2ZEEA

Crystal structure of the human glutaminyl cyclase mutant s160g at 1.99 angstrom resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
329
structure length
323
Chain Sequence
b'ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDGAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2007-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2zeeA00
3KGQA 3VATA 3H8GA 3RZAA 3BI1A 2PJCA 4A39A 1ZG8A 2VL1A 2RFHA 2PJ9A 1F2PA 4MXUA 4NGRA 4WWVA 4OP4A 3B3WA 1DTDA 5ELYA 4OMEA 3H8FA 4UIBA 1CPSA 4OC2A 1Y0YA 1EE3P 2AFWA 2IJZA 1GYTA 2ZEMA 4Z65A 1ELLP 1BPMA 2PJBA 1LAMA 2I3CA 3H8EA 4FBEA 3GLJA 3CPAA 4EMEA 4P4FA 2PJ1A 3HUVA 3NFZA 4BD9A 3B3VA 1Z2LA 3DLJA 2HB6A 4OIDA 3D7FA 1CP6A 4IAVA 3JRUA 3FJUA 1HDQA 2AFMA 2PJAA 3D7DA 4R76A 4OC5A 4ZX9A 1H8LA 3PFEA 2QYVA 2V8DA 4JYWA 3V7ZA 2C6CA 3VH9A 1ZLIA 2QVPA 3PBEA 3IWWA 2ZEHA 1ZG7A 3CPXA 1IGBA 4LQGA 4NJRA 3PB6X 5JH9A 1YW6A 3KHZA 4UEFA 4UEEA 8CPAA 3KHXA 3BHXA 2CTBA 4P4DA 1TKHA 3K9TA 1TKFA 2RB7A 2GLFA 4OIWA 3TX8A 4MHZA 4JZ0A 1HDUA 2XEFA 1QQ9A 1YSJA 1BPNA 1ZG9A 4RUHA 2G9DA 2ZEGA 1CG2A 2F8HA 2PJ2A 4IHMA 2IQ6A 4ONWA 3WT4A 3FF3A 4P44A 2Q4ZA 3SJXA 3B3CA 3MRUA 3GB0A 5K8MA 4EFDA 1YMEA 3B35A 4ZY2A 4FUUA 4FWUA 2AFOA 1CBXA 2O4HA 3IC1A 2C6PA 4ZY1A 3B3TA 1ARMA 3TC8A 3KR5A 4X3RA 2JBJA 2HC9A 4DJLA 2GREA 4YWYA 3CDXA 2BO9A 4DYOA 4PQAA 2ZENA 4OC3A 1VHEA 3MN8A 2PJ4A 2Q51A 4P45A 3S9LA 4X2TA 5HVFA 3B3SA 1ARLA 1Y0RA 4MHPA 5DS0A 5J1QA 1ZLHA 5JM6A 3FEEA 1JQGA 2XEGA 4PPZA 2ZEOA 2WZNA 2XEIA 4UF4A 5F09A 4H2KA 3NA6A 2PIZA 2ZEFA 4P4IA 1ELMP 2ZEDA 5LRKA 2GU2A 5LYFA 5K8NA 3FEDA 1LOKA 2PJ3A 2AFUA 2ZELA 3IJ3A 1TXRA 1DE4C 4MHYA 4UEZA 1R43A 5LYDA 2F7VA 5HXDA 3WC6A 1LAPA 1Z5RA 2V8HA 3B2YA 4W9YA 1R3NA 2EK9A 4MCQA 1VIXA 1RTQA 2JEWA 4G1PA 2PIYA 2PVWA 4IK2A 4MCPA 3FVLA 4WJBA 4KSIA 3NH8A 2BOAA 3DGVA 4PXBA 1Q7LA 3WC7A 1CP7A 4Q7AA 3KASA 4NGNA 2AFXA 7CPAA 3SJGA 5LRJA 4EWTA 4PXCA 3SJEA 3FH4A 5IB9A 2PRQA 3S9NA 3S9MA 3RAMA 2ZOGA 3FECA 3PB9X 1CX8A 3V38A 5K8PA 3N5FA 3D67A 3SJFA 1LCPA 4UIAA 4CPAA 3IFEA 1TKJA 2AFSA 3PB7X 1FNOA 4AXVA 3B7IA 2ANPA 4MCSA 3NH5A 5LYIA 2POKA 4MHNA 3D68A 3LMSA 4YU9A 3K2KA 2CTCA 5D8NA 4F9UA 1CPXA 3I1UA 2BCOA 5HVHA 2JBKA 4ZY0A 4PXEA 4A38A 1YW4A 1Y7EA 4NGMA 3IEHA 2PVVA 3PB8X 4F9VA 2CF4A 2C6GA 3PRTA 5JGFA 2PJ5A 3D66A 4B6ZA 4P6YA 2ZEEA 4OC4A 4ZX8A 1YLOA 2Q43A 3D4UA 4MRIA 5LRGA 6CPAA 5D29A 1FT7A 3GUXA 4MMOA 2J9AA 2NYQA 1NSAA 1F2OA 4NGTA 1PYTB 4ZI6A 3QNVA 3KQZA 4R8FA 2IMOA 2PJ0A 3KI9A 1QMUA 1BAVA 2EWBA 2V8VA 1XMBA 1LANA 3HLPA 4A94A 3CT9A 4R6TA 2QJ8A 4NGSA 1TF9A 3L2NA 2PJ6A 1Z8LA 3WABA 3PEIA 2V77A 2ABZA 1AYEA 2ZOFA 3ISXA 1BLLE 3BXMA 2DEAA 2GLJA 3IIBA 2OOTA 4GM5A 1VHOA 3D7HA 3RBUA 2V8GA 1TF8A 5CBMA 3ISZA 4X8IA 2WYRA 4MCRA 3SI0A 4A37A 3BI0A 4FAIA 1VGYA 3VARA 4ZYQA 4P10A 3PBBA 3SI2A 1KWMA 1UWYA 2EK8A 1IY7A 1XBUA 2PE3A 2ZEPA 3SI1A 3IO1A 4NGPA 3WC5A 3KR4A 2FVGA 1HEEA 4P4BA 1XRYA 5LYLA 4PXDA 2AFZA 4NFRA 2NSMA 3PB4X 1OBRA 4OC0A 1AMPA 4O23A 5HVGA 4K3NA 1PCAA 2XEJA 3NH4A 4OKOA 5I4MA 1M4LA 3FMCA 3T8WA 3KL9A 3PFOA 5K8OA 4TWEA 3KQXA 1XFOA 2C1CA 3D7GA 5CPAA 2OR4A 3LWUA 2PJ7A 5THWA 1LFWA 4DUKA 2O53A 4OC1A 3FX6A 4TNUA 4R7MA 2PCUA 4NGQA 2CIJA 1XJOA 4P4JA 4F8ZA 2PJ8A 3KZWA 4P4EA 1F57A 4NJQA
chains in the Genus database with same CATH superfamily
4B5PB 3KGQA 2D4PA 4J3GA 4KVOE 2OH1A 2B3VA 3VATA 3H8GA 3RZAA 1S7LA 3BI1A 2BEIA 4CGMA 4L89A 5AG5A 2B4DA 2PJCA 3EY5A 4AG9A 3RO0A 2CNTA 2Z3LA 4A39A 1ZG8A 2VL1A 2RFHA 1SQHA 1F2PA 2PJ9A 3NE7A 1YR0A 4K30A 4ORFA 4C2XA 4MXUA 4NGRA 2PDOA 4WWVA 4OP4A 3B3WA 4NF1A 1DTDA 5ELYA 4OMEA 3H8FA 1M44A 4C7HA 1RXTA 4FD4A 1YGHA 4UIBA 5DWMA 1CPSA 4OC2A 4KZTA 1MJ9A 1Y0YA 2FCKA 1EE3P 2AFWA 2IJZA 1GYTA 2ZEMA 4Z65A 1ELLP 2G3AA 2VZYA 2IL4A 5I0CA 1BPMA 2CNSA 2PJBA 1LAMA 2I3CA 2JDCA 5KTAA 4AG7A 4MBUA 3H8EA 1XOVA 1WWZA 4FBEA 5BWAB 3GLJA 1S7NA 3W6XA 4CAVA 4JJXA 1IU8A 2Q7SA 2J8MA 2FT0A 3CPAA 4KVME 