2ZEEA

Crystal structure of the human glutaminyl cyclase mutant s160g at 1.99 angstrom resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDGAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutaminyl-peptide cyclotransferase
publication title A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2007-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2zeeA00
3CPAA 4YU9A 2IJZA 7CPAA 1ELMP 3MRUA 3S9LA 4UF4A 3BHXA 5CBMA 4IAVA 2V8GA 2ZEGA 3V7ZA 4FBEA 2C6GA 4TNUA 5K8MA 2V8DA 4FWUA 4R8FA 2GREA 4P10A 3KR5A 4MCSA 4NGNA 2Q43A 2I3CA 2RFHA 5LRKA 3D7FA 1DE4C 3PBBA 2V8HA 3KASA 3JRUA 1XMBA 1YMEA 3TX8A 2VL1A 3KHXA 4R6TA 3PEIA 2PCUA 3IO1A 2AFMA 3KZWA 4OIWA 5HVFA 3V38A 4MMOA 4NGSA 3KL9A 1CPSA 5LYIA 2V8VA 3NH4A 2ZEHA 1HEEA 4A38A 3N5FA 2C6PA 3RZAA 2CIJA 4MHNA 1XRYA 4P4BA 4BD9A 5LYLA 4F8ZA 1VIXA 3H8FA 2PJ0A 3T8WA 2WZNA 3SI0A 1ZLHA 1TXRA 2XEFA 1CP6A 3MN8A 3HUVA 3IWWA 3LWUA 3PFEA 5DS0A 2EK8A 4MCQA 3KR4A 1QQ9A 1BLLE 4RUHA 4O23A 5LYDA 4P4DA 4UEEA 1RTQA 2AFXA 2JBJA 1AMPA 3K9TA 2Q51A 1LOKA 4ZYQA 3PB7X 3WC6A 2Q4ZA 2PJ4A 2AFSA 3NFZA 1FT7A 1F2OA 5JGFA 4G1PA 3SJGA 3WT4A 4P6YA 3KI9A 3KGQA 6CPAA 3SJFA 4PXDA 3VARA 1GYTA 3B7IA 2F7VA 1BAVA 4P4IA 2PJ5A 4H2KA 1Z8LA 2G9DA 4DJLA 3IFEA 1ARLA 2IQ6A 2BOAA 3PB8X 3GB0A 4MHPA 3I1UA 4ZY2A 1PCAA 4WWVA 1Y7EA 1R3NA 1HDQA 3RBUA 2PJ8A 4UIBA 3PRTA 4X3RA 3PB9X 2ZEEA 4GM5A 4OC2A 4MXUA 4P4JA 3QNVA 4B6ZA 2JBKA 4AXVA 2HC9A 2ZOFA 4IK2A 1TF8A 2PJ2A 3BXMA 1F2PA 3FH4A 3FEEA 5F09A 3GUXA 3D7HA 4ZX9A 3D66A 2AFZA 2ZENA 2F8HA 4K3NA 4JYWA 3LMSA 1Z2LA 1H8LA 3PB4X 2XEGA 3D68A 2ZEMA 1UWYA 2PJAA 4NJRA 2AFUA 3PFOA 1TKHA 1TKJA 5LYFA 1CG2A 1R43A 2FVGA 2PVWA 4F9VA 4IHMA 2NYQA 4Q7AA 1HDUA 3ISXA 4OC3A 2XEJA 3KQZA 4P44A 2PJCA 1LCPA 2PJBA 3FJUA 4A94A 3D4UA 3K2KA 3FEDA 3GLJA 1AYEA 4X2TA 3B3CA 3WC5A 4KSIA 2HB6A 3SI1A 4YWYA 3FX6A 3IEHA 4P45A 3NA6A 4EMEA 4OP4A 4ONWA 3B3SA 4UEZA 3VATA 4X8IA 3FF3A 1OBRA 4ZY1A 5LRJA 5D8NA 2PJ9A 2C1CA 3B3TA 2ZEPA 4A39A 4OIDA 4OC4A 4ZI6A 2O53A 2PIZA 2CTBA 3PBEA 1KWMA 1LANA 4FAIA 1XJOA 4PPZA 5JM6A 1IY7A 2AFOA 5K8NA 2EK9A 3DGVA 3FECA 4A37A 2GU2A 2CTCA 2XEIA 5J1QA 1EE3P 2ZEDA 2NSMA 4W9YA 4NFRA 2PJ7A 4ZY0A 1XFOA 1DTDA 1F57A 4MRIA 3CT9A 4EFDA 4DYOA 3L2NA 4UEFA 3VH9A 1YSJA 3FMCA 1Y0RA 1FNOA 5K8OA 5IB9A 4PQAA 2V77A 2CF4A 1LAMA 4NGPA 2GLJA 1ZG9A 3CPXA 5ELYA 1PYTB 3B2YA 1XBUA 1CX8A 1Y0YA 4WJBA 8CPAA 3TC8A 3B3WA 2QJ8A 2ZEFA 3IIBA 3IC1A 1JQGA 1LFWA 4CPAA 3NH5A 3B3VA 3WC7A 2AFWA 2PIYA 3KHZA 3BI1A 3NH8A 3SJXA 3DLJA 2QYVA 2IMOA 1YLOA 4P4EA 3PB6X 2POKA 1ARMA 2DEAA 2BCOA 2ZOGA 3FVLA 4FUUA 4NGMA 2ZELA 4LQGA 4MCRA 2JEWA 1TF9A 2J9AA 2OR4A 5HXDA 1CBXA 2PJ6A 4R76A 5THWA 5D29A 4NGTA 3D7DA 5I4MA 3D7GA 1VHOA 4OC1A 2PVVA 4R7MA 2QVPA 1ELLP 5LRGA 1ZG8A 4OC0A 2PE3A 2ZEOA 2O4HA 5CPAA 4EWTA 3HLPA 3KQXA 1QMUA 4F9UA 1ZG7A 3IJ3A 2BO9A 3S9MA 4P4FA 3RAMA 4PXCA 1YW6A 3S9NA 1VHEA 1ZLIA 3H8EA 5K8PA 1BPNA 5HVGA 4OC5A 1IGBA 4NJQA 1NSAA 1Z5RA 4OMEA 3BI0A 1TKFA 4ZX8A 3ISZA 2C6CA 2PJ3A 4MHZA 4JZ0A 1VGYA 2ABZA 2ANPA 1BPMA 4Z65A 3H8GA 4NGQA 4NGRA 3SI2A 2RB7A 5HVHA 4MHYA 2PJ1A 4UIAA 5JH9A 2GLFA 2WYRA 4PXEA 1YW4A 2OOTA 1CP7A 1Q7LA 1M4LA 3B35A 1CPXA 4DUKA 3D67A 2EWBA 3SJEA 1LAPA 4MCPA 4TWEA 4PXBA 3WABA 2PRQA 4OKOA 3CDXA
chains in the Genus database with same CATH superfamily
2R98A 3CPAA 1S60A 4YU9A 3TTHA 1N71A 2IJZA 2B58A 2ZW6A 1J4JA 3IGRA 1BO4A 4R57A 5F48A 5HH1A 7CPAA 1XEBA 1ELMP 5IB0A 3NE7A 3MRUA 4M6GA 4YFJA 1CM0A 3S9LA 1MJ9A 4XPDB 5JQ4A 4UF4A 2FXFA 4F0XA 3BHXA 5CBMA 4IAVA 1UFHA 3VWEA 4C7HA 4M6HA 2V8GA 2ZEGA 5G20A 5IV0A 4L8AA 2JDDA 3V7ZA 4FBEA 3D3SA 2C6GA 4UWJA 4NSQA 3S6KA 4TNUA 5K8MA 2V8DA 1Y7RA 4FWUA 4R8FA 1RXTA 1YREA 2GREA 4PV6A 3R9FA 4P10A 4JXQA 1YQEA 5KTDA 2BSWA 4A33A 3KR5A 1X10A 2FL4A 2G3TA 3R9EA 4B5PA 2CNTA 4MCSA 4NGNA 1XE4A 2FSRA 2Q43A 4LUAA 2I3CA 2RFHA 2Q4VA 2EBJA 5LRKA 3D7FA 1DE4C 3PBBA 1RO5A 5BWAB 2V8HA 2VBQA 