2GFQA

Structure of protein of unknown function ph0006 from pyrococcus horikoshii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
288
structure length
288
Chain Sequence
HSSGRENLYFQGHMKVIMTTKVDKASMNIMNKLIENFGFKETEYVFEGNPVYKRGDVLILTTNDEMIYYDYLDREIENQLGFKPEIIAFASRHSSKQKLPALTTHVTGNWGKAMYGGKDESFAVAIPSAMKLSLLKMSELNDLGWTVCYEATHHGPTELEVPSFFIEIGSSEEEWINDRAGEIIAETIIYVLDNYEKGRSKFKVALGIGGGHYAPKQTKRALEGDLAFGHILPKYAQPVSRDVMIKALNRFGEKVEAIYVDWKGSRGETRQLAKSLAQELGLEFIKDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of hypothetical protein ph0006 from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords UPF0204 protein PH0006
total genus 107
structure length 288
sequence length 288
chains with identical sequence B, C
ec nomenclature ec 3.1.1.96: D-aminoacyl-tRNA deacylase.
pdb deposition date 2006-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04414 tRNA_deacylase D-aminoacyl-tRNA deacylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold AF0625-like 2gfqA02
3.40.630.50 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase AF0625-like 2gfqA01
2GFQA 1YQEA
chains in the Genus database with same CATH superfamily
2I6XA 4Q1VA 4FHDA 3D3WA 3SS8A 2DHDA 4E2ZA 1O96A 4UFNA 3ANSA 2IFTA 4M9QA 4OPMA 3DYIA 2GK7A 4NYJQ 5FI3A 4F2PA 2VKTA 4XIYA 2IEIA 5IUNC 3IT1A 2R00C 1NQVA 2W2QA 4H0NA 2NU8A 4D80A 4HS4A 5A9TA 3GEPA 3ZKAA 3RRBA 1JIJA 1U7ZA 4QJ3A 1GTZA 2XDQB 3EVFA 4D82A 2C31A 2HK8A 3AV3A 1MIOB 4M9UA 3GLGA 3KB2A 3V4FA 3NBQA 1Z36A 3IPCA 4TYPA 2UYOA 3OZBA 3PKIA 2VYNA 2Z1MA 4JP2A 1K63A 1LK7A 4K86A 3VUFA 1VXRA 3R9GA 1D4OA 1ZCJA 4YP7A 4KXFB 1NAHA 1QAOA 2E6KA 2OCYC 2YV1A 3AR5A 2FJPA 2W6ID 4MFKA 1CUVA 2H4WA 4KXYA 5K3FA 4L5BA 2IJZA 1GEGA 3F5FA 4Y9DA 3AY0A 1WQ1R 1CJKC 1U2GC 3UVEA 3RWBA 4RPHA 5D00A 2BGWA 4MULA 5JZMA 1IBCA 3GFFA 1GQSA 1AB6A 2PZBA 2XWPA 3O4IA 2GHTA 5BNIA 1Z5RA 3AV0B 4RK0A 2FSVA 1PYOA 3NWPA 1XTZA 4BRUA 1M0TA 3EY4A 3CNQS 1D7AA 2QD4A 2OECA 3A2MA 3F7TA 5L7YA 2W37A 4GWKA 1SU4A 5TC4A 4JBLA 4DABA 4NZZA 2K7FA 4F92B 1QE3A 4BMSA 3VNBA 3GP3A 3WSVA 1UBLS 5C88A 2FI1A 4L9RA 4CLRB 3HJUA 3U80A 2QNIA 4UE2A 4HVLA 2Y3IA 4JWKA 1G6Q1 5K8LA 5AI6A 4DB2A 3I5AA 1ELLP 3OA0A 3H13A 4D4KA 1C9YA 2CSUA 2FKNA 4Q7LA 3THYA 2RGGA 3BWXA 4MUMA 4CLOB 1TCUA 4CM3A 1XFDA 3CXSA 1O97C 2PZ8A 5F9FA 2AE6A 4TWEA 2DUUA 5HJ2A 4EB6B 1KDPA 1GG5A 1ODSA 3T4UA 4X24A 3ZCUA 2JCGA 3QY0A 3EB9A 1UBTS 1EVKA 4L75A 5EMJA 1SUBA 3P2IA 3ZBTA 2VHYA 4E4YA 3SQLA 4QUIA 4B3TB 2CCKA 2JLMA 1HO3A 2BLLA 5HIJA 4Z0PA 2EP7A 4RCZA 3KSAC 3IHWA 1DGQA 1Q1GA 3SDSA 3ZD8A 1O9BA 2V03A 1QHYA 3HUFA 3N0TA 1K5HA 3WXMA 4B44A 4C04A 3URKA 1RZRA 2HWYA 4W6ZA 2P1DA 3L4JA 1WDWB 2EQ5A 3JVEA 3DDHA 3KPVA 3QV2A 3IBTA 4TT3D 3ZK7A 2ONZA 1AYEA 3MJCA 2WYVA 3JYQA 2JJYA 3QNWA 4O2AB 4DMFA 4BO6A 4AULA 4F5EA 2QM8A 5EIXA 4GDFA 1I4TD 1MB2A 3DWGA 4MKHA 4BLWA 2I67A 4B4KA 2B4YA 3NHZA 4ZQIA 2OK7A 2P9QA 2YNMA 1R0BA 2ZCUA 2DFLA 3UK6A 2XTAA 1KK2A 2X0JA 2ZK7A 4CODB 2C0CA 1Z6TA 3OEHA 2ARHA 3ECAA 1XK7A 4LE0A 4AK9A 3CKYA 1EAMA 2MWMA 3DBIA 2IYPA 2QLBA 1H2AS 2VRNA 3V46A 2VQSA 1K6XA 1AO0A 5DM70 2FW1A 1SULA 3FOZA 2OR4A 1TF8A 3AEQA 3KU4A 3PRHA 4QQNA 1P8JA 3Q7SA 2M6LA 3U5TA 3OZTA 4U6SA 3EH1A 1W2GA 4J2TA 3M89A 1YDFA 3RM3A 1I13A 1AUPA 1UZMA 3OQPA 2ZYGA 4H2DA 1D8TA 4RZ3A 3LX8A 4CEHB 2B30A 4Q1BA 5TEVA 4DCTA 4EX7A 2A58A 2X5KO 3KEQA 1RWKA 3B3SA 2PTHA 1FW8A 4BMVA 4CYQA 4W9NA 4KZTA 3P1JA 1EX6A 3L8EA 4JASB 2JDID 5HVHA 2OU2A 5E7MA 1O9HA 2IUFA 1FP6A 2AXQA 4KE6A 1CY7A 4NEXA 3FBTA 2PKXA 3RSFA 3M1IA 4M8SA 3D7SA 4TLCA 1IOZA 2GM3A 2RGAA 3IJPA 621PA 3PFNA 5EN4A 3LQ2A 2HA3A 4FU0A 5A3RA 1VPLA 2Z08A 3RU3A 1NJ6A 1WOYA 1H5UA 5BP7A 5KHLB 1XEXB 1BAPA 5BOVA 3FOAA 1NVEA 1P73A 1MX1A 1RABA 3FVQA 1LPPA 1KYIA 5JG7A 2J4FA 3AHJA 4B84A 5GCNA 1GT6A 1E0DA 2WTMA 3L2OB 1Z6ZA 4PS1A 1S2DA 1L8XA 2K6GA 4K26A 3LODA 3L4EA 3SEZA 1MX3A 3PNQA 3E48A 2A0YA 3MYRA 2PQMA 1HMPA 1UXOA 1DTEA 2OHXA 1G2OA 1I5OA 1RWXA 4GLBA 4D46A 4RH0A 3WLMA 5GIOE 1KOFA 4LJLA 5FNVF 3PXBA 4UBOA 3ZY6A 1T8UA 3F5QA 4PK3A 2BGLA 4JU8A 4BV8A 3JQAB 3WLRA 5ISVA 4N7JA 4AG9A 3PUYA 4YQEA 1QGAA 3C3AA 2FL4A 2OFPA 2PUDA 2BGKA 4JELA 4PSCA 5G3YA 1NHWA 2ZW9A 2VZ9A 3TFQA 2A78A 1KI1A 2WVAA 2NYQA 2RGBA 1SCQA 3CURA 3I9MA 3AJ8A 4JUDX 3K8OE 1SZJG 3U48A 4YCMA 4Y6LA 1AGXA 1LRZA 2II6A 3RUIA 3V33A 3X2FA 4BDTA 3UYKA 3C24A 5BO5A 1XAJA 4RSGA 2D54A 2H57A 1IM2A 3HN2A 1ZG3A 1FNSA 4OFZA 5HCIA 2IPXA 4NY1A 1JPNA 1K7XB 4NV1A 2Q5HA 4CUZA 3FIXA 2XIJA 2VSFA 1RCTE 2WINI 2MDTA 2WQZA 3A1FA 2ZZKA 2VL1A 4BGDA 3TE7A 5C8YB 4FEYA 1PN3A 2HFKA 4PR0A 2DPSA 4HDOB 2H7XA 2WA2A 3BHJA 3WK9A 1CUJA 2OO7A 2Y2UA 4OI2A 2PTGA 16PKA 1XEWX 1ZD8A 4NC9A 5EZ6B 4PYJA 4M53A 5AVZA 2CHFA 1TKRA 3FVWA 2G36A 3TOVA 2YV4A 3IR5A 5TT1A 4I8DA 3GHHA 4RPIA 4NTZA 3ICQB 4MCQA 1ORVA 5LLSA 2K5TA 4IDGA 5DISB 1CF9A 2X0EA 4HAYA 4X6UA 1QOPB 2NZXA 1ZDMA 3P97A 4EEZA 1QRSA 2HC9A 2IEYA 1QTQA 4R05A 3JALA 2IYWA 3T1OA 2C3OA 5EHNA 4Q3DA 2ZBPA 3WK8A 5LQRA 2YWHA 4DSTA 3IV7A 3LMKA 1SEVA 2WKSA 3CUSA 3QP9A 4WT7A 4AJLA 4PG4A 3I09A 3U1VA 4GL2A 1B6BA 3UB4A 5KNLA 3N6XA 4NOMA 2Z2YA 3RFFA 3EGEA 5KMGA 2WHPA 3C2QA 4EK9A 1FP7A 3GVCA 4ZHSA 1WV1A 4FS8A 5KWEA 1LLQA 4F45A 3LD2A 5FJIA 1LH0A 1W59A 2BGGA 4YQFA 