2GFQA

Structure of protein of unknown function ph0006 from pyrococcus horikoshii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
288
structure length
288
Chain Sequence
HSSGRENLYFQGHMKVIMTTKVDKASMNIMNKLIENFGFKETEYVFEGNPVYKRGDVLILTTNDEMIYYDYLDREIENQLGFKPEIIAFASRHSSKQKLPALTTHVTGNWGKAMYGGKDESFAVAIPSAMKLSLLKMSELNDLGWTVCYEATHHGPTELEVPSFFIEIGSSEEEWINDRAGEIIAETIIYVLDNYEKGRSKFKVALGIGGGHYAPKQTKRALEGDLAFGHILPKYAQPVSRDVMIKALNRFGEKVEAIYVDWKGSRGETRQLAKSLAQELGLEFIKDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UPF0204 protein PH0006
publication title Structure of hypothetical protein ph0006 from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
total genus 107
structure length 288
sequence length 288
chains with identical sequence B, C
ec nomenclature ec 3.1.1.96: D-aminoacyl-tRNA deacylase.
pdb deposition date 2006-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04414 tRNA_deacylase D-aminoacyl-tRNA deacylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold AF0625-like 2gfqA02
3.40.630.50 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase AF0625-like 2gfqA01
2GFQA 1YQEA
chains in the Genus database with same CATH superfamily
4G63A 3FB1A 4KPUA 5F35A 4D0RA 5EZ5A 2W00A 5DM60 3Q41A 1J1IA 2XD9A 4FMPA 3HXOA 1PEDA 1NVKA 1ZIPA 5ARBA 1M5UA 3WV4A 4ND5A 2PK3A 2OYRA 1H6AA 2VS1A 2IHYA 2UUPA 3IIKA 1Q7LA 2A9QA 3UJCA 4XKJA 1E3LA 2MDTA 3QHPA 1TI7A 4XX1A 1R9JA 4YJFA 3UN1A 1OH6A 4QSHA 4MJ7A 5JI3E 4X8MA 1S3ZA 1E1NA 3EBLA 5J47A 4O4JB 4J0IA 4U0KA 5DBEX 1CQPA 4H7FA 1H0KA 3PHIA 5FBZA 2VP5A 4M7OA 3SXJA 4ZY0A 2OH1A 1FJHA 4OD0A 1Z15A 4S1TA 4KOXA 4MOWA 4K6MA 1ULUA 2EV9A 2XKJE 1ZU4A 1QO0D 1TEXA 4TLBA 5JJ5A 2VAMA 3DBIA 3IDZA 2FVGA 1ZNZA 2IIVA 4WFJA 5HHTA 1O6FA 3EXFB 1F6BA 5JARA 5L7YA 1UBRS 1YKSA 1PS9A 4JV5B 2H8KA 3DDHA 3TE4A 1KEWA 4QDUA 5I7SA 3KT8A 4MVJG 3HGQA 2CMDA 2PUDA 2MYTA 1UXGA 1T0IA 1OZHA 1EJBA 1SWWA 4PNHA 4K03A 3KAJA 5G0UA 1TD1A 4N8EA 4P92A 3FBGA 4KWTA 4GFDA 2ZROA 2O5EA 3KLMX 3LZDA 3ZD6A 2W5UA 3VARA 1YR3A 4JITA 4UHCA 5C5DA 1M0SA 3TEFA 1MC4A 2ZBUA 3PC7A 4HDKB 5K2MA 3W2GA 5K8MA 2O1WA 3EBPA 1V6CA 1Z16A 2Q9AA 2HNBA 3PJEA 4B8YA 4CVNA 2YWBA 3UVEA 3LCJA 4YMWA 2H0RA 1T2UA 4YJ3A 4YCJA 1Q16A 5B6IA 3SJCA 4GOKA 5M7EA 1K5GA 3CZ5A 1Z0JA 3RREA 3G85A 2DXIA 2P9GA 1SCIA 1Z4NA 4PK3A 2I67A 1W2WB 3PEIA 4HLCA 4W1QA 1CP2A 3T7RA 5CCDA 1QX4A 4LVUA 1I4OA 4LV5B 3PJRA 4J76A 3UMVA 1F06A 3WRXC 4RXUA 4V24A 4L85A 1NLYA 4Z51A 2RBEA 1RQPA 1I1OA 1X0VA 4KRYA 1JW9B 3KZOA 1G1MA 5TLSA 2V55B 4CFZA 1TF9A 1WDTA 4MW1A 4IIFA 3TFQA 4BE9A 2C20A 5CD9A 2HPVA 1T2FA 3LC1O 5M2QA 4OC2A 5BW4A 1I4TD 1Z5PA 4ZEXA 6YASA 2YN0A 4UHEA 1FSPA 2JDCA 4EHBA 3SIXA 3BCSA 4HLDA 3S1AB 4BQSA 4HDNB 3FYTA 1YVEI 2FK7A 1BDIA 3PB7X 1FTNA 3EW9A 1JQJC 2R8EA 1NOKA 3L4JA 3ACDA 3T7CA 2BBTA 3FFAA 3D7HA 3ZY2A 2AI1A 3H8EA 2VDNB 4OL9A 5LYYA 2ZSEA 2XF8A 4DR5B 1PDWA 1TAHA 1WTAA 2PD3A 3GLKA 2BR3A 5FOQA 4GEKA 1R2QA 1L8OA 4J9UE 4PX2A 3UMFA 4FOPA 2AIRA 4CQLB 2G5GX 4E5SA 3BJZA 2FG5A 4HRAA 4CU5A 4GPAA 3JVNA 1EJ2A 3IIIA 4IGIA 3R76A 1NULA 4LTNA 5AP9A 5LMUB 2OCDA 3SEQA 1AKRA 1MB0A 3TL2A 4TSFD 3W6PA 1AKWA 2F8MA 1GCOA 3QVSA 3SPXA 1DKRA 1EK1A 2NAFA 3RT9A 4CIBA 3OLQA 4C0AC 2CLCX 4XCQA 4PTZA 5PGMA 3WR5A 3NFRA 1IEWA 4FWIB 1LLQA 2LCIA 1VSTA 4DV2B 3LZ6A 2WE7A 2AD1A 2PGOA 3ANLA 1B0PA 3HMKA 2G9RA 2WPNA 4IMPA 4YRRA 4JLAA 2VDPB 4QOGA 2ZYAA 2PX5A 3RIEA 2PRJA 1WUYA 1OB2A 4LUAA 5CLHA 2G72A 4G0MA 3CRZA 3PXGA 2Q2OA 1YZTA 2HTEA 3NTRA 1I5RA 3QG5A 1PU2A 1GR1A 4U9IS 1XNJA 4RH3A 1Q2XA 1IBMB 4H7HA 1I33A 5HZHA 2A5JA 4L8FA 1FNNA 2OILA 4UDXX 1XIXA 3LDFA 5AKHA 3QQ5A 3R3HA 1H9CA 2YNDA 4NMHA 1XHLA 1OB5A 4GNRA 3PFOA 1F8GA 5AKYA 1CDOA 2VXKA 4PQEA 2WFMA 4ABYA 1EX7A 4E6EA 2XBLA 4NGNA 4UATA 4OMEA 2PMKA 1QKJA 2ZXEA 3C4VA 4K9KA 1E6UA 5DNEA 1PNQA 2RJOA 3ZGYA 3VH2A 3L07A 2EJWA 4ZOLB 4GS5A 3H1BA 2QR3A 2X5OA 4CLDA 1O6CA 2D4HA 4DC9A 4YVFA 4O4IA 3SLGA 1K89A 3FLBA 4KU4A 3ZVMA 1W76A 1N6PA 5AJUA 5KVAA 4YRMA 2HF7A 2GFQA 3BJ7A 1KETA 2QSZA 2HJWA 4CTOA 3VYTB 1GXSB 4NCJA 2ZEFA 3G8BA 2XW6A 5T3UA 4I4TF 3EQZA 4ACBA 4S04A 4BVAA 5E9WA 5D8DA 4MDEA 3B1XA 1XX6A 5F7JA 3GEBA 4BLQA 4XYEA 2Y71A 3NYWA 3ZLUA 3Q15C 1HQCA 3RFTA 4CBVA 5AVQA 2J3LA 2CXAA 3HEBA 1AA9A 1LBHA 3H8JA 1QXSA 4ZVMA 4U0JA 2RC6A 2XMSA 5MFZA 1E0KA 5JR3A 5BORA 5AXDA 4RVFA 3NAMA 4RVNA 3IUPA 2YHIA 3OPVA 2RK3A 3KDSE 2J0SA 2R7AA 1ECGA 5AW0A 3OLZA 3KYDB 2CVZA 4QO7A 1KSFX 5DSZA 4RLQA 3RT7A 1H85A 8OHMA 3WKAA 1PJZA 3TQQA 2FMHA 4ZQIA 4WE3A 4MFQA 2PRZA 1RFLA 4ILKA 3I1UA 1VHDA 3U49A 3W5VA 2P9ZA 5SZKB 3SI7A 2G1AA 4UFNA 1H69A 3W77A 1DEXA 1W9HA 3HO6A 3LL4A 1Q91A 1AH2A 3WOHA 2OV8A 5K0NA 4QUIA 3TE7A 2WHXA 1NSLA 5J1QA 1C3VA 2XB8A 4PPZA 3B35A 4M0MA 1U2PA 1CVIA 3CUTA 3KT6A 4NJMA 4BNZA 3VQTA 1TM5E 3FCEA 1BRMA 4TLMB 2PQ6A 5CXXA 1MT3A 1R74A 2PSHA 3SC2A 5A6SA 5KJ1A 1IHYA 1WX1A 3OZRA 2ACWA 2QTVA 1U2GC 4MQ4A 1M75A 1DMRA 2JFPA 4IPTA 4S05A 2AXNA 5E38A 4PYIA 3T4XA 5AKEA 4ITUA 3D4LA 1U94A 3KELA 1NE7A 3LGXA 5ELMA 1XEAA 1PSZA 4E5VA 1ZCBA 2JZNA 2MMGA 5IYZB 5AR1A 3GPIA 4WT7A 1JYFA 3GIDA 4JJ8A 3N2YA 4KVOE 5DXAA 1SHZA 3K9NA 4AZ0B 3OIUA 3PUKA 1U8XX 1E3JA 5JPDA 3KE8A 2BGRA 3KO8A 1EUDA 2O8CB 1Q0ZA 5AKJA 2NZ2A 5IJ9A 3UFXB 2QM8A 