2GFQA

Structure of protein of unknown function ph0006 from pyrococcus horikoshii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
288
structure length
288
Chain Sequence
HSSGRENLYFQGHMKVIMTTKVDKASMNIMNKLIENFGFKETEYVFEGNPVYKRGDVLILTTNDEMIYYDYLDREIENQLGFKPEIIAFASRHSSKQKLPALTTHVTGNWGKAMYGGKDESFAVAIPSAMKLSLLKMSELNDLGWTVCYEATHHGPTELEVPSFFIEIGSSEEEWINDRAGEIIAETIIYVLDNYEKGRSKFKVALGIGGGHYAPKQTKRALEGDLAFGHILPKYAQPVSRDVMIKALNRFGEKVEAIYVDWKGSRGETRQLAKSLAQELGLEFIKDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of hypothetical protein ph0006 from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords UPF0204 protein PH0006
total genus 107
structure length 288
sequence length 288
chains with identical sequence B, C
ec nomenclature ec 3.1.1.96: D-aminoacyl-tRNA deacylase.
pdb deposition date 2006-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04414 tRNA_deacylase D-aminoacyl-tRNA deacylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold AF0625-like 2gfqA02
3.40.630.50 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase AF0625-like 2gfqA01
1YQEA 2GFQA
chains in the Genus database with same CATH superfamily
2EZ4A 3IAM6 4KTTE 4B80A 3CA8A 3W3AD 3JYOA 4F2DA 3NTVA 1G291 1MU0A 4WRRA 1OX6A 4C4ZA 4LJAA 4HGZA 1CP2A 2DPYA 4KLWA 4CGMA 1L7NA 2F1OA 4MCQA 3TAUA 1OC4A 1ZD4A 2Q5LA 4WK4B 1USVA 2H08A 4ARAA 2J67A 3AQ4A 4QGBA 2ZKIA 5B7GA 3G0OA 2JKYA 4Q4AB 4TS1A 1QVVA 3QE3A 3SC4A 2HQRA 1N33B 4A37A 1M6NA 3G5TA 1RM0A 2CNWA 4ZVUA 3NHRA 3C7CB 1ZHFA 1XZFA 2V96A 4TWRA 4ZVQA 4WOBA 4OYYA 2GD2A 4LK2A 1XD9A 1OH8A 4BNDA 2G71A 2BBOA 3P97A 3VVLA 3A9VA 4LOHA 4P4LA 4PLCA 3HB0A 1PX0A 3OC0A 5HM8A 4YBZA 4XCQA 2ZVDA 4IOLA 2D2FA 3N6XA 4MUHA 2E0IA 2BJHA 3MN8A 2X1MA 3FOBA 3ZXSA 1W85B 2AEJA 3HGTA 3I39X 5FL7A 2NXWA 4RPGA 2B36A 5DYTA 2XCRB 4NJQA 2X3FA 3OX3A 2NV0A 5B57C 3FMVA 1KMMA 4X65B 1G41A 1XZCA 2J3QA 1H8ED 1EP1B 2LNDA 2G4LA 1WA5A 2IY8A 2Y0CA 2JW5A 4HAUA 1NV9A 1Z8NA 4F2GA 1IXZA 5EXXA 3RTDA 2FW8A 3W5JA 1RMTA 1ZKDA 1XF1A 2GVZC 2BHSA 1OILA 2IIVA 1E58A 2ZJ2A 3ENQA 3TBKA 3A6PC 3KPWA 3BDAA 2RGYA 4TLCA 1SC3A 1U9IC 3TQCA 3ANLA 3HEAA 4LRTB 4M1KA 4U7DA 3D3QA 5IMBA 3T1QA 4ZEMA 4IY1A 2B34A 1B6RA 5HCUA 5AKYA 4EUNA 2GN9A 1W1WA 1X3SA 1CZUA 5LRKA 4WGGA 3LT2A 4XZ3A 5T8KC 3ZE2B 3GGSA 3PEEA 2PSHA 2A9PA 4XPZA 4XPLA 3LM8A 1DIOB 3F74A 1GSOA 4GF5A 1XQ1A 2X77A 4JVNA 3ZD8A 3TTHA 3ST7A 3QPCA 2GPYA 2IQ6A 3VO8A 2YVAA 3PTAA 2XQVA 1Z5WA 5FEMA 4JQZA 2AOUB 2DF8A 2IYYA 1A4XA 3GFOA 2FFAA 3QVWA 4NJEB 1LFWA 4ZT3A 3GNQA 4R9MA 3ITDA 3O4GA 3PDHA 4F6AA 2LBPA 5KNDA 1KU6A 2E5WA 2IFTA 2V54A 3B6JA 3D8SA 3MMNA 3BTUA 3KOUA 5BVGB 5B1DA 1Y9KA 1G8KA 5K4GA 2AZXA 1UKZA 5LN1A 4WKBA 1YW6A 4P6YA 3HDTA 3ZD7A 4OMFG 4C4TA 1KAGA 4QU0A 4YO7A 1JAIA 2OZVA 2BZSA 4ZVLA 3LBAA 2XOXA 3RSQA 5A2GA 5C88A 3O3CA 3N39C 1YVPA 2D2IA 2PGNA 4ZAXA 1KIAA 3FYUA 3G2IA 5KWEA 2DF5A 4ILEA 1CZLA 3SC2B 1Y48E 5MFZA 2F3PA 1M72A 2P0AA 9ABPA 3BGOS 3RANA 5JCJD 4FFSA 3NWEA 3PGJA 3QV2A 4HKFA 4GLJA 5ISVA 1SD5A 5AVXA 4A39A 1G2IA 1PK8A 2VEDA 1PT7A 2HIAA 3PNMA 4DSZA 5EJ8A 1QQ7A 1NFQA 3JZIA 4WV3A 1E0KA 2AFHA 2YV5A 4YUYA 2VS1A 3OUZA 1IHOA 1VKHA 4IM7A 1R5OA 3OOSA 3UHJA 1I12A 3QELB 1Y6ZA 2WSAA 3T52A 1UK7A 2GPBA 2YVLA 3NWBA 1P5RA 1UIMA 1PVVA 1QV9A 3O0DA 4OHWA 3V4SA 1E1RD 4JLBA 2O06A 2XT9A 10MHA 3VYWA 4TYNA 4RVSA 1NMXA 4BQSA 2OMEA 3KOXA 2B4BA 4AJ4A 2EJWA 5C1PA 2VEZA 2ZIVB 5ADUS 4G0UA 3KTAB 1K8QA 1KXZA 4I5DA 2FSVC 4YI3A 3TNYA 5HXAA 5D2CA 4HRVA 4NTZA 3U3JA 3WLSA 4ONUA 2AWNA 3WHIA 4EJSC 3FPEA 3RM3A 3K1AA 4EL0A 3IA7A 1L7RA 1LDYA 1XJQA 4P5PA 3KYDA 1G7TA 4QUKA 4RJLA 3TB4A 3ZI4A 5BWOA 5AW2A 3G3SA 1JQDA 3LK6A 5HXDA 3L82B 2R3SA 1X80A 1ZXBA 3LOPA 1NXXA 5ERXA 3BMCB 3H83A 1FY2A 1ZL0A 2BFEA 4PX5A 2ZE7A 3ELUA 1FU4A 2FDXA 5CVUA 4EO9A 1TUBA 3I8SA 1GNQA 1L2TA 2I6TA 1WCIA 2I71A 2QM7A 4M86A 3T9FA 3MCAA 3RYTC 3KR1A 4X45A 2BEWA 2E3JA 2HJWA 4LHSA 4OAOA 4QEZA 5JY6A 2R5FA 2EWBA 3N86A 4KCGA 4KGVA 1DARA 1U28A 1NKSA 3BKWA 4WNIA 3X3HA 2NACA 4DT1B 2JAWA 5JCXA 3JALA 3J81k 5T4HA 1IULA 2HQBA 3SHVA 5K0NA 2XMDA 3PKZA 2XMZA 4ENPA 1H69A 1DLIA 5CLIA 5G20A 1UC4B 4ZCQA 3PDIB 1VIAA 1EDOA 5JYCA 3A11A 5K8TA 2REOA 2XF8A 3LVFO 3QLJA 3S7TA 3CWZA 2PRZA 3VSBA 4D9EA 4B7AA 3LQ4A 2XJ9A 4JR2A 3F9CA 3TC8A 2GZDA 2IYOA 1OYYA 3IEIA 5TJHA 1EI9A 5B7NA 5GOZA 1LD3A 4PAOA 1CF2O 4J1TA 4PYRA 2EAUA 4RNCA 2PSFA 4B6JA 2AI1A 1NLUA 1PDWA 1NJFA 1O97C 1QGOA 1WXXA 4H9GA 4OHXA 4WD3A 2W0MA 2YJ5A 1DE0A 3N2GB 3D6TB 1YA8A 3DKVA 4JNCA 4ALLA 1OCEA 5G22A 4K9MA 2OR3A 2WJGA 3DGFC 2F67A 4JL8A 2R85A 1FXSA 2WD7B 4RY9A 2NT4A 5H5JA 3CVUA 3G0DA 1L6IA 1QGAA 5ES3A 5CFRA 3RWOA 5IS2A 4BE4A 2FN3A 2B3DA 2WW8A 3CCFA 2HWUA 2C5AA 3CRMA 3CLSD 3MJHA 3HYNA 4ZO7A 5EZ6B 1NU8A 1H2EA 2G63A 5AKKA 3V2IA 1L4YA 1NWCA 3CMMA 1KZHA 1JU4A 1NVDA 1N5OX 4XUEA 5CM8B 5TGDA 1WXFA 2GWHA 1KPHA 2Q4EA 3PNPA 2ZJ1A 4Z51A 5CVTA 4E6EA 2FSRA 1ZKMA 1VE3A 3KAQA 3FTEA 2XGGA 1W46A 4IF6A 4MULA 4PSAA 4QHYA 2HK8A 1OBHA 3F47A 5LNK1 4BPBA 3B7GA 3L6EA 4KPUB 1EWTA 2Z8YM 5IARA 1BE6A 3MTAA 1NN1A 4YJFA 3IP9A 1VMAA 4DMHA 2HTFA 3TUJC 5H70A 5HA5A 1F4LA 1QK4A 1WXGA 5J58A 4IUBS 2B4QA 4AS3A 2PT9A 3D2LA 2QHXA 3VMMA 4LG1A 5F7OA 1BEEA 2QVXX 1B1CA 2PUCA 3VJRA 3WGVA 