2GFQA

Structure of protein of unknown function ph0006 from pyrococcus horikoshii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
288
structure length
288
Chain Sequence
HSSGRENLYFQGHMKVIMTTKVDKASMNIMNKLIENFGFKETEYVFEGNPVYKRGDVLILTTNDEMIYYDYLDREIENQLGFKPEIIAFASRHSSKQKLPALTTHVTGNWGKAMYGGKDESFAVAIPSAMKLSLLKMSELNDLGWTVCYEATHHGPTELEVPSFFIEIGSSEEEWINDRAGEIIAETIIYVLDNYEKGRSKFKVALGIGGGHYAPKQTKRALEGDLAFGHILPKYAQPVSRDVMIKALNRFGEKVEAIYVDWKGSRGETRQLAKSLAQELGLEFIKDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0204 protein PH0006
publication title Structure of hypothetical protein ph0006 from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 107
structure length 288
sequence length 288
chains with identical sequence B, C
ec nomenclature ec 3.1.1.96: D-aminoacyl-tRNA deacylase.
pdb deposition date 2006-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04414 tRNA_deacylase D-aminoacyl-tRNA deacylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold AF0625-like 2gfqA02
3.40.630.50 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase AF0625-like 2gfqA01
2GFQA 1YQEA
chains in the Genus database with same CATH superfamily
3C70A 5GM2A 2O5CA 3B6ZA 2J3QA 3WC4A 1XZPA 3RSLA 1BDJA 3GT7A 2ZJBA 1R6AA 3K1AB 1PT5A 4NPAA 4E15A 2PJZA 1G9TA 3KQYA 3ZJYA 4X9XA 5FJJA 1KMNA 3MMSA 4KQFA 1OU0A 1T1JA 2PZEA 3I2GA 5FXMA 1G7RA 2JD2A 4Y6OA 3WRYC 1M1XB 4JJ4A 3GLIB 5J2TF 3D7MA 3EGDB 2GX6A 4LZJA 5CBPB 4YK7A 3UHAA 4JQOA 1TKRA 1P4RA 1EFDN 4ZRMA 4Y9TA 4GD3Q 2XVMA 4RXMA 1C3JA 1ONNA 1MT3A 4PSXA 2ZRIA 1ZJZA 4O8ZA 1SAYA 3O03A 3TE7A 3MOGA 3MTBA 4I1YA 3JQ8A 3VR6A 3S2UA 2FLVA 1L5ZA 3UCEA 4UPDA 1Y5MA 5D7BA 3RK4A 3DDUA 4TTTS 1JLSA 4LXTA 1J39A 2X2OA 4CG1A 1UMDA 4Q4LA 3SQOA 3A11A 1Y6QA 4TKUA 4E5KA 3ICCA 1KQ3A 2IDZA 1RXEA 4AMZA 2BYTA 1I7PA 5EG5A 2XUJA 4ALLA 4GC9A 3R7FA 4BPRA 3A9LA 1MC1A 1YAHA 4JYAB 2OD2A 4X8OA 3MWFA 2FPSA 5IH7A 3E7XA 1F9AA 1AMOA 4LXUA 1CJVC 1Y6GA 3LF1A 1QIEA 4F38A 3CWCA 2QV7A 1YVDA 3AM5A 3OE5A 3FECA 4ZYXA 