1RCUA 3PFIA 4Z65A 1UK7A 3E0QA 1VMDA 3CV3A 2P2LA 3LFTA 1N8NA 3RROA 3LQKA 4Z3DA 2CF4A 3EPKA 4M54A 1YONA 4CKEA 2C2OA 4CKCB 2BCJQ 1EGQA 3K9HA 2IH5A 4URWR 3H8GA 1O6ZA 4NH4A 4EVSA 3K9LA 1GU1A 2C9CA 3WZ2A 5JUWA 5A4FS 3RIEA 4ZK6A 4IQGA 3NIBA 4CDNA 3I9SA 3TG2A 2OYRA 2ZOFA 4OTZA 4YO8A 2R48A 1DOHA 3QMMA 1KDYA 1Q7CA 1KMQA 4XM2A 4JBYA 2XCRB 3DHYA 3MG9A 2V7VA 1H2ZA 2ZVJA 3N39C 1OIXA 1EWTA 1ZUWA 3QOFA 3F97A 4D8XA 1ORTA 1FYXA 4NXMB 1CY0A 1DUIA 5GONB 4FJ0A 1G6OA 2JJ1D 2VPTA 3FYCA 1KYYA 4WDRA 1FBTA 1GTG1 1UADA 3RG8A 5KPJA 3CKMA 2AFIA 1HDGO 2IXGA 3DMTA 3HCAA 4IXDA 5HUQA 1JHQA 3LUJA 5TLSA 2D59A 3ZIUA 2E1PA 2AEFA 3DB1A 3QOYA 3R2JA 4D4MA 5BSKA 1BSVA 5DULA 1M1XB 1YTLA 1IBKB 4DVGA 1JYSA 2D1SA 1BQ4A 2HTFA 2WG0A 2BISA 5FWXB 1SHTX 1WCIA 1QKKA 3ITEA 2ZXUA 4HWKA 1TJNA 1UKCA 3AEXA 1NMXA 4RVCA 2EZTA 4MCIA 4WUVA 1GA4A 3U4GA 3ZJ4A 2PJ9A 1EQUA 2NYRA 2QA5A 2XVAA 2OV1A 1GU7A 4OQ4A 3TCXB 3WK6A 2IZ5A 3B3TA 2BM8A 1KZ9A 3F78A 1SCJA 2W4MA 4JT9A 4AWBA 1YQEA 1F0KA 4MUXA 2NVBA 5C46F 5ESRA 4WKBA 5H4HA 5SY4A 4F9EA 4OLBA 1CY6A 3MRVA 1NLFA 4IG4A 3T90A 3KZVA 2ZUTA 4RE6A 4B8ZA 3W8RA 5KNCA 1P91A 2BFOA 2F1RA 4GECA 4IAVA 4J49A 1YBHA 4JZYA 1Z7BA 2EZ8A 1WF3A 2QYTA 1TQHA 2MYPA 4MAFA 4KDCA 5F77A 4A91A 4D8UA 1NBMD 2ETXA 4RXTA 4JVOA 3UH1A 3PDHA 5DNUA 1C3XA 3W6XA 4RH1A 2XGOA 3ZVLA 1JRLA 2YNCA 1XALA 3F2VA 5IAAA 5TVGA 4R1UA 4BGVA 3GEGA 5DX1A 1YRLA 4E7PA 4FWBA 4AZWA 3PP9A 4PW0A 1G0OA 3E5NA 5ICFA 4ALKA 5LQCA 4RX1A 1PGNA 3OQMA 2V6GA 5IVHA 3ZWXA 2O4HA 2H8KA 3S7TA 2PMEA 1X12A 3G5TA 1XZKA 4ALNA 1CUCA 3SLGA 3BXOA 2JKVA 4OHVA 1K3TA 4WLNA 4EHAA 3SBDA 4CM8A 3IXLA 2QL6A 3QF7A 3O2SB 2ZREA 3I0NA 3U0BA 3QHAA 3HI6A 4LCEA 5EE1A 5FTLA 3SXOA 4X00A 2IIPA 4MIKA 1SU7A 1TF5A 4GOJA 2NU7A 2O07A 3K16A 3OZVA 3FX6A 4BX8A 3UT6A 4DA4A 1T8WA 3PZJA 1XO1A 3FETA 3X1MA 4GO1A 3A1CA 4HNVA 1CFJA 3EEFA 5AI5A 4OH1A 4UCMA 1SELA 1TUIA 1RXWA 5FB3A 2ZW6A 3NEAA 2FGKA 2KE5A 5JD4A 3LZ6A 4R98A 3RDPA 1L8QA 1PUJA 1GVNB 1Q6YA 1QV9A 3EARA 3AEQB 4BJ5A 4DTCA 3VYVA 2PAFA 4GLJA 3NNNA 3CF0A 4R9SA 3QVTA 4FGKA 1AZTA 1ZN2A 1RM4A 4BNDA 4M46A 3BUSA 1XEAA 2ATIA 5CHEA 1Z75A 4RVHA 5DTMA 3IE2A 1J0EA 5CEJA 1EIWA 3OO0A 1REQA 2QTZA 5KTSA 3TVDA 2ZENA 2AEMA 1ETUA 5DJ5A 1KEKA 1Y5RA 4H6PA 4B3DA 1F17A 3M5WA 1RXEA 9LDTA 3NRJA 1IJFA 1S7KA 1RJWA 1T4GA 4BBHA 3ELDA 4J7AA 3RCBA 3VTKA 1A5TA 1NBOA 1QZ3A 3P7MA 5AK0A 4DV1B 1YS4A 5BMOA 5IXSA 5M29A 4MV6A 2XVMA 3MJHA 4B74A 3HEMA 3OQOA 2ZYUX 2WG2A 2ZJ4A 4G25A 3R9XB 1RLOA 3RT1A 2Q6IA 4ILEA 3CLSD 1OVGA 2MCFA 3E9CA 3LD9A 2P6EA 4RDXA 2IQ5A 2CXAA 1QTRA 1W5EA 1J1ZA 3GA5A 3PQFA 5SY6A 5L6MB 4JCOA 4EVIA 4S0ZA 1RC8A 2C3YA 4Y2XA 1E5DA 1UK8A 2CFSA 3E5HA 3H2JA 821PA 1TVKA 2NVUA 4MRMA 4N01A 1CF4A 2YQ5A 1SURA 2YWRA 1BTOA 1Q3HA 3QQPA 4BOYA 1ZH6A 1P5RA 5CR9A 1PVDA 4G1CA 5HJ5A 1CY2A 4F86A 4QASA 4G0PA 1ZGJA 2C8LA 4QHTA 3KYJB 4BMCA 3OPYI 1DCTA 1N5RA 1P8AA 2XUKA 4EY4A 1IEXA 2P30A 3L46A 1ONSA 5AKYA 1K8ZB 1Y9WA 2QQ0A 4PANA 3IQIX 2AL7A 5JYBA 4ETNA 1WW3A 2WHXA 1JPUA 2FPIB 3HHPA 1J9ZA 1TZBA 2Q7BA 1RADA 3DR5A 4JI0B 3RLIA 2ZIEA 3V2GA 4Z1OA 2ISSD 3JZDA 5HIKA 1TC2A 1XMPA 2E5FA 3IKTA 3CZAA 5TMDA 2HJSA 3CJQA 1A4UA 1JZQA 3DYVA 3IDQA 3T4EA 2B37A 3D2CA 1CQXA 1SVUA 4JNCA 5H59A 5LLTA 1CM0A 1G21B 4EO9A 3KJNA 4WLFA 3GZJA 1USVA 3GBVA 2P6OA 4JN6B 5HKLA 3SQOA 4DQKA 3I83A 3U7HB 2KCWA 1R2QA 1EWYA 3M70A 5KX5F 3BBPA 3C5WP 3JQDA 2ADMA 3W04A 5B30A 1ZKMA 3SX4A 4FMCB 2CLOB 3FNGA 3IHKA 4GGMX 1XLVA 3WFZA 4RNDB 2RKOA 4UPEA 4ZYLA 5IPFA 2ZZMA 2YHUA 3N75A 3IP8A 1H23A 1JQGA 1BA3A 1XK6A 5ICSA 1JXQA 4JC4A 5G1NA 4C7HA 4CT5A 2PH7A 2QB5A 3H11A 5B64A 4WKNA 3GLTA 5KYTA 2JIZD 4W9YA 2A1TS 4KQCA 3LI2A 3NYRA 3F5MA 2J3EA 2ZEOA 1KWMA 1DBPA 3Q10A 3C1AA 4DCVA 2RARA 2Z3PA 1L4YA 1X7ZA 1Q11A 2PSFA 4KKXB 4O5OA 4ZVVA 4DCOA 2IHJA 4EKIA 3G23A 3JQEA 3DMDA 3NDJA 4FT4A 2VLBA 5CDYA 3KTOA 4DHEA 4D8YA 3EYAA 4ZD6A 1XMQB 4HWGA 3QWBA 3RJ5A 4R76A 2WMYA 1ZD3A 4WGGA 4IZ6A 4MFLA 3AGPA 5IULC 1H9CA 2FPKA 1X80B 5JGFA 3PE3A 3TMKA 3AX6A 4ZVSA 4J76A 4I1VA 2A5DA 3HC7A 5NULA 1T6BY 4LRSB 1TW3A 2IGBA 4LHVA 4D4IA 5B7QA 3VZQA 5E7IA 2BBTA 1W36B 1DBQA 4I49A 3R5HA 3SHOA 2IZZA 2JGDA 2ZWIA 3D0KA 3D6FA 4AO8A 5A05A 5LQAA 1CZRA 3MT0A 3QH4A 4OXNA 1J1IA 4OA5A 2QTLA 1VJDA 3DZGA 2GJSA 5FNVA 1FFYA 2D5BA 3KVYA 2Y1FA 3WRXC 5LFAA 1HDQA 3ADOA 1IBRA 5EHIA 3X44A 2DWPA 2J67A 1K4YA 3LWNA 1N2CE 1YQXA 3NHBA 2CD7A 3WKEA 1WY7A 3UMJA 3UUEA 3D8HA 4DDHA 1AURA 4G0ZA 3G1TA 1ADBA 2NYAA 1ARMA 3HXKA 3HH8A 3H84A 1J0XO 1M1YA 4BX9A 1BX1A 1XJQA 4NG5A 2NADA 4RI1A 1W49A 1ZZEA 4L9SA 1U94A 4WY8A 4RULA 2G0NA 2JFHA 3GGDA 1BU5A 4A4DA 1QDUA 4CKWA 4LC1A 3U6BA 4GKKB 4HBGA 1QB8A 4K3UA 4OUDA 3IIMA 5F3RA 3RC9A 3VPXA 4DNPA 1PNQA 1RM3A 1U9ZA 4FE3A 1CERA 2PS1A 4IDNA 3IUQA 3JZFA 1A4RA 1I3NA 4YT5A 1G3QA 1SOMA 2ID8A 2JI7A 1ORDA 3EZXA 1PS8A 2ZTUA 2HBQA 4L89A 2ASVA 3C0KA 4AJ1A 1CJBA 2J48A 4PV6A 2BTEA 4JI4B 3CG0A 3FKJA 3K20A 5LOVF 1R0SA 3HL4A 4EUSA 5DKFA 1JQ3A 4KN8A 3L6OO 2CEAA 1LVGA 1MO2A 3H1TA 3V42A 1V45E 1ZSNA 1I6LA 3PHGA 1K7YA 4DVJA 4F5WA 1KUVA 3IMFA 1EHIA 4Y0VA 3CUEF 2PUWA 3W34A 1OREA 1AQNA 1RI2A 1XPUA 2G0TA 1RACA 4EI2A 4OOFA 2F9LA 4J16A 3KSUA 4QQ8A 1P2SA 3LW7A 2JLUA 5UKDA 1OBFO 4E51A 3GMDA 3OFJA 4B1FA 4RGQA 2F64A 4E1VA 1DMSA 1P1BA 1T4MA 2FSFA 