2ZEEA

Crystal structure of the human glutaminyl cyclase mutant s160g at 1.99 angstrom resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDGAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Glutaminyl-peptide cyclotransferase
total genus 109
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2007-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2zeeA00
1ELLP 1KWMA 1PYTB 3FEDA 2AFMA 4OKOA 2V8DA 4PXEA 3B2YA 1CP7A 8CPAA 3B3CA 4OP4A 3SI0A 5J1QA 2GLJA 2JEWA 3IO1A 4NGTA 1TXRA 2QJ8A 5D29A 3D7HA 4MRIA 2PJCA 4MMOA 5LYFA 3PB4X 4X3RA 3WC7A 2C1CA 5F09A 3IIBA 2ZEEA 2O4HA 3RBUA 4R7MA 3NA6A 5IB9A 2F8HA 4YU9A 2AFSA 1EE3P 4P6YA 2BCOA 4F8ZA 1XMBA 3RZAA 4P4JA 2PJ1A 1ZLIA 4MCQA 3JRUA 2IJZA 1CPXA 1HDQA 3B7IA 3KR4A 3SJFA 3SI1A 4NGQA 4P4DA 4P4BA 2ZEPA 3DLJA 3GB0A 3V7ZA 5HVGA 3D67A 1CG2A 2PJ5A 4IK2A 4B6ZA 1XJOA 3PB7X 3S9MA 5K8NA 2I3CA 6CPAA 4A38A 2XEFA 3D7GA 1XFOA 4A94A 1Y0RA 2IMOA 2ZEGA 2EK9A 3TC8A 4UEEA 3CT9A 2AFUA 3FF3A 4NGSA 1XBUA 3H8FA 4H2KA 2V77A 1HEEA 2QYVA 1BLLE 2WYRA 4UF4A 2ZOGA 4P44A 1YSJA 1Y0YA 2XEIA 1Z2LA 2PJ3A 4EMEA 3NH4A 3FX6A 3PBBA 1LANA 3B3TA 1ARMA 2ZEFA 3RAMA 3NFZA 1AMPA 1UWYA 4OC4A 2EK8A 1LAPA 4ZYQA 2AFOA 1F2PA 1FNOA 2GREA 3ISXA 3KL9A 4NJQA 4NJRA 2CTCA 5K8PA 4FUUA 4DUKA 4JZ0A 2AFXA 2NYQA 2ZOFA 2ZELA 2ZENA 3CDXA 3ISZA 3SJXA 5D8NA 1Q7LA 2ABZA 3QNVA 5DS0A 5K8OA 1R3NA 4UEFA 1YW6A 2CF4A 1R43A 4NGPA 3HLPA 2F7VA 5LRKA 4OC5A 4RUHA 3GLJA 5HXDA 3FH4A 2ZEOA 3I1UA 2HB6A 3LWUA 2AFZA 4OC3A 4R8FA 2ANPA 4ZY0A 1ARLA 4NGNA 3N5FA 4MCRA 4NFRA 5JM6A 4ZY2A 2GLFA 3D68A 3VH9A 3KHZA 4G1PA 4IHMA 1PCAA 1LFWA 4OMEA 2ZEMA 5CPAA 3S9NA 2Q4ZA 1YLOA 3MRUA 4MHPA 4BD9A 3BI1A 4PXCA 2WZNA 4A39A 4OC1A 1TKHA 2PIYA 1M4LA 4P4FA 1CPSA 3FMCA 3D4UA 2PVVA 3HUVA 3PRTA 5JH9A 4CPAA 4EWTA 2PJBA 1YMEA 3FVLA 3VARA 3LMSA 2PJ8A 4TNUA 2XEJA 4MHZA 2EWBA 4MHYA 1OBRA 4R76A 2PRQA 1TKJA 2ZEHA 5THWA 4AXVA 4O23A 2PE3A 1TF8A 3KQXA 3D66A 4OC0A 4F9UA 2CTBA 1Z8LA 2XEGA 5HVHA 5LYIA 3IC1A 4NGRA 4FWUA 4Z65A 4MHNA 2ZEDA 3L2NA 4ZI6A 2OR4A 1HDUA 1F57A 2HC9A 5CBMA 2C6PA 3CPXA 1IGBA 1VHEA 4UIAA 1VHOA 4PQAA 1LCPA 2PJAA 4X2TA 3DGVA 5LRJA 4WJBA 2Q51A 4X8IA 3B3WA 1F2OA 4IAVA 1IY7A 2BO9A 2PJ0A 3K9TA 1LAMA 3B3SA 3KQZA 2V8GA 1XRYA 3PB9X 3KASA 5LRGA 4DJLA 1Z5RA 4R6TA 3PFOA 3SI2A 2O53A 3WT4A 1VGYA 2JBKA 3GUXA 3FJUA 5JGFA 2V8HA 4FBEA 1H8LA 4GM5A 2BOAA 4LQGA 1QQ9A 3IJ3A 3VATA 1TKFA 4OIDA 4F9VA 4ZY1A 1ELMP 4P10A 2G9DA 3K2KA 4OIWA 3TX8A 2PCUA 3NH5A 1NSAA 3T8WA 4KSIA 2RFHA 1CP6A 1ZLHA 1DE4C 4P4EA 3H8GA 3KHXA 4PPZA 4UIBA 1BPMA 3S9LA 5I4MA 1GYTA 3KGQA 5ELYA 1CX8A 2RB7A 3D7DA 3CPAA 3IEHA 3KI9A 3PEIA 3WC6A 3D7FA 3WABA 2QVPA 1LOKA 2POKA 4YWYA 3SJEA 2PJ9A 3PB8X 4UEZA 4ZX8A 3FECA 1AYEA 4EFDA 4NGMA 1ZG7A 3B35A 2PIZA 2NSMA 2JBJA 2PJ7A 2PJ2A 3PB6X 3PFEA 4FAIA 1JQGA 1TF9A 1RTQA 1ZG8A 2PJ6A 3BXMA 5LYDA 1VIXA 2OOTA 1BPNA 2C6CA 2DEAA 2C6GA 4P45A 3PBEA 4MCPA 7CPAA 3KR5A 3SJGA 4JYWA 2GU2A 4W9YA 4DYOA 3BI0A 4PXBA 4ZX9A 4TWEA 1Y7EA 1FT7A 2FVGA 4OC2A 1YW4A 2J9AA 3V38A 3IFEA 4A37A 5LYLA 4MXUA 2AFWA 2VL1A 5K8MA 2CIJA 5HVFA 1QMUA 4P4IA 3KZWA 1BAVA 4Q7AA 3H8EA 3WC5A 1CBXA 3B3VA 3MN8A 4WWVA 2V8VA 2IQ6A 2Q43A 1DTDA 2PVWA 4ONWA 3IWWA 3NH8A 4K3NA 1ZG9A 3FEEA 4PXDA 2PJ4A 4MCSA 3BHXA
chains in the Genus database with same CATH superfamily
2EO8A 2EVNA 1ELLP 2BL1A 1KWMA 1KUVA 1PYTB 2P0WA 1VKCA 4B5OA 4II9A 3H4QA 3FEDA 2AFMA 4OKOA 2V8DA 4PXEA 4KS9A 1QSRA 4XPLA 1QSOA 5AG7A 1FY7A 1CP7A 3B2YA 1Z8TA 8CPAA 2FT0A 3B3CA 4OP4A 3SI0A 3C26A 5J1QA 5JPHA 2GLJA 2JEWA 3IO1A 4NGTA 3VWDA 2JDDA 4YGOA 2B4DB 1TXRA 4CGLA 2QJ8A 5D29A 3D7HA 4F6AA 4MRIA 1S60A 4PSWA 2PJCA 2OZGA 2B5GA 3EY5A 4NF1A 4MMOA 4AVAA 5LYFA 2YNDA 3FBUA 3PB4X 4X3RA 3WC7A 4C7IA 2C1CA 4U9ZA 5F09A 3IIBA 2ZEEA 2O4HA 3RBUA 2OH1A 4AVBA 4MFLA 4R7MA 3IU2A 3NA6A 5IB9A 4C2ZA 3A9LA 2F8HA 4YU9A 2PR1A 2AFSA 1EE3P 1RXTA 4P6YA 4YRHA 2BCOA 3SXNA 1A2ZA 4F8ZA 