5AG7A 4C7IA 1M44A 3KASA 2B4BA 5AGEA 3JRUA 1MK4A 1XMBA 1YMEA 2B4DA 1XOVA 3LODA 4QC6A 3TX8A 2VXKA 4MJ8A 4F0YA 2VL1A 3KHXA 2VZZA 4CGPA 3G3SA 4R6TA 4CGMA 3PEIA 2PCUA 4KOSA 2VI7A 2Y0MA 1LRZA 1ON0A 2P0WA 2RC4A 3IO1A 1PU9A 2AFMA 3TO7A 4CAFA 5I0CA 1TIQA 3KZWA 4OIWA 5HVFA 4B10A 3V38A 3CXPA 4MMOA 4PSXA 4MFJA 4NGSA 4Y49C 2ATRA 4H6UA 3KL9A 5G22A 2Q44A 2K5TA 4J3GA 1CPSA 5LYIA 1KUXA 1R57A 2Q04A 2V8VA 3NH4A 4XNHC 2ZEHA 3V8IA 1XF8A 1HEEA 3P2HA 3W91A 3B8GA 1VHSA 4UCNA 4UWIA 4A38A 3N5FA 2HUZA 3SHPA 2QECA 2C6PA 4UCMA 2WSAA 3RZAA 4B12A 2CIJA 4MHNA 1XRYA 2FCKA 4P4BA 4BD9A 5LYLA 2EVNA 4F8ZA 1OZPA 4R3LA 1VIXA 2PDOA 2PQ8A 4NXYA 3TFYA 2PR8A 3H8FA 2PJ0A 3R1KA 4OLLA 3T8WA 2WZNA 3DR8A 3SI0A 4AVBA 5EC4A 4EVYA 2DXQA 4CRZB 1ZLHA 1BOBA 1TXRA 2I00A 2XEFA 4Y49B 3ZJ0A 1M1DA 1CP6A 1Q2CA 2CXAA 1I21A 3HUVA 2YNDA 3IWWA 1KZFA 3LWUA 3MN8A 3PFEA 4XNHB 3WR7A 2EUIA 4A30A 5DS0A 2EK8A 2C27A 4MCQA 3KR4A 4Q36A 1NSLA 5F47A 5J8FA 1QQ9A 1BLLE 4B5PB 1XIXA 4RUHA 2CNMA 4JJXA 4KOYA 4O23A 5LYDA 3W6XA 2ZW5A 4H89A 1KUVA 2WPWA 3N7ZA 1P4NA 3TOBA 2ARHA 4MHDA 4P4DA 1RTQA 2AFXA 4UFVA 2JBJA 4Q38A 4UEEA 1IB1E 1AMPA 3K9TA 4FD6A 1ZO0A 2Q51A 4GS4A 1LOKA 4M6IA 4ZYQA 1B87A 4KVXA 1IOFA 3VWDA 3PB7X 4MY3A 3WC6A 1FY7A 4HKFA 2Q4ZA 2Z3PA 4HNYB 4KS9A 3D2PA 3F8KA 2QIRA 3D8PA 2HQYA 3MGDA 2PJ4A 5H86A 2VEZA 2ZW4A 2AFSA 3NFZA 1FT7A 5CNPA 1F2OA 2VQYA 4MBUA 4KSFA 3TO6A 4AVAA 4G1PA 3SJGA 3WT4A 5JGFA 5KTCA 4KLVA 4P6YA 4CGNA 4BMHA 4QB9A 3KI9A 3KGQA 2PSWA 3QAHA 3TCVA 4DNCA 6CPAA 4QBJA 3SJFA 3K9UA 4MFKA 4MFZA 4PXDA 3VARA 3S6FA 1GYTA 2G0BA 5EMIA 3B7IA 2F7VA 4BBHA 1BAVA 2JDCA 4P4IA 2B3UA 3CZXA 2GANA 2PJ5A 4H2KA 2YNCA 1Z8LA 2G9DA 4XPKA 4DJLA 3T90A 4NCZA 3BLNA 3IFEA 4QVTA 1ARLA 2IQ6A 2BOAA 3EO4A 3PB8X 3GB0A 4MHPA 2REEA 2Q7SA 4CRYB 3I1UA 2DF5A 4ZY2A 1Y9KA 5EBVA 1PCAA 4WWVA 1JWQA 1Y7EA 3QB8A 1R3NA 4U5YA 2I79A 1Z8XA 1HDQA 1S7NA 3RBUA 2PJ8A 5A27A 2J8MA 4MI4A 4UIBA 3PRTA 4X3RA 4UFWA 3PB9X 3TE4A 3I3GA 4JLYA 4KVOE 2ZEEA 4GM5A 4OC2A 1PUAA 1Z9UA 2QMLA 4MXUA 4P4JA 3QNVA 4B6ZA 2JBKA 2EO8A 4AXVA 2HC9A 4CYQA 3RO0A 1MJAA 2ZOFA 1TF8A 2PJ2A 3BXMA 1F2PA 3FH4A 3FEEA 4IK2A 4CYOA 5F09A 4CGOA 3GUXA 2F5IA 4KORA 3D7HA 4ZX9A 3DR6A 2CY2A 4RI1A 4RS2A 3D66A 2AFZA 2ZENA 3PZJA 2PR1A 2F8HA 4K3NA 4JYWA 3LMSA 1Z2LA 1H8LA 1WK4A 3PB4X 2YNCC 2R7HA 1YLEA 2BUEA 2XEGA 3D68A 2JEVA 2ZEMA 1UWYA 2G3AA 2FE7A 2OB0A 4ORFA 2BL1A 2PJAA 3FNCA 3NE8A 3IWEA 4NJRA 4MFLA 2AFUA 1Q2YA 1IIDA 1QSMA 3PFOA 1TKHA 3DSBA 1TKJA 2X7BA 4XPLA 1YVOA 5LYFA 2YGWA 1QSOA 4B5OA 1CG2A 1R43A 2FVGA 2PVWA 4X5KA 4F6AA 4IHMA 3I9SA 2ZPAA 4F9VA 1KUYA 2NYQA 4Q7AA 4GXHA 4B11A 1GHEA 1HDUA 2Q0YA 3GIUA 3ISXA 2H5MA 3A9LA 4KZTA 4OC3A 1S3ZA 2XEJA 3KQZA 2ZXVA 4PK2A 4P44A 2PJCA 5E96A 1LCPA 2AJ6A 2PJBA 3FJUA 4A94A 3D4UA 4CAEA 1IYKA 3K2KA 1V0CA 4UBRA 3FEDA 4E0AA 3GLJA 2WPXA 1AYEA 4X2TA 3B3CA 2OZHA 2Z3OA 3FYNA 3GYAA 3WC5A 4MFQA 4KSIA 1K4JA 1MJBA 3ZZIA 4FD5A 3F0AA 2HB6A 3SI1A 4B13A 3CXQA 4PK3A 4YWYA 4A95A 5DWNA 2HV2A 1X12A 2NMTA 3FX6A 3IEHA 4P45A 3NA6A 2A4NA 4OAEA 3P2FA 4EMEA 5C82A 4R87A 1WWZA 4OP4A 3R95A 4ONWA 2B4DB 3B3SA 5AG5A 2P6FA 3E0KA 4UEZA 3C26A 4X8IA 3FF3A 3VATA 4CYNA 5F46A 1OBRA 4ZY1A 5LRJA 1P0HA 5D8NA 4BINA 4E2AA 2PJ9A 2C1CA 3B3TA 2ZEPA 4A39A 4AG7A 4OIDA 4OC4A 3EY5A 4ZI6A 2O53A 2FS5A 2KCWA 2PIZA 3FB3A 3PP9A 2CTBA 3PBEA 3TO9A 5KTAA 3UY5A 1KWMA 1QSRA 1LANA 4FAIA 1XJOA 3IU2A 4PPZA 5JM6A 4KOXA 1IY7A 2AFOA 2WUUA 5K8NA 2EK9A 3DGVA 3FECA 3H5ZA 1Z4RA 4A37A 2GU2A 1NMTA 2CTCA 2XEIA 5J1QA 1XMTA 3DNSA 4CAWA 1EE3P 2ZEDA 2NSMA 4LQ6A 2REFA 4W9YA 5A28A 4NFRA 3G8WA 2PJ7A 4NF1A 4AVCA 4HPSA 4ZY0A 1XFOA 1DTDA 4K30A 1VKCA 5FVJA 1F57A 1IOIA 4MRIA 2B5GA 2O28A 3CT9A 4EFDA 1CJWA 4KOVA 3DDDA 3KKWA 3FBUA 4NEXA 5C88A 4DYOA 3L2NA 4UEFA 1IYLA 3LACA 3VH9A 4AG9A 1Q2DA 2R1IA 1YSJA 3FMCA 1YGHA 2Q7BA 1Y0RA 2Z0ZA 1FNOA 3SXNA 5IB9A 5K8OA 4PQAA 2V77A 2CF4A 1LAMA 2YNEA 4NGPA 5J8CA 4M85A 2GLJA 4RN7A 