3ZU5A 3JYNA 1XQXA 3KB6A 4IWNA 4W1SA 1PHPA 1M74A 2A0FA 1MKYA 2OAGA 3R7WA 5IX3A 1HZJA 4JLSA 4BUCA 4EF6A 2PR8A 4I0WB 1MTOA 3A4LA 1Z83A 4J0QA 4RY9A 1U6KA 3GROA 2YRWA 5E4TA 4E07A 3AI7A 4YMHA 1OROA 2C3UA 4B71A 1DXOA 1M9NA 1Y1SA 1I9GA 4NJEB 1UK6A 3BMOB 1PCXA 2XGGA 3WIUA 2BJWA 3OBBA 4B6PA 4EAAA 1H8LA 3CDXA 3V1LA 4A9AA 4W1RA 4OC4A 4GP6A 3HP1A 1G55A 1BROA 1WCWA 2I6FA 4FFBA 4PN7A 1FFBA 1KA9H 4V0QA 1QJCA 3PUHA 3HCPA 2BMFA 3FM9A 1F4LA 3QXSA 1JQAA 2ZSKA 5E4JA 4A8PA 3CVVA 1L9XA 4ASUD 1FB5A 3TM5A 1U5BA 7ABPA 1YRQA 3NHFA 1Y1PA 4Z4FA 4P08A 5GVRA 4Z0TA 1S7LA 4KN5A 2GEKA 1V6CA 2I33A 4RPKA 3LCJA 3VSDA 1N2GA 2HGZA 1T0IA 5BNTA 4OL0A 4WN9B 1KP9A 1NUQA 1EXVA 4L3WA 3OX1A 2ZATA 1Z47A 2JH3A 1XTPA 3PXXA 1YB5A 1KJJA 4MW7A 4EYKA 1VB3A 5I01A 3OE7D 1TQ8A 2ISCA 2CNBA 1F8GA 4RL6A 4XSHA 4C0SA 2NV0A 2YWJA 4FSDA 1S01A 5K0EA 1ZKDA 1BAVA 1YDGA 4FMPA 1T2CA 2R8XA 3EC1A 1GA1A 3ETGA 3LHDA 1P2VA 2E49A 4AO6A 5J1SB 1PYTB 2WV7A 2HK6A 2YY5A 5CU7A 5BWMA 1QCCA 3AERB 3ABQB 2JFFA 4HZUB 4ATNA 5C7IO 2ZZNA 3EZFA 3WMWA 1UBGA 1VE6A 2P4HX 4JJGA 2B7BA 1W0JD 3MUEA 3BWCA 2HQRA 2IGTA 5FOXA 3COZA 4HB4A 4FUUA 5K8CA 2UU9B 2OFWA 4BTEA 2QGNA 3ZZIA 1Y0BA 1EM8B 1V7PC 2W00A 4Q16A 4XTRA 1IB1E 5D5QA 1RIFA 4YCAA 2YV3A 5KSOA 1ZITA 4ZGGA 1T9BA 5DBOA 4CKEB 4HGYA 4H7JA 2O2GA 3VH4A 3OTIA 1DZ3A 3HVJA 5JTUA 3BGSA 2C2XA 4WK2B 2QV0A 4Y2SA 1BEUB 4P9NA 5HKBA 3FUTA 1VYHA 2FE1A 3WNBA 2MSLA 3W1WA 4OLAA 3NOQA 4G3XA 4UEZA 4XOUA 2B35A 4QUGA 2FP4B 5C5IA 3ED1A 2ZRHA 2FGJA 1NF2A 4TX1A 3S44A 2AI2A 1XYYA 1SA0B 1X9IA 5B1DA 3JS5A 5BSVA 1ZESA 2BCEA 2JGIA 4EKDA 4XYLA 1N5OX 1R18A 1CRPA 2CT8A 1F2VA 3IPXA 1Q44A 4K40A 5HUHA 1SUFA 3CRW1 3TRJA 3AFNA 1LPNA 2DYKA 4YIHA 1HE8B 1UM9A 2WSSD 5JFTA 3RAGA 3DDZX 4QYIA 5J9FA 2XNDA 1T1EA 4ZXFA 2IXFA 4DLLA 4ENVA 5MN6A 3GB9A 1ZJ6A 4XB1A 2H1OA 4GD3Q 2P9ZA 2E4VA 2R7LA 4B7CA 3UK0A 2IW3A 3VZBA 4E4TA 2QBYB 1X94A 2WT4A 1P2UA 4M60A 5KSYA 2HCRA 1K0FA 2JI9A 5LU8A 1P5ZB 3KBBA 3RRYA 2PZJA 2W98A 4MB6A 2NTVA 2XBUA 2Q41A 4U5QA 3R8XA 3VPFA 4HAIA 3WO1A 4K30A 4Q02A 4Q6BA 4ZV7A 1F38A 3HEBA 4FBEA 1H3EA 1QP7A 2AMJA 3WNZA 4G01B 2O2SA 4ERNA 5IEBA 3ST7A 3JRXA 4MJLA 3H4IA 4ND6A 3DOHA 1IHDA 3PRTA 4HQNA 1IN5A 4F72A 5IK2D 1X42A 1Z8NA 2QDXA 2R9VA 2G28A 4Q1DA 5DEIA 5LL6P 1B0AA 1DLIA 4EPXA 1KO7A 1NWCA 4N6OA 5EFZA 1DE0A 4GPAA 3DMNA 1ULUA 3QLUA 1KYZA 4HN2A 1B8VA 1JF8A 3G68A 3I2JA 3PR1A 4Q82A 4XDGA 1PG5A 2Q27A 1FMTA 3SYRA 4IGIA 3P9PA 3I76A 3T9BA 3SI2A 2Y66A 1A7KA 2WZDA 1GITA 3KR9A 1P0IA 2QTGA 5J1TB 5AG5A 4K2AA 2HA6A 4P5DA 1ZK0A 1M2GA 1VSVA 5CVDA 3DDOA 1PFGA 1UBKS 3KT0A 1BWPA 4ID9A 2DT8A 5KSWB 2G5CA 3FR8A 2ZLBA 3BE8A 2PFKA 1OFVA 2BTQA 4X45A 3RYFA 4KRYA 4EUFA 3L0PA 3SK0A 2YFHA 4RV9A 4LVNA 2R8YA 3KYCB 3BZWA 5JCJA 5B36A 3IQDB 4XVCA 3P2HA 4UBKA 4TZTA 3KL4A 3Q5EA 4KN6A 2QAGC 1QOZA 1R6DA 2R8PA 2VKQA 4NFHA 4F4UA 4GXQA 2DY1A 1U7UA 2FZVA 3LHSA 5LDGA 4Q9AA 3OM0A 4M38A 3VOAA 5AVSA 1N77A 2WYIA 4Z9AA 1RYHA 5IT9A 1XXLA 3AILA 3BFJA 3BJRA 4JNKA 5BNWA 3UCXA 1RI3A 5JSKA 3HLPA 3A6HA 1YFJA 4M4SA 1B1CA 1J09A 2H16A 1R8JA 1Q84A 1SQGA 2DFDA 2VNHA 4N49A 2YBDA 4PNZA 4KPYA 4MVJD 5KQLA 3DXZA 3ESCA 5DFAA 5DNDA 1G8GA 2GEJA 3GA7A 5HEKA 4K9KA 1JAHA 2CXNA 2IEAA 2NZ8A 3ECCA 4TV8B 3TDNA 3TFOA 1KARA 4MVJP 5K2OA 2CBXA 3UHOA 5FR1A 4QOEA 3VR5A 1T5HX 4QECA 2BTQB 4MRRA 2FPOA 3RYFB 2ZDHA 3D64A 3B36A 2BP7A 1YS6A 3EQ8A 3LE8A 4H59A 2GTHA 2I8LA 4BB6A 1SVLA 1RM5A 1ORWA 3LDFA 1FFSA 3ZHYA 1R3DA 5GOZA 2JDDA 1ICEA 1BVYF 5BW8A 1OBVA 1A7AA 1FDIA 4NZNA 1T9HA 4Z8XA 1M2EA 3OICA 2GAFA 4UNPA 2B9EA 2A35A 2AOVA 2Q62A 1C2YA 1Q0ZA 1N5JA 1J07A 2C4NA 2PD3A 2WE8A 3P2YA 4OQLA 4S2UA 4DMLA 4ZI7A 1KJ9A 1GTRA 1UPXA 1NVKA 3IAEA 3T9FA 1W75A 1DQRA 2YNCC 4CMEA 2PJUA 1MABA 4I9HA 2PJRA 2Q3EA 2D2XA 3UAVA 1IN4A 1E2QA 5IAJA 2NP7A 5G0VA 2LRHA 1ZGCA 2M9MA 1FNNA 2REBA 4J0GA 5JBNA 2PZFA 2YS6A 4MV9A 2WYHA 2B1QA 3THXB 1RBQA 3GLRA 5E6SA 2XMZA 3A0RB 4PLCA 3G49A 3VYRB 5IKMA 4YFJA 2BBOA 4ESHA 4MPDA 1GXSB 5E2AA 1BPMA 4WOKA 1YVDA 3ZHOA 2FWRA 2JCYA 3ID6C 3TGLA 2WWGA 3B6KA 2IOFA 2WV9A 2GBCA 4RYDA 2W2LA 3CCBA 3ODGA 2V6FA 4HPJB 3QX3A 4CRYB 5LIRA 2JAUA 3MRUA 2NNWB 2P6MA 3EAQA 4RV5A 3L1IA 4CEHA 1OYYA 2HIHA 1JJ7A 3QPVA 5GJCA 1QQ7A 2JW5A 2ZI7A 3SQMA 1ACLA 2HU2A 4A5OA 3ILVA 2HNBA 4UAUA 1JHAA 5DWNA 2FFBA 5F9MA 3PBBA 1UKVY 2BGRA 2V7TA 3AR4A 4UAVA 2GM5A 4M7OA 4Z3KA 1EVQA 1L5VA 1W4BA 1NXSA 1QHNA 4FLMA 1Z7WA 3FWNA 3A7DA 5GAJA 5ENVA 4DJTA 4F3RA 2A4KA 2PSEA 3K73O 4NK4A 1O57A 2BUEA 2P1RA 2FX5A 1T91A 3CE9A 4L0MA 4KXXA 3AOGA 4MS1B 1K8RA 3UJBA 1Z4EA 5JSHA 5I8WA 4KVFA 3EVAA 4Q4AA 1IQ0A 3QU5A 4I08A 1YE3A 1L7XA 3RSGA 4GXTA 5HQ3A 4R3LA 4WI1A 2GCOA 2PCUA 3U5ZB 3GDOA 4FYMA 3OLWA 3EPRA 1ZMRA 5IG2A 4OBEA 2VF7A 1ESDA 1SCDA 1PSZA 5C81A 5KQGA 1LBHA 4GKBA 5F7XA 1N6PA 1Z5PA 1GCIA 3FKQA 2YN4A 1IHXA 3WSTA 5KOHB 4DV7B 2PRJA 1A8UA 3ILXA 3P5BA 4L27A 4MS4A 3P8ZA 4NPCA 2A5FA 3B2NA 3ELBA 5DN9A 3O38A 4DZZA 1A9XA 2G3TA 3A4IA 4CETA 1NY6A 2QSYA 2D4OA 4FUQA 4TWRA 3ISZA 4F71A 4FGZA 1UWVA 2W22A 2YIDA 3K09C 3Q72A 3TNJA 3PQDA 1V47A 3SJ7A 4OC3A 4TVKA 1K08A 4P4EA 3OQIB 3NRBA 1XZAA 2P5YA 2PJCA 1IATA 4AZTA 3N0XA 4UARA 2EF1A 1BE0A 1KH3A 3QVSA 5SZHB 1BQ3A 2PMBA 3GRFA 4FDAA 3WO0A 1I7DA 4C6TB 4OGGA 3N8HA 2PVWA 5F48A 4H1VA 3FOFC 4OKNA 