3PJFA 3MJTA 4M6WB 3ESQA 4GXHA 3Q1KA 3TZLA 1RQNA 2WTMA 4NBSA 1TXRA 2IPNA 3FGNA 3OPMA 1XQ6A 1WZ2A 4B5PA 3LGSA 1ZC3A 4N5HX 2ADFA 1NNI1 2IYZA 4UARA 4W4TA 4F1KA 4WZBE 2V65A 2XMQA 3OT1B 1SKBA 2HBRA 1MV8A 4EUFA 2RIPA 2PJDA 1NQXA 3LJKA 1GFSA 3Q9LA 3B1WA 3Q6IA 3NGXA 5LBUA 2P9QA 5LZ2A 4HNHA 2V5VA 4D79A 2W0SA 4BP3A 4L27A 1G19A 4PS0A 1ZK0A 4FK8A 1NUHA 2AJ6A 5ALRA 2Z98A 5B58T 3V80A 1D07A 1VHEA 4KZTA 1L9KA 3G89A 5KQSA 3TRFA 2GJKA 3THXA 2F9LA 5BVGB 5FL7A 2R8PA 4ZAWA 4FCVA 5IC6A 3Q8WA 2YBDA 5T57A 1OPRA 3RVLA 3KPWA 4JC8A 1ZW6A 3ZJ5A 4KORA 3GT3A 3PCTA 1ZG7A 4CU2A 4TRNA 3PR1A 1SGWA 3EF0A 4DLAA 1VL0A 3W9SA 1X15A 3TTWA 1OJ7A 2BEWA 1M6HA 2G4CA 1TL7C 3QTBA 2P4UA 4UHJA 2F8SA 4I99A 3NEJA 3PB8X 1UP4A 3BD7A 1ZN2A 3HS3A 1Z2OX 2M32A 3QKSB 5TVGA 4D8XA 2WSSA 4CLRB 4YP7A 3GGOA 3IMEA 5DCUA 4AY2A 4KXQA 5AW4A 1MJ9A 3CLUC 3DOIA 3MN8A 2NP6A 5AG6A 2IEBA 1L7EA 1WPQA 4N0QA 2JLSA 1M2GA 2HPZA 2VPQA 4GQAA 4MHOA 3E3LA 2KHZA 2XB9A 4ZQGA 1EUZA 3OHMA 2HFJA 3KJNA 4B3XA 3OF5A 3MYYA 1EHYA 5TPWB 3WKDA 2EX4A 3VO1A 3PGVA 4M9RA 3A37A 3B3AA 3FEDA 4CL0A 5IHXA 2XAUA 1EK0A 3T5PA 3CKKA 4BO6A 4TWZA 2CE2X 3P8ZA 2ZI7A 1SC4A 1R8JA 3L40A 4P4SB 2OV1A 3H7IA 1S0UA 5K20A 4MLZA 1W85A 1MD9A 4PAGA 1Z37A 1NDUA 4POOA 2EFCB 1TUBA 1XZBA 1PKXA 1V1RB 4B6GA 3DT9A 4Z4QA 2WM9B 4MWSA 2WZNA 1RBYA 5IB0A 4KVME 5FVJA 2Q7BA 2PXAA 3M5PA 4G5QA 5DGDA 4MXDA 1IFXA 4DPMA 3IKLA 1CQXA 1GYTA 3B13B 4L7QA 3W34A 5BURA 2WJAA 1T4BA 4JFAA 2EW8A 3N2KA 1W87A 3ROZA 4BB5A 4LJSA 4MXUA 1FTQA 4NSNA 2VSQA 1U28A 5IBRA 1AHNA 3WK4A 4MI1A 3FDFA 4L15A 4MUMA 4JZKA 4MO9A 3K2BA 4EPTA 4DG5A 4MEJA 5IKXA 3IEIA 1FLVA 3MTGA 1T5TA 3VTAA 3RARA 2ZSBA 1B16A 2ONCA 4BIIA 3PNOA 4BZPA 3U6KA 4FLFA 4PV6A 4ZO9A 2GAAA 3B6ZA 1P4GA 2XB6A 4JR0A 3TTTA 3BSYA 4NI5A 5FWDA 5IBCA 3TLGB 4REQA 1RYFA 3E82A 2GSWA 4B3MB 4KLWA 4DV1B 4MWTA 1V1MB 1MQSA 5I0CA 4TRMA 1Z7WA 1BN7A 3E5HA 1YRHA 3WDKA 1ILWA 3KK0A 1ZM2A 1MB4A 2F62A 1Z2AA 2I9PA 2GLUA 2Q29A 3FVRA 5L53A 1EDZA 1TM2A 2REXB 2V59A 2JLVA 3DQQA 5DGCA 3GEGA 4K6FA 4X7RA 4EBBA 1VIDA 5EP2A 3B12A 4DLPA 4LXIA 2JC3A 3F2IA 3OQJA 2BBOA 1E79D 2C7PA 3B5EA 3LMSA 2PTGA 3FCOA 4KDCA 1QK4A 3COPA 4DEYA 4WY2A 1AIPA 1HTWA 4B75A 4F11A 3BXEA 5AG5A 4KGDA 5B4TA 1FDUA 1UEXC 4C7XA 1XE3A 1UPXA 1FBTA 3STUA 1K8ZB 5F9HA 1EFVA 4MRIA 3AI7A 1DT3A 1YBHA 2ZEJA 2VBFA 3PICA 5IYZF 3U19A 4GX5A 5IHPA 2ZM5A 1QIIA 4KQCA 3HNOA 1C8LA 5KOJB 1P7YA 4I5EA 3WNZA 1XNQB 1IC6A 2C2YA 2XE7A 4HXGA 2B98A 4EVIA 2ZUTA 3L6EA 2FU5C 3FYUA 4BZZA 1CE8A 3AX6A 1KK2A 4PANA 1A5AB 3RJ9A 5LUAA 3RSGA 1L7XA 1UKCA 3ANXA 5F12A 1LS1A 3P2HA 3EY9A 1PQ4A 3CURA 2UKDA 4DBLC 3VYRB 2QKYA 4ZFNA 5ALEA 1PZHA 3CEPB 5FTKA 3UGKA 1UMBB 2ZANA 1PEYA 4G3XA 4RVUA 4DCUA 2JI9A 2X5NA 3DBHA 3L77A 3DC7A 2FZLA 1HMYA 1M1YA 1U2SA 1KY4A 4BQQA 1TD9A 4O29A 3EXEB 1LLCA 3ZBUA 4P0TA 4B3BA 3OTWA 2UVDA 3D8BA 2Y05A 4EGQA 4YJ2A 3O9MA 3NR2A 2AEFA 3WKEA 6PFKA 3R09A 4GI5A 3IXQA 3M6MD 3JS5A 2VDRB 2EKPA 3LBAA 1TVEA 2R2AA 5LQJA 3GLHE 5C8XA 1SK8A 3ZV5A 2WYIA 4AG7A 4AY5A 4QVTA 4LISA 3L0OA 1XWIA 4BBZA 4M6GA 2P2SA 1YRBA 2D1FA 5COBA 1EJ0A 5KVQA 1EVZA 1VIVA 4AVAA 2DM6A 1YGPA 1J5PA 5E9AA 3AKCA 4CLHA 4LDRA 4AF8A 5H3HA 4E5MA 3ISJA 3L6OO 4U9ZA 3MGCA 1D6MA 3CMMA 3H97A 3W5IA 4U5QA 5F9MA 2Y76A 2GLJA 2R00A 3M1YA 3NBQA 4ZX8A 2E21A 2IJZA 3KALA 4AZSA 3L05A 1PJ8A 4NFYA 3LDHA 2FTKE 2H18A 1L5VA 3OMWA 4ZGYB 5IF9A 1IK4A 3TD6A 1XTPA 1XYGA 3GBSA 5THQA 8ATCA 1I5EA 3SE0A 2FRDA 2ZM6B 3RYFB 4ETMA 3QNUA 5AYVA 3TUIC 4OLHA 1ZEJA 4Q3DA 1L2TA 4TTRA 3TW6A 4OFZA 2XQFA 1KOLA 1T8WA 3R7WA 2ZXFA 3C16C 4J1TC 3GA0A 3RQSA 2GPTA 2XF2A 2YUIA 1K6JA 2C2HA 2ZT7A 3VYVA 3UWPA 2Z56A 4OQLA 1VHWA 2JPDA 3EULA 4CMJA 2YZNA 5CJPA 1OTYA 5FWYA 5ARDA 5K51A 4ZOBA 4A38A 2X2PA 4GM1A 5K99A 1JBKA 4WCFA 3K0CC 3QUQA 3MWJA 1L5GB 5E1BA 1VL5A 5DOZA 1L5QA 4RPHA 4LF8B 2L0XA 1PX2A 2WFAA 3M1LA 5IJXA 2BEUB 3IA7A 4Y8VA 5DIFA 5DKFA 3UAWA 2FSSA 1N32B 3C3XA 2R1ZA 3TOAA 2LKDA 1DFHA 4IH4A 4EPYA 3WP0A 2NO6A 3KYCB 3RROA 3ID6C 4I3FA 1A76A 4Q38A 3BWEA 2FZGA 2VH5R 4V1CA 1J49A 3FPAA 4HH3C 2Q6IA 4HQNA 1P9WA 2Q8PA 3C8ZA 2PVWA 5ERYA 3WGKA 3KHSA 3ZE6A 3N87A 1T5OA 1NVVQ 4LSWA 2C9YA 2X19A 1O94A 2XXJA 1HL3A 1TCVA 5IUNC 5LU8A 4MY0A 4PXEA 1Z4IA 2ST1A 1AURA 3PL5A 4FP9A 2Z0MA 5AHRA 1VPDA 1D09A 3DW3X 2QPAA 1EGAA 4XE5A 3G0IA 1R0SA 4P34A 3LQFA 3NAQA 5JMPA 3EK2A 1GCUA 4XDHA 2QUIA 4TMVA 4W5TA 1WHSB 3KZKA 1SKYB 4JSTA 1P5FA 1WV0A 3FAZA 5K4HA 3LVFO 2ZUBA 3NASA 3CX3A 3VR4D 3S29A 4QGAA 2VDOB 2PDAA 2LRHA 2V6BA 1I14A 1UBTS 5DH9A 3DFFA 5ILQA 4WH0A 1JAZA 4LSMA 1WCIB 4OGKA 5DTIA 2IDKA 1KK0A 2HWXA 4LXGA 1KYXA 1T8RA 3SOPA 3LBHA 4RQAA 5E2BA 2NZUG 3KJHA 1F9AA 4BZWA 1AXRA 1KDVA 5EIHA 5FNZA 2RONA 3NBKA 1JQLB 5U4XA 1KGSA 4R41A 3WGUA 3T9YA 3KQUA 4RD4A 3T3HA 2YIMA 4WGGA 2UYYA 2WPDD 4A73A 4XB2A 9GPBA 5GJBA 2K5TA 3LMKA 3TJRA 3M5CA 2VUTA 1JMVA 5JSZA 1U0JA 4A8TA 5GV7A 4Z1OA 2GPYA 3HKCB 5CJJA 1GDTA 2H5LA 3QX7A 1K7SN 1JH8A 2E49A 3ZGXA 5KYWA 1BFKA 2GJ9A 3QVWA 1JEAA 3WIOA 1NBOA 3SC4A 2QE7D 2IEZA 2X42A 4E0BA 2ZEGA 1UXJA 2W48A 3IULA 4DL9A 3VPCA 3OFSA 2GREA 3U37A 3WABA 3HYNA 5JDIA 4P31A 1A4RA 3A6ZA 1R3UA 2YN4A 4CL3A 2QN9A 1IY2A 4V0NA 1SQ0A 3MELA 5LDHA 5AKLA 3WL4A 4KQXA 3QF4A 2I22A 3AEUA 5LQNA 3QKIA 3ZC3A 3QPBA 3ESBA 2GYVA 3CN7A 3SR3A 