1XMBA 2Y0MA 2X7BA 3GY9A 4P4JA 3RZAA 4IF5A 3BLNA 4M85A 2PJ1A 1S7NA 1Z4EA 1ZLIA 4MCQA 3UY5A 3JRUA 2IJZA 2VXKA 2ZW7A 4U5YA 2DPSA 2ZW5A 1CPXA 1HDQA 4CYQA 2FIWA 2KCWA 4OADA 4F0XA 4M6IA 3B8GA 3B7IA 4M6HA 3KR4A 1Z8XA 3SJFA 4KOVA 3SI1A 4HNYB 1KUYA 1QSTA 3BJ8A 4NGQA 4OLLA 2Z3KA 4P4DA 2K5TA 3I9SA 1S3ZA 2ZEPA 1IYKA 3DLJA 3QB8A 4MY3A 3GB0A 4P4BA 3V7ZA 4CGPA 1J4JA 3EXNA 4AVCA 5C82A 5HVGA 3D67A 1CG2A 2PJ5A 4KVME 4IK2A 4B6ZA 1XJOA 3PB7X 4R3LA 3S9MA 1XF8A 5K8NA 2I3CA 1M44A 6CPAA 2VQYA 4HNXB 1WK4A 5IB0A 4A38A 2XEFA 5G20A 5EC4A 3D7GA 1XFOA 1BOBA 1M1DA 3S6GA 4A94A 5A28A 2OB0A 1IOIA 3EFAA 4B14A 4AG7A 1SQHA 1Y0RA 2AE6A 2EK9A 1OZPA 2IMOA 1P0HA 2ZEGA 3LODA 2Z0ZA 3TC8A 4UEEA 3CT9A 4MJ8A 4A2ZA 4ZGYB 4PK3A 2AFUA 3FF3A 2FIAA 2ZXVA 4MBUA 4NGSA 4A30A 4R9MA 2BUEA 4KORA 1NSLA 1XBUA 3H8FA 2YNCA 4H2KA 3T9YA 2V77A 1HEEA 2QYVA 1BLLE 3N7ZA 1YR0A 2WYRA 4UF4A 2ZOGA 4P44A 4J3GA 1YSJA 4LUAA 1Y0YA 2XEIA 4MFQA 1Z2LA 4Q38A 2PJ3A 2B58A 4PSXA 4EMEA 1N71A 3NH4A 2F5IA 2PDOA 4H6UA 2WPWA 4JJXA 3EC4A 4B13A 3FX6A 3PBBA 3R95A 1LANA 3B3TA 2YNEA 3QAYA 1S7LA 3K9UA 1ARMA 2ZEFA 2G0BA 5J8FA 3RAMA 2YNCC 3NFZA 4FD7A 4CAVA 1AMPA 5KTAA 1UWYA 2ATRA 2VI7A 4MFPA 4CYNA 4JLYA 2EBJA 4OC4A 2EK8A 1LAPA 4UWIA 1YLEA 1I12A 4JXQA 4MFZA 1MK4A 4ZYQA 2AFOA 1P4NA 4XPKA 4BBHA 1YX0A 1F2PA 1YQEA 1FNOA 2GREA 3SHPA 2PSWA 3ISXA 3KL9A 4NJQA 4NJRA 2Q7BA 3IWGA 2Q44A 2QMLA 2CTCA 5FVJA 5K8PA 1X12A 4FUUA 4JZ0A 4DUKA 2AFXA 2Z3NA 4CYOA 2NYQA 1XOVA 2ZOFA 2G3TA 4A32A 4CAEA 2ZELA 2ZENA 4UA3A 4RI1A 3CDXA 3ISZA 3SJXA 4QVTA 1LRZA 5D8NA 1Q7LA 2ABZA 4B5PA 3QNVA 2B5GB 5DS0A 5K8OA 4JXRA 2BSWA 5BWAB 1R3NA 5HH1A 4UEFA 1YW6A 3G8WA 3CXQA 2CF4A 5DWNA 1R43A 4NGPA 3HLPA 2F7VA 3P2HA 4OC5A 3VWEA 5LRKA 1B87A 4RUHA 5EMIA 3GLJA 2ARHA 5H86A 5HXDA 2OZUA 3FH4A 4KOSA 2ZEOA 2OU2A 3D3SA 3DNSA 3KKWA 2DF5A 3I1UA 2HB6A 4UFVA 3LWUA 2AFZA 4OC3A 4R8FA 1S7KA 4CRYB 2CY2A 2ANPA 4RN7A 3TTHA 4HKFA 4ZY0A 1ARLA 3TOAA 4NGNA 3PZJA 3N5FA 4MCRA 2Q4VA 2FS5A 4NFRA 5JM6A 4ZY2A 2GLFA 2B4DA 4KOUA 4NSQA 4Q36A 3D68A 4QBJA 1PUAA 4GXHA 3VH9A 3KHZA 1GHEA 1Z8WA 4XNHC 3TE4A 4KZTA 4A95A 3RO0A 3R9EA 4G1PA 4IHMA 1JWQA 1PCAA 1LFWA 2FE7A 2VZZA 2ZEMA 1Y7RA 2JDCA 4FD4A 4OMEA 5CPAA 2Q4ZA 3S9NA 1YLOA 4H89A 4B11A 1KUXA 3MRUA 4MHPA 1IICA 4BD9A 3BI1A 4KUAA 2DXQA 4PXCA 4I49A 2J8MA 2WZNA 3RYOA 1ON0A 3CXSA 4MI4A 4XPDB 4KOXA 4A39A 3DSBA 3FYNA 4OC1A 1TKHA 2REFA 4YFJA 2PIYA 2I79A 1M4LA 3R96A 4P4FA 1CPSA 3FMCA 1Q2DA 1XEBA 3D4UA 2PVVA 2EUIA 3HUVA 4KLWA 3PRTA 3ZJ0A 5JH9A 4CPAA 4ORFA 4EWTA 2PJBA 1YMEA 2O28A 3FVLA 3LACA 5F48A 2NMTA 4NEXA 2P6FA 3RNZA 3VARA 2H5MA 4HPSA 2PRBA 4Y49C 3LMSA 1UFHA 2GIVA 2PJ8A 3I3GA 1QSMA 4TNUA 2XEJA 4PK2A 3TO9A 4MHZA 1MJAA 1Y9WA 2EWBA 3S6FA 1K4JA 4MHYA 1OBRA 4C68A 3D2PA 4R76A 1M4GA 5E96A 2HQYA 2D4OA 2PRQA 1TKJA 2ZEHA 5THWA 3SXOA 4O23A 2PE3A 1TF8A 4AXVA 2CNSA 3KQXA 3D66A 4OC0A 1IB1E 4F9UA 2CTBA 2YGWA 5H84A 1Z8LA 2XEGA 1NE9A 5HVHA 5LYIA 1S5KA 4CRZB 3IC1A 1Y9KA 4NGRA 4MFKA 4FWUA 4Z65A 4MHNA 2ZEDA 3L2NA 3DDDA 3TCVA 4A33A 4B12A 2OR4A 4ZI6A 2CNTA 1HDUA 2WPXA 4PV6A 1F57A 3DR8A 2HC9A 5CBMA 2C6PA 3CPXA 1IGBA 1VHEA 4UIAA 1VHOA 3FRMA 4PQAA 1IIDA 2BEIA 3H5ZA 3EO4A 3LD2A 4H6ZA 4KOWA 1LCPA 3W91A 2PJAA 4A31A 4C2YA 4KSFA 3GIUA 4L8AA 3ZZIA 1Z4RA 4X2TA 2FSRA 5F49A 2WSAA 3DGVA 3R9GA 5LRJA 4WJBA 2Q51A 4X8IA 4QUSA 2A4NA 4C2XA 3GKRA 3B3WA 1F2OA 4EVYA 4R57A 3W6XA 1L0CA 2Z10A 2R98A 4IAVA 1M4IA 4CAWA 1IY7A 4QC6A 5KTCA 2JEVA 4ONUA 5I0CA 5AG5A 2BO9A 4QB9A 2PJ0A 2J8RA 1LAMA 3K9TA 5A27A 2PC1A 3F5BA 1YREA 3B3SA 2PQ8A 1RO5A 3KQZA 2V8GA 3D2MA 1XRYA 1CJWA 1Q2YA 2G3AA 4R3KA 3PB9X 2FL4A 3KASA 1M4DA 5LRGA 1Z5RA 2CNMA 4R6TA 1Z9UA 2Q7SA 2VBQA 4DJLA 3PFOA 5LYDA 2ZW6A 1IYLA 4B5PB 4C7HA 4UFXA 3SI2A 1TIQA 2O53A 4NXYA 4XPDC 3S6KA 3IGRA 3WT4A 1VGYA 2JBKA 2J8NA 3GUXA 3FJUA 5JGFA 1U6MA 4F0YA 2V8HA 4FBEA 2CXAA 1H8LA 4K30A 4OAEA 4GM5A 2DPTA 2BOAA 5F46A 4LQGA 4UCNA 2C27A 5EBVA 