4EMEA 2EVNA 4P4FA 2GANA 2A4NA 2PJ1A 3HUVA 3NFZA 4BD9A 4XPDB 3B3VA 3I9SA 1Z2LA 3VWEA 3DLJA 2HB6A 4OIDA 4XNHC 3D7FA 1CP6A 1IOIA 1M1DA 4M6IA 4M6HA 1M4DA 3V8IA 4IAVA 5A28A 4B11A 4MJ8A 4A2ZA 1GHEA 3JRUA 3FJUA 1MK4A 1HDQA 2AFMA 2VXKA 2CXAA 4BMHA 5A27A 2PJAA 5J8FA 3D7DA 4HKFA 4R76A 1B6BA 4OC5A 4F6AA 3IWGA 1H8LA 3PFEA 1XE4A 4NSQA 4ZX9A 2QYVA 2V8DA 1S7KA 4JYWA 3V7ZA 3K9UA 4Y49C 2VEZA 2C6CA 3VH9A 1VKCA 1ZLIA 2QVPA 2EBJA 3CXSA 3PBEA 3IWWA 2D4OA 2ZEHA 3FRMA 3EXNA 1ON0A 1YQEA 1ZG7A 2ZW7A 3CPXA 1IGBA 4LQGA 1IIDA 1WK4A 3S6FA 4CYQA 1ZO0A 4NJRA 3DSBA 2OZHA 3PB6X 2Q7BA 2FS5A 5JH9A 1YW6A 3KHZA 3OWCA 2PSWA 4R3KA 4MFKA 4UEFA 2G3TA 4CGPA 4BBHA 2R7HA 4UEEA 8CPAA 3FIXA 4KVXA 3KHXA 2O28A 2VQYA 5AG6A 3BHXA 4CRYB 1XEBA 2CTBA 4CYOA 4P4DA 1BO4A 1TKHA 3K9TA 4LUAA 4GXHA 1TKFA 4MFLA 2RB7A 3I3GA 1KZFA 2GLFA 4OIWA 4AB7A 5G22A 4MHZA 3TX8A 4ZGYB 4JZ0A 1HDUA 3ZZIA 2XEFA 1QQ9A 1YSJA 1BPNA 1ZG9A 4UCMA 4F0XA 4UWIA 4RUHA 2G9DA 1R57A 2ZEGA 1CG2A 2F8HA 2PJ2A 1OZPA 4IHMA 2HUZA 2IQ6A 4ONWA 2DF5A 3WT4A 3FF3A 3NE8A 4P44A 2Q4ZA 3SJXA 3B3CA 4U5YA 3BJ8A 3MRUA 2I79A 4B5PA 3GB0A 2JEVA 5K8MA 4EFDA 1Q2YA 2NMTA 1YMEA 3B35A 4ZY2A 5JPHA 2ZW4A 3F5BA 3IWEA 4FUUA 2B58A 3WR7A 4FWUA 2AFOA 4PK3A 1CBXA 2O4HA 3IC1A 2C6PA 4M3SA 1MJAA 3R96A 4ZY1A 3B3TA 4U9ZA 4CRZB 4CYPA 4Q38A 1CJWA 2YGWA 1ARMA 3TC8A 3KR5A 3TT2A 3LACA 4X3RA 3SXOA 2JBJA 1A2ZA 4C2ZA 2HC9A 3D8PA 3SXNA 2P6GA 4DJLA 2GREA 4YWYA 4CYNA 3CDXA 2BO9A 2DXQA 4OADA 2G0BA 4B5OA 4DYOA 3R9FA 4PQAA 2ZENA 3FNCA 4OC3A 2OU2A 1VHEA 4UFVA 4H6ZA 2PR8A 3MN8A 2PJ4A 4NEXA 2Q51A 4KOVA 4P45A 3S9LA 3E0KA 1LRZA 3S6HA 4X2TA 4H89A 3VWDA 4RI1A 4MHDA 5HVFA 1NMTA 4UCPA 4B13A 3B3SA 1ARLA 1Y0RA 3R9GA 1I12A 4MHPA 2FE7A 1YVOA 4KUAA 5DS0A 1QSNA 2Z3KA 5J1QA 3MGDA 1ZLHA 2X7BA 2FIAA 5JM6A 2YNDA 3P2FA 4CAWA 3GIUA 4HNYB 4DNCA 2REFA 1QSMA 3FEEA 4CAXA 2HQYA 1JQGA 2XEGA 2AJ6A 4PPZA 2ZEOA 4R87A 2GFQA 5ISVA 3SHPA 1JWQA 1KUVA 3QAHA 2WZNA 3QB8A 2XEIA 4R3LA 4UF4A 3PGPA 3TOAA 1QSOA 4H2KA 3NA6A 5F09A 2PIZA 2ZEFA 5IV0A 4P4IA 1XF8A 2ATRA 3F8KA 1ELMP 2RC4A 2ZEDA 2ZW6A 4MFQA 2OZUA 5LRKA 2GU2A 4KOUA 1IYLA 5LYFA 5K8NA 3FEDA 4QUSA 1LOKA 2PJ3A 2AFUA 2J8NA 2ZELA 2JLMA 3IJ3A 3DR8A 1TXRA 1DE4C 2Q0YA 4M85A 4MHYA 4UEZA 3W91A 5EMIA 1R43A 4ONUA 2F7VA 2QMLA 5LYDA 5HXDA 3EC4A 3WC6A 1LAPA 1Z5RA 2V8HA 1P4NA 3PZJA 3B2YA 4B12A 4W9YA 1R3NA 2EK9A 3QAYA 4A95A 1KUYA 5FVJA 4MCQA 1VIXA 1IOFA 1RTQA 2JEWA 5JQ4A 5F48A 3B8GA 4G1PA 3IU2A 2PIYA 2P0WA 1MJBA 2PVWA 4IK2A 4RS2A 3TO7A 4CGOA 4AVAA 1IB1E 4MCPA 1RO5A 3FVLA 4WJBA 2WPWA 4KSIA 3NH8A 1NSLA 3LD2A 2BOAA 3FBUA 2WUUA 3DGVA 4PXBA 4PSXA 2I00A 2B5GB 5H86A 2CNMA 1AUGA 2R98A 1Q7LA 5EC4A 3WC7A 3RYOA 1CP7A 4Q7AA 3KASA 1N71A 4XNHB 4FD6A 4NGNA 2AFXA 7CPAA 1YVKA 1IYKA 3SJGA 5LRJA 2PQ8A 4NCZA 4E0AA 4JD6A 3FXTA 4EWTA 4QBJA 1M4IA 3JTKA 4PXCA 5F49A 3SJEA 3FH4A 5IB9A 4UFXA 2PRQA 1P0HA 4R9MA 4C2YA 3S9NA 5C88A 1KUXA 1XIXA 2P6FA 4HPSA 3S9MA 3DDDA 3RAMA 4HNXB 2F5IA 1Y9KA 2ZOGA 3FECA 4UA3A 1M4GA 3PB9X 4KSAA 4YRHA 5IX3A 1CX8A 2AE6A 2C27A 3V38A 4CS0B 5K8PA 1Z8TA 4YGOA 4JLYA 3N5FA 4JXQA 3D67A 3SJFA 1LCPA 4KLVA 1S5KA 4KS9A 4MFZA 4UIAA 3GY9A 4CPAA 3TO6A 3IFEA 1K4JA 1TKJA 3RNZA 3ZJ0A 2AFSA 1L0CA 1I1DA 3PB7X 5AG7A 5KTCA 2R8VA 1FNOA 4E8OA 4AXVA 2Z3NA 1IICA 3B7IA 4KOTA 3D2MA 4FD5A 2EO8A 1NE9A 1YX0A 3A9LA 2ANPA 2B3UA 2BL1A 3C26A 3NH5A 4MCSA 2Y0MA 5G20A 2H5MA 5LYIA 2POKA 4MHNA 4YFJA 3D68A 2PC1A 2YNCC 3K2KA 2CTCA 2EUIA 3LMSA 1CPXA 4YU9A 2ZW5A 5D8NA 3EO4A 4F9UA 2Z10A 3I1UA 1Y7RA 2BCOA 5HVHA 2VZZA 2JBKA 4ZY0A 4MFPA 4B14A 4PXEA 2WSAA 4UWJA 4A33A 3EFAA 5GCNA 4A38A 1YW4A 1Y7EA 2KCWA 4NGMA 3IEHA 1V0CA 2PVVA 3G3SA 4EVYA 1Z4EA 3PB8X 5J8CA 4F9VA 4CAEA 2CF4A 2C6GA 4AVCA 4L8AA 3PRTA 2J8RA 5JGFA 5KTDA 2PJ5A 2BUEA 2Q04A 3D66A 4P6YA 4B6ZA 5G1ZA 3TTHA 3DR6A 2ZEEA 3GYAA 2DPSA 3N7ZA 3R95A 4OC4A 3T9YA 1CM0A 3DNSA 4KUBA 4FAIA 2Z3MA 1YLOA 2Q43A 4ZX8A 3PP9A 3D4UA 4KOWA 