1ZG9A 4R9MA 1IICA 3CPXA 2IL4A 5ELYA 3EXNA 1PYTB 4UCPA 1L0CA 3B2YA 1XBUA 2FT0A 1CX8A 2DPSA 1IU8A 1Y0YA 4WJBA 4KVME 8CPAA 2OU2A 3W6SA 4HNXB 3TC8A 3B3WA 2QJ8A 2ZEFA 3IIBA 3IC1A 1Z8WA 3FIXA 1JQGA 1LFWA 4YRHA 2GFQA 3D2MA 3S6HA 1A2ZA 4CPAA 4JXRA 3JUWA 3NH5A 3B3VA 4MY0A 1QSNA 3WC7A 2AFWA 2PIYA 2J8NA 3KHZA 4CYPA 3BI1A 3NH8A 3SJXA 5AG4A 4FD7A 3DLJA 4UFXA 2QYVA 2IMOA 5JPHA 1YLOA 1S5KA 4P4EA 2CNSA 3FXTA 3PB6X 4L89A 2POKA 2PRBA 2FIAA 5H84A 1ARMA 5G21A 4C2ZA 2DEAA 2BCOA 2ZOGA 3FVLA 4FUUA 4C68A 4JD6A 4NGMA 2PC1A 2ZELA 1U6MA 4LQGA 4I49A 3IU1A 5ISVA 3LD2A 4KLWA 2OH1A 1M4IA 2JEWA 1TF9A 4MCRA 2J9AA 4CAXA 2OR4A 3R9GA 5HXDA 1CBXA 5DWMA 4C2XA 2PJ6A 3IWGA 4R76A 5D29A 3CXSA 5THWA 1Z4EA 4CGLA 4NGTA 4OADA 3PGPA 5G1ZA 1B6BA 2DPTA 3D7DA 3H4QA 5I4MA 3D7GA 1YK3A 4FD4A 1VHOA 2Z11A 4KOWA 4ZGYB 4KSAA 4OC1A 4ZBGA 2PVVA 4KOUA 4R7MA 4II9A 4ONUA 2QVPA 1ELLP 2Z3KA 2ODFA 4CS0B 2B5GB 5LRGA 1ZG8A 1QSTA 1I1DA 4UA3A 4JWPA 4OC0A 2PE3A 2ZEOA 2O4HA 5CPAA 4A31A 4EWTA 2FIWA 2Z3LA 1QMUA 3HLPA 3KQXA 1ZG7A 3BJ8A 3IJ3A 2BO9A 3S9MA 3TOAA 4P4FA 3RAMA 2GE3A 5HMNA 4YGOA 3TT2A 4QUSA 3EFAA 2OZUA 4CAVA 2R8VA 4PXCA 2D4OA 1YW6A 3S9NA 1VHEA 1ZLIA 3H8EA 4OKOA 4A2ZA 5K8PA 1BPNA 2Z3MA 5HVGA 4OC5A 1IGBA 4NJQA 1NSAA 3JVNA 2AE6A 2BEIA 1Z5RA 4KUBA 4OMEA 3BI0A 1TKFA 4ZX8A 4F9UA 3ISZA 3RNZA 1Y9WA 2C6CA 2PJ3A 4E8OA 5IX3A 4MHZA 4KUAA 1M4GA 4JZ0A 4R3KA 1VGYA 2ABZA 2ANPA 1BPMA 3OWCA 3S6GA 4AB7A 4Z65A 2D4PA 1S7FA 3H8GA 3BJ7A 4IUSA 4NGQA 4NGRA 2Z3NA 3JTKA 5AG6A 3GKRA 3SI2A 2RB7A 4IF5A 4XPDC 3T9YA 2P6GA 4PSWA 5HVHA 1Z8TA 4MHYA 1SQHA 2PJ1A 3R96A 4UIAA 5JH9A 4LX9A 2GLFA 2P6EA 1I12A 2Q4YA 1AUGA 2WYRA 3GY9A 4M3SA 2VZYA 4PXEA 1YW4A 1M4DA 1YX0A 4U9YA 2Z10A 3QAYA 4KOTA 5F49A 1CP7A 2OOTA 1Q7LA 1M4LA 2ZW7A 3B35A 4U9ZA 4HNWB 1CPXA 4DUKA 3D67A 2B3VA 2EWBA 3SJEA 3SXOA 1LAPA 3FRMA 2GIVA 3F5BA 4MCPA 4TWEA 4B14A 2JLMA 4H6ZA 4PXBA 4A32A 3EC4A 3WABA 4C2YA 4MFPA 2PRQA 1NE9A 5GCNA 1S7LA 2J8RA 3RYOA 2OZGA 1S7KA 1YVKA 1YR0A 3CDXA
chains in the Genus database with same CATH topology
3CPAA 4YU9A 2IJZA 7CPAA 1ELMP 3MRUA 3S9LA 4UF4A 3BHXA 5CBMA 4IAVA 2V8GA 2ZEGA 3V7ZA 4FBEA 2C6GA 4TNUA 5K8MA 2V8DA 4FWUA 4R8FA 2GREA 4P10A 3KR5A 4MCSA 4NGNA 2Q43A 2I3CA 2RFHA 5LRKA 3D7FA 1DE4C 3PBBA 2V8HA 3KASA 3JRUA 1XMBA 1YMEA 3TX8A 2VL1A 3KHXA 4R6TA 3PEIA 2PCUA 3IO1A 2AFMA 3KZWA 4OIWA 5HVFA 3V38A 4MMOA 4NGSA 3KL9A 1CPSA 5LYIA 2V8VA 3NH4A 2ZEHA 1HEEA 4A38A 3N5FA 2C6PA 3RZAA 2CIJA 4MHNA 1XRYA 4P4BA 4BD9A 5LYLA 4F8ZA 1VIXA 3H8FA 2PJ0A 3T8WA 2WZNA 3SI0A 1ZLHA 1TXRA 2XEFA 1CP6A 3MN8A 3HUVA 3IWWA 3LWUA 3PFEA 5DS0A 2EK8A 4MCQA 3KR4A 1QQ9A 1BLLE 4RUHA 4O23A 5LYDA 4P4DA 4UEEA 1RTQA 2AFXA 2JBJA 1AMPA 3K9TA 2Q51A 1LOKA 4ZYQA 3PB7X 3WC6A 2Q4ZA 2PJ4A 2AFSA 3NFZA 1FT7A 1F2OA 5JGFA 4G1PA 3SJGA 3WT4A 4P6YA 3KI9A 3KGQA 6CPAA 3SJFA 4PXDA 3VARA 1GYTA 3B7IA 2F7VA 1BAVA 4P4IA 2PJ5A 4H2KA 1Z8LA 2G9DA 4DJLA 3IFEA 1ARLA 2IQ6A 2BOAA 3PB8X 3GB0A 4MHPA 3I1UA 4ZY2A 1PCAA 4WWVA 1Y7EA 1R3NA 1HDQA 3RBUA 2PJ8A 4UIBA 3PRTA 4X3RA 3PB9X 2ZEEA 4GM5A 4OC2A 4MXUA 4P4JA 3QNVA 4B6ZA 2JBKA 4AXVA 2HC9A 2ZOFA 4IK2A 1TF8A 2PJ2A 3BXMA 1F2PA 3FH4A 3FEEA 5F09A 3GUXA 3D7HA 4ZX9A 3D66A 2AFZA 2ZENA 2F8HA 4K3NA 4JYWA 3LMSA 1Z2LA 1H8LA 3PB4X 2XEGA 3D68A 2ZEMA 1UWYA 2PJAA 4NJRA 2AFUA 3PFOA 1TKHA 1TKJA 5LYFA 1CG2A 1R43A 2FVGA 2PVWA 4F9VA 4IHMA 2NYQA 4Q7AA 1HDUA 3ISXA 4OC3A 2XEJA 3KQZA 4P44A 2PJCA 1LCPA 2PJBA 3FJUA 4A94A 3D4UA 3K2KA 3FEDA 3GLJA 1AYEA 4X2TA 3B3CA 3WC5A 4KSIA 2HB6A 3SI1A 4YWYA 3FX6A 3IEHA 4P45A 3NA6A 4EMEA 4OP4A 4ONWA 3B3SA 4UEZA 3VATA 4X8IA 3FF3A 1OBRA 4ZY1A 5LRJA 5D8NA 2PJ9A 2C1CA 3B3TA 2ZEPA 4A39A 4OIDA 4OC4A 4ZI6A 2O53A 2PIZA 2CTBA 3PBEA 1KWMA 1LANA 4FAIA 1XJOA 4PPZA 5JM6A 1IY7A 2AFOA 5K8NA 2EK9A 3DGVA 3FECA 4A37A 2GU2A 2CTCA 2XEIA 5J1QA 1EE3P 2ZEDA 2NSMA 4W9YA 4NFRA 2PJ7A 4ZY0A 1XFOA 1DTDA 1F57A 4MRIA 3CT9A 4EFDA 4DYOA 3L2NA 4UEFA 