1QQ9A 3IJ3A 3JVNA 3VATA 1TKFA 1KZFA 1XIXA 4OIDA 2OZHA 4F9VA 1WWZA 2GFQA 4ZY1A 3F0AA 3WR7A 4CS0B 1ELMP 4P10A 2G9DA 3K2KA 4OIWA 5ISVA 4Y49B 3TX8A 4MHDA 4UCMA 4XNHB 1V0CA 2PCUA 4LX9A 3NE7A 3NH5A 2P6GA 1YK3A 1NSAA 3JUWA 3T8WA 4UWJA 4KSIA 3FNCA 2RFHA 1CP6A 1ZLHA 1DE4C 4FD5A 4FD6A 4P4EA 5G21A 4IUSA 3D8PA 3H8GA 2ODFA 3T90A 5C88A 1S7FA 3TFYA 3KHXA 3TO7A 2IL4A 3TOBA 4PPZA 2QECA 1BPMA 4UIBA 4X5KA 1BO4A 3S9LA 4R87A 5I4MA 4CGOA 5G1ZA 1GYTA 2VEZA 2FXFA 3KGQA 5ELYA 1IOFA 1CX8A 2RB7A 3D7DA 3CPAA 3IEHA 3KI9A 3OWCA 3PEIA 4UCPA 1VHSA 5AGEA 3WC6A 3D7FA 3WABA 4B10A 2QVPA 2R8VA 4MFJA 1AUGA 3JTKA 4E8OA 1LOKA 2POKA 4YWYA 5G22A 2RC4A 2PJ9A 3SJEA 4BINA 4CAFA 2JLMA 1YGHA 3PB8X 1Q2CA 2I00A 2Q0YA 4W9YA 4UEZA 5F47A 3FECA 4KVOE 2FCKA 4ZX8A 1CM0A 1AYEA 4KOTA 3IWEA 4EFDA 4ZBGA 3PGPA 4NGMA 1XE4A 1ZG7A 2GE3A 1I1DA 3B35A 3DR6A 2PIZA 2NSMA 2JBJA 2PJ7A 2PJ2A 3PB6X 3E0KA 4U9YA 5HMNA 1YVKA 3PFEA 3NE8A 3TO6A 3BJ7A 5AG4A 2Z3OA 3CXPA 4KLVA 4FAIA 1JQGA 1TF9A 1RTQA 1ZG8A 2AJ6A 2PJ6A 2Q04A 3BXMA 3FB3A 4GS4A 1VIXA 1R57A 1NMTA 4M3SA 2OOTA 3TT2A 3W6SA 1BPNA 2C6CA 5KTDA 3S6HA 2R1IA 2DEAA 4CAXA 2Z3MA 2C6GA 4P45A 3PBEA 5DWMA 4E0AA 2Z3PA 3PP9A 4DYOA 4M6GA 1XMTA 2ZPAA 4MCPA 7CPAA 3KR5A 3P2FA 4KVXA 4JYWA 3SJGA 2GU2A 3G3SA 2B3UA 3FXTA 2VZYA 4LQ6A 2QIRA 2B4BA 1QSNA 1B6BA 1MJ9A 2HV2A 2Q4YA 3BI0A 4PXBA 4ZX9A 4TWEA 3V8IA 5CNPA 5GCNA 4CYPA 1IU8A 1Y7EA 1FT7A 2FVGA 2Z11A 2R7HA 4HNWB 1YW4A 4OC2A 2J9AA 4MY0A 3V38A 3IFEA 4A37A 5LYLA 2Z3LA 4MXUA 2AFWA 2PR8A 3IU1A 5J8CA 2VL1A 3MGDA 3QAHA 5K8MA 2B3VA 2CIJA 4NCZA 5HVFA 4AB7A 3CZXA 1ZO0A 2HUZA 1QMUA 4P4IA 2D4PA 1X10A 4DNCA 4CGMA 3KZWA 4UFWA 4E2AA 1BAVA 4Q7AA 2P6EA 3H8EA 1I21A 4JD6A 4L89A 3WC5A 4AG9A 4CGNA 1YVOA 3FIXA 1CBXA 3B3VA 3MN8A 4WWVA 2REEA 1MJBA 2GANA 2V8VA 4KOYA 4BMHA 5IV0A 2IQ6A 2Q43A 1DTDA 2PVWA 5IX3A 3R1KA 3IWWA 3NH8A 4K3NA 4ONWA 4UBRA 1ZG9A 4RS2A 3FEEA 2ZW4A 5AG6A 3F8KA 4PXDA 5JQ4A 2PJ4A 1PU9A 4MCSA 4KUBA 3R9FA 3GYAA 4KSAA 2WUUA 4JWPA 3BHXA
chains in the Genus database with same CATH topology
1ELLP 1KWMA 1PYTB 3FEDA 2AFMA 4OKOA 2V8DA 4PXEA 3B2YA 1CP7A 8CPAA 3B3CA 4OP4A 3SI0A 5J1QA 2GLJA 2JEWA 3IO1A 4NGTA 1TXRA 2QJ8A 5D29A 3D7HA 4MRIA 2PJCA 4MMOA 5LYFA 3PB4X 4X3RA 3WC7A 2C1CA 5F09A 3IIBA 2ZEEA 2O4HA 3RBUA 4R7MA 3NA6A 5IB9A 2F8HA 4YU9A 2AFSA 1EE3P 4P6YA 2BCOA 4F8ZA 1XMBA 3RZAA 4P4JA 2PJ1A 1ZLIA 4MCQA 3JRUA 2IJZA 1CPXA 1HDQA 3B7IA 3KR4A 3SJFA 3SI1A 4NGQA 4P4DA 4P4BA 2ZEPA 3DLJA 3GB0A 3V7ZA 5HVGA 3D67A 1CG2A 2PJ5A 4IK2A 4B6ZA 1XJOA 3PB7X 3S9MA 5K8NA 2I3CA 6CPAA 4A38A 2XEFA 3D7GA 1XFOA 4A94A 1Y0RA 2IMOA 2ZEGA 2EK9A 3TC8A 4UEEA 3CT9A 2AFUA 3FF3A 4NGSA 1XBUA 3H8FA 4H2KA 2V77A 1HEEA 2QYVA 1BLLE 2WYRA 4UF4A 2ZOGA 4P44A 1YSJA 1Y0YA 2XEIA 1Z2LA 2PJ3A 4EMEA 3NH4A 3FX6A 3PBBA 1LANA 3B3TA 1ARMA 2ZEFA 3RAMA 3NFZA 1AMPA 1UWYA 4OC4A 2EK8A 1LAPA 4ZYQA 2AFOA 1F2PA 1FNOA 2GREA 3ISXA 3KL9A 4NJQA 4NJRA 2CTCA 5K8PA 4FUUA 4DUKA 4JZ0A 2AFXA 2NYQA 2ZOFA 2ZELA 2ZENA 3CDXA 3ISZA 3SJXA 5D8NA 1Q7LA 2ABZA 3QNVA 5DS0A 5K8OA 1R3NA 4UEFA 1YW6A 2CF4A 1R43A 4NGPA 3HLPA 2F7VA 5LRKA 4OC5A 4RUHA 3GLJA 5HXDA 3FH4A 2ZEOA 3I1UA 2HB6A 3LWUA 2AFZA 4OC3A 4R8FA 2ANPA 4ZY0A 1ARLA 4NGNA 3N5FA 4MCRA 4NFRA 5JM6A 4ZY2A 2GLFA 3D68A 3VH9A 3KHZA 4G1PA 4IHMA 1PCAA 1LFWA 4OMEA 2ZEMA 5CPAA 3S9NA 2Q4ZA 1YLOA 3MRUA 4MHPA 4BD9A 3BI1A 4PXCA 2WZNA 4A39A 4OC1A 1TKHA 2PIYA 1M4LA 4P4FA 1CPSA 3FMCA 3D4UA 2PVVA 3HUVA 3PRTA 5JH9A 4CPAA 4EWTA 2PJBA 1YMEA 3FVLA 3VARA 3LMSA 2PJ8A 4TNUA 2XEJA 4MHZA 2EWBA 4MHYA 1OBRA 4R76A 2PRQA 1TKJA 2ZEHA 5THWA 4AXVA 4O23A 2PE3A 1TF8A 3KQXA 3D66A 4OC0A 4F9UA 2CTBA 1Z8LA 2XEGA 5HVHA 5LYIA 3IC1A 4NGRA 4FWUA 4Z65A 4MHNA 2ZEDA 3L2NA 4ZI6A 2OR4A 1HDUA 1F57A 2HC9A 5CBMA 2C6PA 3CPXA 1IGBA 1VHEA 4UIAA 1VHOA 4PQAA 1LCPA 2PJAA 4X2TA 3DGVA 5LRJA 4WJBA 2Q51A 4X8IA 3B3WA 1F2OA 4IAVA 1IY7A 2BO9A 2PJ0A 3K9TA 1LAMA 3B3SA 3KQZA 2V8GA 1XRYA 