3CXPA 3KE9A 1E64A 5JH7A 2VTEA 4G0UA 3L4SO 4FCVA 1J22A 4AMYA 3ZYZA 3MGBA 2W2OA 3F6SA 3G2NA 4FFVA 3P96A 3K0SA 4QUSA 2EDAA 5TQ2A 2WZQA 1O7JA 5KB3A 4N3BA 1SB8A 3CZ4A 1JB9A 1S6YA 1E1QA 4FZJA 1JHPA 3K53A 3MVEA 4JBHA 5MFPA 1QG0A 1AX9A 2ZAIA 2ZBVA 3DW3X 2ZCJA 2FG5A 2GK3A 4XTCS 1A95A 1DRVA 2KLHA 3NEPX 1MQSA 1UDAA 4AL4A 4O4JB 3BJ7A 2I4NA 1DIRA 4MCAA 3RFUA 4XB2A 1C3LA 3UNXA 1S9HA 4MVJM 4MXDA 5GGXA 3FG9A 3FGPA 3GUVA 1C9NA 1RC0A 3IJRA 5CJ2A 1OFUX 2WWWA 4FAIA 3WG9A 2YC4C 5CYFA 1WZCA 3PA6A 3C85A 2OR3A 1KO5A 4HYEA 1V4NA 1IHUA 4NBUA 3WLJA 3SC6A 1T1RA 4HXGA 2ECPA 1KEUA 2RBGA 5IWCA 3A70A 3DE1X 4NBKA 4IX9A 3R7BA 5L7TA 3R9EA 3GEHA 2AQHA 3LUAA 1Z0JA 2FG6C 2R25B 3O7WA 3RT9A 4QDUA 3JTKA 4M6GA 4MKRA 3C39A 2PANA 4ZU3A 5G21A 4DUZB 3KZCA 1DEKA 2UYGA 3KZWA 1DBRA 1TJ5A 2CE7A 3F67A 4TTIA 1YNOA 3STWA 5A5EA 1PEYA 4IVRA 3T5GA 1B26A 5FBZA 3VC7A 2I1LA 3TZKA 2H3HA 2XIQA 2Z98A 1GZDA 2XKBA 2C5BA 5KYWB 1X7YA 1ZGBA 3UC9A 3DD5A 5L45A 1VBFA 5JY6A 4B7XA 1KMIY 1ZEMA 2NPIA 3P2KA 1QYWA 3U61B 3NVKI 4CMIA 5LP6C 1KQ3A 1FXWF 2E9SA 2PSDA 4YB8A 3AKZA 5DWMA 1T36A 2HHJA 2XOXA 1NVUQ 5LCXA 2C5LA 1XKXA 4S2EA 2ZAYA 4PM4A 2DULA 4IJKA 2PCJA 4MUKA 1QF6A 1EE9A 2RCNA 3DMTC 5F4BA 2ZXFA 4GP9A 1XCLA 1Z37A 4XWTA 4DMHA 2R47A 1V5EA 2A59A 3UFXA 5HMLA 3QY9A 1MG0A 3G5MA 3O84A 3CR8A 4QDOA 4GX5A 3OCZA 4Y2UA 1MAVA 2QGZA 2XZDA 2PHZA 2VNAA 3SPXA 1JWBB 3HB4X 4M9SA 1GGFA 5FXMA 5CB6A 2FCKA 5IX8A 3FECA 3B3VA 3IUNA 5E9WA 3K0AB 2DZDA 1TKAA 5IC4A 4ZN6A 5TQJA 2LWIA 2I22A 1MU0A 4URFA 3RAJA 4RTSA 1R37A 3MWFA 1OXTA 2FW8A 1V39A 1ZMXA 2XKAA 2V0CA 2GBFA 3OO1A 3BL5A 4EHKA 2VH5R 2WM9B 3NRCA 4WPGA 1JR3D 1UBNA 5C5EA 2QRVB 4AVAA 2PXCA 4CKWB 1NLUA 4XWGA 1I51A 4RMNA 4DJ5X 2HYIC 1K8XB 2JAHA 4RMJA 4C0JA 5BYKA 5JJ5A 2V45A 1WB9A 2ZB4A 2DUMA 3D4PA 1TKFA 1D2AA 3I92A 4FFPA 3VO2A 3LW8A 4IZOA 1PLLA 2YIMA 3O75A 5LLDA 1E59A 3V4RA 1UAGA 2ZWOA 3B48A 5JJBA 2VA9A 5SYNA 2EGGA 3W5SA 1UDCA 2ZRPA 3PQEA 4O2LA 4NS4A 4AZ0A 1CS0A 2HXGA 2QMQA 3HKEA 4KLWA 4GXRA 3IAUA 4HUQB 1X8KA 2VQ3A 3EISA 4P31A 1ZP6A 2BI4A 1F06A 2H7VA 5LC1A 3UAZA 3WJAA 4AP6A 3W1EA 4PC3A 5AT1A 4RIEA 4G23A 5J40A 3K8ZA 4O08A 3PFOA 3K6KA 3EFOA 4JKYA 1FA9A 2W9XA 1E3IA 1C1DB 2XUAA 2IYAA 3O7MA 4QTTB 5ERYA 5FUBA 5C1BA 4I2NA 4B6ZA 1QNFA 4G36A 1M8JA 1TTPB 2FJ0A 3QLJA 3PGLA 1MMFB 4RKWA 3SICE 3WLQA 4DW8A 2B83A 4A0RA 1YS2X 5EHXA 3OZSA 2MSEB 4LYEA 2GDZA 4OLFA 1VLZA 1A1SA 1T5BA 1U7HA 3PS9A 1YQDA 5LQMA 1UT5A 3EXIA 3KTDA 5AM3A 1ZG8A 3ZV7A 2FQYA 1H93A 4F1WA 3TDMA 4DLTA 4B12A 1CF2O 2WUDA 3W05A 2GVDC 5AHRA 1Z0KA 2CNWD 3MTAA 5JARA 2OLEA 3ESQA 4E6PA 3T1VA 2Q1WA 2I6QA 3I2HA 5C53B 3B3WA 1XZCA 3ZHRA 1TK9A 4CHGA 1M1YE 3OTQA 5L4LA 1UBJS 2YIVX 1H6CA 2HOQA 3C6QA 3DLTA 4MQUA 4ZQBA 2FW6A 1N7IA 4LX8A 1KFJB 3VI3B 2IUEA 2V8GA 4JJ7A 3V8QA 3P20A 4HDMB 4QHSA 4QREA 2C99A 3PITA 3P26A 5LZ5A 4DNXA 3I6IA 4DSAA 4AWXA 3L8ZA 5EPUA 5I7HA 1UC9A 3F2IA 3JARA 2BYTA 2YGWA 1G3MA 3OLYA 4FZ5A 5DIFA 1WEKA 4MCJA 3RJMA 3DULA 5C18A 4DG9A 3KX2A 5DHSA 1V96A 3H0CA 4ZMRA 2NP6A 4KXMA 3D7FA 3EULA 2XDAA 1JU9A 1SD1A 4R8MA 3LGSA 5TJHA 1OTXA 2IX9A 3B51X 3QGMA 3PNBA 4BINA 1JR3A 2B1GA 3DR8A 3IDFA 5CBKA 4MUFA 3HDVA 4R4JA 5JS7A 1KPIA 2QN3A 3CNNA 1Y8QA 2X14A 2M98A 4X8MA 3SMVA 3HCWA 3RUCA 5F49A 1P72A 3VPCA 5FD8A 1OB5A 5HR5A 3CJRA 1E7RA 3FZEA 1PJZA 2ZUCA 1VJ5A 4N18A 4MRNA 3N53A 2HMYB 2JLAA 2HA5A 4J2OA 4NDZA 2OOKA 1KI3A 4RVOA 3KIPA 3EGDB 4UOEA 1YR0A 3LWUA 1SVIA 7CPAA 3EGOA 2WR8A 5DMHA 4Q7QA 2J0QA 1EK2A 2L19A 5LXTA 3FNFA 1F20A 1FK8A 2XLBA 3ILSA 4QXPA 4BGIA 5A4MS 3MGDA 3D5EA 2E5WA 1E4EA 3KQZA 3ZN2A 4MRMB 4RQUA 3CWCA 2A7XA 1V95A 1PV4A 1FY7A 5CDFE 1MX9A 1UMDB 1XCJA 1N1EA 1Z4PX 3FB1A 4FYKA 3N6VA 4J0HA 4JQSA 4PSVA 1GQ2A 4WFQA 5FOVA 2GLTA 3G0HA 1IONA 4QBTA 4DNFA 2Q1XA 1YOBA 4HVAA 4IVQA 1F4VA 1U11A 2JJ1A 2YMLA 2ZT6A 5G0UA 3PKZA 4KQEA 1L4LA 3Q40A 3PT9A 1OFIA 2ZWPA 3NC4A 3OZXA 1QP8A 3VGJA 1GM5A 4FD4A 5HVGA 1KGSA 3OJFA 4ZV9A 1C2TA 5HOEA 1NASA 1Z35A 1Z8DA 2WAYA 4IQFA 3WMGA 2XODA 2Z3ZA 1FDRA 3N87A 1KORA 4QUEA 1U9CA 1KP3A 3C5HA 2GHIA 2WOOA 3PLRA 2B4TO 3B9BA 5DP2A 3KBOA 4XUDA 1GTVA 4NJQA 5LRKA 2NQ2C 5EP2A 4IIJF 5HM6A 4OFXA 4NBSA 2OWDA 4XLZA 4B73A 1PJQA 3ZE2B 3KR0A 4IYJA 1UDWA 4CIYA 3LKZA 4QRDA 1KR5A 4W7IA 3JAWB 1O6CA 1YQTA 4QYSA 4H0FA 1CIPA 5ALDA 4MMZB 1BCRB 2ZJ6A 3MMPA 4LC9A 5COQA 2W70A 4BX2A 3COJA 1YREA 4KOXA 3ASVA 3HLKA 4BFYA 5JS2A 1E0KA 2X2FA 2XMSA 1NKSA 3QU2A 3H18A 5DCWA 4N7BA 4BKPA 4UFPA 5T7BA 4G63A 3T12A 4ND3A 2MOKA 3WGTA 3SKXA 2FEMA 3SKYA 3CEJA 1HLPA 3N8NA 1D6SA 4LE2A 5DT2A 1IN6A 5CG2A 4Z4IA 3CZMA 3EA4A 5JRJA 4QT4A 2CVQA 4RDCA 4FHCA 4I55F 5JASA 5A27A 2OHVA 2PSSA 4E15A 1K1EA 1ZIPA 1TRHA 3AI1A 3N2EA 1TPZA 1E79A 4LQCA 2WFMA 1U9YA 4PGHA 2P1ZA 5IS2A 1AJEA 4LBZA 1IU9A 3FLEA 1MVLA 4RK1A 4ZALA 4DL9A 1T9KA 4RTOA 4KFSA 1JMVA 1Z5GA 3GI1A 1SH7A 1X80A 3REOA 1P3JA 2ZBFA 4B4OA 3K6SB 4CM1A 4MINA 1L5WA 3A6KA 3DCJA 1ONBA 5KYYB 4B82A 5BMVB 2ICAA 1R0YA 2FQ1A 2ZRCA 2XYVA 1IQPA 2C4MA 1A5BB 1IIDA 2R62A 3U13A 1X2EA 2H9AA 3FNHA 4IS3A 2Q1UA 1T3HA 4YXWA 1Y63A 4IWXA 5I3CA 1KDVA 2G82A 2AX3A 2BC9A 3O1LA 1FTGA 1PG0A 5K2MA 4X7RA 3DTVD 3W5DA 4AJ9A 4DBLC 4Q4CA 3KCNA 3OF2A 5DWQA 4A0GA 3OJ0A 4KGDA 4IM7A 1X38A 2JIDA 2BFCA 3QLUC 1NVFA 1PR9A 1U3DA 4LJ8A 4HGPA 4NZMA 