3VH9A 1YSJA 3FMCA 1Y0RA 1FNOA 5K8OA 5IB9A 4PQAA 2V77A 2CF4A 1LAMA 4NGPA 2GLJA 1ZG9A 3CPXA 5ELYA 1PYTB 3B2YA 1XBUA 1CX8A 1Y0YA 4WJBA 8CPAA 3TC8A 3B3WA 2QJ8A 2ZEFA 3IIBA 3IC1A 1JQGA 1LFWA 4CPAA 3NH5A 3B3VA 3WC7A 2AFWA 2PIYA 3KHZA 3BI1A 3NH8A 3SJXA 3DLJA 2QYVA 2IMOA 1YLOA 4P4EA 3PB6X 2POKA 1ARMA 2DEAA 2BCOA 2ZOGA 3FVLA 4FUUA 4NGMA 2ZELA 4LQGA 4MCRA 2JEWA 1TF9A 2J9AA 2OR4A 5HXDA 1CBXA 2PJ6A 4R76A 5THWA 5D29A 4NGTA 3D7DA 5I4MA 3D7GA 1VHOA 4OC1A 2PVVA 4R7MA 2QVPA 1ELLP 5LRGA 1ZG8A 4OC0A 2PE3A 2ZEOA 2O4HA 5CPAA 4EWTA 3HLPA 3KQXA 1QMUA 4F9UA 1ZG7A 3IJ3A 2BO9A 3S9MA 4P4FA 3RAMA 4PXCA 1YW6A 3S9NA 1VHEA 1ZLIA 3H8EA 5K8PA 1BPNA 5HVGA 4OC5A 1IGBA 4NJQA 1NSAA 1Z5RA 4OMEA 3BI0A 1TKFA 4ZX8A 3ISZA 2C6CA 2PJ3A 4MHZA 4JZ0A 1VGYA 2ABZA 2ANPA 1BPMA 4Z65A 3H8GA 4NGQA 4NGRA 3SI2A 2RB7A 5HVHA 4MHYA 2PJ1A 4UIAA 5JH9A 2GLFA 2WYRA 4PXEA 1YW4A 2OOTA 1CP7A 1Q7LA 1M4LA 3B35A 1CPXA 4DUKA 3D67A 2EWBA 3SJEA 1LAPA 4MCPA 4TWEA 4PXBA 3WABA 2PRQA 4OKOA 3CDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPA A;  4YU9 A;  2IJZ A;  7CPA A;  1ELM P;  3MRU A;  3S9L A;  4UF4 A;  3BHX A;  5CBM A;  4IAV A;  2V8G A;  2ZEG A;  3V7Z A;  4FBE A;  2C6G A;  4TNU A;  5K8M A;  2V8D A;  4FWU A;  4R8F A;  2GRE A;  4P10 A;  3KR5 A;  4MCS A;  4NGN A;  2Q43 A;  2I3C A;  2RFH A;  5LRK A;  3D7F A;  1DE4 C;  3PBB A;  2V8H A;  3KAS A;  3JRU A;  1XMB A;  1YME A;  3TX8 A;  2VL1 A;  3KHX A;  4R6T A;  3PEI A;  2PCU A;  3IO1 A;  2AFM A;  3KZW A;  4OIW A;  5HVF A;  3V38 A;  4MMO A;  4NGS A;  3KL9 A;  1CPS A;  5LYI A;  2V8V A;  3NH4 A;  2ZEH A;  1HEE A;  4A38 A;  3N5F A;  2C6P A;  3RZA A;  2CIJ A;  4MHN A;  1XRY A;  4P4B A;  4BD9 A;  5LYL A;  4F8Z A;  1VIX A;  3H8F A;  2PJ0 A;  3T8W A;  2WZN A;  3SI0 A;  1ZLH A;  1TXR A;  2XEF A;  1CP6 A;  3MN8 A;  3HUV A;  3IWW A;  3LWU A;  3PFE A;  5DS0 A;  2EK8 A;  4MCQ A;  3KR4 A;  1QQ9 A;  1BLL E;  4RUH A;  4O23 A;  5LYD A;  4P4D A;  4UEE A;  1RTQ A;  2AFX A;  2JBJ A;  1AMP A;  3K9T A;  2Q51 A;  1LOK A;  4ZYQ A;  3PB7 X;  3WC6 A;  2Q4Z A;  2PJ4 A;  2AFS A;  3NFZ A;  1FT7 A;  1F2O A;  5JGF A;  4G1P A;  3SJG A;  3WT4 A;  4P6Y A;  3KI9 A;  3KGQ A;  6CPA A;  3SJF A;  4PXD A;  3VAR A;  1GYT A;  3B7I A;  2F7V A;  1BAV A;  4P4I A;  2PJ5 A;  4H2K A;  1Z8L A;  2G9D A;  4DJL A;  3IFE A;  1ARL A;  2IQ6 A;  2BOA A;  3PB8 X;  3GB0 A;  4MHP A;  3I1U A;  4ZY2 A;  1PCA A;  4WWV A;  1Y7E A;  1R3N A;  1HDQ A;  3RBU A;  2PJ8 A;  4UIB A;  3PRT A;  4X3R A;  3PB9 X;  2ZEE A;  4GM5 A;  4OC2 A;  4MXU A;  4P4J A;  3QNV A;  4B6Z A;  2JBK A;  4AXV A;  2HC9 A;  2ZOF A;  4IK2 A;  1TF8 A;  2PJ2 A;  3BXM A;  1F2P A;  3FH4 A;  3FEE A;  5F09 A;  3GUX A;  3D7H A;  4ZX9 A;  3D66 A;  2AFZ A;  2ZEN A;  2F8H A;  4K3N A;  4JYW A;  3LMS A;  1Z2L A;  1H8L A;  3PB4 X;  2XEG A;  3D68 A;  2ZEM A;  1UWY A;  2PJA A;  4NJR A;  2AFU A;  3PFO A;  1TKH A;  1TKJ A;  5LYF A;  1CG2 A;  1R43 A;  2FVG A;  2PVW A;  4F9V A;  4IHM A;  2NYQ A;  4Q7A A;  1HDU A;  3ISX A;  4OC3 A;  2XEJ A;  3KQZ A;  4P44 A;  2PJC A;  1LCP A;  2PJB A;  3FJU A;  4A94 A;  3D4U A;  3K2K A;  3FED A;  3GLJ A;  1AYE A;  4X2T A;  3B3C A;  3WC5 A;  4KSI A;  2HB6 A;  3SI1 A;  4YWY A;  3FX6 A;  3IEH A;  4P45 A;  3NA6 A;  4EME A;  4OP4 A;  4ONW A;  3B3S A;  4UEZ A;  3VAT A;  4X8I A;  3FF3 A;  1OBR A;  4ZY1 A;  5LRJ A;  5D8N A;  2PJ9 A;  2C1C A;  3B3T A;  2ZEP A;  4A39 A;  4OID A;  4OC4 A;  4ZI6 A;  2O53 A;  2PIZ A;  2CTB A;  3PBE A;  1KWM A;  1LAN A;  4FAI A;  1XJO A;  4PPZ A;  5JM6 A;  1IY7 A;  2AFO A;  5K8N A;  2EK9 A;  3DGV A;  3FEC A;  4A37 A;  2GU2 A;  2CTC A;  2XEI A;  5J1Q A;  1EE3 P;  2ZED A;  2NSM A;  4W9Y A;  4NFR A;  2PJ7 A;  4ZY0 A;  1XFO A;  1DTD A;  1F57 A;  4MRI A;  3CT9 A;  4EFD A;  4DYO A;  3L2N A;  4UEF A;  3VH9 A;  1YSJ A;  3FMC A;  1Y0R A;  1FNO A;  5K8O A;  5IB9 A;  4PQA A;  2V77 