2ZEEA

Crystal structure of the human glutaminyl cyclase mutant s160g at 1.99 angstrom resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
329
structure length
323
Chain Sequence
b'ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDGAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2007-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2zeeA00
3S9LA 3T8WA 3PB6X 1FNOA 3WC7A 4A38A 3KL9A 5K8MA 3B7IA 1OBRA 2ZEHA 1VIXA 2AFZA 1BPMA 2BO9A 1R3NA 3BHXA 3MN8A 1ZLIA 3NH8A 4B6ZA 4P44A 2ZOGA 1BAVA 5HXDA 3LMSA 1LOKA 2AFUA 5DS0A 3N5FA 2ZEMA 3NH5A 3K9TA 3S9NA 2PJCA 2ZENA 2WZNA 3NA6A 4R8FA 2AFOA 3IEHA 4OMEA 3HLPA 3D7HA 3L2NA 2PJ1A 1ZG9A 2PCUA 3D66A 3VARA 2CF4A 3ISXA 4EWTA 4BD9A 4CPAA 5HVFA 3D7FA 2CIJA 5HVHA 1Z5RA 3SJXA 3FH4A 4PPZA 1CG2A 3SJFA 2J9AA 4OC5A 2NSMA 3B3SA 4MHZA 5HVGA 1VHOA 3KR5A 3PB7X 2V8DA 2QJ8A 2JEWA 2PJAA 4IHMA 1PCAA 2IQ6A 3FECA 4P4IA 3ISZA 2ZEGA 2ZEPA 1PYTB 2QYVA 3V7ZA 1ELLP 3B2YA 1XJOA 4MMOA 4MCPA 4R76A 5I4MA 2C6CA 4R7MA 1ZG8A 3WC5A 2BCOA 1CPXA 2AFWA 3FX6A 4MCSA 2AFMA 4ONWA 2ZEEA 2C6GA 4X2TA 4OC2A 1UWYA 3KGQA 4GM5A 2PJ0A 5LYIA 1RTQA 1TF9A 2Q51A 5THWA 4LQGA 4P6YA 4NFRA 4IAVA 2GLFA 3VATA 3BI0A 2Q43A 3KQXA 3PB8X 3B3VA 4OC3A 1CP7A 1YMEA 3CT9A 4TNUA 1QQ9A 3B35A 1DE4C 4UIAA 1GYTA 4K3NA 4PXCA 3SI0A 3PB9X 7CPAA 2ZEDA 4ZY1A 5F09A 2GREA 3IC1A 2PJ9A 1TF8A 2C6PA 2PJ8A 5CPAA 3CPAA 3TC8A 4H2KA 2PRQA 1LCPA 4NGTA 1IY7A 3TX8A 2PIZA 3S9MA 3KI9A 4A37A 3GUXA 4UIBA 2V77A 2NYQA 1YLOA 1R43A 3D68A 2CTCA 1YSJA 3DLJA 1BLLE 5D29A 2OOTA 2DEAA 2PVWA 5K8PA 4OP4A 1XFOA 4MHNA 3FF3A 1Y0YA 3DGVA 4O23A 3PBBA 3BXMA 1ARLA 4RUHA 3D67A 1VGYA 3RBUA 5LYDA 2PE3A 2XEJA 3CDXA 4ZX9A 4UEFA 2ZEOA 4F8ZA 1H8LA 1TKJA 1TKFA 4UEEA 4P4BA 5JGFA 4YWYA 1CPSA 3SJGA 4ZI6A 3FJUA 4DUKA 2O53A 3NH4A 3B3TA 5LRGA 5IB9A 5LYLA 4FBEA 2IMOA 3NFZA 2HB6A 5K8NA 3PFOA 4WJBA 5K8OA 2PJ3A 3I1UA 1YW6A 2WYRA 3IWWA 1ZLHA 4UF4A 5J1QA 2PJ5A 8CPAA 3KHXA 5JH9A 3KR4A 1CX8A 1HDQA 4YU9A 1VHEA 2RFHA 1Q7LA 5LRKA 4ZX8A 1LFWA 2PJ6A 2IJZA 2XEIA 1AMPA 3RAMA 3PEIA 4NJRA 3H8GA 3MRUA 4P4FA 3PBEA 2FVGA 1YW4A 1LAMA 1XRYA 4FWUA 4P4DA 1Z8LA 3H8EA 4OC1A 1ARMA 1ZG7A 2V8VA 3IJ3A 2PJ7A 4NJQA 4P10A 2F7VA 2EWBA 2V8GA 4P45A 2ABZA 4PXDA 3RZAA 3IFEA 2C1CA 4P4JA 1HDUA 2PVVA 2PIYA 4EMEA 2PJ4A 3D4UA 3PRTA 3WC6A 4Q7AA 2F8HA 4ZY2A 3FMCA 2VL1A 3KHZA 3KZWA 3PB4X 2JBJA 5D8NA 3FEEA 3SJEA 2HC9A 4Z65A 4MHYA 3B3WA 4UEZA 2OR4A 3D7DA 1XBUA 3LWUA 4JYWA 3GB0A 4DYOA 4WWVA 4A94A 4NGPA 1NSAA 4R6TA 4NGNA 1FT7A 4X8IA 1F2PA 4MHPA 1ELMP 6CPAA 2ANPA 3D7GA 1KWMA 2JBKA 4OIDA 3FVLA 1TKHA 2V8HA 3SI1A 4OC4A 4A39A 2ZEFA 3GLJA 3QNVA 3IO1A 3V38A 1LANA 1DTDA 2GU2A 2ZELA 4PQAA 1LAPA 2O4HA 2POKA 1F57A 3BI1A 4F9UA 4EFDA 3PFEA 3IIBA 3WABA 3K2KA 5JM6A 2EK8A 1BPNA 3WT4A 4JZ0A 5CBMA 4FAIA 3KASA 1Y7EA 2XEFA 1JQGA 4PXEA 4X3RA 1HEEA 4KSIA 2I3CA 2XEGA 4P4EA 1EE3P 4MCRA 4NGRA 4MRIA 4PXBA 4ZY0A 2G9DA 4OC0A 2AFSA 2ZOFA 2GLJA 4IK2A 1M4LA 4NGMA 4AXVA 2BOAA 3SI2A 4FUUA 2QVPA 1F2OA 2PJ2A 4ZYQA 1Z2LA 4F9VA 4TWEA 4W9YA 4MXUA 2RB7A 1AYEA 4DJLA 3H8FA 1XMBA 4MCQA 4OKOA 2Q4ZA 3KQZA 4NGQA 3JRUA 2AFXA 1CP6A 4G1PA 2PJBA 1Y0RA 2CTBA 2EK9A 5LRJA 1QMUA 4OIWA 4NGSA 3CPXA 3FEDA 1IGBA 1TXRA 5ELYA 5LYFA 3VH9A 1CBXA 3B3CA 3HUVA
chains in the Genus database with same CATH superfamily
2K5TA 3S9LA 5G1ZA 3T8WA 3PB6X 4KVME 2EO8A 3C26A 4EVYA 1FNOA 3WC7A 4A38A 3KL9A 5K8MA 1M4IA 3B7IA 4NCZA 4UFXA 1OBRA 2ZEHA 1VIXA 3D8PA 5E96A 2AFZA 1BPMA 3FBUA 3K9UA 2BO9A 1R3NA 2BUEA 1S7KA 3QB8A 4JJXA 3BHXA 4JLYA 3T9YA 2P6GA 2B5GA 4KOUA 1QSMA 4B12A 1KUXA 3MN8A 1ZLIA 2FXFA 4M6HA 2CNSA 4JWPA 4DNCA 3NH8A 3TO6A 1I21A 4B6ZA 4P44A 4I49A 2ZOGA 1BAVA 3EY5A 5HXDA 3LMSA 4KOYA 1LOKA 2AFUA 3JUWA 3R1KA 4H6ZA 3CXPA 1S7NA 3R9FA 1BO4A 4XNHC 2Z0ZA 4KLVA 5DS0A 3N5FA 2FIWA 2KCWA 1XEBA 4C2XA 2ZEMA 4B5PA 3H5ZA 2D4OA 4AVAA 1M44A 4UWIA 4UA3A 1A2ZA 2GIVA 3D3SA 4KLWA 4CS0B 2JDDA 3NH5A 4MFZA 