2ZEEA

Crystal structure of the human glutaminyl cyclase mutant s160g at 1.99 angstrom resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDGAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2007-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2zeeA00
3ISXA 2NYQA 2PCUA 4ZY0A 3PBBA 4KSIA 1RTQA 2ZEEA 4Z65A 5F09A 1XJOA 3D7GA 4R76A 1TF8A 3WC5A 3MRUA 2JBJA 5HVFA 4PPZA 2C6GA 3IFEA 3WABA 4UF4A 2GU2A 3IWWA 4NFRA 4IHMA 3IJ3A 4NGRA 1ARMA 5K8NA 2AFWA 4OKOA 1XBUA 1ZG8A 3K9TA 4EFDA 2PJ4A 1YMEA 4P10A 4PXDA 1FNOA 2AFSA 3N5FA 3PB8X 3SI0A 4MMOA 3CDXA 1LFWA 1Y7EA 3ISZA 3D68A 2CTCA 2EK8A 3NH4A 4GM5A 1CP7A 2PJCA 1LAPA 2Q51A 4WJBA 4OMEA 3KZWA 1TKHA 3KHXA 2AFMA 5IB9A 5JGFA 3BXMA 1KWMA 4OC4A 4EMEA 4ZY2A 2WYRA 3D67A 3CT9A 4UIAA 3B7IA 1VGYA 5LYIA 4B6ZA 1YLOA 4NGMA 3IEHA 3DLJA 4MHYA 3MN8A 4K3NA 2F7VA 4OP4A 5ELYA 5LYFA 2HC9A 4X8IA 3FX6A 1PYTB 5HXDA 4MCPA 3L2NA 2ZEFA 4MCRA 4ZX9A 4MRIA 2F8HA 2QYVA 1Z2LA 2IQ6A 1BPNA 3B35A 3B3VA 2WZNA 3LMSA 4P4IA 5HVHA 2OR4A 3PFEA 4P4JA 2ABZA 3FMCA 2XEJA 2C6CA 2PJAA 3PBEA 1Q7LA 1BAVA 3WC6A 2C1CA 3NH8A 1ZG9A 4UIBA 5JM6A 1AMPA 4A37A 3KHZA 4Q7AA 3IO1A 2J9AA 2GLFA 2PIZA 2RFHA 4NJRA 3FEDA 5D8NA 1Z5RA 4O23A 3LWUA 3PB4X 2ZEOA 2AFXA 3NFZA 4P4EA 3K2KA 2JBKA 4WWVA 3IC1A 2ZEPA 4MXUA 3NA6A 4MHZA 4FWUA 1CPSA 2O4HA 4LQGA 3FEEA 4UEFA 2V8GA 3S9MA 2JEWA 2C6PA 3QNVA 4UEEA 3FF3A 4PQAA 2PJ6A 1R3NA 2EWBA 4A39A 2PJ3A 2NSMA 5CPAA 4BD9A 4P6YA 4F9UA 1EE3P 4X3RA 1IGBA 3B3CA 2V8VA 3B3WA 4MCQA 2ANPA 4TNUA 3WT4A 4PXBA 3BI0A 1ZLIA 2ZEDA 1GYTA 3TC8A 2ZEHA 3VH9A 4OC1A 2Q4ZA 3V38A 1XRYA 5LYLA 1QQ9A 3KASA 2PVWA 2CTBA 1VIXA 1FT7A 3WC7A 3SI2A 3SJFA 3H8FA 5THWA 4P4DA 1LAMA 2BO9A 4AXVA 3H8GA 3GLJA 1CP6A 5K8PA 1Z8LA 1VHOA 3B3TA 1CPXA 1TKJA 3GB0A 7CPAA 2AFUA 3FECA 3D7HA 1IY7A 1CG2A 3B3SA 3D66A 2PJ0A 1F2PA 2PJBA 2BCOA 1Y0YA 2QJ8A 1F2OA 1HDUA 2I3CA 4YU9A 2PIYA 4R7MA 2AFZA 3SJEA 2PRQA 2QVPA 4EWTA 3PB7X 1CBXA 4NJQA 3BI1A 2ZOGA 4OC5A 3KQXA 4F9VA 1M4LA 1TF9A 1CX8A 2PJ9A 3RAMA 3SI1A 3I1UA 1R43A 2VL1A 2RB7A 1DE4C 3PFOA 2ZEMA 1XMBA 1PCAA 3KL9A 3IIBA 4MHNA 4W9YA 2XEGA 3HUVA 4P44A 3KR4A 4IAVA 4TWEA 3KQZA 1F57A 2AFOA 2ZELA 3PB9X 3D7DA 5D29A 3KI9A 1ARLA 4CPAA 4OC2A 3SJXA 4NGPA 5I4MA 3V7ZA 5J1QA 1ZG7A 3SJGA 3KR5A 4X2TA 3TX8A 3RBUA 3DGVA 4P4BA 1YW4A 2XEFA 2CIJA 4OC3A 4OC0A 2ZENA 3VARA 3KGQA 4JYWA 4NGSA 2DEAA 1LOKA 4JZ0A 2Q43A 4FAIA 4A38A 4NGQA 2V8HA 4MCSA 3HLPA 5K8OA 4PXCA 4RUHA 3S9NA 2OOTA 1TXRA 3CPAA 3GUXA 3PRTA 1BLLE 1H8LA 5LRJA 1TKFA 2PJ1A 4DYOA 3PEIA 2PJ7A 2IJZA 1ZLHA 1QMUA 1XFOA 2ZOFA 2GLJA 5LRKA 2IMOA 2V8DA 2POKA 2XEIA 4R6TA 4P45A 3JRUA 1NSAA 2HB6A 2EK9A 4ZY1A 5K8MA 1AYEA 5DS0A 4MHPA 4PXEA 1JQGA 1YW6A 3B2YA 4YWYA 4DJLA 5CBMA 4FBEA 3S9LA 1HDQA 4F8ZA 1Y0RA 4A94A 3D7FA 4OIWA 4OIDA 2ZEGA 4G1PA 2FVGA 2O53A 1ELMP 1HEEA 1UWYA 2CF4A 2PJ5A 4DUKA 2BOAA 3BHXA 4UEZA 2V77A 1LANA 4IK2A 5JH9A 8CPAA 5LRGA 3FJUA 1DTDA 1YSJA 4NGTA 4NGNA 1VHEA 2PE3A 3FVLA 4H2KA 1BPMA 4ZI6A 3NH5A 3VATA 4P4FA 4ONWA 2PJ2A 6CPAA 1OBRA 3H8EA 5HVGA 3D4UA 3RZAA 4R8FA 2PVVA 2PJ8A 2G9DA 4FUUA 4ZYQA 3FH4A 3T8WA 4ZX8A 1ELLP 5LYDA 1LCPA 2GREA 3CPXA 3PB6X
chains in the Genus database with same CATH superfamily
3TO6A 2Q04A 4Y49B 3ISXA 4K30A 2NYQA 2Q7BA 5HMNA 2PCUA 1B87A 4ZY0A 3PBBA 4KOYA 4KOWA 4KSIA 5IV0A 1RTQA 2ZEEA 1QSTA 4Z65A 5F09A 1XJOA 2Z3MA 3D7GA 4MI4A 2Z3NA 3DNSA 2CNMA 4R76A 2R7HA 1TF8A 2X7BA 4OADA 5F49A 3W6SA 3WC5A 3MRUA 2JBJA 1M4GA 2H5MA 3G8WA 5HVFA 3WR7A 3CZXA 4PPZA 2C6GA 3IFEA 3WABA 3PP9A 2B3VA 3BJ7A 4UF4A 4ORFA 1VKCA 2GU2A 3IWWA 4NFRA 4XPDC 1Z4EA 3EC4A 2AJ6A 4IHMA 4R3LA 4JXQA 3IJ3A 4HKFA 4NGRA 4OLLA 1ARMA 4CGMA 5K8NA 2AFWA 5F47A 4OKOA 1XBUA 1IICA 1QSMA 1ZG8A 3JUWA 1IIDA 1B6BA 3K9TA 2PJ4A 3T9YA 4EFDA 4MBUA 1M4IA 3C26A 1Q2DA 1YMEA 4P10A 4PXDA 5C88A 3TCVA 1VHSA 1FNOA 4MY0A 2I00A 3GY9A 4M3SA 2AFSA 3N5FA 4II9A 3PB8X 1S3ZA 4MMOA 3SI0A 3CDXA 3SXOA 