2PRBA 4KI0A 2HRDA 3C7TA 4TNUA 3STXA 1J20A 4GOKA 3ZTWA 1IN8A 3OIWA 1W29A 3NWOA 4H1UA 2AVDA 4YRKA 1FFDA 4LF9B 1KRWA 2RD2A 2F1IA 1A96A 4LJAA 5ES3A 1CTQA 2Z95A 4LXGA 1KS2A 2ZSHA 4FYVA 3FIUA 3B8HA 3AHHA 2IS2A 3VH9A 3QLVA 3U4CA 4LHYA 1HLDA 1QDLB 3COPA 1A8IA 2B3VA 2ZU6A 2D0OB 5CDGA 2BMVA 1XFOA 1RLIA 1T34A 3QFSA 4LZWA 5TF4A 1PFKA 4CF7A 4UQLA 2QRPA 3EVZA 4KBYA 3IGFA 2GD0A 4IKOA 5ALWA 5LMCA 1KPGA 2OCAA 4NAUA 5I7EA 3MIZA 4MMYB 3DP7A 2GZSA 2DR2A 2Z6UA 4HXFB 4TWAA 2ECKA 4MQ6A 4D97A 3K1ZA 1V8DA 2DFPA 1X1RA 4P4DA 4YMGA 1N6IA 2G88A 3AKYA 4GXHA 3OKFA 4JEUA 3DMFA 5HKKD 4GR4A 7YASA 4OSPA 2Z2XA 1AHNA 1J2TA 5K01A 3I2GA 4C6SA 1DX6A 5I7UA 5B58T 3L5KA 1E6KA 4KXUA 5FWDA 5L3SB 5A6SA 2QUHA 2NWQA 1ARZA 2A30A 2WJGA 3C5CA 1RBYA 1X9GA 3R5KA 5HFAA 4F1JA 1M72A 3IUBA 3A9UA 2A4NA 1GUBA 1LV7A 5AKEA 4B4VA 4U02A 3P2MA 3DWIA 3IHTA 1JR2A 1I8TA 2WYUA 4OQZA 2LDXA 1YJBA 3HUVA 4M36A 3QWIA 1L5OA 2IIVA 4JEIA 1SKUA 4RTNA 2P8SA 4HYTA 2G0AA 1QTNA 2HHCA 3U4AA 4YCNA 1XZMA 4Z51A 3KK0A 2VJOA 2VXYA 3EQ9A 3REFA 1F0NA 4P4FA 4UFWA 2RHRA 2AMFA 3NTLA 4EVYA 3B9RA 2B6NA 1YRBA 3VHLB 5EP3A 1OA1A 2B1RA 1L2TA 1LF5A 4FCCA 4DMGA 1JTVA 4PXYA 5FWAA 1BQEA 2AOTA 5KSZA 3BHXA 4M55A 2QHXA 4RTPA 1PYGA 3N2GB 4C08A 2Z30A 2DBYA 2BAGA 1J21A 4H1TA 5AI0A 1SXJC 3NYWA 2FPGA 2WIFA 2Y92A 3OPMA 4YECA 2UDPA 5GPBA 1E5LA 3L0DA 2UXDB 2FPWA 2C98A 3L6DA 4LHSA 2UXCB 3B7IA 4FP9A 4E5KA 1CW2B 2YUIA 3L1UA 4BO8A 1HNWB 1NVGA 3BSYA 4K2HA 1ZIOA 2WF5A 3MJVA 5E8JA 5AVXA 1HE3A 2ODEA 2R66A 3ZK9A 3LMSA 2QM0A 1M6WA 3C4QA 4MS4B 1GSAA 3OOHA 1WNTA 1R6XA 1IY9A 2MU1A 2VZ0A 3DVLA 3I01M 1R0WA 3MMSA 4KC0A 1I6KA 1X8XA 2PR2A 3E58A 3IAS1 4IIYA 3ZD7A 4NGNA 1B73A 4D9IA 1LI4A 2JRCA 5E6RB 1OFTA 5HCUA 2R5WA 4QPJC 1GL9B 1AF4A 4V03A 4G24A 2C5GA 1J9GA 2VWPA 3L43A 5C8YA 1Q1AA 2BBWA 4XQEA 5G41A 1CEQA 5JZVA 2J9AA 4DJDC 5EIFA 4ZBGA 1U8ZA 2G8NA 1QH8B 2LE0A 2PMFA 3EUAA 5CB0A 3L9WA 3NWBA 1YB2A 4CGMA 2GBGA 3E7DA 5KPDA 1K5DA 5KTCA 1UL1X 2C4HA 4FMCF 3PTAA 4NPHA 4RJLA 5IABA 1MAHA 1AHIA 4FFOA 1PU9A 2AG5A 3DC7A 3TB6A 1RYZA 2NT4A 3CW2A 3Q15C 3QUAA 3RVOA 2AKYA 3FCCA 4M1QA 1VM6A 4S0XA 2Y1LA 2GXSA 4WLEA 4MHYA 4YGOA 1U0RA 1F1BA 4HJXA 4WASA 1QAQA 3RFXA 4G0XA 2YV2A 3A3KA 2IYXA 3K09A 5DGCA 3RSQA 5I9MA 1E7WA 4A0SA 2F4VB 1J25A 2WFLB 1JR6A 2Q6OA 4IDPA 5K0ZA 2H51A 3FWYA 1PS0A 4R8VA 1DUVG 2WJZB 2PJ6A 3RYIB 1J24A 3HRKA 4DUYB 5ADVA 2ANPA 3N7TA 4D9FA 5JZ9A 1BHQ1 4JJ4A 5FBQB 3THXA 3C6XA 3GA0A 3L04A 3LOUA 4CG2A 1G1MA 2O2HA 3HCRA 4L7VA 4PX5A 4QNRA 1VIVA 4R2WA 1CRLA 2RAVA 4NONA 2V7QA 3BMXA 7MDHA 2O2CA 3HZZA 1TGVA 1RYMA 2NN3C 1A2BA 3AL3A 1KU6A 3A0UA 1U0TA 4N9WA 4TV9A 4MSUA 1GADO 1U1GA 2P41A 3TLMA 1O5TA 5J2UA 1TZKA 1I6WA 1I2ZA 2VBFA 2AIRA 2Q9AA 1NW9B 5IN5A 3THOA 1YA8A 4HGRA 4DEVA 1MRNA 4NICA 4UVHA 3R6LA 4LKOA 2AEEA 1A5SB 3LYAA 4EPRA 1YZHA 1I33A 2VC2B 2A1TR 3FCSB 4AUEA 2QD3A 4GM5A 2W6CX 4Q9HA 3HDGA 1Z62A 1E3JA 3VOBA 2R6ZA 2UYHA 2YRFA 4M99A 1N0HA 2CWDA 2GTIA 2EC5A 1V25A 1W19A 1A5AB 3P0EA 3U17A 4OI1A 1O08A 3ZHUA 4BIIA 4L08A 2JFWA 1DPFA 1PV1A 2F3TA 2BWJA 2E4ZA 2W6PA 3D43A 2JI4A 4DR3B 4A03A 2RAUA 4HSGA 2FEAA 2FJUA 2PMDA 2B98A 2OBXA 2X7XA 3KUXA 4YACA 3WMEA 4BHTA 4EJ0A 4RTLA 1CZLA 2H00A 4BKOA 5BUQA 1EE1A 2YXLA 5CG1A 3TOBA 8AT1A 4U2EA 3RBVA 3V7ZA 1NW8A 3PC4A 2FSSA 3CF6R 1Z6PA 3FHTA 3RS3A 2PKCA 4IR7A 1LDMA 3JR3A 5BWNA 1NPDA 4AI6A 3B13B 2X9QA 5IJAA 1P74A 2R5FA 4EG4A 3AUAA 3RBXA 3WYEA 3M83A 4JLJA 5DCUA 5CM9C 4DQLA 1ZD1A 5LOVB 4QRIA 2EEPA 3TEFA 3VU3A 1BRMA 3N9IA 2FRDA 2I2WA 3FYHA 4KHPB 1MD9A 3D4LA 2OUIA 3OU6A 3A6GA 4YT2A 3DLAA 2C3MA 3RTEA 4DDWA 2QIRA 1DQYA 3QXGA 3K9TA 3I64A 3LUPA 3NHJA 3FR7A 4KB5A 4ZJPA 1JDBC 4NZPA 1JSCA 1TU0A 2QTVA 1ON0A 3ACDA 4R0NA 5ALTA 3SI0A 4YCBA 2A0UA 2OILA 2C5SA 1ZZGA 4J43A 1WUKS 1UKBA 1YXMA 2ZT5A 1USIA 2UZ1A 5EJ8A 2DHCA 4JSTA 1Z3IX 2PVVA 4EB3A 2P2SA 4WZAB 3TIIA 4JV5B 4HNYB 1VDMA 3BULA 4F60A 3AETA 1VG8A 3DQPA 4R2HA 4B09A 5C9ZA 2WYRA 4BO3A 3BFPA 1SBQA 1JSRA 5FEMA 1P39A 2O2DA 4BO7A 5U4QA 1TT5A 1IICA 4QBGB 1Y6RA 1I0IA 1YJCA 2BGMA 2PO5A 3CF4G 5JOQA 1J99A 4UD6A 3GT4A 4PICA 4PPFA 4F2DA 2EK8A 2EYUA 1L7OA 4R9RA 3DBVO 3FVTA 4IF4A 1LPOA 2B21A 1XVLA 2GU2A 2WP0A 2I3BA 1C14A 2BDTA 4GU5A 5TB5A 3TO9A 1BXGB 2V7XA 1XTBA 4P92A 5FOSA 1OVMA 1HDOA 2W2KA 4MRIA 1LBSA 4KQKA 3HUEA 3G0IA 2Q28A 4X1OA 4Q7AA 2E6UX 4IV8A 4QC2A 1KK3A 1PO7A 3LBAA 1NC1A 1FQJA 1U8UA 2WU4A 4INPA 4PSUA 4XYEA 3KAKA 4UW9A 1Z06A 2P11A 1Z4NA 3TZBA 1ZLIA 4QBJA 2EFJA 5I7SA 1WB4A 3U4QA 4IRXA 5I0CA 3EOAI 5BUSA 5CNMA 2VHWA 3B1YA 4WBNF 2HY7A 2XCTB 1PDOA 1RWOA 3ESYA 1R66A 3EJ6A 3R7SA 1IUPA 1YVEI 3UENA 3TC8A 3ENWA 1R0RE 4IGEA 4NEHB 4Q15A 1UPCA 3BI1A 2JL1A 4ZVTA 4FC6A 2R97A 2LKCA 1NBME 3GJXC 4JBGA 2C82A 2ORYA 3MJSA 4FOLA 1SA0A 2VP4A 1JDTA 1FSSA 4MYDA 4XQGA 4DIBA 5KVAA 1YR2A 2WD9A 3GWGA 4KO1S 3OE7A 4LUCA 3THYB 5A3JA 1PJBA 3CR3C 1WZIA 2OXFA 2QX9A 2DWQA 4XQ9A 3TLXA 3ZKWA 4PLYA 3S2EA 5B3KA 5DYTA 5K0SA 3DZKA 2CXHA 3W6UA 3ZVKA 4RYLA 1VCIA 1UQRA 2X1LA 3H1GA 3J7TA 5GQSA 1WD7A 1YMQA 1VI2A 1VGRA 2FP3A 2VAMA 1H66A 2VDKB 2W6OA 3AFIA 4OB8A 4YJ3A 4B4DA 2WEKA 1D5WA 4LJ4A 1AUOA 4Q4HB 2QVCA 2OZHA 1C3JA 2QK4A 4MI6A 2AT1A 4ZX9A 1W6UA 1CQIB 1PUIA 4QXOA 1ADFA 3N05A 1U3FA 3CPHA 1P7ZA 4MLDA 4DKXA 5A03A 2O54A 3DPUA 1SVNA 