3K9TA 4JXQA 3S9NA 2PJCA 1S3ZA 2ZENA 3RO0A 1RXTA 2WZNA 3RYOA 4II9A 3NA6A 4R8FA 2AFOA 3IEHA 4OMEA 3HLPA 3D7HA 3L2NA 2F5IA 1Z9UA 4YFJA 2PJ1A 1ON0A 4GS4A 3G8WA 1ZG9A 2PCUA 5H86A 3D66A 3VARA 2CF4A 5AG7A 3EXNA 3ISXA 2Z3KA 1OZPA 4EWTA 2AE6A 1KUYA 2G3AA 4BD9A 4R3LA 4CPAA 2B4BA 5HVFA 3TCVA 3D7FA 2CIJA 5HVHA 3CXSA 5KTDA 1Z5RA 3SJXA 3FH4A 4ORFA 4ZGYB 2B3VA 4PPZA 4KS9A 2GANA 2JLMA 1CG2A 3SJFA 1IOFA 2J9AA 4OC5A 5CNPA 2J8NA 2NSMA 4KVOE 3B3SA 4MHZA 4KOSA 5HVGA 1IYKA 2PR1A 1VHOA 2BL1A 3KR5A 3PB7X 1YX0A 3JVNA 2V8DA 2QJ8A 2JEWA 2PJAA 4KOVA 3MGDA 2H5MA 4U5YA 4XPKA 3V8IA 2YNCA 4IHMA 4A31A 1PCAA 2IQ6A 4Y49C 3FECA 4AG9A 4P4IA 4F0XA 3ISZA 2ZEGA 3BLNA 5F47A 2ZEPA 1PYTB 2QYVA 3V7ZA 1ELLP 3B2YA 1XJOA 4MMOA 4MCPA 2VZYA 3B8GA 1YK3A 4ONUA 4R76A 5I4MA 2C6CA 4R7MA 2D4PA 1PUAA 3WR7A 1ZG8A 4CAVA 1IU8A 3WC5A 4C68A 2BCOA 1CPXA 4KUAA 1MK4A 2AFWA 1LRZA 2Z3LA 5G20A 1S60A 3FX6A 4L8AA 4MCSA 2AFMA 4L89A 2ODFA 4ONWA 2ZEEA 1R57A 2C6GA 3P2FA 4X2TA 4OC2A 2IL4A 4XPDB 3S6FA 2ZW7A 1P4NA 1UWYA 3KGQA 1Z4EA 4GM5A 4UBRA 5A28A 1FY7A 2PJ0A 2REEA 4AB7A 2OU2A 4HKFA 5G21A 4B5PB 5LYIA 1RTQA 1TF9A 1Z4RA 2Q51A 5THWA 4LQGA 4P6YA 4NFRA 4IAVA 1MJ9A 2GLFA 4CGNA 3VATA 5EBVA 3TE4A 4QC6A 3BI0A 2Q43A 4C2ZA 2DXQA 1IYLA 1XE4A 3KQXA 1MJBA 3PB8X 5EMIA 1IB1E 2Q44A 3S6GA 1Q2YA 3B3VA 4OC3A 2EVNA 1ZO0A 1CP7A 1YMEA 2JEVA 3CT9A 4TNUA 1QQ9A 5AG5A 3NE7A 5AGEA 3B35A 5G22A 1DE4C 4UIAA 1GYTA 4K3NA 4F0YA 4PXCA 3SI0A 3PB9X 7CPAA 4M3SA 2Z11A 1SQHA 2ZEDA 5C88A 3FYNA 4ZY1A 2VBQA 5F09A 1AUGA 4ZBGA 2GREA 3IC1A 4CAEA 1N71A 2CXAA 2PJ9A 4J3GA 3PP9A 2B58A 5DWMA 4RN7A 1TF8A 1Y9WA 2C6PA 2PJ8A 5GCNA 5CPAA 1BOBA 3CPAA 4K30A 3TC8A 1IOIA 1I1DA 3EC4A 2HV2A 4H2KA 2OZUA 2PRQA 1S7LA 1LCPA 2Y0MA 1IY7A 4NGTA 3TX8A 1CJWA 3IWGA 2PIZA 3P2HA 3KI9A 3S9MA 4M6IA 4B11A 4A37A 3GUXA 1QSTA 4KVXA 2V77A 2NYQA 1YLOA 1B87A 4MFQA 4UIBA 2BSWA 1R43A 3D68A 3CXQA 2CTCA 1YSJA 3DLJA 2VEZA 3GYAA 1Z8XA 3LD2A 1BLLE 1YVOA 5D29A 1M4DA 4KSFA 3FNCA 2OOTA 3S6HA 4CAXA 2Q04A 2DEAA 2PVWA 2YGWA 4AVCA 2QIRA 4OP4A 4RI1A 5K8PA 1XFOA 2GE3A 3DR6A 3FF3A 4MHNA 5AG4A 3LACA 3W6XA 3SHPA 2ATRA 1Y0YA 3DGVA 5J8FA 1J4JA 2Z3MA 4O23A 3PBBA 3BXMA 1ARLA 4FD4A 4NSQA 3D67A 4RUHA 2YNDA 3NE8A 4KZTA 2C27A 1VGYA 3RBUA 4OAEA 4B13A 3F8KA 5LYDA 2PE3A 4CRYB 4YGOA 2B3UA 2I00A 2XEJA 1Q2CA 4UFWA 3CDXA 3OWCA 4ZX9A 3UY5A 4IF5A 4UEFA 2WPWA 2ZEOA 4QVTA 1H8LA 4F8ZA 3LODA 1TKJA 4RS2A 3R9GA 1TKFA 2BEIA 4UEEA 4P4BA 4PSWA 4YWYA 5JGFA 4C7HA 1CPSA 3SJGA 4ZI6A 3FJUA 4DUKA 1U6MA 2O53A 3NH4A 3B3TA 5LRGA 5IB9A 4R3KA 5LYLA 4FBEA 2IMOA 2WPXA 2HB6A 3NFZA 4MI4A 4NXYA 4X5KA 2HUZA 3BJ7A 5C82A 2ZPAA 5K8NA 2YNEA 3PFOA 3FB3A 3VWEA 2OZHA 4HNXB 2JDCA 3JTKA 2Q4VA 4PK3A 4WJBA 2PJ3A 5K8OA 5AG6A 3I1UA 1YREA 2Z3NA 3A9LA 1YW6A 2WYRA 3IWWA 4XPLA 1ZLHA 5BWAB 4UF4A 4XNHB 4R57A 4U9ZA 1Z8TA 2VQYA 5J1QA 2PJ5A 2R7HA 4LUAA 3PGPA 2REFA 3E0KA 1YQEA 3IU2A 2J8RA 4FD5A 8CPAA 3KHXA 1V0CA 5JH9A 5J8CA 3KR4A 3TFYA 4CYQA 5IV0A 1Q2DA 1XMTA 1CX8A 2P6FA 5ISVA 4KSAA 3RNZA 2OH1A 2Q7BA 1MJAA 4HNWB 1K4JA 1GHEA 4OLLA 1HDQA 4A95A 5KTAA 2FCKA 4YU9A 1VHEA 4MFLA 2RFHA 1Q7LA 3SXNA 3FIXA 1I12A 5LRKA 4ZX8A 1LFWA 2WUUA 2X7BA 2PJ6A 4M85A 2IJZA 2YNCC 2XEIA 4UCNA 4CAFA 4CGMA 1AMPA 3D2PA 2PDOA 3RAMA 1RO5A 2Z10A 4IUSA 4UWJA 1XOVA 4F6AA 3PEIA 1IICA 4NJRA 3H8GA 4CRZB 3MRUA 1WK4A 4MJ8A 4P4FA 3W91A 3PBEA 2FVGA 1YW4A 3F5BA 1LAMA 1XRYA 4FWUA 3R9EA 4P4DA 1Z8LA 4UCPA 3DNSA 1WWZA 2ARHA 3H8EA 1Z8WA 4NF1A 4OC1A 2ZXVA 1ARMA 1ZG7A 2V8VA 4Q38A 2RC4A 4CYOA 2VXKA 5IB0A 3IJ3A 2PJ7A 2OZGA 1QSOA 4KOXA 4NJQA 2F7VA 2EWBA 4P10A 2P0WA 4MFJA 4QBJA 2V8GA 1X10A 4P45A 2CNTA 2ABZA 3TOAA 4PXDA 5DWNA 4MY0A 3RZAA 3IFEA 4BINA 3D2MA 2C1CA 4P4JA 4UCMA 2G3TA 1HDUA 2PSWA 2PVVA 3PZJA 2PIYA 4EMEA 2DPTA 2PJ4A 3D4UA 3H4QA 1NE9A 5HMNA 3PRTA 3WC6A 4U9YA 4Q7AA 4LQ6A 2F8HA 2R8VA 4KORA 3F0AA 3GY9A 4ZY2A 3FMCA 2VL1A 4E0AA 2NMTA 5JQ4A 3KHZA 2ZW5A 3KZWA 4B14A 4MHDA 