2GFQA

Structure of protein of unknown function ph0006 from pyrococcus horikoshii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
288
structure length
288
Chain Sequence
b'HSSGRENLYFQGHMKVIMTTKVDKASMNIMNKLIENFGFKETEYVFEGNPVYKRGDVLILTTNDEMIYYDYLDREIENQLGFKPEIIAFASRHSSKQKLPALTTHVTGNWGKAMYGGKDESFAVAIPSAMKLSLLKMSELNDLGWTVCYEATHHGPTELEVPSFFIEIGSSEEEWINDRAGEIIAETIIYVLDNYEKGRSKFKVALGIGGGHYAPKQTKRALEGDLAFGHILPKYAQPVSRDVMIKALNRFGEKVEAIYVDWKGSRGETRQLAKSLAQELGLEFIKDG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0204 protein PH0006
publication title Structure of hypothetical protein ph0006 from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 107
structure length 288
sequence length 288
chains with identical sequence B, C
ec nomenclature ec 3.1.1.96: D-aminoacyl-tRNA deacylase.
pdb deposition date 2006-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04414 tRNA_deacylase D-aminoacyl-tRNA deacylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold AF0625-like 2gfqA02
3.40.630.50 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase AF0625-like 2gfqA01
1YQEA 2GFQA
chains in the Genus database with same CATH superfamily
2CZGA 2GS9A 1CUWA 1Y9AA 4PHGA 1K3UB 4CTJA 4ASUD 1NXSA 2HF9A 3ZKAA 3R8XA 1ES9A 1R8QA 1ZXBA 4QGSA 2EWMA 2F1KA 5IXSA 3A10A 5I5EA 5JD4A 4WJZA 1RXSA 4TM8A 3QVXA 4M0KA 4I5IA 4TL6A 2R6CA 2VH5R 5DNWA 1V96A 2R7NA 2IT1A 3ONNA 4OJNA 1V6CA 1CVRA 2RGBA 4Z0HO 1D2AA 1JHAA 1T1JA 1YZFA 2J9GA 3F4BA 2HSZA 2P2GA 4UHFA 4ILKA 4OV6B 1E6LA 4ONUA 1QH1A 5B3KA 2QKYA 1Z4LA 3OPVA 3WWPA 3QF7A 1WDTA 1VCHA 2H2DA 2BP7B 4TSFD 1JDVA 4MV6A 2I03A 1SQFA 3BIWA 5DRTA 2WVJA 3ZEAA 5AG6A 2ZVPX 2ZZNA 3K1TA 3DL2A 2C7QA 3USZA 2I3BA 1HUQA 2GRUA 1JI3A 2H7YA 3T94A 3VR5A 1GSHA 2BGMA 5LP6F 1IOVA 4JJEA 3MB5A 1ZD4A 3KSBC 4FNMA 16PKA 4M22A 5BT9A 4O2LA 4X6LA 1YL6A 3E5MA 2AFUA 5C5CA 1I2MA 2GKGA 1I33A 3AP1A 2JFPA 3TDMA 1W1WA 4A0HA 5LXTB 3OJFA 1QGOA 1MQSA 3ORSA 4I66A 4LMPA 2OEPA 4R9NA 1TAGA 2UVPB 3U6BA 2CXSA 1E6CA 3BG5A 3EZ9A 5KU7A 1E4EA 2ZQ5A 3BTUA 4K03A 5ESDA 3OLZA 1DEXA 3IQGX 2PL9A 5CU7A 3V48A 1YBFA 2YW9A 1G7CA 4KZPA 4MYRA 4W8OA 3WGYA 1EFCA 4UVEA 4QATA 3AVVA 4AB1A 3NIWA 3LMSA 5CNMA 4TMVA 3KZ1E 4PC6A 3WQRA 3ZQKA 5EKXA 3ZE2B 3HVUA 4B2LA 2QTAA 3N2ZB 4HDRA 4EUSA 3S2YA 4IHQA 3E18A 1DX6A 2GK3A 2ZBQA 2QAJA 1MOPA 3EIHA 1QB8A 3AJEA 3PLRA 3TLBA 1PN3A 1I80A 1BKDR 4URFA 2NU8B 1HDZA 1IXYA 5LB2A 1HFEL 3DZHA 1QH8A 1U0SY 3IQXA 2PRYA 3TUZC 2IGBA 2ODAA 3PGA1 3DZ8A 1IEWA 5DNVA 3NFZA 3EOBI 2VATA 2NZWA 5A9TA 3G13A 4KPFC 4NS1A 1EHIA 5KJ6A 2BFBA 3FIXA 1RWPA 3PB7X 1IY2A 2X4DA 1TAHA 3C3MA 4C76A 4I9UA 3I4FA 4PFSA 5HZKA 4R5HA 3NTRA 3W06A 1X7ZB 3ZXSA 1E60A 3ZJ4A 2HWUA 3WNQA 4RKRA 2C61A 3GXBA 2AFSA 3BGOS 3OCCA 2VZEA 3VR4H 5IHPA 2VNJA 2XUPA 3SZRA 4ZODA 1ZO8A 2Y1OA 4PHFA 3SJBA 2XZOA 4UHEA 3KQNA 1GSIA 5DN6D 2JAUA 2FW0A 4D9BA 1GU1A 4BEBA 5EIXA 4FW9A 3RGWS 2JIBA 1T4CA 3L7AA 4GMGA 1W0KA 4YBRA 4EMEA 3M1AA 2KSQA 5JCXA 3NNDA 4GECA 1K6JA 3UM9A 4JODA 1DJMA 4EHLA 2IDMA 3ZWBA 4JZYA 3DV0A 5MN5A 1UBLS 2DHCA 2INGX 4MFPA 4K6OA 2R6AA 3VA7A 1UK6A 5A6SA 3ONWA 1G18A 5LRGA 4HYTA 5DGIA 3KASA 1LRJA 3C3EA 1B73A 4RCZA 4XEUA 4LDJA 5AVVA 1O94C 5GV8A 4UU0A 4MDHA 1T4DA 1ODIA 2ORWA 3GOHA 5FHQA 1GCGA 4IRXA 5LYYA 2HT6A 2BRUC 1VPWA 3F2IA 1VE5A 3J7AC 3B9QA 1THMA 5EWMA 5M29A 4Q7QA 1J24A 3EIQA 2HF2A 1Z5VA 2J0UA 3CZMA 4G85A 1WABA 1WXGA 2PUCA 4ZC1A 4GMKA 4JL8A 2Z4SA 3ONEA 1DBRA 4N41A 4BXOA 1A2KC 1BG6A 3CS3A 5EJFA 1YQDA 1OY1A 2VKTA 4L3VA 3ZIAA 4IIJF 4AT1A 1W46A 3L6BA 5DEOA 5AW8A 4CXMA 4I5FA 2G9DA 4HO1X 1G9TA 3SS9X 1DJNA 1XKLA 1OOEA 3AINA 1P4NA 1V8BA 5LWQA 2XGGA 1MC5A 1Z0SA 1DIHA 1J4AA 2HRBA 1KO5A 1EGHA 5HJ7A 1F20A 3ZJ5A 3WDLA 1ZR2A 1E2LA 4XM2A 1L5GB 2NQTA 1H0HA 4U7HA 2ZATA 4BL5A 2FPSA 2BD0A 2V7EA 2UAGA 3DTYA 1UMBA 2HK9A 1EU1A 2D4AA 1MORA 3WDSA 1ADBA 1DAGA 3V7ZA 1N9GB 3UWSA 3TNJA 1W5SA 2FN4A 2YIMA 4R2XA 5I9BA 1P0PA 5A2QA 3DOHA 3Q87B 1ONOA 1DHRA 2AF3C 3DFIA 5DDIP 4TL7A 3G2NA 3AKYA 3MCUA 4AJ2A 3LYUA 4I4TA 3DDOA 1DQZA 4B32A 4QC2A 3GYGA 4O29A 1KAMA 4AJNA 4FFRA 2OB1A 4EG8A 1KK0A 2HIAA 3PPXA 2IYWA 1YI0A 3KXIA 2ODFA 4LCEA 3CX6A 3B36A 1YC2A 4O3FA 4TSKA 3SP1A 5KNDA 2N75A 4DT1A 1U0HC 4XJTA 1GZ6A 2B4KA 1P4HA 3E6AA 1M2JA 3IKTA 4ZVLA 4IKOA 4OQEA 3L8DA 1RJFA 4UNNA 1UKAA 2A78A 4O08A 1RKBA 5AJUA 3JARB 3J81A 3RVMA 1WUKS 1O96A 3KVNA 4TOIA 2CF6A 3MRVA 3L3BA 3MWEB 5MHTA 1QX3A 5DHAA 5E0OA 2VF8A 4C0HA 3MZ0A 3ON5A 1BE8A 1NZJA 3PD0A 3A7DA 1NHGA 5B7NA 4OMDA 3BEOA 3OOEA 3G3EA 3VO8A 3B3SA 1DKOA 1GRCA 5JBIA 4GYYA 1I5RA 3HDYA 1AQJA 5E96A 4OKIA 2Z1DA 4WA7A 2VDQB 4EO4A 3TLKA 4P32A 2E6KA 4ZMRA 3GYAA 3G5TA 3PQEA 3KTOA 1Y9ZA 2O0KA 3UF0A 3EW9A 1AKTA 4PR0A 5BUCA 3H1AA 3FLBA 3ANTA 1R0XA 4CJXA 4M60A 4PQRA 3QFFA 4DG8A 3PEIA 4NFRA 3KDAA 2C9CA 1Z9UA 2AYXA 2POCA 1TE2A 1Z7YA 1BEUB 5GTDA 4RPKA 3PVCA 5DTIA 2W11A 5H9WA 2H06A 1OIWA 2ACEA 4WIAA 2VQYA 2OE2A 4E5DA 1GR0A 2FEMA 1G8KA 4DKJA 5D5HA 4ZVPA 2GREA 3C0KA 3THYA 4UMDA 3BWMA 3R7DA 2HGSA 3BQ9A 1EA7A 4MCAA 5JS1A 2H2HA 4KYUA 4DEYA 4YPFA 2WAAA 1JHXA 1GG8A 4B76A 4L8VA 1S9HA 5ALYA 3MCWA 4UCNA 4KIGA 1A9XA 3LKBA 3SI7A 4YLEA 1KY4A 2FOLA 1FS6A 2PWAA 3PXDA 3D4IA 1N6HA 4P82A 4AMGA 5JTTA 3VATA 