3LPCA 1E2MA 5FH9A 3L49A 1PP4A 1KU6A 5H3CA 1BYIA 5I7VA 3CX4A 4EG1A 5FPQA 4DV4B 4F9TA 1Z8DA 4RDHA 1WAMA 3VM6A 1OXKB 3NHRA 3IT1A 4PANA 1Z2EA 4Q3EA 1X1EA 3AIMA 5HQTA 3FPAA 1TYBE 1TCBA 4RD0A 2GN9A 2VYVD 1P17A 1Y1QA 1WOMA 3BJ7A 2VR1A 1MEJA 2FZEA 4GOKA 2HUNA 3KFVA 3ZWQA 2PV0A 1KZFA 2WWWA 1E60A 4UAGA 3MXOA 4KE7A 4XVRA 5IC5A 4JHLA 4B3SB 2HA7A 3RRZA 2ZSEA 4KAFA 4QJ4A 3L05A 2L17A 3UATA 1LC3A 4IZHA 2I76A 3GXOA 4B35A 3BHJA 3BZBA 2FY8A 3QXXA 3B89A 1H69A 2OOSA 1IY2A 2WJYA 1EJ2A 2OHVA 3RT7A 2H0QA 3EXG1 1RXSA 2CF4A 3LLSA 2J33A 2ZJ8A 3OOJA 4AJEA 3QVWA 2NVBA 4IGIA 5IVDA 4WGFA 3R96A 1R8JA 5T3UA 3HA5A 2NYRA 3KKKA 1RWKA 4D74A 3VU9A 3UMRA 2YN4A 3MUNA 3I52A 2YICA 4PC2A 2A9VA 3GLGA 4UOQA 1CB0A 1AQYA 3KCNA 4CEHB 2F1HA 4U2FA 2AUMA 1O97C 2J9FB 5T6BA 3K9HA 4PBSA 5HDQA 3QEAZ 3EGVA 2OZHA 1CC1S 1E4YA 2A9RA 4Q24A 3DC2A 2WJ3A 3IQZA 3D5QA 3UH0A 1XNGA 5EHZA 5DASA 3AWDA 2V03A 3CLHA 4LBWA 4I46A 1RWBA 1NUUA 2AHRA 2NGRA 1VPLA 4RVFA 1LDEA 2BMAA 1RRFA 5I45A 2FF7A 1SQ0A 5AOBA 2VSXA 1GTVA 5K45A 3T9EA 1CUFA 5G0WA 3LNTA 2G9VA 2FZ5A 4NENB 3PUIA 5HJ5A 3S81A 1R4MB 1N9GA 3E3LA 1G3QA 3ZI7A 1UWYA 1TJYA 4INPA 4EUNA 2UXBB 3LC1O 2P7HA 4D5GA 4ZJUA 3K71B 3L7BA 2WT4A 4MV6A 1RQLA 3KB1A 4OLLA 2PGIA 5HUQA 2X2EA 3RAMA 1FY2A 2XHZA 1VDZA 1RMTA 1YE3A 4F5YA 3TBKA 4Z53A 1QQAA 2PSSA 3DVLA 5A06A 1MZPA 3SXNA 1NKSA 3ZHXA 1AKNA 3D3KA 1F0KA 3RHFA 2PEYA 3MA0A 2NV6A 2ZI7A 1G19A 2EP5A 3A1VA 5B5SA 1XCJA 4IQ0A 4RA9B 1PLJA 2EJCA 2W6JD 2KWIA 5I3CA 5KNBD 3SNHA 4K6FA 1E1CB 2AYXA 3HMKA 1YAJA 4LGMA 1XXLA 3VR2D 3A1CA 3EQ8A 1KWKA 2DCUA 3QX3A 2F43A 5IJ0A 1X10A 4GL4A 3C8MA 1YMEA 2XOEA 2BHTA 4WXMA 3ZIAA 5TB5A 3H2YA 4D97A 1XZNA 1JAIA 5EPUA 3A6JA 1ODSA 3NH6A 1XP8A 4WFQA 4M8IA 3OFVA 2NO6A 1JXQA 2A5LA 3S9NA 2GOYA 2ZJ1A 3OZTA 3CSUA 3BSWA 2CTBA 3SS9X 4WHMA 1M34E 1Z12A 1RZRA 2GYUA 4J0DA 2W93A 4MMZB 1Q16A 1JW9B 1Z8WA 5E7QA 3FSEA 1JDZA 1R0ZA 2AFHE 4MW2A 1GA6A 4B6GA 1RI1A 3LL4A 3SFZA 1SMKA 1GVHA 1F2DA 2C4TA 4OHBA 5A4DA 3W4IA 3ZVKA 1SHLA 621PA 1RVDA 3S5UA 4PZDA 3AVPA 3N75A 2BKXA 1MAVA 3CRW1 