4ZJUA 1QYVA 1NMQA 2BKAA 3OO1A 4OUDB 4DRZA 1JU9A 4XIIA 5EHNA 3L7DA 4F4IA 4OP1A 3T9BA 1YQWA 5EUBA 4AS1A 5JJIA 2ESRA 2DWOA 2YHSA 3OC6A 2UYHA 2I1LA 4CQLB 1MV8A 1EGVB 2BR5A 5K2OA 4MHDA 1FXWF 4E22A 2PL5A 1WM1A 4ZOCA 1JSXA 3SZUA 4NQZA 5C4MA 2OCLA 3LZDA 3G17A 3TLGA 1HQDA 1NNUA 3UJ9A 2FUCA 1NA5A 3ZE0B 1EVJA 1A2OA 5AI8A 3MFYA 1U7XA 1AQUA 1ODTC 3TSYA 4YCJA 5FV4A 2GN4A 1XLTC 2WOOA 1YOVB 1ZD3A 1Y1RA 1KOFA 1XVTA 2IXEA 2YHIB 1E2HA 2ZQ5A 3CW8X 4LJYA 4AZ3B 3NHBA 4Y49B 4CDRA 4B7CA 5JFTA 2AC7A 2AN4A 221PA 2CXXA 2B4AA 2VPXA 1TMGE 3GFGA 4HNRA 4W99A 1BW9A 2V6FA 3OZTA 2C58A 4FIDA 2W2TA 4J6EA 3BCHA 2D06A 2OAQ1 5FUVA 4KQIA 5DIZA 3L3BA 5AW6A 4IG9A 4MVJG 2FSIA 3DGVA 4LQDA 5CJ2A 5I7UA 1VE7A 4LZAA 4X8MA 1YKSA 1U8TA 2WOJA 3S6JA 4HQOA 2MINB 3QE4A 5EKSA 1BGWA 1VGQA 1YQXA 3AIKA 5IVIA 3RS5A 5EP3A 1MW8X 3GOHA 3FYHA 1FFXA 4EYKA 3MTGA 3R3JA 5EAIA 4JJ8A 3GAZA 1NBEA 2D1TA 1Z26A 1D4AA 2ET6A 3PI6A 5AIAA 3WYDA 4MV5A 4P1ZA 5SYMA 4M3NA 4XRRA 4QA9A 1YCFA 2AXNA 2C42A 4MVJE 3M5PA 1NVUQ 4XWAA 4J7AA 4QU8A 4RY0A 2A35A 3HR8A 5CT4A 2GD1O 3VVMA 5LFAA 1XVVA 2EKBA 2FEWB 3ZOKA 4X2TA 2PK3A 3JPWA 5I7HA 4IICA 1K88A 3RZAA 3I5AA 1W85A 4LJ9A 5M29A 3KX2A 1JFSA 5BP7A 2C20A 1G8SA 2X5NA 1RM4A 3ACBA 4KQ2A 1TB4A 2FZCA 4M38A 2CVPA 2E4WA 3U9SA 1UJ5A 2GF9A 5AOAA 4D6YA 4PXBA 2QE6A 4PLZA 3SR0A 1G64A 2H16A 4BXOA 3JVVA 1JQBA 5ERGB 1MR3F 2WIAA 4AJIA 1VHTA 3V55A 5K09A 1W4BA 3EUEA 3IR5A 3S5JA 2Q0YA 1LQTA 5D87A 2RGXA 4CMEA 1U9JA 2O9JA 3CHYA 2JBAA 3KUDA 3P4XA 1GEGA 3C6BA 4MMYB 2W2LA 1J5PA 3PPWA 1JKJB 4Y6GB 4B3FX 4EF4A 5LXTA 4D25A 4JXQA 2RK4A 2ZM6B 2JJ2D 2VDPB 1U3CA 2IITA 2JFQA 3M1AA 3WGUA 1O89A 5A9SA 2JAHA 4MX8A 4QTZA 5DTIA 3ZX5A 3NAMA 1BMQA 1UPFA 3PPVA 1NRIA 4RMJA 4M8IA 3LECA 1CJTC 2Q7XA 3FXAA 3SEZA 2WT9A 3WNCA 1VP3A 5CG1A 2HV2A 1O96A 3ROEA 1KRWA 1IY8A 1ARLA 4WY5A 3TKLA 4LEIA 5F64A 3V2GA 3BJ7A 4CL8A 3B7IA 5FUMA 4ZX9A 3KQYA 1JLKA 3A1UA 4JITA 3WL7A 5G1ZA 3QUCA 1HLDA 4FFBA 5G2OA 3DONA 3DZBA 3VO2A 4WXRA 4US1R 3QJ5A 1W4AA 3E58A 3GFFA 3EMDA 2FQYA 3OX2A 3NBMA 5GV7A 4YR9A 3T5AA 4GL2A 1IOIA 3OF5A 5DTMA 1CS0B 1TYDE 4YCDA 4ZC8A 3TLCA 2VAVA 5DYNA 5MF6A 2NGRA 3SZRA 3U3ZA 1GN9A 4HEJA 2VQ3A 2XQFA 3MT7A 5ETJA 1XLUA 5B1IA 5I51A 2QNBA 5JO0A 1K1EA 3B1ZA 4EMEA 1YZGA 1XJCA 2IEGA 4KB5A 4RE5A 4UCNA 2IPLA 3QFHA 3U1TA 3WTBA 2G9VA 3O8NA 2PZMA 4J9UE 4NMMA 5K45A 2GT1A 1S3GA 3GVXA 3NE8A 1JQLB 2NOAA 5AM3A 1ZCBA 4Q38A 4UE3S 1SXIA 1H2WA 5FVJA 2PDAA 3AXSA 3OTGA 5CDUA 1C0LA 3W4IA 2DUWA 2JLRA 2I1WA 4IWXA 1P81A 4B6FA 4D8TA 2Z3KA 3F73A 1XNJA 4AY2A 4AULA 2IBMA 3HSSA 3HVUA 5J2UA 2VT6A 4UNSA 2QLBA 4L27A 1L5RA 5CIWA 1ZJ5A 4ZYZA 1B3BA 3KYJB 5HUHA 4UW9A 2MMGA 4LDPA 5TGZA 2I22A 1T24A 1GKKA 4D4JA 4HPSA 2L17A 2V03A 3IB6A 2EFEB 1DKPA 5LYDA 3TOXA 2H4HA 2A59A 3W2HA 3ZWXA 2JFPA 8ATCA 3DPIA 4H3VA 3R6TA 4P3PA 4RF4A 4ZQFA 4D98A 1N8KA 1R0ZA 2EX0A 3RHFA 4I5FA 1AMNA 1UMDB 1YX0A 2Q29A 2C6GA 2LW7A 3IKVA 4WE3A 1DDGA 4B0PA 4N3AA 1YZFA 4GYKA 2WUWE 2H1IA 5A05A 3BJRA 3KUCA 5KNCD 2DY1A 4XLLA 3VZQA 4B7UA 4YQYA 1E92A 3D64A 3PF9A 1RWXA 4RH0A 2R1TA 4NU8X 2DHCA 4US0R 4A26A 1R6DA 1G9SA 1FA9A 2CHFA 3HZZA 3WYNA 3DEZA 1ZD8A 3LI2A 1JZQA 4G07A 1TEZA 2Q7BA 4G1EB 2PBRA 4RTJA 1Y8RA 3R3WA 3PHIA 4AB7A 2WWFA 2ZIWB 4LV8B 1XX6A 4CKWA 4XFDA 2I3AA 2R97A 3TYXA 3G1UA 4BFVA 2XXAA 2BSWA 2GBLA 2YIJA 4RV9A 3UM9A 3DS8A 4Q3AA 4YROA 3N05A 5JH7F 1IOLA 2X58A 2W43A 4L7VA 5TVGA 1E1MA 1TLFA 2CXUA 1XNQB 1J07A 1PO7A 3AR6A 2IVFA 2WTAA 3RTBA 5IDXA 1JIVA 2O2EA 1E1RA 2WKQA 3I53A 4LXTA 2PKXA 3PR3A 4OUDA 5ALYA 3FUCA 2D8AA 2YL2A 2XNHA 1IAVA 4A8JB 3E9MA 2X15A 3M6AA 4YV2A 1T1RA 2WU3A 4Z8YA 1LCIA 2Z5VA 1JQGA 1CQIB 1KFJB 1YR3A 4MWEA 1JEQB 3T4EA 3VISA 3I5XA 3B3GA 1SK9A 2ZYAA 2GBGA 2CJWA 1UANA 1ULZA 2AYZA 3AKYA 3IDQA 4GMFA 4GYJA 4NRDA 1W73A 3IGFA 2OD2A 3QMWA 4G0YA 4DARA 4EX6A 4DCVA 821PA 2R25B 4ZZIA 1PLJA 1A8QA 2FG5A 1MV5A 2BMWA 4HDRB 3P52A 4RVGA 4U6SA 1EZ4A 4DQVA 3ZNOA 3CB2A 4PU0A 3EHEA 1UODA 1SD2A 1BWRA 1GZ6A 1KF0A 3ZNPA 4HDAA 2BP7B 4BQOA 3CT4A 2QZ9A 5GJVC 1UDCA 1JSCA 3E5RA 3R09A 2WI8A 4HZIA 1NVVQ 4CKBA 4BV8A 5F23A 1QFMA 4K1LA 5IFKA 1OT5A 4MWCA 2ZIGA 3G1TA 3HXTA 4D9MA 4MFZA 3JPYA 1L8AA 5HGXA 2Y1WA 5BV7A 1GDDA 3DLCA 4QJ5A 3LX6A 3WIBA 5HTOA 3GUXA 4GQBA 3BWXA 4MR7B 5F73A 5IX3A 1NLMA 1XSEA 3KHUA 1E5VA 3BD7A 2YYYA 4HNGA 3WLTA 5BYKA 4MFLA 2XUDA 1TK2A 1U6JA 1SNYA 3F6CA 2Q5CA 3KXKA 4JLNA 1XTIA 4FE4A 4OQEA 5CM9C 3K1AB 1GGEA 2FEKA 1YQGA 2WG1A 4QWMA 2GIVA 3EWAA 4OQPA 4UWJA 2XLCA 2WAAA 4BAUA 5I7OA 2ZU6A 5TQ2B 1Z33A 4KACA 2D59A 4X1KA 5I9LA 4C7XA 4POAA 3HACA 2EJTA 1FSFA 3NM6B 4YUVA 3ZDBA 3ZJ0A 5HPYB 3HB1A 4C0BA 3CF0A 4QDKA 4F1KA 2B25A 4YECA 2ZIAA 2QBYB 5EP2A 4COKA 3EW9A 3QFTA 2JLQA 4XYEA 2I76A 3T0FA 1WEHA 4F92B 1FW6A 3TGWA 3FG9A 2X4IA 4UHBA 4QU5A 3PZRA 3LHIA 2OWDA 3NKLA 3LY8A 2MSNA 4XOIA 3SJCA 4B8ZA 5LQRA 1CBXA 1GTG1 2NYRA 1WW2A 1JKJA 1GUBA 3E7FA 3FGPA 2CVFA 2DQYA 2P3SA 1EP9A 4JR1A 4EJ6A 2AZTA 2YUIA 2A4NA 3S28A 1WBDA 1MPXA 4FMCB 1TZ2A 2JLSA 3CURA 5C34B 3AZPA 1T1EA 4L8FA 4AN4A 4UQPA 1NWHA 1M4GA 2DT8A 1S3IA 3OY7A 5CTAA 1BXKA 1K7XB 2AT1A 2PCJA 3K94A 3T99A 4DNPA 1ZVJA 1IN1A 5FTLA 1J99A 2WAYA 3KWJA 5BWLA 3TE4A 5CIYA 3GI1A 2ZTHA 1NNLA 1LEHA 4ENQA 5LMNB 1Z8LA 3IP7A 5IRCD 4AVCA 1SGWA 1T0JB 1VHJA 1EFVA 