2A9RA 4JB3A 1QRTA 2B2XA 5A1TA 5HKOA 4C6HA 4K6HA 5DCYA 2ZYVX 2C2HA 2XMPA 4HMQA 1RSZA 2H48A 1QRUA 4V1CB 2JVKA 4BFLA 5KWSA 1GGHA 4G8CA 1YBVA 3AERA 4XPKA 4OA8A 2PDAA 3DLBA 4FBLA 1RJFA 3ABRB 2WPXA 4UATA 4CV0A 1Q0RA 1GGNA 4Y9RA 4D3DA 2DMRA 2KPOA 2YASA 4FONA 3KYBA 1Y8RB 1USGA 1TEVA 3AJ9A 4IYRA 4NL4H 4WH0A 1G59A 1TO1E 3SF0A 3VR6D 1J2RA 5ELMA 1IWOA 4RF4A 2G08A 4A0HA 3BS4A 3X3HA 2GM9A 3CRRA 5C3MA 3NMUF 4DM7A 4IDBA 2WTBA 1JQLB 3WKAA 5F52A 4CF5A 1OF1A 1CX9B 3HSKA 4RSHA 3OMWA 5BQPA 5EXSA 4CJXA 2MSDB 3QKIA 3T3GA 4KR6A 5LNK6 1TKBA 1Z0DA 1ZIXA 2H1SA 1I7PA 2R0QC 3I28A 5AOCA 5GY7A 1KMCA 4BC1A 2VDWB 1DWUA 4UTRA 2NZUG 3FWKA 5BSEA 5BMVA 3O31A 2AW5A 2ZEHA 2JGNA 3E3NA 5LYIA 3L41A 4NCNA 4Q4JA 2NQTA 4JYPA 4E7OA 4EO7A 3W9YA 2Q4YA 3VYWA 1JUDA 2WU1A 4YJGA 1LLUA 2I4TA 5BR1A 3FNCA 4H6VA 1XPRA 2W5UA 3KFLA 4RO0A 1OXKB 2ET6A 5HF8A 3K4PA 4QDJA 3EIEA 1NRJB 1X87A 1WXXA 1FVOA 3Q41A 2ZYAA 1T3TA 4FFLA 5FV7A 1Y4DE 3NS7A 4MJ3A 5J4LA 3X43A 3HCEA 2QVLA 3ANNA 4IH9A 2R4QA 4ENUA 3D2BA 2QW0X 1BKYA 2RGWA 1JE0A 3DTVA 3QVXA 4GOOD 2B5WA 3VSBA 5JATA 2BFDA 2P65A 3BN3A 4AF7A 1UC8A 3FRJA 2XJ9A 1JHUA 2E0IA 5CURA 3E05A 3BSSA 5E7QA 1G5FA 5K6TA 1LKZA 1AO3A 2WJAA 5K3AA 3U60B 2BHLA 2VHXA 3QV1A 5FHQA 3RIHA 4B3IA 3NAGA 4EI9A 3MMZA 5AW8A 1EYZA 1LQTA 3SZMA 1KC3A 5BN3A 4XYMA 5HRCA 5AXBA 1RI1A 3G9XA 3LL7A 1E2NA 2XYRA 4OBXA 2RHHA 3MOIA 3EG9B 5TT0A 1XYGA 2G1PA 1BC5A 3O2NA 2AOXA 4HFRA 4ZXPA 3VJKA 4C3ZA 4HWPA 2V8VA 3F7NA 2P3QA 2BHSA 3SX0A 1RKBA 1FBNA 1O4VA 4AIIA 1FDUA 2OHIA 2ZYWX 4CLRA 2O8DA 4XDHA 1J9EA 1ZD2P 4BMHA 3ZG6A 4FDUA 4I4CA 1AK1A 1SBHA 4HBZA 1R50A 5JCPA 3I34X 3DG9A 4LV5B 1YIDA 1FE8A 1UWKA 3V7UA 3VU0A 4ECEA 3OU7A 1HRDA 4QU8A 1FYVA 2CMKA 1HSZA 1MRSA 3H17A 1A50B 3K6JA 4I2VA 4B31A 2P2GA 1I2AA 4ZCRA 3WNQA 2YZNA 1D6MA 4JENA 4A6DA 4KZPA 2AGVA 3K96A 5AVOA 4F7DA 5MHTA 1FSZA 1H2XA 1NQAO 2QMOA 2ZSBA 3EHDA 4S1WA 4C43A 2BOAA 1NUHA 3W2HA 4H7HA 2QT0A 1NFFA 4NF1A 1PTJA 4KQJA 2PL1A 4WGFA 3ROQA 4OV6B 4B35A 1KQFA 1RM0A 1XJ0A 2EWMA 3FMGA 3SOZA 4EMUA 5KTRA 2CV1A 1LFWA 1MJBA 3AF4A 2BEUA 4OK5A 5FPKA 1BMDA 4NF2A 2H5EA 1ETHA 1N9KA 3PUWA 1MV8A 2GPWA 3KETA 4BBPA 4H9GA 1A97A 1PDVA 1UFVA 2QENA 1UDBA 2WWHA 4G9GA 4CIXA 4CGNA 4J9VA 3RVKA 2QG6A 3LBFA 4F8EA 1G9SA 1COWD 3DOCA 2JB9A 3RC3A 1T8RA 3EUWA 5F64A 4MBUA 4MWGA 2B92A 1KZ7B 3EDMA 4JJ8A 4M49A 2PSJA 2ZJ3A 3ZCRA 2PX2A 4DPLA 2GZDA 2I3GA 5E2BA 2YN0A 3CXUA 1M4GA 4GWLA 2Q0SA 3PQ8A 3HJNA 6Q21A 1ZD5A 2J1LA 2AOUB 3U49A 3HYNA 4D9GA 4EITA 1EFUA 2XNJA 4REQA 1OAAA 2Q5OA 1O5OA 2JK1A 2M1ZA 1RZUA 1YL7A 1RKVA 4AXVA 1BE1A 3NR2A 4OHBA 4H4EA 3V1NA 3W8FA 2XEDA 3KYDB 2QLLA 3PWSA 2WD7A 2IHVA 3SJAA 3W6ZA 3ME5A 4ENSA 4UNRA 1YCGA 1G21A 1GOTA 2VQ6A 3PCTA 4A1FA 4TL9A 5T3YA 1DCKA 4PIVA 2HSZA 3BCSA 4ZRMA 4U7TB 3JVNA 1IULA 3MFQA 1W0KD 2ZIXB 3PL1A 5ER9A 1VFNA 2ROQA 3A3PA 3DBRB 4COOA 2ZRBA 1V4VA 3GU3A 3TI9A 2VAPA 2OGTA 3ON5A 3KKOA 4RK4A 5AKKA 4B3CA 2MSNA 3QOXA 3MCZA 3WL7A 3O8DA 4QEKA 4P45A 3FUCA 2HHHB 1TUBB 4FNAA 2WICA 1LSSA 3V48A 2JD1A 3F74A 2HSWA 3FGNA 3SWWA 2WT9A 1KVUA 1NQOA 4CAWA 1EX7A 1JJVA 2WAOA 3NT5A 3ND9A 3H2IA 1XC7A 1C0LA 1XDZA 4FINA 2WP8J 2Z9CA 2O50A 1Y7HA 4QEZA 1V7CA 5ELLA 3WYCA 1YVPA 1DOAA 1XU4A 3ICWA 4LOHA 1W0CA 4K6GA 1ORHA 4PEVA 1WU8A 4HATA 4TKLA 5TQ0B 3PPVA 3RBUA 5DYNA 4D9JA 1DINA 1U9IC 3HRIA 3ZCVA 3H6HA 4KYTA 1VLLA 4C4TA 4HDMA 4ZVNA 1UZUA 1O2DA 1V3TA 4MV8A 5C8YF 2H6EA 1NUUA 3VDRA 3IRVA 2E4YA 2Z5LA 2H2GA 1K3FA 2I7XA 5DNYB 1HH4A 3IVGA 5DLYA 2PZGA 3HRHA 2XH8A 4K0RA 2O0JA 3DMYA 1WTCA 4M7PA 4NYJR 4H3KB 4BN4A 1XMBA 4IOLA 1L6RA 2ATRA 2XRZA 1NVAA 3DS8A 3P9XA 1YZQA 1JI0A 1AMNA 3ZTYA 2PSHA 3VFDA 4HNWB 3OOEA 1E1CA 1U7PA 4KKVA 2X40A 2JCXA 4Q66C 2Y9MB 4KX3A 5CPBA 2O1WA 2RH5A 3HCNA 3AF6A 1S3FA 1FJGB 1BW9A 3OZFA 3P9QA 4ZAGA 2YN2A 1A69A 1H1LA 2QX6A 3PC8C 2IXDA 1ABBA 4ML3A 2C6PA 3G3SA 3MW8A 1P5FA 1DTSA 4QBHA 1EE3P 3B3GA 4D0LB 3PYMA 3NDIA 1I2BA 4Q4DA 2PIYA 3GXBA 4FFMA 2CHEA 2Q6KA 2XA2A 4MGHA 1M6YA 1SUDA 5DSTA 1PU2A 1R0CA 4Z4CA 1TYDE 1U2QA 5DZSA 3E0XA 3LOPA 3PIIA 4MMOA 1OR8A 3K0CC 4TKZA 5K8IA 2IUUA 3KXPA 3LFUA 1E6EA 1HFJA 2E55A 3N7ZA 2H0AA 4PC1A 5BW5A 3WGQA 2WJ4A 4R9UC 5E7JA 2IY7A 4GFDA 3PEUA 5DOVA 3QXCA 1FUUA 4LSMA 5B2EA 2C57A 5JDCA 3BT7A 2OHOA 3I61A 2OENG 2J7KA 3QKTA 3VVBA 1WBJB 2R7NA 5FA6A 4Y3UA 2BHTA 2QXUA 2ETVA 2KS6A 4WBNB 3TIFA 2AJCA 4CTOA 3LS2A 3M9XA 2WIJA 3MTEA 3LHFA 1IOVA 2QEQA 3K9WA 1DXQA 2H1CA 721PA 2O0HA 3Q3HA 3H7IA 3VNSA 1ABEA 4PLZA 1VL5A 2HIMA 4YRTA 4EY8A 3TW6A 4ZYVA 4K28A 4Q3KA 1M2OB 3KSBC 1DARA 1M2KA 1R5OA 4PZAA 4OREX 2NSYA 1OX6A 1Z56C 4FE4A 4RS4A 3TJMA 3TZLA 4D02A 1CUAA 2AMVA 4C89A 4RPCA 4EO4A 3OA2A 2V6MA 1NM5A 1JIVA 1Z6AA 2NYVA 3T3PB 1LY1A 2AFRA 2H59A 3VDMA 2NTEA 4CNBA 4DMCA 4CAVA 3T7KA 4E2FA 2OQRA 2XI4A 5BXQC 1W1UA 4RVDA 5HW0A 2RI6A 5DIZA 2UZ1B 1RWVA 2CYAA 2OMKA 4D25A 1A3CA 5DXAA 4HGZA 4RFLA 5FI1B 3S81A 4DV2B 3C45A 3DO8A 3R7FA 1YF3A 2PJ8A 2QE7D 1T3GA 3DVQX 3ANMA 1CETA 3FY4A 3R3JA 4HTAA 4MEJA 4N8SA 1QQBA 2PJ1A 3RQSA 2QZZA 3BGDA 2WF6A 3NM4A 4INOA 5TJ9A 4A6XA 4C21A 1PVOA 2HO5A 3FBGA 1KZ6A 1ZXXA 3H87A 1SG6A 4B0OA 1NR5A 3SHPA 1U6MA 2V5AA 1JLLA 2QF7A 3LU1A 4GBMA 4WQMA 3QSYA 4X2TA 2FY8A 4LSWA 3CBQA 4RFSA 1E1DA 3ZNNA 2O14A 3WGGA 4ZJZA 1KWGA 4YRCA 1ODCA 1U3GA 