4AVCA 1YR0A 1LFWA 1Y7EA 3ISZA 4CYPA 3DR8A 2JLMA 3CXSA 3D68A 2CTCA 1R57A 2EK8A 3NH4A 4GM5A 1CP7A 2PJCA 1LAPA 2Q51A 5I0CA 1YLEA 4WJBA 4CS0B 4OMEA 2FE7A 4A2ZA 3KZWA 2KCWA 1TKHA 3QAYA 3KHXA 1BOBA 2AFMA 5IB9A 3R1KA 4BBHA 1YVKA 3QB8A 5JGFA 3BXMA 1Z4RA 1Z9UA 1Q2YA 2Z3PA 1PUAA 3H5ZA 4FD7A 2WUUA 3FIXA 1WWZA 3ZZIA 4E0AA 1KWMA 4OC4A 2FSRA 1A2ZA 2VQYA 1YK3A 3IGRA 4EMEA 5J8FA 4LUAA 5A28A 3GKRA 4ZY2A 2WYRA 1Z8WA 2GIVA 3D67A 2Q44A 5KTCA 2VBQA 3CT9A 3R9FA 2B4BA 4UIAA 4XPDB 3B7IA 5H84A 1VGYA 4KVME 5LYIA 2D4PA 2B4DB 2GANA 4CGNA 4B6ZA 2PDOA 3MGDA 3FXTA 1I21A 1KZFA 1YLOA 3CXPA 3TOBA 4NGMA 3IEHA 3DLJA 4MHYA 3MN8A 4K3NA 4QB9A 5GCNA 4A31A 1IB1E 2WSAA 2F7VA 4OP4A 4XPKA 5ELYA 5LYFA 2HC9A 3IU2A 2OZGA 3D8PA 4X8IA 3FX6A 1PYTB 4B13A 5HXDA 4MCPA 3CXQA 2BEIA 1BO4A 3L2NA 2ZEFA 5A27A 4MHDA 2B5GB 2Z11A 4MCRA 4ZX9A 3H4QA 4C2ZA 3SXNA 4MRIA 2ATRA 2F8HA 4KOUA 3DR6A 2QYVA 2PR1A 1Z2LA 2IQ6A 4YRHA 5HH1A 3TO9A 1BPNA 3B35A 4EVYA 3B3VA 2WZNA 1IYKA 3LMSA 4P4IA 2OB0A 5HVHA 3T90A 2OR4A 3PFEA 4P4JA 4BINA 2ABZA 5AG4A 5EBVA 4UCNA 3TO7A 4NEXA 1AUGA 3FMCA 5H86A 3K9UA 2XEJA 2C6CA 2REEA 3W91A 2PJAA 4CRYB 2A4NA 3PBEA 1Q7LA 1BAVA 3WC6A 2C1CA 3NH8A 4CAEA 2J8MA 4YGOA 4RI1A 3R9GA 1Z8TA 2BUEA 1KUXA 4MFPA 4PK2A 1ZG9A 4NXYA 3VWEA 4GS4A 3PGPA 5BWAB 3TE4A 4B12A 2WPWA 2ZW5A 2CY2A 4KZTA 4UIBA 2OZUA 5JM6A 1AMPA 4A37A 3KHZA 4Q7AA 3RYOA 2B4DA 4C2XA 4M85A 3IO1A 4R57A 2IL4A 2J9AA 2GLFA 2PIZA 2RFHA 3G3SA 3PZJA 4NJRA 3FEDA 2FL4A 4IF5A 2R1IA 5D8NA 1Z5RA 4A32A 1XE4A 2DPSA 2C27A 4O23A 1NE9A 3LWUA 3PB4X 1XOVA 2ZEOA 2AFXA 3NFZA 4P4EA 3K2KA 4ZGYB 4B11A 2JBKA 4M6IA 4WWVA 5FVJA 3IC1A 4M6GA 2ZEPA 4MFJA 1QSRA 4C7IA 4MXUA 4YFJA 2B5GA 3NA6A 2YGWA 3N7ZA 1M4DA 4MHZA 4FWUA 2R98A 5AG6A 1CPSA 2O4HA 4LQGA 3FEEA 4UEFA 3QAHA 2V8GA 3E0KA 3S9MA 2FT0A 2JEWA 2C6PA 3NE7A 3QNVA 3OWCA 4UEEA 1YGHA 3S6GA 3FF3A 2JEVA 1MJ9A 3PB6X 4PQAA 4B5OA 2PJ6A 1R3NA 5IB0A 2P6GA 5AG7A 2EWBA 4A39A 1NMTA 2PJ3A 2NSMA 5CPAA 1M44A 4BD9A 4P6YA 4KOSA 4F9UA 1S5KA 1EE3P 4X3RA 1IGBA 3B3CA 2V8VA 3B3WA 4MCQA 2ANPA 2DF5A 4TNUA 1Y9WA 1RXTA 4FD5A 1YVOA 3WT4A 3ZJ0A 2PQ8A 1SQHA 2P6EA 3DSBA 4PXBA 4KORA 3BI0A 1PU9A 4Q36A 1S60A 1YX0A 4ZBGA 1ZLIA 4KSFA 2ZEDA 1GYTA 3TC8A 1S7KA 2ZEHA 2Y0MA 3FRMA 3VH9A 4MY3A 3LACA 4AVAA 4OC1A 4E2AA 4CAWA 2Q4ZA 4XNHC 2YNEA 3V38A 1XRYA 4CGOA 5LYLA 1QQ9A 3KASA 2PVWA 2CTBA 3I9SA 1VIXA 2AE6A 1FT7A 4IUSA 3WC7A 4KOTA 3SI2A 3SJFA 3D2MA 3H8FA 4HNYB 5THWA 1I12A 4P4DA 1LAMA 4JWPA 4CGPA 2BO9A 4AXVA 2Q4VA 3H8GA 3GLJA 4RS2A 1CP6A 5K8PA 2GFQA 2ODFA 1Z8LA 1VHOA 3B3TA 3FNCA 4FD4A 3LD2A 2P6FA 4JLYA 1CPXA 1TKJA 3I3GA 3GB0A 7CPAA 2AFUA 3F5BA 3D7HA 3FECA 1IY7A 1CG2A 4KSAA 4CAFA 4CYNA 3B3SA 3D66A 2DXQA 2PJ0A 1F2PA 1Z8XA 2F5IA 2YNCC 2PJBA 2BCOA 1Y0YA 2VXKA 1FY7A 2OZHA 4KS9A 2QJ8A 1F2OA 4L89A 3TOAA 4QUSA 1HDUA 2I3CA 4KLWA 1RO5A 3FBUA 4YU9A 4H6ZA 3NE8A 3TTHA 5K8OA 2PIYA 3RNZA 5JPHA 4R7MA 2AFZA 2GE3A 3SJEA 4XNHB 2PRQA 4UA3A 1UFHA 2QVPA 4EWTA 3TFYA 3BLNA 4F0YA 3PB7X 1TIQA 2Q7SA 2ARHA 4NCZA 4RN7A 3EO4A 3F0AA 3IWEA 1CBXA 4NJQA 3BI1A 2ZOGA 3GIUA 3P2FA 1I1DA 3BJ8A 4OC5A 3W6XA 3KQXA 5IX3A 4F9VA 3V8IA 1M4LA 2VZYA 4HPSA 1TF9A 1IU8A 1CX8A 2PJ9A 1IYLA 3RAMA 4UCMA 3SI1A 3S6KA 2VI7A 2K5TA 2Z10A 3I1UA 4I49A 1R43A 3LODA 4H6UA 4AB7A 4QBJA 2VL1A 4DNCA 2RB7A 1Y7RA 2I79A 2G0BA 1CM0A 1DE4C 1MJAA 5G20A 3PFOA 2ZEMA 1XMBA 1PCAA 1M1DA 3A9LA 3UY5A 4JD6A 5C82A 4JXRA 4HNWB 3KL9A 4PSWA 3IIBA 4MHNA 2PR8A 2PC1A 3DDDA 2R8VA 4W9YA 1XIXA 2XEGA 3HUVA 4P44A 4L8AA 2J8RA 5KTAA 3KR4A 4XPLA 5DWMA 2PRBA 2Q4YA 4IAVA 4PV6A 1ON0A 4TWEA 3KQZA 4UWIA 1F57A 4QC6A 2AFOA 2ZELA 3D2PA 5EC4A 1LRZA 2CNTA 3D7DA 3KI9A 3PB9X 3KKWA 1ARLA 4PSXA 5D29A 5E96A 4Q38A 4H89A 2EBJA 4CPAA 4KLVA 2Z0ZA 1S7NA 4OC2A 4B5PA 2B3UA 3SJXA 4FD6A 4NGPA 3R95A 2J8NA 3P2HA 5I4MA 3V7ZA 1XEBA 2FS5A 5J1QA 1ZG7A 3SJGA 3KR5A 4X2TA 3F8KA 3RBUA 4UFVA 3TX8A 4CYOA 4F0XA 5F46A 1YQEA 2RC4A 