2G3AA

Crystal structure of putative acetyltransferase from agrobacterium tumefaciens
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
b'MNFVLSDVADAEAEKAIRDPLVAYNLARFGESDKRDLNITIRNDDNSVTGGLVGHTARGWLYVQLLFVPEAMRGQGIAPKLLAMAEEEARKRGCMGAYIDTMNPDALRTYERYGFTKIGSLGPLSSGQSITWLEKRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acetyltransferase
molecule tags Transferase
source organism Agrobacterium tumefaciens str. c58
publication title Crystal structure of putative acetyltransferase from Agrobacterium tumefaciens
rcsb
total genus 33
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2006-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2g3aA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2g3aA02
4PK3A 2J8RA 5H86A 3IGRA 3P2FA 1Y9WA 5HH1A 4XNHB 4UA3A 3V8IA 4B5PB 3S6FA 1VHSA 3EXNA 3S9OA 2O28A 5J8CA 3GY9A 2CNMA 3W91A 2GANA 3JVNA 4FD4A 4KUBA 3R9EA 3SHPA 4CAWA 1YQ4C 1QSMA 2PSWA 1LRZA 3R9GA 4M3SA 3F5BA 4CS0B 3IWGA 4R3KA 4KOWA 1P0HA 4EVYA 4K30A 3TOAA 4X5KA 2NMTA 1YQ3C 4QB9A 1ON0A 3D2MA 1TIQA 3LD2A 4L89A 1PV3A 2P6EA 5CNPA 3JUWA 3AE5C 2DXQA 2ZW6A 4KOYA 5HMNA 3SXNA 2OZGA 2Z0ZA 1S60A 5J8FA 3CXSA 3AE4C 2AE6A 2Z10A 2ZPAA 1MK4A 2REFA 2J8NA 2Q44A 2R1IA 2J8MA 1NSLA 3T9YA 1Q2CA 1FY7A 4RS2A 2BUEA 2B5GB 2PR8A 1OW8A 5JPHA 3DR6A 3W6XA 3CXPA 3DR8A 1YGHA 1YVKA 4FD5A 1NMTA 1J4JA 3R96A 2I00A 1M4GA 3B8GA 4PSWA 1I21A 1M4IA 1Y9KA 3DDDA 2FSRA 1CJWA 4AVBA 2B3UA 3W6SA 1IYKA 4LUAA 1BO4A 2BL1A 2ZXVA 3FRMA 3TTHA 2OZHA 3R1KA 4KOUA 5JQ4A 3C26A 4NF1A 4HNYB 2Q4YA 4MJ8A 1K04A 4KOXA 2VBQA 4FD7A 4NXYA 3ZJ0A 2G3AA 4FD6A 5F46A 1M4DA 4KOSA 1M44A 1OZPA 3EFAA 3R95A 1IB1E 5IB0A 5C88A 3LODA 3EO4A 3TCVA 2D4PA 4ONUA 2C27A 1YVOA 2FBWC 3FNCA 4HNWB 2R8VA 5E96A 2P6GA 4NEXA 3S6KA 1NE9A 4XPDC 3TO7A 2Q0YA 1IIDA 4QUSA 1ZOYC 2CY2A 2PDOA 4KUAA 4KORA 4XPKA 4KOVA 2B4DB 1I1DA 3QB8A 4E8OA 1GHEA 4KOTA 5KTDA 4U9ZA 3FBUA 1M1DA 1P4NA 5ISVA 1QSNA 1QSTA 2PQ8A 4HKFA 3T90A 2Q04A 2B3VA 5DWMA 1OW6A 2FCKA 2RC4A 3EC4A 3RYOA 2Y0MA 4I49A 3R9FA 2ARHA 2GIVA 4CRZB 4M85A 4JXRA 4KLWA 4NCZA 2A4NA 3DSBA 1K4JA 4YTPC 3GYAA 4IUSA 3ABVC 3AE7C 4II9A 4XPLA 4UWJA 4YGOA 2K5TA 2PC1A 2F5IA 4JJXA 4B5PA 1MJAA 5F49A 3OWCA 1R57A 4J3GA 2HUZA 4BMHA 4GS4A 2ZW5A 2WPWA 3I9SA 4Y49B 3TFYA 1S3ZA 2Z11A 1XF8A 4NSQA 3SXOA 4PSXA 4YFJA 2GE3A 1L0CA 4JWPA 1S7KA 1RXTA 3MGDA 4XPDB 4LX9A 2QMLA 4B5OA 5GCNA 3VWDA 4AG9A 1N71A 3DNSA 4U9YA 4YRHA 4AVCA 2H89C 2VZZA 2FL4A 2OH1A 2KCWA 3QAHA 5FVJA 2ATRA 3S6GA 3TO6A 1YR0A 1U6MA 1IICA 3NE7A 1MJBA 2HV2A 1BOBA 4MY0A 3SFDC 2EUIA 3VWEA 3AEFC 4OAEA 1Z9UA 1IYLA 2EVNA 2I79A 2X7BA 1S7NA 2ZW7A 1PU9A 3I3GA 4QVTA 3CXQA 2Q4VA 4UWIA 3TO9A 3AE8C 1XEBA 4JD6A 1B6BA 1YK3A 3K9UA 4XNHC 5F47A 3S6HA 3AE6C 5H84A 1Y7RA 1YREA 2G3TA 2JLMA 1S7LA 4MHDA 5DWNA 2OZUA 4U5YA 2VZYA 4E0AA 1B87A 4AVAA 2QIRA 3AECC 3PZJA 1XIXA 1S5KA 4CAVA 4F6AA 2P6FA 4JLYA 1VKCA 3UY5A 2JDDA 2JDCA 4H6ZA 2B4BA 4AG7A 1S7FA 5C82A 4F0YA 5IX3A 1Q2YA 3BLNA 3H4QA 5F48A 4JXQA 2JEVA 3N7ZA 2QECA 1XE4A 2D4OA 2H5MA 3SFEC 4IF5A 3D2PA 3AE2C 2BEIA 2AJ6A 2OU2A 5EBVA 3TOBA 3D3SA 4L8AA 3GKRA 1ZP0C 2P0WA 3AEBC 2BSWA 4UBRA 2FT0A 3AE1C 4KVXA 1KTMA 1YLEA 1Q2DA 2FE7A 4R57A 4OADA 4R87A 3BJ8A 3P2HA 3D8PA 4KVME 4R9MA 2ZW4A 1PUAA 3WR7A 1XMTA 3E0KA 1OW7A 3G8WA 1QSRA 3AE3C 2VI7A 4ZBGA 4QBJA 4PV6A 4RI1A 2CNSA 1WWZA 1YX0A 2VXKA 4Y49C 4CRYB 4YXDC 1KUVA 4MBUA 2G0BA 4KZTA 2VQYA 1UFHA 1KUYA 5I0CA 3FYNA 2B4DA 3ZZIA 4H6UA 2WPXA 2IL4A 3TT2A 1RO5A 3B71A 3PP9A 4DNCA 1V0CA 1K05A 4QC6A 2HQYA 1MJ9A 3AEGC 3F8KA 2B58A 3AE9C 3AEDC 3AEAC 3EY5A 4E2AA 3PGPA 4PK2A 4CAXA 1QSOA 5EC4A 1KZFA 5KTCA 2FXFA 4HNXB 1SQHA 3AEEC 1Z4RA 2PR1A 2H88C 2Q7BA 2WQYC 2REEA 3F0AA 5IV0A 2FIAA 1KUXA 1I12A 4H89A 2FS5A 4ORFA 4R3LA 3G3SA 4OLLA 4MY3A 2PRBA 2R98A 2VEZA 3KKWA 3BJ7A 2CNTA 3TE4A 3FIXA 2OB0A 4AB7A 2B5GA 1CM0A 3FXTA 2FIWA 4MI4A 1WK4A 4KLVA 4KVOE 1Z4EA 3FB3A 2R7HA 5KTAA
chains in the Genus database with same CATH superfamily
4PK3A 1G1JA 4DUKA 2W6BA 4MFKA 3MD0A 2IFMA 2OYHC 3MRUA 4UA3A 3GF7A 2AFSA 3EXNA 1M4LA 1SFCB 2XKMA 2B89A 3CPWO 1FZBA 3GY9A 2CNMA 4KSAA 2V7QJ 1URQB 3KQXA 2GANA 1SFCA 1LWUA 1HJBA 1QSMA 3ITKA 3DLJA 1LRZA 2BCCD 1URQD 2ZYDA 1SQPE 2PGDA 2QJYC 3M06A 4EVYA 3B3WA 4X5KA 3HTKB 2EWBA 3FXDA 1M57D 2O01H 1YTZT 3P32A 2W6JH 2I1JA 3CXHE 3V4QA 1YJ9P 5AVZB 5CNPA 3H25A 1U7JA 1PZQA 1SQVJ 3AE5C 5TJHA 3TK1A 4W80A 4OKOA 2OYHB 2DXQA 2ZW6A 4C7NB 1CP6A 1EC5A 1Q86Q 3I5CA 2BO9A 3SXNA 3CT9A 2ITAA 4ZKUA 2R3CA 5KLVK 3IU2A 3PFEA 1BCCG 3H5ZA 4P4FA 1KILD 1ARLA 3P8MC 1NSLA 4YWYA 3CXHD 2AXCA 3JSVC 1K73Q 1OW8A 3DR6A 3DR8A 4MMOA 2I00A 3L74E 3RK2B 1JO5A 1L0LJ 3B8GA 4PSWA 2EO8A 3DDDA 4N78E 4AYCA 3MP7B 3H1HJ 4AVBA 3I55P 3CX5H 2B88A 1Q7YQ 1TKJA 4LUAA 1BO4A 3RZAA 1DEBA 1IFMA 1PGJA 3O6QB 2ZXVA 2P67A 3TTHA 4I1LA 3RL0g 3R1KA 4GIFA 4ZMDA 4NF1A 2YNYA 3BASA 5JQ4A 4MJ8A 1A02F 1RHZB 3CDXA 4D6TJ 2G3AA 1LWUB 2IMOA 3CCVP 3WABA 2M3BA 3B35A 4IHMA 1PP9G 1N2DC 3EFAA 3R95A 2QJKC 1ZN5A 1PPJD 1GZLA 5AVVB 4JYBA 3CCQP 3LODA 2WSFH 1S9KD 2PJ7A 4ONUA 1LTJC 3TYYA 1UWYA 5KLIC 2E43A 3S6KA 1PYTB 1NE9A 1JCDA 3H1ID 3TO7A 2BCOA 1L0LG 1KYOD 1AV1A 2ZVOB 4JBZA 3VMZA 2JEWA 4P6YA 4QUSA 5J1QA 2AFWA 5CBNA 1HEEA 4KORA 2B4DB 2KSEA 4KOTA 2E42A 3FBUA 5ISVA 1Z8LA 2OYIC 1QSNA 1VQ9P 5H2FH 3T97B 2V7QH 3H8GA 4RO0A 3WC5A 4R6TA 1ZXGA 1OW6A 2FCKA 3EC4A 2K9YA 1HH0A 3H32B 1VQ8P 2QJPB 5C39A 3D7HA 2PJ9A 4H44D 1FU1A 4O23A 2GIVA 4JXRA 3BI0A 4KLWA 5H2FE 3SWKA 5A27A 2A4NA 3DSBA 1X10A 5AVYB 3IEHA 3ABVC 4C7HA 4II9A 1IFJA 4ZNCA 2P1JA 1X79B 1NTZE 3OWCA 4NGQA 4J3GA 2C0XA 1YYCA 4GS4A 2DF5A 3BCCG 1VHOA 1NTZK 1USDA 4D6TE 3F89A 1PIXA 4R4LA 4OC4A 1LAPA 2XDJA 3FMCA 3CMAP 1CPXA 1PL5A 3VWDA 1N71A 3KZIH 2N1TA 1SS1A 3TC8A 4NFRA 4RN7A 3TDKA 5AW0B 1EXJA 1HF9A 2KCWA 3QAHA 5FVJA 4GOEA 3TO6A 1GK4A 1YR0A 1JY3N 2IDBA 1IICA 3G6EP 2PIYA 1RE4A 1AQ5A 1SQVG 5KLVE 3L70J 1BOBA 4OH8B 2PJAA 4P4DA 3RL0D 3WMM0 3VWEA 3K9TA 4DZOA 3HUSC 3NH8A 4OAEA 1BLLE 2ZT9B 3JCUH 3PB8X 2O1JA 3CD6P 1S7NA 4QVTA 4CGPA 2E75C 2D2CB 1R3NA 1TKFA 3BRVB 1XEBA 2PJ2A 5LRKA 2KLUA 3CCRP 1AQTA 1SQQE 4HJGH 2QJKB 1IOIA 1Y0RA 4XNHC 1KILA 1VF5B 5KLVD 4UB8H 3AE6C 2JLMA 2OYOA 5F09A 2AEMA 2KSJA 5DWNA 4WB4A 2OZUA 3EFFK 4E0AA 2K37A 2V8DA 1L2PA 3S9NA 1KMIZ 4IK2A 4AVAA 4ZY0A 3AECC 1LFWA 1TU3F 4F6AA 4PV1B 5A28A 4WY4D 2GLFA 1CBXA 2O53A 1VL2A 2JDDA 4PD4I 2KNCA 5B66H 2JDCA 3TGUJ 3CWBJ 2POHA 1GL2A 1VF5C 3GHGC 3V4WA 5C82A 1H0TA 3H1HD 3CXHH 1SQBD 5BU8B 1Q2YA 1GL2D 3SWFA 2E75B 2D4OA 1W2BO 3PB9X 3V7ZA 3SFEC 5LRGA 1IZNB 2AXTE 4RESB 2HODA 2OU2A 4JPZB 5DJTB 3KHZA 1CSBA 3TOBA 3L73D 1ZLIA 2O1KA 3D3SA 1RH5B 2HODB 2FXMA 2WSCJ 3HD7D 4IFDK 1PP9E 2BSWA 2GUSA 2IQ6A 1OVRA 3H1KG 1X9VA 4WBAA 1ARMA 4R57A 4OADA 3L4FA 1FE6A 2QE7H 2HC9A 4W7ZA 1GTWA 3IWEA 1KFNA 1QGKB 2WSFJ 2YXRB 3V38A 1LANA 4KVME 4I7ZC 3G4SP 2YGWA 1N7SD 2ZYGA 4MHNA 3OA7A 3FXEA 4MHYA 3VMXA 4C7IA 1ZG7A 3FECA 3RO0A 3AE3C 3TSIA 3M91A 1RF1C 2L5GB 4CGNA 1WWZA 1YLOA 4Y49C 1ZR2A 2QM7A 1YW6A 1YMEA 3BRTB 4CRYB 4YXDC 2QVAA 1NU1D 2PJ3A 1KILC 4KS9A 1UFHA 1G2CB 3EFGA 1RE3A 4MHPA 5CPAA 2A45I 2HYNA 3MUDC 3VP9A 2SPZA 2WPXA 3SWYA 4NJQA 4TLFA 1W5CE 2N1TD 4X2TA 4U3FE 1Z2LA 3PP9A 4YXWH 5G21A 1V0CA 1P84H 1AVYA 4QC6A 1LTAC 2ZOGA 3F8KA 3C1LA 