3PB9X 3KASA 5LRGA 4DJLA 1Z5RA 4R6TA 3PFOA 3SI2A 2O53A 3WT4A 1VGYA 2JBKA 3GUXA 3FJUA 5JGFA 2V8HA 4FBEA 1H8LA 4GM5A 2BOAA 4LQGA 1QQ9A 3IJ3A 3VATA 1TKFA 4OIDA 4F9VA 4ZY1A 1ELMP 4P10A 2G9DA 3K2KA 4OIWA 3TX8A 2PCUA 3NH5A 1NSAA 3T8WA 4KSIA 2RFHA 1CP6A 1ZLHA 1DE4C 4P4EA 3H8GA 3KHXA 4PPZA 4UIBA 1BPMA 3S9LA 5I4MA 1GYTA 3KGQA 5ELYA 1CX8A 2RB7A 3D7DA 3CPAA 3IEHA 3KI9A 3PEIA 3WC6A 3D7FA 3WABA 2QVPA 1LOKA 2POKA 4YWYA 3SJEA 2PJ9A 3PB8X 4UEZA 4ZX8A 3FECA 1AYEA 4EFDA 4NGMA 1ZG7A 3B35A 2PIZA 2NSMA 2JBJA 2PJ7A 2PJ2A 3PB6X 3PFEA 4FAIA 1JQGA 1TF9A 1RTQA 1ZG8A 2PJ6A 3BXMA 5LYDA 1VIXA 2OOTA 1BPNA 2C6CA 2DEAA 2C6GA 4P45A 3PBEA 4MCPA 7CPAA 3KR5A 3SJGA 4JYWA 2GU2A 4W9YA 4DYOA 3BI0A 4PXBA 4ZX9A 4TWEA 1Y7EA 1FT7A 2FVGA 4OC2A 1YW4A 2J9AA 3V38A 3IFEA 4A37A 5LYLA 4MXUA 2AFWA 2VL1A 5K8MA 2CIJA 5HVFA 1QMUA 4P4IA 3KZWA 1BAVA 4Q7AA 3H8EA 3WC5A 1CBXA 3B3VA 3MN8A 4WWVA 2V8VA 2IQ6A 2Q43A 1DTDA 2PVWA 4ONWA 3IWWA 3NH8A 4K3NA 1ZG9A 3FEEA 4PXDA 2PJ4A 4MCSA 3BHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ELL P;  1KWM A;  1PYT B;  3FED A;  2AFM A;  4OKO A;  2V8D A;  4PXE A;  3B2Y A;  1CP7 A;  8CPA A;  3B3C A;  4OP4 A;  3SI0 A;  5J1Q A;  2GLJ A;  2JEW A;  3IO1 A;  4NGT A;  1TXR A;  2QJ8 A;  5D29 A;  3D7H A;  4MRI A;  2PJC A;  4MMO A;  5LYF A;  3PB4 X;  4X3R A;  3WC7 A;  2C1C A;  5F09 A;  3IIB A;  2ZEE A;  2O4H A;  3RBU A;  4R7M A;  3NA6 A;  5IB9 A;  2F8H A;  4YU9 A;  2AFS A;  1EE3 P;  4P6Y A;  2BCO A;  4F8Z A;  1XMB A;  3RZA A;  4P4J A;  2PJ1 A;  1ZLI A;  4MCQ A;  3JRU A;  2IJZ A;  1CPX A;  1HDQ A;  3B7I A;  3KR4 A;  3SJF A;  3SI1 A;  4NGQ A;  4P4D A;  4P4B A;  2ZEP A;  3DLJ A;  3GB0 A;  3V7Z A;  5HVG A;  3D67 A;  1CG2 A;  2PJ5 A;  4IK2 A;  4B6Z A;  1XJO A;  3PB7 X;  3S9M A;  5K8N A;  2I3C A;  6CPA A;  4A38 A;  2XEF A;  3D7G A;  1XFO A;  4A94 A;  1Y0R A;  2IMO A;  2ZEG A;  2EK9 A;  3TC8 A;  4UEE A;  3CT9 A;  2AFU A;  3FF3 A;  4NGS A;  1XBU A;  3H8F A;  4H2K A;  2V77 A;  1HEE A;  2QYV A;  1BLL E;  2WYR A;  4UF4 A;  2ZOG A;  4P44 A;  1YSJ A;  1Y0Y A;  2XEI A;  1Z2L A;  2PJ3 A;  4EME A;  3NH4 A;  3FX6 A;  3PBB A;  1LAN A;  3B3T A;  1ARM A;  2ZEF A;  3RAM A;  3NFZ A;  1AMP A;  1UWY A;  4OC4 A;  2EK8 A;  1LAP A;  4ZYQ A;  2AFO A;  1F2P A;  1FNO A;  2GRE A;  3ISX A;  3KL9 A;  4NJQ A;  4NJR A;  2CTC A;  5K8P A;  4FUU A;  4DUK A;  4JZ0 A;  2AFX A;  2NYQ A;  2ZOF A;  2ZEL A;  2ZEN A;  3CDX A;  3ISZ A;  3SJX A;  5D8N A;  1Q7L A;  2ABZ A;  3QNV A;  5DS0 A;  5K8O A;  1R3N A;  4UEF A;  1YW6 A;  2CF4 A;  1R43 A;  4NGP A;  3HLP A;  2F7V A;  5LRK A;  4OC5 A;  4RUH A;  3GLJ A;  5HXD A;  3FH4 A;  2ZEO A;  3I1U A;  2HB6 A;  3LWU A;  2AFZ A;  4OC3 A;  4R8F A;  2ANP A;  4ZY0 A;  1ARL A;  4NGN A;  3N5F A;  4MCR A;  4NFR A;  5JM6 A;  4ZY2 A;  2GLF A;  3D68 A;  3VH9 A;  3KHZ A;  4G1P A;  4IHM A;  1PCA A;  1LFW A;  4OME A;  2ZEM A;  5CPA A;  3S9N A;  2Q4Z A;  1YLO A;  3MRU A;  4MHP A;  4BD9 A;  3BI1 A;  4PXC A;  2WZN A;  4A39 A;  4OC1 A;  1TKH A;  2PIY A;  1M4L A;  4P4F A;  1CPS A;  3FMC A;  3D4U A;  2PVV A;  3HUV A;  3PRT A;  5JH9 A;  4CPA A;  4EWT A;  2PJB A;  1YME A;  3FVL A;  3VAR A;  3LMS A;  2PJ8 A;  4TNU A;  2XEJ A;  4MHZ A;  2EWB A;  4MHY A;  1OBR A;  4R76 A;  2PRQ A;  1TKJ A;  2ZEH A;  5THW A;  4AXV A;  4O23 A;  2PE3 A;  1TF8 A;  3KQX A;  3D66 A;  4OC0 A;  4F9U A;  2CTB A;  1Z8L A;  2XEG A;  5HVH A;  5LYI A;  3IC1 A;  4NGR A;  4FWU A;  4Z65 A;  4MHN A;  2ZED A;  3L2N A;  4ZI6 A;  2OR4 A;  1HDU A;  1F57 A;  2HC9 A;  5CBM A;  2C6P A;  3CPX A;  1IGB A;  1VHE A;  4UIA A;  1VHO A;  4PQA A;  1LCP A;  2PJA A;  4X2T A;  3DGV A;  5LRJ A;  4WJB A;  2Q51 A;  4X8I A;  3B3W A;  1F2O A;  4IAV A;  1IY7 A;  2BO9 A;  2PJ0 A;  3K9T A;  1LAM A;  3B3S A;  3KQZ A;  2V8G A;  1XRY A;  3PB9 X;  3KAS A;  5LRG A;  4DJL A;  1Z5R A;  4R6T A;  3PFO A;  3SI2 A;  2O53 