3DGVA 4P4BA 2DPTA 1S7FA 2BSWA 4MFLA 1YW4A 2XEFA 1X10A 2Q0YA 5EMIA 2CIJA 4OC3A 4OC0A 5G1ZA 1MJBA 2VZZA 2ZENA 4R87A 3B8GA 4JJXA 2REFA 2QIRA 1J4JA 3KGQA 3EFAA 4JYWA 4NGSA 3VARA 4E8OA 2OH1A 4KUBA 2DEAA 1LOKA 4JZ0A 3S6HA 1U6MA 2Q43A 2FXFA 2HQYA 4A38A 2Z3OA 2V8HA 4MCSA 4NGQA 2NMTA 3HLPA 4GXHA 4FAIA 2G3AA 4NF1A 2CXAA 4PXCA 1XF8A 2O28A 4UBRA 4B10A 1YREA 4RUHA 2WPXA 2ZW6A 2OOTA 5AG5A 1TXRA 3S9NA 3IU1A 2YNCA 3FYNA 3CPAA 4A30A 3GUXA 3PRTA 4ONUA 2CNSA 5G21A 4KVXA 1N71A 4QVTA 1L0CA 1BLLE 1H8LA 5LRJA 1TKFA 2PJ1A 4DYOA 4BMHA 5J8CA 3PEIA 1S7LA 2YNDA 5DWNA 2ZW4A 1OZPA 1IOFA 2PJ7A 2IJZA 2EUIA 1ZLHA 4OAEA 4U9YA 2D4OA 1QMUA 4A33A 1XFOA 2ZOFA 2GLJA 4KOVA 4UFWA 5F48A 3D3SA 5LRKA 1V0CA 2IMOA 1QSOA 2POKA 2V8DA 2XEIA 4R6TA 4P45A 4AG9A 5JQ4A 3S6FA 3JRUA 1NSAA 2HB6A 4J3GA 1KUVA 2EK9A 4X5KA 1P4NA 2EVNA 2JDDA 4ZY1A 3R96A 5K8MA 1AYEA 2G3TA 5DS0A 1JWQA 4MHPA 2B58A 4PXEA 4A95A 3RO0A 1JQGA 1YW6A 2ZW7A 3B2YA 4YWYA 4DJLA 5CBMA 2FIAA 3JTKA 4UWJA 2HV2A 4FBEA 5CNPA 3S9LA 1HDQA 4F8ZA 1IOIA 1KUYA 1Y0RA 2JDCA 2QMLA 4C7HA 4A94A 1QSNA 3D7FA 4AG7A 2PSWA 4OIWA 4OIDA 4Y49C 3R9EA 2ZEGA 4B5PB 4G1PA 1MK4A 2FVGA 2P0WA 2O53A 1ELMP 1HEEA 1UWYA 2CF4A 2PJ5A 2QECA 4DUKA 2BOAA 3BHXA 4PK3A 4UEZA 3FB3A 4UCPA 1WK4A 4CAVA 4C2YA 2V77A 4F6AA 4AVBA 1LANA 4IK2A 5ISVA 4LQ6A 5KTDA 1P0HA 4B14A 3SHPA 5JH9A 4R3KA 3EY5A 4MFQA 2ZXVA 2FCKA 4MFZA 1XMTA 4U5YA 8CPAA 5LRGA 2OU2A 3FJUA 1DTDA 4CRZB 1X12A 4R9MA 1YSJA 4NGTA 5AGEA 3IWGA 4NSQA 1VHEA 4NGNA 2PE3A 3FVLA 1ZO0A 4H2KA 1BPMA 2Z3KA 4U9ZA 3NH5A 4ZI6A 1Y9KA 3EXNA 1NSLA 4P4FA 3VATA 1K4JA 2EO8A 4ONWA 3GYAA 2PJ2A 3VWDA 4CYQA 6CPAA 1OBRA 2VEZA 3H8EA 5HVGA 3D4UA 3RZAA 2Z3LA 4R8FA 1CJWA 2PVVA 4KOXA 3TT2A 2PJ8A 4LX9A 2G9DA 4FUUA 2ZPAA 1GHEA 4KVOE 4CGLA 4ZYQA 4MJ8A 3FH4A 4MFKA 4M6HA 4HNXB 4CAXA 4UFXA 4KUAA 3T8WA 2HUZA 4C68A 4ZX8A 1ELLP 5G22A 5LYDA 1LCPA 3JVNA 2GREA 3CPXA 2BL1A 1Q2CA 2FIWA
chains in the Genus database with same CATH topology
3ISXA 2NYQA 2PCUA 4ZY0A 3PBBA 4KSIA 1RTQA 2ZEEA 4Z65A 5F09A 1XJOA 3D7GA 4R76A 1TF8A 3WC5A 3MRUA 2JBJA 5HVFA 4PPZA 2C6GA 3IFEA 3WABA 4UF4A 2GU2A 3IWWA 4NFRA 4IHMA 3IJ3A 4NGRA 1ARMA 5K8NA 2AFWA 4OKOA 1XBUA 1ZG8A 3K9TA 4EFDA 2PJ4A 1YMEA 4P10A 4PXDA 1FNOA 2AFSA 3N5FA 3PB8X 3SI0A 4MMOA 3CDXA 1LFWA 1Y7EA 3ISZA 3D68A 2CTCA 2EK8A 3NH4A 4GM5A 1CP7A 2PJCA 1LAPA 2Q51A 4WJBA 4OMEA 3KZWA 1TKHA 3KHXA 2AFMA 5IB9A 5JGFA 3BXMA 1KWMA 4OC4A 4EMEA 4ZY2A 2WYRA 3D67A 3CT9A 4UIAA 3B7IA 1VGYA 5LYIA 4B6ZA 1YLOA 4NGMA 3IEHA 3DLJA 4MHYA 3MN8A 4K3NA 2F7VA 4OP4A 5ELYA 5LYFA 2HC9A 4X8IA 3FX6A 1PYTB 5HXDA 4MCPA 3L2NA 2ZEFA 4MCRA 4ZX9A 4MRIA 2F8HA 2QYVA 1Z2LA 2IQ6A 1BPNA 3B35A 3B3VA 2WZNA 3LMSA 4P4IA 5HVHA 2OR4A 3PFEA 4P4JA 2ABZA 3FMCA 2XEJA 2C6CA 2PJAA 3PBEA 1Q7LA 1BAVA 3WC6A 2C1CA 3NH8A 1ZG9A 4UIBA 5JM6A 1AMPA 4A37A 3KHZA 4Q7AA 3IO1A 2J9AA 2GLFA 2PIZA 2RFHA 4NJRA 3FEDA 5D8NA 1Z5RA 4O23A 3LWUA 3PB4X 2ZEOA 2AFXA 3NFZA 4P4EA 3K2KA 2JBKA 4WWVA 3IC1A 2ZEPA 4MXUA 3NA6A 4MHZA 4FWUA 1CPSA 2O4HA 4LQGA 3FEEA 4UEFA 2V8GA 3S9MA 2JEWA 2C6PA 3QNVA 4UEEA 3FF3A 4PQAA 2PJ6A 1R3NA 2EWBA 4A39A 2PJ3A 2NSMA 5CPAA 4BD9A 4P6YA 4F9UA 1EE3P 4X3RA 1IGBA 3B3CA 2V8VA 3B3WA 4MCQA 2ANPA 4TNUA 3WT4A 4PXBA 3BI0A 1ZLIA 2ZEDA 1GYTA 3TC8A 2ZEHA 3VH9A 4OC1A 2Q4ZA 3V38A 1XRYA 5LYLA 1QQ9A 3KASA 2PVWA 2CTBA 1VIXA 1FT7A 3WC7A 3SI2A 3SJFA 3H8FA 5THWA 4P4DA 1LAMA 2BO9A 4AXVA 3H8GA 3GLJA 1CP6A 5K8PA 1Z8LA 1VHOA 3B3TA 1CPXA 1TKJA 3GB0A 7CPAA 2AFUA 3FECA 3D7HA 1IY7A 1CG2A 3B3SA 3D66A 2PJ0A 1F2PA 2PJBA 2BCOA 1Y0YA 2QJ8A 1F2OA 1HDUA 2I3CA 4YU9A 2PIYA 4R7MA 2AFZA 3SJEA 2PRQA 2QVPA 4EWTA 3PB7X 1CBXA 4NJQA 3BI1A 2ZOGA 4OC5A 3KQXA 4F9VA 1M4LA 1TF9A 1CX8A 2PJ9A 3RAMA 3SI1A 3I1UA 1R43A 2VL1A 2RB7A 1DE4C 3PFOA 2ZEMA 1XMBA 1PCAA 3KL9A 3IIBA 4MHNA 4W9YA 2XEGA 3HUVA 4P44A 3KR4A 4IAVA 4TWEA 3KQZA 1F57A 2AFOA 2ZELA 3PB9X 3D7DA 5D29A 3KI9A 1ARLA 4CPAA 4OC2A 