5AW5B 1NTZJ 3AEAC 3TGUG 3PGPA 3BXMA 1NTKD 1LCPA 2ZEFA 1PP9D 1EE3P 2O4HA 2FXFA 3CCJP 4PXBA 1NTZD 1E79H 2C6PA 3FF3A 2CIJA 1NTKJ 4TT3H 1NO4A 4X8IA 2B87B 3F0AA 3FH4A 1S72P 4HYTB 1KC8Q 2Q4ZA 3RBXA 4R3LA 1OX3A 2E76B 2WYRA 4KT0J 4C7RA 3E1RA 4MY3A 1GMJA 3IF4A 3LW5J 3P8CD 3M9HA 1JNMA 1WRGA 3BJ7A 2CNTA 3TE4A 1SQQJ 3B7IA 1VQPP 1SP4A 4P10A 4WVZA 1Q2NA 1CM0A 3CCLP 4Y99C 2LXBA 1WK4A 1JCCA 1KYOE 3FB3A 1L4AB 2PJ6A 1BPNA 4YU9A 1N73C 3FWNA 4LGDE 4XNHB 5KLVJ 3CCUP 5GTIE 1USEA 2QRXA 1CP7A 5KJ7D 3R4YA 2OYIA 1OWAA 2IPPA 3H1IG 4L74A 3WT4A 3R9EA 4FD4A 3Q5SA 3IIBA 3CZXA 3CX5I 3SHPA 4CAWA 2PSWA 1CPSA 4GDOA 1X22A 1X8YA 3G71P 3R9GA 3L73G 2JDIH 4M3SA 3F5BA 4W9YA 3B4SA 2KS1B 4R3KA 4KSIA 2NPSA 4KOWA 1P0HA 4K30A 3H32A 3H1IJ 2NMTA 1YQ3C 1FJPA 1R5SA 2RFHA 1BGYD 1HGVA 2Q6QA 2ZT9D 3H1JG 1SQBG 3CPXA 3L74G 2P6EA 3L36A 1YQEA 2KUBA 4IFFA 2WSEJ 3NTNA 3B5NC 4UIBA 4B6ZA 5HVFA 4KOYA 3JTKA 4B86A 2FFDA 2BOAA 4NGPA 1MUUA 2OZGA 2Z0ZA 1N86A 2YIUC 4UFWA 3B3VA 3RBUA 4U3FG 1MK4A 1NU1K 2XU6A 3PTZA 3PRTA 2CPBA 4DJGA 1TXRA 3BI1A 1Q2CA 4NGNA 1FY7A 4ASVA 4RS2A 1YHQP 2J58A 5JPHA 3CXPA 3L35A 1YVKA 1SVFA 2WSSH 2PJBA 4M6GA 1M4GA 1G2CA 1M4IA 3D70A 2FSRA 3U1CA 5GTHH 5B66E 3PJSK 3A9LA 2R5DA 1VQ7P 5AW3B 1EDKA 2Q51A 3CWBD 2W83C 2BEZF 1SQPJ 1T2KC 2ODFA 2BL1A 3FRMA 1L0ND 3PLNA 4Y99B 1YBKA 3CX5E 4JQ0D 2OZHA 2WTYA 1RTQA 2ZEHA 2Q4YA 2OYIB 1YSJA 4NPDA 4UFXA 3ZJ0A 3A2AA 4G1PA 4RUHA 4EIJA 4KOSA 1NTZG 1HDQA 1VQ5P 3L75G 1M1JB 1LT1A 1ZW0A 2E74D 3L72J 3LWUA 1SQXG 2FYNB 5C88A 1EDIA 3EO4A 1KB9E 1T3JA 2Q5UA 4PD4H 2D4PA 1LAMA 2C27A 4OIDA 1OVUA 2FBWC 3FNCA 2Q43A 4MCSA 5E96A 4NEXA 2OTKE 4JYWA 1KQLA 2BASA 1KORA 5GTHE 1ZOYC 4PPZA 1LP1A 3RL0B 1A02J 1ZG8A 4KOVA 2PJ5A 1I1DA 1JTHB 5KTDA 4U9ZA 1GL2B 2VL1A 2Y9YA 1M1DA 2ZEPA 3Q5RA 1H88A 1H0TB 2YNDA 3EQ2A 4HKFA 5DWMA 1IFPA 4WJBA 3RYOA 1FS0E 3E7KA 2Y0DA 1L0NG 1KILE 2Y0MA 3R9FA 1IK9A 1N7LA 1VQMP 2ZEMA 4NCZA 3RK2C 3RNZA 3D7FA 1LT9C 2K5TA 2NZ2A 2WSEH 5JM6A 1MJAA 5F49A 1LTTC 4OMEA 4N3YB 5HXDA 5G1ZA 2NSMA 2HUZA 4BMHA 1UIXA 1MKMA 2KB7P 3KQZA 3VOPA 2WPWA 3KPEA 3I9SA 4Y49B 3JRUA 2YNCC 3RL0C 4A94A 2Z11A 4CGMA 1XF8A 1CW5A 3E1IA 3A0HE 1NKZB 2ZVNB 5AG5A 1L0CA 4JWPA 1S7KA 1CG2A 4A33A 5AVXB 4MFQA 4LX9A 4XPDB 3SJEA 4B5OA 3I1UA 2OARA 2JWDA 2N1TC 4YRHA 1M1JA 2H89C 2WSCH 2PFXA 3L71D 2CTCA 1SQVD 3OW2O 2ZEOA 3S6GA 5LYLA 4P44A 3IWWA 4UFVA 4Q36A 1RF0C 1MJBA 3GF3A 1DX7A 1VQKP 1QL1A 3LACA 7CPAA 2K3RA 4MY0A 1NU1E 5HVHA 3HE4B 4B12A 3TNUB 1IY7A 1F2OA 1FJKA 2YNEA 2YMYA 5AGEA 4Z65A 3H6PA 2EVNA 2I79A 1PU9A 1GDTA 1EZVI 4ZY2A 4UWIA 1BAVA 1LTGC 5E79E 2R3SA 2R44A 4CPGA 4JD6A 2ZELA 2WITA 1YJNP 3GHGA 3BCCJ 5F47A 1SQPK 1S7LA 4MHDA 3SJGA 2ZAEB 1L0LD 1LWUC 2VZYA 2C1CA 4BRYB 1SFCD 3DGVA 5APXA 3L37A 1B87A 3WU2H 4A7PA 3VTPC 4CAVA 3H1HE 1SQXD 3K5BA 3UY5A 1PPJG 1JMBA 2PRRA 3EWKA 2XEFA 1J1DB 1SQBJ 4H2KA 3D4UA 4UCPA 4W7YA 2P7JA 3FEEA 5IX3A 2K1AA 3H4QA 3H1JD 2QEXP 2FYZA 5APUA 2AFUA 3RGUA 2QECA 1XE4A 1T6AA 2V8GA 3BVHA 2JBKA 2ZFCA 1HJ0A 3D2PA 4GOFA 3VARA 2ZT9C 2FVGA 3PFOA 4R8FA 2Z5HA 2KLVA 3K2KA 2XV5A 2K9JA 1M1JC 1ZP0C 1K8AQ 3L75E 4UB6E 4UBRA 1N73A 5LYDA 2FT0A 4KVXA 1Q2DA 2FE7A 4A39A 4CYPA 4KJMA 3Q3DA 2RKLA 3B3CA 1GYTA 1AVOA 1QX8A 1NHLA 3A3YB 5CCGD 3ISXA 2POKA 2Q1KA 1FZAA 5AVTB 1PUAA 2YNCA 1N7SB 4PV1D 1OW7A 3M9BA 1S3JA 1CI6B 4FBEA 2AXTH 2YO3A 4PD4D 2XZRA 2QJYB 1SLQA 5AVWB 3T97A 1YX0A 2LR2A 1T8ZA 5AW1B 1BE3J 1FC2C 1OMIA 4PXCA 1HBWA 2G0BA 4IFMA 1XRYA 1OVVA 2YO2A 2GU2A 3ISZA 1KUYA 1GU4A 1JY3O 3FVLA 5I0CA 1JY2N 3II6A 1H89A 2IZ1A 2B4DA 1BCCE 4XFJA 4AQRD 1PGPA 4UB6H 5CCHD 3G9RA 4YPCA 1IC2A 4P4BA 4H6UA 5APWA 1OIPA 2D2CC 3O6QA 3S1KA 2B87A 2Y9ZA 4IAVA 1RO5A 5JGFA 4DNCA 1IO4A 1KWMA 3CC4P 1Y0YA 2AFXA 1K05A 4PXEA 2HQYA 3AEGC 3M0AA 2WPVB 5AW4B 1T2KD 1Z5RA 1P84D 1NAYA 2IBZG 3AEDC 3N4XA 5D29A 4E2AA 1J1DC 4M3LA 4CAXA 2CXAA 1GD2E 1AJYA 3L75D 2Y0CA 4OWFA 5KTCA 2RH0A 1SQHA 1VIXA 2JBJA 3AEEC 3L73E 2PR1A 5CCGA 3D71A 4A38A 4GKGA 4CYNA 4IOIH 5BWAB 5IV0A 2PAJA 1SQBK 1ZLLA 2FIAA 3BHXA 1URQC 2YKOA 2AEJA 1HVVA 2PIZA 1ELMP 1NSAA 4C2XA 2ZYAA 1KN7A 1OXZA 2PJ8A 2PCUA 1IK7A 1ZV8A 4BBHA 1IU8A 2E74B 5EMIA 3KKWA 1RF0A 3FIXA 4EI2A 4Z1MH 2ZJSE 4RKUJ 4PQAA 3V6IA 2FIWA 1FZEA 1T3UA 4MI4A 2YIUB 2HPCA 1EZVE 4PD4E 1BCCD 1Z4EA 2OTLP 3FGAD 4LLHA 1U7MA 2J8RA 5APVA 1M7LA 4MN4C 1OFCX 4A2ZA 1Y9WA 5HH1A 3GLJA 3H1KJ 5G22A 1YTZI 3BCCD 2WT7B 3V8IA 4B11A 4B5PB 2F8HA 3S6FA 3B5NB 3TGUD 4AXVA 2KOGA 2O28A 3CX5D 5J8CA 2ABZA 1VQ6P 1LOKA 4OP4A 2KI7B 5E79H 4KUBA 3CWBE 1ZRTD 1YQ4C 3HUSB 3W67A 2NYQA 1FNOA 1G1IA 1JQGA 2WPRA 2C6GA 1SQXJ 4N78D 4F9UA 3TOAA 2FXPA 1KB9H 3GW6A 1SQQK 2W8ZA 4U3FJ 2QIWA 3M0DA 5APQA 4EDFA 4LQGA 1PFIA 2O01J 3LD2A 2M5AA 4IL6E 3VN0A 2DW3A 4K3NA 3PB4X 4PJ0H 2Z3NA 1SQXK 1JOCA 2Q9IA 3MTUE 4OC0A 1KZUB 5BVZA 2PJ4A 2GA1A 2LXCB 4H44B 3PRJA 2GFQA 2IZ0A 3CCEP 2O01N 4WWVA 3D6YA 1R5LA 4UEEA 4K3AA 5J8FA 1Z8TA 2AE6A 2Z10A 1CI6A 2REFA 3FEDA 2V8HA 3L72E 1BSNA 3B3TA 2J8MA 2PVWA 1H8LA 3N5FA 3T9YA 5M1BA 4NJRA 2BUEA 4F9VA 1E5WA 2E74C 3W6XA 3D66A 1YGHA 4FD5A 1NMTA 2Y0EA 4MCQA 3PBEA 1CJWA 4AUWA 4NGMA 2PJCA 1AUGA 3GG2A 5AVRB 2PJ0A 3W6SA 2FYUJ 1Q7LA 3D7GA 2A06G 3H8FA 2FYNC 1D7MA 2IFNA 4KOUA 2FFDB 3Q2YA 4KOXA 2VBQA 3L74J 1OBRA 4FD6A 5F46A 4N6JA 2FYUD 2V4HA 2Q7CA 2ZEEA 3KR5A 2Q3EA 1OZPA 1HUCA 3MIWA 2AFZA 2OQQA 1ELLP 5IB0A 5CJ0A 2BEQD 4MCPA 4HH2A 5APSA 3TCVA 2O3JA 1FBMA 1YVOA 2AFMA 3QNVA 2P6GA 1FAVA 1ZG9A 4XPDC 3TF5A 3A0HH 4O9BA 3A5TA 2Q0YA 4Q38A 1EZVD 1QL2A 2Q3IA 2G9DA 2PDOA 2CY2A 2I3CA 4WWIA 1NTKG 4EYYQ 4OIWA 3L71E 3QB8A 1GHEA 4WY4A 3GLMA 1XTGB 3VMAA 1QSTA 2PQ8A 3L74D 2IBZI 3D7DA 5AVQB 3IC1A 2YXQB 2B3VA 2Q04A 3N7NA 1L0LK 2RC4A 3A0BH 1CZQA 5CCGC 4MFJA 2A06D 2W6AA 4I49A 4MFPA 4H13D 2ARHA 3PEIA 1LGHB 4M85A 5AG6A 5AW7B 3KGQA 1K4JA 1SQPG 4YTPC 3D67A 3GYAA 4MXUA 3AE7C 1R8EA 1Y8AA 2Z3MA 4YGOA 2PC1A 1KQGB 3KASA 4JJXA 1JTHA 4B5PA 3VYIA 5D8NA 3B5NA 1R57A 5L8RJ 1RE4C 3VMYA 3JC22 2ZW5A 2JWAA 1S3ZA 3MZWB 4HKZH 4NSQA 3SJFA 3SXOA 1BE3G 4DCKA 3TNUA 4UEZA 3HUSA 2E76C 1YIJP 1RXTA 4GT1A 2QMLA 3L70D 5GCNA 5AVSB 1SQXE 3WUTA 4AVCA 1QQ9A 2OH1A 2M3EA 4BRYA 3CL3D 2E5TA 1YI2P 2ATRA 4WY4C 1ZRTE 1LTIC 4L73A 2P2UA 4P4EA 2XEJA 3NE7A 3SJXA 3NMDA 3GIUA 2HPCB 3IR9A 3SFDC 2WZNA 3JCUE 2I1KA 5APTA 1Z9UA 1IYLA 4M6HA 1DD4A 2ZW7A 1NGMB 3I3GA 1Q81Q 2Z3LA 3AE8C 1LTSC 1JUNA 2GUVA 5K8NA 2KIKA 1B6BA 4BINA 1XOVA 4UIAA 4OC1A 2QYVA 1YK3A 3K9UA 3KXDA 4OC2A 1N8RQ 4HB1A 3S6HA 5H84A 1DD3A 3UIAA 5KJ7A 1YREA 2G3TA 1X0TA 3G3ZA 5KAFH 1FOSF 3HTKA 5CJ4A 1FZFA 3L2NA 2N9YB 2FFDC 1BGYJ 3CCSP 1Z8XA 1XMBA 2QIRA 1FZGA 3S9MA 1L4AA 3PZJA 1XIXA 1S5KA 5LYIA 4FAIA 2EK8A 2P6FA 4JLYA 5EFWB 5HVGA 3D6ZA 2H43A 2B4BA 1S7FA 2WUUA 2Z3PA 2PJ1A 2QVPA 4F0YA 2JP3A 3PHLA 3M9QA 1QLED 4H0LD 2HLOA 3BLNA 2J59M 4JXQA 2JEVA 1OZHA 3N7ZA 2C9NY 3T8WA 1Q82Q 2N1TB 4IF5A 4ZKPA 2CK3H 3V2PA 2BEIA 4C2YA 4NPEA 2P10A 1BGYE 3WC7A 1X12A 5K5GB 1ZLHA 1NOHA 3KI9A 2FYUK 1SQQD 4IL6X 3AEBC 1ZO0A 5KAFE 5DS0A 1KTMA 2FXOA 1NTME 1LT9A 1TKHA 1RE3C 1L0LE 2BCCJ 2JO1A 1EXIA 4WY4B 1LT9B 2PP6A 2QA4P 5CCHC 3Q5PA 4R87A 3NE8A 4ZX9A 3CMEP 3P2HA 3FWLA 4A31A 4CGLA 4M6IA 3E0KA 2C0WA 1KB9D 2VRSA 2ANPA 4ONWA 2XEIA 4JZ0A 3IU1A 3G8WA 3CPAA 1BPMA 5AW8B 1QSRA 1L4AC 2E5YA 2QJPC 1KD1Q 2VI7A 4ZBGA 3V2QA 