2QJKB 5APYA 1JNMA 1BCCJ 2O01H 1TKJA 3TGUG 1XMBA 4TWEA 1BOBA 2WSSH 4B6ZA 4JZ0A 3JSVC 3FJUA 1LTJC 2Q43A 5A28A 3FH4A 1AJYA 1CPSA 2H89C 3KL9A 4W80A 4IK2A 4WY4C 2A06D 2O1KA 2JEWA 1D7MA 1FDIA 4D6TD 1BCCG 2Z3MA 5APQA 3ITKA 1SVFA 1X22A 3D8PA 3ISXA 3GKRA 1HEEA 5KKZB 1SQBK 3AE5C 3HUVA 4MJ8A 1M7LA 3FRMA 2NPSC 3A0HH 1R3NA 3RK3E 4IFDK 3MUDC 1XBUA 1JEKA 4AYCA 2M5AA 3E1RA 4WBAA 3VATA 3B3VA 2FYUD 1IY7A 1SFCB 3VP9A 3EO4A 1ZLLA 1Q2NA 3CX5I 5H84A 1N8RQ 3WU2H 3H1HJ 1FOSF 4CYOA 1KYOI 1PGJA 3S1KA 4E0AA 2FL4A 3L71D 5AW8B 3SJXA 1SQBJ 3D7GA 3FXEA 3RL0g 3L75J 2YGWA 3FECA 1LT9A 4RI1A 1BSNA 4F8ZA 4HPSA 3A7OA 1BDDA 4KVXA 1KB9I 1RE3A 3H1HG 2IYOA 2Z3OA 2BEZF 1VHEA 2YXQB 4NGTA 4OC1A 5CCHD 4UWIA 1B6BA 1XEBA 4H0LD 1MKMA 3L73E 4I7ZB 1SQBG 1P84I 4A95A 4UCPA 1DH3A 2OB0A 3B8EB 4KHXA 3RL0D 3L70E 5B5EH 1LTJA 1ZG9A 1URQB 2GU2A 1FZBA 1J4JA 2BUEA 3D7DA 5H2FH 4LX9A 1BO4A 3S9LA 2Q1KA 3BLNA 1ZR4A 4WY4A 4AVBA 3RGUA 1VL2A 4DCKA 1ARMA 2OYHB 3WC6A 2PE3A 3M06A 5C88A 1BGYJ 2ZYGA 1XMTA 5D29A 4KOTA 2I1KA 4UB8H 5E79E 3TO7A 1LJ2A 1SQQD 1ZMEC 3AE8C 3K9UA 1NSAA 4M6IA 5D8NA 2W8ZA 2RB7A 3MN8A 4PK2A 3CX5H 2ZEOA 4EDFA 2GM4A 4PD4E 1EZVD 4R57A 4JPZB 2RN0A 2NPSA 3JUWA 1NKNA 2H43A 3CPAA 1KC8Q 4H13D 1QMUA 1IK7A 2PCUA 3SWYA 2AFUA 3LODA 4MBUA 3OW2O 4CYNA 1MUUA 1TXRA 1VQLP 3AECC 2IJZA 2B89A 2IZ1A 1PP9E 3I55P 3H1JD 1IJDB 1YW4A 1Z8LA 1FAVA 4OGQC 2PJ7A 1BE3E 1HDUA 2ITAA 1TF9A 5LYLA 5A27A 1OXZA 1P84H 1GZLA 3WR7A 4H44B 3CXHI 1URQD 1N71A 5LRGA 1TKHA 1T6AA 4JBZA 2EK9A 2E75B 1M4IA 5AW7B 3W91A 2WPWA 2P6GA 1GTWA 3T8WA 3R9EA 5K8NA 3CPXA 3LD2A 5F48A 1S5LH 4F9UA 1M4GA 3II6A 3GHGC 3KKWA 2WWWA 4CAEA 4NEXA 1FZFA 2AEFA 4DJLA 3LACA 5KJ7D 3H1LD 1EZVI 3DDDA 5AW5B 3LW5H 1Q82Q 1XIXA 2AE6A 3VMXA 2RC4A 1RF0C 2NMTA 1BSHA 4CRZB 1M1DA 3TYYA 3S9NA 5CJ0A 2WUUA 1T8ZA 1KD1Q 1SLQA 2QECA 1SQPE 2PRBA 2Q3IA 2HC9A 1VHOA 4OC2A 5CNPA 2R5DA 1K73Q 1X8YA 3KHZA 4YTPC 2Q4YA 4NPFX 2QVAA 3FIXA 4U9YA 1LTAC 1YITP 4QMAA 1SQHA 2Z3NA 2AXCA 5KAFH 1SQXK 2BL1A 1N7LA 3PB9X 4CAFA 3N4XA 1J2JB 1U6MA 4H44D 2K9YA 4OC4A 3IU1A 3KHXA 2WPQA 4MMOA 1CI6A 2PAJA 2XEJA 4OAEA 5AVVB 1IFPA 1IB1E 3MRUA 3CXHH 4PK3A 5B66E 4M3SA 2XEFA 3A0BH 3HE5A 2IBZD 2O53A 1EDKA 2QJKC 4PV1B 3CXQA 4R3LA 3KZIH 3SJEA 4U3FD 4ZMDA 1GD2E 5DWMA 1WWZA 1QSOA 1MZ9A 4ZI6A 4MFZA 3S9MA 2A06E 2CNSA 4TNUA 4DYOA 5C82A 5G22A 4D6TE 4H89A 4HKFA 2WSEJ 2KZJA 1VDFA 5CCHC 4Q36A 2Q44A 4H0LC 3CCVP 3GF3A 4C7IA 3B3SA 1KFMA 5GTIH 1ZOYC 4M85A 2YKQA 3RL0C 3GHGA 4Y28J 2OZGA 2KB7P 5KKZC 4MCPA 4NGPA 1Z2LA 2Q7SA 2C9NY 4R8FA 1BAVA 1GK6A 1RF0A 3K5BA 3JC22 5AW1B 2FYUE 1QSTA 5KTBA 2AJ6A 3D4UA 4A39A 2A45I 5HH1A 1KQFB 1VQ4P 1SFCC 5DS0A 3D6YA 2OOTA 2QRXA 1ZO0A 3P8CD 1S5LX 3H8GA 1QSNA 4IOIH 4LGDE 4OWFA 2ZVNB 4AG7A 3A2AA 4MI4A 2DPSA 1L0ND 3L71E 2GANA 3SI2A 1LTBC 3B3TA 3S6KA 4H13C 2FSRA 4ZYQA 1LAMA 1S3JA 3RAMA 3KQXA 3AEBC 2CNMA 2JEEA 1XFOA 3HD7B 3MGDA 5AVXB 2DXQA 2YXRB 3C9IA 4Z65A 1MFTA 4I7ZC 2AFWA 4BRYA 1H8AA 4DNCA 1HGZA 4OMEA 5L8RJ 4LUAA 3SFDC 3T97B 1DEEG 4UFVA 3M0DC 2N1TB 3FVLA 3IC1A 1ZP0C 3FYNA 1URQC 5G20A 1N73B 2ZYDA 5G21A 1AFOA 3SI1A 1F2OA 3H1KD 2KZIA 4IAVA 3BRVB 3TCVA 3E0KA 1M4LA 3GLJA 4P4JA 5JQ4A 2QJYB 5K8OA 2OYHC 5CCHA 1JY3N 2FXOA 2B5GB 3FEEA 3H25A 3IGRA 1IFJA 1SQQE 1P0HA 2PDOA 2ZOGA 4CGLA 5KJ7C 5HVHA 4JYCA 3RO0A 2QMLA 3G9RA 4MHZA 1EE3P 1FU1A 4IL6E 2ODFA 3TX8A 2Z5HA 3F8KA 1AQTA 4Q7AA 4X2TA 2W6BA 5EFWB 3L73J 2HG5D 4TT3H 1KZFA 3H1JE 2FIAA 1LTIC 2PJ6A 3HD7D 3L70J 4GOFA 3WT4A 4EMEA 3FXDA 2FE7A 1KZUB 5AG4A 1IK9A 5F09A 1A02J 1S7FA 2OYIB 1IO4A 2JDCA 3L73G 5BVZA 3WC7A 1LNQA 3W68A 2N1TD 4H44C 3EFFK 2IZ0A 1USEA 2HB6A 4CGOA 2FYNC 3B5NB 3L70G 2E75C 1PCAA 2B58A 4AB7A 2P1JA 2KIKA 3WUTA 2XNDH 3Q3DA 1YI2P 1CP7A 1R5SA 2IFNA 2WPSA 5KLVD 2VEZA 5ELYA 1YJ9P 3H1LE 4RN7A 4UBRA 3S6HA 4W7YA 3D70A 3L74G 1IIDA 3M0DA 3MP7B 1URQA 1IC2A 1M8OB 5I0CA 4UF4A 1PP9J 2D4OA 1AYEA 2IDBA 2KXPB 2EVNA 2QJPC 1KILB 1AV1A 2P6FA 2OYHA 4JD6A 1FNOA 5IV0A 4OC5A 4PJ0H 4GODA 1RE4C 1SQPK 2ZEFA 5KJ7A 1M57D 3SFEC 1KQSO 2D2CD 3G4SP 2D4PA 3NMDA 4PXCA 1PUAA 3HUSB 5APUA 3PB4X 3NH5A 3P7KA 3B5ND 5AVWB 1X0TA 1MK4A 2IBZE 1S72P 1K8AQ 3CXPA 4ZY1A 1LP1B 3KDPB 2WSEH 4M3LA 4U3FE 1IOIA 4MHYA 4PV1C 3Q5PA 2H5MA 1GMJA 4JXQA 2R44A 2AFXA 1SQPJ 4KSIA 4CS0B 2Q4VA 4U9ZA 3WABA 1NTZE 1RF1B 2BSWA 2P2UA 1FY7A 1MV8A 1Y47A 1GL2B 4C46A 2DF5A 2WT7A 1X12A 1SS1A 4H6ZA 1CPXA 3EXNA 3KQGA 1KILD 1SQPG 3BCCE 1NAYA 1OIPA 5AW4B 2K9JB 3N5FA 1FJPA 4B5OA 5CJ4A 2KS1B 4RO0A 2OGUA 2BEQD 3PZJA 1M44A 1IYKA 4P44A 4OKOA 1Y9WA 1PFIA 2GUSA 3PHLA 3L37A 2JJLA 2GE3A 1AVYA 3D7HA 2VRSA 3P8CE 1QX8A 3RYOA 4MFJA 2PJ8A 2OH1A 2QEXP 2E76B 4NPDA 2PRRA 1XRYA 2PR8A 5LYFA 2POKA 1YBKA 2Z10A 3FF3A 1L0NE 2FYUK 3H32A 4HKZH 4ZNCA 1J1DB 1Z8WA 1RE4A 2WQYC 4D6TJ 2PGDA 5AW9B 3KZWA 1TIQA 1NTMD 1OW8A 2ZJSE 4LC1A 2R3CA 3H1IG 1NJIQ 4KOYA 2CNTA 2Y0EA 5F47A 3EFGA 4DZOA 2WSFJ 1HWTC 3HD7C 2J8MA 2A06G 1Y9KA 1BPNA 4R76A 4A94A 3CL3D 4PQAA 4D6TG 5CPAA 3T9YA 1VQOP 4E8OA 5KLIB 2RMZA 2Y0DA 4PPZA 1NE9A 4OIWA 4GIFA 4AVCA 1ZG8A 1U7JA 2CXAA 2FYUJ 2VZYA 3PP9A 2N1TC 2PFXA 3H1KE 1YLOA 3K9TA 3V7ZA 4K3AA 1N73C 4HJGH 2Z3KA 5E96A 5EBVA 4YPCA 3VMYA 4H2KA 1OBRA 3CX5D 4BBHA 4UEFA 3F0AA 4DUKA 3IEHA 5H86A 2QJYC 3R2PA 2CIJA 3P2FA 2HR3A 1PV3A 1KYOD 2OU2A 4CGPA 2P67A 1GU5A 2HFED 2E76D 4C7RA 3V2RA 1M1KQ 4XPLA 1JUNA 4KORA 1PIXA 4UB6H 4NGQA 2LR2A 1FBMA 4B10A 1DD4A 4MFLA 1KB9D 1MFZA 3M91A 1SQQK 1RXTA 2HPCA 1X79B 3BRTB 4B86A 4EOTA 3QWOC 2HUZA 2AFZA 3AEEC 4CYQA 3V2QA 3WMM0 1P84D 4XPDB 5AVZB 1M1JB 1KMIZ 1CM0A 4KZTA 3G3SA 4PXBA 4KOUA 2D2CC 3A5TA 4IFMA 2VBQA 1AVOA 2OYIC 5K5GB 1GYTA 3CXSA 2EUIA 3LMSA 5KAIH 3B5NC 4FUUA 3UY5A 3TK1A 2OARA 2CF4A 4C2XA 3HD7A 3RBZA 1L4AB 3CCJP 4NCZA 3TC8A 4MFQA 4NSQA 1BDCA 3TGUD 5LRJA 4C68A 1QEXA 4I2LC 4KUBA 5FVJA 4WWIA 1Q7LA 2K37A 3T97A 2E42A 1JWQA 1VPCA 2N1TA 2I79A 4W9YA 3H6PA 1IGBA 1N73A 2V7QH 5LYIA 4F0XA 2K1AA 3H1JJ 1EXIA 2O28A 1BCCD 2Q0YA 1S60A 1KILC 3G71P 1ZW0A 3OA7A 1JOCA 3L75G 2OQQA 1K04A 1G1JA 