4MRIA 4MY3A 5LRGA 4UFWA 4F0YA 6CPAA 3IGRA 2Z11A 5D29A 1FY7A 1FT7A 1PUAA 5H84A 3GUXA 4QB9A 3JVNA 4II9A 3D2PA 4MMOA 2J9AA 2NYQA 4HNWB 3FB3A 4RN7A 2K5TA 1TIQA 1NSAA 3CXQA 2QECA 1F2OA 2BSWA 4KOSA 2PR1A 4NGTA 1PYTB 4XPDC 2ZPAA 4ZI6A 1UFHA 1YLEA 4KORA 1Q2DA 1Z8WA 3QNVA 3KQZA 4R8FA 5IB0A 2IMOA 2PJ0A 3KI9A 3TFYA 1QMUA 1BAVA 2Z3PA 3FYNA 2B4BA 4XPKA 2EWBA 2V8VA 2B5GA 1XMBA 2B4DB 1LANA 5E96A 3HLPA 4A94A 3CT9A 5AGEA 1YK3A 3IU1A 4R6TA 1BOBA 2QJ8A 1QSRA 4NGSA 3S6KA 1Y9WA 4KSFA 5CNPA 2R1IA 1TF9A 3L2NA 5HH1A 5F47A 2DPTA 2PJ6A 1X10A 2VBQA 2YNEA 1Q2CA 1Z8LA 3WABA 1B87A 3UY5A 3PEIA 3LODA 2V77A 2ABZA 1AYEA 2ZOFA 1XMTA 3ISXA 1BLLE 2OB0A 4LX9A 4KLWA 4PSWA 3BXMA 3P2HA 3R1KA 3W6SA 2DEAA 1Z8XA 4AVBA 2GLJA 5DWNA 2QIRA 3IIBA 4Q36A 2OOTA 2ARHA 4GM5A 2GE3A 2P6EA 2Z0ZA 1VHOA 1YREA 3D7HA 2PRBA 5F46A 3RBUA 3JUWA 2REEA 2V8GA 5EBVA 1TF8A 4MI4A 3GKRA 5CBMA 2OZGA 3ISZA 2WYRA 1Z4RA 4MCRA 4R57A 3BI0A 4X8IA 3SI0A 4A37A 1VGYA 3VARA 4OAEA 2HV2A 4Y49B 3BLNA 4JWPA 4JXRA 3CXPA 4ZYQA 3TE4A 4P10A 3KKWA 2CY2A 3PBBA 4PV6A 3SI2A 1KWMA 1UWYA 2EK8A 4X5KA 1IY7A 4MFJA 3S6GA 1XBUA 2Q4VA 2PE3A 2ZEPA 3D3SA 4A31A 2Z3OA 3R9EA 3SI1A 4A32A 4KOXA 5C82A 4E2AA 4UBRA 3G8WA 3IO1A 4NGPA 3WC5A 3KR4A 2FVGA 3BJ7A 1S3ZA 1HEEA 2FXFA 4P4BA 1J4JA 2FIWA 2GIVA 1XRYA 2ODFA 4BINA 5LYLA 1Z9UA 4PXDA 1U6MA 2AFZA 4CGLA 4NFRA 2NSMA 3PB4X 5G21A 1OBRA 1QSTA 4OC0A 1X12A 3TO9A 2Q4YA 4QC6A 1AMPA 1PU9A 4O23A 5HVGA 4K3NA 4OLLA 4U9YA 1PCAA 2XEJA 3NH4A 4LQ6A 4OKOA 5I4MA 4C68A 4IUSA 1M4LA 2VI7A 3FMCA 3T8WA 3KL9A 2FSRA 3PFOA 4TWEA 4IF5A 5K8OA 2ZXVA 3KQXA 1I21A 1XFOA 2C1CA 3D7GA 5CPAA 2OR4A 2YNCA 3TCVA 3TOBA 4FD7A 3LWUA 2PJ7A 5THWA 4A30A 1LFWA 1S60A 2O53A 4DUKA 3H5ZA 5HMNA 4CGNA 4H6UA 4PK2A 2JDDA 2Q44A 4B10A 4OC1A 4UCNA 3FX6A 4NXYA 4TNUA 4R7MA 2PCUA 2FL4A 4I49A 4NGQA 5AG4A 2CIJA 4QVTA 1XJOA 3H4QA 4P4JA 4ZBGA 4XPLA 1VHSA 4CAFA 2WPXA 4KOYA 4F8ZA 3CZXA 2PJ8A 3T90A 4C7IA 4M6GA 3KZWA 4P4EA 1F57A 1S7FA 4NJQA 3F0AA 4MY0A 4GS4A
chains in the Genus database with same CATH topology
3KGQA 3VATA 3H8GA 3RZAA 3BI1A 2PJCA 4A39A 1ZG8A 2VL1A 2RFHA 2PJ9A 1F2PA 4MXUA 4NGRA 4WWVA 4OP4A 3B3WA 1DTDA 5ELYA 4OMEA 3H8FA 4UIBA 1CPSA 4OC2A 1Y0YA 1EE3P 2AFWA 2IJZA 1GYTA 2ZEMA 4Z65A 1ELLP 1BPMA 2PJBA 1LAMA 2I3CA 3H8EA 4FBEA 3GLJA 3CPAA 4EMEA 4P4FA 2PJ1A 3HUVA 3NFZA 4BD9A 3B3VA 1Z2LA 3DLJA 2HB6A 4OIDA 3D7FA 1CP6A 4IAVA 3JRUA 3FJUA 1HDQA 2AFMA 2PJAA 3D7DA 4R76A 4OC5A 4ZX9A 1H8LA 3PFEA 2QYVA 2V8DA 4JYWA 3V7ZA 2C6CA 3VH9A 1ZLIA 2QVPA 3PBEA 3IWWA 2ZEHA 1ZG7A 3CPXA 1IGBA 4LQGA 4NJRA 3PB6X 5JH9A 1YW6A 3KHZA 4UEFA 4UEEA 8CPAA 3KHXA 3BHXA 2CTBA 4P4DA 1TKHA 3K9TA 1TKFA 2RB7A 2GLFA 4OIWA 3TX8A 4MHZA 4JZ0A 1HDUA 2XEFA 1QQ9A 1YSJA 1BPNA 1ZG9A 4RUHA 2G9DA 2ZEGA 1CG2A 2F8HA 2PJ2A 4IHMA 2IQ6A 4ONWA 3WT4A 3FF3A 4P44A 2Q4ZA 3SJXA 3B3CA 3MRUA 3GB0A 5K8MA 4EFDA 1YMEA 3B35A 4ZY2A 4FUUA 4FWUA 2AFOA 1CBXA 2O4HA 3IC1A 2C6PA 4ZY1A 3B3TA 1ARMA 3TC8A 3KR5A 4X3RA 2JBJA 2HC9A 4DJLA 2GREA 4YWYA 3CDXA 2BO9A 4DYOA 4PQAA 2ZENA 4OC3A 1VHEA 3MN8A 2PJ4A 2Q51A 4P45A 3S9LA 4X2TA 5HVFA 3B3SA 1ARLA 1Y0RA 4MHPA 5DS0A 5J1QA 1ZLHA 5JM6A 3FEEA 1JQGA 2XEGA 4PPZA 2ZEOA 2WZNA 2XEIA 4UF4A 5F09A 4H2KA 3NA6A 2PIZA 2ZEFA 4P4IA 1ELMP 2ZEDA 5LRKA 2GU2A 5LYFA 5K8NA 3FEDA 1LOKA 2PJ3A 2AFUA 2ZELA 3IJ3A 1TXRA 1DE4C 4MHYA 4UEZA 1R43A 5LYDA 2F7VA 5HXDA 3WC6A 1LAPA 1Z5RA 2V8HA 3B2YA 4W9YA 1R3NA 2EK9A 4MCQA 1VIXA 1RTQA 2JEWA 4G1PA 2PIYA 2PVWA 4IK2A 4MCPA 3FVLA 4WJBA 4KSIA 3NH8A 2BOAA 3DGVA 4PXBA 1Q7LA 3WC7A 1CP7A 4Q7AA 3KASA 4NGNA 2AFXA 7CPAA 3SJGA 5LRJA 4EWTA 4PXCA 3SJEA 3FH4A 5IB9A 2PRQA 3S9NA 3S9MA 3RAMA 2ZOGA 3FECA 3PB9X 1CX8A 3V38A 5K8PA 3N5FA 3D67A 3SJFA 1LCPA 4UIAA 4CPAA 3IFEA 1TKJA 2AFSA 3PB7X 1FNOA 4AXVA 3B7IA 2ANPA 4MCSA 3NH5A 5LYIA 2POKA 4MHNA 3D68A 3LMSA 4YU9A 3K2KA 2CTCA 5D8NA 4F9UA 1CPXA 3I1UA 2BCOA 5HVHA 2JBKA 4ZY0A 4PXEA 4A38A 1YW4A 1Y7EA 4NGMA 