1GZDA 2VK8A 4BLSA 1OZPA 3KL4A 4JI4B 3INTA 4WY2A 1J4JA 2FNAA 3DDZX 3DFUA 1CR2A 2VXCA 3HS3A 3OEEA 2JFBA 3P9IA 2ZS9A 2DLDA 3L6BA 4O4JA 4DIBA 1XHEA 4IMJB 3IT2A 4LHYA 1K2WA 2QL6A 1BHO1 2CXTA 5HVHA 3U4CA 1N6KA 4WADA 1RAFA 3FNEA 1T8TA 2HA2A 5DHFA 5LB4A 1XCPA 2NVOA 3JQQA 3ROZA 1N2ZA 4MHYA 1V9LA 4HB2A 1KJQA 3FVQA 4HF7A 4I1SA 1VKOA 1NX9A 4BY9E 1T3HA 3QOXA 3RASA 5EVCA 1U3GA 3P9PA 2WSLA 1ZQ1A 4JK3A 4C4PA 3TSOA 4LHEA 3R6DA 4C7VA 1BPNA 2QRZA 4F4DA 1XRRA 4CYQA 4YP1A 1BX1A 2YV2A 4UJ3A 2LCQA 2R8YA 1JHPA 3ESXA 1TUEA 3BJEA 1HXHA 1M2HA 3AKZA 4HRAA 1ZOLA 1RKVA 3GA5A 4ZPJA 1UT8A 4QDTA 2XWPA 5LYJF 1ZONA 2A1UB 1DC5A 2XPCA 4HGNA 5ESXA 3ZZIA 4FFPA 4OP4A 3KFVA 4II7A 4OREX 3A28A 4I3HA 1J0DA 1NYLA 1YK0A 4MI9A 3DKRA 4YRLA 1J2UA 1SKUA 3AERB 5D8DA 3L7LA 4YHHB 3BE4A 3RYCB 1E9EA 2OPBA 2XMCA 4IIVA 1WMSA 4EI8A 3TEJA 1O7JA 2OQ2A 1AHPA 1OH7A 4DLVA 2C7OA 2D13A 2CIJA 3U1VA 2ZTSA 4A5SA 4DA6A 4W7SA 1K7EB 3WRXC 1DSSG 4JLUA 2WJIA 1XDBA 3G5UA 1EA5A 1N5RA 2ZEJA 4O4IA 4KE9A 5EGSA 3MJRA 2GEFA 2F43B 3WDMA 3KI9A 3OH8A 3VZSA 1KFEB 3JASB 4ND2A 4HUJA 4WESB 2XUZA 1ANKA 3T4XA 1XAIA 1CUYA 2WF6A 5GAJA 2WAXA 1P61B 2VEOA 3I5MA 1OZFA 4RF2A 4XW2A 1YDGA 5DBIA 2G6BA 1M7GA 3WOVA 4ETMA 5AW0A 4P7BA 1R0LA 4ZZ2A 1RYZA 4KO1S 5K7SA 2BFDB 2W8ZA 4EEKA 4M54A 1SUCA 4EHIA 2JJ1A 4AC9A 4BL5A 2ZB3A 1ZN7A 3EQZA 3EGDA 3KD3A 4KVZA 4PZ0A 5ULLA 5JZ9A 4BLOA 4AL4A 2NQTA 4WERA 1YK1A 2HM7A 3FNBA 3B12A 1V47A 5DN9A 1IMJA 1S2NA 1V35A 1H93A 3IJ5A 4QXMA 1RCTE 2XYGA 4YASA 3KL9A 1JLMA 2NTEA 1UFQA 5DHUA 3T1NA 3I1UA 2FG7C 1B76A 1K8YB 4X3OA 1PQWA 2JLZA 3ZWKA 1XE3A 4CXMA 1PL0A 1X92A 4U63A 5BN3A 2B78A 4JBYA 4EYGA 4KOTA 2EF1A 2HOQA 4XPKA 3IEVA 2E18A 2JVIA 2QTBA 4NCZA 4HVTA 1DMSA 2Z3NA 4JWPA 2OC9A 2YWGA 1SM4A 3F4LA 1EIWA 3SYLA 2C7BA 1S8FA 1XN4A 4MVJP 3ZTTA 1A5ZA 2WD8A 2PH7A 2WIFA 1QV6A 2MSWA 3K32A 4ISBA 1RT9A 1LSSA 3EGIA 4JC5A 4K2HA 1C7IA 2K5TA 4M1QA 4IILA 4F2WA 2DQ4A 3VOAA 1NDHA 1MD9A 5AUQA 2BDTA 3EN0A 2OV3A 3TAXA 1I3CA 3UJNA 3I9FA 1NT2A 4OOFA 1MQSA 5T57A 3NBZC 3G82C 4Q7EA 3AI3A 1LTHR 2Z2XA 2V5VA 3JAKA 3OAAD 5JS1A 3IKTA 4Q93A 1W47A 1NNI1 3UCXA 3DCIA 4YMIA 5DNWA 5F33A 3ZUPA 2CHVA 2XUPA 5B12A 4JUFA 4IJVA 5H16A 1PZXA 3SSAA 3TZLA 3F2VA 3UHPA 3ABIA 3MILA 5CLJA 3K9TA 1EJ2A 2HI0A 1Z0FA 4N0DA 3WXMA 3AONB 5IKOA 1J49A 1ENZA 5E9WA 1PCAA 1WP4A 2XB2A 2R7NA 3CE6A 1XEWX 1ZH2A 3KKQA 2OQRA 2QZ4A 5ILOA 4YAWA 3VARA 2Q0SA 5I4MA 3RSZA 1RRKA 4KOSA 2QWXA 1IIRA 2V7GA 1ZWLA 1MX1A 2Z30A 3KELA 3QW4B 5AO9A 5T41A 5IXYA 3EXFA 3ZUGA 1C3XA 4ND8B 1W88A 3D7MA 4LC9A 4DV2B 1R4AA 5A5GA 5I3CA 3LT1A 5ALTA 1ACLA 3FMCA 4E30A 2XWJI 3OZGA 4KITB 4UHHA 2WJ4A 4KPFC 3UG7A 4LYEA 4U9HS 2C2MA 2VBFA 4RK1A 2CTCA 3TZEA 3HL0A 3UKOA 2AKYA 3ZDAA 1OBVA 2I65A 3R3ZA 3AM1A 4OI4A 4RSHA 1T6ZA 2FWRA 4MB2A 1N6PA 1ADBA 5ESDA 4UMDA 1DIGA 2DTXA 3OCZA 1LS1A 4JT9A 4V39A 2C9ZA 4E1VA 3O91A 3SQNA 3QLVC 4TUYA 1NVAA 3AMVA 1BHQ1 2PH3A 1BS1A 3DHEA 4QPNA 5SYNA 5K4AA 4BQFA 3H2KA 2Q7OE 4CM4B 3NQ41 1RLMA 4CKCA 3E3MA 1I1HA 1Z34A 1VBFA 1PU2A 3MQ2A 3L49A 2IZ6A 3IJPA 4JEIA 4WBXC 2OZHA 1ZVMA 1TTHA 4DBZA 4L6IA 1E8MA 4C2YA 2IT1A 5DGXA 1YU9A 4B33A 1TRKA 2NUPB 1SXJC 3C6XA 3H5NA 4NHOA 1G8FA 1DC6A 2BH9A 4B3IA 1FYXA 2OECA 3QF4A 4OHPA 5IF3A 2K2QB 4FEYA 2PZGA 1DKMA 4WZBE 5G02A 4AJ1A 1NBMD 1JZTA 1XELA 3EZGA 4GO1A 2WFLB 3UUGA 3W5HA 1P1RA 4IQ4A 1L8OA 1Y3IA 2Q1WA 2GPWA 4R41A 5EJGA 1L7XA 1X2BA 4OGFA 3ILXA 2WYOA 1FC0A 4MPRA 2YV4A 3TIGA 1NLZA 1Q50A 2QTLA 2V1UA 4M76B 4MHOA 4DUKA 3L7JA 4LYGA 3N2KA 4QYSA 4CGZA 1OXUA 5I7RA 2ZWOA 4E0AA 2BGMA 1FSGA 1O96B 2GK6A 1PTJA 4QQ8A 1JG1A 3DM5A 3A8TA 4RHYA 1KDZA 4OC1A 3DC7A 2NU9B 2QUZA 3LRXA 3H5TA 5A7HA 5C5DA 2XADA 1QIKA 1ZUNB 4G1VA 5J4LA 1ZG9A 3ECSA 3CXQA 1LLFA 3D7LA 2Q8NA 4TTPA 2HHJA 3GL9A 1R9MA 1YXMA 3JQPA 1H3EA 2A1IA 3L7CA 1ENYA 5B1SA 4LTNA 1NVWQ 2RC4A 1IQPA 3EFOB 5DULA 1BQ4A 3PIRA 3OQ1A 3PQ4A 3RVDA 1IN5A 2IF0A 2PT7A 3JD4A 1VGRA 4N49A 2PKQP 4F96A 3T6KA 3ZTYA 3DEHA 1SHUX 3AV0B 3SMVA 1P0QA 3HZOA 3THRA 4CLOB 2PVPA 4DLZA 1V11B 4ALJA 4H16A 2IZ0A 4I1VA 4RQAA 3ISXA 4JOSA 5EXEA 1HTTA 1QFXA 1KDOA 1M2OB 4POOA 1PWZA 3NIFB 3W8FA 2Z5LA 1AKWA 4IR7A 3LYLA 2W7TA 3LPLA 4MWDA 4UZFA 1ID1A 3MAJA 3ZJ5A 3CIOA 4B3RB 2HWXA 4TPKA 3R75A 4ER0A 3NDIA 3J7TA 4UXJA 4W5TA 1JSRA 1QNLA 1NM5A 2ETXA 2Z1DA 2ZANA 3DE1X 3L4SO 4I50B 4PPNA 2M6KA 3RSLA 4C0HA 5KO2A 1WLSA 3HMQA 2VSQA 3CZRA 2R8RA 2YXPX 3GO4A 1EFVB 1G3QA 2V6BA 2WHRA 3IAS1 1CX8A 4GE3A 2APJA 3IJEB 2J30A 2RHLA 3QBJA 4Z7QB 3BQMB 1T6YA 1T2UA 1UP6A 3KQMA 3CZAA 1JAHA 2Y6VA 3ZHSA 4JBLA 2EK9A 4NCXA 4IIBA 4ANFA 3VM6A 1E77A 3ANTA 2Q8QA 4J2TA 5HRAA 1RBZA 1Q1BA 1T0PA 5BNTA 2C3MA 1DE4C 4Y2GA 5C35A 1JG7A 3NUQA 4JELA 4L6AA 1V5GA 2UV8A 2Z58A 3QXGA 3BAFA 1HORA 1H3NA 3ESRA 4YRQA 1NF2A 5FBZA 1ZA1A 2Z08A 1CQZA 1LRLA 3LLCA 3FOWA 5D1HA 1DRUA 3JR7A 1ADCA 2W37A 2AHOA 3MXOA 2NPOA 2PUGA 1QZUA 3CLTD 1JNYA 1NF9A 4A27A 5FBWB 1VSVA 5HK9A 4DQKA 5JWRA 4P32A 2VSXA 3Q1KA 1EBUA 3BRCA 3KQXA 1H8LA 3TX8A 2CHEA 1Q21A 3E5HA 5F2OA 1L5FA 1T43A 5AM5A 4OXKA 2B4YA 2NZUG 5KKCA 4I4NA 5B3LA 5LYIA 1G2PA 1S1MA 3I6BA 4WNYA 1SULA 3QW2A 4QLOA 4DCGA 1Z6PA 3VI3B 2EUIA 2RARA 4X1KB 4P9NA 5G1NA 5EINA 1I2DA 1F2UB 5KHAA 4MYRA 1IUOA 5GIPE 1F12A 1WCYA 5EUQB 4NMXB 1RQXA 5FUWA 1PNQA 1FRQA 