4YUXA 2Y6UA 4DCMA 3VNVA 1OBFO 4FWUA 3HL0A 2DHQA 2J4DA 1ONPA 1XT6A 1T3ZA 1X1DA 2C3MA 1K4JA 3FJOA 4RM3A 4X20B 3UKJA 1FYDA 4MUAA 1NXXA 4YUZA 1QB8A 4NFRA 4MYTA 4MUYA 2Y8EA 1C7JA 1VYHA 1QGUA 1LI7A 1KI4A 3H5IA 3ZJ4A 4U2EA 2XNJA 3VC2A 3KQSA 5HJEA 2QTCA 4UFWA 3MJEA 4IVRA 3BFVA 4AT1A 3BORA 5T4EA 1JHZA 4ND3A 4F8JA 5AW9A 3I04M 4C0BA 1SRQA 1P7VA 3VPFA 1JG3A 3LH5A 2WLTA 2WHEA 4L5JA 1YJBA 4GH5A 1X7DA 4ZYZA 4QQRA 4DUPA 4TMWA 2YY6A 3AHJA 3HH8A 3SBOA 2BEJA 3FMCA 4BYGA 1QIHA 1SB9A 4MW2A 4XUDA 1LRZA 2OPHA 3FD8A 5F1PA 5JRZA 1PK8A 1CS0B 3NZEA 3L1KA 5EL0A 2QLLA 1UOOA 5DE3A 4PXBA 2Z95A 2F7SA 5IM4A 3DXXA 1PWYE 1FFWA 2A4NA 3TJMA 1UP6A 2NU8A 2VHJA 3JR3A 2XQGA 4HZUA 5E9JA 3F5FA 4E11A 2YCLA 2FW7A 2YS6A 4XTCS 1IHOA 5J2TF 1VXOA 3MBOA 3UWOA 5D29A 3K9WA 3AR3A 3HN7A 4FC6A 3EOBI 4IV0A 1M6WA 4Z49A 4R2LA 1VPTA 4AY3A 2H1SA 4TYYA 1AQUA 2D0PB 3ZWCA 4TZ6A 4BC0A 1JX6A 3PKIA 4C2TA 4QDOA 3GVXA 1N1GA 2QYSA 3QVGB 4LBYA 3UMRA 3CPEA 1ISFA 3IXLA 1ZLYA 4REOA 1YRAA 1SBZA 4AS1A 4IJQA 2WU0A 1SCUB 2QW1A 4FZVA 3BE8A 2D2EA 3WJ2A 5KQLA 4RJKA 2C8KA 3RLFA 4JD6A 1KZ7B 3KS9A 3SIRA 1EB9A 1XCOA 1NPYA 2EDCA 3EQ7A 1CG2A 3UA4A 4YDRA 4UA3A 3DF9A 1UC9A 4J1SA 1VCMA 4IRMA 4RORA 5DNAA 1AUGA 4JX8A 3AHFA 3NUGA 1EFCA 2ZPTX 4YROA 2G9DA 3DHNA 1MAHA 2IOFA 4B6QA 4KXXA 3O2NA 4LRSB 2BMAA 2PXXA 3LP8A 1C5KA 2GDZA 1JTVA 5EMHA 3WYEA 4Q3LA 4ME6A 2CT8A 1P7PA 5BT9A 1W49A 3DYVA 1OBHA 3CF2A 4OYRA 2MMCA 2B34A 4KYTA 5DIZA 1MABB 2BMFA 3C8DA 2C9BA 4B35A 1A0OA 1UBHS 2Z09A 4AN0A 4OGGA 5KWSA 1FNOA 3SD7A 3WIVA 2DFDA 5JC8A 2C27A 1HXHA 1QF7A 4ND6A 4W5QA 4K40A 5T6MA 5DGXA 3SNHA 5LRJA 5GGYA 1VKRA 4BO2A 4QVKA 2J07A 3GP5A 1CUSA 4RD2A 4BVEA 3CLSC 1NU6A 1K7EB 4YCSA 3HABA 1CDEA 2PZBA 3HDJA 4DYOA 1W2HA 4CV2A 2IK8A 4MVYA 3R3VA 2PUHA 2ZWIA 4RCYA 3GJ4A 3NV7A 5KMGB 1QSMA 1OI7A 3ESZA 2C7BA 5EPEA 2O6LA 4B0OA 1C4KA 4DF3A 3BMCA 1E8DA 2DSNA 1Z0KA 1LFAA 3ESDA 3BF8A 1W47A 1S9HA 2ZAYA 1VG1A 3N58A 3ZU2A 5HQTA 2Z0ZA 3JY6A 1OXUA 1NVGA 3WGNA 3TUJC 4EM6A 3M34A 2HMTA 1U02A 3OT5A 1SELA 1JEYB 3H86A 1NSTA 4G81A 1WDWB 1GSIA 1AN9A 2MSNA 2EJTA 5GJWC 4DLZA 2VFAA 4IJ5A 4I1VA 2EW2A 5F5NA 2PHZA 2O5RA 2I0FA 4UJ3A 1VL2A 4WY5A 5FR1A 4ZVOA 5JNTA 1L7QA 1U4SA 2C57A 5LP1A 3WC6A 1DP4A 2QW8A 3LQKA 2RHOA 3IUQA 4M83A 3QIVA 3CF6R 5EHZA 4W6QA 1YI8A 3NIWA 4J49A 3T9AA 1PBNA 5ISVA 4MPTA 4XM0A 3OCXA 2FVYA 3L6DA 4LCEA 1OXBB 1WY5A 5BW6B 4IJUA 3CXSA 1AKUA 2JIZA 5BSKA 5BN4A 1C30B 3SP1A 4MCPA 1N2CB 2J6CA 4BFTA 2J3EA 3M3DA 4BBJA 2CYAA 1Y9JA 2ZT8A 3TN7A 3QLEA 5E4JA 3DNSA 3F6CA 4ZV9A 4FIZA 4K1XA 3LT2A 1DC8A 4JU8A 4PLPA 1FEZA 2QYTA 4O2BF 1C9NA 1F7UA 2DECA 2W6PA 3AR6A 2WHQA 4JK3A 1GY8A 1SD1A 2FPIB 4RA6B 2PH1A 4QOHA 3BTVA 3IVCA 3D81A 2JFFA 3JAWA 1NV9A 2I4OA 1XRNA 1UKAA 4CUJA 3KOYA 1GLVA 1XJ0A 3LXXA 4JEMA 3LU1A 2DYKA 3WWOA 5BVHB 1XGKA 2OD9A 5FPKA 4MUGA 4H6PA 3WMFA 2ZUVA 2W2XA 1G3MA 3E9EA 1Z73A 4A4DA 2XDYA 5FA8A 1NN0A 5GOZA 3NT5A 5DN6D 4KLZA 2YJTD 1NOIA 2I9KA 4BGUA 4ZVRA 1MX9A 3CLTC 2UUCB 4QE3A 1W7AA 2WYWA 3FRJA 2II6A 5AKGA 1JGTA 3SBXA 3RRNA 1GZVA 4NCAA 4Z4IA 3PSHA 2BMJA 1L8XA 2YV5A 2HGSA 1QVWA 3HACA 1T6ZA 4LIPD 3ZZMA 1C9YA 2G9VA 3HHPA 4O2RA 4J0HA 4OGWA 5L3RA 1MF7A 3RRFA 5EQTA 2CLHB 4UAVA 1TKJA 4ZCTA 3AY7A 4X1YB 3B6KA 3DLBA 3CF4A 2W43A 1IXKA 2R86A 5FBKA 2YWXA 5F1YA 3HCOA 2OYSA 4CNBA 2ZYHA 5FJJA 3Q2IA 1C0PA 1PW7A 1DX4A 4EWLA 3FUXA 3SBEA 3MK31 5AXCA 1MX1A 4U2FA 2B1JA 2FJ0A 1YREA 2OR3A 4RZUA 2CXQA 1M6EX 2AT1A 4BNDA 4Z4GA 4CN9A 2DWPA 1WZNA 2QBYA 4L5BA 2YYSA 5F78A 1YAJA 4NAHA 3JRXA 4P2GA 1TCBA 2OENG 1EFUA 2RMKA 1BHJA 3J80A 3GJ0A 5IDYA 3GT4A 1VI5A 4QU9A 1E6MA 3WBFA 2P6UA 1RI5A 3EPLA 1DV2A 3TG2A 1OFIA 4DLNA 1Z5ZA 3MJCA 3CVUA 1J56A 2H1CA 4GPBA 3AI3A 3PI6A 2D1YA 5DI3B 2RGNC 3T7SA 4PNPA 3RYIA 3TLCA 3D0KA 4DZTA 4AJJA 4HNAA 3DXYA 4M8SA 2ZWMA 1BG6A 1TMKA 1CP6A 4BGVA 2P9TA 3NCTA 4F1WA 3DKRA 4H4CA 1A9SA 3HWX1 1Z2PX 3UJBA 1JF8A 4AECA 2V7TA 1ZGAA 1GRCA 1T3GA 3MJRA 5EXEA 2D2XA 3TL6A 5JCPA 3ZHQA 4DNFA 4LWZA 2KM1A 2WTUA 1YCDA 3Q98A 4PCUA 3NVAA 4HXEB 1ZX1A 4G1BA 4KOSA 4CDMA 3GMSA 3D2BA 5TPZD 3S44A 5JQGA 2Q2QA 2E5LB 1Y1SA 4PRKA 2X0NA 1JT9A 5FOTA 4ZKEA 2EBWA 5FF9A 4NZYA 2FFQA 4M0EA 4QQNA 3PUXA 3UMCA 5HS6A 5TE9A 2XUAA 2ZELA 3WLTA 2BEVA 2WR8A 4YT4A 4M0LA 2Y1OA 2BSXA 4QHTA 3AHDA 4EG4A 2V7PA 3ECAA 2HO5A 4ND7A 5BR7A 1KSGA 5DN9A 5E4FA 1G8AA 2P6FA 4YMIA 3BDAA 2F1IA 3C43A 4N6GA 1KSHA 4RYLA 1XAHA 2VCEA 5HJ5A 3RG2A 5JH7F 1Z0IA 4C0JA 2AYYA 5FPYA 4ZCLA 3RPEA 2FEWB 1CJKC 1RLTA 2RB4A 4NQZA 4D4KA 4C2XA 3UMSA 2H2HA 4H3HB 2H54A 3OCZA 3TZHA 3MD9A 1P45A 1A1SA 3HLPA 1FMCA 4BO9A 1YMQA 1TCCA 2ORED 3O9VA 3N7TA 1N6NA 1MOQA 4NG4A 1UWYA 4HQFA 4GI2A 3DTVA 3IELA 1NJ1A 1DAOA 1HUQA 1LUAA 1RFGE 4ACAA 3PENA 4FLMA 4MQLA 1FYVA 4NMLA 2Q9BA 2WV9A 2RCYA 4WBNA 2PV0A 2AFIA 5LYFA 1W1WA 1XF1A 2BCGY 3E2MA 1RC1A 1P0MA 1R15A 1HT0A 4C2ZA 4ZQCB 4MKFA 3EXHA 1KZ9A 2CVHA 1YXMA 4QHYA 1KYVA 2YW2A 4KR7A 3BSSA 2P6OA 1DAHA 5GP1A 4OMCA 1TTPB 3CPJB 2DMRA 1KEPA 1KY3A 1C9MA 4JQZA 1L8QA 3VOSA 3ZLVA 1JIKA 1RJFA 3ZQUA 3AEKA 4HP8A 3MB8A 2C2OA 4O1IA 2FW0A 4HC4A 4NSQA 1IBSA 4B1FA 4GR4A 2BHLA 2C4TA 4KXMA 1UFHA 3LK7A 3VGPA 2RKWA 3WDSA 3FPGA 4WGFA 1ZH8A 4YALA 3KU1A 4PZEA 2ZTVA 1H65A 1QH1B 2B69A 3I4FA 1Y0RA 3C2QA 3L2NA 5HDBB 4I4TB 4DE5A 4MWDA 