4IS3A 2HXYA 2XMDA 3E7PA 5J1TB 5KOHA 3JRWA 3O2SB 4UHCA 4EO9A 5JASA 1WL8A 2R97A 4BO8A 2GPWA 4MQLA 4YDRA 4E5MA 2DUUA 4H7JA 4ZIRA 2CJWB 2YWHA 4S0ZA 2VDVE 4S1PA 5AM1A 2IV2X 2PUEA 7YASA 3TM4A 4DWVA 4UE2A 1ENOA 4UBKA 4JI2B 1U9IA 4KQEA 1AS2A 1GSAA 2QJFA 2CEAA 2SNIE 3CZPA 3A11A 3I04A 1AV6A 5DSXA 2WILA 1Q17A 1P0CA 5CXUA 1HDUA 3PKIA 1RC0A 3FVWA 3KT3A 1CPXA 4PNEA 1FSGA 2GI4A 1NJSA 1V11A 4EHJA 3PWZA 4ZT6A 5DTQA 3L0OA 4YP9A 4XEHA 5I9LA 5B4VA 4NH0A 2RHRA 3NJ4A 4HN9A 3ELWA 2GLXA 5K01A 2IDKA 3MQ4A 4OGKA 4YQYA 5BNWA 5EGSA 3FHOA 3TK1A 2PR8A 3ELUA 2OVBA 4RH1A 3SJCA 3GT7A 4MVJG 1GARA 4MIEA 4AN4A 4Q4AA 4E5YA 1YCDA 4ZWNA 1ESEA 3AFHA 3BCSA 1IMJA 4LYAA 1KEVA 2ZJYA 4FBEA 3KNZA 3OMWA 4GM5A 1PEAA 2QN9A 3LHIA 2ARKA 3OCYA 5DM1A 4OC5A 3EIXA 2GNPA 1IHUA 5HJ5A 2KCWA 1E2MA 3S29A 2OPHA 5DP1A 1UT6A 5H0IA 1NI4A 1CEQA 2WPDA 3I2GA 3F3KA 4S1TA 5LD2B 3N3AC 2FMHA 3LC0A 5ECWA 1T9GS 1T1SA 4LGYA 3U40A 4TTIA 2GNAA 2ZOGA 4DA8A 1UJNA 2ZR9A 3BFKA 5FNZA 4XH9B 3SDZA 5PNTA 2JEVA 3ONVA 2CNLA 3R0VA 4N18A 5CT6A 1RC1A 4YAIA 4E5UA 4H7DA 2O3UA 3W91A 2IHBA 4NPHA 4M1KA 4A10A 1D7OA 4R41A 3V4FA 3HFSA 4LJKA 5FNVF 3MJEA 4C0BA 5D3ZA 5FV7A 3RFXA 4QVKA 3SZGA 2IXAA 2O2GA 3NBQA 4KI7A 1V5FA 4YWJA 2D5IA 1ML4A 4KVXA 4KFSA 1U8CB 5IT9A 4YUWA 4XKJA 3IIIA 3O94A 3DS8A 2PIDA 4F2HA 2B98A 4BO2A 4LNUA 5CPAA 2YJ5A 1WU7A 5TR9A 2CVOA 4H4DA 3FNRA 1XZMA 4ZX8A 4RLSA 1LRKA 3FI0A 1V0JA 2AMYA 3FPCA 2OHFA 3JQAA 4WRRA 2R00C 1YB4A 2V6BA 3RTBA 4K46A 4YV0A 1EUQA 5TSDA 4Q36A 1USVA 1BX1A 4OYRA 1H66A 1RYHA 1ZNYA 1XXHA 3OJXA 5CYPA 3VSAA 1B6GA 2Y0PA 4LZOA 2KBFA 5GJBA 3PG5A 3U3OA 1TGYA 4QEZA 1NW3A 2CJPA 1QP8A 2XVXA 1W5FA 4RVGA 2PQ0A 1YR1A 2JH8A 3RUDA 2PRZA 3RJTA 5HZMA 2FSVC 3RNLA 5ERXA 2EZ4A 1IXSB 4KN8A 1E2JA 3AGPA 3NAQA 3ZWMA 3M8KA 2XNCA 2NSMA 3MK31 4C0AC 3PXXA 1A7JA 2PYDA 1RTKA 4U2EA 3C6KA 4U5YA 4KTTE 1ID8A 2WZQA 3G1TA 2QLNA 4GM0A 2XMQA 1NVXQ 3RZAA 4IFEA 4N6OA 4I19A 4QUAA 4RZHA 1PE0A 1WZCA 2QD5A 3IUNA 2D0DA 1N1DA 4EUKA 4CV1A 5IABA 3ZY2A 1WDWB 4KS9A 2MSKA 3FVRA 1O03A 4BMHA 3WL6A 1FYXA 3CURA 1ZRNA 4I1UA 1UF9A 3SS7X 1WY5A 2PV7A 1OWOA 5IX8A 2XR1A 4IVPA 3KVRA 3RU3A 4MUIA 3TIFA 3H0CA 2WM3A 4U8GA 1MX3A 4ZO7A 2C20A 1SVUA 4FSHA 4IMRA 2FWMX 2O3JA 4F60A 3F1KA 2YCLA 1K7CA 2I6UA 4Z86A 1UUFA 3RROA 2IBTA 1YRHA 1NP6A 3QAHA 5JAQA 3C45A 1W5TA 4BJ1A 1FDIA 1L1RA 2VCYA 3VBEA 1XRQA 2LIPA 1Q92A 4UEFA 1S8FA 2XVZA 3NWOA 2C5SA 4R68A 2HQYA 1ORRA 2VT6A 3VOSA 4DPMA 3S6HA 3HDQA 1UPUA 1I12A 4JLPA 2GESA 3KYDA 1XJQA 3HCEA 4GOKA 3FHJA 4AP5A 2QWXA 3MN1A 2GDJA 2NO9A 4DLTA 3SC3A 3QMPA 5BV1A 5AKZA 1HDCA 3HRHA 3T4XA 1S3FA 1X1DA 4PLVA 3K5WA 4YGOA 4Z65A 1D8AA 1ZLIA 4XVCA 3L7BA 4IRMA 4IMPA 4BLVA 1YJ8A 1Z3CA 4ALLA 3FPSA 4DDWA 2HXGA 2I2WA 3JQEA 1YASA 3PFFA 2VJMB 3GIUA 1XK7A 5BSTA 1SC9A 3AHJA 1JYFA 4ED9A 2O2YA 4UFXA 3F67A 4FWIB 3R4CA 2FFJA 1CUDA 4WK0B 5JECA 4WCFB 2SICE 3W3AA 3X1DA 3F3YA 4QBKA 4HB4A 3IJRA 4U5QA 4ZV7A 3F46A 1EGVB 4YAEA 1XNHA 3AFNA 3MHTA 1W9MA 1PFUA 2AN1A 5CA1B 3U0VA 3K9QO 1CQIB 3TH5A 4W7SA 4JENA 4P6YA 4ZKEA 4ERXA 3FLAA 3MGAA 4OU4A 1GRVA 2MDTA 2NZ8A 2O2EA 1Z13A 4MY3A 3PQ3A 4DLVA 4J7CA 3ESRA 3R7FA 2R6JA 5KX5A 1GG9A 2Y68A 1A4RA 2O2JA 1T2FA 4HS9A 1AO0A 5B55A 5SZHB 5D6NA 3ZGZA 3DO6A 2X5JO 3ED5A 3RCBA 1OFIA 4NBWA 4RAOA 1D2HA 2EK9A 3PU6A 3PDCA 2ZYWX 1FFXB 3BI0A 1V1RA 4CEJA 1ONPA 3UJNA 1T5SA 3SYNA 5P8WA 1X7HA 4C87A 4CYOA 2QMEA 4FILA 3KEQA 2ESRA 1KQGA 3M6WA 4K9QA 4AL4A 4TQ9A 1H0KA 4WLUA 3GBVA 4G4JA 1VMIA 2YJNA 4RZXA 3T3DA 4BNIA 2N0SA 2V0NA 3G1UA 1VJGA 5IAAA 3FOWA 5CAEA 4JJFA 3NVMB 1VCMA 2PMEA 2RHMA 1JJ7A 4BZQA 1XTUA 3LW7A 4RGVA 3IE1A 1HLGA 3PEVA 1NUUA 3SKVA 3QV1A 2P5SA 4B47A 3TSZA 3JASB 3FPHA 1G21E 1IJEA 1GITA 4TKZA 2R7LA 1NN0A 3DTVD 3ADBA 5E6SA 1DVRA 1YKFA 3CN7A 1O58A 2GD0A 3KT8A 5C37A 2EDAA 3OZ7A 3U3XA 4XPKA 2RGUA 4NIMA 3HGMA 4XYBA 5JD3A 1BWPA 4ZV9A 1F3LA 3EYAA 1K0FA 1ECGA 2VYFA 4KQIA 3AP3A 3CVXA 3WRYC 1TL7C 4G9GA 4U2DA 3TQFA 1TM5E 3B85A 4FOOA 1C1XB 2WJHA 3QLVC 5JZMA 1QOPB 1M2OB 2Z5GA 4IG9A 5AVKA 1M33A 3GRAA 4RM3A 5CDFA 2CNOA 3CG4A 2JFFA 4C5CA 3HPQA 5KTRA 4RD2A 2JAPA 4RYDA 3HA7A 1C1YA 3MHPA 3H8EA 3TZLA 1GO2A 4AJPA 1I3MA 2BYTA 2PAAA 2DTEA 2VAWA 1W4BA 2ZTUA 4XDYA 4BVBA 5AG4A 3IEIA 4W5NA 2COKA 4KPEC 2IPXA 3K0FB 1JWBB 3PGKA 2HA2A 3IU1A 3PNSA 3WLSA 1UK7A 2YHSA 2X5OA 5GIOE 1MIHA 1VHQA 4F86A 2R65A 3QFSA 4F3KA 4D4HA 4C3VA 4N5IX 1TPZA 4DKXA 1R6TA 4L6AA 4DV3B 3QTLA 3B1KA 2GJ8A 5B1HA 1YNSA 1PEYA 4D4KA 1MDBA 4Q6BA 2HZBA 2HU8A 3I64A 1PVDA 4L8AA 1GA6A 2Q28A 3PWKA 4B3RB 4GZ6A 1VL1A 2A0KA 2Z6AA 3RASA 2PZBA 4CEIA 4G1PA 1M34A 3B6MA 4JKIA 4UJ3A 4BGEA 2I87A 3GQBA 3JATB 3E9ZA 2LD4A 4ETMA 4V0QA 2W2NA 3DG9A 4YR9A 1W2GA 1ZUNA 2VNSA 2VBIA 1A9SA 3OM9A 3OCVA 1SZCA 2QPLA 3U4AA 4H7IA 2JAHA 3G8DA 2OA0A 1EBFA 4ACBA 2CE2X 4DMFA 4RC9A 4BO7A 4RTJA 4QVIA 4LXXA 4JYWA 4CIDA 1QSTA 3B8EA 1Z5WA 1ZO0A 1W6RA 5CPFA 3FDZB 3FEEA 1IUPA 4GS5A 4DV4B 2AWOA 2NZ2A 4ESVA 5HKLA 3IAXA 4F2WA 2AOVA 3RAGA 4YUYA 3SXUB 3ER6A 1P8JA 2E18A 3KHZA 3R6LA 1ARMA 5IEBA 1IDOA 4BO5A 1NC3A 3G88A 1KYYA 4IFIA 4UZSA 1LY1A 2ACVA 4M89A 4D43A 3FPEA 3OP1A 4F2PA 3FBTA 2CWDA 3DMTC 3GHHA 5LZ2A 5JD5A 3PPWA 2Z6QA 4KUAA 1XLTC 1Z7BA 2NT4A 2LW7A 3CBGA 1EM8A 2EFJA 3K31A 4RV5A 1IN5A 2FUKA 3LBHA 1X42A 2OZUA 2C4KA 