5ICEA 1MVOA 4JB0A 4ABTA 5A6VA 1JYFA 2QVLA 2SHKA 3GJYA 3RRYA 1L7AA 2WYRA 3FSEA 4KOXA 1FDSA 2HBQA 3UN1A 3A36A 3A06A 1QP7A 1AYEA 4UHDA 4NJRA 2G4VA 1XPOA 1ZW1A 1W2WB 3QKRB 1CXZA 3RG8A 1J09A 4B3SB 5GVRA 3C48A 3KKWA 1KZGB 1XZJA 4RIGA 1YIAA 3RABA 2B5GA 3G49A 3DOEA 4LPSA 2IYPA 1XLWA 1M1DA 1OH6A 2JPDA 3NRJA 1FVOA 4J75A 4QE3A 4LMAA 3V80A 1FNNA 1PHRA 3GDFA 3P45A 3TSZA 1G38A 3OF3A 3X43A 4M89A 5KYYB 1ARZA 3GMIA 2VYVA 2RH9B 4HSEA 4D9GA 1UEIA 1PEDA 3NORA 2HK9A 4YLGA 3HR7A 3C24A 3GMTA 4MROA 1PGQA 4OFBA 1T9ZA 3GLVA 2QTHA 4HMPA 3D8UA 3WP0A 3CFYA 1DJMA 3AX6A 3H1PA 1QP8A 2QGNA 1CUVA 2VF5X 3TZKA 2LE0A 3P0FA 3NAQA 3KTOA 1OJ7A 2X2OA 2XTMA 4HWPA 4NCNA 2EVNA 4R16A 5H59A 1U3WA 3THOA 2HLPA 2WHPB 4IFTA 4KREA 2IH2A 2ZZNA 4YXWA 1PSDA 2J9FA 1V25A 3PQFA 4Z65A 7REQA 1PJ3A 1KAEA 2GKOA 3PV0A 3HJHA 4IO1A 1T2DA 4XA8A 3B3CA 4LF7B 1QHSA 1MF7A 5EJ4A 1H2HA 1NN5A 1QP0A 2AJ8A 2F8HA 1Y7PA 4RSGA 3O4JA 5IUJC 2WILA 4P5DA 1AG9A 9LDBA 1SXPA 1M10A 4KX3A 5F7JA 3AVXA 4BNFA 4AI6A 2AFRA 1ADJA 4CGLA 2IX9A 2ODQA 4ETIA 3S1LA 4GOMD 4NU0A 4HYEA 1OLOA 3ZYCA 1CNFA 3F8TA 4EUSA 3F46A 4HDKB 1XZAA 3GHYA 2A94A 4ROTA 1UK9A 3TOSA 2JI8A 4OIWA 1UAYA 2QMLA 1T3GA 3W5BA 2X8AA 4U7WA 2RGAA 4RS3A 1T10A 5KUTA 2CXPA 3ZW7A 3LNCA 3KAJA 2ZB4A 4OJMX 4H7HA 1TC1A 4K8RB 4MR9B 5KYUA 2PRJA 2WBLC 3I2GA 5AQ1A 1QP4A 3ROGA 3VPHA 4LV6A 5LOVF 1ZMOA 1XTUA 5LKRA 3ZH2A 1J2EA 1DEXA 2X4DA 3UAYA 1AZWA 3OCJA 4J0IA 1V16B 3VR5A 4NL4H 5KB3A 3D3SA 4U9ZA 2PSDA 1EFPB 2ZS8A 1N34B 1NM5C 3PL1A 5A4MS 2OOSA 2MCFA 4DIUA 1FU8A 1D09A 3KQTA 4F9EA 1V96A 5B37A 4Z4GA 1WU8A 1GGJA 3MJVA 2X1LA 4I1IA 1B0PA 3CX7A 2UZIR 4IX9A 3NFZA 1XKTA 2P41A 2OGSA 2UVPB 2X3YA 4HLCA 3WBFA 1FRZA 3ADOA 1XTSA 3PFIA 2XV1A 4ND6A 4DR5B 5SZKB 4PR3A 3TRFA 1P1IA 2J32A 2QTAA 4TUYB 3KNZA 5AP9A 3Q12A 1CQWA 4LIPD 1HFEL 2GZSA 5DS0A 1QU2A 1O4WA 4BNGA 4PBRA 1KAMA 1KE2A 1O0BA 2MDTA 3TZBA 1B42A 1K2VN 4NZZA 1NE7A 5I9BA 3EGEA 2YWJA 1HE3A 1GQRA 1X74A 1YU6A 2BZ1A 3HUEA 5UKDA 3T3MB 4BV3A 1ZLYA 3MD9A 4QIHA 3CN9A 2W2OA 4MSUA 3H5RA 4ROSA 4YP5A 2A0FA 2FZ4A 4NBKA 5ALVA 2Q4RA 3CPHA 4JOCA 4MQEA 2ZIXA 3H5AA 1FQJA 2P2GA 5AW9A 5DI3A 3UK7A 4U4AA 5ESWA 2JBHA 1WVMA 4E15A 3UAVA 1WR8A 2WMDA 3ITEA 3T1VA 3LPNA 4L9SA 4MDFA 4D3YA 1X14A 1ZSYA 2X14A 5JXJA 1H65A 2ENWA 4RVCA 1BEUB 1GTJ1 4TRJA 2FLKA 4MUBA 1DLJA 3OMWA 2C9OA 1V4VA 3B78A 1ZK3A 2UXBB 1DTDA 5CYPA 1RM5A 3TPFA 3ICPA 2WQ7A 1WEKA 4PZ9A 1Y34E 3LRPA 4WKGA 1HETA 2DGDA 3A2NA 3D2AA 2IKQA 3CUKA 5IK2A 3WK6A 2QY9A 4CM7A 2DBVO 2WE8A 3JVIA 1O5TA 1TYZA 4BMNA 2KSQA 1E64A 4BP1A 2OCKA 1C0KA 2ABWA 2CN1A 2OXRA 2ZVJA 3C3EA 3O8DA 4E88A 3S8MA 2GDJA 4RJKA 3KCNA 3RK0A 1ZRHA 5ELYA 3IP8A 1WULS 1CE8B 3FJYA 1L4KA 1QYDA 1OAAA 1BDJA 5BOVA 5HOEA 3PENA 4LMBA 2GRAA 2ZFUA 4JC4A 1CVLA 1BMTA 3BWBA 1RWBA 1GGHA 1ISHA 1SB8A 1XMSA 1FUUA 1HMYA 3GN2A 4DUGD 2IW1A 5BSHA 1RPTA 4HK4A 1FZTA 4ZDKA 3VOTA 3T7EA 1UPBA 1O95A 3KWMA 1MH1A 4A3SA 2OAP1 5DSZA 2AKAB 3UHFA 4J6FA 2F9FA 2EW2A 3D0OA 5BSTA 1Z6XA 2HIGA 4Y9DA 4ZVPA 3W7VA 3R3HA 3SJFA 2HQSA 2J33A 3JRNA 1CEYA 3A10A 3P2YA 5IKMA 4NQRA 2O2YA 3OOEA 3QTTA 1P39A 1JMKC 2FZVA 1ZNWA 2CDRA 2ZJAA 1FPQA 3N7UA 1ZMRA 4Q5IA 2I4IA 3TBFA 2WPXA 3QUBA 1XMXA 3K5WA 1CEQA 4GDFA 2ATCA 3C74A 3NOOA 1A8SA 5JAUA 5LRJA 1SUBA 3C7KA 1AJEA 4FGUA 1VI5A 4JODA 4HFMA 1B6SA 2D0IA 4M8NE 5LQAA 3U5ZB 2IPOA 1MXFA 4GWLA 2HSEA 3GCWA 4JJIA 2VHWA 4F2HA 4JU9A 2YWCA 4KQXA 4CVNA 2CJWB 1R8XA 4G5SA 2HBYA 2JAUA 2OBYA 5BYJA 2IU6A 2VJPA 3OOJA 4AY4A 4AMBA 2BPOA 2GA8A 1L3BA 1B00A 1Z7EA 3B3AA 2FCKA 3A4NA 2HNAA 1ZUHA 5IBPA 3K0BA 1DAGA 2IP4A 4DWWA 2EX4A 2EBHX 2J1LA 3V8PA 1WCV1 1F7VA 3G9QA 4BGUA 4XPDB 3EOBI 1W5BA 1HDRA 1P31A 1SMKA 2QRHA 4GKBA 4JBIA 1T8PA 1EM6A 3GVCA 4JUAA 4KG7A 2QF7A 3VYTB 2NYQA 1II8B 2V3WA 3BORA 1VFNA 5GONB 5SICE 4DIKA 2QRVB 4Z7NB 4C7OA 1E8DA 2C84A 2Q4BA 4JXKA 3ABSB 4XWOA 4D5GA 4I55F 5HOQA 3N2YA 1MTOA 4PYMA 5EKUA 4DZTA 3O26A 3A3PA 1MVLA 2R1UA 4TSRA 3FUWA 4CM8A 2I3CA 1O03A 2JCXA 1MLDA 4OJNA 2Q9BA 4UC0A 4GSLA 2HCFA 4FUQA 4AP6A 1SKYE 2XECA 1YREA 3RIEA 1WHTA 5DCUA 3NAGA 3R4CA 4REMA 4C1BA 4YR7A 2O8FB 2Q6IA 1KYTA 2A5YB 4YXWD 2A9VA 3EYAA 1I14A 2Y1KA 5ENZA 4C0KA 3AFMA 5JG7A 3SKYA 1GLNA 1H6AA 2IQ5A 1RXTA 1N1DA 2E1RA 5AOVA 2QPOA 2VP3A 4XAQA 2SKDA 3KSRA 5CDFA 1F0NA 2WFAA 3KQPA 4HCJA 4HH3C 4HUQB 2ZAIA 3RROA 1IIDA 3JZAA 1PKXA 4K05A 4ATNA 4PO1A 4RCZA 3I72A 2FJ0A 5FFFA 4RAQA 3NUZA 4DCMA 4RK4A 4ND3A 8AT1A 4EYOA 4DR4B 3IWWA 2NO4A 1O0SA 3LW7A 1JDUA 1E1CB 4M60A 3OQIB 4OYLA 5J5AA 4C76A 1N6RA 1NDUA 4U7FA 3FOEC 4F04A 4HWGA 1X8XA 4B3MB 5IT0A 4WOCA 4F45A 4XPDC 4HGYA 4NE9A 1YS4A 2B4RO 2IVZA 2R6ZA 1CJSA 3BGIA 4TLEA 2DPXA 4BCDA 1XMBA 2PJ7A 1G7RA 1OFIA 1ZH8A 2JH9A 4BNZA 2CXRA 3CZPA 3LDAA 3DO5A 2FKAA 1ST3A 1XQXA 3T5TA 1SBQA 2AEEA 2IEAA 1DFIA 4BZXA 1XTPA 4UDNA 5ILQA 3LHKA 4NX2A 1X1CA 2QVCA 4JVLA 4ETNA 5DNUA 2FH5B 2X13A 4NYIQ 3DEIA 3RAEC 5TQVA 4LQ6A 2CK3D 1M4IA 2NU9A 3PFHA 4P93A 2MSEB 1QOZA 3PT5A 4R2KA 1GA6A 4U7HA 1KSGA 1QIMA 2W98A 4P7FA 5GCNA 1VSBA 3VHQA 3IQZA 4X6XA 5TPZA 4Q9AA 4UVGA 3F7NA 1YJAA 1X7HA 4V03A 2REEA 3CLUC 1KFCB 2W6ZA 4HXGA 3VAYA 3FW1A 4FQ5A 4LJ6A 1DKRA 4EKEA 5TQ0A 5C8YF 1HDQA 5F77A 2H7XA 1UDBA 4O2RA 3KYBA 1K89A 1D1TA 4Q24A 2OP0A 3TQSA 3MBIA 3E2MA 2Q6LA 4JL6A 3QOFA 4WBNA 