3HZOA 1UT6A 3BGDA 1HDRA 1PK9A 5LRGA 4G0QA 4Q3KA 4LC1A 3CHYA 3ZKWB 3NM4A 3LF2A 1KEVA 2C2BA 5JROA 3IHWA 4DA8A 1PS8A 4YJGB 1YBVA 1KZHA 1G3RA 5CGZA 3LYLA 4MVXA 4QQKA 4MDFA 4TQ9A 5LOVF 2ZEPA 4UBMA 4W63A 4CUKA 3AVVA 1PVDA 4B71A 4ZHQA 1IVNA 2JBJA 3NDJA 4IMJB 5CB0A 3FHTA 1M2JA 3R0QA 2ZEHA 1GQFA 5CW2A 3NHRA 2WD9A 3TQRA 5K8IA 4HDOB 4NICA 1TQDA 3IQEA 5CAEA 2FVXA 3P2JA 3KJGA 5JJBA 4RS4A 3TKAA 3SLRA 3KJXA 1QVZA 1Q57A 4TN1A 1ZJ5A 2IV7A 2R7HA 1S2MA 2Z8YA 1Q92A 3TO5A 3H8FA 5FEUA 3FNEA 5JD4A 2FP4A 4WK6A 1U0EA 4AQYB 4CI9A 1ZU5A 5DPMA 3HI4A 4XEUA 2P30A 3U1VA 1VJDA 3SM9A 3QEMB 2I3DA 3CNLA 4C6TA 1Y3BE 1KDYA 3AEQA 1QCYA 1HI9A 3L0DA 4AKTA 3NVKI 1AUXA 1CWUA 2WABA 1WXHA 2UUOA 3V1YA 3M6VA 1J5EB 5C81A 2VDKB 1XDWA 4CCSA 4OUDB 4R2HA 3RK1A 5I8ZA 3P1JA 4BVHA 1LH0A 5CB4F 2V58A 1U1EA 4D3DA 4OEHA 1QYIA 3M1AA 1TF2A 3PGXA 3UJ8A 1WVIA 1KFBB 2YIVX 1QS0B 1UXKA 2ZYSA 2KYRA 1TKAA 4MV8A 1Y9DA 5TY0A 1UAAA 4ASUD 4RW0A 3UNXA 3PXBA 3GNTA 1CDZA 3FWZA 4V0OA 3EZGA 3LDUA 3VSBA 2WQ7A 3P4YA 1ZNWA 2I3BA 1I1HA 3BRQA 4MAMA 4RAQA 5C82A 1XAGA 4S35A 2CMHA 1VHSA 1LGYA 2P4EA 3OU7A 2OV3A 4BJ6A 4B2YA 4A31A 3QUBA 2BWJA 4TKUA 5EHNA 2AFHA 3KHKA 5BWNA 2Q4TA 3JATB 2FQ1A 1KSJA 2QF7A 1CKEA 2WF9A 1EUCA 3D59A 1RWXA 1KUVA 5THXA 4Q9JA 4MA5A 3LXMA 3BICA 2GU2A 4MRSA 3QFSA 2AFWA 3IUEA 3SQNA 4F8ZA 3OKAA 2DPMA 3GRUA 4IXDA 4KOEC 4E4TA 1J2EA 2CL7X 5HFJA 2FSVC 1ADJA 4PLTA 2XRMA 1PNOA 2DR2A 1DUIA 1VJTA 3QH4A 4FKMA 2NNLD 1MJBA 1OV4A 3R3XA 2IH4A 2WYOA 2CCGA 5LXTA 4D56A 1SG6A 3CVOA 2H1LA 3P20A 5AI5A 1XU9A 1IOIA 1YE3A 4TV8A 5GONA 5LWQA 1KYWA 3BJIC 2HSEA 2OG2A 1OA1A 1NXPA 2XB2A 2IE8A 2HIGA 2R44A 1Q7CA 2FMTA 3EZ6A 3ZE7A 3H8GA 2HNAA 1N6KA 2IBMA 4K9DA 1Q83A 1X1AA 4BU0A 4EHIA 1LA2A 1T2DA 4M21A 3CWZA 3D0QA 4YY3B 3M4YA 5A2QA 3R5XA 5AW5A 1ZCZA 4LOIA 3LPMA 1L4BA 2ZP1A 5LMCA 3TX8A 4Z0TA 5JSUA 4E2FA 1SU7A 2VR1A 4AWAA 3TZ6A 4JLBA 4EVSA 4W7SA 1S4QA 1P1JA 2EFYA 3T6KA 5T41A 3NBXX 1Y82A 4RWZA 4MGIR 4IDPA 4FZJA 8CPAA 2IMOA 1F3LA 1MPXA 3HYTA 3HV0A 2O8EA 5ALOA 4AMGA 1HMPA 2YW9A 4OSOA 2BPOA 4YJKA 4YGYA 3I4LA 4M22A 4HWGA 1EFRA 5LM3A 2ZB3A 4EPRA 1CTQA 4KR6A 3TMKA 5KYTA 3PDIB 4DIBA 2JG3A 4IDBA 3CLHA 1Q0PA 5JH9A 5H3LA 2X5XA 1ZW1A 3IHTA 3SJAA 2BTOA 3LUDA 1I3MA 1HFEL 4EKYA 1PDVA 5KTAA 1A04A 4M3NA 3GU3A 2WJIA 4WZAB 3OOEA 1JE1A 4BPBA 1JALA 1NXQA 4HGPA 4QOIA 3UPUA 1QHXA 3EIUA 3GIWA 3UHAA 3DZ8A 1SUCA 3KHTA 3UIEA 1IOZA 3FPLA 1X1QA 2Q50A 2NSHA 4NONA 3DFUA 3NFZA 3BXPA 1C9JA 1HLDA 3U44B 1PCAA 1G5TA 4TGLA 3TBHA 3P27A 2ZUFA 4X61A 2X8LA 4ZAZA 3R20A 3AYZB 5HBRA 3L8HA 2SNIE 4KK4A 4RULA 1XL0A 4LY0A 3QI2A 5ESXA 1AF7A 2O3SA 3RJZA 3MGDA 3GP8A 2I71A 2NUPB 1MXHA 3KZVA 5IU6A 1KVUA 4KRXA 1N7IA 4LCBA 4O25A 1Z8FA 4KVZA 1RHRA 2PJAA 5TNXA 5H82A 2D1TA 4OIFA 3I9FA 2VZ9A 3TQIA 4LXYA 4OQ4A 3FY4A 3EX7C 3W6SA 1T0HB 5EXDA 3FLAA 4NXNB 1N6OA 4IZOA 2WKWA 3F5MA 3REGA 4UZFA 1U2DC 3PDUA 3U40A 2NXNA 1ABFA 4IW3B 2DX7A 3I1YA 2OWDA 1TF7A 4U5YA 2Q2NA 1LW6E 3VR4H 2V96A 1T6NA 3SYNA 2J0VA 2HJSA 3LP6A 5JIBA 4K2HA 2GRAA 2GS9A 1XRMA 4MAAA 3P0EA 1STOA 3FIJA 1ONBA 2X22A 2NADA 3KQXA 3DXZA 2YDYA 5J23A 5JYEA 4JI2B 4IDDA 3OI7A 4EWTA 3QU5A 2FWAA 2HCBA 4NZOA 2X8WA 1PR9A 4QDZA 5ICCA 1BSVA 3IRUA 1KDOA 3F90A 2A86A 2OO5A 5EJGA 4Y2GA 4B3FX 2JDDA 3TLJA 3HWSA 4TYQA 1EEHA 1OIXA 4TMTA 1T15A 2QPOA 3A9VA 4BP1A 5EP3A 4OAEA 3U16A 3TR0A 1T26A 2VYFA 2XNDA 1ARZA 1L7NA 5G41A 2JIQA 2IEGA 5AKIA 3BKXA 1KAQA 2OZKA 3SHPA 4IDAA 5JWHA 1AZTA 5D7BA 2VJMB 2WZQA 3U3JA 1JHAA 5IN5A 2AFXA 4LHWA 4I5DA 2C1EA 3LO8A 2AK2A 4GLOA 4Q36A 4DQDA 3P97A 4UASA 5B1SA 1M34A 1H4VB 2E2WA 4W1PA 3KOUA 1LV7A 4KRFA 3UGQA 4R6XA 1VL1A 2Q7OE 1D6SA 2NV6A 5D87A 2IXAA 1PYGA 1MU0A 3HADA 1ECPA 4F5DA 4WXPA 3QRWA 2PJZA 1M2OB 3EMKA 2Z3MA 2QB5A 4Y1FA 1JDZA 1B14A 4MPPA 1XQ9A 5B64A 3HDQA 4NBLA 2OCKA 4W8HA 4BRUA 3BEOA 3KQTA 4LBWA 4A94A 3SI2A 1TXGA 4PYQA 2AJBA 4DTIA 1ZNYA 3D7KA 2EQ5A 4RYDA 3I1FA 5KYVA 3WIDA 3BI1A 2HZ7A 1O95D 2W2KA 2X13A 1XBUA 2GBLA 1YIAA 2E0IA 3TDMA 3EWAA 5DMHA 3AB3A 2ZJ5A 2BFNA 1N75A 2G83A 5JBNA 7ABPA 2IF0A 3LQQA 4QBKA 4ZYVA 3D3WB 1N2JA 3OE7D 4FB5A 3K70C 2W93A 1QAMA 3PZBA 4BVKA 4RXMA 2AVDA 3QELB 2Y0DA 2E85A 5IBQA 1GPKA 4GOOD 3MCUA 2EQBA 4C3VA 4MY3A 1LBSA 2I91A 4QJIA 3E61A 3EDYA 3QYFA 4KXLA 4KIWA 1M1ZA 2Q41A 1CP7A 4N01A 3ZLTA 4QPDA 2O8VA 1Z17A 3IURA 5DU2A 2H5JA 2IUYA 1ELLP 1NONA 3TD9A 1GA1A 3P0RA 4CM1A 1YZUA 4AJ2A 1OXKB 1P33A 2R7KA 4E08A 4R1SA 2Z3LA 1VHLA 5FPQA 1N8TA 4UE3S 2J8RA 3ASVA 3TNDA 3GPBA 2XWBF 3SJZA 1CY1A 2AKAB 2VDJA 3OECA 3T5GA 3MPUA 2EBFX 2HBYA 5KNBA 1WHTA 3D68A 1T24A 3FCUB 4M1YA 3G1UA 3CVWA 4HFMA 4OQNA 1SD5A 2YRWA 5F7ZA 4UUMA 1UP7A 3M9XA 4WIAA 4EI9A 3NW9A 5F5XA 1BAPA 2QZSA 4P22A 1TU0A 5K0LA 3MOIA 3PRHA 5DW0A 3S4YA 3MWDA 4OB7A 4DNOA 4Q4JA 2IRWA 3EQ9A 2WUDA 3X1XA 5ESWA 3KWLA 4IIGA 1AVTA 1EPUA 5KX5F 1XLTA 3R7FA 1IZYA 4QFDA 1ZOIA 4XGRA 3N59A 3LCMA 4P98A 3I9NA 1CY6A 1EFKA 5HPYB 3B48A 2XD4A 4LNHA 4DAEA 3IUJA 3RS8A 1EXMA 1MUUA 2RFHA 2WIFA 4QL3A 2PNFA 5C2JB 3JWGA 4NBRA 4G23A 3OZXA 1JVSA 3NDRA 1SIBE 2BP7B 4K86A 3E48A 5KTKA 1UC5B 1CUFA 4U6QA 2YXNA 2IBTA 3OZUA 4MTLA 1M5TA 2YWFA 4C3OB 2BDTA 1Z0ZA 5CVDA 4E2WA 1CR2A 4D3FA 4C0KA 1Y89A 3EUAA 2C99A 3H7AA 2W58A 5B3LA 1EINA 3QE2A 1YQWA 2X7BA 1RCFA 4HWTA 1GLGA 1NBMD 