3SHPA 5M1BA 2PJ3A 5IX3A 5JM6A 1K05A 1DD3A 3ZZIA 4B5PB 4Z1MH 2VXKA 3H8EA 2XZRA 4A31A 4AVAA 1YTZI 2QIRA 1PPJD 3H1JG 3EC4A 3CXHD 1JY2P 1KUYA 3L72E 3TDKA 4EFDA 1CW5A 1UIIA 3TOBA 2BCCJ 1SFCD 2AEMA 1IFMA 8CPAA 1YVOA 2W6AA 3NE7A 4KUAA 4I1LA 1BLLE 3H1LJ 5K8PA 3SWFA 3CLQA 3FWLA 2WITA 1S5KA 4P4EA 4R4LA 3KQZA 3MUDA 2BCCG 4LQ6A 4B11A 1BGYG 3AE9C 3PRTA 1Q2CA 3JRUA 4A38A 4OP4A 1L0CA 3H1LG 4NJRA 1RF1C 3B5NA 1H8LA 2KYVA 1GW4A 1WRGA 1DIPA 1GL2C 2IPPA 1M4DA 2H7HA 1YQ3C 5J8FA 1KILE 3SJGA 2RFHA 2B88A 5BWAB 1SQBD 2JR8A 5APSA 2HQYA 1NTZK 1L2PA 3SSUA 2W90A 4BWNA 3MZWB 3CT9A 2AXTE 3SI0A 1FZEA 3V6IA 1YMEA 3RBXA 1VQ6P 2E43A 1H89A 4N78D 1IU8A 1HGVA 4XE5B 3IO1A 4U3FJ 5AVQB 2FKWB 4OC3A 1JY3O 4GM5A 1MJAA 1VQ8P 1GK4A 2E76C 2V77A 1KILA 4UFXA 2G9DA 2M3EA 3F5HA 3R9GA 2WSAA 1J1DC 4A2ZA 2IBZG 1AA0A 1NTZJ 1NTME 2GLFA 3BASA 3V5BA 4U3FG 1IFIA 3B7IA 1KV4A 1VQPP 1S2EA 4KS9A 1LFWA 3GG2A 2OZHA 1HH0A 1L0NK 2RH0A 1BPMA 3KGQA 2O1JA 1B87A 1Q2YA 1Z4RA 3BCCJ 4PXEA 5H2FE 4ZY2A 2ZVOB 4ZX8A 5CBMA 3FEDA 1NTZG 4R4MA 3H4QA 1NVOA 4J3GA 1LP1A 1Z5RA 4YXWH 3IAOA 2ZEGA 3B3WA 1OZHA 4HB1A 3VOPA 4FD4A 3OWCA 3HTKB 3NFZA 5HVGA 3G6EP 1KQGB 3P32A 4KT0J 5AW2B 4UB8E 3VMAA 1KUXA 3AE3C 4HH2A 3BCCG 3QAYA 4B13A 1IFDA 2F5IA 1N7SB 3HE4B 3CX5E 1PL5A 2E75D 1ON0A 2NRGA 2NSMA 3QH9A 1L0NJ 4NGRA 2QM7A 4UCMA 1GL2A 1KYOE 2JDDA 3ZJ0A 1I21A 4KOSA 4OLLA 4ASVA 1LTSC 3V4QA 3V38A 4NJQA 1PGPA 3DR6A 3HRNA 2K9JA 2VL1A 3TO9A 4FD7A 4JF7A 1KB9E 1SQXJ 3CWBD 4L76A 1PGQA 2B9BA 1W2EA 4P10A 1L0NG 4NXYA 1LGHB 2H88C 1XE4A 3TNUB 1KN7A 5K8MA 1P84E 2RKLA 3ZDMA 2PJ1A 2IMOA 4XPDC 2PC1A 3B2YA 4P6YA 2P0WA 1M1JC 2ZXVA 4UIBA 1SQXG 3H1KJ 1Y7EA 1Y0RA 3FB3A 1VF5B 3W6SA 4ZX9A 1YJWP 4MRIA 3GF7A 1HJBA 2V4HA 1FZAA 3O8ZA 3EY5A 1L0LD 1VQNP 1RTQA 1JMMA 3KYQA 1N7SD 1XOVA 3E1IA 3PB8X 1SQVD 3H1KG 2V8DA 4C7HA 2JWAA 4I49A 4IFFA 1U57A 2ZT9B 4PV1D 1L4AC 3CC2P 4GS4A 5AVRB 1HUCA 1S7LA 1RH5B 1NH4A 1KORA 2FXPA 3PB6X 1VKCA 2FXFA 5J8CA 4ZY0A 2OZUA 5AG7A 1NO4A 4MHNA 1Y0YA 2O4HA 3CMEP 5AVSB 2M5AB 1NTKD 1A02F 2CY2A 1A2ZA 1RQVA 1NHLA 3TOAA 2WSCJ 5KAFE 3B4SA 1XJOA 1K9MQ 2Q9IA 4GOEA 1M56D 2FY8A 2ZENA 1OMIA 2WVRA 5IB9A 4M6GA 3VH9A 1PPJE 3CXHE 4WVZA 2HLOA 3TO6A 3N7NA 1MJ9A 4YU9A 4A32A 3GB0A 4P4BA 4MCSA 3LWUA 3W6XA 3H5ZA 1KFNA 2Z4EA 2VQYA 1IICA 1FC2C 1ELMP 3RK3B 4MFPA 3D67A 5C39A 3G3ZA 1EZVE 2BO9A 2ZT9D 1KWMA 1RY3A 1M1JA 2ZW6A 5F46A 4ZGYB 1Y8AA 1NAFA 5BU8B 4IF5A 1ZLHA 3D7FA 4CAVA 3PFEA 1SFCA 2QYVA 2OTKE 3PP5A 1FDOA 1OFCX 4X5KA 3AE4C 1ARLA 4OIDA 2QG4A 2L5GB 3H8FA 2KLUA 3Q1MA 2GREA 4QVTA 2M3BA 3GW6A 2NYQA 4JWPA 3Q5SA 1EXJA 2Y0CA 2J9AA 3L72J 1Z8TA 2V8VA 2J8NA 3MGNA 2ZEPA 2BCOA 4IL6X 2B3VA 4I6MC 3FX6A 1YQEA 1WMKA 4N78E 4UA3A 3CC7P 2QJ8A 3M9QA 4MN4C 2NPSB 1Q90D 3L72G 2Q4ZA 3WC5A 3TTHA 4ORFA 5CMZA 2QM8A 4ZBGA 3AE7C 2Y9ZA 4QB9A 1ZRTD 4JYBA 3TFYA 2BASA 1KUVA 2SPZA 5AW3B 2E74B 3NE8A 1PZQA 2KUBA 1PU9A 1OVUA 4MCRA
chains in the Genus database with same CATH topology
3IWGA 2PSWA 4CYNA 5H86A 2QJYC 3EWKA 3AECC 2R7HA 3P2FA 3SXOA 1PV3A 2PQ8A 2OU2A 4CGPA 4F0YA 2REEA 4CAXA 2E76D 2G8YA 2R98A 3N7ZA 1QSRA 4XPLA 4OGQC 1PIXA 4KORA 4YGOA 2ZPAA 5A27A 1KTMA 4B10A 1DD4A 4MFLA 3WR7A 4H44B 1IYLA 1RXTA 1N71A 3R1KA 2E75B 3AEFC 1OW7A 1M4IA 3W91A 2HUZA 4Q38A 3AEEC 3SXNA 2WPWA 4CYQA 2P6GA 3R9EA 4XPDB 3LD2A 5F48A 1CJWA 3FBUA 1M4GA 1VF5D 2VZZA 3VWEA 1KMIZ 1CM0A 3KKWA 4KZTA 3G3SA 2Q7BA 2QIWA 4CAEA 4KOUA 4NEXA 2D2CC 4KOVA 2VBQA 3DDDA 1XIXA 4EVYA 2G3AA 2AE6A 3JVNA 2RC4A 2NMTA 4CRZB 4C2ZA 1M1DA 2Y0MA 1NSLA 3CXSA 2WUUA 3G8WA 2QECA 1UFHA 2EUIA 3BJ8A 3UY5A 4KVOE 2PRBA 2E74D 2J8RA 4B12A 4MY3A 2B4DB 4C2XA 1YX0A 4QC6A 2YNCC 3QAHA 3D71A 5CNPA 4NCZA 4MFQA 4NSQA 1RO5A 4UCNA 2IL4A 5EC4A 4C68A 1VF5C 4YXDC 1MJBA 5GCNA 4YTPC 2Q4YA 4KUBA 5FVJA 2Z11A 3I3GA 3FIXA 1NYHA 4U9YA 1JB0J 1SQHA 4KOWA 2I79A 1S7KA 2Z3NA 3F5BA 2BL1A 4CAFA 4F0XA 2Z0ZA 1YLEA 1U6MA 1EXIA 4H44D 2K9YA 3IU1A 3B71A 4C2YA 2WPXA 2O28A 1Q2DA 2KCWA 4OAEA 1IB1E 1OZPA 2Q0YA 2O01J 1S60A 4PK3A 4M3SA 3QB8A 2ZT9C 2OQQA 1K04A 4YRHA 3SHPA 2QJKC 5M1BA 4PV1B 4MY0A 5IX3A 3CXQA 4R3LA 1K05A 1DD3A 3ZZIA 4B5PB 4Z1MH 2VXKA 2Z3PA 1VHSA 4A31A 4AVAA 5DWMA 2QIRA 1WWZA 1QSOA 3EC4A 2ARHA 2YIUC 1KUYA 1YR0A 4IUSA 1I1DA 1LRZA 4K30A 4PV6A 4L89A 4MFZA 2D2CB 2CNSA 3FNCA 5G1ZA 3FGAD 1YQ4C 3Q5RA 3TOBA 5C82A 5G22A 2K5TA 4H89A 4FD5A 4MHDA 4HKFA 2FCKA 4GDOA 2WSEJ 4KLVA 1YVOA 2MKVA 3Q2YA 3NE7A 3S6FA 4Q36A 4KUAA 2Q44A 4H0LC 3GF3A 3R4YA 2HV2A 4B5PA 4C7IA 1ZOYC 4M85A 1S5KA 4R4LA 4JLYA 4KLWA 4Y28J 2OZGA 3AEAC 5KKZC 3AE6C 4B11A 3LW5J 5KTAA 3AE9C 3R96A 3T90A 1Q2CA 1Y7RA 3GLMA 1L0CA 4ONUA 1QSTA 1QSMA 2AJ6A 5HH1A 1KQFB 1M4DA 3S9OA 1DIPA 3D6YA 1ZO0A 4QBJA 1S5LX 2I00A 1YQ3C 5J8FA 1KILE 3AE1C 1QSNA 4KSFA 4UFWA 5HMNA 2YNCA 5BWAB 1S3ZA 4AG7A 2HQYA 4MI4A 2DPSA 4JJXA 2GANA 4PSXA 2GIVA 3DNSA 3S6KA 4H13C 5DWNA 3C26A 1P4NA 1Y9BA 2FSRA 2V7QJ 4JXRA 3A9LA 4QUSA 4XNHB 3O6QA 3AEBC 2CNMA 2VI7A 3MGDA 1MJAA 3JTKA 2B4BA 4HNXB 5F49A 2FBWC 2E76C 2DXQA 4UFXA 5AG6A 3C8VA 3R95A 1S1CX 4Y49C 3ABVC 4I7ZC 4H0LB 4DNCA 3R9GA 2P10A 2WSAA 2NZ2A 4A2ZA 5L8RJ 3EFAA 4LUAA 3SFDC 3T97B 4RS2A 4UFVA 1UIXA 1ZP0C 4A33A 3FYNA 5G20A 1V0CA 3GY9A 5G21A 3V8IA 4U5YA 3B8GA 4AG9A 4KS9A 2OZHA 3TCVA 1B87A 1HJ0A 3IN6A 1Q2YA 1Z4RA 3E0KA 2B3UA 5JQ4A 3P2HA 2WPVB 2B5GB 2DPTA 1R57A 2ZW5A 3H25A 3IGRA 4R4MA 3H4QA 1WK4A 1P0HA 4J3GA 2PDOA 4KSAA 3IAOA 4CGLA 2FT0A 1ZRTE 2JEVA 4OGQB 4FD4A 3OWCA 3AEDC 2G3TA 2QMLA 2JO1A 3G9RA 3AE2C 1KQGB 4KT0J 1KUXA 2QSIA 2BEIA 4HNYB 3AE3C 4BMHA 3DR8A 4B13A 2F5IA 3F8KA 3VWDA 1PL5A 2PR1A 2E75D 2R8VA 1ON0A 2E74C 4H13B 1S7NA 2X7BA 4TT3H 1KZFA 2B5GA 3D6ZA 5AGEA 4UCMA 2FIAA 2JDDA 2C27A 3ZJ0A 1I21A 4KOSA 4OLLA 4UWJA 2Q04A 2FE7A 3DR6A 2FS5A 5AG4A 3GYAA 1S7FA 4KOXA 2ZW4A 3TO9A 2JP3A 4FD7A 4PSWA 2JDCA 4H6UA 4F6AA 4H44C 2P6EA 3BJ7A 1XF8A 1Z4EA 4CGOA 2FYNC 4NXYA 2H88C 2YNEA 1XE4A 2E75C 2B58A 4MFKA 4AB7A 4R3KA 1YGHA 2Z3LA 4XPDC 1GHEA 2PC1A 3Q3DA 4CAWA 2P0WA 1YK3A 2VEZA 2ZW7A 2ZXVA 2A4NA 