1NUUA 2R1VA 5B1HA 3R20A 1NF8A 3GPCA 3O8QB 3V1KA 1A76A 3CRRA 4UD2A 5AXDA 3U0BA 3ZKAA 1QRDA 4PS1A 3KKMA 1FSZA 1C9JA 1P6QA 1PV1A 5C1IA 1JFLA 2W83A 4D45A 4LN1A 1ORIA 3GYAA 1IQRA 1KO8A 5FH9A 1VIMA 2PWZA 2O54A 1GNPA 4OXRA 3D7DA 4ZALA 3FHLA 3UW1A 1GWNA 3NC0C 4EPXA 1U0TA 4JYPA 4KO8A 1K06A 5ITSA 3VO1A 2PH5A 2DEAA 1G1MA 2WDPA 1O5IA 3PB6X 4BO8A 3AFNA 1HE4A 3GFPA 4R01A 2VI7A 1E0JA 2B1JA 2V4UA 1M2KA 3QGMA 3AZQA 4LVNA 5GWXA 3V8EA 3NB0A 4QJBA 1DO2A 3F7MA 4Z86A 1UBJS 3G8WA 2XT0A 4I4IA 4BOYA 1UMBB 1JPJA 2FN4A 3PICA 4QYIA 5K0LA 4A0FA 3JQ7A 2JJ8A 1EFKA 5AG7A 4L16A 4M3SA 2ZJOA 4U3JB 1M75A 4B32A 2VTBB 4CLEA 4M8KA 3GRYA 2HMWA 3KEOA 3ZZNA 4UTNA 5LB2A 1U1EA 1VIDA 2EATA 1UXHA 4RGQA 3RS2A 4EG8A 4BJ3A 2GPTA 2P9TA 1PAUA 1Y6RA 3H7IA 2PAFA 1IICA 3FZNA 5AQEA 4DIMA 2H9YA 5K3FB 2Q5EA 2PRYA 3H4QA 5F47A 3M5WA 5JSHA 4YJ2B 2IYLD 4JZYA 3NI2A 4LRWA 2VHQA 1ATIA 4NYJR 4QXOA 1XJ0A 4CM9A 5KMGB 3HSKA 1BHSA 2DHDA 5JPCA 1K9SA 4Z1OA 3GV0A 3EGVA 1O6FA 3ZN2A 2ZOFA 1ZZEA 4JSYA 3T9YA 1XPRA 1QLJA 3BA1A 1CRQA 3MEQA 3PXGA 1Z8WA 2ZELA 2BFBB 2QX7A 3EWSA 3PUIA 3RGGA 3ZHVA 5H82A 3WO0A 2R68A 1H1LB 4M6GA 3EQ7A 2WTEA 5DH9A 5K8UA 4KOVA 2X76A 1SA0A 2IBSA 3C41J 1XEWY 4IQFA 1N78A 2I55A 1NVVR 2V7UA 1OR8A 2YXLA 4LOJA 1QTIA 4OG2A 2YN4A 4DYOA 4R0NA 1NRXA 4WL0A 1KJYA 1RFGE 2Z2KA 4O25A 1E3IA 3IAEA 4P6VF 1QC5B 2AX4A 2Z56A 5HWSA 4OADA 2FFJA 3H8FA 2X0IA 1U0FA 4LGYA 3N7TA 1XVUA 2FWIA 2JDID 4P8RA 2OGZA 1JKFA 1PKEA 4PYQA 1LSUA 4P4JA 2IOFA 2WUGA 3RRXA 1N2SA 2Y1CA 4L8VA 3E15A 3OT1A 2EIXA 1XZDA 4NG5A 2IWRA 3ABRB 3V8NA 4D57A 2P1ZA 4RLQA 4P31A 3LWNA 1AN9A 1UBNA 2JBAB 4UE2A 5J2TF 5AJYA 1XU9A 4EY7A 1GG8A 2GX6A 1CRPA 4WVFA 4KR6A 4X7MA 2QUAA 1S5KA 5BR7A 3EPJA 1TAGA 4UBJA 4DDUA 3M1IA 1C3VA 3CRVA 1Q22A 5E4FA 2JKVA 1P33A 4G23A 1MB9A 2FL4A 4GS5A 3Q8WA 4W63A 2F17A 2BSAA 2X86A 2DFDA 1C14A 2ODNA 1X9IA 1TAHA 1JHAA 1HRDA 2VK4A 4NSNA 4KQKA 3MGBA 4PX3A 3P2OA 2Y0BA 1QFYA 2FPIB 3SBEA 1JB1A 3BMOA 4M88A 1T2FA 1THTA 2A0YA 1FE8A 3NM5A 5DHPA 3GJSA 4EMSA 3NXKA 5SY9A 3VA7A 1KEZA 3O75A 3PFWO 5IAJA 3UAZA 3UXYA 3WYCA 4HVLA 5HJ7A 4CM8B 4EBBA 3ILYA 1WD7A 3G0IA 5BMOA 1XCMA 4HI0E 3I5YA 2P9QA 3I9OA 3CEMA 1FPMA 1EUQA 1POWA 3SN6A 3MMZA 2VAMA 3GMDA 3SFVA 1CY0A 1BE8A 1K6IA 4IIYA 1X7WB 2M6LA 1QIIA 3H8GA 3ILVA 2O0LA 3EIOA 4COOA 2XCTB 2BN4A 2VJOA 3BD8A 4RZIA 3ZDRA 1MAWA 1RJDA 1C8VB 1E4EB 4DSNA 3GLHA 4MUEA 1UFRA 1ZSVA 3KHKA 4A82A 1MJFA 2JF0A 1I4WA 3PD1A 3PHGA 3ZWNA 2Q1TA 3LX8A 3ZGXA 2AFIE 5IG2A 2VYNA 4G41A 4RXTA 3TE7A 2H31A 4EHJA 4I9GA 1Y8QA 2YV1A 4W5RA 3TTSA 5KKNB 1X70A 3BLNA 4ZA2A 2E4AA 4DM7A 4EIWA 4L3WA 3KETA 3IIJA 4IMPA 1KMNA 1MAVA 1U6IA 2LKCA 1Z2NX 2Z9CA 5AJXA 1I80A 3EIQA 1WF6A 4RY2A 5AKXA 4CKCB 3L4JA 4KXQA 1SBYA 2FZWA 4LWQA 2AFZA 1ORHA 5F21A 5JXWA 1FQWA 1YQUA 3IOBA 4BO2A 1RO5A 4HPXB 2N3ZA 3GLFA 2H5EA 4CKEA 1SVLA 1XL1A 3AJAA 4KMMA 5BYAA 3G0CA 5EPOA 4PQGA 521PA 4DNQA 1D2RA 1MOPA 3M82A 2DX7A 1IPFA 4Y1EA 1YVUA 1R9JA 3KU1A 3D59A 2C9MA 3P1JA 3KK0A 2O8BA 3EIXA 2CK3A 4NJMB 1EFPA 3I9JA 2W6IA 3ECAA 4ZAVA 4DXAA 2EYQA 3O3NB 5DM1A 1N9GA 4KQFA 3ZE6A 3LCRA 4BVJA 4PHCA 4ETWA 5BRJA 3D68A 4WWVA 1VJTA 1W19A 1BDBA 2RHTA 3DZCA 4XJVA 4K9QA 1UL1X 3D1VA 2A5JA 1IHYA 2C2BA 2OFPA 2RHDA 3I9LA 3UMVA 1BOFA 1U8XX 4RUHA 1N6HA 3SJGA 2XYRA 2QM8A 4YV1A 4ZYWA 4GHWA 4HVCA 1Y8ZA 1LAMA 3HEMA 3HYSA 4B82A 5BSGA 4ZX8A 3RBUA 5E4JA 1GTRA 1RIFA 1N6OA 1SIOA 2O2ZA 5IVDA 5CT9A 5LZ7A 2F3RA 2B2NA 3WLLA 3AEKB 1K6XA 1BS2A 2QRJA 4HDSA 5ITZA 1M6YA 1CJVC 2C7VA 4G5RA 4Q9NA 4ZOAA 3UJ7A 1Z2EA 3U6BA 1S3ZA 5TMEA 2C3YA 4LBVA 2J3KA 4WNAA 4CRWB 4A2QA 1RCFA 5IKPA 2J3IA 5JT1A 4NP6A 2REQB 3TR6A 2N0SA 1XUOA 3ZH9B 4BVGA 4DB2A 2O3SA 2WHQA 1MO2A 3MAAC 4L57A 4BGIA 2PUDA 2XRMA 2GTPA 3M6IA 4CMKA 1W48A 2IGTA 3N5KA 4TZKA 4X90A 3EPPA 1VHSA 1RNLA 1AHHA 4RENA 1ODLA 1ZMTA 1ZESA 1KSHA 2PJBA 2D2XA 5DASA 4AZ0A 5DP2A 1WVIA 4BMYA 4I49A 3IPRA 2HL6A 3WRYC 4OQDA 2VRCD 2YWDA 4QQNA 5ALNA 5CCXA 3RGWS 4KTVE 3EULA 4Q3NA 3I2KA 2R6AA 3ZHRA 5FA8A 1N7GA 4P82A 4K88A 1MEJA 2OB1A 2NLOA 3BCRA 3CBGA 4KK4A 4B2IA 4AUNA 1SCIA 3A1FA 1P2DA 1CZOA 1XQVA 3C8DA 3EIEA 3E27A 4G8DA 5EWMA 2GF2A 5FWXB 5JWHA 1ZI9A 4HSGA 5IT9A 1V5IA 1S7FA 3HB9A 3HU1A 2F8SA 1WWKA 1OTXA 2ZPTX 3LC2O 4I4TF 3WMFA 2FPSA 2HU8A 3LUHA 3QXJA 2XGMA 1HGXA 3HKBB 5JLJA 1GVNB 4A2ZA 1FYDA 3PUWA 2D8MA 3RUCA 3ENKA 3EQ6A 4ZVOA 3T5PA 5HFAA 3NYWA 4NCHA 3TQTA 3WI7A 1KUXA 3AUUA 3ICEA 2XVAA 3QEOA 4HB3A 1TQ2A 3L7MA 4MZXA 4EFDA 4EW3A 2BTQB 3FWYA 5K3AA 4CM9D 3BHJA 4X8LA 1RHRA 2P75A 2XKBA 5F52A 3FNCA 3A6EA 2YHUA 3AV3A 1C5KA 4IIUA 1MB2A 4XGQA 2BFOA 3O8OA 4R3NA 2Q4ZA 1IBMB 2QNRA 4OXIA 4B43A 2ZROA 1ISPA 3PA8A 1D1PA 2H2DA 3GYGA 3UT6A 5JBIA 5LQCA 4JXZA 2XWQA 1M5UA 4D6XA 3WC7A 1IXRC 3EEYA 1PVDA 2A0UA 5DISB 2A6PA 1RXCA 1PL8A 3OQMA 2IEBA 2Z43A 1FUYB 1OU0A 1J25A 5EEHA 4AJEA 4F4CA 4JXXA 4JASB 3OWXA 1Z62A 2Q1YA 2VZZA 2G04A 5IDVA 1JLLB 3OWHA 3D7NA 4KN8A 2C4HA 3DE5X 2I9KA 3QAHA 5E95A 1FS4A 3QPDA 3HJTA 1DXQA 1VL1A 4R51A 1IN8A 1CY2A 4AF7A 3M5DA 3W5IA 1WDTA 3L0SA 3PI7A 5J4VA 2AD5A 2FLVA 1H0KA 1P9NA 1U2TA 5JW6A 2MIIA 4MIKA 5LD2B 1DPGA 3P32A 5IJXA 4P7GA 3TTYA 2PJ6A 3O4VA 1XTZA 1E2MA 4RNDB 4IJWA 1D2GA 5CBPA 5KQRA 3K71B 2I7VA 2ZT5A 4KMRA 4KXUA 3TW4A 5F98A 3CO0S 1RHKA 1KC3A 1VTKA 