4FINA 1ESCA 4OLHA 1QHSA 2IUUA 1XAIA 3LUKA 2WKQA 2JIPA 4BWYA 4JLSA 3A1NA 5IPFA 4CVNA 2G71A 2HDOA 2GLFA 5FA8A 3VVLA 1YQWA 3WA6A 2CUKA 2QLLA 1H0RA 2HAEA 2XE4A 2CW5A 3I8XA 4ESOA 1NY6A 2XCRB 4V02A 2DU8A 1COZA 2NLOA 3G6WA 1Q1AA 4K6CA 2VPQA 4YRPA 1DU4A 5KTAA 5IVKA 4BIIA 4MHPA 5IF9A 4OHRA 1CQXA 4BGVA 3TZ6A 3UXYA 1J4JA 2P9GA 1HI9A 3MBKA 3E3MA 1ZIYA 4IILA 3GA0A 1IJFA 3MOGA 4WXYB 2NX2A 3U3ZA 4GLOA 3I5XA 3OUUA 1ISHA 2GF0A 3TIIA 4OKSA 5T4EA 4X92A 4QFDA 3Q6NA 1P2VA 4S24A 2VRCA 1P4GA 3GEDA 1XMOB 4HDQB 4G09A 1SVMA 3GRFA 3RBZA 2DEAA 2HCFA 5ICEA 3WYDA 3QF4B 3AR4A 1WBBA 2NPIA 3OZDA 3QWIA 3CC8A 2M6RA 1L5LA 2Z3PA 1DBSA 3WVNA 4ONEA 4ZHQB 4EF4A 4HWSA 3GUXA 4OQZA 2R68A 3I5YA 2F8SA 3E3OA 4O0MA 3MAAC 4E46A 4B14A 4NAUA 2VUIB 1RYYA 4KGVA 3W5CA 1IQ0A 3H65A 3V8IA 4N5DA 5DBGA 1U6IA 4NCNA 1ORWA 4P34A 1I3OA 3ND9A 2E1PA 1IYKA 3B7GA 2J9ZB 2V6GA 3T7SA 1TO6A 4C9BA 2V6JA 5E9QA 3VH3A 4DZZA 3SD7A 4WA8A 4MWDA 2PYIA 4KK4A 4R3KA 5ESXA 1HYHA 3JZIA 2LVBA 5EUMA 5EZQA 2PA0A 1MPTA 1I1DA 3WNDA 1DS6A 5AT1A 4NOLA 1GPWB 4OAPA 2W22A 1QIMA 1MNQA 1X0VA 2HLDD 3OE5A 1DGQA 1C8KA 1I6LA 2OZLB 1BFKA 821PA 4M8SA 1BVHA 1X7DA 3O4FA 5DM0A 3HSSA 3VR6H 4B0PA 4EYGA 4UBRA 4DR1B 1EE2A 1Y5MA 3G0HA 3OJWA 1JJBA 3IVRA 4BYGA 1CY8A 4LYHA 4KDRA 4EOGA 1V7QA 3C3AA 2QX4A 3EYWA 2IUYA 2PX3A 3UJHA 1M76A 4CWAA 1T8SA 2WD7A 3P9CA 4UULA 2UZ1A 4CBVA 3FBUA 5IT5A 3K9GA 1GZHB 4QEDA 1NJFA 5IASA 3A6DA 1JDTA 1DXQA 2LP4Y 4BD9A 1YWGO 3B3TA 1O95C 2C83A 3I28A 3QNMA 4RIFA 3ZHVA 1R6UA 3CLTC 3BKXA 1PK9A 1U0RA 1ECCA 3T9AA 1NONA 3PHBE 5FYDA 2X0JA 5CX1B 4TZ0A 3AVYA 4PLCA 1KWMA 2PJDA 4NU0A 2WM8A 3I72A 1H5QA 2BY4A 3R09A 1FT7A 3LCVB 4O25A 5LA6B 5LP6C 4DV6B 2QVZX 4OP1A 1G64A 4FMDB 4W5OA 1DCFA 2WF5A 1PQ4A 4PZUA 3ZZMA 3X1YA 2HV2A 1ZMRA 2XQIA 5JSZA 3R9XB 1KQFA 1W36D 4YALA 2OESA 1QP7A 3COSA 1TQDA 5CIYA 4I4IA 2QD3A 1WO8A 4LGVA 4YP0A 3AEQA 1FP4B 1J6UA 1HC7A 2QR2A 3A06A 3EDRA 4DMHA 3Q8MA 2F43B 1NIJA 2E4WA 5JCZA 1YCFA 4G4GA 1TQHA 2GMWA 2QJOA 3VPFA 5EXTA 2GK7A 2H4YA 3DOUA 1ZK2A 3V8NA 3N5FA 4DJEC 1S7GA 2VYND 4RSMA 4JC0A 3K72B 4OB6A 3TG8A 4EITA 1U0LA 1OLUA 4GZ5A 3FTEA 2NWQA 4OXIA 5F3RA 2ZWMA 3WRXA 4NGNA 1K6EA 2EJVA 1U5BA 4KACA 1Z39A 4XX1A 3DL7A 2FQYA 3DLBA 3AERA 4REMA 3CH5A 1U2DC 4XFDA 5FCDA 4UBMA 1R0LA 4QJ3A 4QT4A 1PR0A 1N2SA 3WK9A 3SZOA 1LSOA 4RWEA 5IVIA 3S2ZA 2PFKA 8LDHA 4MIYA 2GEDA 4RXMA 1UQUA 3HLTA 4JJ8A 2ODTX 3IO3A 3V2UA 1SBHA 1P0FA 1VE7A 5C4GB 4GL4A 4A39A 2JZNA 4KG7A 5LNK6 2GZHA 2FXVA 4NBKA 2J0VA 5ELXA 4BQIA 3GD5A 3VSCA 1A9YA 3JQBC 2QM8A 3SBDA 1F7VA 3MD9A 2PWYA 4QLOA 3QOFA 4Y98A 3Q3HA 4NI5A 4TGLA 3TN7A 3LWZA 1Q0QA 1YGHA 3G5LA 5AJHA 3W2TA 3D2MA 3K15A 5C51B 3NM5A 4IEEA 3G6KA 2BOAA 1JU9A 1OWNA 4TRMA 4LHYA 3OU6A 2N47A 5AM0A 2GZ1A 3H7IA 1QZXA 2OV3A 1ZCFA 5DASA 1K6XA 3AF4A 1WKVA 1N78A 1I9GA 1TCUA 5AI4A 4HSEA 4M55A 2B4DA 4G36A 3F5DA 4QQKA 1SKAA 1F2OA 5DT2A 3WK8A 1GQRA 1LPNA 3KKPA 5FO1A 3CRQA 1JEDA 3TVDA 3WLRA 1HEYA 2A9JA 4FMCF 1UQRA 4YJ3B 2XQFA 4RHFA 5AO9A 3BWCA 3QPAA 3CUYA 5FUXA 1MAAA 1NVVR 4M7RA 3PQ7A 2Y99A 5DMHA 4CG3A 3CNEA 3ZR4B 2GBLC 3JQGB 4QGBA 4QDKA 2R79A 3WC7A 4BLTA 3SBEA 4Y6GB 3F7MA 3AKEA 1II8A 3I1IA 5LUAA 1G8FA 1RWXA 2XPCA 3I2HA 1C9JA 1FE8A 3HR4A 3GKRA 4UHKA 4JCCA 2BKAA 4Y8VA 2G82A 1GKKA 1V45E 3OT1B 3W7BA 3ZE1B 2PT5A 3PENA 5D01A 4P5EA 3ZHCA 4PPZA 1JKMA 1G1MA 4DRZA 3DHNA 1MEEA 4IQFA 1NTOA 3VUEA 3M9LA 3ZY6A 2BZSA 5AXDA 3EVDA 1LA2A 4M46A 5J47A 3AESB 4ZVTA 2C3OA 2I1VB 3ZWWA 4BVHA 3A31A 3VX3A 4BQPA 5BN4B 5CFNA 1KSGA 3BQMB 5TIIA 1PI3A 1T3ZA 4PINA 3SR3A 1J06A 4RIHA 4OX9Y 1U5CA 4Z7NB 2CBXA 5KUTA 2HFJA 5KVSA 3VYWA 5BSGA 4D41A 1C8VB 1NNLA 4OP2A 2J3QA 4J8PA 3NBAA 2EUIA 1FQWA 4TMYA 3D6HA 2O2XA 3W7AA 2XGMA 5KYXA 3W3ZB 1PT5A 4FNOA 4LAFA 4ZVQA 3FCSB 2JLSA 1OZ0A 2WHQA 2XLCA 2YHIA 4JQSA 1FLNA 5LOVB 1UWCA 3O8OA 2PX6A 2OQRA 3H17A 3AI3A 5EQJB 3L05A 2ZBGA 1QVRA 1UBRS 3CKMA 3EC1A 3W5VA 5CBPA 1IY1A 4UNQA 1B26A 1ELMP 3HNPA 4Q5IA 4I2VA 2VA9A 4LF9B 4UE6A 5JVDB 1J25A 3MPOA 4TRJA 1VYVA 2W6IA 1DLIA 4A27A 5AKXA 2DCUA 4QXQA 2ACWA 1E1CA 2A9OA 3AEYA 4IH4A 1UZLA 1F4PA 4JLMA 1KK3A 1SOMA 1IB6A 2AC7A 2IUSA 3FSJX 1RXIA 2DWPA 4GXTA 3QPDA 2O52A 2Q44A 1RCFA 5H83A 4CE6A 3CTPA 1B74A 4C14A 4DILA 4RDIA 1D0IA 1U02A 1Y1PA 2NVUB 3EGEA 3HZHA 1AKYA 1M67A 4RNDB 4H7FA 3FDJA 1P0MA 3LT1A 4C7KA 5ALWA 2BMWA 2B7LA 2AFRA 5C0OE 2B4TO 2JC3A 3CZAA 5IDWA 5DGXA 5T5QA 1VA4A 1PW7A 3JAMA 4A33A 2I7DA 3V38A 2VP2A 3LFTA 3N3BC 4YMTA 4DSNA 1OH5A 4KLWA 2W6JA 4YI5A 2VK8A 3QNUA 5AIAA 2X19A 1JFFB 4YP5A 3O1JC 3LQYA 1RRPA 4U3JB 5ALMA 4BMPB 1JSXA 4ND2A 2QM7A 4ZT2A 4OHKA 4B6OA 1KH1A 1YSCA 3NGMA 3WP0A 4BQEA 3ORRA 4RSGA 3TXXA 1H2ZA 4FHCA 3JWGA 2LNDA 2ECKA 4G24A 4QWWA 3FZNA 4NFSA 2P77A 5ULLA 1AKQA 1QDEA 4N6NA 2XF8A 5F9MA 2JJ1D 2GN0A 2F3TA 1JIIA 2PE3A 3LUGA 5DX8A 2QY6A 4KQGA 2XBLA 4MV9A 2Q3HA 3NHZA 4YV7A 1P19A 1XBUA 1YDHA 1K7XB 1NUQA 3L8CA 4V0RA 4TKVA 3LDAA 4WKOA 3V7YA 3QAYA 4G1UC 4CKWA 1KDPA 4L78A 1AKRA 1HE3A 2UUOA 3HN2A 4IHJB 4F85A 1P1IA 1U0EA 1BE0A 3MT7A 4CF6A 4FX2A 2W2VA 1LK0A 4LJ8A 3F49S 4MOWA 5HSGA 1J0DA 4BJ6A 3BL5A 4OLFA 1J0XO 1ZL0A 2DYKA 3TLCA 1E61A 3BICA 3BIOA 3BDIA 1XOIA 4EHHA 1G63A 2JNWA 5LZ5A 4FT2A 1F8YA 4NU8X 4ZANA 4B6PA 1KH2A 1R18A 2FEWB 2ZBFA 3QHPA 4MDYA 2BI4A 3H6KA 