3KD2A 3QWHA 5AJTA 3MT8A 1SVSA 1GNQA 3MWJA 2WKQA 2CNKA 2QTCA 4FYWA 4GUAA 5BRNA 2I0FA 2FK7A 3R7NA 3W2IA 4YV1A 2CLKB 1XTJA 2GANA 2AFHB 4O8CA 4G5HA 2VCEA 1HEEA 2YDYA 5CLGA 3W2EA 4EFNA 2I8AA 3IURA 4KWCA 5LR6A 5HRUA 3OPQA 1MO6A 1KFKB 1E5XA 1SPXA 2G0BA 4A0QA 4XQCA 3PXCX 4R8LA 221PA 3UGQA 1CUXA 1F2TA 1ZYUA 2PGLA 4Y30A 4DQVA 3S2FA 4WZBA 1IY2A 3ZWVA 3NM5A 2YW2A 2OBFA 1J8VA 3OWCA 4MS3A 2D62A 1HDXA 4PNEA 1X0VA 1E6WA 2FNAA 2I1VB 3H4MA 4JOQA 3FYDA 1IQRA 3BXMA 1KP2A 3OC0A 3W91A 1VPDA 1W88B 3KXLA 3A36A 4RGBA 4AVCA 4BV9A 2DQ4A 3HVRA 2HSJA 1GG2A 1QGZA 2JLWA 2HV9A 2XA9A 4M0FA 4KRGA 4CT0A 1DDOA 2WYOA 1UPBA 2ZJ7A 1K97A 2JJ8A 3UUFA 2X23A 3MB8A 4MUBA 2OD2A 4Z2YA 3RC2A 4D2IA 2ABZA 4DLBA 4GPTA 4F3TA 5EJ5A 4RTJA 4MTCA 2QRLA 4FYYA 4EWTA 1J4AA 1YR9A 1BS9A 3GLFB 1JN0A 2IUYA 2VYVD 1XN4A 4MIOA 2WSAA 1BU8A 3L2NA 3GLFE 3HBAA 1JBQA 1CYEA 3H5ZA 1DJOA 1S7GA 2QIPA 3WICA 1ZOPA 5THXA 3HA5A 2GXAA 5CLLA 5EP4A 4FTWA 2WPDA 2CVOA 1C9EA 4PAGA 1OWOA 3JALB 3DBLA 2BBSA 3LQRA 4GE0A 4RM3A 2FPUA 2G3YA 3TTXA 1U6JA 3M6UA 5K0JA 2NAPA 2M32A 4G1MB 4DYOA 4PXEA 2HHLA 4L4RA 1P2FA 1NXTA 2JKYA 4RDIA 4MX8A 2O19A 3G1WA 4NJRA 2AFSA 1P1HA 1U2EA 4RK7A 3CX8A 4AMUA 3S6HA 4WFKA 2ZR8A 2QTVB 3H4VA 2NXJA 1COWA 1MEJA 2GGSA 4QWWA 3WKDA 1UAAA 2JFQA 2JIOA 3R6TA 1NYLA 1G8MA 1P7YA 4BLRA 3N0RA 1S2GA 5H3CA 4EZEA 1L7DA 4ZEMA 3E61A 3A6JA 1J8DA 2C9MA 3P9KA 5ALXA 1XAHA 1AA9A 4EBBA 3IR6A 3VR0A 1Y3CE 2Z6VA 3CSDA 3QLTA 5F2NA 3HK2A 3CYFA 4UIAA 1DTDA 1JXMA 3RLFA 4J7XA 2D4AA 3HJGA 3JD4A 2QPTA 2VK1A 2BIFA 4K88A 1M5RA 1PQ4A 1LPAB 4GKAA 4LI3X 2AFHE 1SVMA 5TARA 1MORA 2CLDX 3RYHB 2FZ4A 2AMYA 3NHMA 4I1SA 3CG4A 4AD8A 1Z8LA 4ZODA 4LXYA 4AJHA 3VX4A 2QM3A 3FUUA 5CA0A 3QWAA 4RF3A 1UKZA 2IPAB 1XN1A 3IP7A 4AY5A 3PF8A 4RESA 4XI9A 2HNAA 2X4DA 1M76A 3CZQA 1FX0B 4U7JA 4FOOA 4UTPA 4AG7A 1CNEA 5DTIA 2GPAA 5EKSA 1YDHA 4PYQA 3VU8A 3Q7PA 2L2QA 4L8LA 2QTFA 2ID4A 5D8NA 2A3NA 1UXIA 4G1PA 2I2AA 3ILYA 3H2HA 2HJWA 1MB4A 4OQXA 1KBOA 1T6YA 1Y42X 1E4YA 3C3JA 4TRRA 5JROA 2V8DA 2ZEMA 2XUZA 3I30X 1ZW1A 1M6HA 4W6QA 3RVSA 3UMSA 3AYXB 2I3ZA 2WU0A 1R74A 3IVRA 2Q2WA 3ZQJA 8LDHA 3KYIB 3IV9A 1QFXA 1NFQA 3MRTA 3TQSA 1R9GA 1CE8B 1ULTA 2GZAA 2EW2A 5D6NA 6LDHA 4URHA 5ILQA 4TV9B 5EQDA 2PRIA 2Q0XA 4UUMA 4UQPA 3VPGA 4MQ5A 2GCNA 4FDLA 3KDSE 1LPBB 4QGAA 4PX3A 1JDPA 3LT2A 4WCDA 5KJ6A 1W46A 4OQDA 1L4NA 3TK1A 3GJ6A 3HWRA 2OYCA 1EFKA 4DSZA 4PTYA 3WJ2A 3U7QB 3HB0A 3IXMA 1U9IA 5JWRA 1DG1G 1I4DD 2JFBA 3GRVA 3OMXA 4NYMQ 4MS3B 2D2VA 4EUEA 5IYZB 3U7FB 3IKJA 3BE6A 4JUIA 4E13A 1ILWA 3JQAA 2H31A 4PCVA 1VHSA 1EZ1A 2GF0A 5CVJA 1B41A 1II8A 1RJ9A 4J2HA 4MQFA 4OHXA 2QVZX 3WISA 1JHZA 1HXHA 4ENRA 4HKTA 3UGTA 5MN5A 3VHQA 5H84A 1XEFA 4CCYB 3IEVA 1U2ZA 4P58A 3DEIA 3DKKA 4L76A 5E8RA 3RVLA 3U19A 1YJ8A 2FWPA 2H1VA 4F9FA 2Z43A 3OLXA 5L3QA 2WU8A 3ZWKA 4EI8A 3CEPB 4ZQEA 4OHUA 5F73A 3ZDQA 1QV7A 5AQEA 3OJWA 4XD7A 3TYXA 1SBCA 2OCBA 2PMKA 4UNNA 5AOVA 2CVPA 3UC5A 4ARAA 1QR6A 1XD2A 4Q7JB 1CR6A 3O4FA 1XHFA 4KUEA 2FK8A 5HK8A 2F5IA 3VWEA 3I9OA 4QTZA 2AR9A 2V6JA 3N8GA 5ADHA 2B4DA 3L7BA 1EK5A 2QQEA 3RVMA 4K8OA 1X39A 2QRKA 5HF5A 3MFYA 2FLKA 3D6VA 3EZ7A 2VTBA 4HN4B 2O8CA 5DTQA 4QM6A 1TRKA 2JLRA 4GHWA 4TS3A 1E8DA 3ND8A 1JG6A 2XCIA 1DG9A 4MVCA 4BO2A 1RXCA 1WUJS 1XU9A 5EOVA 3R7AA 4HLCA 5EWLA 1ZHHA 4JMPA 2CBZA 1NNUA 3BMQA 3EXG1 1Q2CA 1YFZA 1P0HA 3H1BA 4LJ6A 4I4NA 5C1PA 3OETA 5KAPA 2Y0EA 3KHZA 2PZLA 1ODJA 2JFXA 1CNMA 4XD2A 4FNGA 2XCUA 4DLKA 3BCHA 2GPBA 4OATA 7AT1A 2VN8A 1ML4A 2A9KA 3PXAA 5EHGA 3OPNA 4GZMA 4AAYA 3L92A 5JS6A 2X77A 1XPJA 2ES4A 3C6KA 1OT5A 4LMRA 3QVGB 1FSFA 1BDHA 5TY0A 4DIKA 2WIKA 3DR6A 2YCLA 2NLOA 2RIPA 2C9OA 3HY3A 4YN3A 5JM6A 3EFHA 1M2OA 2OZLA 1Z2NX 1B23P 3UV6A 2XRFA 3QKSB 3GN1A 3ONEA 2IYVA 2BW0A 2RC5A 1FJ2A 1GPH1 4IJ6A 3VMMA 4MWEA 2WJ6A 5KKCA 1M5UA 2X6QA 1THTA 4KO3S 5AVKA 1KEEA 4UNQA 2C7OA 5ALQA 4E5UA 4FDTA 4FGJA 1CUZA 5F5XA 1XLTC 4RVFA 4KOVA 2HDOA 2XVXA 3C98A 5AM5A 4S35A 1DJNA 4NRDA 1OUMA 3C8MA 1OE0A 2X7JA 4G4SP 3AI3A 3DC2A 3PUKA 5JDIC 1OD6A 1YAJA 4PCUA 1XCGB 1R57A 4A10A 4FUTA 4P3XA 1E98A 2R7AA 1I0ZA 3LLMA 1L7NA 3JWHA 2HJHA 3IVXA 3NM6B 3QM1A 3GUCA 2ZIVB 1LAMA 4B6QA 1K8YB 4O2AF 3PBKA 2WVGA 3RW9A 3F8TA 4KIGA 1ZGHA 1QWSA 4H7DA 3NHPA 3VR2A 1XOIA 4B7AA 2FW7A 4KZKA 4EFKA 1GUAA 3UJCA 1YK3A 1CZOA 2ERCA 2R44A 1I1HA 1YI0A 2YMMA 3IQWA 2JARA 4QFDA 3X2EA 5BRJA 4NECA 4UEJA 3UCFA 4OX9Y 1ZD9A 5A5DA 1XXHA 2G71A 4M0MA 2J31A 2NSMA 1RTQA 3NWJA 3I2YX 2Q8PA 1PR2A 2QVGA 1EQ2A 2BF4A 1H4QA 4DZRA 1PTJC 2IS1A 1MAAA 4RAOA 4CLDA 2VUSA 3AUTA 2FDCA 2RHCA 3DOIA 3THSA 5A9SA 4B7UA 2BGTA 4Y49C 5EJ2A 4ZOLB 4P3OA 4XNHC 5ICCA 2ORED 1E1LA 1HL3A 1IVYA 1R4MB 1BFKA 1ZI6A 2QTRA 3ACBA 3PRYA 4HGOA 4XE5A 3C5EA 5ANRB 2IZ7A 2SKEA 4B2IA 4AZ3A 5IKPA 1QK5A 3LX6A 2FUNB 1FFXA 4TVSA 3NH4A 2CLHB 2O5VA 3GNTA 3PYLA 3UQZA 1V5WA 1TM7E 1VJGA 4C1NA 1HNXB 2FHSA 1WD5A 5M3BA 2NU6B 1KYWA 1Y4AE 2HZBA 3FW1A 3TNLA 3UAGA 1KO1A 4JI8B 3MCUA 3R77A 4DRZA 2WPWA 1EDOA 2FUCA 3WVNA 5DW0A 2EWWA 1EM6A 5C4IA 1G38A 1SXJB 4IQ4A 2PXXA 4REQB 4Z9BA 3ZE9A 1RAEA 2F48A 4NCBA 3TQIA 5TVKA 3TUJC 3AF0A 2QYSA 2Q3FA 1VA5A 4LQDA 4V0NA 4AP5A 4NQRA 5AJVB 1LVHA 1VSBA 3PU6A 5LB4A 2OG2A 4P4GA 3HEAA 3VISA 1R12A 2ZIWB 5HFNA 1QC5B 3FRIA 4DCCA 1NFRA 1YR6A 