5AG5A 3TT2A 3FB3A 1VF5B 4L8AA 3W6SA 4II9A 4UBRA 3S6HA 3D70A 4XFJA 3GF7A 4OGQD 1IIDA 2JLMA 4A30A 5KTCA 5KTDA 2J5UA 4OADA 4NF1A 4B14A 3EY5A 4XPKA 5I0CA 2D4OA 2IDBA 3D2PA 4YFJA 2EVNA 2QJPC 1NMTA 4C7HA 2P6FA 3D2MA 4I49A 1U57A 2ZT9B 4JD6A 1R8EA 5IV0A 4PV1D 4GS4A 1S7LA 1KORA 2FXPA 1BOBA 1Z9UA 3TE4A 3SFEC 1VKCA 2FXFA 5J8CA 5A28A 2D2CD 3IU2A 1AJYA 2OZUA 3DSBA 5AG7A 2H89C 2D4PA 2FIWA 3S6GA 1PUAA 2CY2A 4CYPA 4E2AA 1RQVA 1FDIA 4U7JA 1NGMB 3TOAA 2WSCJ 1MK4A 2Z3MA 4R9MA 3CXPA 4KVME 2YNDA 3GMAA 2YMKA 1OMIA 4RKUJ 3FXTA 4PV1C 3D8PA 3Q5PA 2H5MA 1GMJA 3GKRA 4JXQA 3IWEA 3TO6A 3AE5C 1MJ9A 4A32A 4MJ8A 3FRMA 3W6XA 3RK3E 4CS0B 3H5ZA 1OW6A 2Q4VA 3I9SA 2G0BA 2VQYA 4U9ZA 1IICA 2BSWA 4MFPA 4FD6A 1FY7A 3EO4A 4H6ZA 5JPHA 5KLIC 3EXNA 5H84A 1RQUA 2ATRA 2ZT9D 4R87A 4CYOA 2ZW6A 3PGPA 5F46A 4ZGYB 4B5OA 4E0AA 2FL4A 2BEQD 3PZJA 4IF5A 1M44A 3RL0g 4CAVA 2YGWA 1IYKA 4RI1A 1Y9WA 1FDOA 2GE3A 4X5KA 4KVXA 3AE4C 1I12A 3RYOA 4MFJA 2Z3OA 4HNWB 2BEZF 1TU3F 2OH1A 2E76B 3Q1MA 2PR8A 4UWIA 1B6BA 2Z10A 2B4DA 1XEBA 4H0LD 1MKMA 4QVTA 4Y49B 4I7ZB 4JWPA 3Q5SA 1EXJA 1HF9A 4A95A 2R1IA 2J8NA 4UCPA 2OB0A 2WQYC 4IL6X 2B3VA 1YVKA 2REFA 1WMKA 1TIQA 1K4JA 1OW8A 1J4JA 2BUEA 4UA3A 4LX9A 1BO4A 3BLNA 1YREA 3AEGC 4KOYA 4AVBA 1Q90D 2CNTA 1VL2A 3D3SA 5F47A 4XNHC 2WSFJ 4CGMA 2J8MA 5C88A 1Y9KA 3TTHA 4ORFA 1XMTA 4CGNA 4KOTA 3T9YA 3TO7A 4E8OA 4ZBGA 1ZMEC 4AVCA 3AE8C 1NE9A 3K9UA 5ISVA 3AE7C 4PK2A 5IB0A 2CXAA 4QB9A 2VZYA 3PP9A 4R57A 3TFYA 3JUWA 1KUVA 3R9FA 2Z3KA 5E96A 5EBVA 4H13D 2E74B 1IK7A 3LODA 4MBUA 4BBHA 3F0AA 1PU9A 4CRYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IWG A;  2PSW A;  5H86 A;  3AEC C;  2R7H A;  3P2F A;  3SXO A;  1PV3 A;  2PQ8 A;  2OU2 A;  4F0Y A;  2REE A;  4CAX A;  2R98 A;  3N7Z A;  1QSR A;  4XPL A;  4KOR A;  4YGO A;  2ZPA A;  1KTM A;  3WR7 A;  1IYL A;  1RXT A;  1N71 A;  3R1K A;  3AEF C;  1OW7 A;  1M4I A;  3W91 A;  2HUZ A;  3SXN A;  3AEE C;  2WPW A;  2P6G A;  3R9E A;  4XPD B;  3LD2 A;  5F48 A;  1CJW A;  3FBU A;  1M4G A;  2VZZ A;  3VWE A;  1CM0 A;  3KKW A;  4KZT A;  3G3S A;  2Q7B A;  4KOU A;  4NEX A;  4KOV A;  2VBQ A;  3DDD A;  1XIX A;  4EVY A;  2G3A A;  2AE6 A;  3JVN A;  2RC4 A;  2NMT A;  4CRZ B;  1M1D A;  2Y0M A;  1NSL A;  3CXS A;  3G8W A;  2QEC A;  1UFH A;  2EUI A;  3BJ8 A;  3UY5 A;  4KVO E;  2PRB A;  2J8R A;  4MY3 A;  2B4D B;  1YX0 A;  4QC6 A;  3QAH A;  5CNP A;  4NCZ A;  4NSQ A;  1RO5 A;  2IL4 A;  5EC4 A;  4YXD C;  1MJB A;  5GCN A;  4YTP C;  2Q4Y A;  4KUB A;  5FVJ A;  2Z11 A;  3I3G A;  3FIX A;  4U9Y A;  1SQH A;  4KOW A;  2I79 A;  1S7K A;  3F5B A;  2BL1 A;  2Z0Z A;  1YLE A;  1U6M A;  3B71 A;  2WPX A;  2O28 A;  1Q2D A;  2KCW A;  4OAE A;  1IB1 E;  1OZP A;  2Q0Y A;  1S60 A;  4PK3 A;  4M3S A;  3QB8 A;  1K04 A;  4YRH A;  3SHP A;  4MY0 A;  5IX3 A;  3CXQ A;  4R3L A;  1K05 A;  3ZZI A;  4B5P B;  2VXK A;  1VHS A;  4AVA A;  5DWM A;  2QIR A;  1WWZ A;  1QSO A;  3EC4 A;  2ARH A;  1KUY A;  1YR0 A;  4IUS A;  1I1D A;  1LRZ A;  4K30 A;  4PV6 A;  4L89 A;  2CNS A;  3FNC A;  1YQ4 C;  3TOB A;  5C82 A;  2K5T A;  4H89 A;  4FD5 A;  4MHD A;  4HKF A;  2FCK A;  4KLV A;  1YVO A;  3NE7 A;  3S6F A;  4KUA A;  2Q44 A;  2HV2 A;  4B5P A;  1ZOY C;  4M85 A;  1S5K A;  4JLY A;  4KLW A;  2OZG A;  3AEA C;  3AE6 C;  5KTA A;  3AE9 C;  3R96 A;  3T90 A;  1Q2C A;  1Y7R A;  1L0C A;  4ONU A;  1QST A;  1QSM A;  2AJ6 A;  5HH1 A;  1M4D A;  3S9O A;  4QBJ A;  2I00 A;  1YQ3 C;  5J8F A;  3AE1 C;  1QSN A;  5HMN A;  1S3Z A;  4AG7 A;  2HQY A;  4MI4 A;  4JJX A;  2GAN A;  4PSX A;  2GIV A;  3DNS A;  3S6K A;  5DWN A;  3C26 A;  1P4N A;  2FSR A;  4JXR A;  4QUS A;  4XNH B;  3AEB C;  2CNM A;  2VI7 A;  3MGD A;  1MJA A;  2B4B A;  4HNX B;  5F49 A;  2FBW C;  2DXQ A;  3R95 A;  4Y49 C;  3ABV C;  4DNC A;  3R9G A;  3EFA A;  4LUA A;  3SFD C;  4RS2 A;  1ZP0 C;  3FYN A;  1V0C A;  3GY9 A;  3V8I A;  4U5Y A;  3B8G A;  4AG9 A;  2OZH A;  3TCV A;  1B87 A;  1Q2Y A;  1Z4R A;  3E0K A;  2B3U A;  5JQ4 A;  3P2H A;  2B5G B;  1R57 A;  2ZW5 A;  3IGR A;  3H4Q A;  1WK4 A;  1P0H A;  4J3G A;  2PDO A;  2JEV A;  2FT0 A;  4FD4 A;  3OWC A;  3AED C;  2G3T A;  2QML A;  3AE2 C;  1KUX A;  2BEI A;  4HNY B;  3AE3 C;  4BMH A;  3DR8 A;  2F5I A;  3F8K A;  3VWD A;  2PR1 A;  2R8V A;  1ON0 A;  1S7N A;  2X7B A;  1KZF A;  2B5G A;  2FIA A;  2JDD A;  2C27 A;  3ZJ0 A;  1I21 A;  4KOS A;  4OLL A;  4UWJ A;  2Q04 A;  2FE7 A;  3DR6 A;  2FS5 A;  3GYA A;  1S7F A;  4KOX A;  2ZW4 A;  3TO9 A;  4FD7 A;  4PSW A;  2JDC A;  4H6U A;  4F6A A;  2P6E A;  3BJ7 A;  1XF8 A;  1Z4E A;  4NXY A;  2H88 C;  1XE4 A;  2B58 A;  4AB7 A;  4R3K A;  1YGH A;  4XPD C;  1GHE A;  2PC1 A;  4CAW A;  2P0W A;  1YK3 A;  2VEZ A;  2ZW7 A;  2ZXV A;  2A4N A;  3TT2 A;  3FB3 A;  4L8A A;  3W6S A;  4II9 A;  4UBR A;  3S6H A;  1IID A;  2JLM A;  5KTC A;  5KTD A;  4OAD A;  4NF1 A;  3EY5 A;  4XPK A;  5I0C A;  2D4O A;  3D2P A;  4YFJ A;  2EVN A;  1NMT A;  2P6F A;  3D2M A;  4I49 A;  4JD6 A;  5IV0 A;  4GS4 A;  1S7L A;  1BOB A;  1Z9U A;  3TE4 A;  3SFE C;  1VKC A;  2FXF A;  5J8C A;  2OZU A;  3DSB A;  2H89 C;  2D4P A;  2FIW A;  3S6G A;  1PUA A;  2CY2 A;  4E2A A;  3TOA A;  1MK4 A;  4R9M A;  3CXP A;  4KVM E;  3FXT A;  3D8P A;  2H5M A;  3GKR A;  4JXQ A;  3TO6 A;  3AE5 C;  1MJ9 A;  4MJ8 A;  3FRM A;  3W6X A;  4CS0 B;  1OW6 A;  2Q4V A;  3I9S A;  2G0B A;  2VQY A;  4U9Z A;  1IIC A;  2BSW A;  4FD6 A;  1FY7 A;  3EO4 A;  4H6Z A;  5JPH A;  3EXN A;  5H84 A;  2ATR A;  4R87 A;  2ZW6 A;  3PGP A;  5F46 A;  4B5O A;  4E0A A;  2FL4 A;  3PZJ A;  4IF5 A;  1M44 A;  4CAV A;  1IYK A;  4RI1 A;  1Y9W A;  2GE3 A;  4X5K A;  4KVX A;  3AE4 C;  1I12 A;  3RYO A;  4HNW B;  2OH1 A;  2PR8 A;  4UWI A;  1B6B A;  2Z10 A;  2B4D A;  1XEB A;  4QVT A;  4Y49 B;  4JWP A;  2R1I A;  2J8N A;  2OB0 A;  2WQY C;  2B3V A;  1YVK A;  2REF A;  1TIQ A;  1K4J A;  1OW8 A;  1J4J A;  2BUE A;  4UA3 A;  4LX9 A;  1BO4 A;  3BLN A;  1YRE A;  3AEG C;  4KOY A;  4AVB A;  2CNT A;  3D3S A;  5F47 A;  4XNH C;  2J8M A;  5C88 A;  1Y9K A;  3TTH A;  4ORF A;  1XMT A;  4KOT A;  3T9Y A;  3TO7 A;  4E8O A;  4ZBG A;  5ISV A;  4AVC A;  3AE8 C;  1NE9 A;  3K9U A;  3AE7 C;  4PK2 A;  5IB0 A;  4QB9 A;  2VZY A;  3PP9 A;  4R57 A;  3TFY A;  3JUW A;  1KUV A;  3R9F A;  5E96 A;  5EBV A;  3LOD A;  4MBU A;  3F0A A;  1PU9 A;  4CRY B; 