1J99A 5EJ9A 1KBZA 2QTZA 1MF7A 3L0CA 3CPHA 2ODEA 2UU9B 2ZUVA 1EFLA 4OC1A 2K87A 2WUDA 1GDHA 1VRVA 1I5EA 3I6QA 5DWMA 3C3WA 2P9JA 5ITZA 5B6PA 1Q2UA 2Z04A 1I13A 1RWOA 1IJBA 1PL0A 3WQHA 3K0EA 1LS6A 4HRYA 3TX6A 1KVSA 3ZX4A 3U16A 2R2AA 4BNNA 2G0TA 1SEPA 4RORA 3I5MA 4R1LA 1QQTA 3RAEC 3QK7A 5JAPA 2PSFA 3OMXA 5B1IA 3TO9A 4XIFA 2GE3A 1YB5A 1XWIA 1L7EA 4ESHA 2B58A 4J1SA 4AKTA 4OSOA 2FZGA 2PD6A 2XUKA 2WF8A 4Q0MA 3JVNA 3B3VA 1U4NA 4W1SA 2Y1CA 1Z0AA 3BHIA 4WT7A 2RGAA 4ND5A 4M6WB 1VI5A 4WUTA 4MUJA 2IX3A 4YU9A 3A1DA 6PFKA 4A2ZA 1DFGA 3M5WA 2M9MA 4B0OA 2ECPA 4ZCPA 3RIXA 3T4EA 4HXGA 4BDSA 4YIHA 1K7EB 4EMUA 1CIJA 4JYBA 4RF2A 2R47A 2VHEA 2C4WA 5LKRA 4PG7A 1F12A 2H18A 2CMHA 4NC9A 1PSWA 4UMVA 5JQGB 1NDQA 5ENDA 1BWRA 3L7CA 3BRSA 4N7BA 2V55B 2LCIA 1E2QA 2OG1A 1J8MF 4BU0A 3LPNA 4EVRA 3O31A 1RRCA 4I5DA 3JD0A 3PEYA 4YONB 3D7LA 2XUFA 4R01A 2G80A 2V7UA 1KI2A 1XZCA 5FTWA 4W8GA 3DT8A 3PD7A 4DNCA 4GYKA 3ZC3A 4X7PA 1NXQA 5CA0A 2J4FA 1E58A 3HU3A 4MMYB 3GLHA 3BH7A 3E5NA 3BHJA 5ERGB 3AIMA 2X1VA 4CNBA 2QHXA 4KVAA 3P20A 1N6OA 1P8AA 2QSYA 3E03A 1VSVA 4R1UA 1KORA 4H2KA 4KDFA 3L4BC 1WKBA 4NGTA 1H4SA 1UADA 1JSZA 1MA0A 4KL8S 3EO4A 3VH1A 3VSEA 1H42A 1TK2A 4R16A 2HNAA 4Y2HA 1KOJA 4PGGA 1EXDA 3OH8A 3NVAA 3PJRA 2GN9A 5HYVA 2PN1A 4FFPA 4C6SA 2NZVG 4K9DA 3FHTA 4YLYA 1L0BA 4F3YA 1F06A 1ZNZA 1Z0DA 4X66B 2DP4E 1AUOA 2GCPA 3LLMA 2CFRA 5A0VA 4TXMA 4BKRA 5BXQC 4UWJA 5KOIA 3G3SA 4NCIA 5DLEA 2XGJA 3FWNA 2X5XA 2IYPA 4QOJA 2HDHA 2XWSA 3A0RB 1UMDA 4HB0A 4MEBA 4I14A 3I2JA 1QHNA 2H2IA 5HKAA 2AH5A 1H2RS 1E2UA 4I6JA 3GA5A 4EAAA 2ZAIA 5AKLA 5E38A 4FNAA 2PSHA 4DVGA 4KR3A 2PV0A 4EWLA 2JHAA 2LPMA 5C46F 4L6IA 4MYTA 5HQTA 1QTNA 3TE6A 1ISPA 1L7BA 1XTTA 2PVPA 5KHLB 4KO1S 1ACLA 2KW5A 3FOZA 3Q9NA 4TPKA 4LJSA 4HDSA 3RVSA 4PXCA 4R8MA 4YAKA 1H0SA 1SO8A 6CHYA 3OOSA 1EFHA 5ALXA 2RAUA 2Q4VA 2PS0A 3RUAA 4Q3CA 4QB9A 2F5IA 3GLFB 5FI3A 2FN7A 4A15A 1T9KA 4G1BA 3TR5A 1JILA 3CVOA 4CCYB 1IMOA 1IRXA 1P1JA 4QVTA 4GT1A 4OQFA 3HADA 1Q7LA 1YZKA 4HAVA 3UY4A 3AOEA 4TT3D 4YCNA 3NO4A 2SKEA 2HNKA 2ISCA 3NAMA 3A4NA 4OB7A 1MTZA 4XD7A 1XTVA 2Q7DA 1V1JA 4B80A 1KGSA 2NO4A 1F5SA 3M4YA 3HN6A 1UBFA 3EIFA 3QE3A 1YLOA 1Y7PA 1JGTA 4A94A 3LECA 1VKRA 3DDHA 3SS8A 3IFEA 3RYHB 3H9EO 3NORA 4CT5A 5A05A 2ZCJA 1EP1B 1GM5A 2C5FA 4KMSA 3SQMA 2I3AA 3W1WA 5IAKA 1NOJA 4NMXB 1ZLYA 4EG7A 4G5XA 2FB9A 2BHLA 2RCYA 1DRKA 4EZEA 4QQRA 5DWQA 5CCDA 3GA7A 4OK3A 1OAKA 2Q0SA 3C74A 1ZINA 1LV8A 2G67A 5AGEA 2CLOB 1TYCA 2AUNA 1JQDA 2I2CA 1XOVA 3TFQA 2IPNA 4Z0NA 4J1TA 1C7EA 1KEZA 2ISSD 3QVOA 3JW8A 5DWDA 2MSEB 4WWHA 2FPWA 4K3NA 1U7ZA 1WCV1 1P33A 2A0FA 1VLHA 1K08A 4KYVA 4Q7KA 2QLTA 5ADUS 4N48A 3JD1A 3T38A 2IYVA 1U7PA 2VJAA 4ARVA 4E5NA 4KN5A 4MRMB 2GM4A 4B3MB 3DQZA 2P79A 3W6UA 3IV6A 2ZEMA 5GOZA 4J4TA 5DHRA 4S12A 3KVVA 4P58A 1WD7A 1KAGA 1Z5ZA 2VP0A 1W5EA 3L6OO 2V0CA 2PBLA 5EINA 3A4MA 1ICIA 1LV7A 4DLKA 4EARA 2AFIB 4MKGA 5LYLA 4FDMA 2HWYA 1DB3A 2CXQA 4HK4A 2IC5A 4WKCA 3I1UA 2ZJ4A 4M7OA 3PB3A 4B3FX 2B1IA 3A1EA 5CYOA 1IPEA 3JZDA 3MS7A 1M1DA 4F9GA 1J90A 1D1TA 1X3LA 4CKBB 1Q6ZA 3EAFA 3X2EA 3D3JA 3K2IA 5CEEA 4IZOA 4NJEA 3H18A 4JGBA 1Q19A 5K0SA 5FLYA 3TQTA 1VCIA 2XCQA 1ZAYA 4L4UA 2E4XA 1LPAB 2UZ4A 1FIUA 4WCDA 1TUBB 2IU0A 3NI2A 1VB5A 4L6CA 2ZYSA 5FORA 4LF8B 1UXGA 2O2SA 4QE3A 2D4PA 3TVTA 1TYDE 4CAEA 5PGMA 1V3QE 5KYWB 1XPJA 2NMVA 4O4IB 1CP7A 2GCGA 5EYPA 4H4CA 2B2XA 4DYOA 1SUAA 4JX9A 2XT6A 3ZY3A 2P4EA 1QHGA 1V7CA 3ND5A 3OQMA 2CUNA 2WY2D 3DF7A 5HIMA 2EC5A 1E5DA 3L07A 3RVPA 4C2AA 4YDQA 3V8MA 3O1IC 1KVRA 2PR1A 2ZB4A 4BAZA 5JYDA 3D0OA 2YOHA 2QEQA 3TZBA 4P98A 3MG9A 2X1LA 5KAMA 5TJ9A 1GU7A 3ELYA 4KQKA 4PNPA 5I4MA 1DJOA 1AKMA 2VYCA 5DHQA 2Z95A 3T7JA 3VR0A 3IA7A 3DGEC 3WGGA 4FLEA 3O6VA 2DUNA 4FQ5A 4P9NA 1LAPA 5LLDA 4Q39A 4KQ1A 3DMHA 3VM6A 4K87A 3WIBA 4G1VA 1UBNA 1T9GR 2Q5OA 4GXNA 4HAZA 5A27A 3WXMA 4BNWA 5BRAA 4KKXB 3IEVA 2XIJA 4J9VA 4HFRA 1Z0UA 1OROA 5JS7A 3SLKA 3LKVA 4AW9A 5GPBA 5IARA 2PWZA 1Z25A 2NYVA 4ZQHA 2QT0A 3D3WA 3D66A 4ZAYA 2PVCA 1SKMA 4PYOA 4O2AB 3H9BA 3ZU2A 3LRXA 1XR3A 1HNNA 2Q6OA 5JZOA 3UXEA 1Z4JA 1M1UA 1MIOB 3C7KA 5DCUA 1BDMA 2WAYA 1HA3A 2IOQA 3FSGD 1SUBA 3NM6B 3VZDA 4GNKA 2XQVA 1PGJA 1L1EA 4BKOA 1YK0A 4Y9SA 4G1FA 2JHGA 1QE3A 1GTG1 5I4IA 1RJEA 4PLWA 1JVBA 1LS1A 1P7VA 1ZGZA 1MFZA 2HO5A 1WB4A 2ZIXB 1CUHA 1JEOA 1UPCA 2ZJ5A 3EA0A 1E3WB 4ZICA 4M99A 1EAMA 3PFKA 1ODJA 1GGJA 3UMVA 1Z0KA 3TD6A 2AZMA 4OJMX 3OF2A 3RU2A 2OUKA 1T2VA 3HDVA 1IEXA 3IQWA 4ZAZA 3IUQA 2GERA 3U4CA 4PG8A 2PKWA 3RQSA 4BNDA 4JSRA 1IZYA 1XMXA 3EPRA 3GU3A 4R2JA 3C70A 2ZJ3A 3A3NA 3L0DA 4CM8A 2PZJA 3NE8A 4KYTA 3VSDA 5F2EA 2MIIA 3LUAA 3EASA 1SWWA 3Q2IA 2W2KB 3OPYI 3FGPA 3BDAA 1XQYA 1HEIA 2HCTA 1J70A 9LDTA 4DCGA 4G0XA 2C8JA 2OO5C 5EBVA 3KB8A 3E3NA 1L7AA 4FD5A 2YWBA 4FBMA 1Y6RA 1UBKS 2IYFA 1ZXXA 1HT3A 4LHVA 1QRRA 2A7XA 3MNFA 4QGFA 3GLRA 1Y3AA 3DHYA 2IEAA 4GYWA 3D8TA 1M54A 1X39A 1QYIA 3IO1A 3I9NA 5C4IA 4RTMA 4CG0A 4J1NA 3G82C 3SNHA 2EWBA 4PTYA 4IX1A 4B73A 3FUWA 5A5GA 4HY3A 1ZK0A 2R6ZA 4Z51A 3ZXXA 4FD6A 4IH1A 2QL6A 4DJAA 1UINA 2VL1A 1X10A 4ZY1A 2N3ZA 2R5FA 1LI4A 3CZ4A 3NWJA 2HXSA 4ZU6X 1ZP6A 2ZKLA 1F6BA 4OATA 4GSLA 1NVVQ 5IK2D 2QMQA 3OFJA 4H17A 1QIJA 4DA6A 5A0FA 4CRZB 1TF2A 1BGWA 2W6NA 3CNBA 