4PV6A 4RI1A 2CNSA 3U1AA 1VF5D 1WMKA 1S5LH 4NPFX 3HD7A 3H1LD 1KUVA 2F7VA 1GL2C 4MBUA 4K35A 4F0XA 2ZEGA 3HD7B 3H1HG 4MHZA 1PPJE 3VH9A 2XEGA 4DJLA 1HGZA 4IL6H 4BXLA 2IL4A 4GODA 5B5EH 3PB6X 2Z5IA 4OC5A 1N7SA 2KYVA 5KLIB 1FDIA 3RK3B 1ZR4A 3VATA 4ZI6A 3PB7X 3KZWA 1Q90D 1UIIA 2V8VA 1MJ9A 1BCCJ 2B58A 2WPSA 3AE9C 2AEFA 3EY5A 3GHGB 1BE3E 3HE5B 1HWTC 4I2LC 5EC4A 1KZFA 1XBUA 1VHEA 1Z4RA 2H88C 5KJ7C 4A30A 2WQYC 1VQOP 2NPSC 3H1JJ 1NYHA 1KB9I 3V5BA 1KUXA 4QMAA 3L72D 1JEKA 1KQFB 1I12A 4OGQC 2FS5A 4ORFA 3G3SA 2RN0A 4BD9A 2KZJA 2N9BA 4OLLA 3TX8A 4UB8E 1FT7A 2VEZA 1L0NK 4OVNF 2QG4A 5CCHA 3IJ3A 2MJZA 1FDOA 5DJUB 1KILB 1PP9J 4P4IA 2B5GA 1MFTA 3B5ND 1KV4A 3Q1MA 4MFLA 3H1LE 3FXTA 1DTDA 2IYPA 4JYCA 1KYOI 4KLVA 3L70G 4CYQA 4KVOE 2R7HA 3D2MA 1EQ7A 5I4MA 3RK3C 5H86A 3IGRA 2AFOA 1PGQA 2OYHA 3P2FA 2ZOFA 1LJ2A 1IGBA 3OJAB 4H13C 1VHSA 2OTJP 3S9OA 4OGQB 2GLJA 2KXPB 1RQVA 2E76D 3W91A 1HTLC 2CPSA 1TF8A 1VPCA 3JVNA 1S5LX 5IB9A 2M8RA 3CI9A 2NPSB 3H1KE 1F2PA 2FYUE 1IFNA 4CS0B 3IWGA 1NTMK 3L72G 4QB9A 1ON0A 3H8EA 5TISE 1Y9BA 1TIQA 4FWUA 4B10A 4L89A 2PRQA 2WT7A 2V77A 1TF9A 4FUUA 1PV3A 3CXHI 3JUWA 1NU1G 2HFED 1NTMJ 3GUXA 1AYEA 1JMMA 1JY2O 3WUVA 2HR3A 1N73B 1KQSO 3NH4A 5HMNA 2IBZD 4R76A 2WZ7A 2G8YA 1S60A 3CXSA 2J5UA 2JJLA 3AE4C 1NTKK 2ZPAA 1YITP 2J8NA 2Q44A 3H1JE 2WMMA 3CLQA 4GXHA 4KHXA 2R1IA 1NTKE 3RK3E 4ASWA 2Z4EA 2B5GB 3MN8A 2PR8A 3NH5A 5AW9B 4ZGYB 3R96A 1J4JA 5AG7A 4NGTA 1F57A 1Y47A 4A37A 1I21A 2W27A 2R32A 1QVGO 1Y9KA 2KZIA 3HUVA 4X3RA 2B3UA 1FZCA 4U3FD 4L75A 4I6MC 5AVUB 5KKZB 3KL9A 1IYKA 1IJDB 3SSUA 3QAYA 1S2EA 2A45H 3IN6A 1MFZA 1JM0A 2OGUA 1NH4A 2I8DA 2XNXA 4C7NA 1W2EA 3C26A 1J1EB 4HNYB 4FD7A 5LRJA 3BCCE 4NXYA 3O8ZA 4MCRA 1M4DA 1A2ZA 1Y7EA 4UF4A 2M0BA 5GTIH 4EMEA 1M44A 3U59A 1XFOA 2H8PD 3NXSA 5CMZA 5ELYA 3RAMA 1IB1E 2IJZA 5AW6B 3TGUE 1NAFA 1YJWP 3IFMA 1M1KQ 4Q7AA 1IFIA 4ZX8A 4HNWB 2R8VA 1S4XA 3SI0A 5CBOA 3L70E 3KDPB 1SQVK 1L0NE 4DYOA 1IIDA 1GW3A 1M90Q 4CAEA 1AA0A 2MKVA 1PGOA 1IFDA 4KUAA 1DEEG 1SQVE 5KLVG 3MHVA 4XPKA 4E8OA 1GW4A 2EK9A 4PJ0E 2YKQA 3B8EB 1KFMA 1P4NA 5TISH 1L4AD 1J1EC 1DIPA 1JWQA 3T90A 3V2RA 3GB0A 1MZ9A 2C6CA 2FKWB 5KKZC 1HDUA 4CRZB 2W90A 4XA4A 3S4RA 2BCCG 1NU1J 1EDJA 4IUSA 2WPQA 2A45G 4A95A 4XPLA 1NWQA 4HPSA 4UWJA 2F5IA 1JY3P 1GK6A 1YW4A 4MFZA 5AW2B 1VDFA 1Z56A 3TFYA 1K9MQ 2YKPA 1SQBE 4U7JA 3HLPA 1NJIQ 4P45A 4PSXA 4YFJA 1P84E 2GE3A 2IBZE 3MGDA 3FX0A 3W68A 3H1IE 1QVFO 5K8OA 1R43A 4AG9A 3FJUA 1URQA 4CAFA 3DNSA 4U9YA 2KK7A 4H44C 2GM4A 3BATA 2VZZA 2B9BA 2FL4A 3S9LA 1M8OB 3USSA 3H1KD 3IAOA 2Q7SA 2HG5D 3RBZA 4NGRA 3L71J 3A7OA 1U6MA 3LIDA 1S1CX 5JH9A 2WSAA 2HV2A 3FX6A 3MUDA 1S5LE 2DEAA 3KHXA 3L71G 1BGYG 4DT0A 1S9KE 2HB6A 8CPAA 2EUIA 4P4JA 2IYOA 1U57A 3AEFC 3WU2E 3RK2D 1QEXA 2OR4A 3HE4A 3WUUA 2X7BA 2NRGA 5G20A 2NPSD 1FOSE 4Y28J 3CXQA 1NTMD 2Q4VA 3TO9A 4H0LC 2RMZA 4KSFA 3LW5H 3KHUA 4LC1A 3C8VA 2PE3A 3LMSA 2M5AB 1Y7RA 3HE5A 3V2NA 1EZVG 4ZY1A 1DE4C 4U5YA 4TNUA 4D6TG 2PVVA 4D6TD 2GREA 4UCNA 4CYOA 1VGYA 4C68A 1H8AA 4EWTA 1EDLA 2ZXXA 1VKCA 4JF7A 3CC7P 3IO1A 3M0DC 2JR8A 1WT6A 4L76A 1VQNP 4H6ZA 4AG7A 6CPAA 3RK3D 4BWNA 2ZENA 4EFDA 1LNQA 1MV8A 2J9AA 4LQ6A 1SQQG 1FDMA 5F48A 1RY3A 2DPTA 5AG4A 3C9IA 1FZCC 4EOTA 2H5MA 3KYQA 3B2YA 3NA6A 3AE2C 1JB0J 3KZIE 3QH9A 2RB7A 2AJ6A 5EBVA 2ZEDA 3H1LJ 2D2CD 4L8AA 4NGSA 1VQLP 4OC3A 3GKRA 2P0WA 3PH0A 3LIEA 1LTBC 3PBBA 3AE1C 2BCCE 1YLEA 1BE3D 2UWJE 1FZCB 3KR4A 1AMPA 2EBJA 1XTCC 4C2ZA 3I56P 2OOTA 1SFCC 5KTBA 3BJ8A 1RF1B 4DOJA 4R7MA 3D8PA 4R9MA 3SI2A 2KNCB 4H13B 2ZW4A 3B3SA 2Z3OA 3WR7A 1XMTA 5CBMA 2QM8A 2QSIA 2C9LY 3HRNA 4CGOA 1SQPD 1DH3A 3MGNA 3NFQA 4B13A 3CC2P 2KP8A 4QBJA 4TWEA 2WVRA 2DPSA 1XJOA 4I7ZB 1QMUA 1NVOA 4RJTA 2VXKA 1ZMEC 3QWOC 3CCMP 2CF4A 3L73J 5K8MA 1J2JB 3HD7C 4XE5B 2R5BA 1GU5A 4KZTA 1PCAA 2VQYA 4MRIA 2JEEA 3FYNA 2Z3KA 3H1LG 4F8ZA 3ZZIA 4H0LB 4UEFA 3IFEA 1LTJA 3TT2A 1KYOH 1N7SC 3B71A 2FY8A 4OGQD 1LTJB 3A0BE 3GMAA 3P8CE 5KAIE 4A32A 1Z8WA 1VQ4P 2YMKA 4PK2A 3WC6A 3VP8A 2CTBA 2P58A 3R2PA 1QSOA 2A06E 4HNXB 4PV1C 3P7KA 5THWA 1NTMG 2FYUG 4B14A 2K9JB 2WWWA 2Q7BA 1LP1B 3PP5A 2REEA 3SI1A 3NFZA 2ZXEB 3D68A 1BSHA 1BDCA 4GM5A 5APYA 3KQGA 4H89A 3F5HA 4PXDA 5B5EE 2IX7C 2XNDH 1RF1A 3ZDMA 1NKNA 2PRBA 5LYFA 2R98A 1RQUA 2H7HA 4ZYQA 1AFOA 2E75D 3OAKA 5CHXA 3L75J 2OB0A 1L0NJ 4AB7A 2JKVA 2L91A 5K8PA 5KAIH 1JY2P 1CX8A 2K88A 3CWBG 1M56D 2LKMA 2KS1A 4UCMA 2QJ8A 5BU5A 4CPAA 4R4MA 1IOFA 4C46A 1BDDA 1K04A 1P84I 5KTAA
chains in the Genus database with same CATH topology
4PK3A 2J8RA 5H86A 3IGRA 3P2FA 1Y9WA 4MFKA 5HH1A 4A2ZA 5G22A 4XNHB 4H13C 4UA3A 3V8IA 4B11A 4B5PB 3S6FA 3GF7A 1VHSA 3EXNA 3S9OA 2O28A 5J8CA 4OGQB 3R4YA 3GY9A 1RQVA 2E76D 2CNMA 4KSAA 3W91A 2V7QJ 2GANA 3JVNA 1S5LX 3Q5SA 4FD4A 4KUBA 3R9EA 3SHPA 4CAWA 1YQ4C 1QSMA 2PSWA 4GDOA 1LRZA 3R9GA 4M3SA 3F5BA 4CS0B 3IWGA 4R3KA 4KOWA 1P0HA 2QJYC 4EVYA 4K30A 3TOAA 4X5KA 2NMTA 1YQ3C 2FXPA 4QB9A 1ON0A 2QIWA 3D2MA 2O01J 1Y9BA 2ZT9D 1TIQA 3LD2A 4B10A 4L89A 2Z3NA 1PV3A 2P6EA 5CNPA 3H25A 3JUWA 2WSEJ 3AE5C 4H44B 2DXQA 2ZW6A 4KOYA 5HMNA 3JTKA 3D6YA 3SXNA 2OZGA 2Z0ZA 2G8YA 1S60A 2YIUC 3CXSA 2J5UA 3AE4C 4UFWA 5J8FA 2AE6A 2Z10A 3IU2A 2ZPAA 1MK4A 2REFA 2J8NA 2Q44A 3H5ZA 2R1IA 2J8MA 1NSLA 3T9YA 1Q2CA 5M1BA 1FY7A 4RS2A 3RK3E 2BUEA 2B5GB 2PR8A 1OW8A 5JPHA 2E74C 3DR6A 3W6XA 3CXPA 4ZGYB 3DR8A 1YGHA 1YVKA 4FD5A 1NMTA 1J4JA 5AG7A 3R96A 2I00A 1M4GA 3B8GA 4PSWA 1I21A 1M4IA 1Y9KA 3DDDA 2FSRA 3D70A 1CJWA 4AVBA 2B3UA 3A9LA 3W6SA 1IYKA 4LUAA 2BEZF 1BO4A 2BL1A 2ZXVA 3FRMA 3TTHA 3IN6A 2OZHA 3RL0g 2FYNC 3R1KA 4KOUA 5JQ4A 3C26A 4NF1A 4HNYB 3Q2YA 2Q4YA 4MJ8A 4KOXA 2VBQA 4FD7A 4UFXA 4NXYA 3ZJ0A 2G3AA 4FD6A 5F46A 1M4DA 4KOSA 1M44A 1OZPA 3EFAA 3R95A 2QJKC 2E74D 1IB1E 2OQQA 5IB0A 2BEQD 5C88A 3LODA 3EO4A 3TCVA 2D4PA 4ONUA 2C27A 1YVOA 2FBWC 3FNCA 4HNWB 2R8VA 5E96A 5KLIC 2P6GA 4NEXA 3S6KA 1NE9A 4XPDC 3TO7A 2Q0YA 1IIDA 1KORA 4Q38A 4CAEA 4QUSA 1ZOYC 2CY2A 2MKVA 2PDOA 4KUAA 4KORA 4XPKA 4KOVA 2B4DB 1I1DA 3QB8A 4E8OA 1GHEA 4KOTA 3GLMA 5KTDA 4U9ZA 3FBUA 1M1DA 1P4NA 3Q5RA 5ISVA 1QSNA 1QSTA 2PQ8A 2YNDA 3T97B 1DIPA 4HKFA 3T90A 2Q04A 2B3VA 5DWMA 1OW6A 2FCKA 2RC4A 3EC4A 2K9YA 3RYOA 4MFJA 1KILE 5KKZC 4H44D 2Y0MA 4I49A 4MFPA 3R9FA 4H13D 2ARHA 2GIVA 4CRZB 4M85A 4JXRA 5AG6A 4KLWA 5A27A 4NCZA 2A4NA 3DSBA 1K4JA 4YTPC 3GYAA 4IUSA 4A95A 3ABVC 3AE7C 1R8EA 2Z3MA 4UWJA 4XPLA 4YGOA 4C7HA 4II9A 2K5TA 2NZ2A 1KQGB 2PC1A 2F5IA 4JJXA 4B5PA 1MJAA 5F49A 1R57A 3OWCA 5G1ZA 4J3GA 4MFZA 5L8RJ 2HUZA 4BMHA 1UIXA 4GS4A 1MKMA 2ZW5A 2WPWA 3I9SA 4Y49B 3TFYA 2YNCC 1S3ZA 2Z11A 4U7JA 4CGMA 1PIXA 4R4LA 1XF8A 4NSQA 3SXOA 4PSXA 4YFJA 2GE3A 5AG5A 2E76C 1L0CA 4JWPA 1S7KA 1RXTA 4A33A 3MGDA 4MFQA 4LX9A 4XPDB 1PL5A 2QMLA 4B5OA 5GCNA 3VWDA 4AG9A 1N71A 4CAFA 3DNSA 4U9YA 4YRHA 4H44C 4AVCA 2H89C 2VZZA 2FL4A 2OH1A 1EXJA 1HF9A 2KCWA 3QAHA 5FVJA 3IAOA 2ATRA 3S6GA 1ZRTE 4UFVA 3TO6A 1YR0A 4Q36A 2IDBA 1U6MA 1IICA 1S1CX 3NE7A 2WSAA 1MJBA 2HV2A 3GF3A 1BOBA 4MY0A 3SFDC 4B12A 2EUIA 3VWEA 2YNEA 3AEFC 1U57A 4OAEA 2ZT9B 5AGEA 1Z9UA 1IYLA 2EVNA 2I79A 2X7BA 1DD4A 1S7NA 2ZW7A 1NGMB 5G20A 1PU9A 3I3GA 4QVTA 4CGPA 4Y28J 2E75C 3CXQA 2Q4VA 4UWIA 2Z3LA 2D2CB 3TO9A 3AE8C 1XEBA 4JD6A 1B6BA 4H0LC 4KSFA 1YK3A 