1CB0A 4FE4A 3H18A 1R66A 4PONA 1JNYA 1RBQA 5I9IA 2NVWA 1C7QA 3TL3A 3RUHA 1ONOA 4I6GA 3GWZA 4UAUA 2EX1A 2WILA 1L1QA 4XUGB 1JHUA 3SK0A 4DM4A 2YWJA 4GC9A 3DHYA 5K05A 1QHIA 1OBVA 3BC1A 1LAMA 5TQ0B 3K5HA 1V37A 1MJAA 3SQOA 1JWBB 1U7WA 1UZAA 3TDKA 4NE2A 3FEEA 2W6MA 1ZRMA 1MEEA 3DTTA 4DSNA 3RFUA 1FVXA 3S6FA 1FRZA 3K53A 5J8FA 4JUFA 4L4RA 1LF0A 1MKYA 2PY6A 4KQ2A 3E18A 4FBGA 1HQYE 4FMCF 3OETA 4INOA 5DYYA 5KU7A 2CB0A 4K9MA 4MP8A 1E99A 1IQPA 1DG3A 1UWCA 3O73A 4RIGA 2GCIA 4YRPA 3O8OB 1CJWA 4C68A 3HTXA 1H2WA 2P2CA 2GM5A 3RFXA 1SUWA 4FSHA 5KPDA 4YRFA 3M6LA 3G7UA 1Q3KA 2DUWA 3V1UA 2G07A 2DKNA 2DQ4A 3R95A 5ERGB 1XXHB 4IGKA 2QN7A 5BNZA 1ITZA 4DMMA 2JZCA 3WWCA 1OGJA 1QHEA 4ZEMA 5FLYA 5IXYA 1U90A 4GC5A 1YFZA 3WL3A 4CFYA 1M4IA 4F8YA 5KHLB 5B57C 4OLJA 2PJ7A 3EG9B 1TIBA 3X44A 5A28A 2Y1LA 5FOWA 1PJCA 1G3UA 5KAMA 1P1KA 2OZEA 1JECA 3JASA 1E2JA 5E6RA 3IEUA 4UU8A 4H7JA 1PAUA 1PKEA 2N42A 3W5UA 2C9OA 5BSFA 3AFOA 3ML1A 4B33A 2F3RA 3IR6A 1NIJA 3ZD7A 3GLRA 3IAFA 4UD2A 1XZJA 3DGFC 1PUAA 4IIHA 2GD6A 3OSZA 5CCEA 1J0AA 3BRCA 2HRQA 2X86A 5C8VA 1AE1A 2ATVA 2QTFA 3PLAE 1BVUA 1U9CA 4X60A 5ALSA 2F3QA 3ZPXA 4XM1A 1H66A 3ZD9A 2ACEA 2HK6A 2PS3A 2PL5A 2V5AA 1QR6A 2ANPA 2YNMC 1HDQA 2ZATA 5BMVA 5K01A 1GKKA 3TX2A 3DP7A 1N3IA 4BLSA 3IDSA 1BXGB 4EHAA 1REQB 3F7TA 3A4LA 3QHQA 2CHVA 2F64A 3QY9A 4NAVA 4HDQB 2LCQA 3C39A 3GLFA 4E0AA 3WSVA 4M87A 3TINA 4DWOA 5J2TB 3UICA 5CIQA 3VAAA 3NXSA 4HLUA 3F1LA 1TEVA 1ZOLA 2Q3CA 4MHPA 4R1OA 4NL4H 1FZQA 2ODTX 3OEWA 2OGSA 2DEAA 4S0ZA 3I05A 2HWYA 1YFKA 1ZUIA 4CAFA 2XTAA 2IZ5A 4L9AA 4X54A 5BT8A 4POAA 4RK7A 2WA2A 1AQLA 2FOXA 2HXSA 4YCMA 2Y4OA 5J2UB 2PT7A 4LQCA 4BFCA 5CD1A 4RX1A 3OCWA 2PT9A 1YA8A 1J8YF 1FDOA 1RAIA 2FSFA 5HKLA 4BXOB 4G5SA 4WRRA 2OCBA 3MS7A 2R60A 3N2IA 2PR2A 1W44A 5C18A 4XZ3A 4LG1A 2BISA 4UCXA 3KUXA 3PQ4A 4AK9A 1WSBA 4KVAA 1M1YE 1NFRA 4XYBA 1V16A 1YR9A 4TYNA 2ILVA 2C8JA 3FYHA 3WYBA 1ZUNB 3T3DA 1XD2A 3V8VA 4BOYA 3T1OA 1R1DA 3ZGNA 2JNWA 8MHTA 3TB4A 2H31A 4ZP1A 4CPAA 4L28A 5J4HA 3KR2A 1BQ3A 1G2OA 1KP9A 2ODNA 3GD5A 4QC6A 2HA7A 4G1VA 2B4DA 3FDZB 3GXBA 3SXUA 4G0PA 1EXWA 1KFJB 1JG7A 1E5QA 1EP9A 4QLBA 1DJLA 3MTBA 2WVAA 1K9SA 5TRTA 3CZQA 3O82A 1E9DA 2RFLA 3Q7TA 4E32A 1OWNA 3HRIA 3AFHA 3V33A 4J16C 4DVGA 3N8KA 3AR2A 1O96B 1QGYA 1DHTA 3K0AB 4WNAB 5EJAA 3TLXA 4JYCA 2P27A 4FNAA 4RY2A 4DCSA 4EY4A 1S5KA 2X41A 4ARZA 2PGDA 1I5OA 2Z1MA 1JE0A 2A84A 4I1SA 2G9NA 4MMZB 1QU3A 3DCJA 3EHDA 5DM0A 4XNHC 1DUSA 4E2XA 1PP4A 3COVA 4M3SA 3L5OA 4LOKA 3FCSB 1Y7LA 4Z0PA 2CZGA 3D1VA 3P94A 4B3RB 4X6XA 1ZGHA 1Q17A 4TLDA 3W4JA 1X9IA 4LOLA 4X1IA 3KLPX 1Y63A 4UIAA 3B3TA 1IBCA 1L5ZA 4G24A 1NRJB 2VHVA 3GMTA 4EENA 2FX2A 3D0RA 1C1XA 3GLTA 3SF0A 4D8WA 1MTOA 3B82A 2XMCA 4ABTA 1KHHA 5ITWA 1OX4A 4BKPA 3UOGA 1QV9A 2ZR8A 3ONDA 3FOBA 1A4XA 4BWFB 4BV3A 1NQVA 5EFOA 2GVDC 4LX0A 1SU8A 1MC1A 1CJUC 1UWVA 1NYQA 2NUAB 3GGSA 2H2AA 4QXPA 1TLFA 3W79A 2AR7A 4K0KB 3AUUA 3CVXA 4MVJI 4G0VA 1Y1QA 4NBUA 3ROFA 4WAUA 3FGZA 5KREA 3LQYA 2N3ZA 3HKBA 3ND5A 1JWAB 4MVJF 4NWIA 4QBFA 5TS3A 2GN9A 5K1ZA 4O2BB 3B3CA 4BLPA 5B7PA 1X8KA 1CX8A 3P0JA 4NVRA 1T2NA 2ODAA 2GSDA 3CV3A 3SDBA 1J99A 3DR3A 3NBZC 4X7BA 1F8YA 5JI2E 3LIIA 5FI1B 1FRVA 4CLXA 3ZY5A 2PL1A 1AYEA 4PGMA 3K1TA 2B4AA 1T0BA 3NOOA 3JALA 5BR4A 3Q7PA 1LQTA 2C5AA 2PBFA 1BQ4A 1UBCA 5IBPA 1Q3HA 2IE0A 1EHIA 3WAGA 1B0UA 4RE5A 1VRWA 2V45A 1SB8A 2HH9A 3E4DA 1TOAA 1XYVA 4CG1A 1P17A 3G0BA 2CUZA 1E6CA 2C9CA 4LZJA 3DP9A 1KKMA 2BRUA 1E4VA 1I4DD 1V96A 3L7MA 5B2EA 5CFLA 3CRW1 3NLLA 4FR2A 5G1NA 4OLBA 4FM9A 3W5CA 3CSDA 2I87A 1JKJB 2OGUA 4O4JA 5BY2A 4DQ0A 1J22A 4RGVA 3T0FA 4P4BA 2B1IA 3PG5A 3RHTA 1IB0A 3B7IA 2JANA 4A0GA 3DMYA 1J8FA 1J33A 1KEEB 2WJPA 4GX2A 4L02A 3MWGA 4N7RA 3W9BA 3R5KA 3L7OA 5E3JA 3SS9X 3PPYA 3ER8A 5IZCC 4A91A 4O3FA 1E92A 4TRRA 5FAXA 2WIJA 5T64A 1CEQA 3FNHA 4H1HA 3OZCA 3ADDA 1RBZA 3PHGA 1BXKA 3TSOA 3CX7A 4KITB 1TE2A 3EXFA 2XYQA 4G09A 5AVRA 4YCLA 1EXNA 4AMUA 5A7GA 1PT9A 4EJMA 4NOMA 2XNSA 1JR6A 1MB3A 5JMWA 1PZEA 4KMRA 4I6EA 5K3EA 5DGIA 1NVAA 4ZAFA 3O4FA 2IW3A 2I1QA 1IG3A 2Y67A 1IL0A 3NHWA 3RK4A 4CR8A 2O48X 3TW4A 5J2UF 2XEDA 1WV1A 1XMSA 2E37A 1NW4A 2BI8A 3DKIA 3KR5A 3GRZA 4ZVPA 1VE3A 2XA1A 3M8KA 2FPXA 3NHKA 5T6BA 3C1AA 1DE0A 2OORA 4Z9AA 3O3OB 1KO1A 2BFPA 4HDKA 4WKNA 2QDKA 1DQRA 1AB5A 3ZCQA 4ETNA 3P45A 1C0EA 3QBJA 4MS3B 3NORA 4RABA 3A7EA 4DSAA 2NTYC 4X8IA 5H3CA 2P62A 1DOZA 3PR3A 4YAEA 2PJ1A 3RIHA 4MVWA 3WQQA 1IJKA 2VT7A 4UTVA 2IPAB 2EVNA 2C2XA 1KMNA 1G5PA 4AUKA 1TFUA 2V9ZA 2GHRA 3UATA 5JANA 4BMXA 5G3YA 4R51A 3NHUA 3Q0EA 1DTDA 1EWTA 4WKOA 1N3YA 3D66A 3RHZA 1LTQA 2WKRA 2Q2WA 3R4VA 5TX7A 2P4SA 4LK3A 1J4JA 4OP2A 4IZ6A 1OZPA 2NV0A 2WVGA 4E31A 4EEXA 4I1OA 4N7JA 1NJFA 2I00A 4CIWA 2OVFA 2QPLA 2FV8A 3LXUX 4G5HA 1THTA 2XXBA 1JR3D 2ZOSA 1JS1X 2QJOA 1ZDMA 1G66A 5I8WA 4ZALA 4YECA 4UMDA 2RH5A 2FUG1 1UBJS 4YJHB 4UQOA 4BEVA 4X45A 5EN4A 5ES4B 3TRJA 5K8NA 3AWIA 3S1AA 2P3QA 2PL9A 3BRWA 5JH7B 4HDNA 4MI6A 4YRJA 5A04A 3M5DA 2Q04A 4F0JA 2A0KA 4KL8S 2NO4A 5EUMA 1U1GA 3ZHVA 5KDLA 3K96A 3W5JA 1NG1A 5LNK6 4UDNA 4A23A 1X77A 2V9PA 2EKBA 1SAYA 3VYWA 2E4UA 1Z4RA 3C7KA 1QQTA 2C8VA 4YPVA 3HFRA 3SFZA 3T1TA 2P6NA 3HGMA 3JQBC 3ICPA 1ADFA 4NS4A 4JI7B 4CQLA 2GZ2A 3INYA 1DCFA 