A;  2CF4 A;  1LAM A;  4NGP A;  2GLJ A;  1ZG9 A;  3CPX A;  5ELY A;  1PYT B;  3B2Y A;  1XBU A;  1CX8 A;  1Y0Y A;  4WJB A;  8CPA A;  3TC8 A;  3B3W A;  2QJ8 A;  2ZEF A;  3IIB A;  3IC1 A;  1JQG A;  1LFW A;  4CPA A;  3NH5 A;  3B3V A;  3WC7 A;  2AFW A;  2PIY A;  3KHZ A;  3BI1 A;  3NH8 A;  3SJX A;  3DLJ A;  2QYV A;  2IMO A;  1YLO A;  4P4E A;  3PB6 X;  2POK A;  1ARM A;  2DEA A;  2BCO A;  2ZOG A;  3FVL A;  4FUU A;  4NGM A;  2ZEL A;  4LQG A;  4MCR A;  2JEW A;  1TF9 A;  2J9A A;  2OR4 A;  5HXD A;  1CBX A;  2PJ6 A;  4R76 A;  5THW A;  5D29 A;  4NGT A;  3D7D A;  5I4M A;  3D7G A;  1VHO A;  4OC1 A;  2PVV A;  4R7M A;  2QVP A;  1ELL P;  5LRG A;  1ZG8 A;  4OC0 A;  2PE3 A;  2ZEO A;  2O4H A;  5CPA A;  4EWT A;  3HLP A;  3KQX A;  1QMU A;  4F9U A;  1ZG7 A;  3IJ3 A;  2BO9 A;  3S9M A;  4P4F A;  3RAM A;  4PXC A;  1YW6 A;  3S9N A;  1VHE A;  1ZLI A;  3H8E A;  5K8P A;  1BPN A;  5HVG A;  4OC5 A;  1IGB A;  4NJQ A;  1NSA A;  1Z5R A;  4OME A;  3BI0 A;  1TKF A;  4ZX8 A;  3ISZ A;  2C6C A;  2PJ3 A;  4MHZ A;  4JZ0 A;  1VGY A;  2ABZ A;  2ANP A;  1BPM A;  4Z65 A;  3H8G A;  4NGQ A;  4NGR A;  3SI2 A;  2RB7 A;  5HVH A;  4MHY A;  2PJ1 A;  4UIA A;  5JH9 A;  2GLF A;  2WYR A;  4PXE A;  1YW4 A;  2OOT A;  1CP7 A;  1Q7L A;  1M4L A;  3B35 A;  1CPX A;  4DUK A;  3D67 A;  2EWB A;  3SJE A;  1LAP A;  4MCP A;  4TWE A;  4PXB A;  3WAB A;  2PRQ A;  4OKO A;  3CDX A; 
#chains in the Genus database with same CATH topology
 2R98 A;  3CPA A;  1S60 A;  4YU9 A;  3TTH A;  1N71 A;  2IJZ A;  2B58 A;  2ZW6 A;  1J4J A;  3IGR A;  1BO4 A;  4R57 A;  5F48 A;  5HH1 A;  7CPA A;  1XEB A;  1ELM P;  5IB0 A;  3NE7 A;  3MRU A;  4M6G A;  4YFJ A;  1CM0 A;  3S9L A;  1MJ9 A;  4XPD B;  5JQ4 A;  4UF4 A;  2FXF A;  4F0X A;  3BHX A;  5CBM A;  4IAV A;  1UFH A;  3VWE A;  4C7H A;  4M6H A;  2V8G A;  2ZEG A;  5G20 A;  5IV0 A;  4L8A A;  2JDD A;  3V7Z A;  4FBE A;  3D3S A;  2C6G A;  4UWJ A;  4NSQ A;  3S6K A;  4TNU A;  5K8M A;  2V8D A;  1Y7R A;  4FWU A;  4R8F A;  1RXT A;  1YRE A;  2GRE A;  4PV6 A;  3R9F A;  4P10 A;  4JXQ A;  1YQE A;  5KTD A;  2BSW A;  4A33 A;  3KR5 A;  1X10 A;  2FL4 A;  2G3T A;  3R9E A;  4B5P A;  2CNT A;  4MCS A;  4NGN A;  1XE4 A;  2FSR A;  2Q43 A;  4LUA A;  2I3C A;  2RFH A;  2Q4V A;  2EBJ A;  5LRK A;  3D7F A;  1DE4 C;  3PBB A;  1RO5 A;  5BWA B;  2V8H A;  2VBQ A;  5AG7 A;  4C7I A;  1M44 A;  3KAS A;  2B4B A;  5AGE A;  3JRU A;  1MK4 A;  1XMB A;  1YME A;  2B4D A;  1XOV A;  3LOD A;  4QC6 A;  3TX8 A;  2VXK A;  4MJ8 A;  4F0Y A;  2VL1 A;  3KHX A;  2VZZ A;  4CGP A;  3G3S A;  4R6T A;  4CGM A;  3PEI A;  2PCU A;  4KOS A;  2VI7 A;  2Y0M A;  1LRZ A;  1ON0 A;  2P0W A;  2RC4 A;  3IO1 A;  1PU9 A;  2AFM A;  3TO7 A;  4CAF A;  5I0C A;  1TIQ A;  3KZW A;  4OIW A;  5HVF A;  4B10 A;  3V38 A;  3CXP A;  4MMO A;  4PSX A;  4MFJ A;  4NGS A;  4Y49 C;  2ATR A;  4H6U A;  3KL9 A;  5G22 A;  2Q44 A;  2K5T A;  4J3G A;  1CPS A;  5LYI A;  1KUX A;  1R57 A;  2Q04 A;  2V8V A;  3NH4 A;  4XNH C;  2ZEH A;  3V8I A;  1XF8 A;  1HEE A;  3P2H A;  3W91 A;  3B8G A;  1VHS A;  4UCN A;  4UWI A;  4A38 A;  3N5F A;  2HUZ A;  3SHP A;  2QEC A;  2C6P A;  4UCM A;  2WSA A;  3RZA A;  4B12 A;  2CIJ A;  4MHN A;  1XRY A;  2FCK A;  4P4B A;  4BD9 A;  5LYL A;  2EVN A;  4F8Z A;  1OZP A;  4R3L A;  1VIX A;  2PDO A;  2PQ8 A;  4NXY A;  3TFY A;  2PR8 A;  3H8F A;  2PJ0 A;  3R1K A;  4OLL A;  3T8W A;  2WZN A;  3DR8 A;  3SI0 A;  4AVB A;  5EC4 A;  4EVY A;  2DXQ A;  4CRZ B;  1ZLH A;  1BOB A;  1TXR A;  2I00 A;  2XEF A;  4Y49 B;  3ZJ0 A;  1M1D A;  1CP6 A;  1Q2C A;  2CXA A;  1I21 A;  3HUV A;  2YND A;  3IWW A;  1KZF A;  3LWU A;  3MN8 A;  3PFE A;  4XNH B;  3WR7 A;  2EUI A;  4A30 A;  5DS0 A;  2EK8 A;  2C27 A;  4MCQ A;  3KR4 A;  4Q36 A;  1NSL A;  5F47 A;  5J8F A;  1QQ9 A;  1BLL E;  4B5P B;  1XIX A;  4RUH A;  2CNM A;  4JJX A;  4KOY A;  4O23 A;  5LYD A;  