A;  3WT4 A;  1VGY A;  2JBK A;  3GUX A;  3FJU A;  5JGF A;  2V8H A;  4FBE A;  1H8L A;  4GM5 A;  2BOA A;  4LQG A;  1QQ9 A;  3IJ3 A;  3VAT A;  1TKF A;  4OID A;  4F9V A;  4ZY1 A;  1ELM P;  4P10 A;  2G9D A;  3K2K A;  4OIW A;  3TX8 A;  2PCU A;  3NH5 A;  1NSA A;  3T8W A;  4KSI A;  2RFH A;  1CP6 A;  1ZLH A;  1DE4 C;  4P4E A;  3H8G A;  3KHX A;  4PPZ A;  4UIB A;  1BPM A;  3S9L A;  5I4M A;  1GYT A;  3KGQ A;  5ELY A;  1CX8 A;  2RB7 A;  3D7D A;  3CPA A;  3IEH A;  3KI9 A;  3PEI A;  3WC6 A;  3D7F A;  3WAB A;  2QVP A;  1LOK A;  2POK A;  4YWY A;  3SJE A;  2PJ9 A;  3PB8 X;  4UEZ A;  4ZX8 A;  3FEC A;  1AYE A;  4EFD A;  4NGM A;  1ZG7 A;  3B35 A;  2PIZ A;  2NSM A;  2JBJ A;  2PJ7 A;  2PJ2 A;  3PB6 X;  3PFE A;  4FAI A;  1JQG A;  1TF9 A;  1RTQ A;  1ZG8 A;  2PJ6 A;  3BXM A;  5LYD A;  1VIX A;  2OOT A;  1BPN A;  2C6C A;  2DEA A;  2C6G A;  4P45 A;  3PBE A;  4MCP A;  7CPA A;  3KR5 A;  3SJG A;  4JYW A;  2GU2 A;  4W9Y A;  4DYO A;  3BI0 A;  4PXB A;  4ZX9 A;  4TWE A;  1Y7E A;  1FT7 A;  2FVG A;  4OC2 A;  1YW4 A;  2J9A A;  3V38 A;  3IFE A;  4A37 A;  5LYL A;  4MXU A;  2AFW A;  2VL1 A;  5K8M A;  2CIJ A;  5HVF A;  1QMU A;  4P4I A;  3KZW A;  1BAV A;  4Q7A A;  3H8E A;  3WC5 A;  1CBX A;  3B3V A;  3MN8 A;  4WWV A;  2V8V A;  2IQ6 A;  2Q43 A;  1DTD A;  2PVW A;  4ONW A;  3IWW A;  3NH8 A;  4K3N A;  1ZG9 A;  3FEE A;  4PXD A;  2PJ4 A;  4MCS A;  3BHX A; 
#chains in the Genus database with same CATH topology
 2EO8 A;  2EVN A;  1ELL P;  2BL1 A;  1KWM A;  1KUV A;  1PYT B;  2P0W A;  1VKC A;  4B5O A;  4II9 A;  3H4Q A;  3FED A;  2AFM A;  4OKO A;  2V8D A;  4PXE A;  4KS9 A;  1QSR A;  4XPL A;  1QSO A;  5AG7 A;  1FY7 A;  1CP7 A;  3B2Y A;  1Z8T A;  8CPA A;  2FT0 A;  3B3C A;  4OP4 A;  3SI0 A;  3C26 A;  5J1Q A;  5JPH A;  2GLJ A;  2JEW A;  3IO1 A;  4NGT A;  3VWD A;  2JDD A;  4YGO A;  2B4D B;  1TXR A;  4CGL A;  2QJ8 A;  5D29 A;  3D7H A;  4F6A A;  4MRI A;  1S60 A;  4PSW A;  2PJC A;  2OZG A;  2B5G A;  3EY5 A;  4NF1 A;  4MMO A;  4AVA A;  5LYF A;  2YND A;  3FBU A;  3PB4 X;  4X3R A;  3WC7 A;  4C7I A;  2C1C A;  4U9Z A;  5F09 A;  3IIB A;  2ZEE A;  2O4H A;  3RBU A;  2OH1 A;  4AVB A;  4MFL A;  4R7M A;  3IU2 A;  3NA6 A;  5IB9 A;  4C2Z A;  3A9L A;  2F8H A;  4YU9 A;  2PR1 A;  2AFS A;  1EE3 P;  1RXT A;  4P6Y A;  4YRH A;  2BCO A;  3SXN A;  1A2Z A;  4F8Z A;  1XMB A;  2Y0M A;  2X7B A;  3GY9 A;  4P4J A;  3RZA A;  4IF5 A;  3BLN A;  4M85 A;  2PJ1 A;  1S7N A;  1Z4E A;  1ZLI A;  4MCQ A;  3UY5 A;  3JRU A;  2IJZ A;  2VXK A;  2ZW7 A;  4U5Y A;  2DPS A;  2ZW5 A;  1CPX A;  1HDQ A;  4CYQ A;  2FIW A;  2KCW A;  4OAD A;  4F0X A;  4M6I A;  3B8G A;  3B7I A;  4M6H A;  3KR4 A;  1Z8X A;  3SJF A;  4KOV A;  3SI1 A;  4HNY B;  1KUY A;  1QST A;  3BJ8 A;  4NGQ A;  4OLL A;  2Z3K A;  4P4D A;  2K5T A;  3I9S A;  1S3Z A;  2ZEP A;  1IYK A;  3DLJ A;  3QB8 A;  4MY3 A;  3GB0 A;  4P4B A;  3V7Z A;  4CGP A;  1J4J A;  3EXN A;  4AVC A;  5C82 A;  5HVG A;  3D67 A;  1CG2 A;  2PJ5 A;  4KVM E;  4IK2 A;  4B6Z A;  1XJO A;  3PB7 X;  4R3L A;  3S9M A;  1XF8 A;  5K8N A;  2I3C A;  1M44 A;  6CPA A;  2VQY A;  4HNX B;  1WK4 A;  5IB0 A;  4A38 A;  2XEF A;  5G20 A;  5EC4 A;  3D7G A;  1XFO A;  1BOB A;  1M1D A;  3S6G A;  4A94 A;  5A28 A;  2OB0 A;  1IOI A;  3EFA A;  4B14 A;  4AG7 A;  1SQH A;  1Y0R A;  2AE6 A;  2EK9 A;  1OZP A;  2IMO A;  1P0H A;  2ZEG A;  3LOD A;  2Z0Z A;  3TC8 A;  4UEE A;  3CT9 A;  4MJ8 A;  4A2Z A;  4ZGY B;  4PK3 A;  2AFU A;  3FF3 A;  2FIA A;  2ZXV A;  4MBU A;  4NGS A;  4A30 A;  4R9M A;  2BUE A;  4KOR A;  1NSL A;  1XBU A;  3H8F A;  2YNC A;  4H2K A;  3T9Y A;  2V77 A;  1HEE A;  2QYV A;  1BLL E;  3N7Z A;  1YR0 A;  2WYR A;  4UF4 A;  2ZOG A;  4P44 A;  4J3G A;  1YSJ A;  4LUA A;  1Y0Y A;  2XEI A;  4MFQ A;  1Z2L A;  4Q38 A;  2PJ3 A;  2B58 A;  4PSX A;  4EME A;  1N71 A;  3NH4 A;  2F5I A;  2PDO A;  4H6U A;  2WPW A;  