3K9UA 4XNHC 1VF5B 3C8VA 5F47A 3S6HA 3AE6C 5H84A 1DD3A 1Y7RA 1YREA 2G3TA 2JLMA 1S7LA 2R7HA 4MHDA 5DWNA 2OZUA 4U5YA 2VZYA 4E0AA 1B87A 1KMIZ 4AVAA 2QIRA 4UCNA 4CYOA 3AECC 3PZJA 1XIXA 4C68A 1TU3F 1S5KA 4CAVA 4F6AA 2P6FA 4JLYA 4PV1B 1VKCA 5A28A 3UY5A 3D6ZA 1VL2A 2JDDA 2JDCA 3EWKA 4H6ZA 2B4BA 4AG7A 1S7FA 2WUUA 2Z3PA 1VF5C 5C82A 4UCPA 2JP3A 4F0YA 5IX3A 1Q2YA 4H0LD 3BLNA 3H4QA 5F48A 4JXQA 2JEVA 3N7ZA 2QECA 1XE4A 2E75B 2D4OA 2DPTA 5AG4A 2H5MA 3SFEC 4IF5A 1HJ0A 3D2PA 3AE2C 1JB0J 2BEIA 4C2YA 2P10A 2AJ6A 2ZT9C 2OU2A 5EBVA 3TOBA 3D3SA 2D2CD 4L8AA 3GKRA 1ZP0C 2WSCJ 4IL6X 2P0WA 3AEBC 1ZO0A 2BSWA 4UBRA 2FT0A 3AE1C 4KVXA 1KTMA 1YLEA 1Q2DA 2FE7A 4CYPA 3Q3DA 4R57A 4OADA 2JO1A 1EXIA 4C2ZA 3Q5PA 3IWEA 4R87A 2WSFJ 3BJ8A 3P2HA 4A31A 4CGLA 3D8PA 4KVME 4I7ZC 4R9MA 4H13B 2ZW4A 1PUAA 2Z3OA 2YGWA 3WR7A 1XMTA 2QSIA 3E0KA 2YNCA 4CGOA 4C7IA 4PV1D 1OW7A 3IU1A 3G8WA 4B13A 1QSRA 3AE3C 2QJPC 2VI7A 4ZBGA 4QBJA 2DPSA 4PV6A 4I7ZB 4RI1A 2CNSA 4CGNA 1VF5D 1WWZA 1YX0A 1WMKA 2VXKA 4Y49C 1ZMEC 4CRYB 4YXDC 1KUVA 1OMIA 4MBUA 4F0XA 2G0BA 4KZTA 2VQYA 4KS9A 1UFHA 1KUYA 5I0CA 3FYNA 2B4DA 4XFJA 2Z3KA 3G9RA 3ZZIA 4H0LB 4H6UA 2WPXA 2IL4A 3TT2A 2D2CC 3O6QA 1FDIA 1RO5A 3B71A 3PP9A 4DNCA 4OGQD 5G21A 1V0CA 1K05A 3GMAA 1Q90D 4QC6A 2HQYA 1MJ9A 3AEGC 3F8KA 2WPVB 2B58A 3AE9C 4A32A 3AEDC 3AEAC 3EY5A 4E2AA 3PGPA 2YMKA 4PK2A 4CAXA 2CXAA 1AJYA 1QSOA 5EC4A 1KZFA 5KTCA 2FXFA 4HNXB 1SQHA 4PV1C 3AEEC 1Z4RA 2PR1A 2H88C 4B14A 2Q7BA 4A30A 2WQYC 2REEA 4TT3H 3D71A 3F0AA 4CYNA 5BWAB 5IV0A 1NYHA 2FIAA 1KUXA 1KQFB 1I12A 4OGQC 4H89A 2FS5A 4ORFA 4C2XA 4R3LA 3G3SA 2E76B 4OLLA 4KT0J 1IK7A 4MY3A 2PRBA 2R98A 1GMJA 2VEZA 3LW5J 1RQUA 4BBHA 2E74B 3KKWA 3BJ7A 1FDOA 2CNTA 2E75D 3TE4A 3FIXA 2OB0A 4AB7A 2B5GA 4Z1MH 4MFLA 3Q1MA 4RKUJ 1CM0A 3FXTA 2FIWA 4UCMA 4MI4A 1WK4A 4KLVA 4CYQA 4KVOE 4R4MA 1Z4EA 3FB3A 3FGAD 1K04A 5KTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PK3 A;  2J8R A;  5H86 A;  3IGR A;  3P2F A;  1Y9W A;  5HH1 A;  4XNH B;  4UA3 A;  3V8I A;  4B5P B;  3S6F A;  1VHS A;  3EXN A;  3S9O A;  2O28 A;  5J8C A;  3GY9 A;  2CNM A;  3W91 A;  2GAN A;  3JVN A;  4FD4 A;  4KUB A;  3R9E A;  3SHP A;  4CAW A;  1YQ4 C;  1QSM A;  2PSW A;  1LRZ A;  3R9G A;  4M3S A;  3F5B A;  4CS0 B;  3IWG A;  4R3K A;  4KOW A;  1P0H A;  4EVY A;  4K30 A;  3TOA A;  4X5K A;  2NMT A;  1YQ3 C;  4QB9 A;  1ON0 A;  3D2M A;  1TIQ A;  3LD2 A;  4L89 A;  1PV3 A;  2P6E A;  5CNP A;  3JUW A;  3AE5 C;  2DXQ A;  2ZW6 A;  4KOY A;  5HMN A;  3SXN A;  2OZG A;  2Z0Z A;  1S60 A;  5J8F A;  3CXS A;  3AE4 C;  2AE6 A;  2Z10 A;  2ZPA A;  1MK4 A;  2REF A;  2J8N A;  2Q44 A;  2R1I A;  2J8M A;  1NSL A;  3T9Y A;  1Q2C A;  1FY7 A;  4RS2 A;  2BUE A;  2B5G B;  2PR8 A;  1OW8 A;  5JPH A;  3DR6 A;  3W6X A;  3CXP A;  3DR8 A;  1YGH A;  1YVK A;  4FD5 A;  1NMT A;  1J4J A;  3R96 A;  2I00 A;  1M4G A;  3B8G A;  4PSW A;  1I21 A;  1M4I A;  1Y9K A;  3DDD A;  2FSR A;  1CJW A;  4AVB A;  2B3U A;  3W6S A;  1IYK A;  4LUA A;  1BO4 A;  2BL1 A;  2ZXV A;  3FRM A;  3TTH A;  2OZH A;  3R1K A;  4KOU A;  5JQ4 A;  3C26 A;  4NF1 A;  4HNY B;  2Q4Y A;  4MJ8 A;  1K04 A;  4KOX A;  2VBQ A;  4FD7 A;  4NXY A;  3ZJ0 A;  2G3A A;  4FD6 A;  5F46 A;  1M4D A;  4KOS A;  1M44 A;  1OZP A;  3EFA A;  3R95 A;  1IB1 E;  5IB0 A;  5C88 A;  3LOD A;  3EO4 A;  3TCV A;  2D4P A;  4ONU A;  2C27 A;  1YVO A;  2FBW C;  3FNC A;  4HNW B;  2R8V A;  5E96 A;  2P6G A;  4NEX A;  3S6K A;  1NE9 A;  4XPD C;  3TO7 A;  2Q0Y A;  1IID A;  4QUS A;  1ZOY C;  2CY2 A;  2PDO A;  4KUA A;  4KOR A;  4XPK A;  4KOV A;  2B4D B;  1I1D A;  3QB8 A;  4E8O A;  1GHE A;  4KOT A;  5KTD A;  4U9Z A;  3FBU A;  1M1D A;  1P4N A;  5ISV A;  1QSN A;  1QST A;  2PQ8 A;  4HKF A;  3T90 A;  2Q04 A;  2B3V A;  5DWM A;  1OW6 A;  2FCK A;  2RC4 A;  3EC4 A;  3RYO A;  2Y0M A;  4I49 A;  3R9F A;  2ARH A;  2GIV A;  4CRZ B;  4M85 A;  4JXR A;  4KLW A;  4NCZ A;  2A4N A;  3DSB A;  1K4J A;  4YTP C;  3GYA A;  4IUS A;  3ABV C;  3AE7 C;  4II9 A;  4XPL A;  4UWJ A;  4YGO A;  2K5T A;  2PC1 A;  2F5I A;  4JJX A;  4B5P A;  1MJA A;  5F49 A;  3OWC A;  1R57 A;  4J3G A;  2HUZ A;  4BMH A;  4GS4 A;  2ZW5 A;  2WPW A;  3I9S A;  4Y49 B;  3TFY A;  1S3Z A;  2Z11 A;  1XF8 A;  4NSQ A;  3SXO A;  4PSX A;  4YFJ A;  2GE3 A;  1L0C A;  4JWP A;  1S7K A;  1RXT A;  3MGD A;  4XPD B;  4LX9 A;  2QML A;  4B5O A;  5GCN A;  3VWD A;  4AG9 A;  1N71 A;  3DNS A;  4U9Y A;  4YRH A;  4AVC A;  2H89 C;  2VZZ A;  2FL4 A;  2OH1 A;  2KCW A;  3QAH A;  5FVJ A;  2ATR A;  3S6G A;  3TO6 A;  1YR0 A;  1U6M A;  1IIC A;  3NE7 A;  1MJB A;  2HV2 A;  1BOB A;  4MY0 A;  3SFD C;  2EUI A;  3VWE A;  3AEF C;  4OAE A;  1Z9U A;  1IYL A;  2EVN A;  2I79 A;  2X7B A;  1S7N A;  2ZW7 A;  1PU9 A;  3I3G A;  4QVT A;  3CXQ A;  2Q4V A;  4UWI A;  3TO9 A;  3AE8 C;  1XEB A;  4JD6 A;  1B6B A;  1YK3 A;  3K9U A;  4XNH C;  5F47 A;  3S6H A;  3AE6 C;  5H84 A;  1Y7R A;  1YRE A;  2G3T A;  2JLM A;  1S7L A;  4MHD A;  5DWN A;  2OZU A;  4U5Y A;  2VZY A;  4E0A A;  1B87 A;  4AVA A;  2QIR A;  3AEC C;  3PZJ A;  1XIX A;  1S5K A;  4CAV A;  4F6A A;  2P6F A;  4JLY A;  1VKC A;  3UY5 A;  2JDD A;  2JDC A;  4H6Z A;  2B4B A;  4AG7 A;  1S7F A;  5C82 A;  4F0Y A;  5IX3 A;  1Q2Y A;  3BLN A;  3H4Q A;  5F48 A;  4JXQ A;  2JEV A;  3N7Z A;  2QEC A;  1XE4 A;  2D4O A;  2H5M A;  3SFE C;  4IF5 A;  3D2P A;  3AE2 C;  2BEI A;  2AJ6 A;  2OU2 A;  5EBV A;  3TOB A;  3D3S A;  4L8A A;  3GKR A;  1ZP0 C;  2P0W A;  3AEB C;  2BSW A;  4UBR A;  2FT0 A;  3AE1 C;  4KVX A;  1KTM A;  1YLE A;  1Q2D A;  2FE7 A;  4R57 A;  4OAD A;  4R87 A;  3BJ8 A;  3P2H A;  3D8P A;  4KVM E;  4R9M A;  2ZW4 A;  1PUA A;  3WR7 A;  1XMT A;  3E0K A;  1OW7 A;  3G8W A;  1QSR A;  3AE3 C;  2VI7 A;  4ZBG A;  4QBJ A;  4PV6 A;  4RI1 A;  2CNS A;  1WWZ A;  1YX0 A;  2VXK A;  4Y49 C;  4CRY B;  4YXD C;  1KUV A;  4MBU A;  2G0B A;  4KZT A;  2VQY A;  1UFH A;  1KUY A;  5I0C A;  3FYN A;  2B4D A;  3ZZI A;  4H6U A;  2WPX A;  2IL4 A;  3TT2 A;  1RO5 A;  3B71 A;  3PP9 A;  4DNC A;  1V0C A;  1K05 A;  4QC6 A;  2HQY A;  1MJ9 A;  3AEG C;  3F8K A;  2B58 A;  3AE9 C;  3AED C;  3AEA C;  3EY5 A;  4E2A A;  3PGP A;  4PK2 A;  4CAX A;  1QSO A;  5EC4 A;  1KZF A;  5KTC A;  2FXF A;  4HNX B;  1SQH A;  3AEE C;  1Z4R A;  2PR1 A;  2H88 C;  2Q7B A;  2WQY C;  2REE A;  3F0A A;  5IV0 A;  2FIA A;  1KUX A;  1I12 A;  4H89 A;  2FS5 A;  4ORF A;  4R3L A;  3G3S A;  4OLL A;  4MY3 A;  2PRB A;  2R98 A;  2VEZ A;  3KKW A;  3BJ7 A;  2CNT A;  3TE4 A;  3FIX A;  2OB0 A;  4AB7 A;  2B5G A;  1CM0 A;  3FXT A;  2FIW A;  4MI4 A;  1WK4 A;  4KLV A;  4KVO E;  1Z4E A;  3FB3 A;  2R7H A;  5KTA A; 
#chains in the Genus database with same CATH topology