1U11A 3FI9A 2O1XA 2PGLA 1G20A 3SY8A 1BS2A 2EKLA 2CXNA 3ZE2B 2PRKA 1ZAYA 2WHYA 1P62B 4PF1A 4PZYA 1NVMB 2FF5A 4QBTA 3I9SA 1EFAA 1X87A 2W6JA 4QNRA 3E3MA 1K68A 1R18A 3FH4A 2FE4A 4LYEA 2X4IA 3PFWO 4WJKB 5JJCA 1CF9A 3IUNA 2FW9A 1ATZA 2DPGA 5EHGA 4DA4A 2BFDB 2ZIAA 1ZD1A 3G1WA 5CA1F 3OZSA 3H75A 2G1KA 1SG0A 3C1TA 4JHLA 1HYBA 2DUNA 3PNLA 5AIAA 4WMLA 2IS2A 4UUQA 2HREA 5TJHA 1QQBA 2HJGA 3OG9A 3MHTA 5B55A 1S1CA 3MWEB 2ANBA 4GOJA 4RTRA 1PD0A 1YNSA 3W3ZB 4JR1A 3H5OA 2BELA 4K81B 5EKDA 5DJ5A 3T7DA 3N70A 2ZVJA 1O0BA 1ZR2A 4PICA 3RYTC 4BLUA 4R7TA 3E58A 1VE9A 4U6NA 1UODA 4YCAA 4EA7A 4HB3A 3TIIA 3A3OA 2IS6A 1PYTB 5FHQA 3HV2A 2QTWB 2C7OA 3G2JA 2XX3A 4BX8A 1FUYB 1Y8AA 2XMPA 2VRCD 2VNJA 2Q4OA 1TK2A 4JFRA 2R11A 2JW5A 1ZWKA 4Y2PA 3ZHBA 3NTVA 2EIHA 2PO5A 4X00A 2A59A 3TVDA 3U4HA 4XWYA 3UJDA 4C21A 2CCKA 4DQKA 2W4MA 4XVQA 1A82A 2ZQYA 5LOVB 2WIAA 4DC0A 5AK3A 3FYDA 5FAKA 2RIRA 5BSVA 4U7FA 3NM5A 5CYFA 4ZCMA 4KAJA 3OMXA 1VB5A 2QUKA 3RFVA 1H8ED 5I7HA 3H2KA 4ZOLA 3ZE0B 3O4RA 1A88A 1B1CA 3HZHA 1I6KA 3SQXA 2I79A 3VNQA 4EL5A 1PV2A 2ID8A 3DCIA 1UJ5A 1ML4A 2YZ2A 4FB4A 4TWJA 1UEIA 3AL3A 1NM5A 2H4WA 2HF9A 3DL7A 4N54A 4OU5A 3WC7A 3KUCA 4LRYA 4X0EA 1IM8A 3TTVA 1E0JA 3DC2A 1JLHA 1ISPA 1GXSA 2JGNA 2FH5B 2QRJA 3KL4A 3CE9A 3IT0A 1GPMA 4GDMA 4OB6A 4I9HA 1E9RA 3D3KA 3DE1X 1YB7A 5K5EA 1H3NA 5E95A 1Q6ZA 4PFJA 2JLMA 2Y93A 2ZSAA 3DZDA 3DBRA 1FS4A 1G5RA 4EG7A 4OHFA 4K6OA 1JV2B 1M6YA 2UZ0A 2CTBA 1M6NA 2PEYA 3WG9A 1TKCA 1E96A 3BXGA 4UU7A 1Z08A 2GEBA 3OC0A 2ZJYA 1RYMA 3PQEA 3AH8A 3JTKA 4EDHA 4TVSA 2BHTA 4I2VA 3S6HA 3DBLB 4MFLA 5LMNB 4I9NA 3BM5A 4YMVA 1RLJA 3GT0A 4H27A 4HVTA 4M1MA 5CB4B 4F4IA 3TTHA 1I1QB 1UK7A 4XH9B 4OXXA 4W8OA 5D5PA 2QVGA 3KYDA 2IS1A 1LI5A 4R1MA 2AXEA 2IXGA 4JYWA 3HU1A 3QVKA 5E0OA 2QT9A 1LTKA 4GPEA 4WLVA 1DS6A 5BV8A 4XX0B 1IBKB 3I62A 1EK5A 4MJXA 1L6IA 5B7QA 5CK4A 4F3KA 5L4SA 1TT5B 3L8YA 4O1MA 3KQHA 1WPGA 3OQIB 5GIOE 3PPIA 4LWPA 5KEIA 1K2WA 3AOEC 2OB2A 3BX1A 4YXWA 4ZT4A 4I3GA 1Q7TA 4FS8A 3FG9A 4R2WA 5IMBA 5DV9A 4R84A 1RI1A 2WJ3A 1DAGA 3KZCA 4XD7D 3R3YA 4IZHA 3P2OA 1K4KA 3H65A 1Z8XA 1G8PA 3LWDA 4WFQA 1Z68A 1WOMA 2C84A 3KQPA 1YJQA 3KBBA 3KKPA 1E2HA 1I4WA 1ZUWA 1B8VA 3S6KA 4BQIA 2FZEA 4KQKA 5KDOA 3TZEA 3RU3A 3WYDA 3BFXA 1PSDA 4JQYA 4DMHA 4I4CA 4FFVA 4E6PA 1RWBA 4PR3A 2R7MA 2RHLA 4OQZA 3M4JA 3A05A 4OAQA 2DOKA 4ZRMA 1F5NA 4KOTA 3QX9A 4AZ0A 1AKYA 1YBAA 5A4KA 1TZ2A 4WOCA 4ON9A 3O92A 2VP4A 2C2KA 3RS5A 2OHHA 4P84A 1INLA 2B5GB 4M6WA 5CLFA 1CUDA 5K0EA 2JEZA 3FSEA 1BZYA 4PZLA 2AC4A 2R1UA 4TTTS 4WKBA 3DV9A 5EKSA 1K2VN 1H9BA 3GZNB 1YT5A 3AERB 2NW6A 1NF2A 4D98A 2XKKA 1PJSA 3REQB 4DDVA 3OT1A 1PN3A 4MUKA 4QVIA 1GAXA 1ZZGA 3LT4A 2QLNA 4O4LF 1N9GB 4XGKA 5A1JA 3DFZA 4V0KA 1GZ3A 2CNOA 3EZ9A 3K6KA 3DOFA 4EO9A 3KSUA 2UXCB 1ND6A 4HYYA 1OZFA 1GZ5A 3QXSA 4DZRA 3BGOS 4D5GA 3JUWA 3DFKA 5BVGA 1D8AA 2JAXA 2Y2VA 5HGXA 3STVA 2GUGA 4G0XA 3KIPA 2FIAA 1L5HB 1DNPA 1GQ2A 4JBGA 4CV3A 3JZIA 4IEFB 2AGVA 1T6BY 3HY4A 4IIEA 4B79A 2Z3OA 3L79A 1DIRA 4XD2A 1HE2A 2PPVA 4IDEA 4FNOA 4ZJUA 1E3DA 2Q1XA 1NXVA 5JZ9A 4HSEA 4F3YA 3Q72A 2IIQA 2LIPA 3IJ5A 4XRRA 2PKQO 2JGAA 1DRJA 2EJUA 3QKSA 3S2EA 2Y0PA 2CB9A 4CLRA 3K1JA 3C3JA 1ZLHA 3NH5A 3FZQA 4MCJA 3BXMA 4DR4B 3Q8XB 4AL4A 2P8SA 3CLKA 5KDDA 2GBIA 1FLAA 2QUJA 3HJGA 3VMFA 3W8FA 3MFQA 4NS1A 4TSRA 5DM1A 1AGPA 1Z0AA 2WIDA 2JAPA 3QLUA 1OD6A 1IZ7A 5C1PA 1THMA 4ZO6A 5I6DA 2BBWA 4JP8A 3H42B 3BCHA 3K92A 5TPWA 1GSOA 4RN7A 1NP3A 3A26A 4MUIA 5G0WA 5D01A 4ESEA 3C3MA 4WN9B 4BWYA 2VQ3A 4F60A 4PGAA 5ED4A 3ADPA 4PIPA 1C3OB 2YVLA 2JHPA 4P4SA 1CD5A 2VP6A 2G6TA 3L3BA 5MGNA 3DBOB 4HHEA 2XEFA 1D4AA 4FCTA 3OQHA 4X41A 5E96A 1Y4ZA 2VJQA 5C8DA 1II8B 2EAUA 3KKKA 2XCIA 2ENWA 1RE0A 1V1RA 1P1HA 1W93A 2Z8ZA 1YW6A 1KUXA 4L2IB 4DNPA 3V4LA 2XRZA 3WWZA 4EHLA 4ZYYA 2GAFA 3GUCA 4WUVA 4ZREA 3WISA 2FN8A 1SC6A 2VO1A 2XV1A 2I8CA 3GG2A 4F9TA 4B13A 4WXHA 4OYHA 2AN4A 2CLIB 2Q62A 2VTDA 4TXHA 3DLAA 2C0CA 2NQ8A 2AZ4A 4JWPA 5IKMA 4QXAA 4R7GA 2JIRA 3VR1A 1FJXA 2D3WA 4U2BA 3EUEA 3OZGA 2EJVA 3MWYW 3TLGA 4C6SA 5IARA 1SC3A 4B4WA 3R6TA 1V1MA 2FWJA 3KEMA 3GLIB 2WWGA 3S9LA 4Q39A 4XI9A 3F3SA 1HYEA 1NN3A 1WPXA 2HBZA 1TYZA 2AW3A 1V5EA 4D4HA 1HX7A 5L45A 1IOWA 2YYAA 5LVAA 3CTMA 5ELLA 3QJYA 2QQ0A 2GMWA 1XR3A 3D1LA 3QWFA 2NXWA 4Z1MD 2ZZMA 4DUKA 1SXJC 4C7OB 1GFIA 1Q95A 3EFBA 3EGWA 2JJ2D 2Z57A 1PUJA 5A0FA 2JJYA 1M0EA 3WI7A 2ZGVA 3N6VA 1SN7A 1T4CB 4K28A 3DEIA 4C7HA 2PSWA 4N3CA 4ZYXA 1E3EA 2OFWA 4LGCA 4YN3A 3DLTA 4URWR 2EBUA 1AQIA 3IKTA 5FPHA 2PUWA 4D4MA 2GEKA 1UBEA 3ACCA 2XT6A 3F5BA 2G3AA 4MCRA 5L7TA 1JPNA 2XIJA 3OJCA 4TXLA 5B36A 1I1NA 4IH9A 1JWLA 4N47A 1RAFA 3MM4A 5NLLA 4GGPA 3QUTA 1E5DA 4KMSA 4LPKA 5KOJA 3O8CA 3JWIA 4IP0A 4QEZA 1RRFA 2W8BA 4AP6A 2J5BA 1T1IA 4EYQA 1MN6A 3VPAA 5BR8B 3AP1A 1ST3A 3CDXA 3AK4A 1VYTA 2C31A 1B43A 4JVLA 1NQOA 1XU4A 3PGKA 5MN4A 2FT0A 4IQGA 4NPHA 2P7HA 3VYSB 3UENA 2WICA 4Q9AA 4HV4A 4FFMA 4ZMSA 3SHOA 3P9PA 3SDSA 2AOTB 1W5SA 2Y0CA 4ESOA 2R1TB 1LWNA 3BFJA 1C29B 4CDGA 1ODIA 2A5YB 3MS4A 5HW0A 3F4BA 3OX1A 3O1IC 1UMBA 4R81A 3TOZA 2IYNA 2GJ4A 4MHZA 3H9GA 5JOQA 2IEIA 1HWYA 1CZKA 3ZK8A 2Y1EA 4EO7A 1G42A 4GPIB 4JCCA 4B85A 3EXEA 3P9ZA 4MQEB 5FOUA 4UNSA 3WTCA 6ABPA 4IIYA 3LUHA 4NLLA 4M1QA 4L4UA 