3IEHA 2PVVA 3PB8X 4F9VA 2CF4A 2C6GA 3PRTA 5JGFA 2PJ5A 3D66A 4B6ZA 4P6YA 2ZEEA 4OC4A 4ZX8A 1YLOA 2Q43A 3D4UA 4MRIA 5LRGA 6CPAA 5D29A 1FT7A 3GUXA 4MMOA 2J9AA 2NYQA 1NSAA 1F2OA 4NGTA 1PYTB 4ZI6A 3QNVA 3KQZA 4R8FA 2IMOA 2PJ0A 3KI9A 1QMUA 1BAVA 2EWBA 2V8VA 1XMBA 1LANA 3HLPA 4A94A 3CT9A 4R6TA 2QJ8A 4NGSA 1TF9A 3L2NA 2PJ6A 1Z8LA 3WABA 3PEIA 2V77A 2ABZA 1AYEA 2ZOFA 3ISXA 1BLLE 3BXMA 2DEAA 2GLJA 3IIBA 2OOTA 4GM5A 1VHOA 3D7HA 3RBUA 2V8GA 1TF8A 5CBMA 3ISZA 4X8IA 2WYRA 4MCRA 3SI0A 4A37A 3BI0A 4FAIA 1VGYA 3VARA 4ZYQA 4P10A 3PBBA 3SI2A 1KWMA 1UWYA 2EK8A 1IY7A 1XBUA 2PE3A 2ZEPA 3SI1A 3IO1A 4NGPA 3WC5A 3KR4A 2FVGA 1HEEA 4P4BA 1XRYA 5LYLA 4PXDA 2AFZA 4NFRA 2NSMA 3PB4X 1OBRA 4OC0A 1AMPA 4O23A 5HVGA 4K3NA 1PCAA 2XEJA 3NH4A 4OKOA 5I4MA 1M4LA 3FMCA 3T8WA 3KL9A 3PFOA 5K8OA 4TWEA 3KQXA 1XFOA 2C1CA 3D7GA 5CPAA 2OR4A 3LWUA 2PJ7A 5THWA 1LFWA 4DUKA 2O53A 4OC1A 3FX6A 4TNUA 4R7MA 2PCUA 4NGQA 2CIJA 1XJOA 4P4JA 4F8ZA 2PJ8A 3KZWA 4P4EA 1F57A 4NJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KGQ A;  3VAT A;  3H8G A;  3RZA A;  3BI1 A;  2PJC A;  4A39 A;  1ZG8 A;  2VL1 A;  2RFH A;  2PJ9 A;  1F2P A;  4MXU A;  4NGR A;  4WWV A;  4OP4 A;  3B3W A;  1DTD A;  5ELY A;  4OME A;  3H8F A;  4UIB A;  1CPS A;  4OC2 A;  1Y0Y A;  1EE3 P;  2AFW A;  2IJZ A;  1GYT A;  2ZEM A;  4Z65 A;  1ELL P;  1BPM A;  2PJB A;  1LAM A;  2I3C A;  3H8E A;  4FBE A;  3GLJ A;  3CPA A;  4EME A;  4P4F A;  2PJ1 A;  3HUV A;  3NFZ A;  4BD9 A;  3B3V A;  1Z2L A;  3DLJ A;  2HB6 A;  4OID A;  3D7F A;  1CP6 A;  4IAV A;  3JRU A;  3FJU A;  1HDQ A;  2AFM A;  2PJA A;  3D7D A;  4R76 A;  4OC5 A;  4ZX9 A;  1H8L A;  3PFE A;  2QYV A;  2V8D A;  4JYW A;  3V7Z A;  2C6C A;  3VH9 A;  1ZLI A;  2QVP A;  3PBE A;  3IWW A;  2ZEH A;  1ZG7 A;  3CPX A;  1IGB A;  4LQG A;  4NJR A;  3PB6 X;  5JH9 A;  1YW6 A;  3KHZ A;  4UEF A;  4UEE A;  8CPA A;  3KHX A;  3BHX A;  2CTB A;  4P4D A;  1TKH A;  3K9T A;  1TKF A;  2RB7 A;  2GLF A;  4OIW A;  3TX8 A;  4MHZ A;  4JZ0 A;  1HDU A;  2XEF A;  1QQ9 A;  1YSJ A;  1BPN A;  1ZG9 A;  4RUH A;  2G9D A;  2ZEG A;  1CG2 A;  2F8H A;  2PJ2 A;  4IHM A;  2IQ6 A;  4ONW A;  3WT4 A;  3FF3 A;  4P44 A;  2Q4Z A;  3SJX A;  3B3C A;  3MRU A;  3GB0 A;  5K8M A;  4EFD A;  1YME A;  3B35 A;  4ZY2 A;  4FUU A;  4FWU A;  2AFO A;  1CBX A;  2O4H A;  3IC1 A;  2C6P A;  4ZY1 A;  3B3T A;  1ARM A;  3TC8 A;  3KR5 A;  4X3R A;  2JBJ A;  2HC9 A;  4DJL A;  2GRE A;  4YWY A;  3CDX A;  2BO9 A;  4DYO A;  4PQA A;  2ZEN A;  4OC3 A;  1VHE A;  3MN8 A;  2PJ4 A;  2Q51 A;  4P45 A;  3S9L A;  4X2T A;  5HVF A;  3B3S A;  1ARL A;  1Y0R A;  4MHP A;  5DS0 A;  5J1Q A;  1ZLH A;  5JM6 A;  3FEE A;  1JQG A;  2XEG A;  4PPZ A;  2ZEO A;  2WZN A;  2XEI A;  4UF4 A;  5F09 A;  4H2K A;  3NA6 A;  2PIZ A;  2ZEF A;  4P4I A;  1ELM P;  2ZED A;  5LRK A;  2GU2 A;  5LYF A;  5K8N A;  3FED A;  1LOK A;  2PJ3 A;  2AFU A;  2ZEL A;  3IJ3 A;  1TXR A;  1DE4 C;  4MHY A;  4UEZ A;  1R43 A;  5LYD A;  2F7V A;  5HXD A;  3WC6 A;  1LAP A;  1Z5R A;  2V8H A;  3B2Y A;  4W9Y A;  1R3N A;  2EK9 A;  4MCQ A;  1VIX A;  1RTQ A;  2JEW A;  4G1P A;  2PIY A;  2PVW A;  4IK2 A;  4MCP A;  3FVL A;  4WJB A;  4KSI A;  3NH8 A;  2BOA A;  3DGV A;  4PXB A;  1Q7L A;  3WC7 A;  1CP7 A;  4Q7A A;  3KAS A;  4NGN A;  2AFX A;  7CPA A;  3SJG A;  5LRJ A;  4EWT A;  4PXC A;  3SJE A;  3FH4 A;  5IB9 A;  2PRQ A;  3S9N A;  3S9M A;  3RAM A;  2ZOG A;  3FEC A;  3PB9 X;  1CX8 A;  3V38 A;  5K8P A;  3N5F A;  3D67 A;  3SJF A;  1LCP A;  4UIA A;  4CPA A;  3IFE A;  1TKJ A;  2AFS A;  3PB7 X;  1FNO A;  4AXV A;  3B7I A;  2ANP A;  4MCS A;  3NH5 A;  5LYI A;  2POK A;  4MHN A;  3D68 A;  3LMS A;  4YU9 A;  3K2K A;  2CTC A;  5D8N A;  4F9U A;  1CPX A;  3I1U A;  2BCO A;  5HVH A;  2JBK A;  4ZY0 A;  4PXE A;  4A38 A;  1YW4 A;  1Y7E A;  4NGM A;  3IEH A;  2PVV A;  3PB8 X;  4F9V A;  2CF4 A;  2C6G A;  3PRT A;  5JGF A;  