#chains in the Genus database with same CATH topology
 3IWG A;  2PSW A;  1KQL A;  4JQ0 D;  2Z5I A;  1NTM K;  4MCQ A;  3PBB A;  2YMY A;  2PP6 A;  3USS A;  1FOS E;  2PQ8 A;  4F0Y A;  1PP9 G;  1DTD A;  2G8Y A;  3L2N A;  1QSR A;  2PJB A;  2KOG A;  5TIS H;  1KTM A;  1BE3 G;  2LKM A;  3L73 D;  1H0T B;  2P7J A;  2ZEL A;  2KP8 A;  1N7S C;  3RK2 B;  1XTG B;  1E5W A;  1ZN5 A;  3JCU E;  1EC5 A;  4FWU A;  4Q38 A;  1YJN P;  2ABZ A;  1H88 A;  1CJW A;  3FBU A;  1NTM J;  1FE6 A;  4LLH A;  2Q7B A;  2JDI H;  3EQ2 A;  4KOV A;  1J1E B;  3CWB E;  1PGO A;  3L74 D;  2PJ2 A;  4HYT B;  1NSL A;  1HBW A;  3G8W A;  5CCG D;  4DJG A;  3BJ8 A;  2HOD B;  2E74 D;  1LTG C;  2J8R A;  2XKM A;  2B4D B;  3BI1 A;  1YX0 A;  4QC6 A;  2R3S A;  1VQK P;  3QAH A;  3D71 A;  4UCN A;  1YTZ T;  2CTB A;  1VF5 C;  4DT0 A;  1MJB A;  4X8I A;  3IWW A;  5GCN A;  1SP4 A;  3TF5 A;  2Z11 A;  1QLE D;  1N2D C;  1JB0 J;  1L0L E;  4KOW A;  1JCD A;  2Z0Z A;  1YLE A;  2JBK A;  1X9V A;  3HLP A;  1SQV E;  3B71 A;  1OVR A;  5LYD A;  3RK2 D;  1Q2D A;  1OZP A;  2O01 N;  2ZT9 C;  5CBO A;  4PXD A;  2K88 A;  5TJH A;  4RJT A;  2WSC H;  2N9B A;  1VHS A;  3WUU A;  2M0B A;  5AVY B;  3SWK A;  2YKP A;  4PJ0 E;  2PJ9 A;  3GHG B;  2ZEE A;  1YR0 A;  3HTK A;  4IUS A;  2AEJ A;  1JMB A;  3WUV A;  3MHV A;  3FNC A;  4MXU A;  3OAK A;  3FGA D;  3Q5R A;  1NTK E;  4L75 A;  3W67 A;  2K5T A;  1N7S A;  3HE4 A;  1GL2 D;  4PD4 I;  3I56 P;  4GDO A;  1VQ9 P;  2MKV A;  2F7V A;  3Q2Y A;  4L73 A;  2I8D A;  2HV2 A;  1T2K D;  2XU6 A;  3CMA P;  2XNX A;  1S9K D;  1LWU B;  1Q7Y Q;  4JLY A;  4KLW A;  5HVF A;  3AEA C;  2C9L Y;  1NWQ A;  3LW5 J;  3M9B A;  3A3Y B;  3GLM A;  3L36 A;  4DOJ A;  1TF8 A;  3RK3 C;  3L71 J;  2FYU G;  1YIJ P;  1AUG A;  3S9O A;  5APT A;  2AFS A;  1HVV A;  3PLN A;  3DLJ A;  3TNU A;  2R32 A;  2I00 A;  4YWY A;  1RE3 C;  4WB4 A;  4BIN A;  1EQ7 A;  1ZV8 A;  3M9H A;  4KSF A;  5APX A;  3V2P A;  1CG2 A;  4JJX A;  3RZA A;  1QVG O;  4BRY B;  4PSX A;  3CD6 P;  2GIV A;  2YNY A;  3L71 G;  1GDT A;  1R5L A;  3C26 A;  1Z56 A;  1U7M A;  3I1U A;  3H1I D;  4QUS A;  5E79 H;  4XNH B;  1R43 A;  2CPB A;  2DEA A;  3JTK A;  2POH A;  4HNX B;  5F49 A;  1VQM P;  2J58 A;  4O23 A;  3C8V A;  3R95 A;  4PD4 H;  1S1C X;  3ABV C;  4H0L B;  1NU1 D;  1RHZ B;  2WZ7 A;  3IJ3 A;  3PFO A;  3CCR P;  3RL0 B;  4UEE A;  4A33 A;  2XEG A;  1SQQ J;  5I4M A;  3GY9 A;  1PPJ G;  4U5Y A;  3IR9 A;  4AG9 A;  3MIW A;  1FS0 E;  1JTH B;  5KLV E;  3VP8 A;  1HJ0 A;  3IN6 A;  2Y9Y A;  2ANP A;  3PBE A;  2B3U A;  2EBJ A;  2QA4 P;  3P2H A;  2WPV B;  1R57 A;  5GTH E;  4KJM A;  1PYT B;  3CDX A;  1EDI A;  4KSA A;  2R5B A;  4ASW A;  1SQQ G;  2FT0 A;  1ZRT E;  2JEV A;  3AED C;  2ZAE B;  2JO1 A;  2AXT H;  3AE2 C;  3P8M C;  2ZYA A;  2BEI A;  1EZV G;  4HNY B;  4BMH A;  3KHU A;  5CCG C;  4RES B;  2HYN A;  2DW3 A;  3VWD A;  2PR1 A;  1Q81 Q;  2E74 C;  1T3J A;  3RBU A;  1LT1 A;  4H13 B;  2FFD B;  2X7B A;  2B5G A;  3BI0 A;  5AGE A;  3PB7 X;  2C27 A;  2C0X A;  1WT6 A;  4UWJ A;  3U59 A;  2Q04 A;  2AFM A;  2GLJ A;  2CPS A;  3GYA A;  4KOX A;  2OYO A;  3L4F A;  3HUS C;  2M8R A;  3UIA A;  1JO5 A;  4PSW A;  2EK8 A;  4H6U A;  2O3J A;  2Q3E A;  4UB6 E;  3BJ7 A;  1XF8 A;  3RK2 C;  4ONW A;  1YGH A;  3CCM P;  1L4A D;  1LCP A;  2Z3L A;  2WTY A;  4CAW A;  1EDJ A;  1YK3 A;  2ZW7 A;  1EDL A;  5AG5 A;  4L8A A;  2OYI A;  4L74 A;  3L74 E;  3NH4 A;  4NGS A;  4R6T A;  1HTL C;  4WWV A;  1FDM A;  1J1E C;  4XFJ A;  2JLM A;  5KTC A;  5KTD A;  3A0H E;  2J5U A;  2KSE A;  2YKO A;  3H1H D;  2KNC B;  4NF1 A;  5B66 H;  3O6Q B;  4GT1 A;  4P4F A;  5DJU B;  1VQ7 P;  1KYO H;  1T2K C;  1DX7 A;  1NMT A;  3D2M A;  1FZC B;  3E7K A;  3L75 D;  2PJ0 A;  1R8E A;  5KAI E;  1W2B O;  2PJA A;  2KLV A;  3V4W A;  3WU2 E;  2FVG A;  1W5C E;  4CPA A;  3LID A;  1VGY A;  4NFR A;  1Z9U A;  5LRK A;  2GA1 A;  3BVH A;  4P45 A;  2YIU B;  3TE4 A;  2I1J A;  1KB9 H;  3IU2 A;  3DSB A;  1T3U A;  2ZEH A;  2IQ6 A;  2FIW A;  3S6G A;  5CCG A;  2GUV A;  4CYP A;  4E2A A;  2A45 G;  4U7J A;  2WSF H;  1NGM B;  2FYN B;  1HDQ A;  4R9M A;  2KSJ A;  1F2P A;  4KVM E;  3BXM A;  2WT7 B;  3GMA A;  2YND A;  1L0L K;  3CWB J;  2YMK A;  4M6H A;  4BD9 A;  4RKU J;  3B3C A;  3FXT A;  3FWN A;  1GU4 A;  2I3C A;  1FZG A;  3IWE A;  1ZLI A;  1SQV K;  2BCC D;  1M90 Q;  1BGY D;  5B5E E;  3HUS A;  1G2C B;  4BXL A;  3SJF A;  1OW6 A;  3I9S A;  1H0T A;  2G0B A;  4JYW A;  4ZKU A;  4FD6 A;  2V8G A;  3CWB G;  4EIJ A;  2PVW A;  5JPH A;  5KLI C;  4AQR D;  1S9K E;  4CPG A;  1RQU A;  2QJP B;  2ATR A;  3NH8 A;  1NTK K;  4R87 A;  1L0L J;  1LWU C;  3PGP A;  4LQG A;  5AVT B;  3H32 B;  1USD A;  2C6C A;  1AMP A;  1SQV J;  3IFM A;  1RF1 A;  5AW0 B;  3KPE A;  2KK7 A;  4C7N B;  1BE3 J;  2CTC A;  2F8H A;  3CCE P;  2KI7 B;  1I12 A;  2PJ4 A;  2WPR A;  4HNW B;  1TU3 F;  3MTU E;  2HOD A;  1L0L G;  2Q51 A;  1JM0 A;  2B87 B;  1F57 A;  2B4D A;  4N6J A;  2ZFC A;  4Y49 B;  4WJB A;  2MJZ A;  2UWJ E;  1HF9 A;  1SQV G;  3VMZ A;  2R1I A;  2KS1 A;  3CZX A;  3NFQ A;  2ZOF A;  3CCU P;  1NTK J;  3C1L A;  4Y99 B;  1YVK A;  1CBX A;  2REF A;  4G1P A;  2L91 A;  1G1I A;  1K4J A;  1TKF A;  1QGK B;  3H1I E;  1IFN A;  4N3Y B;  3FMC A;  3BAT A;  3KAS A;  5DJT B;  1YRE A;  3AEG C;  2GFQ A;  3D3S A;  4XNH C;  3D66 A;  4W7Z A;  4CGM A;  3VN0 A;  1VQ5 P;  1NTK G;  5BU5 A;  1NTZ D;  3IF4 A;  4CGN A;  1NU1 E;  1LTT C;  1S5L E;  5ISV A;  4IL6 H;  3V2N A;  5IB0 A;  3RNZ A;  5AW6 B;  2OTL P;  1Q86 Q;  1NKZ B;  2ZEM A;  3BCC