3MRVA 4WA8A 1LQ2A 2ZW4A 2QUZA 4QATA 4FT4A 4WN3A 1QQ7A 1RKUA 1GNPA 1R8QA 3LA6A 1V7QA 1PL7A 1KAHA 3WDLA 4KV9A 1KMQA 4P4NA 1DAFA 1GRRA 5CLLA 4J6FA 3IQIX 5AK4A 4IRXA 3TWOA 1W52X 2CV1A 3P0FA 3GBVA 3T12A 1E2KA 1SCNE 5LPNA 1OLUB 3BDIA 4PYMA 1Q12A 1HYQA 5KX5B 5EMMA 2RDMA 5J5AA 4YDHB 2J5RA 4B8WA 2FPSA 1KMHB 2IU0A 2WZCA 4CPDA 4JP2A 1WO8A 1XRRA 3H1PA 1M6VA 3PP8A 1VG9B 3ICEA 3U4QB 3I39X 3ZDCA 2AFVA 4KIJA 1JDTA 4PC7A 7MHTA 3IRVA 2R751 3E9YA 4M1EA 1JR4A 2BR5A 4U2GA 4QAQA 1HO3A 4MP3A 2I2AA 3FBUA 2GZ3A 3AJDA 3RYFA 1M3SA 1SKAA 3NCHA 3CTPA 1O89A 4Z7QB 1Y3FE 1IUOA 5JNLA 4DJFC 5D3ZA 1ZAKA 2ONYA 2DWOA 1MDBA 4G37A 2JCYA 2IHNA 4RIHA 3STXA 3R8CA 3UMYA 4NTZA 1K8QA 3IKMB 1COWD 3DL0A 1JN0A 2QXTA 1QKIA 2ZUSA 2W2LD 5K3SA 4LJ5A 3GAZA 2JEYA 3AF6A 3H6GA 3IAEA 1O3YA 1AS2A 4PZDA 5DP2A 4FGJA 2F5IA 3QEOA 1S8OA 1E7YA 1WD5A 3KSZO 4GO1A 1LCPA 3MZ0A 4MA0A 4DSOA 2O4HA 2BEUA 3K9QO 2RGDA 1E89A 1GAQA 1VPLA 2REEA 3B1ZA 4P9NA 3KHUA 3TTYA 4D9IA 1XMIA 3KYCA 2C58A 4IEIA 2OP0A 2X14A 4L8AA 1VJ1A 3I3SR 2XBUA 3IT3A 2NVBA 3PRKE 5D5QA 4FMCB 5JAIA 1RQGA 1E4YA 3OEEA 3C15C 3RKSA 1IULA 3NHMA 4I6JA 1OXMA 3CT9A 3NVMB 5TXGA 3VYUB 4BNTA 4MSUA 2HQBA 1VYUA 3FPKA 2GEDA 5CFNA 3CY6A 3CUVA 3NRCA 4D9CA 4XUEA 3O1HB 4YLYA 2K7ZA 2I2XB 5DYGA 1LX7A 3VH3A 1V3TA 3KSDO 4EJ6A 1OZ0A 5DB4A 1WHSA 3NJ8A 2MU1A 2I54A 4AXXA 2CNBA 4D1YA 3ABSB 1KDZA 3HXQA 5ADVA 2EFGA 1DQYA 3LHDA 3I04A 1HFWA 4UUBA 1RP1A 4XA8A 1J39A 4HX9A 3NNSA 4NKRA 3EVTA 4QFCA 1KKUA 2GZRA 1WCIA 4DLXA 4W99A 1NVTA 2HK7A 4B6FA 4FD7A 3BTUA 3R5TA 3BF7A 3C6XA 3DLPX 4QTYA 5EGSA 2EWVA 1QZXA 3IJRA 4HTFA 4URZR 4CCWA 1ODCA 3IU2A 3ICCA 2XEGA 4EZBA 1Z0FA 3DGVA 1Z36A 4EYSA 4MR8B 3PHJA 2VHUA 2GERA 1W19A 4BATA 2CUNA 4RM2A 3R77A 1OI3A 4G67A 3VR5H 3IE2A 4AZWA 4HNSA 4CM8B 4XWAA 2HM7A 2GK4A 2VF8A 3DAYA 2O0JA 2H3EA 1ARMA 4G2NA 5IC4A 1O6GA 2WV7A 2AEMA 4JLJA 1LPPA 3OOHA 5E7MA 2BY4A 3QKRB 1QP4A 4C0LA 5CVVA 4IJVA 1TKRA 2A88A 2ZAMA 5K0CA 3IAAA 4MW9A 3HUUA 1J2YA 5IKPA 1Z29A 3PHCA 4YT5A 4C22A 3VZBA 3DO8A 2NPOA 2YHUA 3HKCA 3L7BA 4ZQEA 2JS7A 3VZPA 3EGEA 1ZWLA 3LX6A 1DAIA 4GZ6A 4FN5A 3BILA 2F3SA 2WDZA 2JRLA 1ZD4A 1M0WA 3UCXA 5LZ5A 4MDHA 2ARHA 1C4WA 3GVIA 3R74A 5ICMA 2WYVA 1R16A 4MR9B 1XLVA 4KQGA 1P8JA 2AKYA 1SOWA 3EXG2 3AF3A 2ZJOA 1VIMA 2XNCA 1R0LA 1I94B 4DCJA 1Z5WA 4YP0A 5F2KA 3GGPA 2W6IA 3HA2A 2BAGA 1Z83A 1M9NA 3CIFA 2EBJA 5DK6A 4FD6A 2PUCA 5K0BA 3K70B 1Z88A 2ID4A 3OAAD 4IDQA 1UDRA 1SHJA 5AVTA 1M34E 1AGYA 2YRFA 1UT5A 4A92A 2I6QA 4ZK6A 4FYHA 4BGEA 3MT8A 3PEUA 1SBTA 1YNOA 2R66A 3SZMA 4BX2A 5D3QA 3I9OA 3TZCA 4MFKA 4OMDA 2PSFA 4PE5B 4D8UA 1SULA 5A9SA 1XA3A 1PG2A 3SKYA 2OE2A 2IHUA 3AUFA 3GLUA 3K16A 4UU1A 5FOSA 2G8LA 3PQCA 2ZQZA 5EPUA 3I9KA 3TXAA 2R5FA 3WWPA 4EECA 1I10A 3QVTA 1MO4A 2QX7A 3V4SA 1CS0A 3DWIA 4G4SP 4RTOA 3DZGA 1M5RA 2IX3A 3FUWA 4QXQA 3SHQA 3W3AH 4JJKA 3HJAA 2FMXA 1JLRA 2FR8C 4TNUA 1B8NA 5IP5A 1CHDA 2Z08A 2AG1A 3OTIA 4Z4CA 2BOVA 4Y6PA 1F2VA 4EF4A 5AUPB 4AUEA 3QVGA 1YTLA 2A57A 1GCGA 5JY1A 4Z2YA 4G36A 2IDJA 2RBKA 2GCEA 2VRBA 1DSSG 3I6IA 4MQFB 3UCFA 2RI0A 1SM4A 4D0GA 1T5LA 5CNIA 5DWMA 5KTMA 4WBSA 3TOXA 3N5FA 4FOLA 1P29A 4MW7A 3C74A 3ZHSA 2O2SA 2E6UX 3N1UA 3AJAA 4FMDF 4DV4B 5BN1A 2R1IA 2PH7A 3FZNA 4QG7A 5CP8A 1BOFA 1SXIA 2GIVA 2PIZA 1B42A 2OXTA 4D02A 2PKXA 4CLEA 1BKDR 1HPLA 1DAMA 1IN5A 2ZRNA 3TX6A 4HLQB 3NTUA 5TQJA 3REFA 4BP9A 2WZBA 1GZ7A 4UEQA 3RUEA 3WK8A 1PT6A 1QYDA 4G6ZA 4MPDA 3KSAC 1FW6A 1IWOA 3K73O 1G18A 1XD8A 2ZDGA 1QORA 2YOHA 2YQ4A 4Y49C 2VYCA 3Q7IA 2OOSA 3HPQA 4CG3A 3SR4A 1KAGA 1V9CA 5EEGA 5CH5A 2G5PA 3SXNA 5LC1A 1MABA 221PA 2CJWB 1T9AA 5BYKA 1OPXA 2CDBA 3IXMA 4Y1RA 4FHGA 1XJQA 4LYDA 4P4TA 1NN5A 3KAQA 1J5XA 3E9QA 2P6MA 4U63A 3K9HA 1SOUA 4E8OA 4ARCA 3ZQJA 4KXUA 1RMTA 2C5GA 4BMCA 3B60A 5ECWA 3ZWQA 1J2JA 5EC8A 2P3LA 3B1FA 3WLHA 1S2OA 4CDNA 1F2PA 4A95A 5AVSA 1N4AA 3UV7A 3LF1A 1H23A 3FVQA 3COSA 1T0PA 4ZK2A 4Y49B 2XYRA 5KMGA 1PS0A 3EIWA 4Z3OA 4LAFA 1N2OA 5L6MB 4Z2AA 2OXIA 1TRKA 1P2SA 1CQZA 1XBTA 1ZYUA 2FETA 2WD7B 1J2RA 3RG8A 1PSWA 1WXIA 1WW2A 4U2KA 5C3UA 5KWEA 1MJFA 3D2MA 3PX7A 4OTZA 1TUIA 5ALVA 3U62A 3WQRA 1G1AA 4DIFA 4O4HF 3NTXA 4UE2A 5HIJA 2O0LA 3NPAA 3HYRA 2C6CA 4DBZA 3ZWYA 1KEZA 3M33A 4DMUB 3JTMA 1CUEA 3AIKA 3H1AA 4ERXA 1HC7A 2ERXA 3T7AA 4JDUA 3LRPA 3I4CA 3VJKA 3HB1A 3CH7A 4PZAA 1FFXB 3EIXA 4IQ0A 1QG0A 4LXQA 2WMOB 2ROQA 4FJ1A 1YVKA 1KY2A 1YUMA 1S2NA 3I45A 4MHSA 3IDOA 3WJ7A 1GFWA 4XQEA 4Q1BA 3PUVA 3WOVA 1G16A 4QAJA 2B8JA 2FLKA 2NU7B 1NVWQ 4YRBA 4U3JB 3WK7A 5HTKA 4UUNA 1YZYA 1KZYC 1OU4A 3MRTA 2ZIZA 4AM8A 4EGJA 2XUGA 2PUGA 1UJ2A 5EBVA 4YIKA 2CNWA 1C30A 3F0AA 1N2CA 1JQEA 2BM1A 3NDBB 3FPFA 3PHHA 3PGMA 4BMPB 4I19A 3T3OA 1NNLA 4QDKA 4CKEB 1TQ6A 1ZLIA 1YZGA 4L75A 3DAGA 4NGMA 1RIFA 4OI2A 2CFOA 3P2FA 2F48A 1PJBA 4YGOA 5CNJA 2JHGA 1YIDA 4GXRA 2FPIA 4RA6A 4AWXA 4P08A 2YOGA 3BD9A 4M38A 1YIOA 2ZJ1A 4CLOA 1MA3A 1XNHA 2ZYDA 2FL4A 2BGGA 4EL0A 3TPFA 3R7DA 4DQUA 5G4KA 5CLJA 1N3BA 1GPAA 5BVHA 1MW9X 1QK3A 2OSVA 3N8GA 4HQLA 4LFBB 3FNGA 1RLUA 4KLCA 2DU8A 5ITZB 2VYNA 4DYDA 3TFYA 3M7IA 5FUQA 1IQRA 4W9NA 3QFCA 3QHAA 3ZJ0A 1A4IA 3RC9A 3B3QA 4MVJM 3Q3GE 2A4KA 4RF5A 1JPJA 2EBHX 3IP5A 1QC5B 4ZGGA 2RB7A 2ZBEA 2HOQA 1Y34E 4DS3A 3WLQA 1ZN8A 3H9EO 3PFNA 4MWZA 2GPAA 