2PJ5 A;  3D66 A;  4B6Z A;  4P6Y A;  2ZEE A;  4OC4 A;  4ZX8 A;  1YLO A;  2Q43 A;  3D4U A;  4MRI A;  5LRG A;  6CPA A;  5D29 A;  1FT7 A;  3GUX A;  4MMO A;  2J9A A;  2NYQ A;  1NSA A;  1F2O A;  4NGT A;  1PYT B;  4ZI6 A;  3QNV A;  3KQZ A;  4R8F A;  2IMO A;  2PJ0 A;  3KI9 A;  1QMU A;  1BAV A;  2EWB A;  2V8V A;  1XMB A;  1LAN A;  3HLP A;  4A94 A;  3CT9 A;  4R6T A;  2QJ8 A;  4NGS A;  1TF9 A;  3L2N A;  2PJ6 A;  1Z8L A;  3WAB A;  3PEI A;  2V77 A;  2ABZ A;  1AYE A;  2ZOF A;  3ISX A;  1BLL E;  3BXM A;  2DEA A;  2GLJ A;  3IIB A;  2OOT A;  4GM5 A;  1VHO A;  3D7H A;  3RBU A;  2V8G A;  1TF8 A;  5CBM A;  3ISZ A;  4X8I A;  2WYR A;  4MCR A;  3SI0 A;  4A37 A;  3BI0 A;  4FAI A;  1VGY A;  3VAR A;  4ZYQ A;  4P10 A;  3PBB A;  3SI2 A;  1KWM A;  1UWY A;  2EK8 A;  1IY7 A;  1XBU A;  2PE3 A;  2ZEP A;  3SI1 A;  3IO1 A;  4NGP A;  3WC5 A;  3KR4 A;  2FVG A;  1HEE A;  4P4B A;  1XRY A;  5LYL A;  4PXD A;  2AFZ A;  4NFR A;  2NSM A;  3PB4 X;  1OBR A;  4OC0 A;  1AMP A;  4O23 A;  5HVG A;  4K3N A;  1PCA A;  2XEJ A;  3NH4 A;  4OKO A;  5I4M A;  1M4L A;  3FMC A;  3T8W A;  3KL9 A;  3PFO A;  5K8O A;  4TWE A;  3KQX A;  1XFO A;  2C1C A;  3D7G A;  5CPA A;  2OR4 A;  3LWU A;  2PJ7 A;  5THW A;  1LFW A;  4DUK A;  2O53 A;  4OC1 A;  3FX6 A;  4TNU A;  4R7M A;  2PCU A;  4NGQ A;  2CIJ A;  1XJO A;  4P4J A;  4F8Z A;  2PJ8 A;  3KZW A;  4P4E A;  1F57 A;  4NJQ A; 
#chains in the Genus database with same CATH topology
 4B5P B;  3KGQ A;  2D4P A;  4J3G A;  4KVO E;  2OH1 A;  2B3V A;  3VAT A;  3H8G A;  3RZA A;  1S7L A;  3BI1 A;  2BEI A;  4CGM A;  4L89 A;  5AG5 A;  2B4D A;  2PJC A;  3EY5 A;  4AG9 A;  3RO0 A;  2CNT A;  2Z3L A;  4A39 A;  1ZG8 A;  2VL1 A;  2RFH A;  1SQH A;  1F2P A;  2PJ9 A;  3NE7 A;  1YR0 A;  4K30 A;  4ORF A;  4C2X A;  4MXU A;  4NGR A;  2PDO A;  4WWV A;  4OP4 A;  3B3W A;  4NF1 A;  1DTD A;  5ELY A;  4OME A;  3H8F A;  1M44 A;  4C7H A;  1RXT A;  4FD4 A;  1YGH A;  4UIB A;  5DWM A;  1CPS A;  4OC2 A;  4KZT A;  1MJ9 A;  1Y0Y A;  2FCK A;  1EE3 P;  2AFW A;  2IJZ A;  1GYT A;  2ZEM A;  4Z65 A;  1ELL P;  2G3A A;  2VZY A;  2IL4 A;  5I0C A;  1BPM A;  2CNS A;  2PJB A;  1LAM A;  2I3C A;  2JDC A;  5KTA A;  4AG7 A;  4MBU A;  3H8E A;  1XOV A;  1WWZ A;  4FBE A;  5BWA B;  3GLJ A;  1S7N A;  3W6X A;  4CAV A;  4JJX A;  1IU8 A;  2Q7S A;  2J8M A;  2FT0 A;  3CPA A;  4KVM E;  4EME A;  2EVN A;  4P4F A;  2GAN A;  2A4N A;  2PJ1 A;  3HUV A;  3NFZ A;  4BD9 A;  4XPD B;  3B3V A;  3I9S A;  1Z2L A;  3VWE A;  3DLJ A;  2HB6 A;  4OID A;  4XNH C;  3D7F A;  1CP6 A;  1IOI A;  1M1D A;  4M6I A;  4M6H A;  1M4D A;  3V8I A;  4IAV A;  5A28 A;  4B11 A;  4MJ8 A;  4A2Z A;  1GHE A;  3JRU A;  3FJU A;  1MK4 A;  1HDQ A;  2AFM A;  2VXK A;  2CXA A;  4BMH A;  5A27 A;  2PJA A;  5J8F A;  3D7D A;  4HKF A;  4R76 A;  1B6B A;  4OC5 A;  4F6A A;  3IWG A;  1H8L A;  3PFE A;  1XE4 A;  4NSQ A;  4ZX9 A;  2QYV A;  2V8D A;  1S7K A;  4JYW A;  3V7Z A;  3K9U A;  4Y49 C;  2VEZ A;  2C6C A;  3VH9 A;  1VKC A;  1ZLI A;  2QVP A;  2EBJ A;  3CXS A;  3PBE A;  3IWW A;  2D4O A;  2ZEH A;  3FRM A;  3EXN A;  1ON0 A;  1YQE A;  1ZG7 A;  2ZW7 A;  3CPX A;  1IGB A;  4LQG A;  1IID A;  1WK4 A;  3S6F A;  4CYQ A;  1ZO0 A;  4NJR A;  3DSB A;  2OZH A;  3PB6 X;  2Q7B A;  2FS5 A;  5JH9 A;  1YW6 A;  3KHZ A;  3OWC A;  2PSW A;  4R3K A;  4MFK A;  4UEF A;  2G3T A;  4CGP A;  4BBH A;  2R7H A;  4UEE A;  8CPA A;  3FIX A;  4KVX A;  3KHX A;  2O28 A;  2VQY A;  5AG6 A;  3BHX A;  4CRY B;  1XEB A;  2CTB A;  4CYO A;  4P4D A;  1BO4 A;  1TKH A;  3K9T A;  4LUA A;  4GXH A;  1TKF A;  4MFL A;  2RB7 A;  3I3G A;  1KZF A;  2GLF A;  4OIW A;  4AB7 A;  5G22 A;  4MHZ A;  3TX8 A;  4ZGY B;  4JZ0 A;  1HDU A;  3ZZI A;  2XEF A;  1QQ9 A;  1YSJ A;  1BPN A;  1ZG9 A;  4UCM A;  4F0X A;  4UWI A;  4RUH A;  2G9D A;  1R57 A;  2ZEG A;  1CG2 A;  2F8H A;  2PJ2 A;  1OZP A;  4IHM A;  