4JJX A;  3EC4 A;  4B13 A;  3FX6 A;  3PBB A;  3R95 A;  1LAN A;  3B3T A;  2YNE A;  3QAY A;  1S7L A;  3K9U A;  1ARM A;  2ZEF A;  2G0B A;  5J8F A;  3RAM A;  2YNC C;  3NFZ A;  4FD7 A;  4CAV A;  1AMP A;  5KTA A;  1UWY A;  2ATR A;  2VI7 A;  4MFP A;  4CYN A;  4JLY A;  2EBJ A;  4OC4 A;  2EK8 A;  1LAP A;  4UWI A;  1YLE A;  1I12 A;  4JXQ A;  4MFZ A;  1MK4 A;  4ZYQ A;  2AFO A;  1P4N A;  4XPK A;  4BBH A;  1YX0 A;  1F2P A;  1YQE A;  1FNO A;  2GRE A;  3SHP A;  2PSW A;  3ISX A;  3KL9 A;  4NJQ A;  4NJR A;  2Q7B A;  3IWG A;  2Q44 A;  2QML A;  2CTC A;  5FVJ A;  5K8P A;  1X12 A;  4FUU A;  4JZ0 A;  4DUK A;  2AFX A;  2Z3N A;  4CYO A;  2NYQ A;  1XOV A;  2ZOF A;  2G3T A;  4A32 A;  4CAE A;  2ZEL A;  2ZEN A;  4UA3 A;  4RI1 A;  3CDX A;  3ISZ A;  3SJX A;  4QVT A;  1LRZ A;  5D8N A;  1Q7L A;  2ABZ A;  4B5P A;  3QNV A;  2B5G B;  5DS0 A;  5K8O A;  4JXR A;  2BSW A;  5BWA B;  1R3N A;  5HH1 A;  4UEF A;  1YW6 A;  3G8W A;  3CXQ A;  2CF4 A;  5DWN A;  1R43 A;  4NGP A;  3HLP A;  2F7V A;  3P2H A;  4OC5 A;  3VWE A;  5LRK A;  1B87 A;  4RUH A;  5EMI A;  3GLJ A;  2ARH A;  5H86 A;  5HXD A;  2OZU A;  3FH4 A;  4KOS A;  2ZEO A;  2OU2 A;  3D3S A;  3DNS A;  3KKW A;  2DF5 A;  3I1U A;  2HB6 A;  4UFV A;  3LWU A;  2AFZ A;  4OC3 A;  4R8F A;  1S7K A;  4CRY B;  2CY2 A;  2ANP A;  4RN7 A;  3TTH A;  4HKF A;  4ZY0 A;  1ARL A;  3TOA A;  4NGN A;  3PZJ A;  3N5F A;  4MCR A;  2Q4V A;  2FS5 A;  4NFR A;  5JM6 A;  4ZY2 A;  2GLF A;  2B4D A;  4KOU A;  4NSQ A;  4Q36 A;  3D68 A;  4QBJ A;  1PUA A;  4GXH A;  3VH9 A;  3KHZ A;  1GHE A;  1Z8W A;  4XNH C;  3TE4 A;  4KZT A;  4A95 A;  3RO0 A;  3R9E A;  4G1P A;  4IHM A;  1JWQ A;  1PCA A;  1LFW A;  2FE7 A;  2VZZ A;  2ZEM A;  1Y7R A;  2JDC A;  4FD4 A;  4OME A;  5CPA A;  2Q4Z A;  3S9N A;  1YLO A;  4H89 A;  4B11 A;  1KUX A;  3MRU A;  4MHP A;  1IIC A;  4BD9 A;  3BI1 A;  4KUA A;  2DXQ A;  4PXC A;  4I49 A;  2J8M A;  2WZN A;  3RYO A;  1ON0 A;  3CXS A;  4MI4 A;  4XPD B;  4KOX A;  4A39 A;  3DSB A;  3FYN A;  4OC1 A;  1TKH A;  2REF A;  4YFJ A;  2PIY A;  2I79 A;  1M4L A;  3R96 A;  4P4F A;  1CPS A;  3FMC A;  1Q2D A;  1XEB A;  3D4U A;  2PVV A;  2EUI A;  3HUV A;  4KLW A;  3PRT A;  3ZJ0 A;  5JH9 A;  4CPA A;  4ORF A;  4EWT A;  2PJB A;  1YME A;  2O28 A;  3FVL A;  3LAC A;  5F48 A;  2NMT A;  4NEX A;  2P6F A;  3RNZ A;  3VAR A;  2H5M A;  4HPS A;  2PRB A;  4Y49 C;  3LMS A;  1UFH A;  2GIV A;  2PJ8 A;  3I3G A;  1QSM A;  4TNU A;  2XEJ A;  4PK2 A;  3TO9 A;  4MHZ A;  1MJA A;  1Y9W A;  2EWB A;  3S6F A;  1K4J A;  4MHY A;  1OBR A;  4C68 A;  3D2P A;  4R76 A;  1M4G A;  5E96 A;  2HQY A;  2D4O A;  2PRQ A;  1TKJ A;  2ZEH A;  5THW A;  3SXO A;  4O23 A;  2PE3 A;  1TF8 A;  4AXV A;  2CNS A;  3KQX A;  3D66 A;  4OC0 A;  1IB1 E;  4F9U A;  2CTB A;  2YGW A;  5H84 A;  1Z8L A;  2XEG A;  1NE9 A;  5HVH A;  5LYI A;  1S5K A;  4CRZ B;  3IC1 A;  1Y9K A;  4NGR A;  4MFK A;  4FWU A;  4Z65 A;  4MHN A;  2ZED A;  3L2N A;  3DDD A;  3TCV A;  4A33 A;  4B12 A;  2OR4 A;  4ZI6 A;  2CNT A;  1HDU A;  2WPX A;  4PV6 A;  1F57 A;  3DR8 A;  2HC9 A;  5CBM A;  2C6P A;  3CPX A;  1IGB A;  1VHE A;  4UIA A;  1VHO A;  3FRM A;  4PQA A;  1IID A;  2BEI A;  3H5Z A;  3EO4 A;  3LD2 A;  4H6Z A;  4KOW A;  1LCP A;  3W91 A;  2PJA A;  4A31 A;  4C2Y A;  4KSF A;  3GIU A;  4L8A A;  3ZZI A;  1Z4R A;  4X2T A;  2FSR A;  5F49 A;  2WSA A;  3DGV A;  3R9G A;  5LRJ A;  4WJB A;  2Q51 A;  4X8I A;  4QUS A;  2A4N A;  4C2X A;  3GKR A;  3B3W A;  1F2O A;  4EVY A;  4R57 A;  3W6X A;  1L0C A;  2Z10 A;  2R98 A;  4IAV A;  1M4I A;  4CAW A;  1IY7 A;  4QC6 A;  5KTC A;  2JEV A;  4ONU A;  5I0C A;  5AG5 A;  2BO9 A;  4QB9 A;  2PJ0 A;  2J8R A;  1LAM A;  3K9T A;  5A27 A;  2PC1 A;  3F5B A;  1YRE A;  3B3S A;  2PQ8 A;  1RO5 A;  3KQZ A;  2V8G A;  3D2M A;  1XRY A;  1CJW A;  1Q2Y A;  2G3A A;  4R3K A;  3PB9 X;  2FL4 A;  3KAS A;  1M4D A;  5LRG