3DPSA 4WFJA 3DWGA 1R10A 4GVXA 4IBOA 1AZSC 4TLMB 4UFPA 5IAAA 3LCMA 3N8HA 4NH0A 1Q0TA 1SOUA 4NZMA 5EJ6A 4KAJA 3D7SA 4UE6A 4MBUA 1LOKA 2ACEA 4UEFA 4Q36A 1ZH4A 3EOZA 1BFKA 1VHDA 1P9RA 4O2BB 2NSMA 4FFLA 1UWYA 3CGGA 5TEVA 1X9HA 1HL7A 2FK7A 4IIJF 1KZ1A 5TB5A 4ZEVA 3MG9A 1W7AA 1U0HC 4XOUA 3X1DA 2OFWA 2XUFA 2PGJA 2Q8PA 3F49S 3KJQA 1IMOA 1W52X 4FGSA 5HQ3A 1LI7A 2B21A 4V3BA 4UXHA 4L22A 1YRLA 2H8GA 4OC4A 5C8YA 2P9FA 3TPCA 5C32A 3GC6A 2D5CA 3Q0IA 4N54A 4NULA 3T9EA 3SYMA 2XYQA 2I9PA 4TYMA 1I4OA 3UUFA 4EG3A 4HNAA 8MHTA 2R86A 1OZGA 1R7RA 4F86A 4PCVA 1KBZA 4OHOA 4OLLA 1ISJA 3QLTA 4Q12A 3RK1A 3D1LA 2C2HA 1GNRA 2IQIA 2J09A 3W8RA 3NJ4A 3CUWA 2Q1SA 3K1JA 4XPIA 3NHKA 1JAZA 4WH0A 3WIDA 1P7VA 3RVPA 4AJ9A 2P6RA 4URYR 2BFCA 5EJ7A 4LJSA 4Q3OA 1UPTA 1Y33E 1ZM4A 2XA1A 3A6FA 2G0BA 5EP1A 1GKYA 4Q18A 1IC6A 3B6ZA 4YMGA 4ESHA 5I5EA 2HRQA 3CX4A 3IVGA 1JDZA 3GDWA 1IRIA 4GOND 1OBFO 2Q6TA 4M37A 4TXLA 5EHIA 5IUKC 3SYNA 1EQUA 5E6SB 1J8DA 2YWRA 3E3OA 2Y9PB 5C0OE 2VJYA 3UHOA 3K0EA 2G1KA 4HN2A 1XCLA 1Y8QB 4PXSA 1YS1X 4KXFB 3SKXA 1SUIA 4KJZA 4DBVO 3V7NA 2AG0A 3OO0A 4MJ3A 2P6NA 4WPGA 5GM1A 4EUFA 1VL2A 3HM9A 1RJ9B 4FMBB 4OY3A 1R12A 4DZZA 2B4TO 1TTPB 2I6XA 4D6PA 3QJGA 3HCOA 1E4OA 4JB2A 4LCBA 4HRYA 4K28A 4BEBA 5LA6B 4Q82A 5F1KA 2CXSA 3L1KA 5MGBA 3LUJA 1PS9A 4EEZA 2DOKA 2Z4TA 3ADKA 5ALUA 3O1LA 2NU8B 1QKJA 4A9AA 5IKEA 2Y0MA 3GRRA 5IJ0B 2I6SA 5JD3A 1KO1A 3VR6H 3AYZB 4HDRA 2O57A 2XODA 2XVMA 3SF8A 2XEIA 3OM1A 1EXMA 2F48A 2WMYA 2H92A 3AG5A 4ABYA 1AK2A 1KGSA 3B1VA 4HDKA 4M49A 4RVDA 3KKOA 5CYFA 4R84A 3VHXB 4NGNA 1JEEA 3GAAA 4MVCA 4ARSA 1AZTA 4BGVA 1D2MA 4KPEC 1MAAA 3P8ZA 4R2LA 3TW8A 1D0IA 1TECE 4PSCA 3DV0B 4QYWA 1GTZA 2ZUBA 2ZB7A 2QAGA 2AJTA 3DAPA 3DBRB 2PXAA 4IDFA 4IV8A 2CLFB 2WHXA 4QBFA 3UGKA 1B0UA 3KSDO 4M9CA 3EC7A 3GRFA 5C8DA 1ND5A 3KR0A 2V8VA 2I91A 1QHIA 2VDMB 4IH4A 3MJDA 4N9WA 2PVSA 5KWIA 2QD3A 3NIWA 1IRXA 1DQNA 1W4LA 2NU6A 3O4IA 4R2MA 4UUNA 3CVYA 1ND6A 2XCUA 4LOIA 3FZQA 3UHAA 3WGHA 5K3BA 2XUAA 1RI3A 5FULA 3PL5A 3RREA 5K0CA 1N3IA 2QG4A 2JCSA 3NP7A 5ILGA 4U6QA 2GESA 5DPMA 2FSHA 3ZWVA 4B3BA 5JGFA 4LTMA 4IDGA 3K6KA 1P2GA 1FVXA 2Q2VA 4O2AF 5DM60 3DF9A 3IODA 2GZMA 4Y2PA 2VNKA 3BWYA 1RQNA 4C6HA 3RO0A 2B1IA 1O87A 3PWKA 1Y7TA 2IHYA 4MEJA 1VKJA 3KG2A 3FRIA 2F2TA 3R3SA 4C87A 4BC1A 4BNLA 4S1PA 3MCWA 5AM2A 2XE6A 3GFTA 2JIPA 2Y99A 1D1QA 2ZIXB 3IIKA 4IS3A 4LJ8A 1JV2B 3FPFA 3U31A 4M7PA 1Q19A 4D1YA 3OZWA 1HNWB 1IZZA 1I1QB 1GQYA 2GCOB 3C39A 3WX0A 4MRVA 5COBA 2GLJA 3WDKA 2DMRA 4X6YA 2AMYA 2F1IA 4OHMA 5FNVF 4BN5A 2XHEA 2H57A 4F71A 2FX2A 2QN8A 3BOSA 4RTLA 3HO1A 2CNNA 4DBLE 2JCYA 2LDXA 1ONPA 3P9KA 4NICA 2WEKA 4K9SA 4PSWA 1QAQA 2OL4A 1GITA 4MYDA 3QBTA 1CUDA 4I4LA 5AVYA 2XMQA 3PX7A 5K20A 1Z63A 2QG9A 3DPUA 2E4UA 3I1YA 4CM1A 2A4MA 5JJLA 1E3WA 1YAJA 2HSDA 3HNRA 5JU6A 4Q3DA 1NOKA 1QPBA 1M1ZA 1OYVA 2ORWA 2WHEA 1LVHA 3OJFA 4F0JA 1P75A 1Q84A 3FI0A 4MQ6A 4MYHA 5FOSA 3BM5A 5CMLA 1QIEA 4OYRA 4ND8A 1QO7A 4W9MC 1IONA 1DC8A 1EAYA 4RABA 4TL9A 3SYTA 3WWPA 2ZRHA 2PGOA 5EI5A 2Y8EA 2XEJA 4KWCA 2GEUA 2OLEA 1E5DA 1EP2B 1L4LA 3EIFA 2L18A 5A4AA 4C5AA 4N0EA 2CL5A 1JTFA 1IM8A 2G1JA 3NX4A 3IQGX 4TWBA 2ZCVA 4EA8A 5JXGA 2KS6A 1N9KA 3K9HA 3R7LA 1VHEA 4AKHA 3ZHTA 4CMCA 1W36D 4EB8A 4TYWA 3E9EA 4F9FA 3DTTA 1IDOA 1V1JA 1WMBA 1YVEI 2ZVPX 4L3VA 2DQKA 2EDAA 5CT5A 4KAXA 2QL5A 5CHYA 5B1YA 2PT6A 4WZ6A 3W5VA 2YX1A 3RHZA 4GM1A 3ZK8A 5D85A 3DDCA 2BGTA 1ZG7A 4MW1A 1SFRA 1TK9A 4ZYXA 2YJZA 3M3HA 1WMFA 4BO0A 2FEXA 3O73A 1FOEB 4BVHA 4CF4A 2CNWD 4ZU3A 4CMEC 1AX9A 2B2CA 4OGWA 3ZE1B 4I55B 2EGGA 2JGIA 3KJNA 4MLZA 2A92A 5CPBA 3T54A 1FJXA 2CF6A 3CX8A 4Y0VA 4OI1A 1KZ9A 2ZW5A 4L1KA 4P83A 2I2XB 5K8LA 1G4AE 3VSEA 2QYVA 1B4DA 1U4SA 3EG9B 3F5QA 1DCFA 3T34A 5BQXA 1ORVA 1POXA 1JJVA 3G5AA 1EVKA 4BP8A 4FK8A 4RTSA 1STOA 2DC1A 5FX2A 3A7EA 1K4JA 1CUGA 2ZDGA 4TYQA 4EX7A 5IZCC 4TT3A 5ELMA 2QRUA 3AHCA 2AW5A 4CEIA 3T90A 1IJEA 5EQDA 5HCNA 5DF1A 2Z6AA 1J9EA 2ARHA 4IIJA 3CLVA 2AFMA 4A33A 4C2AA 3Q0EA 4FWTA 4IG4A 1G66A 3V46A 4PPFA 1IY9A 1U8UA 3DYBA 2AJCA 2O5EA 3MB5A 4I2VA 4LKOA 3VH2A 3WNVA 1NW4A 3EVAA 2ZSJA 4IF4A 4QYXA 4PW0A 1KVRA 1RVV1 4NNJA 4H1HA 4QTUB 1L1FA 4ZU6X 5TT1A 5G0UA 4OJQA 3FJOA 2G1AA 4HTAA 4YJGA 3UKDA 4KOAA 3IE2A 2PLAA 4OSPA 2OYCA 3SE0A 2BH2A 4Z7JA 3MPUA 4G36A 4U2FA 3F6EX 4BIMA 3RCBA 5JMTA 2H1OA 4JZ0A 4Y1RB 2EHDA 1HT3A 2Q4TA 1GUAA 1OTHA 5M34A 3DFMA 1QTNA 3HBLA 3VGJA 1RACA 1PFGA 5CDTA 4XJSA 2JFUA 4MGZR 3WHKA 3DG9A 2NUAA 721PA 2IS1A 3PHBE 1DINA 1UOOA 1XZPA 4RD0A 5DCLA 3WP1B 5K1ZA 5D3ZA 1YGHA 2DXQA 1XRQA 2XE4A 3DD1A 3RU3A 3JAWA 3H0KA 1T9CA 1CP6A 3H1BA 2JDDA 2GNAA 3HVKA 3IR6A 4W5HA 4WXMA 4XVRA 5FHRA 1YZQA 5JSKA 2QLJA 3HHEA 1EU1A 3QVMA 2G09A 3WADA 3KEGA 2H48A 1KO4A 1UF9A 2ZAOA 3HA2A 4HY3A 3PKJA 4XTRA 2B3VA 2PRQA 1TQDA 5BVHB 3TX2A 1U8EA 1JUDA 4KZTA 2DJIA 1IEVA 4EENA 2Q50A 3DBRA 1IH8A 3F98A 3SBXA 2WJYA 1Z13A 3H6HA 2PKRA 3EVFA 2OENG 4AROA 2GK3A 3ZU2A 1WHSA 4IKEA 4DS3A 5FLEX 3LYUA 1DTWA 4DGSA 1P74A 3DAYA 3L7AA 2J9GA 3NV9A 4D97A 5D29A 1TL7C 3TLGB 3HFRA 1G6KA 3P2MA 5B36A 2WUVA 3CKMA 1KORA 3G9ZA 4XVHA 3VTZA 1SU7A 3L0ZA 1F2TB 3OZDA 1AGRA 4KPGA 4UKDA 4YAOA 5H1YA 4OKOA 4TRRA 1TD9A 4RZ3A 1M3SA 1H2RS 2W5UA 4W7IA 1VQ1A 2I62A 3HY4A 3Q7IA 2A58A 