2Q2QA 3EZNA 4HVAA 3WGIA 4LRSB 3AVOA 3ZCXA 2B37A 3L0BA 2PQ8A 1FZQA 3TLGB 3VVBA 3SJGA 5D5QA 1Z08A 2REQB 1OHHA 4G5YA 4NVRA 2X9NA 4DG5A 4P0PB 1IOLA 4S05A 1R10A 2EW8A 1OH6A 1HNXB 4Q16A 4KE7A 2W70A 3U3JA 1AUGA 3LJKA 4HFJA 3HHPA 5LQAA 4MGZR 1BJTA 1FNBA 2GCOB 5CD1A 3G0GA 1DPFA 4KBYA 3RO7A 1KEUA 2QJ8A 1R0CA 4O5AA 3JYOA 1E9AA 4LRYA 4F8ZA 4MP3A 3MJCA 4WK6A 4ZFNA 3SHVA 4X2TA 3U3KA 2OC9A 3S6JA 4CRWB 3FOCA 4QBFA 2L42A 3GMDA 3LC1O 1ZH4A 7REQB 4MCRA 1E32A 4LQ6A 2WF7A 3LODA 1V8FA 2QTNA 3BD8A 2I22A 3BE6A 1OTYA 4YRAA 2YRWA 2GZRA 1ZS9A 1MAVA 5BO5A 5IJ9A 3BD6A 1JEQB 1N2EA 1YB6A 1UBEA 2R8EA 4WEOA 2ORVA 1GPH1 3OEWA 4QYSA 2EOAA 1M7BA 1SOAA 3KFLA 4ZI7F 1DKLA 2I78A 2VNKA 3WJ1A 3OX2A 4X7RA 3QBVA 3ZGXA 3FWHA 3NBYC 1BCSA 2JIRA 4QBGB 1YR8A 3KYIB 4ENVA 1U8TA 2XDQA 3I01M 4ERNA 1WSWA 5A7HA 1O77A 4KJXA 2OGTA 3LHSA 2NQ8A 2ZPUA 2TMDA 1IOFA 2WD9A 1HO3A 5G40A 4UAVA 3AF5A 1Y8QB 3DXFA 3D0QA 2ZETA 2HA4A 4PYKA 3I83A 2OBFA 4ARZB 5KC8A 3IH5A 3RS9A 2X0KA 3ZQ4A 3RNOA 4WINA 5KHAA 1E2EA 5CH8A 1N6KA 2A86A 4LPKA 1CVLA 3O92A 4NQRA 4NBRA 2PX5A 5EHNA 2WMYA 4LI3X 2DMRA 1MJ5A 1YMEA 3Q10A 2Y2UA 1V9SA 1UWKA 3OPYA 1VZ3A 1RWWA 4EI9A 2FPIA 3KJXA 3WL5A 3AF6A 3NBZC 2JH3A 1YX0A 4EJMA 5K1ZA 3IAS1 1PR6A 2QRVA 1MAWA 4WKGA 4YS6A 1XUOA 5LBUA 4EEKA 3K70B 1IQRA 1KPIA 2HCBA 1DEKA 2ON6A 1P77A 1MK4A 1UKVY 3FZYA 4BMVA 1YBAA 2DHEA 1TVMA 3N70A 4MKXA 3BXXA 2O8CB 2NUAB 3F71A 1P1BA 5K6RA 4ZU1X 2QTVA 1TF9A 4JI0B 2ZJBA 3ZDCA 2GZDA 1IXZA 2CVPA 4GLBA 3JQ8B 4MRNA 3G9ZA 4GMHA 1Q57A 2QZ9A 4D9HA 3QELB 5HM6A 3ZS8A 1HZJA 3AI1A 3WKCA 1OB2A 5HILA 1UXOA 1YDEA 2PJ3A 2ZVDA 3DD1A 5D3MA 1V16B 2TMGA 2GLUA 1W29A 5JH7A 4EELA 2A1UB 2WE8A 3TW8A 4CMHA 3PXUA 2WFLB 5JH9A 2W2OA 3MBOA 2R86A 4GOJA 1G8MA 3RAJA 2CK3D 2GF2A 3L7YA 4DMKA 3LLVA 2X7HA 2PS9A 1II9A 3GNSA 2HQBA 3JQDA 4LI0A 4BGIA 5A4AA 3P0HA 4HGNA 3EXFA 3WNBA 5F2NA 1XVVA 3TRDA 2OGWA 2JFBA 2WJPA 3PRHA 1NZDA 5D8DA 2FX5A 2IOHA 1QUFA 1UCFA 3R7WB 4X64B 2QTTA 2ADOA 4NJOA 2A9RA 3Q0IA 1KDVA 3CR8A 2PKQP 1Z3IX 4O4LA 4GUAA 4G1MB 5BPHA 1X9GA 4OLBA 1NT4A 2G3AA 1TMKA 3H8WA 1U1IA 1CZLA 4HJXA 4WFIA 3VI4B 4AJ9A 2NT3A 1U8EA 3IESA 1KFCB 1HLDA 4RV4A 4NK5A 3PFGA 1Z82A 3SJUA 2ZUCA 2LUOA 5FHRA 4XQGA 3ZGVA 1DO2A 3AR9A 3E70C 4P08A 3NIGB 1GTRA 4FOSA 3F0AA 1N1MA 2V5AA 4ALJA 1RR6A 5KTYA 4MLZA 3A3OA 2CHEA 3I6ZA 4QFBA 4E1AA 1EEXB 3T0FA 1L7QA 1UPFA 3BK2A 4HBZA 4FQ8A 1AURA 3D5TA 5EE5B 3WADA 2H0AA 3OIYA 3UG7A 1N33B 4RHYA 4DQUA 5DNAA 1KZ7B 5C35A 5F1OA 4TWBA 4ZKDA 1CUUA 4E13A 4L8LA 3PP9A 1DBQA 2AJLI 3LVRE 2JJ2A 1IH8A 1ZOOA 4G0OA 1FNCA 1L5RA 4BNJA 1X94A 1Q21A 2ID9A 3ML1A 3GGJA 5KNCD 2Q0QA 5CJ2A 5IB9A 1N3IA 3OQHA 4B85A 2CZCA 3U7FB 2PWBA 2OD9A 2I66A 3MINB 2JLCA 1Y4DE 4KW7A 2F7VA 1FMLA 2IGTA 5I3ZA 3RC2A 3TOZA 6YASA 3OKAA 4MGIR 3L8MA 3SHWA 2ZEHA 1BHJA 3QUBA 2I4RA 1PDOA 2Z56A 4ZOAA 5C3UA 3FKSD 4C4ZA 3VUFA 3GLQA 1FDWA 3VH9A 4TLLB 1WCIA 4MPJA 5EWLB 1Z4EA 1M10A 1JTFA 5JNTA 4KTVE 2H1VA 3DZFA 4C2UA 2ZI3A 1GUBA 1N5JA 1QH0A 2O3TA 2ZYDA 3N39C 4HTFB 3TUJC 1EDOA 3KOYA 1PDWA 2WG0A 1A8SA 1DQPA 3EH1A 2YWEA 1T3GA 3I9JA 1BCRB 1M1XB 5LDHA 3IP8A 5FL7D 4KQCA 3TQRA 3DFFA 1OF1A 2MSCB 4AMBA 1KU6A 1D04A 4DY4A 7CPAA 2QLBA 1JXOA 1XE3A 4J3JA 3LWNA 2B34A 4N3CA 3TPFA 3T7EA 2XXAA 3TOBA 2VJLA 3GUCA 1JQJC 2X7JA 2VSXA 4XPLA 3PRYA 1PRYA 4D96A 4RTQA 5I7FA 3NHFA 2P3OA 1Q20A 3FD8A 1PR5A 3WWZA 4Y2QA 2C07A 3PFNA 2AOUB 2IWHA 1IUOA 1JFLA 2HSDA 1E3LA 3OIWA 3LL4A 5FF9A 3SY8A 3I9V1 3S6FA 1USKA 3D4LA 2QAGA 1E9DA 1NJ1A 3CEPB 1L5MA 2X9QA 4F4CA 1VE6A 2P3SA 3PQCA 1I3NA 3IXQA 5TGDA 4OHZA 4CR6A 4R83A 4W9RA 2Q43A 3FDFA 2VZLA 4DC9A 1O94A 3H5LA 2F1OA 3NW9A 3BWBA 4F0YA 4JIGA 5B5SA 1J2JA 4Y9RA 1GLVA 4H1VA 1WM1A 2CDAA 4COKA 4D0GA 1N36B 4YPVA 4BMZA 2IP1A 2Q2NA 1A3CA 5KNLA 3T15A 2EWWA 2ATXA 1WG8A 5EIHA 4PXYA 4ZOCA 2WWTA 3P2HA 3RFCA 1AUPA 5BOSB 3UT6A 4ZGYB 2H8GA 1VI2A 4LJRA 1EVYA 4NHOA 5LIRA 3BXPA 1XD2A 2FWJA 3L0SA 2WIGA 5G2OA 1JJAA 1AMPA 2PMKA 4F4UA 5J43A 3IMCA 4E11A 4CIAA 2FV8A 4JLKA 3EWAA 4B9AA 4ZZ3A 1XRNA 2YWDA 4QBTA 4YRDA 2BZGA 4AJLA 3BLNA 4MRIA 3HXTA 2WKRA 5TS3A 3KKLA 4L8YA 1SVNA 4O4JA 5D2CA 4F3NA 1PZEA 1H6DA 3A28A 4LXQA 5DIZA 3HGTA 1WIWA 4NXMB 4ND7A 1Z4MA 4MFQA 3WKDA 2YXBA 2P4UA 1Z22A 3M5DA 3PE4A 5EQDA 3L1UA 4IFTA 3EG9A 1CR6A 1U1FA 3HYRA 2KYRA 2ZJ1A 1WKCA 2J46A 4FE3A 3H2BA 1W49A 3SLGA 2P6NA 2YUIA 4PN7A 4KIFA 3T9FA 1QMGA 1MR3F 1JV2B 4IXTA 5CT9A 4MFZA 1FPMA 2Y1XA 2WJYA 6CPAA 1Z36A 3AXSA 3KE9A 2R6GA 1RJWA 1QAOA 3E7DA 1W36C 1Y0YA 1H6AA 4BX3A 1UOEA 2PX8A 3CUTA 4FIZA 1UMCA 3WMWA 3B1FA 1A97A 2C2GA 4E3ZA 2OZKA 3EIWA 1THGA 5K05A 1OH7A 3HABA 3IEKA 3AG5A 4CPDA 2DWOA 1E1DA 1N9ZA 3SHFA 2AQKA 2QQGA 3HKCA 4G23A 4JHLA 3D8NA 3O4HA 3HL0A 3OFND 1I51A 2Z3LA 4A37A 1Z6QA 1DC8A 2CLIB 1KKMA 5CPBA 3EY5A 5B3JA 2C98A 1JB9A 1XCOA 2VTKA 2J0SA 1FTYA 1Q11A 2LTAA 3OTGA 1GQSA 2A33A 4REQA 4MQFB 1Z33A 4QUJA 3DE0X 4Q6WA 1RWMA 1PS9A 2DT5A 3RTGA 2W8BB 3L0ZA 1T2AA 3ISTA 3O4IA 1RBZA 3V6LA 2CJYA 1BGXT 2ZDQA 3HY4A 1E89A 3MOSA 3ADCA 1XSEA 5G0SA 2C2YA 2AZ4A 3BB4A 4E2YA 3BZWA 2I33A 3L8HA 1GPLA 5DN9A 4NNJA 3NUZA 5C8YA 3N0RA 3FMGA 5DBHX 5DYGA 3T1NA 1MOSA 2P8JA 2ZAMA 5DTMA 4NULA 1ZSNA 2PO7A 4JLBA 5J2TF 2OXIA 3FYNA 4BZPA 4M87A 1DDIA 2WIFA 4BMOB 1RXTA 1FMCA 3MJ4A 3EVAA 4WH0A 