 4PK3 A;  1G1J A;  4DUK A;  2W6B A;  4MFK A;  3MD0 A;  2IFM A;  2OYH C;  3MRU A;  4UA3 A;  3GF7 A;  2AFS A;  3EXN A;  1M4L A;  1SFC B;  2XKM A;  2B89 A;  3CPW O;  1FZB A;  3GY9 A;  2CNM A;  4KSA A;  2V7Q J;  1URQ B;  3KQX A;  2GAN A;  1SFC A;  1LWU A;  1HJB A;  1QSM A;  3ITK A;  3DLJ A;  1LRZ A;  2BCC D;  1URQ D;  2ZYD A;  1SQP E;  2PGD A;  2QJY C;  3M06 A;  4EVY A;  3B3W A;  4X5K A;  3HTK B;  2EWB A;  3FXD A;  1M57 D;  2O01 H;  1YTZ T;  3P32 A;  2W6J H;  2I1J A;  3CXH E;  3V4Q A;  1YJ9 P;  5AVZ B;  5CNP A;  3H25 A;  1U7J A;  1PZQ A;  1SQV J;  3AE5 C;  5TJH A;  3TK1 A;  4W80 A;  4OKO A;  2OYH B;  2DXQ A;  2ZW6 A;  4C7N B;  1CP6 A;  1EC5 A;  1Q86 Q;  3I5C A;  2BO9 A;  3SXN A;  3CT9 A;  2ITA A;  4ZKU A;  2R3C A;  5KLV K;  3IU2 A;  3PFE A;  1BCC G;  3H5Z A;  4P4F A;  1KIL D;  1ARL A;  3P8M C;  1NSL A;  4YWY A;  3CXH D;  2AXC A;  3JSV C;  1K73 Q;  1OW8 A;  3DR6 A;  3DR8 A;  4MMO A;  2I00 A;  3L74 E;  3RK2 B;  1JO5 A;  1L0L J;  3B8G A;  4PSW A;  2EO8 A;  3DDD A;  4N78 E;  4AYC A;  3MP7 B;  3H1H J;  4AVB A;  3I55 P;  3CX5 H;  2B88 A;  1Q7Y Q;  1TKJ A;  4LUA A;  1BO4 A;  3RZA A;  1DEB A;  1IFM A;  1PGJ A;  3O6Q B;  2ZXV A;  2P67 A;  3TTH A;  4I1L A;  3RL0 g;  3R1K A;  4GIF A;  4ZMD A;  4NF1 A;  2YNY A;  3BAS A;  5JQ4 A;  4MJ8 A;  1A02 F;  1RHZ B;  3CDX A;  4D6T J;  2G3A A;  1LWU B;  2IMO A;  3CCV P;  3WAB A;  2M3B A;  3B35 A;  4IHM A;  1PP9 G;  1N2D C;  3EFA A;  3R95 A;  2QJK C;  1ZN5 A;  1PPJ D;  1GZL A;  5AVV B;  4JYB A;  3CCQ P;  3LOD A;  2WSF H;  1S9K D;  2PJ7 A;  4ONU A;  1LTJ C;  3TYY A;  1UWY A;  5KLI C;  2E43 A;  3S6K A;  1PYT B;  1NE9 A;  1JCD A;  3H1I D;  3TO7 A;  2BCO A;  1L0L G;  1KYO D;  1AV1 A;  2ZVO B;  4JBZ A;  3VMZ A;  2JEW A;  4P6Y A;  4QUS A;  5J1Q A;  2AFW A;  5CBN A;  1HEE A;  4KOR A;  2B4D B;  2KSE A;  4KOT A;  2E42 A;  3FBU A;  5ISV A;  1Z8L A;  2OYI C;  1QSN A;  1VQ9 P;  5H2F H;  3T97 B;  2V7Q H;  3H8G A;  4RO0 A;  3WC5 A;  4R6T A;  1ZXG A;  1OW6 A;  2FCK A;  3EC4 A;  2K9Y A;  1HH0 A;  3H32 B;  1VQ8 P;  2QJP B;  5C39 A;  3D7H A;  2PJ9 A;  4H44 D;  1FU1 A;  4O23 A;  2GIV A;  4JXR A;  3BI0 A;  4KLW A;  5H2F E;  3SWK A;  5A27 A;  2A4N A;  3DSB A;  1X10 A;  5AVY B;  3IEH A;  3ABV C;  4C7H A;  4II9 A;  1IFJ A;  4ZNC A;  2P1J A;  1X79 B;  1NTZ E;  3OWC A;  4NGQ A;  4J3G A;  2C0X A;  1YYC A;  4GS4 A;  2DF5 A;  3BCC G;  1VHO A;  1NTZ K;  1USD A;  4D6T E;  3F89 A;  1PIX A;  4R4L A;  4OC4 A;  1LAP A;  2XDJ A;  3FMC A;  3CMA P;  1CPX A;  1PL5 A;  3VWD A;  1N71 A;  3KZI H;  2N1T A;  1SS1 A;  3TC8 A;  4NFR A;  4RN7 A;  3TDK A;  5AW0 B;  1EXJ A;  1HF9 A;  2KCW A;  3QAH A;  5FVJ A;  4GOE A;  3TO6 A;  1GK4 A;  1YR0 A;  1JY3 N;  2IDB A;  1IIC A;  3G6E P;  2PIY A;  1RE4 A;  1AQ5 A;  1SQV G;  5KLV E;  3L70 J;  1BOB A;  4OH8 B;  2PJA A;  4P4D A;  3RL0 D;  3WMM 0;  3VWE A;  3K9T A;  4DZO A;  3HUS C;  3NH8 A;  4OAE A;  1BLL E;  2ZT9 B;  3JCU H;  3PB8 X;  2O1J A;  3CD6 P;  1S7N A;  4QVT A;  4CGP A;  2E75 C;  2D2C B;  1R3N A;  1TKF A;  3BRV B;  1XEB A;  2PJ2 A;  5LRK A;  2KLU A;  3CCR P;  1AQT A;  1SQQ E;  4HJG H;  2QJK B;  1IOI A;  1Y0R A;  4XNH C;  1KIL A;  1VF5 B;  5KLV D;  4UB8 H;  3AE6 C;  2JLM A;  2OYO A;  5F09 A;  2AEM A;  2KSJ A;  5DWN A;  4WB4 A;  2OZU A;  3EFF K;  4E0A A;  2K37 A;  2V8D A;  1L2P A;  3S9N A;  1KMI Z;  4IK2 A;  4AVA A;  4ZY0 A;  3AEC C;  1LFW A;  1TU3 F;  4F6A A;  4PV1 B;  5A28 A;  4WY4 D;  2GLF A;  1CBX A;  2O53 A;  1VL2 A;  2JDD A;  4PD4 I;  2KNC A;  5B66 H;  2JDC A;  3TGU J;  3CWB J;  2POH A;  1GL2 A;  1VF5 C;  3GHG C;  3V4W A;  5C82 A;  1H0T A;  3H1H D;  3CXH H;  1SQB D;  5BU8 B;  1Q2Y A;  1GL2 D;  3SWF A;  2E75 B;  2D4O A;  1W2B O;  3PB9 X;  3V7Z A;  3SFE C;  5LRG A;  1IZN B;  2AXT E;  4RES B;  2HOD A;  2OU2 A;  4JPZ B;  5DJT B;  3KHZ A;  1CSB A;  3TOB A;  3L73 D;  1ZLI A;  2O1K A;  3D3S A;  1RH5 B;  2HOD B;  2FXM A;  2WSC J;  3HD7 D;  4IFD K;  1PP9 E;  2BSW A;  2GUS A;  2IQ6 A;  1OVR A;  3H1K G;  1X9V A;  4WBA A;  1ARM A;  4R57 A;  4OAD A;  3L4F A;  1FE6 A;  2QE7 H;  2HC9 A;  4W7Z A;  1GTW A;  3IWE A;  1KFN A;  1QGK B;  2WSF J;  2YXR B;  3V38 A;  1LAN A;  4KVM E;  4I7Z C;  3G4S P;  2YGW A;  1N7S D;  2ZYG A;  4MHN A;  3OA7 A;  3FXE A;  4MHY A;  3VMX A;  4C7I A;  1ZG7 A;  3FEC A;  3RO0 A;  3AE3 C;  3TSI A;  3M91 A;  1RF1 C;  2L5G B;  4CGN A;  1WWZ A;  1YLO A;  4Y49 C;  1ZR2 A;  2QM7 A;  1YW6 A;  1YME A;  3BRT B;  4CRY B;  4YXD C;  2QVA A;  1NU1 D;  2PJ3 A;  1KIL C;  4KS9 A;  1UFH A;  1G2C B;  3EFG A;  1RE3 A;  4MHP A;  5CPA A;  2A45 I;  2HYN A;  3MUD C;  3VP9 A;  2SPZ A;  2WPX A;  3SWY A;  4NJQ A;  4TLF A;  1W5C E;  2N1T D;  4X2T A;  4U3F E;  1Z2L A;  3PP9 A;  4YXW H;  5G21 A;  1V0C A;  1P84 H;  1AVY A;  4QC6 A;  1LTA C;  2ZOG A;  3F8K A;  3C1L A;  5AW5 B;  1NTZ J;  3AEA C;  3TGU G;  3PGP A;  3BXM A;  1NTK D;  1LCP A;  2ZEF A;  1PP9 D;  1EE3 P;  2O4H A;  2FXF A;  3CCJ P;  4PXB A;  1NTZ D;  1E79 H;  2C6P A;  3FF3 A;  2CIJ A;  1NTK J;  4TT3 H;  1NO4 A;  4X8I A;  2B87 B;  3F0A A;  3FH4 A;  1S72 P;  4HYT B;  1KC8 Q;  2Q4Z A;  3RBX A;  4R3L A;  1OX3 A;  2E76 B;  2WYR A;  4KT0 J;  4C7R A;  3E1R A;  4MY3 A;  1GMJ A;  3IF4 A;  3LW5 J;  3P8C D;  3M9H A;  1JNM A;  1WRG A;  3BJ7 A;  2CNT A;  3TE4 A;  1SQQ J;  3B7I A;  1VQP P;  1SP4 A;  4P10 A;  4WVZ A;  1Q2N A;  1CM0 A;  3CCL P;  4Y99 C;  2LXB A;  1WK4 A;  1JCC A;  1KYO E;  3FB3 A;  1L4A B;  2PJ6 A;  1BPN A;  4YU9 A;  1N73 C;  3FWN A;  4LGD E;  4XNH B;  5KLV J;  3CCU P;  5GTI E;  1USE A;  2QRX A;  1CP7 A;  5KJ7 D;  3R4Y A;  2OYI A;  1OWA A;  2IPP A;  3H1I G;  4L74 A;  3WT4 A;  3R9E A;  4FD4 A;  3Q5S A;  3IIB A;  3CZX A;  3CX5 I;  3SHP A;  4CAW A;  2PSW A;  1CPS A;  4GDO A;  1X22 A;  1X8Y A;  3G71 P;  3R9G A;  3L73 G;  2JDI H;  4M3S A;  3F5B A;  4W9Y A;  3B4S A;  2KS1 B;  4R3K A;  4KSI A;  2NPS A;  4KOW A;  1P0H A;  4K30 A;  3H32 A;  3H1I J;  2NMT A;  1YQ3 C;  1FJP A;  1R5S A;  2RFH A;  1BGY D;  1HGV A;  2Q6Q A;  2ZT9 D;  3H1J G;  1SQB G;  3CPX A;  3L74 G;  2P6E A;  3L36 A;  1YQE A;  2KUB A;  4IFF A;  2WSE J;  3NTN A;  3B5N C;  4UIB A;  4B6Z A;  5HVF A;  4KOY A;  3JTK A;  4B86 A;  2FFD A;  2BOA A;  4NGP A;  1MUU A;  2OZG A;  2Z0Z A;  1N86 A;  2YIU C;  4UFW A;  3B3V A;  3RBU A;  4U3F G;  1MK4 A;  1NU1 K;  2XU6 A;  3PTZ A;  3PRT A;  2CPB A;  4DJG A;  1TXR A;  3BI1 A;  1Q2C A;  4NGN A;  1FY7 A;  4ASV A;  4RS2 A;  1YHQ P;  2J58 A;  5JPH A;  3CXP A;  3L35 A;  1YVK A;  1SVF A;  2WSS H;  2PJB A;  4M6G A;  1M4G A;  1G2C A;  1M4I A;  3D70 A;  2FSR A;  3U1C A;  5GTH H;  5B66 E;  3PJS K;  3A9L A;  2R5D A;  1VQ7 P;  5AW3 B;  1EDK A;  2Q51 A;  3CWB D;  2W83 C;  2BEZ F;  1SQP J;  1T2K C;  2ODF A;  2BL1 A;  3FRM A;  1L0N D;  3PLN A;  4Y99 B;  1YBK A;  3CX5 E;  4JQ0 D;  2OZH A;  2WTY A;  1RTQ A;  2ZEH A;  2Q4Y A;  2OYI B;  1YSJ A;  4NPD A;  4UFX A;  3ZJ0 A;  3A2A A;  4G1P A;  4RUH A;  4EIJ A;  4KOS A;  1NTZ G;  1HDQ A;  1VQ5 P;  3L75 G;  1M1J B;  1LT1 A;  1ZW0 A;  2E74 D;  3L72 J;  3LWU A;  1SQX G;  2FYN B;  5C88 A;  1EDI A;  3EO4 A;  1KB9 E;  1T3J A;  2Q5U A;  4PD4 H;  2D4P A;  1LAM A;  2C27 A;  4OID A;  1OVU A;  2FBW C;  3FNC A;  2Q43 A;  4MCS A;  5E96 A;  4NEX A;  2OTK E;  4JYW A;  1KQL A;  2BAS A;  1KOR A;  5GTH E;  1ZOY C;  4PPZ A;  1LP1 A;  3RL0 B;  1A02 J;  1ZG8 A;  4KOV A;  2PJ5 A;  1I1D A;  1JTH B;  5KTD A;  4U9Z A;  1GL2 B;  2VL1 A;  2Y9Y A;  1M1D A;  2ZEP A;  3Q5R A;  1H88 A;  1H0T B;  2YND A;  3EQ2 A;  4HKF A;  5DWM A;  1IFP A;  4WJB A;  3RYO A;  1FS0 E;  3E7K A;  2Y0D A;  1L0N G;  1KIL E;  2Y0M A;  3R9F A;  1IK9 A;  1N7L A;  1VQM