3W6X A;  2ZW5 A;  4H89 A;  1KUV A;  2WPW A;  3N7Z A;  1P4N A;  3TOB A;  2ARH A;  4MHD A;  4P4D A;  1RTQ A;  2AFX A;  4UFV A;  2JBJ A;  4Q38 A;  4UEE A;  1IB1 E;  1AMP A;  3K9T A;  4FD6 A;  1ZO0 A;  2Q51 A;  4GS4 A;  1LOK A;  4M6I A;  4ZYQ A;  1B87 A;  4KVX A;  1IOF A;  3VWD A;  3PB7 X;  4MY3 A;  3WC6 A;  1FY7 A;  4HKF A;  2Q4Z A;  2Z3P A;  4HNY B;  4KS9 A;  3D2P A;  3F8K A;  2QIR A;  3D8P A;  2HQY A;  3MGD A;  2PJ4 A;  5H86 A;  2VEZ A;  2ZW4 A;  2AFS A;  3NFZ A;  1FT7 A;  5CNP A;  1F2O A;  2VQY A;  4MBU A;  4KSF A;  3TO6 A;  4AVA A;  4G1P A;  3SJG A;  3WT4 A;  5JGF A;  5KTC A;  4KLV A;  4P6Y A;  4CGN A;  4BMH A;  4QB9 A;  3KI9 A;  3KGQ A;  2PSW A;  3QAH A;  3TCV A;  4DNC A;  6CPA A;  4QBJ A;  3SJF A;  3K9U A;  4MFK A;  4MFZ A;  4PXD A;  3VAR A;  3S6F A;  1GYT A;  2G0B A;  5EMI A;  3B7I A;  2F7V A;  4BBH A;  1BAV A;  2JDC A;  4P4I A;  2B3U A;  3CZX A;  2GAN A;  2PJ5 A;  4H2K A;  2YNC A;  1Z8L A;  2G9D A;  4XPK A;  4DJL A;  3T90 A;  4NCZ A;  3BLN A;  3IFE A;  4QVT A;  1ARL A;  2IQ6 A;  2BOA A;  3EO4 A;  3PB8 X;  3GB0 A;  4MHP A;  2REE A;  2Q7S A;  4CRY B;  3I1U A;  2DF5 A;  4ZY2 A;  1Y9K A;  5EBV A;  1PCA A;  4WWV A;  1JWQ A;  1Y7E A;  3QB8 A;  1R3N A;  4U5Y A;  2I79 A;  1Z8X A;  1HDQ A;  1S7N A;  3RBU A;  2PJ8 A;  5A27 A;  2J8M A;  4MI4 A;  4UIB A;  3PRT A;  4X3R A;  4UFW A;  3PB9 X;  3TE4 A;  3I3G A;  4JLY A;  4KVO E;  2ZEE A;  4GM5 A;  4OC2 A;  1PUA A;  1Z9U A;  2QML A;  4MXU A;  4P4J A;  3QNV A;  4B6Z A;  2JBK A;  2EO8 A;  4AXV A;  2HC9 A;  4CYQ A;  3RO0 A;  1MJA A;  2ZOF A;  1TF8 A;  2PJ2 A;  3BXM A;  1F2P A;  3FH4 A;  3FEE A;  4IK2 A;  4CYO A;  5F09 A;  4CGO A;  3GUX A;  2F5I A;  4KOR A;  3D7H A;  4ZX9 A;  3DR6 A;  2CY2 A;  4RI1 A;  4RS2 A;  3D66 A;  2AFZ A;  2ZEN A;  3PZJ A;  2PR1 A;  2F8H A;  4K3N A;  4JYW A;  3LMS A;  1Z2L A;  1H8L A;  1WK4 A;  3PB4 X;  2YNC C;  2R7H A;  1YLE A;  2BUE A;  2XEG A;  3D68 A;  2JEV A;  2ZEM A;  1UWY A;  2G3A A;  2FE7 A;  2OB0 A;  4ORF A;  2BL1 A;  2PJA A;  3FNC A;  3NE8 A;  3IWE A;  4NJR A;  4MFL A;  2AFU A;  1Q2Y A;  1IID A;  1QSM A;  3PFO A;  1TKH A;  3DSB A;  1TKJ A;  2X7B A;  4XPL A;  1YVO A;  5LYF A;  2YGW A;  1QSO A;  4B5O A;  1CG2 A;  1R43 A;  2FVG A;  2PVW A;  4X5K A;  4F6A A;  4IHM A;  3I9S A;  2ZPA A;  4F9V A;  1KUY A;  2NYQ A;  4Q7A A;  4GXH A;  4B11 A;  1GHE A;  1HDU A;  2Q0Y A;  3GIU A;  3ISX A;  2H5M A;  3A9L A;  4KZT A;  4OC3 A;  1S3Z A;  2XEJ A;  3KQZ A;  2ZXV A;  4PK2 A;  4P44 A;  2PJC A;  5E96 A;  1LCP A;  2AJ6 A;  2PJB A;  3FJU A;  4A94 A;  3D4U A;  4CAE A;  1IYK A;  3K2K A;  1V0C A;  4UBR A;  3FED A;  4E0A A;  3GLJ A;  2WPX A;  1AYE A;  4X2T A;  3B3C A;  2OZH A;  2Z3O A;  3FYN A;  3GYA A;  3WC5 A;  4MFQ A;  4KSI A;  1K4J A;  1MJB A;  3ZZI A;  4FD5 A;  3F0A A;  2HB6 A;  3SI1 A;  4B13 A;  3CXQ A;  4PK3 A;  4YWY A;  4A95 A;  5DWN A;  2HV2 A;  1X12 A;  2NMT A;  3FX6 A;  3IEH A;  4P45 A;  3NA6 A;  2A4N A;  4OAE A;  3P2F A;  4EME A;  5C82 A;  4R87 A;  1WWZ A;  4OP4 A;  3R95 A;  4ONW A;  2B4D B;  3B3S A;  5AG5 A;  2P6F A;  3E0K A;  4UEZ A;  3C26 A;  4X8I A;  3FF3 A;  3VAT A;  4CYN A;  5F46 A;  1OBR A;  4ZY1 A;  5LRJ A;  1P0H A;  5D8N A;  4BIN A;  4E2A A;  2PJ9 A;  2C1C A;  3B3T A;  2ZEP A;  4A39 A;  4AG7 A;  4OID A;  4OC4 A;  3EY5 A;  4ZI6 A;  2O53 A;  2FS5 A;  2KCW A;  2PIZ A;  3FB3 A;  3PP9 A;  2CTB A;  3PBE A;  3TO9 A;  5KTA A;  3UY5 A;  1KWM A;  1QSR A;  1LAN A;  4FAI A;  1XJO A;  3IU2 A;  4PPZ A;  5JM6 A;  4KOX A;  1IY7 A;  2AFO A;  2WUU A;  5K8N A;  2EK9 A;  3DGV A;  3FEC A;  3H5Z A;  1Z4R A;  4A37 A;  2GU2 A;  1NMT A;  2CTC A;  2XEI A;  5J1Q A;  1XMT A;  3DNS A;  4CAW A;  1EE3 P;  2ZED A;  2NSM A;  4LQ6 A;  2REF A;  4W9Y A;  5A28 A;  4NFR A;  3G8W A;  2PJ7 A;  4NF1 A;  4AVC A;  4HPS A;  4ZY0 A;  1XFO A;  1DTD A;  4K30 A;  1VKC