1N3LA 1MH1A 1A7AA 2DHRA 2XDAA 1RAFA 4BBHA 1FQKA 3KI9A 5JCJA 4JHXA 2XZPA 1OX5A 4HVTA 1FK8A 3F5SA 4HAIA 3OM0A 5LLTA 4LWQA 3N6RA 2P6UA 3T41A 2IRWA 1V4BA 1L3CA 2GN2A 8MHTA 3I0ZA 2CLHB 1R3UA 4R0MA 1WW2A 2P90A 1QQ5A 3IDQA 3B48A 1Y8RA 1JSRA 2VDJA 3TZCA 1F0NA 3OLXA 3VPHA 2C6PA 2Z0ZA 4DEXA 2XKJE 1YDWA 4V3CA 4IDNA 1GPKA 1VTKA 1G5IA 1C30A 2A8YA 3DR8A 5ARDA 1KJ8A 1UT5A 3N7AA 3KQTA 5FUMA 2RK3A 1SQSA 1SBYA 2CL5A 1L7MA 1KTVA 5G3ZA 2XUOA 4ZPXA 4H6ZA 3G2MA 1CB7A 4KVGA 2XYVA 5CMLA 1RFGE 4LJYA 1WVMA 3IBFA 1RLOA 4L3WA 4EFMA 4DCVA 1W581 3OPXA 4HDKB 4PX9A 4WX2B 2Q3JA 1U8XX 4QODA 5E6RA 1RDFA 1H2WA 3PJDA 3HU2A 1GZ3A 5JXHA 4PSAA 1KY3A 1WV0A 1G21A 1K6MA 3E22A 2WZDA 4W7IA 4LSMA 2YZKA 3MRXA 3MTEA 4MW6A 3HUDA 1BAVA 2EFYA 1XCLA 1DKUA 1FQOA 4YXFA 1XQVA 1VG0B 3CGWA 4MJLA 4UVHA 1IGBA 2QRGA 4XYLA 4TMZA 1T6XA 5KNBD 2POKA 1RLJA 1IOZA 4NENB 4EEZA 1BRTA 3GDOA 2FE4A 3EDQA 3TJZA 1FTNA 1GTZA 3SEFA 4EJ0A 1W1UA 5FOXA 4I8XA 1N8NA 4HD8A 4LMRA 5FFNA 2XMBA 4D4JA 4XVHA 3IQEA 1I4EB 1FDOA 2MT9A 5HQ3A 4WKBA 2C58A 2VSFA 4ZD6A 4HBGA 3WZLA 1K88A 2BTEA 1NBME 4UBIA 2GCEA 3N1UA 3FUVA 1BN7A 2ADMA 4LKOA 2OFOA 1Q1QA 4UUPA 1T24A 2H07A 4PLFA 5EHXA 3JU3A 1POWA 1X1TA 3H5TA 1NPYA 3SZUA 4HFMA 4IDHA 5J5AA 3CW9A 4M9UA 3KR0A 4FGWA 1D2CA 4KSCA 2QNIA 2ZRQA 4B5PA 3FVTA 4B6RA 1O5TA 4D56A 1RWBA 3K9FC 1ULSA 2PANA 2G9RA 3OPMA 1QWOA 4M6HA 3PNBA 1L7DA 2FHPA 1Q15A 1NL3A 3W2IA 3DAHA 1PW5A 5AW1A 3SQNA 5BWBA 1R3DA 4GWLA 1CPYA 3KPUA 1D5WA 2VZ9A 3LS2A 1FXWF 2Y1DA 1ETUA 3H87A 1XLVA 4UCFA 2PGLA 2P1ZA 1RHJA 1E5VA 1LSSA 1FXSA 4TTTS 1QHHB 1M9NA 2JA1A 2C1CA 1W76A 3VHXB 3OZUA 3ZHZA 3GUVA 3SLRA 1RHRA 2YNMD 4I50A 1RIFA 1Z8LA 2A30A 3GG2A 2BJHA 1ZWKA 3IOYA 3LQ1A 5ETJA 3AYXB 3OUZA 5K4AA 1XEWY 3EDOA 1ADCA 1CQJB 2R00A 1L5HB 1OC2A 3AMVA 2GEFA 4TUYB 4FYIA 4E4TA 4E2ZA 4Q12A 1W85B 3KV1A 1IVYA 3Q3VA 4HDNB 3H5WA 1GRNA 2BGUA 1TVCA 4MR9A 5F4ZA 2OHVA 5AVZA 3BMOB 3TNLA 1BJKA 2I54A 4FGJA 1CK4A 4AK9A 4BE4A 3F6EX 4US0R 4TWEA 3I4LA 4G4SO 4D9IA 2B4AA 1OD6A 3L9WA 3DPSA 1NMTA 2GASA 5TVGA 1XP5A 1UEXC 2FSVA 3SEZA 1M2GA 3HUTA 1N6NA 3H0EA 3DJYA 2ZWPA 2YYSA 1H8EA 1AV7A 3L77A 1PJRA 1NQ5A 3ZGLA 1NXOA 4YRKA 1KJNA 1ILWA 1FXUA 1SUSA 3H8VA 2FKAA 4XPIB 1W4AA 1VCOA 2CHUA 3DA8A 2EVNA 1HT1E 5AFSA 2XZDA 2B7BA 3DEIA 4EX7A 3VPGA 3WGOA 3DV9A 1XEXA 4F91B 4L0CA 3PCRB 4JITA 1ULUA 4LJ9A 1Z45A 5LZ4A 1A8PA 3G0IA 3CH6A 1NURA 2UUPA 4BZXA 3SHQA 3KUCA 1FU4A 1IATA 3UJ9A 3B1ZA 4BO6A 5TRTA 2RH9B 1SGWA 1WQ4A 1KC1A 5GV7A 3KTDA 4QLBA 4DBVO 4KWIA 2REBA 2R44A 1ZK4A 4BMYA 4ZOQI 3VSBA 1FNDA 3WNCA 3OHSX 4PZ9A 2PUWA 1KERA 3FYTA 2X4IA 3IPRA 2E4AA 2RI6A 1GZUA 4RENA 4U9IS 3ECSA 4BWGA 3ZGYA 1U2GC 2PQMA 1J2YA 5K2OA 2X3YA 1UM9B 2I2FA 3CKKA 4YO7A 5A06A 1BS1A 1T4BA 4ZREA 1Z4NA 4A6EA 3UZUA 4G63A 2E1RA 1BMFD 1TZMA 3HEMA 3O8BA 2DWQA 3HACA 3IE0A 4MCSA 4P4SB 2JLMA 1YZLA 3JRUA 3EDMA 4JS0A 4X65B 5DYWA 4C68A 1FX1A 3DBVO 3WGTA 3DSRA 1KMNA 1N2GA 5I4KA 1I1HA 2FPGB 4YB8A 2L82A 4OBEA 1YUNA 1T0BA 2G25A 4S04A 4HZUB 5KYVA 3PYXA 2J3EA 2J6HA 4CMCA 1TXGA 5DNCA 4N47A 1G2PA 3W0LB 3BH6A 2ORED 1E79D 3WLMA 3L7DA 4X94A 3EPHA 1YQXA 3LCMA 3JALA 3VU9B 3JPYA 3VHLB 3D3SA 2ZLBA 5A3QA 1SXHA 5KOJA 5A4IS 1W8DA 4G0YA 4CQLA 4HAWA 4A6PA 1PV2A 4CAWA 1ABEA 1QAMA 3DMGA 1X14A 2ZIAA 3GF4A 1YVUA 5KYUA 4UVDA 2RARA 3PKZA 5TT0A 1BDJA 3H1EA 4KGDA 3EXHB 2IE8A 4H1WA 1H5NA 3WOVA 1S3GA 4AI6A 4RUHA 1T25A 1N5MA 3SPXA 4ZVSA 3O8NA 1QSMA 1P0HA 3ZCTA 2P8SA 2QD4A 1EQ2A 1HL3A 4KIWA 3ACDA 3I1JA 4PCUA 1TU3A 5DOZA 1KEKA 2YJ4A 2PUTA 2WPXA 3TI9A 3LY7A 1CDOA 2CDBA 4G2NA 3K5PA 1UKBA 4P4EA 3REGA 5E4JA 3QVGB 3VPSA 2JEWA 3IODA 1XHLA 5FPHA 1U3TA 2FN9A 3BMNB 2NXEA 5CX4A 2BHTA 1B23P 4Z49A 4PFQA 4AN1A 3LYLA 1RIIA 4NESA 2IXTA 5KQSA 3KAQA 5ILGA 4JUFA 3IHWA 2C4HA 2F48A 5DSTA 3TMAA 4D9GA 1E20A 7GPBA 1LVHA 3WO1A 5D29A 2F6RA 2FNAA 3HNRA 2GANA 4X3PA 4PPGA 4QRIA 2GD6A 1NP3A 3PQ4A 1RU3A 4X93A 1DMSA 1XZKA 2XITA 3AF2A 2WU4A 3F5MA 1YJ5A 1GFIA 2BFDB 4KOUA 5K3DA 2GHRA 3NETA 3ESCA 2F4VB 1SURA 3ICEA 4OJYA 4G81A 3H8GA 1ZNWA 1NJ8A 2GM3A 5AKHA 4L51A 3K16A 2FEAA 4ZP1A 3RS2A 1C1DA 4G67A 2ZEFA 1E7RA 4US1R 1Y3HA 3FVLA 4IOJA 3UYLA 4N7JA 4N8DA 2M6LA 1TMYA 3H4IA 1Y42X 2I6TA 1LF0A 4AF8A 3TGLA 3ZOZA 2GHQA 3L4EA 4KCGA 3L1KA 4H7HA 4IWNA 2YZMA 4D57A 4N3BA 2ZRKA 3K9HA 4FZJA 5MFPA 4YJ2F 2PKXA 2VJCA 1MVNA 3ZQUA 2RKOA 2UVQA 4GU5A 1B8OA 1DTWB 3ET5A 2RC6A 1XMBA 2BEJA 2EG5A 4IR7A 5H3HA 3TSAA 1RKQA 1MEOA 3B89A 2L19A 5GAJA 2JKZA 3AJDA 2WPWA 3GAAA 5AVRA 3CWZA 4F7WA 3W5SA 1VJ0A 2BM1A 4IV0A 2P6EA 1OPRA 3QVWA 4PAGA 1JEAA 1GTVA 2DBZA 1UXKA 3L40A 1OV4A 4IO1A 1DAPA 4RTPA 2WWXA 5DTEA 4PG4A 3KQWA 1QIDA 3CNQS 4UFNA 2NN3C 1V43A 3B7PA 1M8GA 1IHDA 3MCTA 2WTBA 1DAKA 4PXBA 5AJVB 1SHUX 1K63A 2XKBA 4IF6A 1TM4E 4I7EA 1SA0A 2NXCA 3AEUB 1E6KA 7ABPA 1QMPA 4ZYXA 3CMCO 5AKYA 5CEFA 3E2PA 3P9IA 2QVCA 4HC4A 2IHJA 1NLUA 3IWWA 4HNVA 2HC9A 2YFYA 2F1HA 3C2QA 2J08A 4BNXA 1XTQA 1JQLB 4OCZA 1WUHS 5CNIA 1TZKA 2VZ8A 3N8KA 2HHLA 8OHMA 4YQZA 2QVPA 2D0PB 1S1MA 1NQXA 3NOQA 3G5MA 4LRQA 4TMXA 4INPA 1Z7WA 3KVYA 3Q7EA 3M6MD 1HV8A 4G8CA 1W52X 3WL7A 3WC4A 5G3YA 5DYTA 5T3UA 4K9LA 3FTQA 2BEUB 3GYBA 2GD2A 4ITRC 1V41E 2R1ZA 2ZXVA 5JMTA 2BEIA 3B12A 2GVDC 1M6VB 4I55A 4H6VA 4OLJA 4LQGA 3NBXX 3R6WA 2V59A 3PPVA 1WBDA 