A;  1Z5R A;  2CNM A;  4R6T A;  1Z9U A;  2Q7S A;  2VBQ A;  4DJL A;  3PFO A;  5LYD A;  2ZW6 A;  1IYL A;  4B5P B;  4C7H A;  4UFX A;  3SI2 A;  1TIQ A;  2O53 A;  4NXY A;  4XPD C;  3S6K A;  3IGR A;  3WT4 A;  1VGY A;  2JBK A;  2J8N A;  3GUX A;  3FJU A;  5JGF A;  1U6M A;  4F0Y A;  2V8H A;  4FBE A;  2CXA A;  1H8L A;  4K30 A;  4OAE A;  4GM5 A;  2DPT A;  2BOA A;  5F46 A;  4LQG A;  4UCN A;  2C27 A;  5EBV A;  1QQ9 A;  3IJ3 A;  3JVN A;  3VAT A;  1TKF A;  1KZF A;  1XIX A;  4OID A;  2OZH A;  4F9V A;  1WWZ A;  2GFQ A;  4ZY1 A;  3F0A A;  3WR7 A;  4CS0 B;  1ELM P;  4P10 A;  2G9D A;  3K2K A;  4OIW A;  5ISV A;  4Y49 B;  3TX8 A;  4MHD A;  4UCM A;  4XNH B;  1V0C A;  2PCU A;  4LX9 A;  3NE7 A;  3NH5 A;  2P6G A;  1YK3 A;  1NSA A;  3JUW A;  3T8W A;  4UWJ A;  4KSI A;  3FNC A;  2RFH A;  1CP6 A;  1ZLH A;  1DE4 C;  4FD5 A;  4FD6 A;  4P4E A;  5G21 A;  4IUS A;  3D8P A;  3H8G A;  2ODF A;  3T90 A;  5C88 A;  1S7F A;  3TFY A;  3KHX A;  3TO7 A;  2IL4 A;  3TOB A;  4PPZ A;  2QEC A;  1BPM A;  4UIB A;  4X5K A;  1BO4 A;  3S9L A;  4R87 A;  5I4M A;  4CGO A;  5G1Z A;  1GYT A;  2VEZ A;  2FXF A;  3KGQ A;  5ELY A;  1IOF A;  1CX8 A;  2RB7 A;  3D7D A;  3CPA A;  3IEH A;  3KI9 A;  3OWC A;  3PEI A;  4UCP A;  1VHS A;  5AGE A;  3WC6 A;  3D7F A;  3WAB A;  4B10 A;  2QVP A;  2R8V A;  4MFJ A;  1AUG A;  3JTK A;  4E8O A;  1LOK A;  2POK A;  4YWY A;  5G22 A;  2RC4 A;  2PJ9 A;  3SJE A;  4BIN A;  4CAF A;  2JLM A;  1YGH A;  3PB8 X;  1Q2C A;  2I00 A;  2Q0Y A;  4W9Y A;  4UEZ A;  5F47 A;  3FEC A;  4KVO E;  2FCK A;  4ZX8 A;  1CM0 A;  1AYE A;  4KOT A;  3IWE A;  4EFD A;  4ZBG A;  3PGP A;  4NGM A;  1XE4 A;  1ZG7 A;  2GE3 A;  1I1D A;  3B35 A;  3DR6 A;  2PIZ A;  2NSM A;  2JBJ A;  2PJ7 A;  2PJ2 A;  3PB6 X;  3E0K A;  4U9Y A;  5HMN A;  1YVK A;  3PFE A;  3NE8 A;  3TO6 A;  3BJ7 A;  5AG4 A;  2Z3O A;  3CXP A;  4KLV A;  4FAI A;  1JQG A;  1TF9 A;  1RTQ A;  1ZG8 A;  2AJ6 A;  2PJ6 A;  2Q04 A;  3BXM A;  3FB3 A;  4GS4 A;  1VIX A;  1R57 A;  1NMT A;  4M3S A;  2OOT A;  3TT2 A;  3W6S A;  1BPN A;  2C6C A;  5KTD A;  3S6H A;  2R1I A;  2DEA A;  4CAX A;  2Z3M A;  2C6G A;  4P45 A;  3PBE A;  5DWM A;  4E0A A;  2Z3P A;  3PP9 A;  4DYO A;  4M6G A;  1XMT A;  2ZPA A;  4MCP A;  7CPA A;  3KR5 A;  3P2F A;  4KVX A;  4JYW A;  3SJG A;  2GU2 A;  3G3S A;  2B3U A;  3FXT A;  2VZY A;  4LQ6 A;  2QIR A;  2B4B A;  1QSN A;  1B6B A;  1MJ9 A;  2HV2 A;  2Q4Y A;  3BI0 A;  4PXB A;  4ZX9 A;  4TWE A;  3V8I A;  5CNP A;  5GCN A;  4CYP A;  1IU8 A;  1Y7E A;  1FT7 A;  2FVG A;  2Z11 A;  2R7H A;  4HNW B;  1YW4 A;  4OC2 A;  2J9A A;  4MY0 A;  3V38 A;  3IFE A;  4A37 A;  5LYL A;  2Z3L A;  4MXU A;  2AFW A;  2PR8 A;  3IU1 A;  5J8C A;  2VL1 A;  3MGD A;  3QAH A;  5K8M A;  2B3V A;  2CIJ A;  4NCZ A;  5HVF A;  4AB7 A;  3CZX A;  1ZO0 A;  2HUZ A;  1QMU A;  4P4I A;  2D4P A;  1X10 A;  4DNC A;  4CGM A;  3KZW A;  4UFW A;  4E2A A;  1BAV A;  4Q7A A;  2P6E A;  3H8E A;  1I21 A;  4JD6 A;  4L89 A;  3WC5 A;  4AG9 A;  4CGN A;  1YVO A;  3FIX A;  1CBX A;  3B3V A;  3MN8 A;  4WWV A;  2REE A;  1MJB A;  2GAN A;  2V8V A;  4KOY A;  4BMH A;  5IV0 A;  2IQ6 A;  2Q43 A;  1DTD A;  2PVW A;  5IX3 A;  3R1K A;  3IWW A;  3NH8 A;  4K3N A;  4ONW A;  4UBR A;  1ZG9 A;  4RS2 A;  3FEE A;  2ZW4 A;  5AG6 A;  3F8K A;  4PXD A;  5JQ4 A;  2PJ4 A;  1PU9 A;  4MCS A;  4KUB A;  3R9F A;  3GYA A;  4KSA A;  2WUU A;  4JWP A;  3BHX A; 
#chains in the Genus database with same CATH homology