3SJXA 4NGPA 5I4MA 3V7ZA 5J1QA 1ZG7A 3SJGA 3KR5A 4X2TA 3TX8A 3RBUA 3DGVA 4P4BA 1YW4A 2XEFA 2CIJA 4OC3A 4OC0A 2ZENA 3VARA 3KGQA 4JYWA 4NGSA 2DEAA 1LOKA 4JZ0A 2Q43A 4FAIA 4A38A 4NGQA 2V8HA 4MCSA 3HLPA 5K8OA 4PXCA 4RUHA 3S9NA 2OOTA 1TXRA 3CPAA 3GUXA 3PRTA 1BLLE 1H8LA 5LRJA 1TKFA 2PJ1A 4DYOA 3PEIA 2PJ7A 2IJZA 1ZLHA 1QMUA 1XFOA 2ZOFA 2GLJA 5LRKA 2IMOA 2V8DA 2POKA 2XEIA 4R6TA 4P45A 3JRUA 1NSAA 2HB6A 2EK9A 4ZY1A 5K8MA 1AYEA 5DS0A 4MHPA 4PXEA 1JQGA 1YW6A 3B2YA 4YWYA 4DJLA 5CBMA 4FBEA 3S9LA 1HDQA 4F8ZA 1Y0RA 4A94A 3D7FA 4OIWA 4OIDA 2ZEGA 4G1PA 2FVGA 2O53A 1ELMP 1HEEA 1UWYA 2CF4A 2PJ5A 4DUKA 2BOAA 3BHXA 4UEZA 2V77A 1LANA 4IK2A 5JH9A 8CPAA 5LRGA 3FJUA 1DTDA 1YSJA 4NGTA 4NGNA 1VHEA 2PE3A 3FVLA 4H2KA 1BPMA 4ZI6A 3NH5A 3VATA 4P4FA 4ONWA 2PJ2A 6CPAA 1OBRA 3H8EA 5HVGA 3D4UA 3RZAA 4R8FA 2PVVA 2PJ8A 2G9DA 4FUUA 4ZYQA 3FH4A 3T8WA 4ZX8A 1ELLP 5LYDA 1LCPA 2GREA 3CPXA 3PB6X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ISX A;  2NYQ A;  2PCU A;  4ZY0 A;  3PBB A;  4KSI A;  1RTQ A;  2ZEE A;  4Z65 A;  5F09 A;  1XJO A;  3D7G A;  4R76 A;  1TF8 A;  3WC5 A;  3MRU A;  2JBJ A;  5HVF A;  4PPZ A;  2C6G A;  3IFE A;  3WAB A;  4UF4 A;  2GU2 A;  3IWW A;  4NFR A;  4IHM A;  3IJ3 A;  4NGR A;  1ARM A;  5K8N A;  2AFW A;  4OKO A;  1XBU A;  1ZG8 A;  3K9T A;  4EFD A;  2PJ4 A;  1YME A;  4P10 A;  4PXD A;  1FNO A;  2AFS A;  3N5F A;  3PB8 X;  3SI0 A;  4MMO A;  3CDX A;  1LFW A;  1Y7E A;  3ISZ A;  3D68 A;  2CTC A;  2EK8 A;  3NH4 A;  4GM5 A;  1CP7 A;  2PJC A;  1LAP A;  2Q51 A;  4WJB A;  4OME A;  3KZW A;  1TKH A;  3KHX A;  2AFM A;  5IB9 A;  5JGF A;  3BXM A;  1KWM A;  4OC4 A;  4EME A;  4ZY2 A;  2WYR A;  3D67 A;  3CT9 A;  4UIA A;  3B7I A;  1VGY A;  5LYI A;  4B6Z A;  1YLO A;  4NGM A;  3IEH A;  3DLJ A;  4MHY A;  3MN8 A;  4K3N A;  2F7V A;  4OP4 A;  5ELY A;  5LYF A;  2HC9 A;  4X8I A;  3FX6 A;  1PYT B;  5HXD A;  4MCP A;  3L2N A;  2ZEF A;  4MCR A;  4ZX9 A;  4MRI A;  2F8H A;  2QYV A;  1Z2L A;  2IQ6 A;  1BPN A;  3B35 A;  3B3V A;  2WZN A;  3LMS A;  4P4I A;  5HVH A;  2OR4 A;  3PFE A;  4P4J A;  2ABZ A;  3FMC A;  2XEJ A;  2C6C A;  2PJA A;  3PBE A;  1Q7L A;  1BAV A;  3WC6 A;  2C1C A;  3NH8 A;  1ZG9 A;  4UIB A;  5JM6 A;  1AMP A;  4A37 A;  3KHZ A;  4Q7A A;  3IO1 A;  2J9A A;  2GLF A;  2PIZ A;  2RFH A;  4NJR A;  3FED A;  5D8N A;  1Z5R A;  4O23 A;  3LWU A;  3PB4 X;  2ZEO A;  2AFX A;  3NFZ A;  4P4E A;  3K2K A;  2JBK A;  4WWV A;  3IC1 A;  2ZEP A;  4MXU A;  3NA6 A;  4MHZ A;  4FWU A;  1CPS A;  2O4H A;  4LQG A;  3FEE A;  4UEF A;  2V8G A;  3S9M A;  2JEW A;  2C6P A;  3QNV A;  4UEE A;  3FF3 A;  4PQA A;  2PJ6 A;  1R3N A;  2EWB A;  4A39 A;  2PJ3 A;  2NSM A;  5CPA A;  4BD9 A;  4P6Y A;  4F9U A;  1EE3 P;  4X3R A;  1IGB A;  3B3C A;  2V8V A;  3B3W A;  4MCQ A;  2ANP A;  4TNU A;  3WT4 A;  4PXB A;  3BI0 A;  1ZLI A;  2ZED A;  1GYT A;  3TC8 A;  2ZEH A;  3VH9 A;  4OC1 A;  2Q4Z A;  3V38 A;  1XRY A;  5LYL A;  1QQ9 A;  3KAS A;  2PVW A;  2CTB A;  1VIX A;  1FT7 A;  3WC7 A;  3SI2 A;  3SJF A;  3H8F A;  5THW A;  4P4D A;  1LAM A;  2BO9 A;  4AXV A;  3H8G A;  3GLJ A;  1CP6 A;  5K8P A;  1Z8L A;  1VHO A;  3B3T A;  1CPX A;  1TKJ A;  3GB0 A;  7CPA A;  2AFU A;  3FEC A;  3D7H A;  1IY7 A;  1CG2 A;  3B3S A;  3D66 A;  2PJ0 A;  1F2P A;  2PJB A;  2BCO A;  1Y0Y A;  2QJ8 A;  1F2O A;  1HDU A;  2I3C A;  4YU9 A;  2PIY A;  4R7M A;  2AFZ A;  3SJE A;  2PRQ A;  2QVP A;  4EWT A;  3PB7 X;  1CBX A;  4NJQ A;  3BI1 A;  2ZOG A;  4OC5 A;  3KQX A;  4F9V A;  1M4L A;  1TF9 A;  1CX8 A;  2PJ9 A;  3RAM A;  3SI1 A;  3I1U A;  1R43 A;  2VL1 A;  2RB7 A;  1DE4 C;  3PFO A;  2ZEM A;  1XMB A;  1PCA A;  3KL9 A;  3IIB A;  4MHN A;  4W9Y A;  2XEG A;  3HUV A;  4P44 A;  3KR4 A;  4IAV A;  4TWE A;  3KQZ A;  1F57 A;  2AFO A;  2ZEL A;  3PB9 X;  3D7D A;  5D29 A;  3KI9 A;  1ARL A;  4CPA A;  4OC2 A;  3SJX A;  4NGP A;  