5B64A 2XOKD 4UARA 3UMCA 2JD0A 1R27A 2YNEA 3LS2A 1G5TA 2ZSBA 2VDVE 3PNBA 1U63A 3ZGNA 2O23A 5HVFA 3B2YA 4WINA 3SVTA 5T5QA 2E4ZA 2NVUA 3JYQA 4NFHA 4QPJC 9ATCA 2PSWA 2D74A 3DO8A 1IY7A 1OXMA 1BN6A 4MP8A 4QM7A 4G0NA 2HMVA 4MYCA 4ZHQF 3QU5A 3CNNA 5U4QA 3RFTA 1OB2A 3CT9A 3UMBA 2B8NA 4R2XA 4BFWA 1RKBA 3QNUA 2AZMA 2BCGY 1KYVA 2XNDD 2ZWPA 5L45A 2O7NA 1N6NA 4EOGA 4J2OA 5TMPA 3F9RA 3RU9A 2ZUFA 1T4BA 5IHXA 4LDAA 2ZEEA 2GKSA 4EMBA 3VZPA 3GG9A 3Q7EA 3ERCA 3HA3A 4YRAA 2XCLA 4GLFA 3TZ6A 2FQQA 5KOHB 3EEQA 1QVAA 5HIAA 1VPDA 1ZGGA 3N7AA 3FYSA 4G3XA 2A14A 3QWHA 4JBNA 3UOWA 1QV7A 2AMVA 3NALA 4CMIB 1F5NA 1UBFA 3MLAA 4QG3A 5DHTA 2V45A 2B2XA 4XB6B 5JE8A 4C4OA 8GPBA 2HYIC 2BI8A 3KXDA 4MVJA 4PHTA 4KYTA 4X64B 3FXTA 5BW4A 5AXBA 3OCWA 4QKQA 3E9CA 1IZ7A 4FI3F 2P2SA 3JWJA 1UFVA 1NVTA 3MTDA 1UAAA 1QPGA 3A4TA 2GU2A 1C8BA 1E2JA 1GQQA 1Z0AA 3OKFA 3WLRA 1PYTB 1QORA 2F43A 4JYCA 4GX5A 4IKOA 3P9RA 1YL7A 1T34A 4JROA 3LP6A 1OXSC 4PNEA 2PZLA 2B8WA 1AKYA 3COPA 2JGKA 3W6NA 1P6UA 2ISCA 3AJ9A 3DGEC 5JCJA 3IPLA 1KYXA 5H86A 3TFWA 3IOMA 2CZQA 3D6FA 5CGZA 5GQSA 3PDUA 5GMOA 1THMA 1RRVA 4X1YA 1AB5A 3TZCA 3N87A 4G5YA 4DRYA 3TLZA 1UZUA 2LKDA 1P5ZB 4N3BA 2A9JA 1IYZA 1UT5A 1VLHA 3NKVA 3RVRA 5FORA 4HYYA 3TQOA 3WKDA 2NSLA 1HOXA 3AW9A 3DNSA 3WYBA 4KC0A 3AVPA 2CFCA 4TOIA 2YW9A 5BQFA 1PZNA 4A0QA 1T5BA 4X6LA 3AETA 1GARA 1NP3A 4ILKA 1T1SA 2AVDA 4UUMA 3BILA 1KQGA 3GBVA 2OBNA 4ZMRA 1Y3CE 3CNEA 5JDIC 1T0BA 3ASVA 3HWWA 5HF6A 3RYOA 3LUCA 3WBJA 4AVAA 2BEUB 1CHDA 2W4IA 3EXG1 3V5NA 1BXRB 1TYEB 1Z0KA 2BMAA 4WLEA 3ZY4A 1ZP6A 1Z8XA 3PUZA 3UJAA 3GDOA 4DAEA 4CDMA 2ZQZA 1V43A 3D66A 2PZEA 3OWCA 1NATA 1QQ9A 1IOVA 2XTZA 4NAHA 2IX3A 2FW0A 4EYQA 2I4LA 3RSHA 5CTJA 2DHQA 1UKVY 1JBQA 1QB7A 5HKBA 1C1HA 1BCSA 1KERA 3FVRA 4OQFA 2C5LA 1P0IA 1RS0A 2QX4A 3BF7A 3TGLA 3B3VA 1KFKB 5ARCA 1TU3A 1V9CA 2WD7A 4RF5A 1QR2A 2C2OA 2QB5A 5IT4A 1RZRA 1QRAA 4EHFA 4RORA 2W2XA 4EG4A 1IE3A 4TV9B 5G0TA 3DE0X 5BR1A 3WLJA 1KI6B 2V8OA 2QU8A 3RSSA 2KBFA 4CEIB 3JQ7B 3HFSA 5DKFA 3ZCPA 4EBFA 1R64A 2WG0A 3CEJA 1M2NA 4IAVA 4QEKA 4W5NA 4MS3A 3UT5B 1IN4A 1BTOA 1OTYA 1VA4A 4XX0B 1ARMA 1D2HA 1XDZA 2QRMA 4OAQA 1A72A 4LYJA 4KIUA 4UCQA 5BY2A 3AF4A 3EPHA 3B3WA 5F1PA 4AKTA 1BLLE 1YMEA 1GAQA 2OO5A 2FSFA 3NE7A 4ZVRA 5HMMA 4LOLA 4PF1A 4FWBA 5JFOA 4DIEA 5I9IA 2Y2UA 1ZOIA 4PXAA 4RHCA 4K9PA 3NVKI 4C29A 1HKHA 3H86A 1DCKA 4IINA 4UXIA 4QOEA 5CLGA 1T29A 3NYIA 4YP9A 4ALKA 4N18A 4Y9UA 1Z4NA 2IHUA 3ZKWB 1FK8A 4OHCA 3MHTA 2GEKA 3E9YA 3DE2X 1Y5RA 3KJXA 4AX8A 4BMSA 4H89A 1B8VA 4Y2QA 1PV4A 4ARUA 3H16A 3SIPA 4CYOA 3RC9A 2YZNA 3CJTA 5KTAA 1Z73A 1J90A 3OE7D 3GY0A 4LF8B 4P0QB 1PR0A 4LKRA 3IU2A 2GN1A 2AOTB 1KBOA 3FFBA 3ER9A 4OO3A 1Y42X 1FNSA 1CLUA 2CYCA 1PYDA 2PSJA 3O2SB 1A2ZA 5CB4B 3ODPA 1BD3A 2F3UA 4YT5A 5EZ5A 4FEGA 5CBMA 1XCOA 3D4BA 3KIPA 4FLFA 2WSBA 1MX9A 4LSWA 4P3YA 2RB7A 3OQOA 3VTKA 4HX9A 5J9FA 3LKBA 1EA7A 3G8DA 4YH1A 4WOPA 1P5JA 4R9VA 2J0UB 2O1WA 4TMVA 3RRMA 3WR5A 1YQ9A 3ZHZA 1P8AA 1VL0A 5GP1A 4I19A 3SZLA 1U8CB 2PO7A 3BMQA 3ETDA 3GB9A 5GZ3A 5E8RA 5LUAA 4GGPA 4KNWA 3KLNA 3KFXA 2JFOA 2AJDA 2WM8A 3AR3A 4RGBA 5E2AA 3D2MA 3PFNA 2IE0A 3NIGB 2Q4OA 1QHGA 3UWSA 2OV2A 2GEDA 2G9RA 2JFXA 2O7RA 2ON6A 1YZYA 2ZBUA 3EH1A 3MS7A 5AHXA 4D02A 4PN3A 4WGFA 1PYGA 1M0TA 3C3JA 1M8GA 1N0HA 1JPUA 4QEDA 2DPTA 2NIPA 4INZA 2XYVA 3P5SA 4BFYA 4DM4A 3GRPA 4M9XA 1BVHA 1XL0A 3TLKA 2EFCB 1JR6A 5JROA 1U31A 2YHBA 3M49A 4KOUA 4S2EA 2I6UA 5P21A 3SJBA 2F62A 2G8LA 1GZUA 3FDXA 3JRXA 2HNBA 1H1DA 3PP8A 4QX6A 4RFVA 4PSVA 4W6QA 1CPSA 2XEGA 5CK4A 2HREA 3FGZA 4CV1A 4MRIA 2DU8A 5ARDA 2O3RA 4EW6A 1QK3A 4Y2HA 5EE9A 3ZHYA 4B3CA 4FQ8A 4OHRA 1YR0A 3R9XB 2FWAA 3P0JA 1QZXA 1X42A 1CY7A 1DWPA 1PRYA 1ZM9A 3WWYA 4BBJA 3C5HA 1WDKA 4W1PA 3AESB 1U8ZA 2F7VA 1HM5A 2WYWA 1CEEA 3OY2A 1ZNYA 3CLRC 4G9GA 4MI3A 4WZBB 4ZQGA 5E9JA 3ER8A 4TZ6A 5K0TA 3I1IA 1NSFA 2X9GA 3D4OA 2QV7A 3WGTA 5JSZB 4JCOA 4GDMA 1OGJA 2HV9A 4TQGA 2O4HA 2OHGA 3PE4A 1GCOA 2CKMA 2OHVA 3VOBA 5SV2A 2QTMA 2YICA 4ZICA 3SICE 5JD4A 2ZSKA 3DTNA 4W4TA 2H4YA 3NW9A 3TCNA 2BMFA 2BEJA 1G5IA 1GPJA 4XFKA 5BYBA 1WU7A 5KSYA 1W5FA 3DUWA 5G41A 1DEHA 1BQEA 2BLLA 3OT5A 3SC6A 1B2RA 1EDZA 4G4SP 4A0GA 3HXQA 4DW8A 2P4SA 2X19A 1E1DA 2K2WA 3EVCA 4RKYA 4DTCA 3K6SB 1NRJB 1GPUA 2EQBA 3ASUA 1H22A 3DMGA 3NDRA 2EKZA 3BN3A 1VSUA 2KMLA 4JWTA 5A3JA 1HT2E 4AAYA 4OD0A 4W7HA 1GU1A 3WRXA 2YKGA 5JQGB 4R1MA 1DZIA 3OHSX 4TX1A 3B9PA 4NJOA 2LDBA 5A04A 3SZOA 4CQMB 3R95A 2JGMA 4BMZA 3PXBA 4O4LB 4WKCA 2O8BB 1A2KC 3DNPA 1EFDN 3E4CA 3L5KA 4QFMA 2R87A 5K0SA 1KEKA 3PC8C 1PSZA 1E6MA 1E5TA 3HB4X 5TS2A 3TRKA 1E89A 5E7QA 1RLTA 1Q7GA 3STTA 4BZPA 4TGLA 1EJ0A 1JDPA 2NUTB 3JWGA 5AMXA 3V33A 4BKMA 2WZCA 4IGAA 3VZRA 3M9LA 4BEVA 2ZOGA 4MDHA 3PIIA 1CU1A 2BL4A 4JD5A 4MKZA 3E05A 4LRYA 3O8LA 4NJEA 3JWPA 4HHEA 2V4MA 2ZJBA 4PPZA 5FPKA 3TLAA 3JWEA 3ZVRA 2FXVA 2GXQA 5K6AC 5LSAA 1FUEA 3HA5A 3Q3EA 1XZIA 4R2WA 1UKEA 3G5MA 4BO4A 3OFND 6REQA 1E3QA 1REQA 1DHTA 2AN9A 3M4NA 3RFCA 3S81A 2J0SA 1PL6A 3N59A 1S8NA 3HMKA 4A4DA 4NOLA 1HDOA 3DQQA 4C7MA 4D81A 5HJEA 2AQIA 3E4DA 1R0XA 2O52A 1W4CA 3LBHA 2OHHA 2V55B 4EM6A 2QMQA 4WLUA 1WXEA 2WSSA 2XUHA 4O3MA 3F0AA 1LNSA 4BNJA 3R44A 1LKZA 1I1DA 2P6GA 1J20A 3C6KA 2ODWA 1O6BA 