3PB4X 2JBJA 4MFPA 5D8NA 5JPHA 1XIXA 2EBJA 4A33A 4R87A 4FD7A 3FEEA 2Q0YA 4QUSA 2Z3OA 2HC9A 3SJEA 3TT2A 4Z65A 1M1DA 1VHSA 4MHYA 3B3WA 3GIUA 4A30A 4E2AA 3IWEA 3DR8A 4PK2A 2G0BA 2FS5A 2Q4YA 4B10A 4YRHA 4UEZA 4MY3A 4C7IA 1IIDA 2OR4A 2A4NA 4HPSA 4AVBA 5HH1A 3EO4A 3D7DA 1XBUA 3N7ZA 4BBHA 2FL4A 1JWQA 3LWUA 4JYWA 3GB0A 4DYOA 2PC1A 2ZW4A 3R95A 2AJ6A 3ZZIA 4WWVA 4A94A 5A27A 4NGPA 3TO9A 1NSAA 4R6TA 4NGNA 1FT7A 3KKWA 1CM0A 4MFKA 4KUBA 4R9MA 4X8IA 4CYPA 1F2PA 4MHPA 1ELMP 2FT0A 2PRBA 3T90A 6CPAA 4MBUA 2ANPA 2QECA 3D7GA 3DDDA 2GFQA 3S6KA 1KWMA 2JBKA 4XPDC 4CAWA 4OIDA 2B4DB 3FVLA 1TKHA 3TO7A 2I79A 3FRMA 3TTHA 3SXOA 2DPSA 4HNYB 2V8HA 3R96A 4OC4A 2O28A 5EC4A 3SI1A 4B5OA 4Q36A 2FIAA 1NSLA 3EFAA 4FD6A 4A39A 2ZEFA 3GLJA 2HQYA 3QNVA 3IO1A 3V38A 2Z3PA 4AG7A 5F46A 1LANA 1DTDA 2GU2A 2ZELA 1YVKA 2FSRA 1XF8A 4PQAA 2O4HA 1LAPA 1QSRA 2Q7SA 4QB9A 3I9SA 2POKA 1F57A 3BI1A 4F9UA 4EFDA 4PV6A 3PFEA 3IIBA 3WABA 2J8MA 3K2KA 1B6BA 2EK8A 3ZJ0A 1BPNA 3WT4A 1NMTA 5JM6A 3G3SA 2WSAA 4PSXA 4JZ0A 5CBMA 4FAIA 4JD6A 3KASA 1Y7EA 2XEFA 1JQGA 2DF5A 1QSNA 4PXEA 4X3RA 1M4GA 1HEEA 2PQ8A 2CNMA 4KSIA 2I3CA 4KOTA 2XEGA 3GKRA 4P4EA 1EE3P 3IGRA 4MCRA 4NGRA 1X12A 4MRIA 4PXBA 1KUVA 4M6GA 5IX3A 4UFVA 2R1IA 4LX9A 4A2ZA 4OADA 4ZY0A 1YR0A 2G9DA 4OC0A 4H6UA 2B5GB 3FXTA 4C2YA 2AFSA 2ZOFA 2GLJA 1VKCA 1M4LA 4IK2A 1Y7RA 4NGMA 4CGLA 3W6SA 2OB0A 4AXVA 3CZXA 4GXHA 2BOAA 3SI2A 2B4DA 5F48A 4FUUA 2QVPA 1F2OA 2PJ2A 1YGHA 4ZYQA 1Y9KA 1Z2LA 4F9VA 1KZFA 4CGOA 5F49A 3TOBA 3I3GA 4TWEA 4MXUA 4W9YA 5I0CA 2RB7A 2CY2A 2VZZA 4A32A 1AYEA 1UFHA 1S7FA 1YLEA 2QMLA 3DSBA 3H8FA 4NEXA 4CYNA 1XMBA 4DJLA 3QAYA 4MCQA 2EUIA 2ZW6A 2Q4ZA 3QAHA 4OKOA 5KTCA 3KQZA 4NGQA 3JRUA 1P0HA 3VWDA 4BMHA 2AFXA 1CP6A 2FE7A 4Y49B 4G1PA 1TIQA 2PJBA 1Y0RA 2CTBA 4CGPA 2EK9A 4E8OA 2PR8A 5LRJA 1QMUA 4OIWA 4NGSA 5FVJA 2R98A 3CPXA 5H84A 3FEDA 1S5KA 1IGBA 4H89A 1TXRA 4KOWA 4JXRA 5ELYA 1PU9A 5LYFA 3VH9A 1CBXA 3B3CA 3BJ8A 3HUVA 2P6EA 2VI7A 3IU1A 1L0CA
chains in the Genus database with same CATH topology
3S9LA 3T8WA 3PB6X 1FNOA 3WC7A 4A38A 3KL9A 5K8MA 3B7IA 1OBRA 2ZEHA 1VIXA 2AFZA 1BPMA 2BO9A 1R3NA 3BHXA 3MN8A 1ZLIA 3NH8A 4B6ZA 4P44A 2ZOGA 1BAVA 5HXDA 3LMSA 1LOKA 2AFUA 5DS0A 3N5FA 2ZEMA 3NH5A 3K9TA 3S9NA 2PJCA 2ZENA 2WZNA 3NA6A 4R8FA 2AFOA 3IEHA 4OMEA 3HLPA 3D7HA 3L2NA 2PJ1A 1ZG9A 2PCUA 3D66A 3VARA 2CF4A 3ISXA 4EWTA 4BD9A 4CPAA 5HVFA 3D7FA 2CIJA 5HVHA 1Z5RA 3SJXA 3FH4A 4PPZA 1CG2A 3SJFA 2J9AA 4OC5A 2NSMA 3B3SA 4MHZA 5HVGA 1VHOA 3KR5A 3PB7X 2V8DA 2QJ8A 2JEWA 2PJAA 4IHMA 1PCAA 2IQ6A 3FECA 4P4IA 3ISZA 2ZEGA 2ZEPA 1PYTB 2QYVA 3V7ZA 1ELLP 3B2YA 1XJOA 4MMOA 4MCPA 4R76A 5I4MA 2C6CA 4R7MA 1ZG8A 3WC5A 2BCOA 1CPXA 2AFWA 3FX6A 4MCSA 2AFMA 4ONWA 2ZEEA 2C6GA 4X2TA 4OC2A 1UWYA 3KGQA 4GM5A 2PJ0A 5LYIA 1RTQA 1TF9A 2Q51A 5THWA 4LQGA 4P6YA 4NFRA 4IAVA 2GLFA 3VATA 3BI0A 2Q43A 3KQXA 3PB8X 3B3VA 4OC3A 1CP7A 1YMEA 3CT9A 4TNUA 1QQ9A 3B35A 1DE4C 4UIAA 1GYTA 4K3NA 4PXCA 3SI0A 3PB9X 7CPAA 2ZEDA 4ZY1A 5F09A 2GREA 3IC1A 2PJ9A 1TF8A 2C6PA 2PJ8A 5CPAA 3CPAA 3TC8A 4H2KA 2PRQA 1LCPA 4NGTA 1IY7A 3TX8A 2PIZA 3S9MA 3KI9A 4A37A 3GUXA 4UIBA 2V77A 2NYQA 1YLOA 1R43A 3D68A 2CTCA 1YSJA 3DLJA 1BLLE 5D29A 2OOTA 2DEAA 2PVWA 5K8PA 4OP4A 1XFOA 4MHNA 3FF3A 1Y0YA 3DGVA 4O23A 3PBBA 3BXMA 1ARLA 4RUHA 3D67A 1VGYA 3RBUA 5LYDA 2PE3A 2XEJA 3CDXA 4ZX9A 4UEFA 2ZEOA 4F8ZA 1H8LA 1TKJA 1TKFA 4UEEA 4P4BA 5JGFA 4YWYA 1CPSA 3SJGA 4ZI6A 3FJUA 4DUKA 2O53A 3NH4A 3B3TA 5LRGA 5IB9A 5LYLA 4FBEA 2IMOA 3NFZA 2HB6A 5K8NA 3PFOA 4WJBA 5K8OA 2PJ3A 3I1UA 1YW6A 2WYRA 3IWWA 1ZLHA 4UF4A 5J1QA 2PJ5A 8CPAA 3KHXA 5JH9A 3KR4A 1CX8A 1HDQA 4YU9A 1VHEA 2RFHA 1Q7LA 5LRKA 4ZX8A 1LFWA 2PJ6A 2IJZA 2XEIA 1AMPA 3RAMA 3PEIA 4NJRA 3H8GA 3MRUA 4P4FA 3PBEA 2FVGA 1YW4A 1LAMA 1XRYA 4FWUA 4P4DA 1Z8LA 3H8EA 4OC1A 1ARMA 1ZG7A 2V8VA 3IJ3A 2PJ7A 4NJQA 4P10A 2F7VA 2EWBA 2V8GA 4P45A 2ABZA 4PXDA 3RZAA 3IFEA 