2HUZ A;  2IQ6 A;  4ONW A;  2DF5 A;  3WT4 A;  3FF3 A;  3NE8 A;  4P44 A;  2Q4Z A;  3SJX A;  3B3C A;  4U5Y A;  3BJ8 A;  3MRU A;  2I79 A;  4B5P A;  3GB0 A;  2JEV A;  5K8M A;  4EFD A;  1Q2Y A;  2NMT A;  1YME A;  3B35 A;  4ZY2 A;  5JPH A;  2ZW4 A;  3F5B A;  3IWE A;  4FUU A;  2B58 A;  3WR7 A;  4FWU A;  2AFO A;  4PK3 A;  1CBX A;  2O4H A;  3IC1 A;  2C6P A;  4M3S A;  1MJA A;  3R96 A;  4ZY1 A;  3B3T A;  4U9Z A;  4CRZ B;  4CYP A;  4Q38 A;  1CJW A;  2YGW A;  1ARM A;  3TC8 A;  3KR5 A;  3TT2 A;  3LAC A;  4X3R A;  3SXO A;  2JBJ A;  1A2Z A;  4C2Z A;  2HC9 A;  3D8P A;  3SXN A;  2P6G A;  4DJL A;  2GRE A;  4YWY A;  4CYN A;  3CDX A;  2BO9 A;  2DXQ A;  4OAD A;  2G0B A;  4B5O A;  4DYO A;  3R9F A;  4PQA A;  2ZEN A;  3FNC A;  4OC3 A;  2OU2 A;  1VHE A;  4UFV A;  4H6Z A;  2PR8 A;  3MN8 A;  2PJ4 A;  4NEX A;  2Q51 A;  4KOV A;  4P45 A;  3S9L A;  3E0K A;  1LRZ A;  3S6H A;  4X2T A;  4H89 A;  3VWD A;  4RI1 A;  4MHD A;  5HVF A;  1NMT A;  4UCP A;  4B13 A;  3B3S A;  1ARL A;  1Y0R A;  3R9G A;  1I12 A;  4MHP A;  2FE7 A;  1YVO A;  4KUA A;  5DS0 A;  1QSN A;  2Z3K A;  5J1Q A;  3MGD A;  1ZLH A;  2X7B A;  2FIA A;  5JM6 A;  2YND A;  3P2F A;  4CAW A;  3GIU A;  4HNY B;  4DNC A;  2REF A;  1QSM A;  3FEE A;  4CAX A;  2HQY A;  1JQG A;  2XEG A;  2AJ6 A;  4PPZ A;  2ZEO A;  4R87 A;  2GFQ A;  5ISV A;  3SHP A;  1JWQ A;  1KUV A;  3QAH A;  2WZN A;  3QB8 A;  2XEI A;  4R3L A;  4UF4 A;  3PGP A;  3TOA A;  1QSO A;  4H2K A;  3NA6 A;  5F09 A;  2PIZ A;  2ZEF A;  5IV0 A;  4P4I A;  1XF8 A;  2ATR A;  3F8K A;  1ELM P;  2RC4 A;  2ZED A;  2ZW6 A;  4MFQ A;  2OZU A;  5LRK A;  2GU2 A;  4KOU A;  1IYL A;  5LYF A;  5K8N A;  3FED A;  4QUS A;  1LOK A;  2PJ3 A;  2AFU A;  2J8N A;  2ZEL A;  2JLM A;  3IJ3 A;  3DR8 A;  1TXR A;  1DE4 C;  2Q0Y A;  4M85 A;  4MHY A;  4UEZ A;  3W91 A;  5EMI A;  1R43 A;  4ONU A;  2F7V A;  2QML A;  5LYD A;  5HXD A;  3EC4 A;  3WC6 A;  1LAP A;  1Z5R A;  2V8H A;  1P4N A;  3PZJ A;  3B2Y A;  4B12 A;  4W9Y A;  1R3N A;  2EK9 A;  3QAY A;  4A95 A;  1KUY A;  5FVJ A;  4MCQ A;  1VIX A;  1IOF A;  1RTQ A;  2JEW A;  5JQ4 A;  5F48 A;  3B8G A;  4G1P A;  3IU2 A;  2PIY A;  2P0W A;  1MJB A;  2PVW A;  4IK2 A;  4RS2 A;  3TO7 A;  4CGO A;  4AVA A;  1IB1 E;  4MCP A;  1RO5 A;  3FVL A;  4WJB A;  2WPW A;  4KSI A;  3NH8 A;  1NSL A;  3LD2 A;  2BOA A;  3FBU A;  2WUU A;  3DGV A;  4PXB A;  4PSX A;  2I00 A;  2B5G B;  5H86 A;  2CNM A;  1AUG A;  2R98 A;  1Q7L A;  5EC4 A;  3WC7 A;  3RYO A;  1CP7 A;  4Q7A A;  3KAS A;  1N71 A;  4XNH B;  4FD6 A;  4NGN A;  2AFX A;  7CPA A;  1YVK A;  1IYK A;  3SJG A;  5LRJ A;  2PQ8 A;  4NCZ A;  4E0A A;  4JD6 A;  3FXT A;  4EWT A;  4QBJ A;  1M4I A;  3JTK A;  4PXC A;  5F49 A;  3SJE A;  3FH4 A;  5IB9 A;  4UFX A;  2PRQ A;  1P0H A;  4R9M A;  4C2Y A;  3S9N A;  5C88 A;  1KUX A;  1XIX A;  2P6F A;  4HPS A;  3S9M A;  3DDD A;  3RAM A;  4HNX B;  2F5I A;  1Y9K A;  2ZOG A;  3FEC A;  4UA3 A;  1M4G A;  3PB9 X;  4KSA A;  4YRH A;  5IX3 A;  1CX8 A;  2AE6 A;  2C27 A;  3V38 A;  4CS0 B;  5K8P A;  1Z8T A;  4YGO A;  4JLY A;  3N5F A;  4JXQ A;  3D67 A;  3SJF A;  1LCP A;  4KLV A;  1S5K A;  4KS9 A;  4MFZ A;  4UIA A;  3GY9 A;  4CPA A;  3TO6 A;  3IFE A;  1K4J A;  1TKJ A;  3RNZ A;  3ZJ0 A;  2AFS A;  1L0C A;  1I1D A;  3PB7 X;  5AG7 A;  5KTC A;  2R8V A;  1FNO A;  4E8O A;  4AXV A;  2Z3N A;  1IIC A;  3B7I A;  4KOT A;  3D2M A;  4FD5 A;  2EO8 A;  1NE9 A;  1YX0 A;  3A9L A;  2ANP A;  2B3U A;  2BL1 A;  3C26 A;  3NH5 A;  4MCS A;  2Y0M A;  5G20 A;  2H5M A;  5LYI A;  2POK A;  4MHN A;  4YFJ A;  3D68 A;  2PC1 A;  2YNC C;  3K2K A;  2CTC A;  2EUI A;  3LMS A;  1CPX A;  4YU9 A;  2ZW5 A;  5D8N A;  3EO4 A;  4F9U A;  2Z10 A;  3I1U A;  1Y7R A;  2BCO A;  5HVH A;  2VZZ A;  2JBK A;  4ZY0 A;  4MFP A;  4B14 A;  4PXE A;  2WSA A;  4UWJ A;  4A33 A;  3EFA A;  5GCN A;  4A38 A;  1YW4 A;  1Y7E A;  2KCW A;  4NGM