P;  2ZEM A;  4NCZ A;  3RK2 C;  3RNZ A;  3D7F A;  1LT9 C;  2K5T A;  2NZ2 A;  2WSE H;  5JM6 A;  1MJA A;  5F49 A;  1LTT C;  4OME A;  4N3Y B;  5HXD A;  5G1Z A;  2NSM A;  2HUZ A;  4BMH A;  1UIX A;  1MKM A;  2KB7 P;  3KQZ A;  3VOP A;  2WPW A;  3KPE A;  3I9S A;  4Y49 B;  3JRU A;  2YNC C;  3RL0 C;  4A94 A;  2Z11 A;  4CGM A;  1XF8 A;  1CW5 A;  3E1I A;  3A0H E;  1NKZ B;  2ZVN B;  5AG5 A;  1L0C A;  4JWP A;  1S7K A;  1CG2 A;  4A33 A;  5AVX B;  4MFQ A;  4LX9 A;  4XPD B;  3SJE A;  4B5O A;  3I1U A;  2OAR A;  2JWD A;  2N1T C;  4YRH A;  1M1J A;  2H89 C;  2WSC H;  2PFX A;  3L71 D;  2CTC A;  1SQV D;  3OW2 O;  2ZEO A;  3S6G A;  5LYL A;  4P44 A;  3IWW A;  4UFV A;  4Q36 A;  1RF0 C;  1MJB A;  3GF3 A;  1DX7 A;  1VQK P;  1QL1 A;  3LAC A;  7CPA A;  2K3R A;  4MY0 A;  1NU1 E;  5HVH A;  3HE4 B;  4B12 A;  3TNU B;  1IY7 A;  1F2O A;  1FJK A;  2YNE A;  2YMY A;  5AGE A;  4Z65 A;  3H6P A;  2EVN A;  2I79 A;  1PU9 A;  1GDT A;  1EZV I;  4ZY2 A;  4UWI A;  1BAV A;  1LTG C;  5E79 E;  2R3S A;  2R44 A;  4CPG A;  4JD6 A;  2ZEL A;  2WIT A;  1YJN P;  3GHG A;  3BCC J;  5F47 A;  1SQP K;  1S7L A;  4MHD A;  3SJG A;  2ZAE B;  1L0L D;  1LWU C;  2VZY A;  2C1C A;  4BRY B;  1SFC D;  3DGV A;  5APX A;  3L37 A;  1B87 A;  3WU2 H;  4A7P A;  3VTP C;  4CAV A;  3H1H E;  1SQX D;  3K5B A;  3UY5 A;  1PPJ G;  1JMB A;  2PRR A;  3EWK A;  2XEF A;  1J1D B;  1SQB J;  4H2K A;  3D4U A;  4UCP A;  4W7Y A;  2P7J A;  3FEE A;  5IX3 A;  2K1A A;  3H4Q A;  3H1J D;  2QEX P;  2FYZ A;  5APU A;  2AFU A;  3RGU A;  2QEC A;  1XE4 A;  1T6A A;  2V8G A;  3BVH A;  2JBK A;  2ZFC A;  1HJ0 A;  3D2P A;  4GOF A;  3VAR A;  2ZT9 C;  2FVG A;  3PFO A;  4R8F A;  2Z5H A;  2KLV A;  3K2K A;  2XV5 A;  2K9J A;  1M1J C;  1ZP0 C;  1K8A Q;  3L75 E;  4UB6 E;  4UBR A;  1N73 A;  5LYD A;  2FT0 A;  4KVX A;  1Q2D A;  2FE7 A;  4A39 A;  4CYP A;  4KJM A;  3Q3D A;  2RKL A;  3B3C A;  1GYT A;  1AVO A;  1QX8 A;  1NHL A;  3A3Y B;  5CCG D;  3ISX A;  2POK A;  2Q1K A;  1FZA A;  5AVT B;  1PUA A;  2YNC A;  1N7S B;  4PV1 D;  1OW7 A;  3M9B A;  1S3J A;  1CI6 B;  4FBE A;  2AXT H;  2YO3 A;  4PD4 D;  2XZR A;  2QJY B;  1SLQ A;  5AVW B;  3T97 A;  1YX0 A;  2LR2 A;  1T8Z A;  5AW1 B;  1BE3 J;  1FC2 C;  1OMI A;  4PXC A;  1HBW A;  2G0B A;  4IFM A;  1XRY A;  1OVV A;  2YO2 A;  2GU2 A;  3ISZ A;  1KUY A;  1GU4 A;  1JY3 O;  3FVL A;  5I0C A;  1JY2 N;  3II6 A;  1H89 A;  2IZ1 A;  2B4D A;  1BCC E;  4XFJ A;  4AQR D;  1PGP A;  4UB6 H;  5CCH D;  3G9R A;  4YPC A;  1IC2 A;  4P4B A;  4H6U A;  5APW A;  1OIP A;  2D2C C;  3O6Q A;  3S1K A;  2B87 A;  2Y9Z A;  4IAV A;  1RO5 A;  5JGF A;  4DNC A;  1IO4 A;  1KWM A;  3CC4 P;  1Y0Y A;  2AFX A;  1K05 A;  4PXE A;  2HQY A;  3AEG C;  3M0A A;  2WPV B;  5AW4 B;  1T2K D;  1Z5R A;  1P84 D;  1NAY A;  2IBZ G;  3AED C;  3N4X A;  5D29 A;  4E2A A;  1J1D C;  4M3L A;  4CAX A;  2CXA A;  1GD2 E;  1AJY A;  3L75 D;  2Y0C A;  4OWF A;  5KTC A;  2RH0 A;  1SQH A;  1VIX A;  2JBJ A;  3AEE C;  3L73 E;  2PR1 A;  5CCG A;  3D71 A;  4A38 A;  4GKG A;  4CYN A;  4IOI H;  5BWA B;  5IV0 A;  2PAJ A;  1SQB K;  1ZLL A;  2FIA A;  3BHX A;  1URQ C;  2YKO A;  2AEJ A;  1HVV A;  2PIZ A;  1ELM P;  1NSA A;  4C2X A;  2ZYA A;  1KN7 A;  1OXZ A;  2PJ8 A;  2PCU A;  1IK7 A;  1ZV8 A;  4BBH A;  1IU8 A;  2E74 B;  5EMI A;  3KKW A;  1RF0 A;  3FIX A;  4EI2 A;  4Z1M H;  2ZJS E;  4RKU J;  4PQA A;  3V6I A;  2FIW A;  1FZE A;  1T3U A;  4MI4 A;  2YIU B;  2HPC A;  1EZV E;  4PD4 E;  1BCC D;  1Z4E A;  2OTL P;  3FGA D;  4LLH A;  1U7M A;  2J8R A;  5APV A;  1M7L A;  4MN4 C;  1OFC X;  4A2Z A;  1Y9W A;  5HH1 A;  3GLJ A;  3H1K J;  5G22 A;  1YTZ I;  3BCC D;  2WT7 B;  3V8I A;  4B11 A;  4B5P B;  2F8H A;  3S6F A;  3B5N B;  3TGU D;  4AXV A;  2KOG A;  2O28 A;  3CX5 D;  5J8C A;  2ABZ A;  1VQ6 P;  1LOK A;  4OP4 A;  2KI7 B;  5E79 H;  4KUB A;  3CWB E;  1ZRT D;  1YQ4 C;  3HUS B;  3W67 A;  2NYQ A;  1FNO A;  1G1I A;  1JQG A;  2WPR A;  2C6G A;  1SQX J;  4N78 D;  4F9U A;  3TOA A;  2FXP A;  1KB9 H;  3GW6 A;  1SQQ K;  2W8Z A;  4U3F J;  2QIW A;  3M0D A;  5APQ A;  4EDF A;  4LQG A;  1PFI A;  2O01 J;  3LD2 A;  2M5A A;  4IL6 E;  3VN0 A;  2DW3 A;  4K3N A;  3PB4 X;  4PJ0 H;  2Z3N A;  1SQX K;  1JOC A;  2Q9I A;  3MTU E;  4OC0 A;  1KZU B;  5BVZ A;  2PJ4 A;  2GA1 A;  2LXC B;  4H44 B;  3PRJ A;  2GFQ A;  2IZ0 A;  3CCE P;  2O01 N;  4WWV A;  3D6Y A;  1R5L A;  4UEE A;  4K3A A;  5J8F A;  1Z8T A;  2AE6 A;  2Z10 A;  1CI6 A;  2REF A;  3FED A;  2V8H A;  3L72 E;  1BSN A;  3B3T A;  2J8M A;  2PVW A;  1H8L A;  3N5F A;  3T9Y A;  5M1B A;  4NJR A;  2BUE A;  4F9V A;  1E5W A;  2E74 C;  3W6X A;  3D66 A;  1YGH A;  4FD5 A;  1NMT A;  2Y0E A;  4MCQ A;  3PBE A;  1CJW A;  4AUW A;  4NGM A;  2PJC A;  1AUG A;  3GG2 A;  5AVR B;  2PJ0 A;  3W6S A;  2FYU J;  1Q7L A;  3D7G A;  2A06 G;  3H8F A;  2FYN C;  1D7M A;  2IFN A;  4KOU A;  2FFD B;  3Q2Y A;  4KOX A;  2VBQ A;  3L74 J;  1OBR A;  4FD6 A;  5F46 A;  4N6J A;  2FYU D;  2V4H A;  2Q7C A;  2ZEE A;  3KR5 A;  2Q3E A;  1OZP A;  1HUC A;  3MIW A;  2AFZ A;  2OQQ A;  1ELL P;  5IB0 A;  5CJ0 A;  2BEQ D;  4MCP A;  4HH2 A;  5APS A;  3TCV A;  2O3J A;  1FBM A;  1YVO A;  2AFM A;  3QNV A;  2P6G A;  1FAV A;  1ZG9 A;  4XPD C;  3TF5 A;  3A0H H;  4O9B A;  3A5T A;  2Q0Y A;  4Q38 A;  1EZV D;  1QL2 A;  2Q3I A;  2G9D A;  2PDO A;  2CY2 A;  2I3C A;  4WWI A;  1NTK G;  4EYY Q;  4OIW A;  3L71 E;  3QB8 A;  1GHE A;  4WY4 A;  3GLM A;  1XTG B;  3VMA A;  1QST A;  2PQ8 A;  3L74 D;  2IBZ I;  3D7D A;  5AVQ B;  3IC1 A;  2YXQ B;  2B3V A;  2Q04 A;  3N7N A;  1L0L K;  2RC4 A;  3A0B H;  1CZQ A;  5CCG C;  4MFJ A;  2A06 D;  2W6A A;  4I49 A;  4MFP A;  4H13 D;  2ARH A;  3PEI A;  1LGH B;  4M85 A;  5AG6 A;  5AW7 B;  3KGQ A;  1K4J A;  1SQP G;  4YTP C;  3D67 A;  3GYA A;  4MXU A;  3AE7 C;  1R8E A;  1Y8A A;  2Z3M A;  4YGO A;  2PC1 A;  1KQG B;  3KAS A;  4JJX A;  1JTH A;  4B5P A;  3VYI A;  5D8N A;  3B5N A;  1R57 A;  5L8R J;  1RE4 C;  3VMY A;  3JC2 2;  2ZW5 A;  2JWA A;  1S3Z A;  3MZW B;  4HKZ H;  4NSQ A;  3SJF A;  3SXO A;  1BE3 G;  4DCK A;  3TNU A;  4UEZ A;  3HUS A;  2E76 C;  1YIJ P;  1RXT A;  4GT1 A;  2QML A;  3L70 D;  5GCN A;  5AVS B;  1SQX E;  3WUT A;  4AVC A;  1QQ9 A;  2OH1 A;  2M3E A;  4BRY A;  3CL3 D;  2E5T A;  1YI2 P;  2ATR A;  4WY4 C;  1ZRT E;  1LTI C;  4L73 A;  2P2U A;  4P4E A;  2XEJ A;  3NE7 A;  3SJX A;  3NMD A;  3GIU A;  2HPC B;  3IR9 A;  3SFD C;  2WZN A;  3JCU E;  2I1K A;  5APT A;  1Z9U A;  1IYL A;  4M6H A;  1DD4 A;  2ZW7 A;  1NGM B;  3I3G A;  1Q81 Q;  2Z3L A;  3AE8 C;  1LTS C;  1JUN A;  2GUV A;  5K8N A;  2KIK A;  1B6B A;  4BIN A;  1XOV A;  4UIA A;  4OC1 A;  2QYV A;  1YK3 A;  3K9U A;  3KXD A;  4OC2 A;  1N8R Q;  4HB1 A;  3S6H A;  5H84 A;  1DD3 A;  3UIA A;  5KJ7 A;  1YRE A;  2G3T A;  1X0T A;  3G3Z A;  5KAF H;  1FOS F;  3HTK A;  5CJ4 A;  1FZF A;  3L2N A;  2N9Y B;  2FFD C;  1BGY J;  3CCS P;  1Z8X A;  1XMB A;  2QIR A;  1FZG A;  3S9M A;  1L4A A;  3PZJ A;  1XIX A;  1S5K A;  5LYI A;  4FAI A;  2EK8 A;  2P6F A;  4JLY A;  5EFW B;  5HVG A;  3D6Z A;  2H43 A;  2B4B A;  1S7F A;  2WUU A;  2Z3P A;  2PJ1 A;  2QVP A;  4F0Y A;  2JP3 A;  3PHL A;  3M9Q A;  1QLE D;  4H0L D;  2HLO A;  