2C1CA 4P4JA 1HDUA 2PVVA 2PIYA 4EMEA 2PJ4A 3D4UA 3PRTA 3WC6A 4Q7AA 2F8HA 4ZY2A 3FMCA 2VL1A 3KHZA 3KZWA 3PB4X 2JBJA 5D8NA 3FEEA 3SJEA 2HC9A 4Z65A 4MHYA 3B3WA 4UEZA 2OR4A 3D7DA 1XBUA 3LWUA 4JYWA 3GB0A 4DYOA 4WWVA 4A94A 4NGPA 1NSAA 4R6TA 4NGNA 1FT7A 4X8IA 1F2PA 4MHPA 1ELMP 6CPAA 2ANPA 3D7GA 1KWMA 2JBKA 4OIDA 3FVLA 1TKHA 2V8HA 3SI1A 4OC4A 4A39A 2ZEFA 3GLJA 3QNVA 3IO1A 3V38A 1LANA 1DTDA 2GU2A 2ZELA 4PQAA 1LAPA 2O4HA 2POKA 1F57A 3BI1A 4F9UA 4EFDA 3PFEA 3IIBA 3WABA 3K2KA 5JM6A 2EK8A 1BPNA 3WT4A 4JZ0A 5CBMA 4FAIA 3KASA 1Y7EA 2XEFA 1JQGA 4PXEA 4X3RA 1HEEA 4KSIA 2I3CA 2XEGA 4P4EA 1EE3P 4MCRA 4NGRA 4MRIA 4PXBA 4ZY0A 2G9DA 4OC0A 2AFSA 2ZOFA 2GLJA 4IK2A 1M4LA 4NGMA 4AXVA 2BOAA 3SI2A 4FUUA 2QVPA 1F2OA 2PJ2A 4ZYQA 1Z2LA 4F9VA 4TWEA 4W9YA 4MXUA 2RB7A 1AYEA 4DJLA 3H8FA 1XMBA 4MCQA 4OKOA 2Q4ZA 3KQZA 4NGQA 3JRUA 2AFXA 1CP6A 4G1PA 2PJBA 1Y0RA 2CTBA 2EK9A 5LRJA 1QMUA 4OIWA 4NGSA 3CPXA 3FEDA 1IGBA 1TXRA 5ELYA 5LYFA 3VH9A 1CBXA 3B3CA 3HUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S9L A;  3T8W A;  3PB6 X;  1FNO A;  3WC7 A;  4A38 A;  3KL9 A;  5K8M A;  3B7I A;  1OBR A;  2ZEH A;  1VIX A;  2AFZ A;  1BPM A;  2BO9 A;  1R3N A;  3BHX A;  3MN8 A;  1ZLI A;  3NH8 A;  4B6Z A;  4P44 A;  2ZOG A;  1BAV A;  5HXD A;  3LMS A;  1LOK A;  2AFU A;  5DS0 A;  3N5F A;  2ZEM A;  3NH5 A;  3K9T A;  3S9N A;  2PJC A;  2ZEN A;  2WZN A;  3NA6 A;  4R8F A;  2AFO A;  3IEH A;  4OME A;  3HLP A;  3D7H A;  3L2N A;  2PJ1 A;  1ZG9 A;  2PCU A;  3D66 A;  3VAR A;  2CF4 A;  3ISX A;  4EWT A;  4BD9 A;  4CPA A;  5HVF A;  3D7F A;  2CIJ A;  5HVH A;  1Z5R A;  3SJX A;  3FH4 A;  4PPZ A;  1CG2 A;  3SJF A;  2J9A A;  4OC5 A;  2NSM A;  3B3S A;  4MHZ A;  5HVG A;  1VHO A;  3KR5 A;  3PB7 X;  2V8D A;  2QJ8 A;  2JEW A;  2PJA A;  4IHM A;  1PCA A;  2IQ6 A;  3FEC A;  4P4I A;  3ISZ A;  2ZEG A;  2ZEP A;  1PYT B;  2QYV A;  3V7Z A;  1ELL P;  3B2Y A;  1XJO A;  4MMO A;  4MCP A;  4R76 A;  5I4M A;  2C6C A;  4R7M A;  1ZG8 A;  3WC5 A;  2BCO A;  1CPX A;  2AFW A;  3FX6 A;  4MCS A;  2AFM A;  4ONW A;  2ZEE A;  2C6G A;  4X2T A;  4OC2 A;  1UWY A;  3KGQ A;  4GM5 A;  2PJ0 A;  5LYI A;  1RTQ A;  1TF9 A;  2Q51 A;  5THW A;  4LQG A;  4P6Y A;  4NFR A;  4IAV A;  2GLF A;  3VAT A;  3BI0 A;  2Q43 A;  3KQX A;  3PB8 X;  3B3V A;  4OC3 A;  1CP7 A;  1YME A;  3CT9 A;  4TNU A;  1QQ9 A;  3B35 A;  1DE4 C;  4UIA A;  1GYT A;  4K3N A;  4PXC A;  3SI0 A;  3PB9 X;  7CPA A;  2ZED A;  4ZY1 A;  5F09 A;  2GRE A;  3IC1 A;  2PJ9 A;  1TF8 A;  2C6P A;  2PJ8 A;  5CPA A;  3CPA A;  3TC8 A;  4H2K A;  2PRQ A;  1LCP A;  4NGT A;  1IY7 A;  3TX8 A;  2PIZ A;  3S9M A;  3KI9 A;  4A37 A;  3GUX A;  4UIB A;  2V77 A;  2NYQ A;  1YLO A;  1R43 A;  3D68 A;  2CTC A;  1YSJ A;  3DLJ A;  1BLL E;  5D29 A;  2OOT A;  2DEA A;  2PVW A;  5K8P A;  4OP4 A;  1XFO A;  4MHN A;  3FF3 A;  1Y0Y A;  3DGV A;  4O23 A;  3PBB A;  3BXM A;  1ARL A;  4RUH A;  3D67 A;  1VGY A;  3RBU A;  5LYD A;  2PE3 A;  2XEJ A;  3CDX A;  4ZX9 A;  4UEF A;  2ZEO A;  4F8Z A;  1H8L A;  1TKJ A;  1TKF A;  4UEE A;  4P4B A;  5JGF A;  4YWY A;  1CPS A;  3SJG A;  4ZI6 A;  3FJU A;  4DUK A;  2O53 A;  3NH4 A;  3B3T A;  5LRG A;  5IB9 A;  5LYL A;  4FBE A;  2IMO A;  3NFZ A;  2HB6 A;  5K8N A;  3PFO A;  4WJB A;  5K8O A;  2PJ3 A;  3I1U A;  1YW6 A;  2WYR A;  3IWW A;  1ZLH A;  4UF4 A;  5J1Q A;  2PJ5 A;  8CPA A;  3KHX A;  5JH9 A;  3KR4 A;  1CX8 A;  1HDQ A;  4YU9 A;  1VHE A;  2RFH A;  1Q7L A;  5LRK A;  4ZX8 A;  1LFW A;  2PJ6 A;  2IJZ A;  2XEI A;  1AMP A;  3RAM A;  3PEI A;  4NJR A;  3H8G A;  3MRU A;  4P4F A;  3PBE A;  2FVG A;  1YW4 A;  1LAM A;  1XRY A;  4FWU A;  4P4D A;  1Z8L A;  3H8E A;  4OC1 A;  1ARM A;  1ZG7 A;  2V8V A;  3IJ3 A;  2PJ7 A;  4NJQ A;  4P10 A;  2F7V A;  2EWB A;  2V8G A;  4P45 A;  2ABZ A;  4PXD A;  3RZA A;  3IFE A;  2C1C A;  4P4J A;  1HDU A;  2PVV A;  2PIY A;  4EME A;  2PJ4 A;  3D4U A;  