 1ELL P;  1KWM A;  1PYT B;  3FED A;  2AFM A;  4OKO A;  2V8D A;  4PXE A;  3B2Y A;  1CP7 A;  8CPA A;  3B3C A;  4OP4 A;  3SI0 A;  5J1Q A;  2GLJ A;  2JEW A;  3IO1 A;  4NGT A;  1TXR A;  2QJ8 A;  5D29 A;  3D7H A;  4MRI A;  2PJC A;  4MMO A;  5LYF A;  3PB4 X;  4X3R A;  3WC7 A;  2C1C A;  5F09 A;  3IIB A;  2ZEE A;  2O4H A;  3RBU A;  4R7M A;  3NA6 A;  5IB9 A;  2F8H A;  4YU9 A;  2AFS A;  1EE3 P;  4P6Y A;  2BCO A;  4F8Z A;  1XMB A;  3RZA A;  4P4J A;  2PJ1 A;  1ZLI A;  4MCQ A;  3JRU A;  2IJZ A;  1CPX A;  1HDQ A;  3B7I A;  3KR4 A;  3SJF A;  3SI1 A;  4NGQ A;  4P4D A;  4P4B A;  2ZEP A;  3DLJ A;  3GB0 A;  3V7Z A;  5HVG A;  3D67 A;  1CG2 A;  2PJ5 A;  4IK2 A;  4B6Z A;  1XJO A;  3PB7 X;  3S9M A;  5K8N A;  2I3C A;  6CPA A;  4A38 A;  2XEF A;  3D7G A;  1XFO A;  4A94 A;  1Y0R A;  2IMO A;  2ZEG A;  2EK9 A;  3TC8 A;  4UEE A;  3CT9 A;  2AFU A;  3FF3 A;  4NGS A;  1XBU A;  3H8F A;  4H2K A;  2V77 A;  1HEE A;  2QYV A;  1BLL E;  2WYR A;  4UF4 A;  2ZOG A;  4P44 A;  1YSJ A;  1Y0Y A;  2XEI A;  1Z2L A;  2PJ3 A;  4EME A;  3NH4 A;  3FX6 A;  3PBB A;  1LAN A;  3B3T A;  1ARM A;  2ZEF A;  3RAM A;  3NFZ A;  1AMP A;  1UWY A;  4OC4 A;  2EK8 A;  1LAP A;  4ZYQ A;  2AFO A;  1F2P A;  1FNO A;  2GRE A;  3ISX A;  3KL9 A;  4NJQ A;  4NJR A;  2CTC A;  5K8P A;  4FUU A;  4DUK A;  4JZ0 A;  2AFX A;  2NYQ A;  2ZOF A;  2ZEL A;  2ZEN A;  3CDX A;  3ISZ A;  3SJX A;  5D8N A;  1Q7L A;  2ABZ A;  3QNV A;  5DS0 A;  5K8O A;  1R3N A;  4UEF A;  1YW6 A;  2CF4 A;  1R43 A;  4NGP A;  3HLP A;  2F7V A;  5LRK A;  4OC5 A;  4RUH A;  3GLJ A;  5HXD A;  3FH4 A;  2ZEO A;  3I1U A;  2HB6 A;  3LWU A;  2AFZ A;  4OC3 A;  4R8F A;  2ANP A;  4ZY0 A;  1ARL A;  4NGN A;  3N5F A;  4MCR A;  4NFR A;  5JM6 A;  4ZY2 A;  2GLF A;  3D68 A;  3VH9 A;  3KHZ A;  4G1P A;  4IHM A;  1PCA A;  1LFW A;  4OME A;  2ZEM A;  5CPA A;  3S9N A;  2Q4Z A;  1YLO A;  3MRU A;  4MHP A;  4BD9 A;  3BI1 A;  4PXC A;  2WZN A;  4A39 A;  4OC1 A;  1TKH A;  2PIY A;  1M4L A;  4P4F A;  1CPS A;  3FMC A;  3D4U A;  2PVV A;  3HUV A;  3PRT A;  5JH9 A;  4CPA A;  4EWT A;  2PJB A;  1YME A;  3FVL A;  3VAR A;  3LMS A;  2PJ8 A;  4TNU A;  2XEJ A;  4MHZ A;  2EWB A;  4MHY A;  1OBR A;  4R76 A;  2PRQ A;  1TKJ A;  2ZEH A;  5THW A;  4AXV A;  4O23 A;  2PE3 A;  1TF8 A;  3KQX A;  3D66 A;  4OC0 A;  4F9U A;  2CTB A;  1Z8L A;  2XEG A;  5HVH A;  5LYI A;  3IC1 A;  4NGR A;  4FWU A;  4Z65 A;  4MHN A;  2ZED A;  3L2N A;  4ZI6 A;  2OR4 A;  1HDU A;  1F57 A;  2HC9 A;  5CBM A;  2C6P A;  3CPX A;  1IGB A;  1VHE A;  4UIA A;  1VHO A;  4PQA A;  1LCP A;  2PJA A;  4X2T A;  3DGV A;  5LRJ A;  4WJB A;  2Q51 A;  4X8I A;  3B3W A;  1F2O A;  4IAV A;  1IY7 A;  2BO9 A;  2PJ0 A;  3K9T A;  1LAM A;  3B3S A;  3KQZ A;  2V8G A;  1XRY A;  3PB9 X;  3KAS A;  5LRG A;  4DJL A;  1Z5R A;  4R6T A;  3PFO A;  3SI2 A;  2O53 A;  3WT4 A;  1VGY A;  2JBK A;  3GUX A;  3FJU A;  5JGF A;  2V8H A;  4FBE A;  1H8L A;  4GM5 A;  2BOA A;  4LQG A;  1QQ9 A;  3IJ3 A;  3VAT A;  1TKF A;  4OID A;  4F9V A;  4ZY1 A;  1ELM P;  4P10 A;  2G9D A;  3K2K A;  4OIW A;  3TX8 A;  2PCU A;  3NH5 A;  1NSA A;  3T8W A;  4KSI A;  2RFH A;  1CP6 A;  1ZLH A;  1DE4 C;  4P4E A;  3H8G A;  3KHX A;  4PPZ A;  4UIB A;  1BPM A;  3S9L A;  5I4M A;  1GYT A;  3KGQ A;  5ELY A;  1CX8 A;  2RB7 A;  3D7D A;  3CPA A;  3IEH A;  3KI9 A;  3PEI A;  3WC6 A;  3D7F A;  3WAB A;  2QVP A;  1LOK A;  2POK A;  4YWY A;  3SJE A;  2PJ9 A;  3PB8 X;  4UEZ A;  4ZX8 A;  3FEC A;  1AYE A;  4EFD A;  4NGM A;  1ZG7 A;  3B35 A;  2PIZ A;  2NSM A;  2JBJ A;  2PJ7 A;  2PJ2 A;  3PB6 X;  3PFE A;  4FAI A;  1JQG A;  1TF9 A;  1RTQ A;  1ZG8 A;  2PJ6 A;  3BXM A;  5LYD A;  1VIX A;  2OOT A;  1BPN A;  2C6C A;  2DEA A;  2C6G A;  4P45 A;  3PBE A;  4MCP A;  7CPA A;  3KR5 A;  3SJG A;  4JYW A;  2GU2 A;  4W9Y A;  4DYO A;  3BI0 A;  4PXB A;  4ZX9 A;  4TWE A;  1Y7E A;  1FT7 A;  2FVG A;  4OC2 A;  1YW4 A;  2J9A A;  3V38 A;  3IFE A;  4A37 A;  5LYL A;  4MXU A;  2AFW A;  2VL1 A;  5K8M A;  2CIJ A;  5HVF A;  1QMU A;  4P4I A;  3KZW A;  1BAV A;  4Q7A A;  3H8E A;  3WC5 A;  1CBX A;  3B3V A;  3MN8 A;  4WWV A;  2V8V A;  2IQ6 A;  2Q43 A;  1DTD A;  2PVW A;  4ONW A;  3IWW A;  3NH8 A;  4K3N A;  1ZG9 A;  3FEE A;  4PXD A;  2PJ4 A;  4MCS A;  3BHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...