5I4M A;  3V7Z A;  5J1Q A;  1ZG7 A;  3SJG A;  3KR5 A;  4X2T A;  3TX8 A;  3RBU A;  3DGV A;  4P4B A;  1YW4 A;  2XEF A;  2CIJ A;  4OC3 A;  4OC0 A;  2ZEN A;  3VAR A;  3KGQ A;  4JYW A;  4NGS A;  2DEA A;  1LOK A;  4JZ0 A;  2Q43 A;  4FAI A;  4A38 A;  4NGQ A;  2V8H A;  4MCS A;  3HLP A;  5K8O A;  4PXC A;  4RUH A;  3S9N A;  2OOT A;  1TXR A;  3CPA A;  3GUX A;  3PRT A;  1BLL E;  1H8L A;  5LRJ A;  1TKF A;  2PJ1 A;  4DYO A;  3PEI A;  2PJ7 A;  2IJZ A;  1ZLH A;  1QMU A;  1XFO A;  2ZOF A;  2GLJ A;  5LRK A;  2IMO A;  2V8D A;  2POK A;  2XEI A;  4R6T A;  4P45 A;  3JRU A;  1NSA A;  2HB6 A;  2EK9 A;  4ZY1 A;  5K8M A;  1AYE A;  5DS0 A;  4MHP A;  4PXE A;  1JQG A;  1YW6 A;  3B2Y A;  4YWY A;  4DJL A;  5CBM A;  4FBE A;  3S9L A;  1HDQ A;  4F8Z A;  1Y0R A;  4A94 A;  3D7F A;  4OIW A;  4OID A;  2ZEG A;  4G1P A;  2FVG A;  2O53 A;  1ELM P;  1HEE A;  1UWY A;  2CF4 A;  2PJ5 A;  4DUK A;  2BOA A;  3BHX A;  4UEZ A;  2V77 A;  1LAN A;  4IK2 A;  5JH9 A;  8CPA A;  5LRG A;  3FJU A;  1DTD A;  1YSJ A;  4NGT A;  4NGN A;  1VHE A;  2PE3 A;  3FVL A;  4H2K A;  1BPM A;  4ZI6 A;  3NH5 A;  3VAT A;  4P4F A;  4ONW A;  2PJ2 A;  6CPA A;  1OBR A;  3H8E A;  5HVG A;  3D4U A;  3RZA A;  4R8F A;  2PVV A;  2PJ8 A;  2G9D A;  4FUU A;  4ZYQ A;  3FH4 A;  3T8W A;  4ZX8 A;  1ELL P;  5LYD A;  1LCP A;  2GRE A;  3CPX A;  3PB6 X; 
#chains in the Genus database with same CATH topology
 3TO6 A;  2Q04 A;  4Y49 B;  3ISX A;  4K30 A;  2NYQ A;  2Q7B A;  5HMN A;  2PCU A;  1B87 A;  4ZY0 A;  3PBB A;  4KOY A;  4KOW A;  4KSI A;  5IV0 A;  1RTQ A;  2ZEE A;  1QST A;  4Z65 A;  5F09 A;  1XJO A;  2Z3M A;  3D7G A;  4MI4 A;  2Z3N A;  3DNS A;  2CNM A;  4R76 A;  2R7H A;  1TF8 A;  2X7B A;  4OAD A;  5F49 A;  3W6S A;  3WC5 A;  3MRU A;  2JBJ A;  1M4G A;  2H5M A;  3G8W A;  5HVF A;  3WR7 A;  3CZX A;  4PPZ A;  2C6G A;  3IFE A;  3WAB A;  3PP9 A;  2B3V A;  3BJ7 A;  4UF4 A;  4ORF A;  1VKC A;  2GU2 A;  3IWW A;  4NFR A;  4XPD C;  1Z4E A;  3EC4 A;  2AJ6 A;  4IHM A;  4R3L A;  4JXQ A;  3IJ3 A;  4HKF A;  4NGR A;  4OLL A;  1ARM A;  4CGM A;  5K8N A;  2AFW A;  5F47 A;  4OKO A;  1XBU A;  1IIC A;  1QSM A;  1ZG8 A;  3JUW A;  1IID A;  1B6B A;  3K9T A;  2PJ4 A;  3T9Y A;  4EFD A;  4MBU A;  1M4I A;  3C26 A;  1Q2D A;  1YME A;  4P10 A;  4PXD A;  5C88 A;  3TCV A;  1VHS A;  1FNO A;  4MY0 A;  2I00 A;  3GY9 A;  4M3S A;  2AFS A;  3N5F A;  4II9 A;  3PB8 X;  1S3Z A;  4MMO A;  3SI0 A;  3CDX A;  3SXO A;  4AVC A;  1YR0 A;  1LFW A;  1Y7E A;  3ISZ A;  4CYP A;  3DR8 A;  2JLM A;  3CXS A;  3D68 A;  2CTC A;  1R57 A;  2EK8 A;  3NH4 A;  4GM5 A;  1CP7 A;  2PJC A;  1LAP A;  2Q51 A;  5I0C A;  1YLE A;  4WJB A;  4CS0 B;  4OME A;  2FE7 A;  4A2Z A;  3KZW A;  2KCW A;  1TKH A;  3QAY A;  3KHX A;  1BOB A;  2AFM A;  5IB9 A;  3R1K A;  4BBH A;  1YVK A;  3QB8 A;  5JGF A;  3BXM A;  1Z4R A;  1Z9U A;  1Q2Y A;  2Z3P A;  1PUA A;  3H5Z A;  4FD7 A;  2WUU A;  3FIX A;  1WWZ A;  3ZZI A;  4E0A A;  1KWM A;  4OC4 A;  2FSR A;  1A2Z A;  2VQY A;  1YK3 A;  3IGR A;  4EME A;  5J8F A;  4LUA A;  5A28 A;  3GKR A;  4ZY2 A;  2WYR A;  1Z8W A;  2GIV A;  3D67 A;  2Q44 A;  5KTC A;  2VBQ A;  3CT9 A;  3R9F A;  2B4B A;  4UIA A;  4XPD B;  3B7I A;  5H84 A;  1VGY A;  4KVM E;  5LYI A;  2D4P A;  2B4D B;  2GAN A;  4CGN A;  4B6Z A;  2PDO A;  3MGD A;  3FXT A;  1I21 A;  1KZF A;  1YLO A;  3CXP A;  3TOB A;  4NGM A;  3IEH A;  3DLJ A;  4MHY A;  3MN8 A;  4K3N A;  4QB9 A;  5GCN A;  4A31 A;  1IB1 E;  2WSA A;  2F7V A;  4OP4 A;  4XPK A;  5ELY A;  5LYF A;  2HC9 A;  3IU2 A;  2OZG A;  3D8P A;  4X8I A;  3FX6 A;  1PYT B;  4B13 A;  5HXD A;  4MCP A;  3CXQ A;  2BEI A;  1BO4 A;  3L2N A;  2ZEF A;  5A27 A;  4MHD A;  2B5G B;  2Z11 A;  4MCR A;  4ZX9 A;  3H4Q A;  4C2Z A;  3SXN A;  4MRI A;  2ATR A;  2F8H A;  4KOU A;  3DR6 A;  2QYV A;  2PR1 A;  1Z2L A;  2IQ6 A;  4YRH A;  5HH1 A;  3TO9 A;  1BPN A;  3B35 A;  4EVY A;  3B3V A;  2WZN A;  1IYK A;  3LMS A;  4P4I A;  2OB0 A;  5HVH A;  3T90 A;  2OR4 A;  3PFE A;  4P4J A;  4BIN A;  2ABZ A;  5AG4 A;  5EBV A;  4UCN A;  3TO7 A;  4NEX A;  1AUG A;  3FMC A;  5H86 A;  3K9U A;  2XEJ A;  2C6C A;  2REE A;  3W91 A;  2PJA A;  4CRY B;  2A4N A;  3PBE A;  1Q7L A;  1BAV A;  3WC6 A;  2C1C A;  3NH8 A;  4CAE A;  2J8M A;  4YGO A;  4RI1 A;  3R9G A;  1Z8T A;  2BUE A;  1KUX A;  4MFP A;  4PK2 A;  1ZG9 A;  4NXY A;  3VWE A;  4GS4 A;  3PGP A;  5BWA B;  3TE4 A;  4B12 A;  2WPW A;  2ZW5 A;  2CY2 A;  4KZT A;  4UIB A;  2OZU A;  5JM6 A;  1AMP A;  4A37 A;  3KHZ A;  4Q7A A;  3RYO A;  2B4D A;  4C2X A;  4M85 A;  3IO1 A;  4R57 A;  2IL4 A;  2J9A A;  2GLF A;  2PIZ A;  2RFH A;  3G3S A;  3PZJ A;  4NJR A;  3FED A;  2FL4 A;  4IF5 A;  2R1I A;  5D8N A;  1Z5R A;  4A32 A;  1XE4 A;  2DPS A;  2C27 A;  4O23 A;  1NE9 A;  3LWU A;  3PB4 X;  1XOV A;  2ZEO A;  2AFX A;  3NFZ A;  4P4E A;  3K2K A;  4ZGY B;  4B11 A;  2JBK A;  4M6I A;  4WWV A;  5FVJ A;  3IC1 A;  4M6G A;  2ZEP A;  4MFJ A;  1QSR A;  4C7I A;  4MXU A;  4YFJ A;  2B5G A;  3NA6 A;  2YGW A;  3N7Z A;  1M4D A;  4MHZ A;  4FWU A;  2R98 A;  5AG6 A;  1CPS A;  2O4H A;  4LQG A;  3FEE A;  4UEF A;  3QAH A;  2V8G A;  3E0K A;  3S9M A;  2FT0 A;  2JEW A;  2C6P A;  3NE7 A;  3QNV A;  3OWC A;  4UEE A;  1YGH A;  3S6G A;  3FF3 A;  2JEV A;  1MJ9 A;  3PB6 X;  4PQA A;  4B5O A;  2PJ6 A;  1R3N A;  5IB0 A;  2P6G A;  5AG7 A;  2EWB A;  4A39 A;  1NMT A;  2PJ3 A;  2NSM A;  5CPA A;  1M44 A;  4BD9 A;  4P6Y A;  4KOS A;  4F9U A;  1S5K A;  1EE3 P;  4X3R A;  1IGB A;  3B3C A;  2V8V A;  3B3W A;  4MCQ A;  2ANP A;  2DF5 A;  4TNU A;  1Y9W A;  1RXT A;  4FD5 A;  1YVO A;  3WT4 A;  3ZJ0 A;  2PQ8 A;  1SQH A;  2P6E A;  3DSB A;  4PXB A;  4KOR A;  3BI0 A;  1PU9 A;  4Q36 A;  1S60 A;  1YX0 A;  4ZBG A;  1ZLI A;  4KSF A;  2ZED A;  1GYT A;  3TC8 A;  1S7K A;  2ZEH A;  2Y0M A;  3FRM A;  3VH9 A;  4MY3 A;  3LAC A;  4AVA A;  4OC1 A;  4E2A A;  4CAW A;  2Q4Z A;  4XNH C;  2YNE A;  3V38 A;  1XRY A;  4CGO A;  5LYL A;  1QQ9 A;  3KAS A;  2PVW A;  2CTB A;  3I9S A;  1VIX A;  2AE6 A;  1FT7 A;  4IUS A;  3WC7 A;  4KOT A;  3SI2 A;  3SJF A;  3D2M A;  3H8F A;  4HNY B;  5THW A;  1I12 A;  4P4D A;  1LAM A;  4JWP A;  4CGP A;  2BO9 A;  4AXV A;  2Q4V A;  3H8G A;  3GLJ A;  4RS2 A;  1CP6 A;  5K8P A;  2GFQ A;  2ODF A;  1Z8L A;  1VHO A;  3B3T A;  3FNC A;  4FD4 A;  3LD2 A;  2P6F A;  4JLY A;  1CPX A;  1TKJ A;  3I3G A;  3GB0 A;  7CPA A;  2AFU A;  3F5B A;  3D7H A;  3FEC A;  1IY7 A;  1CG2 A;  4KSA A;  4CAF A;  4CYN A;  3B3S A;  3D66 A;  2DXQ A;  2PJ0 A;  1F2P A;  1Z8X A;  2F5I A;  2YNC C;  2PJB A;  2BCO A;  1Y0Y A;  2VXK A;  1FY7 A;  2OZH A;  4KS9 A;  2QJ8 A;  1F2O A;  4L89 A;  3TOA A;  4QUS A;  1HDU A;  2I3C A;  4KLW A;  1RO5 A;  3FBU A;  4YU9 A;  4H6Z A;  3NE8 A;  3TTH A;  5K8O A;  2PIY A;  3RNZ A;  5JPH A;  4R7M A;  2AFZ A;  2GE3 A;  3SJE A;  4XNH B;  2PRQ A;  4UA3 A;  1UFH A;  2QVP A;  4EWT A;  3TFY A;  3BLN A;  4F0Y A;  3PB7 X;  1TIQ A;  2Q7S A;  2ARH A;  4NCZ A;  4RN7 A;  3EO4 A;  3F0A A;  3IWE A;  1CBX A;  4NJQ A;  3BI1 A;  2ZOG A;  3GIU A;  3P2F A;  1I1D A;  3BJ8 A;  4OC5 A;  3W6X A;  3KQX A;  5IX3 A;  4F9V A;  3V8I A;  1M4L A;  2VZY A;  4HPS A;  1TF9 A;  1IU8 A;  1CX8 A;  2PJ9 A;  1IYL A;  3RAM A;  4UCM A;  3SI1 A;  3S6K A;  2VI7 A;  2K5T A;  2Z10 A;  3I1U A;  4I49 A;  1R43 A;  3LOD A;  4H6U A;  4AB7 A;  4QBJ A;  2VL1 A;  4DNC A;  2RB7 A;  1Y7R A;  2I79 A;  2G0B A;  1CM0 A;  1DE4 C;  1MJA A;  5G20 A;  3PFO A;  2ZEM A;  1XMB A;  1PCA A;  1M1D A;  3A9L A;  3UY5 A;  4JD6 A;  5C82 A;  4JXR A;  4HNW B;  3KL9 A;  4PSW A;  3IIB A;  4MHN A;  2PR8 A;  2PC1 A;  3DDD A;  2R8V A;  4W9Y A;  1XIX A;  2XEG A;  3HUV A;  4P44 A;  4L8A A;  2J8R A;  5KTA A;  3KR4 A;  4XPL A;  5DWM A;  2PRB A;  2Q4Y A;  4IAV A;  4PV6 