3PRT A;  3WC6 A;  4Q7A A;  2F8H A;  4ZY2 A;  3FMC A;  2VL1 A;  3KHZ A;  3KZW A;  3PB4 X;  2JBJ A;  5D8N A;  3FEE A;  3SJE A;  2HC9 A;  4Z65 A;  4MHY A;  3B3W A;  4UEZ A;  2OR4 A;  3D7D A;  1XBU A;  3LWU A;  4JYW A;  3GB0 A;  4DYO A;  4WWV A;  4A94 A;  4NGP A;  1NSA A;  4R6T A;  4NGN A;  1FT7 A;  4X8I A;  1F2P A;  4MHP A;  1ELM P;  6CPA A;  2ANP A;  3D7G A;  1KWM A;  2JBK A;  4OID A;  3FVL A;  1TKH A;  2V8H A;  3SI1 A;  4OC4 A;  4A39 A;  2ZEF A;  3GLJ A;  3QNV A;  3IO1 A;  3V38 A;  1LAN A;  1DTD A;  2GU2 A;  2ZEL A;  4PQA A;  1LAP A;  2O4H A;  2POK A;  1F57 A;  3BI1 A;  4F9U A;  4EFD A;  3PFE A;  3IIB A;  3WAB A;  3K2K A;  5JM6 A;  2EK8 A;  1BPN A;  3WT4 A;  4JZ0 A;  5CBM A;  4FAI A;  3KAS A;  1Y7E A;  2XEF A;  1JQG A;  4PXE A;  4X3R A;  1HEE A;  4KSI A;  2I3C A;  2XEG A;  4P4E A;  1EE3 P;  4MCR A;  4NGR A;  4MRI A;  4PXB A;  4ZY0 A;  2G9D A;  4OC0 A;  2AFS A;  2ZOF A;  2GLJ A;  4IK2 A;  1M4L A;  4NGM A;  4AXV A;  2BOA A;  3SI2 A;  4FUU A;  2QVP A;  1F2O A;  2PJ2 A;  4ZYQ A;  1Z2L A;  4F9V A;  4TWE A;  4W9Y A;  4MXU A;  2RB7 A;  1AYE A;  4DJL A;  3H8F A;  1XMB A;  4MCQ A;  4OKO A;  2Q4Z A;  3KQZ A;  4NGQ A;  3JRU A;  2AFX A;  1CP6 A;  4G1P A;  2PJB A;  1Y0R A;  2CTB A;  2EK9 A;  5LRJ A;  1QMU A;  4OIW A;  4NGS A;  3CPX A;  3FED A;  1IGB A;  1TXR A;  5ELY A;  5LYF A;  3VH9 A;  1CBX A;  3B3C A;  3HUV A; 
#chains in the Genus database with same CATH topology
 2K5T A;  3S9L A;  5G1Z A;  3T8W A;  3PB6 X;  4KVM E;  2EO8 A;  3C26 A;  4EVY A;  1FNO A;  3WC7 A;  4A38 A;  3KL9 A;  5K8M A;  1M4I A;  3B7I A;  4NCZ A;  4UFX A;  1OBR A;  2ZEH A;  1VIX A;  3D8P A;  5E96 A;  2AFZ A;  1BPM A;  3FBU A;  3K9U A;  2BO9 A;  1R3N A;  2BUE A;  1S7K A;  3QB8 A;  4JJX A;  3BHX A;  4JLY A;  3T9Y A;  2P6G A;  2B5G A;  4KOU A;  1QSM A;  4B12 A;  1KUX A;  3MN8 A;  1ZLI A;  2FXF A;  4M6H A;  2CNS A;  4JWP A;  4DNC A;  3NH8 A;  3TO6 A;  1I21 A;  4B6Z A;  4P44 A;  4I49 A;  2ZOG A;  1BAV A;  3EY5 A;  5HXD A;  3LMS A;  4KOY A;  1LOK A;  2AFU A;  3JUW A;  3R1K A;  4H6Z A;  3CXP A;  1S7N A;  3R9F A;  1BO4 A;  4XNH C;  2Z0Z A;  4KLV A;  5DS0 A;  3N5F A;  2FIW A;  2KCW A;  1XEB A;  4C2X A;  2ZEM A;  4B5P A;  3H5Z A;  2D4O A;  4AVA A;  1M44 A;  4UWI A;  4UA3 A;  1A2Z A;  2GIV A;  3D3S A;  4KLW A;  4CS0 B;  2JDD A;  3NH5 A;  4MFZ A;  3K9T A;  4JXQ A;  3S9N A;  2PJC A;  1S3Z A;  2ZEN A;  3RO0 A;  1RXT A;  2WZN A;  3RYO A;  4II9 A;  3NA6 A;  4R8F A;  2AFO A;  3IEH A;  4OME A;  3HLP A;  3D7H A;  3L2N A;  2F5I A;  1Z9U A;  4YFJ A;  2PJ1 A;  1ON0 A;  4GS4 A;  3G8W A;  1ZG9 A;  2PCU A;  5H86 A;  3D66 A;  3VAR A;  2CF4 A;  5AG7 A;  3EXN A;  3ISX A;  2Z3K A;  1OZP A;  4EWT A;  2AE6 A;  1KUY A;  2G3A A;  4BD9 A;  4R3L A;  4CPA A;  2B4B A;  5HVF A;  3TCV A;  3D7F A;  2CIJ A;  5HVH A;  3CXS A;  5KTD A;  1Z5R A;  3SJX A;  3FH4 A;  4ORF A;  4ZGY B;  2B3V A;  4PPZ A;  4KS9 A;  2GAN A;  2JLM A;  1CG2 A;  3SJF A;  1IOF A;  2J9A A;  4OC5 A;  5CNP A;  2J8N A;  2NSM A;  4KVO E;  3B3S A;  4MHZ A;  4KOS A;  5HVG A;  1IYK A;  2PR1 A;  1VHO A;  2BL1 A;  3KR5 A;  3PB7 X;  1YX0 A;  3JVN A;  2V8D A;  2QJ8 A;  2JEW A;  2PJA A;  4KOV A;  3MGD A;  2H5M A;  4U5Y A;  4XPK A;  3V8I A;  2YNC A;  4IHM A;  4A31 A;  1PCA A;  2IQ6 A;  4Y49 C;  3FEC A;  4AG9 A;  4P4I A;  4F0X A;  3ISZ A;  2ZEG A;  3BLN A;  5F47 A;  2ZEP A;  1PYT B;  2QYV A;  3V7Z A;  1ELL P;  3B2Y A;  1XJO A;  4MMO A;  4MCP A;  2VZY A;  3B8G A;  1YK3 A;  4ONU A;  4R76 A;  5I4M A;  2C6C A;  4R7M A;  2D4P A;  1PUA A;  3WR7 A;  1ZG8 A;  4CAV A;  1IU8 A;  3WC5 A;  4C68 A;  2BCO A;  1CPX A;  4KUA A;  1MK4 A;  2AFW A;  1LRZ A;  2Z3L A;  5G20 A;  1S60 A;  3FX6 A;  4L8A A;  4MCS A;  2AFM A;  4L89 A;  2ODF A;  4ONW A;  2ZEE A;  1R57 A;  2C6G A;  3P2F A;  4X2T A;  4OC2 A;  2IL4 A;  4XPD B;  3S6F A;  