A;  3IEH A;  1V0C A;  2PVV A;  3G3S A;  4EVY A;  1Z4E A;  3PB8 X;  5J8C A;  4F9V A;  4CAE A;  2CF4 A;  2C6G A;  4AVC A;  4L8A A;  3PRT A;  2J8R A;  5JGF A;  5KTD A;  2PJ5 A;  2BUE A;  2Q04 A;  3D66 A;  4P6Y A;  4B6Z A;  5G1Z A;  3TTH A;  3DR6 A;  2ZEE A;  3GYA A;  2DPS A;  3N7Z A;  3R95 A;  4OC4 A;  3T9Y A;  1CM0 A;  3DNS A;  4KUB A;  4FAI A;  2Z3M A;  1YLO A;  2Q43 A;  4ZX8 A;  3PP9 A;  3D4U A;  4KOW A;  4MRI A;  4MY3 A;  5LRG A;  4UFW A;  4F0Y A;  6CPA A;  3IGR A;  2Z11 A;  5D29 A;  1FY7 A;  1FT7 A;  1PUA A;  5H84 A;  3GUX A;  4QB9 A;  3JVN A;  4II9 A;  3D2P A;  4MMO A;  2J9A A;  2NYQ A;  4HNW B;  3FB3 A;  4RN7 A;  2K5T A;  1TIQ A;  1NSA A;  3CXQ A;  2QEC A;  1F2O A;  2BSW A;  4KOS A;  2PR1 A;  4NGT A;  1PYT B;  4XPD C;  2ZPA A;  4ZI6 A;  1UFH A;  1YLE A;  4KOR A;  1Q2D A;  1Z8W A;  3QNV A;  3KQZ A;  4R8F A;  5IB0 A;  2IMO A;  2PJ0 A;  3KI9 A;  3TFY A;  1QMU A;  1BAV A;  2Z3P A;  3FYN A;  2B4B A;  4XPK A;  2EWB A;  2V8V A;  2B5G A;  1XMB A;  2B4D B;  1LAN A;  5E96 A;  3HLP A;  4A94 A;  3CT9 A;  5AGE A;  1YK3 A;  3IU1 A;  4R6T A;  1BOB A;  2QJ8 A;  1QSR A;  4NGS A;  3S6K A;  1Y9W A;  4KSF A;  5CNP A;  2R1I A;  1TF9 A;  3L2N A;  5HH1 A;  5F47 A;  2DPT A;  2PJ6 A;  1X10 A;  2VBQ A;  2YNE A;  1Q2C A;  1Z8L A;  3WAB A;  1B87 A;  3UY5 A;  3PEI A;  3LOD A;  2V77 A;  2ABZ A;  1AYE A;  2ZOF A;  1XMT A;  3ISX A;  1BLL E;  2OB0 A;  4LX9 A;  4KLW A;  4PSW A;  3BXM A;  3P2H A;  3R1K A;  3W6S A;  2DEA A;  1Z8X A;  4AVB A;  2GLJ A;  5DWN A;  2QIR A;  3IIB A;  4Q36 A;  2OOT A;  2ARH A;  4GM5 A;  2GE3 A;  2P6E A;  2Z0Z A;  1VHO A;  1YRE A;  3D7H A;  2PRB A;  5F46 A;  3RBU A;  3JUW A;  2REE A;  2V8G A;  5EBV A;  1TF8 A;  4MI4 A;  3GKR A;  5CBM A;  2OZG A;  3ISZ A;  2WYR A;  1Z4R A;  4MCR A;  4R57 A;  3BI0 A;  4X8I A;  3SI0 A;  4A37 A;  1VGY A;  3VAR A;  4OAE A;  2HV2 A;  4Y49 B;  3BLN A;  4JWP A;  4JXR A;  3CXP A;  4ZYQ A;  3TE4 A;  4P10 A;  3KKW A;  2CY2 A;  3PBB A;  4PV6 A;  3SI2 A;  1KWM A;  1UWY A;  2EK8 A;  4X5K A;  1IY7 A;  4MFJ A;  3S6G A;  1XBU A;  2Q4V A;  2PE3 A;  2ZEP A;  3D3S A;  4A31 A;  2Z3O A;  3R9E A;  3SI1 A;  4A32 A;  4KOX A;  5C82 A;  4E2A A;  4UBR A;  3G8W A;  3IO1 A;  4NGP A;  3WC5 A;  3KR4 A;  2FVG A;  3BJ7 A;  1S3Z A;  1HEE A;  2FXF A;  4P4B A;  1J4J A;  2FIW A;  2GIV A;  1XRY A;  2ODF A;  4BIN A;  5LYL A;  1Z9U A;  4PXD A;  1U6M A;  2AFZ A;  4CGL A;  4NFR A;  2NSM A;  3PB4 X;  5G21 A;  1OBR A;  1QST A;  4OC0 A;  1X12 A;  3TO9 A;  2Q4Y A;  4QC6 A;  1AMP A;  1PU9 A;  4O23 A;  5HVG A;  4K3N A;  4OLL A;  4U9Y A;  1PCA A;  2XEJ A;  3NH4 A;  4LQ6 A;  4OKO A;  5I4M A;  4C68 A;  4IUS A;  1M4L A;  2VI7 A;  3FMC A;  3T8W A;  3KL9 A;  2FSR A;  3PFO A;  4TWE A;  4IF5 A;  5K8O A;  2ZXV A;  3KQX A;  1I21 A;  1XFO A;  2C1C A;  3D7G A;  5CPA A;  2OR4 A;  2YNC A;  3TCV A;  3TOB A;  4FD7 A;  3LWU A;  2PJ7 A;  5THW A;  4A30 A;  1LFW A;  1S60 A;  2O53 A;  4DUK A;  3H5Z A;  5HMN A;  4CGN A;  4H6U A;  4PK2 A;  2JDD A;  2Q44 A;  4B10 A;  4OC1 A;  4UCN A;  3FX6 A;  4NXY A;  4TNU A;  4R7M A;  2PCU A;  2FL4 A;  4I49 A;  4NGQ A;  5AG4 A;  2CIJ A;  4QVT A;  1XJO A;  3H4Q A;  4P4J A;  4ZBG A;  4XPL A;  1VHS A;  4CAF A;  2WPX A;  4KOY A;  4F8Z A;  3CZX A;  2PJ8 A;  3T90 A;  4C7I A;  4M6G A;  3KZW A;  4P4E A;  1F57 A;  1S7F A;  4NJQ A;  3F0A A;  4MY0 A;  4GS4 A; 
#chains in the Genus database with same CATH homology