A;  1ON0 A;  4TWE A;  3KQZ A;  4UWI A;  1F57 A;  4QC6 A;  2AFO A;  2ZEL A;  3D2P A;  5EC4 A;  1LRZ A;  2CNT A;  3D7D A;  3KI9 A;  3PB9 X;  3KKW A;  1ARL A;  4PSX A;  5D29 A;  5E96 A;  4Q38 A;  4H89 A;  2EBJ A;  4CPA A;  4KLV A;  2Z0Z A;  1S7N A;  4OC2 A;  4B5P A;  2B3U A;  3SJX A;  4FD6 A;  4NGP A;  3R95 A;  2J8N A;  3P2H A;  5I4M A;  3V7Z A;  1XEB A;  2FS5 A;  5J1Q A;  1ZG7 A;  3SJG A;  3KR5 A;  4X2T A;  3F8K A;  3RBU A;  4UFV A;  3TX8 A;  4CYO A;  4F0X A;  5F46 A;  1YQE A;  2RC4 A;  3DGV A;  4P4B A;  2DPT A;  1S7F A;  2BSW A;  4MFL A;  1YW4 A;  2XEF A;  1X10 A;  2Q0Y A;  5EMI A;  2CIJ A;  4OC3 A;  4OC0 A;  5G1Z A;  1MJB A;  2VZZ A;  2ZEN A;  4R87 A;  3B8G A;  4JJX A;  2REF A;  2QIR A;  1J4J A;  3KGQ A;  3EFA A;  4JYW A;  4NGS A;  3VAR A;  4E8O A;  2OH1 A;  4KUB A;  2DEA A;  1LOK A;  4JZ0 A;  3S6H A;  1U6M A;  2Q43 A;  2FXF A;  2HQY A;  4A38 A;  2Z3O A;  2V8H A;  4MCS A;  4NGQ A;  2NMT A;  3HLP A;  4GXH A;  4FAI A;  2G3A A;  4NF1 A;  2CXA A;  4PXC A;  1XF8 A;  2O28 A;  4UBR A;  4B10 A;  1YRE A;  4RUH A;  2WPX A;  2ZW6 A;  2OOT A;  5AG5 A;  1TXR A;  3S9N A;  3IU1 A;  2YNC A;  3FYN A;  3CPA A;  4A30 A;  3GUX A;  3PRT A;  4ONU A;  2CNS A;  5G21 A;  4KVX A;  1N71 A;  4QVT A;  1L0C A;  1BLL E;  1H8L A;  5LRJ A;  1TKF A;  2PJ1 A;  4DYO A;  4BMH A;  5J8C A;  3PEI A;  1S7L A;  2YND A;  5DWN A;  2ZW4 A;  1OZP A;  1IOF A;  2PJ7 A;  2IJZ A;  2EUI A;  1ZLH A;  4OAE A;  4U9Y A;  2D4O A;  1QMU A;  4A33 A;  1XFO A;  2ZOF A;  2GLJ A;  4KOV A;  4UFW A;  5F48 A;  3D3S A;  5LRK A;  1V0C A;  2IMO A;  1QSO A;  2POK A;  2V8D A;  2XEI A;  4R6T A;  4P45 A;  4AG9 A;  5JQ4 A;  3S6F A;  3JRU A;  1NSA A;  2HB6 A;  4J3G A;  1KUV A;  2EK9 A;  4X5K A;  1P4N A;  2EVN A;  2JDD A;  4ZY1 A;  3R96 A;  5K8M A;  1AYE A;  2G3T A;  5DS0 A;  1JWQ A;  4MHP A;  2B58 A;  4PXE A;  4A95 A;  3RO0 A;  1JQG A;  1YW6 A;  2ZW7 A;  3B2Y A;  4YWY A;  4DJL A;  5CBM A;  2FIA A;  3JTK A;  4UWJ A;  2HV2 A;  4FBE A;  5CNP A;  3S9L A;  1HDQ A;  4F8Z A;  1IOI A;  1KUY A;  1Y0R A;  2JDC A;  2QML A;  4C7H A;  4A94 A;  1QSN A;  3D7F A;  4AG7 A;  2PSW A;  4OIW A;  4OID A;  4Y49 C;  3R9E A;  2ZEG A;  4B5P B;  4G1P A;  1MK4 A;  2FVG A;  2P0W A;  2O53 A;  1ELM P;  1HEE A;  1UWY A;  2CF4 A;  2PJ5 A;  2QEC A;  4DUK A;  2BOA A;  3BHX A;  4PK3 A;  4UEZ A;  3FB3 A;  4UCP A;  1WK4 A;  4CAV A;  4C2Y A;  2V77 A;  4F6A A;  4AVB A;  1LAN A;  4IK2 A;  5ISV A;  4LQ6 A;  5KTD A;  1P0H A;  4B14 A;  3SHP A;  5JH9 A;  4R3K A;  3EY5 A;  4MFQ A;  2ZXV A;  2FCK A;  4MFZ A;  1XMT A;  4U5Y A;  8CPA A;  5LRG A;  2OU2 A;  3FJU A;  1DTD A;  4CRZ B;  1X12 A;  4R9M A;  1YSJ A;  4NGT A;  5AGE A;  3IWG A;  4NSQ A;  1VHE A;  4NGN A;  2PE3 A;  3FVL A;  1ZO0 A;  4H2K A;  1BPM A;  2Z3K A;  4U9Z A;  3NH5 A;  4ZI6 A;  1Y9K A;  3EXN A;  1NSL A;  4P4F A;  3VAT A;  1K4J A;  2EO8 A;  4ONW A;  3GYA A;  2PJ2 A;  3VWD A;  4CYQ A;  6CPA A;  1OBR A;  2VEZ A;  3H8E A;  5HVG A;  3D4U A;  3RZA A;  2Z3L A;  4R8F A;  1CJW A;  2PVV A;  4KOX A;  3TT2 A;  2PJ8 A;  4LX9 A;  2G9D A;  4FUU A;  2ZPA A;  1GHE A;  4KVO E;  4CGL A;  4ZYQ A;  4MJ8 A;  3FH4 A;  4MFK A;  4M6H A;  4HNX B;  4CAX A;  4UFX A;  4KUA A;  3T8W A;  2HUZ A;  4C68 A;  4ZX8 A;  1ELL P;  5G22 A;  5LYD A;  1LCP A;  3JVN A;  2GRE A;  3CPX A;  2BL1 A;  1Q2C A;  2FIW A; 
#chains in the Genus database with same CATH homology