2ZW7 A;  1P4N A;  1UWY A;  3KGQ A;  1Z4E A;  4GM5 A;  4UBR A;  5A28 A;  1FY7 A;  2PJ0 A;  2REE A;  4AB7 A;  2OU2 A;  4HKF A;  5G21 A;  4B5P B;  5LYI A;  1RTQ A;  1TF9 A;  1Z4R A;  2Q51 A;  5THW A;  4LQG A;  4P6Y A;  4NFR A;  4IAV A;  1MJ9 A;  2GLF A;  4CGN A;  3VAT A;  5EBV A;  3TE4 A;  4QC6 A;  3BI0 A;  2Q43 A;  4C2Z A;  2DXQ A;  1IYL A;  1XE4 A;  3KQX A;  1MJB A;  3PB8 X;  5EMI A;  1IB1 E;  2Q44 A;  3S6G A;  1Q2Y A;  3B3V A;  4OC3 A;  2EVN A;  1ZO0 A;  1CP7 A;  1YME A;  2JEV A;  3CT9 A;  4TNU A;  1QQ9 A;  5AG5 A;  3NE7 A;  5AGE A;  3B35 A;  5G22 A;  1DE4 C;  4UIA A;  1GYT A;  4K3N A;  4F0Y A;  4PXC A;  3SI0 A;  3PB9 X;  7CPA A;  4M3S A;  2Z11 A;  1SQH A;  2ZED A;  5C88 A;  3FYN A;  4ZY1 A;  2VBQ A;  5F09 A;  1AUG A;  4ZBG A;  2GRE A;  3IC1 A;  4CAE A;  1N71 A;  2CXA A;  2PJ9 A;  4J3G A;  3PP9 A;  2B58 A;  5DWM A;  4RN7 A;  1TF8 A;  1Y9W A;  2C6P A;  2PJ8 A;  5GCN A;  5CPA A;  1BOB A;  3CPA A;  4K30 A;  3TC8 A;  1IOI A;  1I1D A;  3EC4 A;  2HV2 A;  4H2K A;  2OZU A;  2PRQ A;  1S7L A;  1LCP A;  2Y0M A;  1IY7 A;  4NGT A;  3TX8 A;  1CJW A;  3IWG A;  2PIZ A;  3P2H A;  3KI9 A;  3S9M A;  4M6I A;  4B11 A;  4A37 A;  3GUX A;  1QST A;  4KVX A;  2V77 A;  2NYQ A;  1YLO A;  1B87 A;  4MFQ A;  4UIB A;  2BSW A;  1R43 A;  3D68 A;  3CXQ A;  2CTC A;  1YSJ A;  3DLJ A;  2VEZ A;  3GYA A;  1Z8X A;  3LD2 A;  1BLL E;  1YVO A;  5D29 A;  1M4D A;  4KSF A;  3FNC A;  2OOT A;  3S6H A;  4CAX A;  2Q04 A;  2DEA A;  2PVW A;  2YGW A;  4AVC A;  2QIR A;  4OP4 A;  4RI1 A;  5K8P A;  1XFO A;  2GE3 A;  3DR6 A;  3FF3 A;  4MHN A;  5AG4 A;  3LAC A;  3W6X A;  3SHP A;  2ATR A;  1Y0Y A;  3DGV A;  5J8F A;  1J4J A;  2Z3M A;  4O23 A;  3PBB A;  3BXM A;  1ARL A;  4FD4 A;  4NSQ A;  3D67 A;  4RUH A;  2YND A;  3NE8 A;  4KZT A;  2C27 A;  1VGY A;  3RBU A;  4OAE A;  4B13 A;  3F8K A;  5LYD A;  2PE3 A;  4CRY B;  4YGO A;  2B3U A;  2I00 A;  2XEJ A;  1Q2C A;  4UFW A;  3CDX A;  3OWC A;  4ZX9 A;  3UY5 A;  4IF5 A;  4UEF A;  2WPW A;  2ZEO A;  4QVT A;  1H8L A;  4F8Z A;  3LOD A;  1TKJ A;  4RS2 A;  3R9G A;  1TKF A;  2BEI A;  4UEE A;  4P4B A;  4PSW A;  4YWY A;  5JGF A;  4C7H A;  1CPS A;  3SJG A;  4ZI6 A;  3FJU A;  4DUK A;  1U6M A;  2O53 A;  3NH4 A;  3B3T A;  5LRG A;  5IB9 A;  4R3K A;  5LYL A;  4FBE A;  2IMO A;  2WPX A;  2HB6 A;  3NFZ A;  4MI4 A;  4NXY A;  4X5K A;  2HUZ A;  3BJ7 A;  5C82 A;  2ZPA A;  5K8N A;  2YNE A;  3PFO A;  3FB3 A;  3VWE A;  2OZH A;  4HNX B;  2JDC A;  3JTK A;  2Q4V A;  4PK3 A;  4WJB A;  2PJ3 A;  5K8O A;  5AG6 A;  3I1U A;  1YRE A;  2Z3N A;  3A9L A;  1YW6 A;  2WYR A;  3IWW A;  4XPL A;  1ZLH A;  5BWA B;  4UF4 A;  4XNH B;  4R57 A;  4U9Z A;  1Z8T A;  2VQY A;  5J1Q A;  2PJ5 A;  2R7H A;  4LUA A;  3PGP A;  2REF A;  3E0K A;  1YQE A;  3IU2 A;  2J8R A;  4FD5 A;  8CPA A;  3KHX A;  1V0C A;  5JH9 A;  5J8C A;  3KR4 A;  3TFY A;  4CYQ A;  5IV0 A;  1Q2D A;  1XMT A;  1CX8 A;  2P6F A;  5ISV A;  4KSA A;  3RNZ A;  2OH1 A;  2Q7B A;  1MJA A;  4HNW B;  1K4J A;  1GHE A;  4OLL A;  1HDQ A;  4A95 A;  5KTA A;  2FCK A;  4YU9 A;  1VHE A;  4MFL A;  2RFH A;  1Q7L A;  3SXN A;  3FIX A;  1I12 A;  5LRK A;  4ZX8 A;  1LFW A;  2WUU A;  2X7B A;  2PJ6 A;  4M85 A;  2IJZ A;  2YNC C;  2XEI A;  4UCN A;  4CAF A;  4CGM A;  1AMP A;  3D2P A;  2PDO A;  3RAM A;  1RO5 A;  2Z10 A;  4IUS A;  4UWJ A;  1XOV A;  4F6A A;  3PEI A;  1IIC A;  4NJR A;  3H8G A;  4CRZ B;  3MRU A;  1WK4 A;  4MJ8 A;  4P4F A;  3W91 A;  3PBE A;  2FVG A;  1YW4 A;  3F5B A;  1LAM A;  1XRY A;  4FWU A;  3R9E A;  4P4D A;  1Z8L A;  4UCP A;  3DNS A;  1WWZ A;  2ARH A;  3H8E A;  1Z8W A;  4NF1 A;  4OC1 A;  2ZXV A;  1ARM A;  1ZG7 A;  2V8V A;  4Q38 A;  2RC4 A;  4CYO A;  2VXK A;  5IB0 A;  3IJ3 A;  2PJ7 A;  2OZG A;  1QSO A;  4KOX A;  4NJQ A;  2F7V A;  2EWB A;  4P10 A;  2P0W A;  4MFJ A;  4QBJ A;  2V8G A;  1X10 A;  4P45 A;  2CNT A;  2ABZ A;  3TOA A;  4PXD A;  5DWN A;  4MY0 A;  3RZA A;  3IFE A;  4BIN A;  3D2M A;  2C1C A;  4P4J A;  4UCM A;  2G3T A;  1HDU A;  2PSW A;  2PVV A;  3PZJ A;  2PIY A;  4EME A;  2DPT A;  2PJ4 A;  3D4U A;  3H4Q A;  1NE9 A;  5HMN A;  3PRT A;  3WC6 A;  4U9Y A;  4Q7A A;  4LQ6 A;  2F8H A;  2R8V A;  4KOR A;  3F0A A;  3GY9 A;  4ZY2 A;  3FMC A;  2VL1 A;  4E0A A;  2NMT A;  5JQ4 A;  3KHZ A;  2ZW5 A;  3KZW A;  4B14 A;  4MHD A;  3PB4 X;  2JBJ A;  4MFP A;  5D8N A;  5JPH A;  1XIX A;  2EBJ A;  4A33 A;  4R87 A;  4FD7 A;  3FEE A;  2Q0Y A;  4QUS A;  2Z3O A;  2HC9 A;  3SJE A;  3TT2 A;  4Z65 A;  1M1D A;  1VHS A;  4MHY A;  3B3W A;  3GIU A;  4A30 A;  4E2A A;  3IWE A;  3DR8 A;  4PK2 A;  2G0B A;  2FS5 A;  2Q4Y A;  4B10 A;  4YRH A;  4UEZ A;  4MY3 A;  4C7I A;  1IID A;  2OR4 A;  2A4N A;  4HPS A;  4AVB A;  5HH1 A;  3EO4 A;  3D7D A;  1XBU A;  3N7Z A;  4BBH A;  2FL4 A;  1JWQ A;  3LWU A;  4JYW A;  3GB0 A;  4DYO A;  2PC1 A;  2ZW4 A;  3R95 A;  2AJ6 A;  3ZZI A;  4WWV A;  4A94 A;  5A27 A;  4NGP A;  3TO9 A;  1NSA A;  4R6T A;  4NGN A;  1FT7 A;  3KKW A;  1CM0 A;  4MFK A;  4KUB A;  4R9M A;  4X8I A;  4CYP A;  1F2P A;  4MHP A;  1ELM P;  2FT0 A;  2PRB A;  3T90 A;  6CPA A;  4MBU A;  2ANP A;  2QEC A;  3D7G A;  3DDD A;  2GFQ A;  3S6K A;  1KWM A;  2JBK A;  4XPD C;  4CAW A;  4OID A;  2B4D B;  3FVL A;  1TKH A;  3TO7 A;  2I79 A;  3FRM A;  3TTH A;  3SXO A;  2DPS A;  4HNY B;  2V8H A;  3R96 A;  4OC4 A;  2O28 A;  5EC4 A;  3SI1 A;  4B5O A;  4Q36 A;  2FIA A;  1NSL A;  3EFA A;  4FD6 A;  4A39 A;  2ZEF A;  3GLJ A;  2HQY A;  3QNV A;  3IO1 A;  3V38 A;  2Z3P A;  4AG7 A;  5F46 A;  1LAN A;  1DTD A;  2GU2 A;  2ZEL A;  1YVK A;  2FSR A;  1XF8 A;  4PQA A;  2O4H A;  1LAP A;  1QSR A;  2Q7S A;  4QB9 A;  3I9S A;  2POK A;  1F57 A;  3BI1 A;  4F9U A;  4EFD A;  4PV6 A;  3PFE A;  3IIB A;  3WAB A;  2J8M A;  3K2K A;  1B6B A;  2EK8 A;  3ZJ0 A;  1BPN A;  3WT4 A;  1NMT A;  5JM6 A;  3G3S A;  2WSA A;  4PSX A;  4JZ0 A;  5CBM A;  4FAI A;  4JD6 A;  3KAS A;  1Y7E A;  2XEF A;  1JQG A;  2DF5 A;  1QSN A;  4PXE A;  4X3R A;  1M4G A;  1HEE A;  2PQ8 A;  2CNM A;  4KSI A;  2I3C A;  4KOT A;  2XEG A;  3GKR A;  4P4E A;  1EE3 P;  3IGR A;  4MCR A;  4NGR A;  1X12 A;  4MRI A;  4PXB A;  1KUV A;  4M6G A;  5IX3 A;  4UFV A;  2R1I A;  4LX9 A;  4A2Z A;  4OAD A;  4ZY0 A;  1YR0 A;  2G9D A;  4OC0 A;  4H6U A;  2B5G B;  3FXT A;  4C2Y A;  2AFS A;  2ZOF A;  2GLJ A;  1VKC A;  1M4L A;  4IK2 A;  1Y7R A;  4NGM A;  4CGL A;  3W6S A;  2OB0 A;  4AXV A;  3CZX A;  4GXH A;  2BOA A;  3SI2 A;  2B4D A;  5F48 A;  4FUU A;  2QVP A;  1F2O A;  2PJ2 A;  1YGH A;  4ZYQ A;  1Y9K A;  1Z2L A;  4F9V A;  1KZF A;  4CGO A;  5F49 A;  3TOB A;  3I3G A;  4TWE A;  4MXU A;  4W9Y A;  5I0C A;  2RB7 A;  2CY2 A;  2VZZ A;  4A32 A;  1AYE A;  1UFH A;  1S7F A;  1YLE A;  2QML A;  3DSB A;  3H8F A;  4NEX A;  4CYN A;  1XMB A;  4DJL A;  3QAY A;  4MCQ A;  2EUI A;  2ZW6 A;  2Q4Z A;  3QAH A;  4OKO A;  5KTC A;  3KQZ A;  4NGQ A;  3JRU A;  1P0H A;  3VWD A;  4BMH A;  2AFX A;  1CP6 A;  2FE7 A;  4Y49 B;  4G1P A;  1TIQ A;  2PJB A;  1Y0R A;  2CTB A;  4CGP A;  2EK9 A;  4E8O A;  2PR8 A;  5LRJ A;  1QMU A;  4OIW A;  4NGS A;  5FVJ A;  2R98 A;  3CPX A;  5H84 A;  3FED A;  1S5K A;  1IGB A;  4H89 A;  1TXR A;  4KOW A;  4JXR A;  5ELY A;  1PU9 A;  5LYF A;  3VH9 A;  1CBX A;  3B3C A;  3BJ8 A;  3HUV A;  2P6E A;  2VI7 A;  3IU1 A;  1L0C A; 
#chains in the Genus database with same CATH homology