D;  3R9F A;  7CPA A;  2E5Y A;  1FT7 A;  3VAR A;  3VYI A;  2FYZ A;  3TGU E;  4CRY B;  2PJ5 A;  4NPE A;  2IX7 C;  2HPC B;  3EWK A;  2R7H A;  3SXO A;  2LXB A;  2EO8 A;  3ISZ A;  4R7M A;  1XTC C;  2REE A;  4CAX A;  1CP6 A;  4GKG A;  2ZXE B;  2R98 A;  3N7Z A;  2IBZ I;  5KLV K;  1LWU A;  4YGO A;  2ZXX A;  2OTJ P;  2ZPA A;  3FX0 A;  3S4R A;  3KR5 A;  4P4D A;  1BCC E;  2BOA A;  1IYL A;  2C1C A;  3PH0 A;  1JY2 O;  3R1K A;  5APW A;  3AEF C;  1OW7 A;  2FFD C;  1DEB A;  3SXN A;  1ZXG A;  3A0B E;  3L35 A;  1VF5 D;  2VZZ A;  3VWE A;  1SQX D;  4MHP A;  3KZI E;  2QIW A;  4AXV A;  4EVY A;  2G3A A;  5KLV J;  3JVN A;  2W83 C;  1LT9 B;  3NXS A;  1NOH A;  4C2Z A;  2JKV A;  5THW A;  2Y0M A;  1UFH A;  1S4X A;  4KVO E;  4X3R A;  1ELL P;  2C6G A;  4MY3 A;  4B12 A;  2YNC C;  2E5T A;  5KLV G;  5GTI E;  6CPA A;  1RO5 A;  2W27 A;  2IL4 A;  5EC4 A;  4YXD C;  1LTJ B;  2Q6Q A;  4A7P A;  4OH8 B;  2A45 H;  1FJK A;  3I3G A;  4F9V A;  3H1H E;  1NYH A;  3CCQ P;  4FBE A;  1S7K A;  3F5B A;  2CK3 H;  4WY4 B;  2IFM A;  4IHM A;  3JCU H;  1SQB E;  4C2Y A;  2WPX A;  1JTH A;  2KCW A;  3L75 E;  2Q5U A;  1L4A A;  2O01 J;  1LAN A;  2N9Y B;  1FZC C;  3QB8 A;  4EI2 A;  4YRH A;  4AUW A;  2PRQ A;  2QVP A;  4MY0 A;  2Z3P A;  3DGV A;  4A37 A;  2ARH A;  2YIU C;  4GXH A;  1I1D A;  1LRZ A;  4K30 A;  4PV6 A;  4L89 A;  5HXD A;  2D2C B;  3OJA B;  5G1Z A;  3RK3 D;  1YQ4 C;  1AQ5 A;  4FD5 A;  4UIA A;  4MHD A;  4KLV A;  2FCK A;  5APV A;  5EMI A;  3S6F A;  2FFD A;  3NTN A;  3K2K A;  4EYY Q;  3L74 J;  1DE4 C;  3R4Y A;  4B5P A;  2H8P D;  4O9B A;  2BCC E;  1JCC A;  1BGY E;  3AE6 C;  3CI9 A;  1CX8 A;  2XV5 A;  2YO3 A;  3U1C A;  5KTA A;  1JQG A;  3R96 A;  3T90 A;  1Y7R A;  1QL1 A;  4ONU A;  2FXM A;  1ZG7 A;  3QNV A;  1QSM A;  5CBN A;  4RUH A;  4WY4 D;  5CHX A;  4XA4 A;  2AFO A;  2WMM A;  4QBJ A;  1Z8X A;  3AE1 C;  2XEI A;  4UFW A;  5HMN A;  2YNC A;  4ZKP A;  1S3Z A;  3DNS A;  2PJC A;  2V8H A;  3L70 D;  3CCL P;  4OVN F;  4TLF A;  5AVU B;  5DWN A;  1P4N A;  1Y9B A;  2NPS D;  2V7Q J;  2KNC A;  4JXR A;  3A9L A;  1UWY A;  3O6Q A;  2VI7 A;  3KR4 A;  3L72 D;  4K3N A;  1YYC A;  1QVF O;  2B4B A;  2FBW C;  2YO2 A;  5JH9 A;  3I5C A;  5AG6 A;  1FZC A;  3B35 A;  4FAI A;  2QE7 H;  1OX3 A;  1ZR2 A;  4UEZ A;  4Y49 C;  2EWB A;  2P10 A;  3GUX A;  2NZ2 A;  1LAP A;  3EFA A;  2PIY A;  3VTP C;  4Y99 C;  4RS2 A;  1UIX A;  1IZN B;  1JY2 N;  1NTM G;  1OVV A;  2XDJ A;  4PD4 D;  1V0C A;  4OC0 A;  3V8I A;  3IIB A;  3B8G A;  1GW3 A;  4K35 A;  1CSB A;  2PIZ A;  1CI6 B;  3IFE A;  3CC4 P;  2ZED A;  3HE5 B;  2DPT A;  2ZW5 A;  1WK4 A;  1PP9 D;  3NA6 A;  3CPW O;  3M0A A;  4OGQ B;  2G3T A;  2QSI A;  2PVV A;  1BE3 D;  2WZN A;  3LIE A;  3DR8 A;  1G2C A;  4EWT A;  1YSJ A;  1NU1 K;  2P58 A;  3PRJ A;  2R8V A;  2LXC B;  1S7N A;  3D6Z A;  2JBJ A;  5JGF A;  3U1A A;  2C6P A;  4NGN A;  3PEI A;  3D68 A;  4P4I A;  2JWD A;  3H1I J;  2FS5 A;  1VIX A;  2IYP A;  2Q7C A;  2ZW4 A;  1OWA A;  2JP3 A;  2C0W A;  4F6A A;  3MD0 A;  1JY3 P;  5TIS E;  2P6E A;  1Z4E A;  4C7N A;  1CZQ A;  2W6J H;  2YNE A;  2K3R A;  1NU1 J;  3PTZ A;  1SQP D;  4MFK A;  4R3K A;  3PJS K;  1YHQ P;  1N86 A;  5GTH H;  1GHE A;  5J1Q A;  1QL2 A;  1SQX E;  2WYR A;  2B87 A;  3KI9 A;  1IOF A;  3F89 A;  2A4N A;  3CCS P;  3TT2 A;  4II9 A;  1QQ9 A;  4OGQ D;  2OR4 A;  1E79 H;  4A30 A;  1NU1 G;  3TGU J;  3BHX A;  1LT9 C;  4OAD A;  4B14 A;  3TSI A;  4XPK A;  3KXD A;  3D2P A;  4YFJ A;  2J59 M;  4NGM A;  3GIU A;  1LOK A;  1X10 A;  1YW6 A;  2QJK B;  5APY A;  1JNM A;  1BCC J;  2O01 H;  1TKJ A;  3TGU G;  1XMB A;  4TWE A;  1BOB A;  2WSS H;  4B6Z A;  4JZ0 A;  3JSV C;  3FJU A;  1LTJ C;  2Q43 A;  5A28 A;  3FH4 A;  1AJY A;  1CPS A;  2H89 C;  3KL9 A;  4W80 A;  4IK2 A;  4WY4 C;  2A06 D;  2O1K A;  2JEW A;  1D7M A;  1FDI A;  4D6T D;  1BCC G;  2Z3M A;  5APQ A;  3ITK A;  1SVF A;  1X22 A;  3D8P A;  3ISX A;  3GKR A;  1HEE A;  5KKZ B;  1SQB K;  3AE5 C;  3HUV A;  4MJ8 A;  1M7L A;  3FRM A;  2NPS C;  3A0H H;  1R3N A;  3RK3 E;  4IFD K;  3MUD C;  1XBU A;  1JEK A;  4AYC A;  2M5A A;  3E1R A;  4WBA A;  3VAT A;  3B3V A;  2FYU D;  1IY7 A;  1SFC B;  3VP9 A;  3EO4 A;  1ZLL A;  1Q2N A;  3CX5 I;  5H84 A;  1N8R Q;  3WU2 H;  3H1H J;  1FOS F;  4CYO A;  1KYO I;  1PGJ A;  3S1K A;  4E0A A;  2FL4 A;  3L71 D;  5AW8 B;  3SJX A;  1SQB J;  3D7G A;  3FXE A;  3RL0 g;  3L75 J;  2YGW A;  3FEC A;  1LT9 A;  4RI1 A;  1BSN A;  4F8Z A;  4HPS A;  3A7O A;  1BDD A;  4KVX A;  1KB9 I;  1RE3 A;  3H1H G;  2IYO A;  2Z3O A;  2BEZ F;  1VHE A;  2YXQ B;  4NGT A;  4OC1 A;  5CCH D;  4UWI A;  1B6B A;  1XEB A;  4H0L D;  1MKM A;  3L73 E;  4I7Z B;  1SQB G;  1P84 I;  4A95 A;  4UCP A;  1DH3 A;  2OB0 A;  3B8E B;  4KHX A;  3RL0 D;  3L70 E;  5B5E H;  1LTJ A;  1ZG9 A;  1URQ B;  2GU2 A;  1FZB A;  1J4J A;  2BUE A;  3D7D A;  5H2F H;  4LX9 A;  1BO4 A;  3S9L A;  2Q1K A;  3BLN A;  1ZR4 A;  4WY4 A;  4AVB A;  3RGU A;  1VL2 A;  4DCK A;  1ARM A;  2OYH B;  3WC6 A;  2PE3 A;  3M06 A;  5C88 A;  1BGY J;  2ZYG A;  1XMT A;  5D29 A;  4KOT A;  2I1K A;  4UB8 H;  5E79 E;  3TO7 A;  1LJ2 A;  1SQQ D;  1ZME C;  3AE8 C;  3K9U A;  1NSA A;  4M6I A;  5D8N A;  2W8Z A;  2RB7 A;  3MN8 A;  4PK2 A;  3CX5 H;  2ZEO A;  4EDF A;  2GM4 A;  4PD4 E;  1EZV D;  4R57 A;  4JPZ B;  2RN0 A;  2NPS A;  3JUW A;  1NKN A;  2H43 A;  3CPA A;  1KC8 Q;  4H13 D;  1QMU A;  1IK7 A;  2PCU A;  3SWY A;  2AFU A;  3LOD A;  4MBU A;  3OW2 O;  4CYN A;  1MUU A;  1TXR A;  1VQL P;  3AEC C;  2IJZ A;  2B89 A;  2IZ1 A;  1PP9 E;  3I55 P;  3H1J D;  1IJD B;  1YW4 A;  1Z8L A;  1FAV A;  4OGQ C;  2PJ7 A;  1BE3 E;  1HDU A;  2ITA A;  1TF9 A;  5LYL A;  5A27 A;  1OXZ A;  1P84 H;  1GZL A;  3WR7 A;  4H44 B;  3CXH I;  1URQ D;  1N71 A;  5LRG A;  1TKH A;  1T6A A;  4JBZ A;  2EK9 A;  2E75 B;  1M4I A;  5AW7 B;  3W91 A;  2WPW A;  2P6G A;  1GTW A;  3T8W A;  3R9E A;  5K8N A;  3CPX A;  3LD2 A;  5F48 A;  