 3ISX A;  2NYQ A;  2PCU A;  4ZY0 A;  3PBB A;  4KSI A;  1RTQ A;  2ZEE A;  4Z65 A;  5F09 A;  1XJO A;  3D7G A;  4R76 A;  1TF8 A;  3WC5 A;  3MRU A;  2JBJ A;  5HVF A;  4PPZ A;  2C6G A;  3IFE A;  3WAB A;  4UF4 A;  2GU2 A;  3IWW A;  4NFR A;  4IHM A;  3IJ3 A;  4NGR A;  1ARM A;  5K8N A;  2AFW A;  4OKO A;  1XBU A;  1ZG8 A;  3K9T A;  4EFD A;  2PJ4 A;  1YME A;  4P10 A;  4PXD A;  1FNO A;  2AFS A;  3N5F A;  3PB8 X;  3SI0 A;  4MMO A;  3CDX A;  1LFW A;  1Y7E A;  3ISZ A;  3D68 A;  2CTC A;  2EK8 A;  3NH4 A;  4GM5 A;  1CP7 A;  2PJC A;  1LAP A;  2Q51 A;  4WJB A;  4OME A;  3KZW A;  1TKH A;  3KHX A;  2AFM A;  5IB9 A;  5JGF A;  3BXM A;  1KWM A;  4OC4 A;  4EME A;  4ZY2 A;  2WYR A;  3D67 A;  3CT9 A;  4UIA A;  3B7I A;  1VGY A;  5LYI A;  4B6Z A;  1YLO A;  4NGM A;  3IEH A;  3DLJ A;  4MHY A;  3MN8 A;  4K3N A;  2F7V A;  4OP4 A;  5ELY A;  5LYF A;  2HC9 A;  4X8I A;  3FX6 A;  1PYT B;  5HXD A;  4MCP A;  3L2N A;  2ZEF A;  4MCR A;  4ZX9 A;  4MRI A;  2F8H A;  2QYV A;  1Z2L A;  2IQ6 A;  1BPN A;  3B35 A;  3B3V A;  2WZN A;  3LMS A;  4P4I A;  5HVH A;  2OR4 A;  3PFE A;  4P4J A;  2ABZ A;  3FMC A;  2XEJ A;  2C6C A;  2PJA A;  3PBE A;  1Q7L A;  1BAV A;  3WC6 A;  2C1C A;  3NH8 A;  1ZG9 A;  4UIB A;  5JM6 A;  1AMP A;  4A37 A;  3KHZ A;  4Q7A A;  3IO1 A;  2J9A A;  2GLF A;  2PIZ A;  2RFH A;  4NJR A;  3FED A;  5D8N A;  1Z5R A;  4O23 A;  3LWU A;  3PB4 X;  2ZEO A;  2AFX A;  3NFZ A;  4P4E A;  3K2K A;  2JBK A;  4WWV A;  3IC1 A;  2ZEP A;  4MXU A;  3NA6 A;  4MHZ A;  4FWU A;  1CPS A;  2O4H A;  4LQG A;  3FEE A;  4UEF A;  2V8G A;  3S9M A;  2JEW A;  2C6P A;  3QNV A;  4UEE A;  3FF3 A;  4PQA A;  2PJ6 A;  1R3N A;  2EWB A;  4A39 A;  2PJ3 A;  2NSM A;  5CPA A;  4BD9 A;  4P6Y A;  4F9U A;  1EE3 P;  4X3R A;  1IGB A;  3B3C A;  2V8V A;  3B3W A;  4MCQ A;  2ANP A;  4TNU A;  3WT4 A;  4PXB A;  3BI0 A;  1ZLI A;  2ZED A;  1GYT A;  3TC8 A;  2ZEH A;  3VH9 A;  4OC1 A;  2Q4Z A;  3V38 A;  1XRY A;  5LYL A;  1QQ9 A;  3KAS A;  2PVW A;  2CTB A;  1VIX A;  1FT7 A;  3WC7 A;  3SI2 A;  3SJF A;  3H8F A;  5THW A;  4P4D A;  1LAM A;  2BO9 A;  4AXV A;  3H8G A;  3GLJ A;  1CP6 A;  5K8P A;  1Z8L A;  1VHO A;  3B3T A;  1CPX A;  1TKJ A;  3GB0 A;  7CPA A;  2AFU A;  3FEC A;  3D7H A;  1IY7 A;  1CG2 A;  3B3S A;  3D66 A;  2PJ0 A;  1F2P A;  2PJB A;  2BCO A;  1Y0Y A;  2QJ8 A;  1F2O A;  1HDU A;  2I3C A;  4YU9 A;  2PIY A;  4R7M A;  2AFZ A;  3SJE A;  2PRQ A;  2QVP A;  4EWT A;  3PB7 X;  1CBX A;  4NJQ A;  3BI1 A;  2ZOG A;  4OC5 A;  3KQX A;  4F9V A;  1M4L A;  1TF9 A;  1CX8 A;  2PJ9 A;  3RAM A;  3SI1 A;  3I1U A;  1R43 A;  2VL1 A;  2RB7 A;  1DE4 C;  3PFO A;  2ZEM A;  1XMB A;  1PCA A;  3KL9 A;  3IIB A;  4MHN A;  4W9Y A;  2XEG A;  3HUV A;  4P44 A;  3KR4 A;  4IAV A;  4TWE A;  3KQZ A;  1F57 A;  2AFO A;  2ZEL A;  3PB9 X;  3D7D A;  5D29 A;  3KI9 A;  1ARL A;  4CPA A;  4OC2 A;  3SJX A;  4NGP A;  5I4M A;  3V7Z A;  5J1Q A;  1ZG7 A;  3SJG A;  3KR5 A;  4X2T A;  3TX8 A;  3RBU A;  3DGV A;  4P4B A;  1YW4 A;  2XEF A;  2CIJ A;  4OC3 A;  4OC0 A;  2ZEN A;  3VAR A;  3KGQ A;  4JYW A;  4NGS A;  2DEA A;  1LOK A;  4JZ0 A;  2Q43 A;  4FAI A;  4A38 A;  4NGQ A;  2V8H A;  4MCS A;  3HLP A;  5K8O A;  4PXC A;  4RUH A;  3S9N A;  2OOT A;  1TXR A;  3CPA A;  3GUX A;  3PRT A;  1BLL E;  1H8L A;  5LRJ A;  1TKF A;  2PJ1 A;  4DYO A;  3PEI A;  2PJ7 A;  2IJZ A;  1ZLH A;  1QMU A;  1XFO A;  2ZOF A;  2GLJ A;  5LRK A;  2IMO A;  2V8D A;  2POK A;  2XEI A;  4R6T A;  4P45 A;  3JRU A;  1NSA A;  2HB6 A;  2EK9 A;  4ZY1 A;  5K8M A;  1AYE A;  5DS0 A;  4MHP A;  4PXE A;  1JQG A;  1YW6 A;  3B2Y A;  4YWY A;  4DJL A;  5CBM A;  4FBE A;  3S9L A;  1HDQ A;  4F8Z A;  1Y0R A;  4A94 A;  3D7F A;  4OIW A;  4OID A;  2ZEG A;  4G1P A;  2FVG A;  2O53 A;  1ELM P;  1HEE A;  1UWY A;  2CF4 A;  2PJ5 A;  4DUK A;  2BOA A;  3BHX A;  4UEZ A;  2V77 A;  1LAN A;  4IK2 A;  5JH9 A;  8CPA A;  5LRG A;  3FJU A;  1DTD A;  1YSJ A;  4NGT A;  4NGN A;  1VHE A;  2PE3 A;  3FVL A;  4H2K A;  1BPM A;  4ZI6 A;  3NH5 A;  3VAT A;  4P4F A;  4ONW A;  2PJ2 A;  6CPA A;  1OBR A;  3H8E A;  5HVG A;  3D4U A;  3RZA A;  4R8F A;  2PVV A;  2PJ8 A;  2G9D A;  4FUU A;  4ZYQ A;  3FH4 A;  3T8W A;  4ZX8 A;  1ELL P;  5LYD A;  1LCP A;  2GRE A;  3CPX A;  3PB6 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...