 3S9L A;  3T8W A;  3PB6 X;  1FNO A;  3WC7 A;  4A38 A;  3KL9 A;  5K8M A;  3B7I A;  1OBR A;  2ZEH A;  1VIX A;  2AFZ A;  1BPM A;  2BO9 A;  1R3N A;  3BHX A;  3MN8 A;  1ZLI A;  3NH8 A;  4B6Z A;  4P44 A;  2ZOG A;  1BAV A;  5HXD A;  3LMS A;  1LOK A;  2AFU A;  5DS0 A;  3N5F A;  2ZEM A;  3NH5 A;  3K9T A;  3S9N A;  2PJC A;  2ZEN A;  2WZN A;  3NA6 A;  4R8F A;  2AFO A;  3IEH A;  4OME A;  3HLP A;  3D7H A;  3L2N A;  2PJ1 A;  1ZG9 A;  2PCU A;  3D66 A;  3VAR A;  2CF4 A;  3ISX A;  4EWT A;  4BD9 A;  4CPA A;  5HVF A;  3D7F A;  2CIJ A;  5HVH A;  1Z5R A;  3SJX A;  3FH4 A;  4PPZ A;  1CG2 A;  3SJF A;  2J9A A;  4OC5 A;  2NSM A;  3B3S A;  4MHZ A;  5HVG A;  1VHO A;  3KR5 A;  3PB7 X;  2V8D A;  2QJ8 A;  2JEW A;  2PJA A;  4IHM A;  1PCA A;  2IQ6 A;  3FEC A;  4P4I A;  3ISZ A;  2ZEG A;  2ZEP A;  1PYT B;  2QYV A;  3V7Z A;  1ELL P;  3B2Y A;  1XJO A;  4MMO A;  4MCP A;  4R76 A;  5I4M A;  2C6C A;  4R7M A;  1ZG8 A;  3WC5 A;  2BCO A;  1CPX A;  2AFW A;  3FX6 A;  4MCS A;  2AFM A;  4ONW A;  2ZEE A;  2C6G A;  4X2T A;  4OC2 A;  1UWY A;  3KGQ A;  4GM5 A;  2PJ0 A;  5LYI A;  1RTQ A;  1TF9 A;  2Q51 A;  5THW A;  4LQG A;  4P6Y A;  4NFR A;  4IAV A;  2GLF A;  3VAT A;  3BI0 A;  2Q43 A;  3KQX A;  3PB8 X;  3B3V A;  4OC3 A;  1CP7 A;  1YME A;  3CT9 A;  4TNU A;  1QQ9 A;  3B35 A;  1DE4 C;  4UIA A;  1GYT A;  4K3N A;  4PXC A;  3SI0 A;  3PB9 X;  7CPA A;  2ZED A;  4ZY1 A;  5F09 A;  2GRE A;  3IC1 A;  2PJ9 A;  1TF8 A;  2C6P A;  2PJ8 A;  5CPA A;  3CPA A;  3TC8 A;  4H2K A;  2PRQ A;  1LCP A;  4NGT A;  1IY7 A;  3TX8 A;  2PIZ A;  3S9M A;  3KI9 A;  4A37 A;  3GUX A;  4UIB A;  2V77 A;  2NYQ A;  1YLO A;  1R43 A;  3D68 A;  2CTC A;  1YSJ A;  3DLJ A;  1BLL E;  5D29 A;  2OOT A;  2DEA A;  2PVW A;  5K8P A;  4OP4 A;  1XFO A;  4MHN A;  3FF3 A;  1Y0Y A;  3DGV A;  4O23 A;  3PBB A;  3BXM A;  1ARL A;  4RUH A;  3D67 A;  1VGY A;  3RBU A;  5LYD A;  2PE3 A;  2XEJ A;  3CDX A;  4ZX9 A;  4UEF A;  2ZEO A;  4F8Z A;  1H8L A;  1TKJ A;  1TKF A;  4UEE A;  4P4B A;  5JGF A;  4YWY A;  1CPS A;  3SJG A;  4ZI6 A;  3FJU A;  4DUK A;  2O53 A;  3NH4 A;  3B3T A;  5LRG A;  5IB9 A;  5LYL A;  4FBE A;  2IMO A;  3NFZ A;  2HB6 A;  5K8N A;  3PFO A;  4WJB A;  5K8O A;  2PJ3 A;  3I1U A;  1YW6 A;  2WYR A;  3IWW A;  1ZLH A;  4UF4 A;  5J1Q A;  2PJ5 A;  8CPA A;  3KHX A;  5JH9 A;  3KR4 A;  1CX8 A;  1HDQ A;  4YU9 A;  1VHE A;  2RFH A;  1Q7L A;  5LRK A;  4ZX8 A;  1LFW A;  2PJ6 A;  2IJZ A;  2XEI A;  1AMP A;  3RAM A;  3PEI A;  4NJR A;  3H8G A;  3MRU A;  4P4F A;  3PBE A;  2FVG A;  1YW4 A;  1LAM A;  1XRY A;  4FWU A;  4P4D A;  1Z8L A;  3H8E A;  4OC1 A;  1ARM A;  1ZG7 A;  2V8V A;  3IJ3 A;  2PJ7 A;  4NJQ A;  4P10 A;  2F7V A;  2EWB A;  2V8G A;  4P45 A;  2ABZ A;  4PXD A;  3RZA A;  3IFE A;  2C1C A;  4P4J A;  1HDU A;  2PVV A;  2PIY A;  4EME A;  2PJ4 A;  3D4U A;  3PRT A;  3WC6 A;  4Q7A A;  2F8H A;  4ZY2 A;  3FMC A;  2VL1 A;  3KHZ A;  3KZW A;  3PB4 X;  2JBJ A;  5D8N A;  3FEE A;  3SJE A;  2HC9 A;  4Z65 A;  4MHY A;  3B3W A;  4UEZ A;  2OR4 A;  3D7D A;  1XBU A;  3LWU A;  4JYW A;  3GB0 A;  4DYO A;  4WWV A;  4A94 A;  4NGP A;  1NSA A;  4R6T A;  4NGN A;  1FT7 A;  4X8I A;  1F2P A;  4MHP A;  1ELM P;  6CPA A;  2ANP A;  3D7G A;  1KWM A;  2JBK A;  4OID A;  3FVL A;  1TKH A;  2V8H A;  3SI1 A;  4OC4 A;  4A39 A;  2ZEF A;  3GLJ A;  3QNV A;  3IO1 A;  3V38 A;  1LAN A;  1DTD A;  2GU2 A;  2ZEL A;  4PQA A;  1LAP A;  2O4H A;  2POK A;  1F57 A;  3BI1 A;  4F9U A;  4EFD A;  3PFE A;  3IIB A;  3WAB A;  3K2K A;  5JM6 A;  2EK8 A;  1BPN A;  3WT4 A;  4JZ0 A;  5CBM A;  4FAI A;  3KAS A;  1Y7E A;  2XEF A;  1JQG A;  4PXE A;  4X3R A;  1HEE A;  4KSI A;  2I3C A;  2XEG A;  4P4E A;  1EE3 P;  4MCR A;  4NGR A;  4MRI A;  4PXB A;  4ZY0 A;  2G9D A;  4OC0 A;  2AFS A;  2ZOF A;  2GLJ A;  4IK2 A;  1M4L A;  4NGM A;  4AXV A;  2BOA A;  3SI2 A;  4FUU A;  2QVP A;  1F2O A;  2PJ2 A;  4ZYQ A;  1Z2L A;  4F9V A;  4TWE A;  4W9Y A;  4MXU A;  2RB7 A;  1AYE A;  4DJL A;  3H8F A;  1XMB A;  4MCQ A;  4OKO A;  2Q4Z A;  3KQZ A;  4NGQ A;  3JRU A;  2AFX A;  1CP6 A;  4G1P A;  2PJB A;  1Y0R A;  2CTB A;  2EK9 A;  5LRJ A;  1QMU A;  4OIW A;  4NGS A;  3CPX A;  3FED A;  1IGB A;  1TXR A;  5ELY A;  5LYF A;  3VH9 A;  1CBX A;  3B3C A;  3HUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...