 3KGQ A;  3VAT A;  3H8G A;  3RZA A;  3BI1 A;  2PJC A;  4A39 A;  1ZG8 A;  2VL1 A;  2RFH A;  2PJ9 A;  1F2P A;  4MXU A;  4NGR A;  4WWV A;  4OP4 A;  3B3W A;  1DTD A;  5ELY A;  4OME A;  3H8F A;  4UIB A;  1CPS A;  4OC2 A;  1Y0Y A;  1EE3 P;  2AFW A;  2IJZ A;  1GYT A;  2ZEM A;  4Z65 A;  1ELL P;  1BPM A;  2PJB A;  1LAM A;  2I3C A;  3H8E A;  4FBE A;  3GLJ A;  3CPA A;  4EME A;  4P4F A;  2PJ1 A;  3HUV A;  3NFZ A;  4BD9 A;  3B3V A;  1Z2L A;  3DLJ A;  2HB6 A;  4OID A;  3D7F A;  1CP6 A;  4IAV A;  3JRU A;  3FJU A;  1HDQ A;  2AFM A;  2PJA A;  3D7D A;  4R76 A;  4OC5 A;  4ZX9 A;  1H8L A;  3PFE A;  2QYV A;  2V8D A;  4JYW A;  3V7Z A;  2C6C A;  3VH9 A;  1ZLI A;  2QVP A;  3PBE A;  3IWW A;  2ZEH A;  1ZG7 A;  3CPX A;  1IGB A;  4LQG A;  4NJR A;  3PB6 X;  5JH9 A;  1YW6 A;  3KHZ A;  4UEF A;  4UEE A;  8CPA A;  3KHX A;  3BHX A;  2CTB A;  4P4D A;  1TKH A;  3K9T A;  1TKF A;  2RB7 A;  2GLF A;  4OIW A;  3TX8 A;  4MHZ A;  4JZ0 A;  1HDU A;  2XEF A;  1QQ9 A;  1YSJ A;  1BPN A;  1ZG9 A;  4RUH A;  2G9D A;  2ZEG A;  1CG2 A;  2F8H A;  2PJ2 A;  4IHM A;  2IQ6 A;  4ONW A;  3WT4 A;  3FF3 A;  4P44 A;  2Q4Z A;  3SJX A;  3B3C A;  3MRU A;  3GB0 A;  5K8M A;  4EFD A;  1YME A;  3B35 A;  4ZY2 A;  4FUU A;  4FWU A;  2AFO A;  1CBX A;  2O4H A;  3IC1 A;  2C6P A;  4ZY1 A;  3B3T A;  1ARM A;  3TC8 A;  3KR5 A;  4X3R A;  2JBJ A;  2HC9 A;  4DJL A;  2GRE A;  4YWY A;  3CDX A;  2BO9 A;  4DYO A;  4PQA A;  2ZEN A;  4OC3 A;  1VHE A;  3MN8 A;  2PJ4 A;  2Q51 A;  4P45 A;  3S9L A;  4X2T A;  5HVF A;  3B3S A;  1ARL A;  1Y0R A;  4MHP A;  5DS0 A;  5J1Q A;  1ZLH A;  5JM6 A;  3FEE A;  1JQG A;  2XEG A;  4PPZ A;  2ZEO A;  2WZN A;  2XEI A;  4UF4 A;  5F09 A;  4H2K A;  3NA6 A;  2PIZ A;  2ZEF A;  4P4I A;  1ELM P;  2ZED A;  5LRK A;  2GU2 A;  5LYF A;  5K8N A;  3FED A;  1LOK A;  2PJ3 A;  2AFU A;  2ZEL A;  3IJ3 A;  1TXR A;  1DE4 C;  4MHY A;  4UEZ A;  1R43 A;  5LYD A;  2F7V A;  5HXD A;  3WC6 A;  1LAP A;  1Z5R A;  2V8H A;  3B2Y A;  4W9Y A;  1R3N A;  2EK9 A;  4MCQ A;  1VIX A;  1RTQ A;  2JEW A;  4G1P A;  2PIY A;  2PVW A;  4IK2 A;  4MCP A;  3FVL A;  4WJB A;  4KSI A;  3NH8 A;  2BOA A;  3DGV A;  4PXB A;  1Q7L A;  3WC7 A;  1CP7 A;  4Q7A A;  3KAS A;  4NGN A;  2AFX A;  7CPA A;  3SJG A;  5LRJ A;  4EWT A;  4PXC A;  3SJE A;  3FH4 A;  5IB9 A;  2PRQ A;  3S9N A;  3S9M A;  3RAM A;  2ZOG A;  3FEC A;  3PB9 X;  1CX8 A;  3V38 A;  5K8P A;  3N5F A;  3D67 A;  3SJF A;  1LCP A;  4UIA A;  4CPA A;  3IFE A;  1TKJ A;  2AFS A;  3PB7 X;  1FNO A;  4AXV A;  3B7I A;  2ANP A;  4MCS A;  3NH5 A;  5LYI A;  2POK A;  4MHN A;  3D68 A;  3LMS A;  4YU9 A;  3K2K A;  2CTC A;  5D8N A;  4F9U A;  1CPX A;  3I1U A;  2BCO A;  5HVH A;  2JBK A;  4ZY0 A;  4PXE A;  4A38 A;  1YW4 A;  1Y7E A;  4NGM A;  3IEH A;  2PVV A;  3PB8 X;  4F9V A;  2CF4 A;  2C6G A;  3PRT A;  5JGF A;  2PJ5 A;  3D66 A;  4B6Z A;  4P6Y A;  2ZEE A;  4OC4 A;  4ZX8 A;  1YLO A;  2Q43 A;  3D4U A;  4MRI A;  5LRG A;  6CPA A;  5D29 A;  1FT7 A;  3GUX A;  4MMO A;  2J9A A;  2NYQ A;  1NSA A;  1F2O A;  4NGT A;  1PYT B;  4ZI6 A;  3QNV A;  3KQZ A;  4R8F A;  2IMO A;  2PJ0 A;  3KI9 A;  1QMU A;  1BAV A;  2EWB A;  2V8V A;  1XMB A;  1LAN A;  3HLP A;  4A94 A;  3CT9 A;  4R6T A;  2QJ8 A;  4NGS A;  1TF9 A;  3L2N A;  2PJ6 A;  1Z8L A;  3WAB A;  3PEI A;  2V77 A;  2ABZ A;  1AYE A;  2ZOF A;  3ISX A;  1BLL E;  3BXM A;  2DEA A;  2GLJ A;  3IIB A;  2OOT A;  4GM5 A;  1VHO A;  3D7H A;  3RBU A;  2V8G A;  1TF8 A;  5CBM A;  3ISZ A;  4X8I A;  2WYR A;  4MCR A;  3SI0 A;  4A37 A;  3BI0 A;  4FAI A;  1VGY A;  3VAR A;  4ZYQ A;  4P10 A;  3PBB A;  3SI2 A;  1KWM A;  1UWY A;  2EK8 A;  1IY7 A;  1XBU A;  2PE3 A;  2ZEP A;  3SI1 A;  3IO1 A;  4NGP A;  3WC5 A;  3KR4 A;  2FVG A;  1HEE A;  4P4B A;  1XRY A;  5LYL A;  4PXD A;  2AFZ A;  4NFR A;  2NSM A;  3PB4 X;  1OBR A;  4OC0 A;  1AMP A;  4O23 A;  5HVG A;  4K3N A;  1PCA A;  2XEJ A;  3NH4 A;  4OKO A;  5I4M A;  1M4L A;  3FMC A;  3T8W A;  3KL9 A;  3PFO A;  5K8O A;  4TWE A;  3KQX A;  1XFO A;  2C1C A;  3D7G A;  5CPA A;  2OR4 A;  3LWU A;  2PJ7 A;  5THW A;  1LFW A;  4DUK A;  2O53 A;  4OC1 A;  3FX6 A;  4TNU A;  4R7M A;  2PCU A;  4NGQ A;  2CIJ A;  1XJO A;  4P4J A;  4F8Z A;  2PJ8 A;  3KZW A;  4P4E A;  1F57 A;  4NJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...