1S5L H;  4F9U A;  1M4G A;  3II6 A;  3GHG C;  3KKW A;  2WWW A;  4CAE A;  4NEX A;  1FZF A;  2AEF A;  4DJL A;  3LAC A;  5KJ7 D;  3H1L D;  1EZV I;  3DDD A;  5AW5 B;  3LW5 H;  1Q82 Q;  1XIX A;  2AE6 A;  3VMX A;  2RC4 A;  1RF0 C;  2NMT A;  1BSH A;  4CRZ B;  1M1D A;  3TYY A;  3S9N A;  5CJ0 A;  2WUU A;  1T8Z A;  1KD1 Q;  1SLQ A;  2QEC A;  1SQP E;  2PRB A;  2Q3I A;  2HC9 A;  1VHO A;  4OC2 A;  5CNP A;  2R5D A;  1K73 Q;  1X8Y A;  3KHZ A;  4YTP C;  2Q4Y A;  4NPF X;  2QVA A;  3FIX A;  4U9Y A;  1LTA C;  1YIT P;  4QMA A;  1SQH A;  2Z3N A;  2AXC A;  5KAF H;  1SQX K;  2BL1 A;  1N7L A;  3PB9 X;  4CAF A;  3N4X A;  1J2J B;  1U6M A;  4H44 D;  2K9Y A;  4OC4 A;  3IU1 A;  3KHX A;  2WPQ A;  4MMO A;  1CI6 A;  2PAJ A;  2XEJ A;  4OAE A;  5AVV B;  1IFP A;  1IB1 E;  3MRU A;  3CXH H;  4PK3 A;  5B66 E;  4M3S A;  2XEF A;  3A0B H;  3HE5 A;  2IBZ D;  2O53 A;  1EDK A;  2QJK C;  4PV1 B;  3CXQ A;  4R3L A;  3KZI H;  3SJE A;  4U3F D;  4ZMD A;  1GD2 E;  5DWM A;  1WWZ A;  1QSO A;  1MZ9 A;  4ZI6 A;  4MFZ A;  3S9M A;  2A06 E;  2CNS A;  4TNU A;  4DYO A;  5C82 A;  5G22 A;  4D6T E;  4H89 A;  4HKF A;  2WSE J;  2KZJ A;  1VDF A;  5CCH C;  4Q36 A;  2Q44 A;  4H0L C;  3CCV P;  3GF3 A;  4C7I A;  3B3S A;  1KFM A;  5GTI H;  1ZOY C;  4M85 A;  2YKQ A;  3RL0 C;  3GHG A;  4Y28 J;  2OZG A;  2KB7 P;  5KKZ C;  4MCP A;  4NGP A;  1Z2L A;  2Q7S A;  2C9N Y;  4R8F A;  1BAV A;  1GK6 A;  1RF0 A;  3K5B A;  3JC2 2;  5AW1 B;  2FYU E;  1QST A;  5KTB A;  2AJ6 A;  3D4U A;  4A39 A;  2A45 I;  5HH1 A;  1KQF B;  1VQ4 P;  1SFC C;  5DS0 A;  3D6Y A;  2OOT A;  2QRX A;  1ZO0 A;  3P8C D;  1S5L X;  3H8G A;  1QSN A;  4IOI H;  4LGD E;  4OWF A;  2ZVN B;  4AG7 A;  3A2A A;  4MI4 A;  2DPS A;  1L0N D;  3L71 E;  2GAN A;  3SI2 A;  1LTB C;  3B3T A;  3S6K A;  4H13 C;  2FSR A;  4ZYQ A;  1LAM A;  1S3J A;  3RAM A;  3KQX A;  3AEB C;  2CNM A;  2JEE A;  1XFO A;  3HD7 B;  3MGD A;  5AVX B;  2DXQ A;  2YXR B;  3C9I A;  4Z65 A;  1MFT A;  4I7Z C;  2AFW A;  4BRY A;  1H8A A;  4DNC A;  1HGZ A;  4OME A;  5L8R J;  4LUA A;  3SFD C;  3T97 B;  1DEE G;  4UFV A;  3M0D C;  2N1T B;  3FVL A;  3IC1 A;  1ZP0 C;  3FYN A;  1URQ C;  5G20 A;  1N73 B;  2ZYD A;  5G21 A;  1AFO A;  3SI1 A;  1F2O A;  3H1K D;  2KZI A;  4IAV A;  3BRV B;  3TCV A;  3E0K A;  1M4L A;  3GLJ A;  4P4J A;  5JQ4 A;  2QJY B;  5K8O A;  2OYH C;  5CCH A;  1JY3 N;  2FXO A;  2B5G B;  3FEE A;  3H25 A;  3IGR A;  1IFJ A;  1SQQ E;  1P0H A;  2PDO A;  2ZOG A;  4CGL A;  5KJ7 C;  5HVH A;  4JYC A;  3RO0 A;  2QML A;  3G9R A;  4MHZ A;  1EE3 P;  1FU1 A;  4IL6 E;  2ODF A;  3TX8 A;  2Z5H A;  3F8K A;  1AQT A;  4Q7A A;  4X2T A;  2W6B A;  5EFW B;  3L73 J;  2HG5 D;  4TT3 H;  1KZF A;  3H1J E;  2FIA A;  1LTI C;  2PJ6 A;  3HD7 D;  3L70 J;  4GOF A;  3WT4 A;  4EME A;  3FXD A;  2FE7 A;  1KZU B;  5AG4 A;  1IK9 A;  5F09 A;  1A02 J;  1S7F A;  2OYI B;  1IO4 A;  2JDC A;  3L73 G;  5BVZ A;  3WC7 A;  1LNQ A;  3W68 A;  2N1T D;  4H44 C;  3EFF K;  2IZ0 A;  1USE A;  2HB6 A;  4CGO A;  2FYN C;  3B5N B;  3L70 G;  2E75 C;  1PCA A;  2B58 A;  4AB7 A;  2P1J A;  2KIK A;  3WUT A;  2XND H;  3Q3D A;  1YI2 P;  1CP7 A;  1R5S A;  2IFN A;  2WPS A;  5KLV D;  2VEZ A;  5ELY A;  1YJ9 P;  3H1L E;  4RN7 A;  4UBR A;  3S6H A;  4W7Y A;  3D70 A;  3L74 G;  1IID A;  3M0D A;  3MP7 B;  1URQ A;  1IC2 A;  1M8O B;  5I0C A;  4UF4 A;  1PP9 J;  2D4O A;  1AYE A;  2IDB A;  2KXP B;  2EVN A;  2QJP C;  1KIL B;  1AV1 A;  2P6F A;  2OYH A;  4JD6 A;  1FNO A;  5IV0 A;  4OC5 A;  4PJ0 H;  4GOD A;  1RE4 C;  1SQP K;  2ZEF A;  5KJ7 A;  1M57 D;  3SFE C;  1KQS O;  2D2C D;  3G4S P;  2D4P A;  3NMD A;  4PXC A;  1PUA A;  3HUS B;  5APU A;  3PB4 X;  3NH5 A;  3P7K A;  3B5N D;  5AVW B;  1X0T A;  1MK4 A;  2IBZ E;  1S72 P;  1K8A Q;  3CXP A;  4ZY1 A;  1LP1 B;  3KDP B;  2WSE H;  4M3L A;  4U3F E;  1IOI A;  4MHY A;  4PV1 C;  3Q5P A;  2H5M A;  1GMJ A;  4JXQ A;  2R44 A;  2AFX A;  1SQP J;  4KSI A;  4CS0 B;  2Q4V A;  4U9Z A;  3WAB A;  1NTZ E;  1RF1 B;  2BSW A;  2P2U A;  1FY7 A;  1MV8 A;  1Y47 A;  1GL2 B;  4C46 A;  2DF5 A;  2WT7 A;  1X12 A;  1SS1 A;  4H6Z A;  1CPX A;  3EXN A;  3KQG A;  1KIL D;  1SQP G;  3BCC E;  1NAY A;  1OIP A;  5AW4 B;  2K9J B;  3N5F A;  1FJP A;  4B5O A;  5CJ4 A;  2KS1 B;  4RO0 A;  2OGU A;  2BEQ D;  3PZJ A;  1M44 A;  1IYK A;  4P44 A;  4OKO A;  1Y9W A;  1PFI A;  2GUS A;  3PHL A;  3L37 A;  2JJL A;  2GE3 A;  1AVY A;  3D7H A;  2VRS A;  3P8C E;  1QX8 A;  3RYO A;  4MFJ A;  2PJ8 A;  2OH1 A;  2QEX P;  2E76 B;  4NPD A;  2PRR A;  1XRY A;  2PR8 A;  5LYF A;  2POK A;  1YBK A;  2Z10 A;  3FF3 A;  1L0N E;  2FYU K;  3H32 A;  4HKZ H;  4ZNC A;  1J1D B;  1Z8W A;  1RE4 A;  2WQY C;  4D6T J;  2PGD A;  5AW9 B;  3KZW A;  1TIQ A;  1NTM D;  1OW8 A;  2ZJS E;  4LC1 A;  2R3C A;  3H1I G;  1NJI Q;  4KOY A;  2CNT A;  2Y0E A;  5F47 A;  3EFG A;  4DZO A;  2WSF J;  1HWT C;  3HD7 C;  2J8M A;  2A06 G;  1Y9K A;  1BPN A;  4R76 A;  4A94 A;  3CL3 D;  4PQA A;  4D6T G;  5CPA A;  3T9Y A;  1VQO P;  4E8O A;  5KLI B;  2RMZ A;  2Y0D A;  4PPZ A;  1NE9 A;  4OIW A;  4GIF A;  4AVC A;  1ZG8 A;  1U7J A;  2CXA A;  2FYU J;  2VZY A;  3PP9 A;  2N1T C;  2PFX A;  3H1K E;  1YLO A;  3K9T A;  3V7Z A;  4K3A A;  1N73 C;  4HJG H;  2Z3K A;  5E96 A;  5EBV A;  4YPC A;  3VMY A;  4H2K A;  1OBR A;  3CX5 D;  4BBH A;  4UEF A;  3F0A A;  4DUK A;  3IEH A;  5H86 A;  2QJY C;  3R2P A;  2CIJ A;  3P2F A;  2HR3 A;  1PV3 A;  1KYO D;  2OU2 A;  4CGP A;  2P67 A;  1GU5 A;  2HFE D;  2E76 D;  4C7R A;  3V2R A;  1M1K Q;  4XPL A;  1JUN A;  4KOR A;  1PIX A;  4UB6 H;  4NGQ A;  2LR2 A;  1FBM A;  4B10 A;  1DD4 A;  4MFL A;  1KB9 D;  1MFZ A;  3M91 A;  1SQQ K;  1RXT A;  2HPC A;  1X79 B;  3BRT B;  4B86 A;  4EOT A;  3QWO C;  2HUZ A;  2AFZ A;  3AEE C;  4CYQ A;  3V2Q A;  3WMM 0;  1P84 D;  4XPD B;  5AVZ B;  1M1J B;  1KMI Z;  1CM0 A;  4KZT A;  3G3S A;  4PXB A;  4KOU A;  2D2C C;  3A5T A;  4IFM A;  2VBQ A;  1AVO A;  2OYI C;  