3BLN A;  2J59 M;  4JXQ A;  2JEV A;  1OZH A;  3N7Z A;  2C9N Y;  3T8W A;  1Q82 Q;  2N1T B;  4IF5 A;  4ZKP A;  2CK3 H;  3V2P A;  2BEI A;  4C2Y A;  4NPE A;  2P10 A;  1BGY E;  3WC7 A;  1X12 A;  5K5G B;  1ZLH A;  1NOH A;  3KI9 A;  2FYU K;  1SQQ D;  4IL6 X;  3AEB C;  1ZO0 A;  5KAF E;  5DS0 A;  1KTM A;  2FXO A;  1NTM E;  1LT9 A;  1TKH A;  1RE3 C;  1L0L E;  2BCC J;  2JO1 A;  1EXI A;  4WY4 B;  1LT9 B;  2PP6 A;  2QA4 P;  5CCH C;  3Q5P A;  4R87 A;  3NE8 A;  4ZX9 A;  3CME P;  3P2H A;  3FWL A;  4A31 A;  4CGL A;  4M6I A;  3E0K A;  2C0W A;  1KB9 D;  2VRS A;  2ANP A;  4ONW A;  2XEI A;  4JZ0 A;  3IU1 A;  3G8W A;  3CPA A;  1BPM A;  5AW8 B;  1QSR A;  1L4A C;  2E5Y A;  2QJP C;  1KD1 Q;  2VI7 A;  4ZBG A;  3V2Q A;  4PV6 A;  4RI1 A;  2CNS A;  3U1A A;  1VF5 D;  1WMK A;  1S5L H;  4NPF X;  3HD7 A;  3H1L D;  1KUV A;  2F7V A;  1GL2 C;  4MBU A;  4K35 A;  4F0X A;  2ZEG A;  3HD7 B;  3H1H G;  4MHZ A;  1PPJ E;  3VH9 A;  2XEG A;  4DJL A;  1HGZ A;  4IL6 H;  4BXL A;  2IL4 A;  4GOD A;  5B5E H;  3PB6 X;  2Z5I A;  4OC5 A;  1N7S A;  2KYV A;  5KLI B;  1FDI A;  3RK3 B;  1ZR4 A;  3VAT A;  4ZI6 A;  3PB7 X;  3KZW A;  1Q90 D;  1UII A;  2V8V A;  1MJ9 A;  1BCC J;  2B58 A;  2WPS A;  3AE9 C;  2AEF A;  3EY5 A;  3GHG B;  1BE3 E;  3HE5 B;  1HWT C;  4I2L C;  5EC4 A;  1KZF A;  1XBU A;  1VHE A;  1Z4R A;  2H88 C;  5KJ7 C;  4A30 A;  2WQY C;  1VQO P;  2NPS C;  3H1J J;  1NYH A;  1KB9 I;  3V5B A;  1KUX A;  4QMA A;  3L72 D;  1JEK A;  1KQF B;  1I12 A;  4OGQ C;  2FS5 A;  4ORF A;  3G3S A;  2RN0 A;  4BD9 A;  2KZJ A;  2N9B A;  4OLL A;  3TX8 A;  4UB8 E;  1FT7 A;  2VEZ A;  1L0N K;  4OVN F;  2QG4 A;  5CCH A;  3IJ3 A;  2MJZ A;  1FDO A;  5DJU B;  1KIL B;  1PP9 J;  4P4I A;  2B5G A;  1MFT A;  3B5N D;  1KV4 A;  3Q1M A;  4MFL A;  3H1L E;  3FXT A;  1DTD A;  2IYP A;  4JYC A;  1KYO I;  4KLV A;  3L70 G;  4CYQ A;  4KVO E;  2R7H A;  3D2M A;  1EQ7 A;  5I4M A;  3RK3 C;  5H86 A;  3IGR A;  2AFO A;  1PGQ A;  2OYH A;  3P2F A;  2ZOF A;  1LJ2 A;  1IGB A;  3OJA B;  4H13 C;  1VHS A;  2OTJ P;  3S9O A;  4OGQ B;  2GLJ A;  2KXP B;  1RQV A;  2E76 D;  3W91 A;  1HTL C;  2CPS A;  1TF8 A;  1VPC A;  3JVN A;  1S5L X;  5IB9 A;  2M8R A;  3CI9 A;  2NPS B;  3H1K E;  1F2P A;  2FYU E;  1IFN A;  4CS0 B;  3IWG A;  1NTM K;  3L72 G;  4QB9 A;  1ON0 A;  3H8E A;  5TIS E;  1Y9B A;  1TIQ A;  4FWU A;  4B10 A;  4L89 A;  2PRQ A;  2WT7 A;  2V77 A;  1TF9 A;  4FUU A;  1PV3 A;  3CXH I;  3JUW A;  1NU1 G;  2HFE D;  1NTM J;  3GUX A;  1AYE A;  1JMM A;  1JY2 O;  3WUV A;  2HR3 A;  1N73 B;  1KQS O;  3NH4 A;  5HMN A;  2IBZ D;  4R76 A;  2WZ7 A;  2G8Y A;  1S60 A;  3CXS A;  2J5U A;  2JJL A;  3AE4 C;  1NTK K;  2ZPA A;  1YIT P;  2J8N A;  2Q44 A;  3H1J E;  2WMM A;  3CLQ A;  4GXH A;  4KHX A;  2R1I A;  1NTK E;  3RK3 E;  4ASW A;  2Z4E A;  2B5G B;  3MN8 A;  2PR8 A;  3NH5 A;  5AW9 B;  4ZGY B;  3R96 A;  1J4J A;  5AG7 A;  4NGT A;  1F57 A;  1Y47 A;  4A37 A;  1I21 A;  2W27 A;  2R32 A;  1QVG O;  1Y9K A;  2KZI A;  3HUV A;  4X3R A;  2B3U A;  1FZC A;  4U3F D;  4L75 A;  4I6M C;  5AVU B;  5KKZ B;  3KL9 A;  1IYK A;  1IJD B;  3SSU A;  3QAY A;  1S2E A;  2A45 H;  3IN6 A;  1MFZ A;  1JM0 A;  2OGU A;  1NH4 A;  2I8D A;  2XNX A;  4C7N A;  1W2E A;  3C26 A;  1J1E B;  4HNY B;  4FD7 A;  5LRJ A;  3BCC E;  4NXY A;  3O8Z A;  4MCR A;  1M4D A;  1A2Z A;  1Y7E A;  4UF4 A;  2M0B A;  5GTI H;  4EME A;  1M44 A;  3U59 A;  1XFO A;  2H8P D;  3NXS A;  5CMZ A;  5ELY A;  3RAM A;  1IB1 E;  2IJZ A;  5AW6 B;  3TGU E;  1NAF A;  1YJW P;  3IFM A;  1M1K Q;  4Q7A A;  1IFI A;  4ZX8 A;  4HNW B;  2R8V A;  1S4X A;  3SI0 A;  5CBO A;  3L70 E;  3KDP B;  1SQV K;  1L0N E;  4DYO A;  1IID A;  1GW3 A;  1M90 Q;  4CAE A;  1AA0 A;  2MKV A;  1PGO A;  1IFD A;  4KUA A;  1DEE G;  1SQV E;  5KLV G;  3MHV A;  4XPK A;  4E8O A;  1GW4 A;  2EK9 A;  4PJ0 E;  2YKQ A;  3B8E B;  1KFM A;  1P4N A;  5TIS H;  1L4A D;  1J1E C;  1DIP A;  1JWQ A;  3T90 A;  3V2R A;  3GB0 A;  1MZ9 A;  2C6C A;  2FKW B;  5KKZ C;  1HDU A;  4CRZ B;  2W90 A;  4XA4 A;  3S4R A;  2BCC G;  1NU1 J;  1EDJ A;  4IUS A;  2WPQ A;  2A45 G;  4A95 A;  4XPL A;  1NWQ A;  4HPS A;  4UWJ A;  2F5I A;  1JY3 P;  1GK6 A;  1YW4 A;  4MFZ A;  5AW2 B;  1VDF A;  1Z56 A;  3TFY A;  1K9M Q;  2YKP A;  1SQB E;  4U7J A;  3HLP A;  1NJI Q;  4P45 A;  4PSX A;  4YFJ A;  1P84 E;  2GE3 A;  2IBZ E;  3MGD A;  3FX0 A;  3W68 A;  3H1I E;  1QVF O;  5K8O A;  1R43 A;  4AG9 A;  3FJU A;  1URQ A;  4CAF A;  3DNS A;  4U9Y A;  2KK7 A;  4H44 C;  2GM4 A;  3BAT A;  2VZZ A;  2B9B A;  2FL4 A;  3S9L A;  1M8O B;  3USS A;  3H1K D;  3IAO A;  2Q7S A;  2HG5 D;  3RBZ A;  4NGR A;  3L71 J;  3A7O A;  1U6M A;  3LID A;  1S1C X;  5JH9 A;  2WSA A;  2HV2 A;  3FX6 A;  3MUD A;  1S5L E;  2DEA A;  3KHX A;  3L71 G;  1BGY G;  4DT0 A;  1S9K E;  2HB6 A;  8CPA A;  2EUI A;  4P4J A;  2IYO A;  1U57 A;  3AEF C;  3WU2 E;  3RK2 D;  1QEX A;  2OR4 A;  3HE4 A;  3WUU A;  2X7B A;  2NRG A;  5G20 A;  2NPS D;  1FOS E;  4Y28 J;  3CXQ A;  1NTM D;  2Q4V A;  3TO9 A;  4H0L C;  2RMZ A;  4KSF A;  3LW5 H;  3KHU A;  4LC1 A;  3C8V A;  2PE3 A;  3LMS A;  2M5A B;  1Y7R A;  3HE5 A;  3V2N A;  1EZV G;  4ZY1 A;  1DE4 C;  4U5Y A;  4TNU A;  4D6T G;  2PVV A;  4D6T D;  2GRE A;  4UCN A;  4CYO A;  1VGY A;  4C68 A;  1H8A A;  4EWT A;  1EDL A;  2ZXX A;  1VKC A;  4JF7 A;  3CC7 P;  3IO1 A;  3M0D C;  2JR8 A;  1WT6 A;  4L76 A;  1VQN P;  4H6Z A;  4AG7 A;  6CPA A;  3RK3 D;  4BWN A;  2ZEN A;  4EFD A;  1LNQ A;  1MV8 A;  2J9A A;  4LQ6 A;  1SQQ G;  1FDM A;  5F48 A;  1RY3 A;  2DPT A;  5AG4 A;  3C9I A;  1FZC C;  4EOT A;  2H5M A;  3KYQ A;  3B2Y A;  3NA6 A;  3AE2 C;  1JB0 J;  3KZI E;  3QH9 A;  2RB7 A;  2AJ6 A;  5EBV A;  2ZED A;  3H1L J;  2D2C D;  4L8A A;  4NGS A;  1VQL P;  4OC3 A;  3GKR A;  2P0W A;  3PH0 A;  3LIE A;  1LTB C;  3PBB A;  3AE1 C;  2BCC E;  1YLE A;  1BE3 D;  2UWJ E;  1FZC B;  3KR4 A;  1AMP A;  2EBJ A;  1XTC C;  4C2Z A;  3I56 P;  2OOT A;  1SFC C;  5KTB A;  3BJ8 A;  1RF1 B;  4DOJ A;  4R7M A;  3D8P A;  4R9M A;  3SI2 A;  2KNC B;  4H13 B;  2ZW4 A;  3B3S A;  2Z3O A;  3WR7 A;  1XMT A;  5CBM A;  2QM8 A;  2QSI A;  2C9L Y;  3HRN A;  4CGO A;  1SQP D;  1DH3 A;  3MGN A;  3NFQ A;  4B13 A;  3CC2 P;  2KP8 A;  4QBJ A;  4TWE A;  2WVR A;  2DPS A;  1XJO A;  4I7Z B;  1QMU A;  1NVO A;  4RJT A;  2VXK A;  1ZME C;  3QWO C;  3CCM P;  2CF4 A;  3L73 J;  5K8M A;  1J2J B;  3HD7 C;  4XE5 B;  2R5B A;  1GU5 A;  4KZT A;  1PCA A;  2VQY A;  4MRI A;  2JEE A;  3FYN A;  2Z3K A;  3H1L G;  4F8Z A;  3ZZI A;  4H0L B;  4UEF A;  3IFE A;  1LTJ A;  3TT2 A;  1KYO H;  1N7S C;  3B71 A;  2FY8 A;  4OGQ D;  1LTJ B;  3A0B E;  3GMA A;  3P8C E;  5KAI E;  4A32 A;  1Z8W A;  1VQ4 P;  2YMK A;  4PK2 A;  3WC6 A;  3VP8 A;  2CTB A;  2P58 A;  3R2P A;  1QSO A;  2A06 E;  4HNX B;  4PV1 C;  3P7K A;  5THW A;  1NTM G;  2FYU G;  4B14 A;  2K9J B;  2WWW A;  2Q7B A;  1LP1 B;  3PP5 A;  2REE A;  3SI1 A;  3NFZ A;  2ZXE B;  3D68 A;  1BSH A;  1BDC A;  4GM5 A;  5APY A;  3KQG A;  4H89 A;  3F5H A;  4PXD A;  5B5E E;  2IX7 C;  2XND H;  1RF1 A;  3ZDM A;  1NKN A;  2PRB A;  5LYF A;  2R98 A;  1RQU A;  2H7H A;  4ZYQ A;  1AFO A;  2E75 D;  3OAK A;  5CHX A;  3L75 J;  2OB0 A;  1L0N J;  4AB7 A;  2JKV A;  2L91 A;  5K8P A;  5KAI H;  1JY2 P;  1CX8 A;  2K88 A;  3CWB G;  1M56 D;  2LKM A;  2KS1 A;  4UCM A;  2QJ8 A;  5BU5 A;  4CPA A;  4R4M A;  1IOF A;  4C46 A;  1BDD A;  1K04 A;  1P84 I;  5KTA A; 