1SXHA 4FB5A 1PZEA 4FNMA 3PZBA 2XRZA 4YJ3B 3ZG6A 1LCPA 2QUHA 4E11A 2QJTA 2R6CA 3K30A 4BVKA 1FSPA 4ZI6A 1TTQB 1GPNA 5CBPB 2HHLA 4DDMA 2LRHA 5IXJA 5B7PA 2QD2A 1SJ9A 2R5NA 4E14A 4XXHA 3TJRA 3EE6A 5AI6A 3I9MA 3VXKA 2VYVD 1XD8A 3IUEA 1ZI6A 4WCFC 4AW9A 9LDTA 4CLDA 2ZR7A 3ZQUA 1V2HE 2GI4A 1QB8A 5IAEA 5TS3A 4JJFA 4IDEA 2AR7A 2M6RA 3JQBC 1Z74A 2B6NA 2EFHB 2QRNA 2PRKA 2AW3A 2FEPA 2NG1A 3DAFA 5E0KB 1PQYA 4AJOA 1PTKA 4R1QA 3KYDB 4NZPA 4QUJA 4LK3A 4EGAA 5F3RA 4BB6A 4CQMA 1A3CA 1NIPA 5H4GA 1GQOA 4AG6A 3THXB 1RTTA 3PDCA 3F6PA 1B1AA 1RDFA 1YKGA 3GAFA 4EGFA 1PWYE 3RUEA 1P3DA 1SHKA 3HABA 4JX8A 1UJCA 2QAJA 2VP0A 2KX7A 4ZVKA 1NKTA 2PRSA 4C21A 2HCRA 2BISA 5FFNA 4RLSA 3O03A 1A8HA 1DAOA 5LZ5A 1LLCA 3JZDA 3HJRA 3TNFA 2Z2JA 1E99A 2IYQA 2GFQA 2XCOA 1ZGBA 3GNSA 4Y1RA 3HYRA 2GE3A 2QMZA 4G0XA 4K9OA 2DCUA 4QATA 3RUPA 4CKXA 1Q95A 4CS0B 5JDIA 3IERA 5HMNA 5B4TA 3ND6A 5BMVA 2W6JA 2J07A 1CR1A 3ZWAA 1MNAA 3INRA 3QSGA 4R71A 2BM8A 4XB1A 5K2MA 3TBHA 2JBWA 1Z4EA 1NZJA 1YDFA 4C5CA 4OX9B 2Y1LA 2ZW4A 2Q7SA 2XLBA 1QH8B 1E96A 3RVNA 1Y3HA 3DVAB 4IWNA 1W6RA 3UIEA 5LR6A 2XMPA 4E21A 4QUBA 1C81A 3HLKA 4G8CA 1I5OA 2GM5A 4RH3A 4A73A 2WSYB 3OLVA 4AMVA 3FEDA 4LF5B 3ORHA 3FGNA 3A14A 3FB3A 3R23A 5THXA 3M33A 3QVGA 1VKNA 2YJ3A 4R83A 2QIOA 2PVCA 5ALHA 1QHEA 1NSAA 4F9TA 4PNPA 2ZEHA 3STXA 5AVKA 2CY0A 4ZRDA 2JC3A 3PITA 4KWEA 1VPVA 3WBKA 1ACJA 3TNJA 5FA5A 5MGNA 1VE5A 4EG7A 1X7YB 1DJLA 3QHPA 1Y4ZA 3KS9A 1ZO8A 1VYVA 2HMYB 4HDSB 1AV6A 2COKA 3EGWA 2IYXA 3ZWQA 1KYQA 3AR9A 3BVPA 3K0FA 4IDCA 1VE6A 3ZHOA 3W5DA 1XQYA 4TTRA 1A27A 1X7ZA 4MB0A 1VCOA 4PHGA 2QR5A 4CUZA 3SBOA 3GLFE 4LF9B 4GKKB 2CFIA 4ZO4A 3ANMA 3PJGA 4PZUA 4C4AA 3PXDA 1Q3KA 4LAFA 1RPJA 4PHHA 2AUNA 3TKYA 4LHXA 4MRMA 4FMCF 3BULA 4F5EA 2IEZA 4OM8A 2XZLA 4Q7KA 3BFJA 1ECBA 1LV8A 1XA0A 4LXQA 3ONNA 4YRCA 1YRWA 3SQMA 2NSYA 3HCRA 2BE9A 4TMKA 4XM1A 4FYIA 3R0QA 3FTCA 4MVJH 2JHPA 1P4RA 3IDZA 3RODA 1B15A 3NNSA 2Z6VA 4MS4B 4MV0A 1DV2A 1MIOA 5LMZA 1EWQA 1ESDA 1SKBA 2WRZA 3BEDA 5BWBA 1ESMA 3HNPA 2QN6A 5EY5B 4EGQA 4J0CA 4LRQA 7CPAA 3VR4D 1LBSA 2OV4A 3WKBA 2X6RA 2HDHA 4Q9KA 3GLHE 4PBSA 2XY4A 2ZQYA 3RIXA 5LYJB 4EKIA 4JJGA 2EGHA 3U3MA 3L8EA 1Z37A 4K03A 2NTJA 4W5JA 5FO1A 3WNZA 2UZ3A 1JHRA 3JD3A 1CVIA 2AG8A 4RTRA 1J8QA 4QUDA 4EKNB 1O77A 1QHXA 2J9ZB 1RXVA 1AE1A 1MJAA 2GBIA 2R7LA 3D4LA 2VHEA 4O5OA 5L95A 2OZLA 5BORA 2JVKA 2Q99A 2QJ8A 4FMDF 4BFZA 2XRYA 1H2AS 1S6YA 1T3ZA 2QLNA 4ARIA 1KJJA 3UKJA 4RVOA 2W11A 1MAHA 3A6DA 3CR3C 4WA8A 3DKPA 1MO4A 2BOAA 1YI1A 1X1DA 3L9WA 2CB0A 2X8LA 4TXJA 4YRPA 3WVNA 1F6BA 4OGLA 3U7IA 5K9ZA 5I4IA 2JLMA 1CE8A 2HH9A 4NGPA 1CR0A 1P4NA 4KAFA 4EGJA 1K27A 5K8MA 3MOSA 4RA9B 2ADOA 3WC6A 5JASA 4O4LF 4LFCB 4TWJA 1X1TA 2ONYA 1SZDA 3OHMA 4S35A 3TS1A 4R9RA 4Q34A 3KUKA 1EXVA 1FP6A 3S3TA 4UHCA 1M1XB 4GMKA 4MICA 4BN0A 1XMQB 3ZDFA 2MTBA 1C4OA 1BFDA 5JSZA 5DHSA 2V7EA 1G6Q1 4UOEA 3K0FB 1VFPA 3KXIA 3H17A 5DO9A 3ROTA 4QT4A 4ONEA 3KSZO 4ICIA 2UU9B 1IOFA 1QH9A 3OZEA 1N3LA 3A4LA 3UJPA 1ODSA 2CLKB 2ORED 5MDHA 4Z3OA 2Y1OA 3NTUA 4LJKA 1PBNA 1A82A 3LKDA 1DBQA 1W0JD 2J3EA 4HBGA 4XEUA 1JHUA 5DX8A 3NTLA 4E2FA 3S9LA 4FYVA 2VJBA 3Q3CA 2V6IA 4BWGA 3GNTA 4Y2SA 1CUFA 1U2ZA 3SBDA 6Q21A 3KR5A 1BXRA 4RSMA 1Z06A 3DMHA 2FZ5A 421PA 4KRFA 5DXJA 2VQEB 2WA1A 2E9SA 2F8MA 4Q03A 1PR6A 3Q7SA 3BIOA 5GPBA 4O3FA 2LGJA 3HFJA 5LLSA 3VTAA 4D0GA 1I10A 3PFBA 2JI7A 3ANNA 1CY1A 8ABPA 3UTCA 4FNGA 3ZS9A 1YSJA 1ECGA 4X97A 2FCRA 4CR6A 2EARA 3Q88A 4G1UC 3BXGA 3UG6A 3NOVA 4UCXA 3TXYA 5P8WA 4TT3D 4D0LB 3GZTB 2EKDA 3EISA 1YE5A 3H5WA 1TIKA 4C3VA 1VHOA 2YYZA 4B6QA 4R7MA 3BRWA 4WT7A 1RHUA 2Z95A 2ZI3A 2FETA 4I99A 4LWPA 3ZQKA 1DKQA 3F8WA 1CP7A 5AW8A 3P0HA 4B8WA 2Z11A 2QZSA 3MT9A 1W76A 3K20A 5CA1A 3KVOA 3SJAA 3A9CA 3WGJA 4EPWA 1EBBA 2A33A 2MSCB 2O2JA 3OZIA 3KZWA 1VYTA 1I6LA 1GPMA 1SY7A 2ZJ4A 3HBNA 4NI5A 5E0OA 4OBEA 4CW7A 3HKDA 4UZEA 2YTZA 4EYEA 2X0EA 2R6DA 4OFXA 2I4NA 2VNHA 3FR8A 3P96A 2CLIB 4ZYYA 3R76A 3WK8A 4AZ3A 2I87A 1R8JA 3U4IA 2OSVA 4KORA 4PO3X 4L07A 3V1MA 2NP7A 2QD5A 4M1EA 3B6KA 4CCYB 1U6KA 3TVYA 2H7CA 1ZCZA 4F84A 3JQRA 2Z8YA 4UAJA 4YT8A 4EA6A 3CLKA 3EXAA 4NENA 3DMTC 4RKRA 5FBRB 1TJPB 5FOVA 1WB9A 4F9VA 1AS2A 2BKEA 2G67A 1HFWA 2XWBF 3VNAA 3WLIA 3IO3A 4DANA 3ROFA 1XFAA 4M7RA 5EJAA 2XUJA 2CBZA 3AY6A 4C30A 2NTYC 2WWVD 3B8HA 4GEKA 5IJ0A 3JWHA 3EAQA 4WLFA 4CL3A 1JNXX 1GEEA 1RXEA 2BELA 2C8LA 3O4FA 2GD6A 2MSLA 2NXJA 2SCUA 3ED1A 3JQ8A 4S1VA 4PZCA 4CU2A 2SICE 2J45A 1A71A 3VGPA 3EJWA 4Y1GA 4CPAA 4OHYA 1QSMA 4OL9A 3WZLA 1NMTA 5FIUA 3KLMX 1AM4D 1JLRA 3QK7A 4JI3B 3WB0A 1YBMA 4FCTA 2O6LA 4ZAZA 5JRJA 2O5CA 4IVRA 3WLQA 1Q1GA 3TR5A 2BEIA 1RXYA 2JI4A 4Q4CA 4WECA 2HPZA 3DBVO 4I4CA 4E5UA 1F2UA 2GILA 1KDPA 1EUDA 5AKJA 3PB7X 2P9YA 2CNMA 3AUKA 5BUQA 4HDMB 3P7MA 1DS6A 2VYQA 3PEWA 4PXDA 2P2NA 3TTTA 3ZLBA 4E07A 4ZZ0A 3ZGVA 1NC1A 4EK9A 3E8MA 5BSWA 1S60A 4FTWA 9GPBA 4PYOA 4ZDIA 2DKOA 1JPNA 2IODA 2Q41A 3VR6A 1MABB 3PVCA 2F1RA 2YFQA 3KZXA 2VPYA 4CKZA 5H3CA 2FN7A 4L5YA 1XWFA 3URMA 3SSNA 3QKRA 1OBRA 2ZW7A 2PX2A 3FCAA 3EGCA 2R1TB 4LMRA 4D74A 5EHXA 4GU5A 1N75A 1UIRA 4OMCA 1TM3E 3KB6A 4ALNA 5K0BA 1D4FA 1E2PA 2UUPA 2GM3A 3V97A 5HJ2A 1DAPA 1ZC4A 3U4GA 2GNOA 1SU4A 1FMTA 2HYDA 1HLPA 3HR4A 4NV3A 2BY4A 4BDSA