3Q12A 3CONA 3IUSA 1CQWA 4YB8A 2WJ4A 4JJZA 3GQVA 4CDRA 2PX2A 3BXXA 2OQIA 5JD3A 3ESYA 2WUUA 3L4SO 5CFPA 2VA8A 4L4YA 4E4YA 3LWUA 4EKDA 3LW7A 2FEKA 2PE3A 3G5LA 4X1YA 3F9RA 2J9GA 3T3MB 6CPAA 3AJRA 4IXTA 5C5EA 3G2KA 3WYFA 1PJAA 1GILA 3S6GA 1KHTA 1GR0A 4P44A 2J8ZA 4U8HA 4OOEA 4DA7A 2QPTA 1SWVA 4G5OA 4LC0A 3OCUA 1EGHA 1NT4A 2IODA 3UOAB 4N9QA 1DXYA 4IYRA 1YBMA 1D6JA 1V5FA 4D4GA 5TQ2A 1QMPA 3IT1A 1KI7A 2CUTA 3VNRA 1L5NA 3F1KA 4XQ9A 2I2FA 2VZ8A 4JXXA 3K0FB 3VBEA 3C85A 1TMOA 5AWFC 3OEHD 3EPPA 4RPCA 4QUJA 1G5FA 2QIRA 5T3YA 2A9OA 3DZIA 3W6ZA 4AXVA 4D8YA 1KQ3A 3DQPA 3GLFE 1TF5A 3KSMA 1ZXXA 3AJ9A 3JQGB 1KOFA 4BFZA 3NHJA 2RK6A 2JBKA 3A7DA 3LCVB 4NCKA 5DLDA 3S3TA 4FZ3A 3W8NA 1GGJA 5I3ZA 3LLMA 4Q37A 2H51A 1JSXA 4ZGWA 1NHGA 1LPNA 3DVRX 4NRDA 1Q0HA 5DNCA 1PDOA 1Z18A 3EVDA 3GEPA 2OXFA 4BX9A 4R2XA 5KNDH 5B2ZA 4C7IA 5DT2A 3S2SA 3UK2A 2QX6A 2BKEA 1P60A 3TFWA 5FV7A 2W7TA 2RHMA 3HYLA 1T25A 2B20A 1KPGA 3V8PA 5EIWA 2UYGA 4EY3A 4R7ZA 4LX8A 4OAOA 1PL0A 3ER6A 5EJ9A 2BFFA 1NW9B 1BHO1 3I0NA 1DBSA 4UEOA 5C1OA 3GJ8A 3LKDA 5JXGA 2AN3A 2PH5A 1R8SA 2DPHA 2B8WA 2VHXA 3WQHA 4C7JA 2DE0X 3D43A 3M5WA 4PEVA 2X15A 1ZXBA 3QOYA 4UHBA 1P75A 4DNQA 3I61A 1NI3A 3SFVA 2DPTA 3D7NA 3KAKA 1NLZA 3H05A 3KOXA 4JUIA 4V38A 5JJLA 1KYQA 5CA1B 3A06A 3SMQA 5CX1B 4D74A 1C0IA 821PA 4OJTA 4FQ7A 4XNHB 2QJRA 1CZNA 4J1QA 4RC9A 3E1KA 2XT9A 2WAOA 2IUFA 4I1RA 3DAFA 3AESA 1TA4A 3MHPA 4UZSA 4HAIA 4ER6A 3HHEA 2I55A 1FDTA 1QHYA 2IKQA 3K9UA 1EBUA 2QL9A 1S7FA 1LPSA 2QAIA 1E2EA 1YHYA 3B9RA 4TX1A 4TKVB 4AJIA 4A16A 3NIFB 4G8BA 3AIMA 2I2BA 1E7RA 4GXTA 1YDWA 2GD1O 2QNBA 1ULBA 2VHWA 5BN5B 1NG9A 1N2IA 1NFFA 3EIOA 1AO3A 2CF4A 1UBOS 4B81A 3QU9A 4QQFA 3JAKB 1N8NA 1YB2A 3T7IA 4LF9B 2P67A 4B4UA 2YN2A 2V8GA 3EC2A 3HXPA 2HL6A 4PW0A 3VR5D 2Z6UA 4F06A 5IK2D 5L4LA 2QVPA 4MUBA 4O8CA 4LQ4A 3DE4X 1N0VC 2C0PA 3HCEA 3FOCA 2BUAA 3T1NA 4UEWA 5HIMA 3O9ZA 3ZXUB 2C97A 5TGTA 1RM3A 4R54A 1R3DA 5AICA 1KP2A 4P3XA 4PLFA 3UUWA 3O1JC 4XLTA 3E15A 1QSTA 4TTSA 4PWZA 1G8JA 3L92A 2ECPA 5DWQA 4Q12A 2QMHA 4ZT2A 1P80A 2FSGA 4QUKA 2XCUA 4Q4AB 5UKDA 3NHBA 5BUQA 4OA5A 5A4DA 3QFHA 2CNNA 1Y6RA 1R6VA 1F8XA 3R3SA 2TMGA 1QH1A 2E5FA 5H8WA 1Z75A 4I4TA 1EIZA 4ZQBA 2BCJQ 2CLDX 1CF4A 4P4EA 1E4EB 3ME5A 5E9QA 2X1VA 2XUOA 3ND9A 5FTLA 2KCWA 2YUTA 4NARA 5JFGA 4Q1EA 2O2XA 2XEXA 4YJGA 3B53X 3EZ7A 3ZXYA 3CFYA 2CL0X 3ZNOA 5K6AC 4JB3A 3B89A 1EYZA 4RZ3A 1JQDA 3KASA 4HH4A 5SZJA 1Z74A 3HY3A 1DDGA 1M2VB 3A9RA 1II0A 1A5BB 1VBNA 2CHGA 5CG1A 1Z33A 5HF8A 3QG1A 1XRYA 4YWYA 2N9UA 3WA6A 1OROA 2QD3A 3BHIA 3IR7A 3DDDA 4H6VA 4FD2A 5CLGA 2AJTA 4TS4A 4XEHA 5J5CA 4QYSA 2H65A 4LHSA 3IAS1 2WTAA 3ER9A 3VX4A 1UC8A 2COKA 4H77A 1NF9A 2DKFA 5IJ0B 3W3AD 4X64B 4DCPA 4EA9A 1RAAA 3RDPA 5E3IA 1ULSA 4B44A 1V26A 8ADHA 2YJ5A 4FAIA 4NOJA 2VH1A 3OY2A 2MSWA 1E5VA 4PYLA 4L78A 4KPYA 2M6KA 2J32A 5EAIA 5K6TA 4OQPA 3K7EA 1PGPA 3JQ9C 2OGWA 4G85A 5FWNA 4CR7A 1G55A 3ZZTA 5KJ6A 2KW5A 3QEMA 3OWOA 4UDOA 4GI7A 2ZE8A 2IU4A 1S7NA 3KTOA 4NYIR 5G2OA 1QZTA 1YQDA 3V4OA 2ILTA 1E9CA 1YC5A 2J4CA 5JPCA 1SVWA 1BU5A 1QPBA 2AC2A 4LDQA 4OUDA 1CT9A 2Y0MA 3FPEA 1OX6A 2ZIVB 3ESAA 4IWYA 2JA1A 2GAOA 2ZJ6A 4TQAA 5NULA 3E0XA 1QS0A 3O5AA 1WUKS 4PU0A 3D1JA 1UFVA 3LOQA 4AJPA 1B3RA 3WRXA 1ZM4A 4F0YA 5HQ3B 2ZJ3A 1M2WA 5FUWA 2LXNA 3L7YA 3ZDEA 4N5NA 4EHKA 3ICWA 3BD6A 2XUKA 5HIIA 3HUFA 5KI6A 2QTZA 2DFTA 4KKVA 1ZMBA 4PHCA 2QLJA 4HYQA 3L6BA 4O0MA 1S3FA 3HJBA 4EB6B 1FL9A 4FEAA 4CWAA 4Z4EA 1AZWA 4OC4A 3JATA 4JODA 3E0QA 2G0AA 5DVZA 2DCUA 1IU9A 2J41A 1O97D 2NZXA 1C1YA 2JK0A 2BV3A 2FPMA 3I37X 4XSGA 4MV9A 5HK8A 1J21A 4OHXA 1E9EA 4O4LB 4R05A 1NC3A 1QIKA 3C7AA 4CS0B 4GZ3A 3IB6A 2QD1A 4B09A 3B9PA 3AKZA 4UWIA 3PS9A 5KTNA 2QIPA 1VDZA 2EWMA 5AVVA 1IUKA 4F2WA 2C9MA 3K35A 3LV8A 2JCBA 4JI3B 3KQQA 1KERA 1Y7HA 3ABQB 1OZAA 2POKA 2JAHA 5HKAA 1OKKD 1U8ZA 3R0JA 3G17A 3G3EA 4N8SA 4EHNA 4PXAA 4OC3A 2Y1FA 4FUUA 4GSYA 3HN2A 3KLBA 5B4VA 1Y6QA 1HR0B 3G0DA 5HKOA 4DMGA 5JADA 1IPHA 1QYRA 4IDHA 4QQ8A 1E3QA 3RF7A 1GSHA 1QTRA 4EGFA 4QWWA 3AGQA 3PSAA 1WXWA 4ROSA 2PVSA 3JARB 4MBUA 3OKPA 1OH5A 2F2TA 2QMEA 4JIMA 1NBEA 5D3MB 1U3FA 1QZ3A 2PLNA 1NVDA 4KLRA 1S2DA 3L7NA 3SSMA 1D6NA 1QIJA 3EEBA 3PDIA 1G20E 5EPOA 4E94A 4UNNA 2YV2A 5BXQC 1KAOA 3OQVA 1ZMTA 2I76A 1GHTA 5A4AA 3C70A 2GN4A 3FZEA 4BASA 1Q1BA 2BFOA 1X1RA 3ET5A 4WZAA 4GVPA 3A9LA 4JOCA 4J1NA 1FNCA 4IXWA 3FJ1A 3F8WA 1I7LA 4U8GA 4YCCA 2PC1A 2IEAA 5CGQB 3UAGA 3H5AA 1LDYA 3FGPA 4H6WA 1JVNA 2C77A 4K8OA 5DI9A 2ALJA 3QI7A 2F4VB 2OCLA 1PEAA 4I8DA 4WHMA 3QF7A 5K8JB 3U44A 4KJXA 4EB3A 5IASA 1WZEA 1A7KA 2X1LA 4WCVA 5FBHA 1CY7A 1Z4PX 3Q3HA 4HWOA 3HFSA 1XMJA 1XZFA 3W6OA 2PRQA 4PSXA 2H1WA 4P4GA 4BDTA 2UYHA 4DDKA 3FSRA 2NUPA 4TTJA 1O1YA 3OIFA 3VR3D 2PH3A 2I2CA 2I99A 5BV7A 3O3CA 2UYCA 2CV2A 3WE7A 3KPYA 1J1UA 3GUYA 1P81A 3QLVC 4LMRA 1AMOA 1EWQA 1QIMA 5F23A 4LHEA 1QSNA 4E7PA 2D6FA 2FOLA 4BO4A 4JUAA 2OQRA 2OC4A 1BJKA 4D41A 1SC1A 1GN8A 4WLUA 5INTA 5TF0A 3RUIA 3IFEA 3NALA 2BLLA 4RK4A 1Q2UA 4M88A 3KB1A 3FYNA 5IT0A 4UWJA 1GV1A 2W2PA 3CVJA 4MKZA 3ZS8A 3UW1A 4DMLA 4IHJB 4J4TA 4NV0A 2PR1A 4M53A 1RPJA 3GCXA 7GPBA 2DFPA 4CYMA 1W29A 4ZXPA 4C3ZA 2F59A 1WAMA 1JXOA 2BL4A 1GG2A 5KO2A 3WNBA 1W88B 4CM9D 1SVOA 3OT4A 2I80A 3ZCUA 3NHPA