A;  5FVJ A;  1F57 A;  1IOI A;  4MRI A;  2B5G A;  2O28 A;  3CT9 A;  4EFD A;  1CJW A;  4KOV A;  3DDD A;  3KKW A;  3FBU A;  4NEX A;  5C88 A;  4DYO A;  3L2N A;  4UEF A;  1IYL A;  3LAC A;  3VH9 A;  4AG9 A;  1Q2D A;  2R1I A;  1YSJ A;  3FMC A;  1YGH A;  2Q7B A;  1Y0R A;  2Z0Z A;  1FNO A;  3SXN A;  5IB9 A;  5K8O A;  4PQA A;  2V77 A;  2CF4 A;  1LAM A;  2YNE A;  4NGP A;  5J8C A;  4M85 A;  2GLJ A;  4RN7 A;  1ZG9 A;  4R9M A;  1IIC A;  3CPX A;  2IL4 A;  5ELY A;  3EXN A;  1PYT B;  4UCP A;  1L0C A;  3B2Y A;  1XBU A;  2FT0 A;  1CX8 A;  2DPS A;  1IU8 A;  1Y0Y A;  4WJB A;  4KVM E;  8CPA A;  2OU2 A;  3W6S A;  4HNX B;  3TC8 A;  3B3W A;  2QJ8 A;  2ZEF A;  3IIB A;  3IC1 A;  1Z8W A;  3FIX A;  1JQG A;  1LFW A;  4YRH A;  2GFQ A;  3D2M A;  3S6H A;  1A2Z A;  4CPA A;  4JXR A;  3JUW A;  3NH5 A;  3B3V A;  4MY0 A;  1QSN A;  3WC7 A;  2AFW A;  2PIY A;  2J8N A;  3KHZ A;  4CYP A;  3BI1 A;  3NH8 A;  3SJX A;  5AG4 A;  4FD7 A;  3DLJ A;  4UFX A;  2QYV A;  2IMO A;  5JPH A;  1YLO A;  1S5K A;  4P4E A;  2CNS A;  3FXT A;  3PB6 X;  4L89 A;  2POK A;  2PRB A;  2FIA A;  5H84 A;  1ARM A;  5G21 A;  4C2Z A;  2DEA A;  2BCO A;  2ZOG A;  3FVL A;  4FUU A;  4C68 A;  4JD6 A;  4NGM A;  2PC1 A;  2ZEL A;  1U6M A;  4LQG A;  4I49 A;  3IU1 A;  5ISV A;  3LD2 A;  4KLW A;  2OH1 A;  1M4I A;  2JEW A;  1TF9 A;  4MCR A;  2J9A A;  4CAX A;  2OR4 A;  3R9G A;  5HXD A;  1CBX A;  5DWM A;  4C2X A;  2PJ6 A;  3IWG A;  4R76 A;  5D29 A;  3CXS A;  5THW A;  1Z4E A;  4CGL A;  4NGT A;  4OAD A;  3PGP A;  5G1Z A;  1B6B A;  2DPT A;  3D7D A;  3H4Q A;  5I4M A;  3D7G A;  1YK3 A;  4FD4 A;  1VHO A;  2Z11 A;  4KOW A;  4ZGY B;  4KSA A;  4OC1 A;  4ZBG A;  2PVV A;  4KOU A;  4R7M A;  4II9 A;  4ONU A;  2QVP A;  1ELL P;  2Z3K A;  2ODF A;  4CS0 B;  2B5G B;  5LRG A;  1ZG8 A;  1QST A;  1I1D A;  4UA3 A;  4JWP A;  4OC0 A;  2PE3 A;  2ZEO A;  2O4H A;  5CPA A;  4A31 A;  4EWT A;  2FIW A;  2Z3L A;  1QMU A;  3HLP A;  3KQX A;  1ZG7 A;  3BJ8 A;  3IJ3 A;  2BO9 A;  3S9M A;  3TOA A;  4P4F A;  3RAM A;  2GE3 A;  5HMN A;  4YGO A;  3TT2 A;  4QUS A;  3EFA A;  2OZU A;  4CAV A;  2R8V A;  4PXC A;  2D4O A;  1YW6 A;  3S9N A;  1VHE A;  1ZLI A;  3H8E A;  4OKO A;  4A2Z A;  5K8P A;  1BPN A;  2Z3M A;  5HVG A;  4OC5 A;  1IGB A;  4NJQ A;  1NSA A;  3JVN A;  2AE6 A;  2BEI A;  1Z5R A;  4KUB A;  4OME A;  3BI0 A;  1TKF A;  4ZX8 A;  4F9U A;  3ISZ A;  3RNZ A;  1Y9W A;  2C6C A;  2PJ3 A;  4E8O A;  5IX3 A;  4MHZ A;  4KUA A;  1M4G A;  4JZ0 A;  4R3K A;  1VGY A;  2ABZ A;  2ANP A;  1BPM A;  3OWC A;  3S6G A;  4AB7 A;  4Z65 A;  2D4P A;  1S7F A;  3H8G A;  3BJ7 A;  4IUS A;  4NGQ A;  4NGR A;  2Z3N A;  3JTK A;  5AG6 A;  3GKR A;  3SI2 A;  2RB7 A;  4IF5 A;  4XPD C;  3T9Y A;  2P6G A;  4PSW A;  5HVH A;  1Z8T A;  4MHY A;  1SQH A;  2PJ1 A;  3R96 A;  4UIA A;  5JH9 A;  4LX9 A;  2GLF A;  2P6E A;  1I12 A;  2Q4Y A;  1AUG A;  2WYR A;  3GY9 A;  4M3S A;  2VZY A;  4PXE A;  1YW4 A;  1M4D A;  1YX0 A;  4U9Y A;  2Z10 A;  3QAY A;  4KOT A;  5F49 A;  1CP7 A;  2OOT A;  1Q7L A;  1M4L A;  2ZW7 A;  3B35 A;  4U9Z A;  4HNW B;  1CPX A;  4DUK A;  3D67 A;  2B3V A;  2EWB A;  3SJE A;  3SXO A;  1LAP A;  3FRM A;  2GIV A;  3F5B A;  4MCP A;  4TWE A;  4B14 A;  2JLM A;  4H6Z A;  4PXB A;  4A32 A;  3EC4 A;  3WAB A;  4C2Y A;  4MFP A;  2PRQ A;  1NE9 A;  5GCN A;  1S7L A;  2J8R A;  3RYO A;  2OZG A;  1S7K A;  1YVK A;  1YR0 A;  3CDX A; 
#chains in the Genus database with same CATH homology