5K5G B;  1GYT A;  3CXS A;  2EUI A;  3LMS A;  5KAI H;  3B5N C;  4FUU A;  3UY5 A;  3TK1 A;  2OAR A;  2CF4 A;  4C2X A;  3HD7 A;  3RBZ A;  1L4A B;  3CCJ P;  4NCZ A;  3TC8 A;  4MFQ A;  4NSQ A;  1BDC A;  3TGU D;  5LRJ A;  4C68 A;  1QEX A;  4I2L C;  4KUB A;  5FVJ A;  4WWI A;  1Q7L A;  2K37 A;  3T97 A;  2E42 A;  1JWQ A;  1VPC A;  2N1T A;  2I79 A;  4W9Y A;  3H6P A;  1IGB A;  1N73 A;  2V7Q H;  5LYI A;  4F0X A;  2K1A A;  3H1J J;  1EXI A;  2O28 A;  1BCC D;  2Q0Y A;  1S60 A;  1KIL C;  3G71 P;  1ZW0 A;  3OA7 A;  1JOC A;  3L75 G;  2OQQ A;  1K04 A;  1G1J A;  3SHP A;  5M1B A;  2PJ3 A;  5IX3 A;  5JM6 A;  1K05 A;  1DD3 A;  3ZZI A;  4B5P B;  4Z1M H;  2VXK A;  3H8E A;  2XZR A;  4A31 A;  4AVA A;  1YTZ I;  2QIR A;  1PPJ D;  3H1J G;  3EC4 A;  3CXH D;  1JY2 P;  1KUY A;  3L72 E;  3TDK A;  4EFD A;  1CW5 A;  1UII A;  3TOB A;  2BCC J;  1SFC D;  2AEM A;  1IFM A;  8CPA A;  1YVO A;  2W6A A;  3NE7 A;  4KUA A;  4I1L A;  1BLL E;  3H1L J;  5K8P A;  3SWF A;  3CLQ A;  3FWL A;  2WIT A;  1S5K A;  4P4E A;  4R4L A;  3KQZ A;  3MUD A;  2BCC G;  4LQ6 A;  4B11 A;  1BGY G;  3AE9 C;  3PRT A;  1Q2C A;  3JRU A;  4A38 A;  4OP4 A;  1L0C A;  3H1L G;  4NJR A;  1RF1 C;  3B5N A;  1H8L A;  2KYV A;  1GW4 A;  1WRG A;  1DIP A;  1GL2 C;  2IPP A;  1M4D A;  2H7H A;  1YQ3 C;  5J8F A;  1KIL E;  3SJG A;  2RFH A;  2B88 A;  5BWA B;  1SQB D;  2JR8 A;  5APS A;  2HQY A;  1NTZ K;  1L2P A;  3SSU A;  2W90 A;  4BWN A;  3MZW B;  3CT9 A;  2AXT E;  3SI0 A;  1FZE A;  3V6I A;  1YME A;  3RBX A;  1VQ6 P;  2E43 A;  1H89 A;  4N78 D;  1IU8 A;  1HGV A;  4XE5 B;  3IO1 A;  4U3F J;  5AVQ B;  2FKW B;  4OC3 A;  1JY3 O;  4GM5 A;  1MJA A;  1VQ8 P;  1GK4 A;  2E76 C;  2V77 A;  1KIL A;  4UFX A;  2G9D A;  2M3E A;  3F5H A;  3R9G A;  2WSA A;  1J1D C;  4A2Z A;  2IBZ G;  1AA0 A;  1NTZ J;  1NTM E;  2GLF A;  3BAS A;  3V5B A;  4U3F G;  1IFI A;  3B7I A;  1KV4 A;  1VQP P;  1S2E A;  4KS9 A;  1LFW A;  3GG2 A;  2OZH A;  1HH0 A;  1L0N K;  2RH0 A;  1BPM A;  3KGQ A;  2O1J A;  1B87 A;  1Q2Y A;  1Z4R A;  3BCC J;  4PXE A;  5H2F E;  4ZY2 A;  2ZVO B;  4ZX8 A;  5CBM A;  3FED A;  1NTZ G;  4R4M A;  3H4Q A;  1NVO A;  4J3G A;  1LP1 A;  1Z5R A;  4YXW H;  3IAO A;  2ZEG A;  3B3W A;  1OZH A;  4HB1 A;  3VOP A;  4FD4 A;  3OWC A;  3HTK B;  3NFZ A;  5HVG A;  3G6E P;  1KQG B;  3P32 A;  4KT0 J;  5AW2 B;  4UB8 E;  3VMA A;  1KUX A;  3AE3 C;  4HH2 A;  3BCC G;  3QAY A;  4B13 A;  1IFD A;  2F5I A;  1N7S B;  3HE4 B;  3CX5 E;  1PL5 A;  2E75 D;  1ON0 A;  2NRG A;  2NSM A;  3QH9 A;  1L0N J;  4NGR A;  2QM7 A;  4UCM A;  1GL2 A;  1KYO E;  2JDD A;  3ZJ0 A;  1I21 A;  4KOS A;  4OLL A;  4ASV A;  1LTS C;  3V4Q A;  3V38 A;  4NJQ A;  1PGP A;  3DR6 A;  3HRN A;  2K9J A;  2VL1 A;  3TO9 A;  4FD7 A;  4JF7 A;  1KB9 E;  1SQX J;  3CWB D;  4L76 A;  1PGQ A;  2B9B A;  1W2E A;  4P10 A;  1L0N G;  4NXY A;  1LGH B;  2H88 C;  1XE4 A;  3TNU B;  1KN7 A;  5K8M A;  1P84 E;  2RKL A;  3ZDM A;  2PJ1 A;  2IMO A;  4XPD C;  2PC1 A;  3B2Y A;  4P6Y A;  2P0W A;  1M1J C;  2ZXV A;  4UIB A;  1SQX G;  3H1K J;  1Y7E A;  1Y0R A;  3FB3 A;  1VF5 B;  3W6S A;  4ZX9 A;  1YJW P;  4MRI A;  3GF7 A;  1HJB A;  2V4H A;  1FZA A;  3O8Z A;  3EY5 A;  1L0L D;  1VQN P;  1RTQ A;  1JMM A;  3KYQ A;  1N7S D;  1XOV A;  3E1I A;  3PB8 X;  1SQV D;  3H1K G;  2V8D A;  4C7H A;  2JWA A;  4I49 A;  4IFF A;  1U57 A;  2ZT9 B;  4PV1 D;  1L4A C;  3CC2 P;  4GS4 A;  5AVR B;  1HUC A;  1S7L A;  1RH5 B;  1NH4 A;  1KOR A;  2FXP A;  3PB6 X;  1VKC A;  2FXF A;  5J8C A;  4ZY0 A;  2OZU A;  5AG7 A;  1NO4 A;  4MHN A;  1Y0Y A;  2O4H A;  3CME P;  5AVS B;  2M5A B;  1NTK D;  1A02 F;  2CY2 A;  1A2Z A;  1RQV A;  1NHL A;  3TOA A;  2WSC J;  5KAF E;  3B4S A;  1XJO A;  1K9M Q;  2Q9I A;  4GOE A;  1M56 D;  2FY8 A;  2ZEN A;  1OMI A;  2WVR A;  5IB9 A;  4M6G A;  3VH9 A;  1PPJ E;  3CXH E;  4WVZ A;  2HLO A;  3TO6 A;  3N7N A;  1MJ9 A;  4YU9 A;  4A32 A;  3GB0 A;  4P4B A;  4MCS A;  3LWU A;  3W6X A;  3H5Z A;  1KFN A;  2Z4E A;  2VQY A;  1IIC A;  1FC2 C;  1ELM P;  3RK3 B;  4MFP A;  3D67 A;  5C39 A;  3G3Z A;  1EZV E;  2BO9 A;  2ZT9 D;  1KWM A;  1RY3 A;  1M1J A;  2ZW6 A;  5F46 A;  4ZGY B;  1Y8A A;  1NAF A;  5BU8 B;  4IF5 A;  1ZLH A;  3D7F A;  4CAV A;  3PFE A;  1SFC A;  2QYV A;  2OTK E;  3PP5 A;  1FDO A;  1OFC X;  4X5K A;  3AE4 C;  1ARL A;  4OID A;  2QG4 A;  2L5G B;  3H8F A;  2KLU A;  3Q1M A;  2GRE A;  4QVT A;  2M3B A;  3GW6 A;  2NYQ A;  4JWP A;  3Q5S A;  1EXJ A;  2Y0C A;  2J9A A;  3L72 J;  1Z8T A;  2V8V A;  2J8N A;  3MGN A;  2ZEP A;  2BCO A;  4IL6 X;  2B3V A;  4I6M C;  3FX6 A;  1YQE A;  1WMK A;  4N78 E;  4UA3 A;  3CC7 P;  2QJ8 A;  3M9Q A;  4MN4 C;  2NPS B;  1Q90 D;  3L72 G;  2Q4Z A;  3WC5 A;  3TTH A;  4ORF A;  5CMZ A;  2QM8 A;  4ZBG A;  3AE7 C;  2Y9Z A;  4QB9 A;  1ZRT D;  4JYB A;  3TFY A;  2BAS A;  1KUV A;  2SPZ A;  5AW3 B;  2E74 B;  3NE8 A;  1PZQ A;  2KUB A;  1PU9 A;  1OVU A;  4MCR A; 
#chains in the Genus database with same CATH homology
 3IWG A;  2PSW A;  4CYN A;  5H86 A;  2QJY C;  3EWK A;  3AEC C;  2R7H A;  3P2F A;  3SXO A;  1PV3 A;  2PQ8 A;  2OU2 A;  4CGP A;  4F0Y A;  2REE A;  4CAX A;  2E76 D;  2G8Y A;  2R98 A;  3N7Z A;  1QSR A;  4XPL A;  4OGQ C;  1PIX A;  4KOR A;  4YGO A;  2ZPA A;  5A27 A;  1KTM A;  4B10 A;  1DD4 A;  4MFL A;  3WR7 A;  4H44 B;  1IYL A;  1RXT A;  1N71 A;  3R1K A;  2E75 B;  3AEF C;  1OW7 A;  1M4I A;  3W91 A;  2HUZ A;  4Q38 A;  3AEE C;  3SXN A;  2WPW A;  4CYQ A;  2P6G A;  3R9E A;  4XPD B;  3LD2 A;  5F48 A;  1CJW A;  3FBU A;  1M4G A;  1VF5 D;  2VZZ A;  3VWE A;  1KMI Z;  1CM0 A;  3KKW A;  4KZT A;  3G3S A;  2Q7B A;  2QIW A;  4CAE A;  4KOU A;  4NEX A;  2D2C C;  4KOV A;  2VBQ A;  3DDD A;  1XIX A;  4EVY A;  2G3A A;  2AE6 A;  3JVN A;  2RC4 A;  2NMT A;  4CRZ B;  4C2Z A;  1M1D A;  2Y0M A;  1NSL A;  3CXS A;  2WUU A;  3G8W A;  2QEC A;  1UFH A;  2EUI A;  3BJ8 A;  3UY5 A;  4KVO E;  2PRB A;  2E74 D;  2J8R A;  4B12 A;  4MY3 