2GEVA 3HKCB 5IDVA 1FP2A 3HXPA 4RJIA 1I24A 4WN9A 2O8BB 3JATB 1A2KC 1UWCA 3LYUA 2HMAA 2J3KA 3BX1A 4WEQA 3WWYA 1KI6A 4PNPA 3FVRA 1GYTA 4I4LA 3UMVA 4Z1MD 2X1VA 2RGDA 4CM5A 4BS9A 3EVEA 4JL8A 2P5UA 3E4CA 3J81A 3K5IA 1DDGA 1JZTA 1U0FA 2XCOA 1GPUA 2RIRA 2W2PA 3KEMA 3UTCA 3K6SA 4A23A 3MTIA 4LEIA 1JVBA 5CA0F 2AG0A 2ZR9A 1WWKA 2XUFA 3CH6A 3L3BA 3QKUA 1FT7A 4G37A 1TOAA 2ESRA 1WXGA 3BIFA 3SM3A 1K9VF 2JVIA 4FXOA 4F8JA 2F00A 3O8QA 3EFEA 4GS4A 2PKWA 2WNIA 1JECA 3A4NA 1YSJA 4A37A 2WM8A 4L5IA 4ZOEA 4ZVUA 4COKA 1X10A 2VZEA 3UO8B 1HT0A 3ZCSA 3O26A 2HWXA 5EWMB 2QQ5A 1NA5A 4O6VA 4YPVA 2O8DB 4ED9A 4J0KA 5EINA 5JMPA 1BE8A 5CEFA 1G8HA 4FSHA 4IUYA 4BFWA 3GJRA 4GE3A 1EG2A 3TZ6A 3PB8X 1Z5WA 4D99A 3KOZA 4C7IA 3MUFA 3BHIA 5F76A 4C03A 3O8OA 5GZ6A 5JBQA 3QHPA 2Q29A 1JHRA 1YBAA 4R1LA 1A27A 3N2ZB 1N7JA 1V3UA 1GD1O 3P71T 3PGXA 4U2FA 1H9AA 3WGIA 4BVEA 2BCOA 1QMPA 4CMEC 2OVFA 5K05A 3A6PC 2CC2A 3S68A 3KKZA 1F60A 3ONNA 2G1JA 3AG5A 4X3PA 4INZA 3HZOA 4OHFA 4YHBA 4HUQA 1MG5A 4MHTA 2HF2A 2BJHA 3LHIA 3LXRA 4IHQA 3IALA 4RSMA 3TL3A 3TZEA 4ZI6A 3KFVA 2NO6A 4QUDA 1M0SA 4D43A 1NL3A 3AJAA 4B3GA 4D4GA 1HQYE 2NM0A 4FQ8A 3KL9A 3JQGA 4KR3A 2AXNA 4M0EA 4M0PA 4S1NA 2H54A 2QJOA 5GJBA 2Y0PA 1GRVA 4AYWA 1I6MA 2JATA 4YPFA 2G63A 3BDAA 2P2DA 2WYWA 2ZBQA 3H5NA 4F2HA 2Q8NA 2F4NA 4NCJA 2ZT8A 1E3EA 2JEZA 1ITZA 1OXSC 4FYXA 2B4RO 4ODIA 2J0SA 2POKA 2JH8A 2ZUDA 3K05A 2X8LA 3H99A 4M76B 2X86A 1N1DA 2QZJA 1L4FA 1ZVMA 4GPZA 4UPDA 3RS0A 3SZ3A 3T5AA 4BPBA 1YDWA 3MUOA 3QXHA 1DE4C 3D7MA 5CIQA 1ZISA 3PC7A 2FX2A 3STTA 3UT5A 3QIVA 5FL7A 2BGJA 3PUVA 1V4BA 3DZJA 4ZZ2A 3O4RA 2HEGA 1U8AA 4LOIA 5EQJB 1EFLA 3ACCA 4LIPD 4TYWA 1KSJA 1ZMBA 4IHMA 1E8NA 5AVVA 3NXKA 4KIJA 1I1DA 3RJZA 5M34A 2ST1A 1V1RA 3SC2B 1XCPA 1NXPA 3MJFA 3UPDA 5T3UA 2PGOA 4OK3A 3C7DB 3PICA 3UFXB 3HACA 3HDHA 5H5JA 2EQBA 5BQOA 1CUDA 1ZHFA 1S4QA 3BH6A 4UTZA 2BEVA 4IDOA 5K5EA 1F2DA 1ZEJA 4NGQA 2OGWA 4JLOA 4HEJA 1U0NA 2JJQA 1RFLA 3K0HA 2FH5B 1NR7A 2F9MA 3EMVA 4MR8B 1CQJB 1RYDA 4U9ZA 3NKFA 4K9LA 1XLWA 3QEBZ 4QOHA 2JFNA 1P4NA 2V4MA 4N3GA 4UVDA 5KJCA 1VE7A 4CPAA 2FV8A 4KOYA 2CL7X 1OWLA 4G56A 2VZ8A 1BYUA 3PXDA 1E9DA 2HWKA 2L0XA 4LNUA 4EB8A 3U39A 4ZY2A 1CQIA 1D5CA 1EVLA 1FCJA 4MP3A 2HIAA 4RZSA 4RACA 3N8DA 4PCAA 3NC1C 4JLUA 2NSHA 3IAM1 4FQ7A 1QO7A 3ZI0A 4KITB 2W4IA 2XZOA 2R2AA 3N3AC 3VGPA 2XTMA 3TRIA 3RS5A 3UJ6A 3C3KA 3ZU6A 4ES6A 4C0XA 1CS4C 2FEPA 3R40A 2NXEA 1SY7A 4XSGA 3RGGA 3S6KA 1QG4A 3NJRA 4FCTA 4AM8A 1VLVA 5BN1A 1JFFA 1HGXA 2F62A 4LYHA 5ETJA 4ENWA 5HZHA 4L3OA 1ACJA 4RIGA 3TSYA 3B2QA 4B5KA 2CVHA 3S2UA 4NI5A 3AFMA 2TS1A 2XPCA 1EZZA 3E23A 3KTAB 3LVBA 3TXXA 4DBZA 1UT8A 1WAMA 1XZLA 4BGUA 2ZE7A 3H83A 2JPDA 1LX6A 2VF5X 3TPCA 4BFCA 1T9GS 2YJNA 4C4SA 5KVQA 3GCXA 5KTOA 2B4BA 1JDSA 1NBAA 5AG4A 2UZAA 4CAXA 3VBEA 2B78A 1UFOA 4TXNA 2YHBA 3JQ6A 3NU1A 1ZK2A 4A2CA 4EM6A 5BV0A 3IUPA 4WZZA 4RXMA 2X9NA 3UJ9A 1H4TA 1LI7A 4J1QA 4L3VA 5JNTA 1BYIA 3P2EA 4OU4A 3WL3A 4KCGA 3LJKA 5AWFC 2DQSA 1E5VA 3O9ZA 2WA1A 1Z13A 1HYGA 4P84A 1G5TA 1QGYA 5EC8A 2JD2A 1J4JA 2AE2A 3OQBA 1QHXA 3FNQA 3AKDA 4QUHA 4HNTA 4XNHB 5HMMA 1G20E 3R3UA 3LPMA 2OXTA 2X8JB 1PJ4A 1PP4A 2FXIA 1T1IA 2XCQA 4IFTA 3NGMA 5JH9A 5JPHA 4B2YA 1L5RA 5TMPA 2XQFA 3F0AA 1G2QA 4H6UA 3WRVA 1MJGM 2WSIA 2A3RA 2ZRDA 3KI9A 3GO4A 5U4XA 4DV3B 1Y34E 5KDOA 1V1JA 3ORSA 5ILOA 4CMJA 2QLMA 2I2XB 1NI5A 2SNIE 4LOKA 4U5YA 2CVZA 2AR7A 3BQ9A 3QEKA 1M44A 5BT8A 1NMTA 1ZNWA 3U4QB 3QFTA 1CC1S 4GM4A 2IMOA 2VQYA 3DEZA 3EF1A 2QN9A 2WSLA 1OZAA 1UJ5A 2QDKA 3ZWQA 2I7CA 1J42A 2ZJOA 3GLKA 3MS2A 1CZNA 1LJLA 5JYDA 1CVIA 2EFCB 5LZ7A 5AW7A 5DM4A 2ZKIA 1VLHA 4XX1A 4D57A 4A95A 3QUSA 4F2WA 3GUXA 1GCAA 5E0KB 3G8CA 4GKVA 4D3YA 2X5XA 4UUOA 3EVBA 1JEYB 5FOTA 1ATZA 5BSMA 3HM9A 1EQAA 4RBNA 4MFZA 4HZIA 4X8LA 3FZGA 1OWMA 1YZLA 1CDOA 2ZSEA 1DNPA 3VZRA 4F1KA 3PIDA 3R9FA 4BQRA 2OCGA 1NG1A 3K0FA 2A9PA 2X0FA 1GHEA 2C2BA 2JC3A 1MPXA 2XD9A 3GLVA 1WQ3A 1VG9B 4G85A 1IZ0A 4DQUA 3IJ3A 1EFPB 3QI7A 3PUIA 3QAHA 2FN9A 2ILTA 3Q8KA 3VQTA 1KYXA 1ZJJA 3WC4A 1SZPA 2C1EA 3GEDA 3NHKA 3SBOA 4CN9A 4JBIA 5JQGF 1EIZA 1ZN8A 4F5ZA 3GC6A 3M9LA 4TSFA 3G9QA 2A9FA 4PYNA 4RMIA 4KO2S 5AXCA 1DJPA 3RRJA 1OY1A 3MTQA 4YRHA 2K2QB 4HUTA 5F98A 2OA0A 4LF5B 3EEIA 2MIIA 1OSNA 4E12A 3G8WA 2RGCA 1S7NA 3PV0A 2HU7A 3IGRA 4HNRA 1V48A 4O4JF 2GVZC 2QLTA 4GVPA 4X62B 3HABA 1M10A 4F96A 4YO7A 4KIUA 4WOJA 1JEDA 3TTWA 5KNCD 3R6DA 5CK5A 3ER6A 1KZGB 3FHOA 3R3ZA 1AQ6A 1L8AA 3LUHA 3ANYB 4RZHA 2BSWA 4ADSG 3G5UA 4IIHA 3H0KA 5LU9A 1CG2A 1HTWA 2REQA 1JKXA 3PNYA 2YVUA 2D8MA 4JQOA 4TLBA 4NNJA 2G77B 4MIEA 1YJAA 3SSMA 1IM5A 1M7HA 5MFZA 4LMPA 4U63A 1RWMA 3L6CA 5DTJA 3L1JA 3HGQA 2AC7A 1Y6ZA 3TVYA 4UXJA 3DUFA 1EX9A 2IHBA 1IYLA 3UUGA 2PS0A 1O94C 3N70A 4IGAA 2ZQZA 3VR6H 2CJYA 3WGYA 3Q0IA 3S9NA 4G9BA 4Y1FA 4GXNA 2EATA 2QRNA 1VE1A 2FR8A 4M21A 1T9AA 5EJ4A 3OOSA 2V96A 3A37A 3AM4A 3I39X 4HXYA 3UKJA 2XEFA 3ND6A 5LQUA 3PQ4A 4OAOA 3TD9A 3EFAA 4DV4B 1A9ZA 1S02A 3F3YA 1E1KA 4HOYA 1U8YA 1JHOA 1QH1A 1U8CB 4GPBA 4B3FX 4CL3A 2Q4ZA 3MCWA 1EBUA 4JKIA 3AJDA 1SD5A 2F90A 3OY2A 1MJHA 4H4DA 2UUBB 3RUFA 3NAQA 4YLEA 1T9CA 2FPLA 2QTNA 1XKQA 3DBOB 2CUTA 3GAMA 5TNXA 4KQ2A 1F9AA 3H8JA 2N47A 3DO6A 4OGLA 4BYGA 4HRXA 2ZR7A 2ZRNA 3KOWA 5KVVA