 3CPA A;  4YU9 A;  2IJZ A;  7CPA A;  1ELM P;  3MRU A;  3S9L A;  4UF4 A;  3BHX A;  5CBM A;  4IAV A;  2V8G A;  2ZEG A;  3V7Z A;  4FBE A;  2C6G A;  4TNU A;  5K8M A;  2V8D A;  4FWU A;  4R8F A;  2GRE A;  4P10 A;  3KR5 A;  4MCS A;  4NGN A;  2Q43 A;  2I3C A;  2RFH A;  5LRK A;  3D7F A;  1DE4 C;  3PBB A;  2V8H A;  3KAS A;  3JRU A;  1XMB A;  1YME A;  3TX8 A;  2VL1 A;  3KHX A;  4R6T A;  3PEI A;  2PCU A;  3IO1 A;  2AFM A;  3KZW A;  4OIW A;  5HVF A;  3V38 A;  4MMO A;  4NGS A;  3KL9 A;  1CPS A;  5LYI A;  2V8V A;  3NH4 A;  2ZEH A;  1HEE A;  4A38 A;  3N5F A;  2C6P A;  3RZA A;  2CIJ A;  4MHN A;  1XRY A;  4P4B A;  4BD9 A;  5LYL A;  4F8Z A;  1VIX A;  3H8F A;  2PJ0 A;  3T8W A;  2WZN A;  3SI0 A;  1ZLH A;  1TXR A;  2XEF A;  1CP6 A;  3MN8 A;  3HUV A;  3IWW A;  3LWU A;  3PFE A;  5DS0 A;  2EK8 A;  4MCQ A;  3KR4 A;  1QQ9 A;  1BLL E;  4RUH A;  4O23 A;  5LYD A;  4P4D A;  4UEE A;  1RTQ A;  2AFX A;  2JBJ A;  1AMP A;  3K9T A;  2Q51 A;  1LOK A;  4ZYQ A;  3PB7 X;  3WC6 A;  2Q4Z A;  2PJ4 A;  2AFS A;  3NFZ A;  1FT7 A;  1F2O A;  5JGF A;  4G1P A;  3SJG A;  3WT4 A;  4P6Y A;  3KI9 A;  3KGQ A;  6CPA A;  3SJF A;  4PXD A;  3VAR A;  1GYT A;  3B7I A;  2F7V A;  1BAV A;  4P4I A;  2PJ5 A;  4H2K A;  1Z8L A;  2G9D A;  4DJL A;  3IFE A;  1ARL A;  2IQ6 A;  2BOA A;  3PB8 X;  3GB0 A;  4MHP A;  3I1U A;  4ZY2 A;  1PCA A;  4WWV A;  1Y7E A;  1R3N A;  1HDQ A;  3RBU A;  2PJ8 A;  4UIB A;  3PRT A;  4X3R A;  3PB9 X;  2ZEE A;  4GM5 A;  4OC2 A;  4MXU A;  4P4J A;  3QNV A;  4B6Z A;  2JBK A;  4AXV A;  2HC9 A;  2ZOF A;  4IK2 A;  1TF8 A;  2PJ2 A;  3BXM A;  1F2P A;  3FH4 A;  3FEE A;  5F09 A;  3GUX A;  3D7H A;  4ZX9 A;  3D66 A;  2AFZ A;  2ZEN A;  2F8H A;  4K3N A;  4JYW A;  3LMS A;  1Z2L A;  1H8L A;  3PB4 X;  2XEG A;  3D68 A;  2ZEM A;  1UWY A;  2PJA A;  4NJR A;  2AFU A;  3PFO A;  1TKH A;  1TKJ A;  5LYF A;  1CG2 A;  1R43 A;  2FVG A;  2PVW A;  4F9V A;  4IHM A;  2NYQ A;  4Q7A A;  1HDU A;  3ISX A;  4OC3 A;  2XEJ A;  3KQZ A;  4P44 A;  2PJC A;  1LCP A;  2PJB A;  3FJU A;  4A94 A;  3D4U A;  3K2K A;  3FED A;  3GLJ A;  1AYE A;  4X2T A;  3B3C A;  3WC5 A;  4KSI A;  2HB6 A;  3SI1 A;  4YWY A;  3FX6 A;  3IEH A;  4P45 A;  3NA6 A;  4EME A;  4OP4 A;  4ONW A;  3B3S A;  4UEZ A;  3VAT A;  4X8I A;  3FF3 A;  1OBR A;  4ZY1 A;  5LRJ A;  5D8N A;  2PJ9 A;  2C1C A;  3B3T A;  2ZEP A;  4A39 A;  4OID A;  4OC4 A;  4ZI6 A;  2O53 A;  2PIZ A;  2CTB A;  3PBE A;  1KWM A;  1LAN A;  4FAI A;  1XJO A;  4PPZ A;  5JM6 A;  1IY7 A;  2AFO A;  5K8N A;  2EK9 A;  3DGV A;  3FEC A;  4A37 A;  2GU2 A;  2CTC A;  2XEI A;  5J1Q A;  1EE3 P;  2ZED A;  2NSM A;  4W9Y A;  4NFR A;  2PJ7 A;  4ZY0 A;  1XFO A;  1DTD A;  1F57 A;  4MRI A;  3CT9 A;  4EFD A;  4DYO A;  3L2N A;  4UEF A;  3VH9 A;  1YSJ A;  3FMC A;  1Y0R A;  1FNO A;  5K8O A;  5IB9 A;  4PQA A;  2V77 A;  2CF4 A;  1LAM A;  4NGP A;  2GLJ A;  1ZG9 A;  3CPX A;  5ELY A;  1PYT B;  3B2Y A;  1XBU A;  1CX8 A;  1Y0Y A;  4WJB A;  8CPA A;  3TC8 A;  3B3W A;  2QJ8 A;  2ZEF A;  3IIB A;  3IC1 A;  1JQG A;  1LFW A;  4CPA A;  3NH5 A;  3B3V A;  3WC7 A;  2AFW A;  2PIY A;  3KHZ A;  3BI1 A;  3NH8 A;  3SJX A;  3DLJ A;  2QYV A;  2IMO A;  1YLO A;  4P4E A;  3PB6 X;  2POK A;  1ARM A;  2DEA A;  2BCO A;  2ZOG A;  3FVL A;  4FUU A;  4NGM A;  2ZEL A;  4LQG A;  4MCR A;  2JEW A;  1TF9 A;  2J9A A;  2OR4 A;  5HXD A;  1CBX A;  2PJ6 A;  4R76 A;  5THW A;  5D29 A;  4NGT A;  3D7D A;  5I4M A;  3D7G A;  1VHO A;  4OC1 A;  2PVV A;  4R7M A;  2QVP A;  1ELL P;  5LRG A;  1ZG8 A;  4OC0 A;  2PE3 A;  2ZEO A;  2O4H A;  5CPA A;  4EWT A;  3HLP A;  3KQX A;  1QMU A;  4F9U A;  1ZG7 A;  3IJ3 A;  2BO9 A;  3S9M A;  4P4F A;  3RAM A;  4PXC A;  1YW6 A;  3S9N A;  1VHE A;  1ZLI A;  3H8E A;  5K8P A;  1BPN A;  5HVG A;  4OC5 A;  1IGB A;  4NJQ A;  1NSA A;  1Z5R A;  4OME A;  3BI0 A;  1TKF A;  4ZX8 A;  3ISZ A;  2C6C A;  2PJ3 A;  4MHZ A;  4JZ0 A;  1VGY A;  2ABZ A;  2ANP A;  1BPM A;  4Z65 A;  3H8G A;  4NGQ A;  4NGR A;  3SI2 A;  2RB7 A;  5HVH A;  4MHY A;  2PJ1 A;  4UIA A;  5JH9 A;  2GLF A;  2WYR A;  4PXE A;  1YW4 A;  2OOT A;  1CP7 A;  1Q7L A;  1M4L A;  3B35 A;  1CPX A;  4DUK A;  3D67 A;  2EWB A;  3SJE A;  1LAP A;  4MCP A;  4TWE A;  4PXB A;  3WAB A;  2PRQ A;  4OKO A;  3CDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...