4KPGA 1QHFA 4LXIA 1HXHA 3PB9X 3FOFC 2ZBDA 4MBUA 1MQAA 6AT1A 3ZW9A 4INZA 3N8IA 5K4HA 1K2WA 2WSMA 3CRZA 3TTSA 5EIFA 3DHVA 5I5GA 3LLSA 5K9ZA 3UPTA 3FNHA 1FP1D 1LB1B 1UR5A 1D2RA 2V7BA 3KPVA 1QYXA 4W5TA 1UP6A 3EHDA 3JYNA 1D09A 3ESYA 4AJOA 8ADHA 3KB6A 2PUDA 5T4FA 3RJZA 5AJYA 3EULA 1SKBA 2O5CA 3PDJA 4Z9BA 3P0EA 5KTMA 2WHPA 3NJRA 3BMXA 4Z99A 3WYCA 4JI6B 4BWFB 2OAEA 1Y3CE 5J4KA 4X45A 4OU5A 3FYCA 3C6ZA 3D4OA 2IQ5A 4MROA 2CXAA 3ICCA 4KH1A 3V00A 5BNTA 2CXHA 2A88A 4CEHA 1KMHA 2WNSA 1M2EA 5EESA 3STXA 1UPBA 1T6NA 2G4VA 4BCBA 2ANBA 2ZANA 4TLEA 2ZQYA 4MAAA 1MTOA 5CFOA 4XGQA 5EZYF 4X00A 5A04A 3EFHA 2VSOA 4A82A 5FQNA 5AQ1A 5K8JB 3O26A 3K94A 3CRMA 3HR8A 4L73A 2A1TS 5DHSA 3TYXA 3V42A 3H11B 2YIVX 1EGMB 5DNEA 2QQFA 2PFSA 3VMFA 4HGOA 3RSQA 3G5AA 5H9VA 1CQZA 4GX1A 1CCWA 3H5VA 4PG5A 1N5RA 3MUFA 3THWB 1SOWA 1S8NA 5CDSA 4D3FA 3F6BX 1WV1A 4LWZA 3IAAA 2OWEA 4BP3A 2XQKA 2OCIA 4IUCS 4FUTA 3ZEIA 1EHCA 2ZIVB 3QBJA 1JHQA 4WNYA 5DTJA 3UTCA 5DRYA 2XMRA 5A0TA 4IY1A 3AW9A 3ORYA 3EB9A 1UDAA 3HKDA 1XRJA 3CVYA 2JAOA 1JHUA 4C0SA 1NBOA 3PNOA 4YV2A 4JJXA 2O7VA 3SQLA 2SCUA 3K1AB 5YASA 4EYOA 2ANCA 1L4MA 5TQ2A 3N2KA 2V8GA 4IHJF 5CB4A 3WGZA 3NM4A 2Y6VA 5I7VA 3RV4A 1O08A 4OREX 3VO1A 4X7MA 1WDKA 4MW7A 5KTDA 2OKGA 1LCPA 3ZDDA 2Q99A 1NN3A 3I1FA 2Y67A 3M7IA 5LXTF 4IVQA 4X1KB 3IP3A 4CDMA 2ZUDA 2G77B 5KMGB 3DZCA 2JB9A 3OBIA 3SHOA 1RP7A 2B4YA 2GPSA 4OAQA 2VSYA 4I36A 1QHIA 3R7SA 1LD3A 2VP9A 1V8ZA 1BFUA 4BNHA 1KMQA 2DJ5A 3ZU6A 4JJ7A 1Z4KA 3JR7A 2FWPA 4P83A 3D4PA 1U8FO 1ZH2A 4CCWA 1PHRA 2VNAA 1YZNA 1DE4C 3HJHA 3JS5A 3O8QB 4PXDA 4JQZA 2O50A 3UANA 1UJ6A 3T0GA 3EDYA 1FUEA 5CHEA 2O19A 2YZGA 3ETCA 4D9EA 4KFUA 2CHFA 4DQ0A 2V54A 2V74B 2YVUA 4RLHA 3VYTB 2OHJA 5K5EA 4MXDA 2QP9X 5MDHA 2DY0A 1N71A 3TQIA 3ZIUA 5IW8A 3LXUX 4E03A 1IONA 1KP9A 2AFXA 1C7RA 1XYVA 1QZ3A 1D6SA 1O6FA 2MSLA 3MTGA 2PRSA 1YTUA 4KEAA 1NJ5A 5AUQA 4URYR 3NDRA 3KLOA 4YECA 1KHHA 4EBFA 2WG2A 1I24A 2IHYA 5ALSA 2VWQA 1AGPA 1G5QA 5ICFA 1IEQA 1V71A 3IPAA 5GONB 3GLGB 1KJYA 1N0WA 4KUHA 4JGIA 2VQ6A 4RK5A 3FTCA 1RTTA 2J3DA 4CZ2A 3ZE8A 1YJCA 4L16A 1A9RA 3U48A 2R8YA 1O95A 2XX3A 4R7TA 4MO2A 1SCAA 3B1JA 3SKXA 1FCJA 1KFEB 1GQQA 2PAFA 3K3PA 2ZSDA 2XOKA 4JT9A 1EK6A 4EHIA 3ZGNA 1E1QD 4GE3A 2CCJA 4A8JA 1F2VA 1IY0A 2A14A 2ENWA 3A4VA 5LP6A 4QQ8A 3RF7A 3ECAA 4HQRA 1DBIA 4RS4A 2GRJA 3F1LA 3B2QA 1VLQA 4DA9A 2YDXA 4Q7LA 5LD2C 4UF4A 5JO0A 5AK5A 4BC1A 4Q9KA 4MDEA 2IKSA 2V7QA 4DCMA 3LLCA 4FYPA 3HWRA 4L7QA 1KZ4A 1SC4A 1M75A 4MUMA 2UKDA 1O54A 3ZS9A 5CLGA 1GR1A 4QJIA 4WXPA 4NBVA 3B3WA 4B3XA 4DDHA 4DRXB 3NHKA 5DHPA 2XADA 4CDRA 3G9XA 2CXUA 4FNGA 4WV3A 4ZEWA 2GPBA 1SNYA 3AVWA 1BXGB 5AUOB 4MV1A 1P29A 3ETLA 1R0KA 1PUXA 2BFOA 2ZGVA 3ROGA 3ITDA 3N9IA 5TDHA 3PGMA 1U2DA 4WBXC 1M1NA 4U7JA 3NALA 3Q1LA 4E12A 3QE0A 1BZYA 3EF3A 1ATZA 2PL3A 3L0YA 4HNAA 4KNWA 2NAFA 4KMRA 1IY7A 4UTVA 5CURA 4TTAA 2PGXA 4ND4A 2E6UX 3UV6A 4QU5A 2RHLA 2ERYA 3RODA 1SBZA 3ZUPA 3ENVA 3KU1A 3L7MA 1IRIA 2TRSB 4Q3AA 3IT1A 5IKXA 3GUHA 1Z6PA 1KSJA 3R5TA 2BHRA 2OAGA 3ZLJA 4IOMA 3DM9B 4XIJA 1HYEA 5ITVA 3JQBA 1GGKA 3T3PB 1XMJA 4R84A 2QRMA 4LZPA 2PJ4A 2Z1MA 3K8QA 2R4TA 1MO5A 1XHFA 3HE3A 1LFWA 4MA5A 3CVVA 3F74A 3Q85A 1VHTA 3QSYA 1GUDA 4P5DA 5ESWA 1Z5GA 3HB7A 1QG2A 3C14C 4D3SA 5HZGA 3ISZA 4AS2A 1MJBA 4MJ7A 3RFTA 1U28A 1B87A 3JQ9C 2WB2A 1P91A 3H1GA 1JQAA 4BTEA 5EJ8A 1LI5A 4G8JA 2IV7A 1IXKA 1EWRA 2BBWA 4DE5A 2Q4OA 1CG6A 3FFBA 1R12A 3MJRA 1UZNA 1JLMA 1EG2A 5L3QB 2IW1A 5DISB 1WPXA 4Z9YA 1P1RA 3GY9A 2NTNA 1P2TA 5AVWA 2O7SA 1QGUA 4KE9A 2I2XB 2ATIA 3T3OA 1QE0A 1GPNA 3W90A 1C4KA 1WMSA 3HEBA 4KVOE 1WXIA 1XCMA 2GM5A 1ZGHA 5KOYA 3VKVA 2CVZA 2AQIA 4B6SA 2GX6A 3ZHQA 3O9MA 1UDXA 4Y6QA 5DLQC 4OIWA 1GKYA 1Y7HA 3LNCA 4MQ6A 3K92A 4C4OA 2BE7A 2VDMB 2DQSA 1WBJB 1PFWA 4JQCA 2F1IA 5ITWA 4YUZA 5AI8A 3DDSA 3STYA 3L9XA 2EGHA 3MQFA 1DRUA 3LWUA 3OC0A 1SC1A 3CUEF 2C77A 1LK7A 4UTZA 1ZICA 1RO5A 1YRYE 1Y8CA 1CXZA 4DY6A 1E5LA 2I4MA 2ZRLA 4IIJA 2PR7A 1BA3A 1JHPA 2FH5B 4YJFA 3T8YA 4XB1A 4CW7A 4HNHA 1Z2AA 3EZXA 4I3FA 3C5HA 1HR0B 2HBYA 1JQ5A 3B78A 1HQYE 4Z4FA 4YI3A 4ASUA 4PLGA 3OAAA 2X3UA 1R6AA 3V7FA 5JNLA 4ARBA 3UOGA 4CIXA 5D84A 2O06A 3OO0A 1NC1A 1NSLA 1ZSYA 2I4LA 3I4CA 1GQFA 1KJQA 2AUTA 3DVQX 3I2FA 1Z0IA 3TTVA 4TTPA 4MS1B 4C1BA 1GXSA 2E37A 1L4HA 3I2YX 4D45A 4OO3A 3DE2X 3OVMA 1MQ8B 3L4KA 2VXBA 3V2IA 2H3EA 3KSMA 2JLVA 3C7TA 2CKDA 2YX1A 1ADGA 3B1VA 4MICA 4ZT7A 1EZ4A 2QORA 5FBZA 4MS3B 2NUPA 3BWXA 2JLUA 4B79A 3W2EA 4KV7A 2ZJOA 3IV7A 1ENYA 3IAEA 2WIAA 4C6TB 4RJ2A 3DBRA 4TSFA 2VHCA 3LBIA 1S7FA 4PO8A 4RVNA 4WCFC 5BRNA 4K9PA 4ALMA 3HJBA 5FUYA 4C88A 3RHSA 1PYDA 3G1WA 1JIJA 4Q66C 4ZCTA 5IN5A 5BUQA 2K2QB 1PLJA 1MRSA 5CB8A 1RRGA 3LZCA 3W9BA 1EQUA 1EWYA 4GM1A 4QM6A 3GGGA 4GDFA 4LNHA 4K05A 3N0VA 4PQYA 1WPRA 1RKVA 2B94A 4IQ8A 2EZUA 4CM9D 1KP2A 1MU0A 2WKSA 1WPGA 5U9CA 1UEJA 1RCTE 4MUYA 3MGGA 3OTIA 1KWKA 1ZXLA 2G28A 1IBMB 3DAFA 3LGAA 2OFXA 3FUTA 3PI7A 3HBLA 1OZGA 1OV6A 4BX8A 2DGDA 1ZOSA 4HUJA 2A4MA 3TTWA 5E2AA 3OOHA 2P9FA 3U1VA 4IJ6A 3LIIA 2B21A 4WL0A 1QB7A 2VJOA 3O21A 4JOCA 1G4UR 2WQ7A 3C6QA 4L4XA 3TL6A 2CXRA 3M49A 2QZZA 4B3IA 5THKA 1ZC4A 3EZ2A 3K0AA 1GA1A 1E0AA 4MVJM 1F8UA 4AQYB 1YR7A 1LW7A 1N0IA 2H4JA 2QN8A 4K1LA 1IAQA 2D8AA 