A;  2B4D B;  4C2X A;  1YX0 A;  4QC6 A;  2YNC C;  3QAH A;  3D71 A;  5CNP A;  4NCZ A;  4MFQ A;  4NSQ A;  1RO5 A;  4UCN A;  2IL4 A;  5EC4 A;  4C68 A;  1VF5 C;  4YXD C;  1MJB A;  5GCN A;  4YTP C;  2Q4Y A;  4KUB A;  5FVJ A;  2Z11 A;  3I3G A;  3FIX A;  1NYH A;  4U9Y A;  1JB0 J;  1SQH A;  4KOW A;  2I79 A;  1S7K A;  2Z3N A;  3F5B A;  2BL1 A;  4CAF A;  4F0X A;  2Z0Z A;  1YLE A;  1U6M A;  1EXI A;  4H44 D;  2K9Y A;  3IU1 A;  3B71 A;  4C2Y A;  2WPX A;  2O28 A;  1Q2D A;  2KCW A;  4OAE A;  1IB1 E;  1OZP A;  2Q0Y A;  2O01 J;  1S60 A;  4PK3 A;  4M3S A;  3QB8 A;  2ZT9 C;  2OQQ A;  1K04 A;  4YRH A;  3SHP A;  2QJK C;  5M1B A;  4PV1 B;  4MY0 A;  5IX3 A;  3CXQ A;  4R3L A;  1K05 A;  1DD3 A;  3ZZI A;  4B5P B;  4Z1M H;  2VXK A;  2Z3P A;  1VHS A;  4A31 A;  4AVA A;  5DWM A;  2QIR A;  1WWZ A;  1QSO A;  3EC4 A;  2ARH A;  2YIU C;  1KUY A;  1YR0 A;  4IUS A;  1I1D A;  1LRZ A;  4K30 A;  4PV6 A;  4L89 A;  4MFZ A;  2D2C B;  2CNS A;  3FNC A;  5G1Z A;  3FGA D;  1YQ4 C;  3Q5R A;  3TOB A;  5C82 A;  5G22 A;  2K5T A;  4H89 A;  4FD5 A;  4MHD A;  4HKF A;  2FCK A;  4GDO A;  2WSE J;  4KLV A;  1YVO A;  2MKV A;  3Q2Y A;  3NE7 A;  3S6F A;  4Q36 A;  4KUA A;  2Q44 A;  4H0L C;  3GF3 A;  3R4Y A;  2HV2 A;  4B5P A;  4C7I A;  1ZOY C;  4M85 A;  1S5K A;  4R4L A;  4JLY A;  4KLW A;  4Y28 J;  2OZG A;  3AEA C;  5KKZ C;  3AE6 C;  4B11 A;  3LW5 J;  5KTA A;  3AE9 C;  3R96 A;  3T90 A;  1Q2C A;  1Y7R A;  3GLM A;  1L0C A;  4ONU A;  1QST A;  1QSM A;  2AJ6 A;  5HH1 A;  1KQF B;  1M4D A;  3S9O A;  1DIP A;  3D6Y A;  1ZO0 A;  4QBJ A;  1S5L X;  2I00 A;  1YQ3 C;  5J8F A;  1KIL E;  3AE1 C;  1QSN A;  4KSF A;  4UFW A;  5HMN A;  2YNC A;  5BWA B;  1S3Z A;  4AG7 A;  2HQY A;  4MI4 A;  2DPS A;  4JJX A;  2GAN A;  4PSX A;  2GIV A;  3DNS A;  3S6K A;  4H13 C;  5DWN A;  3C26 A;  1P4N A;  1Y9B A;  2FSR A;  2V7Q J;  4JXR A;  3A9L A;  4QUS A;  4XNH B;  3O6Q A;  3AEB C;  2CNM A;  2VI7 A;  3MGD A;  1MJA A;  3JTK A;  2B4B A;  4HNX B;  5F49 A;  2FBW C;  2E76 C;  2DXQ A;  4UFX A;  5AG6 A;  3C8V A;  3R95 A;  1S1C X;  4Y49 C;  3ABV C;  4I7Z C;  4H0L B;  4DNC A;  3R9G A;  2P10 A;  2WSA A;  2NZ2 A;  4A2Z A;  5L8R J;  3EFA A;  4LUA A;  3SFD C;  3T97 B;  4RS2 A;  4UFV A;  1UIX A;  1ZP0 C;  4A33 A;  3FYN A;  5G20 A;  1V0C A;  3GY9 A;  5G21 A;  3V8I A;  4U5Y A;  3B8G A;  4AG9 A;  4KS9 A;  2OZH A;  3TCV A;  1B87 A;  1HJ0 A;  3IN6 A;  1Q2Y A;  1Z4R A;  3E0K A;  2B3U A;  5JQ4 A;  3P2H A;  2WPV B;  2B5G B;  2DPT A;  1R57 A;  2ZW5 A;  3H25 A;  3IGR A;  4R4M A;  3H4Q A;  1WK4 A;  1P0H A;  4J3G A;  2PDO A;  4KSA A;  3IAO A;  4CGL A;  2FT0 A;  1ZRT E;  2JEV A;  4OGQ B;  4FD4 A;  3OWC A;  3AED C;  2G3T A;  2QML A;  2JO1 A;  3G9R A;  3AE2 C;  1KQG B;  4KT0 J;  1KUX A;  2QSI A;  2BEI A;  4HNY B;  3AE3 C;  4BMH A;  3DR8 A;  4B13 A;  2F5I A;  3F8K A;  3VWD A;  1PL5 A;  2PR1 A;  2E75 D;  2R8V A;  1ON0 A;  2E74 C;  4H13 B;  1S7N A;  2X7B A;  4TT3 H;  1KZF A;  2B5G A;  3D6Z A;  5AGE A;  4UCM A;  2FIA A;  2JDD A;  2C27 A;  3ZJ0 A;  1I21 A;  4KOS A;  4OLL A;  4UWJ A;  2Q04 A;  2FE7 A;  3DR6 A;  2FS5 A;  5AG4 A;  3GYA A;  1S7F A;  4KOX A;  2ZW4 A;  3TO9 A;  2JP3 A;  4FD7 A;  4PSW A;  2JDC A;  4H6U A;  4F6A A;  4H44 C;  2P6E A;  3BJ7 A;  1XF8 A;  1Z4E A;  4CGO A;  2FYN C;  4NXY A;  2H88 C;  2YNE A;  1XE4 A;  2E75 C;  2B58 A;  4MFK A;  4AB7 A;  4R3K A;  1YGH A;  2Z3L A;  4XPD C;  1GHE A;  2PC1 A;  3Q3D A;  4CAW A;  2P0W A;  1YK3 A;  2VEZ A;  2ZW7 A;  2ZXV A;  2A4N A;  5AG5 A;  3TT2 A;  3FB3 A;  1VF5 B;  4L8A A;  3W6S A;  4II9 A;  4UBR A;  3S6H A;  3D70 A;  4XFJ A;  3GF7 A;  4OGQ D;  1IID A;  2JLM A;  4A30 A;  5KTC A;  5KTD A;  2J5U A;  4OAD A;  4NF1 A;  4B14 A;  3EY5 A;  4XPK A;  5I0C A;  2D4O A;  2IDB A;  3D2P A;  4YFJ A;  2EVN A;  2QJP C;  1NMT A;  4C7H A;  2P6F A;  3D2M A;  4I49 A;  1U57 A;  2ZT9 B;  4JD6 A;  1R8E A;  5IV0 A;  4PV1 D;  4GS4 A;  1S7L A;  1KOR A;  2FXP A;  1BOB A;  1Z9U A;  3TE4 A;  3SFE C;  1VKC A;  2FXF A;  5J8C A;  5A28 A;  2D2C D;  3IU2 A;  1AJY A;  2OZU A;  3DSB A;  5AG7 A;  2H89 C;  2D4P A;  2FIW A;  3S6G A;  1PUA A;  2CY2 A;  4CYP A;  4E2A A;  1RQV A;  1FDI A;  4U7J A;  1NGM B;  3TOA A;  2WSC J;  1MK4 A;  2Z3M A;  4R9M A;  3CXP A;  4KVM E;  2YND A;  3GMA A;  2YMK A;  1OMI A;  4RKU J;  3FXT A;  4PV1 C;  3D8P A;  3Q5P A;  2H5M A;  1GMJ A;  3GKR A;  4JXQ A;  3IWE A;  3TO6 A;  3AE5 C;  1MJ9 A;  4A32 A;  4MJ8 A;  3FRM A;  3W6X A;  3RK3 E;  4CS0 B;  3H5Z A;  1OW6 A;  2Q4V A;  3I9S A;  2G0B A;  2VQY A;  4U9Z A;  1IIC A;  2BSW A;  4MFP A;  4FD6 A;  1FY7 A;  3EO4 A;  4H6Z A;  5JPH A;  5KLI C;  3EXN A;  5H84 A;  1RQU A;  2ATR A;  2ZT9 D;  4R87 A;  4CYO A;  2ZW6 A;  3PGP A;  5F46 A;  4ZGY B;  4B5O A;  4E0A A;  2FL4 A;  2BEQ D;  3PZJ A;  4IF5 A;  1M44 A;  3RL0 g;  4CAV A;  2YGW A;  1IYK A;  4RI1 A;  1Y9W A;  1FDO A;  2GE3 A;  4X5K A;  4KVX A;  3AE4 C;  1I12 A;  3RYO A;  4MFJ A;  2Z3O A;  4HNW B;  2BEZ F;  1TU3 F;  2OH1 A;  2E76 B;  3Q1M A;  2PR8 A;  4UWI A;  1B6B A;  2Z10 A;  2B4D A;  1XEB A;  4H0L D;  1MKM A;  4QVT A;  4Y49 B;  4I7Z B;  4JWP A;  3Q5S A;  1EXJ A;  1HF9 A;  4A95 A;  2R1I A;  2J8N A;  4UCP A;  2OB0 A;  2WQY C;  4IL6 X;  2B3V A;  1YVK A;  2REF A;  1WMK A;  1TIQ A;  1K4J A;  1OW8 A;  1J4J A;  2BUE A;  4UA3 A;  4LX9 A;  1BO4 A;  3BLN A;  1YRE A;  3AEG C;  4KOY A;  4AVB A;  1Q90 D;  2CNT A;  1VL2 A;  3D3S A;  5F47 A;  4XNH C;  2WSF J;  4CGM A;  2J8M A;  5C88 A;  1Y9K A;  3TTH A;  4ORF A;  1XMT A;  4CGN A;  4KOT A;  3T9Y A;  3TO7 A;  4E8O A;  4ZBG A;  1ZME C;  4AVC A;  3AE8 C;  1NE9 A;  3K9U A;  5ISV A;  3AE7 C;  4PK2 A;  5IB0 A;  2CXA A;  4QB9 A;  2VZY A;  3PP9 A;  4R57 A;  3TFY A;  3JUW A;  1KUV A;  3R9F A;  2Z3K A;  5E96 A;  5EBV A;  4H13 D;  2E74 B;  1IK7 A;  3LOD A;  4MBU A;  4BBH A;  3F0A A;  1PU9 A;  4CRY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...