#chains in the Genus database with same CATH homology
 4PK3 A;  2J8R A;  5H86 A;  3IGR A;  3P2F A;  1Y9W A;  4MFK A;  5HH1 A;  4A2Z A;  5G22 A;  4XNH B;  4H13 C;  4UA3 A;  3V8I A;  4B11 A;  4B5P B;  3S6F A;  3GF7 A;  1VHS A;  3EXN A;  3S9O A;  2O28 A;  5J8C A;  4OGQ B;  3R4Y A;  3GY9 A;  1RQV A;  2E76 D;  2CNM A;  4KSA A;  3W91 A;  2V7Q J;  2GAN A;  3JVN A;  1S5L X;  3Q5S A;  4FD4 A;  4KUB A;  3R9E A;  3SHP A;  4CAW A;  1YQ4 C;  1QSM A;  2PSW A;  4GDO A;  1LRZ A;  3R9G A;  4M3S A;  3F5B A;  4CS0 B;  3IWG A;  4R3K A;  4KOW A;  1P0H A;  2QJY C;  4EVY A;  4K30 A;  3TOA A;  4X5K A;  2NMT A;  1YQ3 C;  2FXP A;  4QB9 A;  1ON0 A;  2QIW A;  3D2M A;  2O01 J;  1Y9B A;  2ZT9 D;  1TIQ A;  3LD2 A;  4B10 A;  4L89 A;  2Z3N A;  1PV3 A;  2P6E A;  5CNP A;  3H25 A;  3JUW A;  2WSE J;  3AE5 C;  4H44 B;  2DXQ A;  2ZW6 A;  4KOY A;  5HMN A;  3JTK A;  3D6Y A;  3SXN A;  2OZG A;  2Z0Z A;  2G8Y A;  1S60 A;  2YIU C;  3CXS A;  2J5U A;  3AE4 C;  4UFW A;  5J8F A;  2AE6 A;  2Z10 A;  3IU2 A;  2ZPA A;  1MK4 A;  2REF A;  2J8N A;  2Q44 A;  3H5Z A;  2R1I A;  2J8M A;  1NSL A;  3T9Y A;  1Q2C A;  5M1B A;  1FY7 A;  4RS2 A;  3RK3 E;  2BUE A;  2B5G B;  2PR8 A;  1OW8 A;  5JPH A;  2E74 C;  3DR6 A;  3W6X A;  3CXP A;  4ZGY B;  3DR8 A;  1YGH A;  1YVK A;  4FD5 A;  1NMT A;  1J4J A;  5AG7 A;  3R96 A;  2I00 A;  1M4G A;  3B8G A;  4PSW A;  1I21 A;  1M4I A;  1Y9K A;  3DDD A;  2FSR A;  3D70 A;  1CJW A;  4AVB A;  2B3U A;  3A9L A;  3W6S A;  1IYK A;  4LUA A;  2BEZ F;  1BO4 A;  2BL1 A;  2ZXV A;  3FRM A;  3TTH A;  3IN6 A;  2OZH A;  3RL0 g;  2FYN C;  3R1K A;  4KOU A;  5JQ4 A;  3C26 A;  4NF1 A;  4HNY B;  3Q2Y A;  2Q4Y A;  4MJ8 A;  4KOX A;  2VBQ A;  4FD7 A;  4UFX A;  4NXY A;  3ZJ0 A;  2G3A A;  4FD6 A;  5F46 A;  1M4D A;  4KOS A;  1M44 A;  1OZP A;  3EFA A;  3R95 A;  2QJK C;  2E74 D;  1IB1 E;  2OQQ A;  5IB0 A;  2BEQ D;  5C88 A;  3LOD A;  3EO4 A;  3TCV A;  2D4P A;  4ONU A;  2C27 A;  1YVO A;  2FBW C;  3FNC A;  4HNW B;  2R8V A;  5E96 A;  5KLI C;  2P6G A;  4NEX A;  3S6K A;  1NE9 A;  4XPD C;  3TO7 A;  2Q0Y A;  1IID A;  1KOR A;  4Q38 A;  4CAE A;  4QUS A;  1ZOY C;  2CY2 A;  2MKV A;  2PDO A;  4KUA A;  4KOR A;  4XPK A;  4KOV A;  2B4D B;  1I1D A;  3QB8 A;  4E8O A;  1GHE A;  4KOT A;  3GLM A;  5KTD A;  4U9Z A;  3FBU A;  1M1D A;  1P4N A;  3Q5R A;  5ISV A;  1QSN A;  1QST A;  2PQ8 A;  2YND A;  3T97 B;  1DIP A;  4HKF A;  3T90 A;  2Q04 A;  2B3V A;  5DWM A;  1OW6 A;  2FCK A;  2RC4 A;  3EC4 A;  2K9Y A;  3RYO A;  4MFJ A;  1KIL E;  5KKZ C;  4H44 D;  2Y0M A;  4I49 A;  4MFP A;  3R9F A;  4H13 D;  2ARH A;  2GIV A;  4CRZ B;  4M85 A;  4JXR A;  5AG6 A;  4KLW A;  5A27 A;  4NCZ A;  2A4N A;  3DSB A;  1K4J A;  4YTP C;  3GYA A;  4IUS A;  4A95 A;  3ABV C;  3AE7 C;  1R8E A;  2Z3M A;  4UWJ A;  4XPL A;  4YGO A;  4C7H A;  4II9 A;  2K5T A;  2NZ2 A;  1KQG B;  2PC1 A;  2F5I A;  4JJX A;  4B5P A;  1MJA A;  5F49 A;  1R57 A;  3OWC A;  5G1Z A;  4J3G A;  4MFZ A;  5L8R J;  2HUZ A;  4BMH A;  1UIX A;  4GS4 A;  1MKM A;  2ZW5 A;  2WPW A;  3I9S A;  4Y49 B;  3TFY A;  2YNC C;  1S3Z A;  2Z11 A;  4U7J A;  4CGM A;  1PIX A;  4R4L A;  1XF8 A;  4NSQ A;  3SXO A;  4PSX A;  4YFJ A;  2GE3 A;  5AG5 A;  2E76 C;  1L0C A;  4JWP A;  1S7K A;  1RXT A;  4A33 A;  3MGD A;  4MFQ A;  4LX9 A;  4XPD B;  1PL5 A;  2QML A;  4B5O A;  5GCN A;  3VWD A;  4AG9 A;  1N71 A;  4CAF A;  3DNS A;  4U9Y A;  4YRH A;  4H44 C;  4AVC A;  2H89 C;  2VZZ A;  2FL4 A;  2OH1 A;  1EXJ A;  1HF9 A;  2KCW A;  3QAH A;  5FVJ A;  3IAO A;  2ATR A;  3S6G A;  1ZRT E;  4UFV A;  3TO6 A;  1YR0 A;  4Q36 A;  2IDB A;  1U6M A;  1IIC A;  1S1C X;  3NE7 A;  2WSA A;  1MJB A;  2HV2 A;  3GF3 A;  1BOB A;  4MY0 A;  3SFD C;  4B12 A;  2EUI A;  3VWE A;  2YNE A;  3AEF C;  1U57 A;  4OAE A;  2ZT9 B;  5AGE A;  1Z9U A;  1IYL A;  2EVN A;  2I79 A;  2X7B A;  1DD4 A;  1S7N A;  2ZW7 A;  1NGM B;  5G20 A;  1PU9 A;  3I3G A;  4QVT A;  4CGP A;  4Y28 J;  2E75 C;  3CXQ A;  2Q4V A;  4UWI A;  2Z3L A;  2D2C B;  3TO9 A;  3AE8 C;  1XEB A;  4JD6 A;  1B6B A;  4H0L C;  4KSF A;  1YK3 A;  3K9U A;  4XNH C;  1VF5 B;  3C8V A;  5F47 A;  3S6H A;  3AE6 C;  5H84 A;  1DD3 A;  1Y7R A;  1YRE A;  2G3T A;  2JLM A;  1S7L A;  2R7H A;  4MHD A;  5DWN A;  2OZU A;  4U5Y A;  2VZY A;  4E0A A;  1B87 A;  1KMI Z;  4AVA A;  2QIR A;  4UCN A;  4CYO A;  3AEC C;  3PZJ A;  1XIX A;  4C68 A;  1TU3 F;  1S5K A;  4CAV A;  4F6A A;  2P6F A;  4JLY A;  4PV1 B;  1VKC A;  5A28 A;  3UY5 A;  3D6Z A;  1VL2 A;  2JDD A;  2JDC A;  3EWK A;  4H6Z A;  2B4B A;  4AG7 A;  1S7F A;  2WUU A;  2Z3P A;  1VF5 C;  5C82 A;  4UCP A;  2JP3 A;  4F0Y A;  5IX3 A;  1Q2Y A;  4H0L D;  3BLN A;  3H4Q A;  5F48 A;  4JXQ A;  2JEV A;  3N7Z A;  2QEC A;  1XE4 A;  2E75 B;  2D4O A;  2DPT A;  5AG4 A;  2H5M A;  3SFE C;  4IF5 A;  1HJ0 A;  3D2P A;  3AE2 C;  1JB0 J;  2BEI A;  4C2Y A;  2P10 A;  2AJ6 A;  2ZT9 C;  2OU2 A;  5EBV A;  3TOB A;  3D3S A;  2D2C D;  4L8A A;  3GKR A;  1ZP0 C;  2WSC J;  4IL6 X;  2P0W A;  3AEB C;  1ZO0 A;  2BSW A;  4UBR A;  2FT0 A;  3AE1 C;  4KVX A;  1KTM A;  1YLE A;  1Q2D A;  2FE7 A;  4CYP A;  3Q3D A;  4R57 A;  4OAD A;  2JO1 A;  1EXI A;  4C2Z A;  3Q5P A;  3IWE A;  4R87 A;  2WSF J;  3BJ8 A;  3P2H A;  4A31 A;  4CGL A;  3D8P A;  4KVM E;  4I7Z C;  4R9M A;  4H13 B;  2ZW4 A;  1PUA A;  2Z3O A;  2YGW A;  3WR7 A;  1XMT A;  2QSI A;  3E0K A;  2YNC A;  4CGO A;  4C7I A;  4PV1 D;  1OW7 A;  3IU1 A;  3G8W A;  4B13 A;  1QSR A;  3AE3 C;  2QJP C;  2VI7 A;  4ZBG A;  4QBJ A;  2DPS A;  4PV6 A;  4I7Z B;  4RI1 A;  2CNS A;  4CGN A;  1VF5 D;  1WWZ A;  1YX0 A;  1WMK A;  2VXK A;  4Y49 C;  1ZME C;  4CRY B;  4YXD C;  1KUV A;  1OMI A;  4MBU A;  4F0X A;  2G0B A;  4KZT A;  2VQY A;  4KS9 A;  1UFH A;  1KUY A;  5I0C A;  3FYN A;  2B4D A;  4XFJ A;  2Z3K A;  3G9R A;  3ZZI A;  4H0L B;  4H6U A;  2WPX A;  2IL4 A;  3TT2 A;  2D2C C;  3O6Q A;  1FDI A;  1RO5 A;  3B71 A;  3PP9 A;  4DNC A;  4OGQ D;  5G21 A;  1V0C A;  1K05 A;  3GMA A;  1Q90 D;  4QC6 A;  2HQY A;  1MJ9 A;  3AEG C;  3F8K A;  2WPV B;  2B58 A;  3AE9 C;  4A32 A;  3AED C;  3AEA C;  3EY5 A;  4E2A A;  3PGP A;  2YMK A;  4PK2 A;  4CAX A;  2CXA A;  1AJY A;  1QSO A;  5EC4 A;  1KZF A;  5KTC A;  2FXF A;  4HNX B;  1SQH A;  4PV1 C;  3AEE C;  1Z4R A;  2PR1 A;  2H88 C;  4B14 A;  2Q7B A;  4A30 A;  2WQY C;  2REE A;  4TT3 H;  3D71 A;  3F0A A;  4CYN A;  5BWA B;  5IV0 A;  1NYH A;  2FIA A;  1KUX A;  1KQF B;  1I12 A;  4OGQ C;  4H89 A;  2FS5 A;  4ORF A;  4C2X A;  4R3L A;  3G3S A;  2E76 B;  4OLL A;  4KT0 J;  1IK7 A;  4MY3 A;  2PRB A;  2R98 A;  1GMJ A;  2VEZ A;  3LW5 J;  1RQU A;  4BBH A;  2E74 B;  3KKW A;  3BJ7 A;  1FDO A;  2CNT A;  2E75 D;  3TE4 A;  3FIX A;  2OB0 A;  4AB7 A;  2B5G A;  4Z1M H;  4MFL A;  3Q1M A;  4RKU J;  1CM0 A;  3FXT A;  2FIW A;  4UCM A;  4MI4 A;  1WK4 A;  4KLV A;  4CYQ A;  4KVO E;  4R4M A;  1Z4E A;  3FB3 A;  3FGA D;  1K04 A;  5KTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...