1EUDA 3UMFA 3RT9A 3L6DA 2TYSB 4BFVA 2ZJAA 3DCJA 2H4WA 3T06B 2GEVA 5IVDA 2XNHA 3G0BA 3FNFA 1KYIA 4LRXA 2VAXA 4NYIQ 3OF3A 2YZNA 1OXMA 2Z5LA 3T12A 3UKOA 3IULA 5LLSA 1TEHA 1QGDA 5B7PA 2G5CA 1H4VB 3QFHA 1DG3A 4MA0A 3JAWA 2QJWA 3U56A 1V8OA 3VISA 3BOSA 1UBSB 4L9AA 3CJTA 2PH5A 3SYLA 1RXYA 4JQYA 5H59A 1PSZA 5CR9A 2FRDC 2DLNA 4KRFA 4MKIA 5FYQA 2PZ8A 3MGBA 5ICCA 2NVWA 1KOFA 2KI5A 4G97A 2OR4A 3KL9A 1SHJA 4IINA 2XTAA 1C7JA 3BIFA 4A23A 3RHTA 4CLRA 3GRRA 1ELLP 5EMKA 3CZQA 5IZCC 3CWCA 1GG2A 1YRWA 5DN6A 4HG2A 4Z0PA 3B3GA 4KAAA 4H6XA 2AKAB 2PVWA 1ZJWA 4GGPA 2FPPB 1JB1A 4ZYQA 2FR0A 3WA7A 3SQDA 2JK0A 3Q40A 4PQAA 1OI4A 1M0TA 4OEHA 1SY7A 3INYA 1CD5A 1LZKA 1ZG8A 1CLUA 4Q4JA 2Y92A 1SHTX 3CF2A 4IDDA 1P75A 1K4JA 4FOTA 3A25A 4XDZA 4P44A 3I23A 2HO4A 3UWMA 2WSYB 4UCXA 1TKFA 1T2EA 3PTLA 3EUWA 1KIAA 1I1NA 1TI7A 2WSSD 1UT8A 1ARZA 2J6BA 5HF5A 1U1EA 2WUEA 4QULA 4M54A 3PBBA 2AR7A 3F4LA 2JCVA 3LCCA 1U6MA 1NSTA 2MOKA 4G65A 1RYNA 2X8JA 3ZHRA 4YCLA 3W34A 3R9GA 3CLVA 4A2QA 4BFCA 4C4AA 2C97A 3VOTA 3AY7A 3SIXA 1B6TA 2AUMA 5TGZA 3ZKWA 5EERA 4JR1A 1FSPA 4P3KA 3CNNA 3VX4A 5BT8A 5K3AA 1N5OX 2HWKA 4KXLA 3LDUA 3H6GA 1T3HA 2GZ3A 5KI6A 3UAOA 2PMCA 2FZ4A 4MHSA 3THXB 4UASA 4F4JA 1CE8A 2JCBA 4JD5A 2ZRMA 2JAXA 3R9FA 3N2GA 3V4PB 5JZ9A 1RWVA 4KQ6A 4MVXA 2BRUA 3NYIA 4FGUA 5FNVA 3TAUA 1VJTA 1J0EA 1GD1O 5J5CA 3UA4A 2HZ7A 5ALPA 2GB4A 1I4LD 1IN7A 2I6FA 2ZJ8A 4TTQA 3NEAA 2OSVA 5HS4A 3GVHA 3L4BA 3HU5A 3PXBA 2ZJ0A 4AURA 5K3FB 1G8GA 3CUSA 1NM5C 4ALKA 5KSZA 2XWQA 1L8OA 1X7XB 2QW8A 2YC2C 3A4TA 4DV0B 5LMUB 1WW3A 4HLQB 1D0SA 2XB8A 3D6VA 1AVTA 5HBGA 4CAXA 1DHTA 1WZUA 5B3LA 4ZDKA 4OQYA 2HCRA 3VTKA 2VUHB 1OC4A 3WLQA 2AEMA 4JP1A 4ENUA 5KPJA 4L4YA 4Q05A 3LTEA 1N2CE 1WE2A 2IV3A 2BTQA 1Q2XA 3ESBA 4PBRA 4Y1RA 3T9BA 4YRSA 5KWEA 3OKFA 3TZQA 1RAIA 2GEBA 1RQPA 4CRYB 4X20B 4FP9A 2KE5A 3WOHA 4PEVA 5CDGA 4PYQA 4RY8A 4DMLA 5BWCA 3NH5A 3T5BA 3GVXA 3Q8LA 3IP6A 2QDXA 5UKDA 2QYSA 1S5KA 5BORA 3FMOB 2WW8A 3UXMA 2MTBA 2OENG 4HAXA 2CFCA 3UOWA 1EX9A 5DX0A 3CKYA 3T1OA 1X12A 3QQPA 1DFIA 3L8YA 3ZZUA 5HM8A 1RYEA 4RVSA 3OECA 1N5DA 3QWAA 5C8XA 3HHEA 3QXSA 4BRSA 1XDBA 1YNOA 3P2MA 4AMZA 2L18A 3BYZA 4G8BA 5FOTA 4U6SA 4MYHA 4RY0A 4UXHA 1RI2A 3BGSA 2RH4A 4OUDB 3ZNPA 1I2AA 3V97A 2NVOA 2Q1UA 2HA3A 3DGFC 1QIHA 5EXXA 5CA1F 3LPLA 1SHKA 1IVNA 3UHJA 2WBLC 3FCYA 1CG2A 4MHNA 1MABA 5E1MA 1ZA1A 3KLNA 5I7RA 1Q44A 4F5ZA 1DXHA 1M4LA 2Z4RA 1YFKA 3V4VB 2ONCA 5K8NA 1XTJA 1GNPA 4F6RB 3KBBA 4E15A 4F4FA 4XWTA 4OQLA 1NOIA 4RH3A 2G4CA 5EIBC 3FY4A 4E51A 1OU4A 4R2IA 4YRFA 3FCAA 1C5KA 5F48A 3BXZA 4BKMA 4PN3A 5K8IA 2FUG1 3PFIA 4XVQA 1OI2A 4Q4CA 5HF8A 5BR1A 5KKCA 2O5EA 4ZRDA 4MW0A 1E66A 2O8BB 2B3VA 2CLMB 3N2EA 4OLAA 2C1EA 2P9HA 5F64A 4GKJB 1PVOA 5GZ6A 2K4MA 2BGWA 1JEYA 2IDJA 3ZU5A 2QW1A 3IIJA 3PNVA 5BSUA 4LDPA 2BGGA 4ZC8A 4H0FA 3PLAE 1AY0A 1GNRA 5BNZA 1IY9A 4TSRA 4KR7A 2QDKA 1KYZA 3D31A 3RSFA 1F60A 3ODPA 3VU8A 1LBEA 2J3LA 3GCXA 1GQOA 1Z83A 3GROA 4KXYA 2PJRA 3ESDA 3NP9A 1W0CA 4BX0A 2VZYA 4V0KA 3JQ6A 3STTA 2WF6A 2DFNA 1G7RA 2LIVA 4A16A 1T1GA 3EVFA 2HA7A 5E4TA 1VQ1A 2OUIA 1R57A 2AD5A 2OXRA 1S96A 1CFZA 2LR0A 3FAZA 2B8TA 4F9VA 4MA4A 4EFDA 3UPDA 2VWGA 4KMMA 4CLXA 4IOLA 1MHTA 3F9CA 4GKAA 5EIBD 3NATA 2C31A 4U7PB 1GPBA 4QUGA 2YQZA 1NX6A 1N4DA 5HXDA 1EWQA 3WV4A 4YCJA 2VTBB 2B4BA 3WIVA 2GH1A 5E7IA 4KQ2A 1LNQA 4XQ0A 1UC9A 3PFHA 4CGOA 2XOXA 3GIWA 3PUKA 1XEAA 1CUCA 3CA8A 1CP2A 4XE5A 3LVBA 5KYTA 1UKZA 2RCNA 4QSHA 4GBGA 4JXQA 2AS0A 4GUDA 4KQXA 1QJ4A 4EL0A 1NQAO 2Y1WA 3GL9A 2C95A 1OCEA 1W59A 3FGZA 5KDDA 4TXLA 1XZPA 3AUAA 5LMCA 2BLNA 4OH1A 4F5YA 2WJ4A 2YQ4A 3R7AA 2ZIGA 3TR0A 4RA6A 4BE9A 5JISA 3QE9Y 1RTQA 3C39A 1Z5UA 1NQTA 3RG2A 4B8WA 2R0QC 5JS2A 1W96A 5K03A 2BFFA 2ZBEA 3LCJA 2AIRA 3RVKA 3SXJA 1OTXA 3W78A 4AFNA 1HKHA 2I80A 3CEJA 5C1IA 2CNMA 4DJDC 3LBNA 5LDGA 1W4ZA 2B2CA 4TVSA 2Z3NA 2E85A 4P0TA 4X8LA 5C1DA 4OD0A 1X1CA 4DHWA 4AWBA 1NF9A 2CE7A 4WI1A 5ED0A 2BLLA 4DLBA 2YNMC 1H85A 3KCQA 1TVKB 4OB8A 4K88A 4IJVA 3EZYA 2XXJA 4I1IA 4HYEA 1OXKB 4WFJA 1C3XA 4IDPA 1LXCA 3OCZA 2AG0A 3VOAA 1TC1A 1RJ9A 3ZW8A 4DMGA 4IXWA 4QPJC 4DM4A 1PP4A 3HCBA 4OHYA 5J2UB 1OWMA 1Q12A 3GZJA 4KFRA 1FYWA 4TLDA 1VKNA 4M1QA 1P4RA 3L43A 3NNNA 3MYRA 2XY4A 3U4QA 3E82A 5T3YA 4RBNA 4TKUB 3AW8A 1QV7A 1UBHS 1WMBA 1M1YE 3GW8A 2QX8A 2AG5A 3R0IA 1EAYA 5FV4A 3K35A 3W79A 4RW0A 4X1IB 2YXNA 4N65A 1P7WA 4F38A 5DHTA 4RPCA 1SHZA 4IJKA 3X1KA 4EY3A 3GBPA 1AGXA 1J1UA 3CXSA 2X8BA 5FJJA 4LXHA 4QU0A 1MJFA 2HF7A 1YKSA 4A8HA 4LVOA 5FI5A 1GYRA 4QBHA 1K4YA 3DBLB 1YQEA 3PTAA 1Q83A 2PHZA 5ADVA 1EP2B 3PC6A 5BW4A 4D80A 4DLAA 1FFSA 4RD1A 4UOQA 1R0SA 2E0IA 4U2BA 2J1LA 1KQPA 2FZLA 1MBZA 3VHQA 2NO1A 3GVCA 2CTBA 4ND3A 4QRHA 2NM0A 1R9NA 2O54A 1ADJA 3OLVA 4LZZA 5E0KB 1WR8A 3HA5A 4A3SA 1TOAA 1G1AA 3RI3A 3AEXA 1S2OA 3BC1A 4FWBA 2QB5A 4FFNA 3O4GA 2D8MA 5TQ0A 3R9IA 2JFZA 3RK0A 2WHRA 4UTNA 1PJ3A 1QYCA 2VT7A 3IEPA 2OO5A 2Q49A 3RBVA 2R6R1 4KO2S 2AOXA 4RELA 3IU2A 2IYXA 3JYHA 4MV3A 3NTXA 3VNQA 4D7AA 3EWSA 1XYGA 1SVWA 5JOQA 4BV3A 2COUA 1H2BA 2JLWA 4LX8A 3N0WA 3B9BA 1TIKA 3WMRA 1CRZA 2A35A 6ABPA 3E2IA 2QJTA 1YULA 5FTNA 2OHIA 2ZENA 5CYFA 3VXKA 3LPDA 4GPD1 1U1DA 5A4FS 4BUZA 5FBVB 1NLFA 4R81A 1CB0A 2CFIA 3MQ2A 2J67A 3RSLA 3R9EA