5F33A 4RWZA 4XWTA 3OTHA 2OGZA 4YHHB 3L01A 5EGNA 4WKCA 4C6HA 3ABSB 1ISRA 2RGNC 3KVNA 2XCTB 3FR7A 5CG2A 3EMBA 4HT3B 2EX0A 5LU8A 3B1VA 5EC8A 1I4OA 1QZ3A 3R2JA 1XPUA 4EW6A 1WSBA 2O8EB 5CW2A 3TUJC 3FWZA 4TZTA 4ZYZA 1NKVA 2FSGA 1EGMB 5JLAA 3GEBA 1QCYA 4DSZA 4FFBA 2G7MC 5G4KA 1C14A 3NIDB 2OPBA 4DNOA 1DAMA 2P2DA 4ZI7A 1FLAA 5I4IA 1H8EA 3GFPA 5M3BA 4G8CA 3CNQS 3K15A 4LF7B 3C3WA 4DCVA 1UK9A 1DT3A 5AI0A 3W90A 1K2VN 2NAPA 4LJSA 1HDCA 1GKIA 1QK3A 3OOHA 2H65A 3GIDA 1JAYA 1FVXA 2CXAA 2ADFA 4A0RA 4QT4A 5LQKA 3IKLA 2EZTA 2AG5A 4C7JA 2QIRA 5CVUA 2VYFA 4IXWA 3PZJA 3RHSA 4BUZA 8OHMA 4GXRA 3STHA 1VPTA 4YXWA 1EGQA 3HBMA 1THTA 4O4LF 3LKZA 4CGPA 3DEAA 4MGIR 3LHKA 2C4MA 4NH4A 3GCZA 3KQHA 1LOKA 5CDTA 1NW6A 1PX0A 2ENUA 1YS6A 4OXQA 4HFNA 4C4AA 4I4NA 3D4BA 2Z09A 1UPFA 4EHAA 5JAPA 4QFMA 5I4BA 1GR1A 3EULA 1HKUA 3B9BA 3UTCA 1HOXA 2QD3A 1VMKA 2XAUA 1MBZA 2D0PB 4MRAA 1M72A 3BMCA 2HD4A 3AY0A 1Q1NA 4DOMA 3TZLA 1FYDA 2PMBA 4ZOLB 5A1JA 4JLDA 2VRCD 2G9QA 3DT8A 1KI9A 1WJGA 3ESQA 2R6HA 3LYLA 2FPPB 3BAFA 4ZCRA 1JDVA 3ANLA 4CDNA 1P3Y1 3J80A 3GGJA 5EZQA 2E18A 4PR0A 3U3JA 4DNPA 1JHDA 4AN4A 2H1VA 3VV3A 2GJ9A 2I34A 4C5BA 1ODIA 3OZIA 4UNRA 2VYNA 3T7KA 3CS3A 1OA0A 2ZAMA 3ZLVA 4AY5A 3Q0TA 5FA8A 1PI3A 1X8LA 4RIGA 3RUHA 4R68A 2FXFA 4Y6LA 5IK2A 1AUGA 2D2VA 4WLEA 3KT3A 2AUTA 1JI3A 3K0CC 3C8DA 1Z4IA 5JECA 5ALDA 4B6FA 5HRUA 1DC6A 5EOVA 2GRAA 5EZYA 4GQAA 2JLSA 4Q3OA 3SZUA 3ZVNA 1JU3A 4G86A 4Y6GB 2W6QA 1SOVA 4YROA 1U81A 3IBSA 3QMMA 5AVKA 1H85A 1SHZA 3TZEA 1R6XA 5JQGA 1UWVA 4W1SA 1ZG7A 3B8GA 3WNQA 3V4PB 2BI8A 2BR5A 4ESOA 1BC5A 4L6CA 1F1JA 3JYOA 3I9JA 5FB3A 2D5AA 4KZTA 4CKEB 3EC1A 1M7GA 1XNJA 3L7LA 2HGSA 2FK8A 2YNEA 1T1SA 2AF4C 4AZVA 3TRFA 2FR1A 1JYEA 3MMXA 4N9QA 1XLTA 5B7GA 2IW1A 1OBHA 1G64A 2WYVA 3SSOA 2Q3BA 4BTEA 1SGWA 2NO1A 1FNBA 1NPTO 3A1NA 2OBYA 3DTVD 2J46A 4HDMB 1BW9B 3DMPA 1W2HA 1ZWLA 2ZE7A 4PCUA 1CT9A 4EATA 4A8JB 4WCVA 1H2HA 4WNIA 4JR2A 3IB6A 4F2GA 3ZCPA 2XXAA 5B7NA 2RBEA 4R54A 3QY0A 3UA3A 1X1SA 1BCSB 2WVJA 2Q3LA 1CIJA 1AT1A 4QBJA 1QHNA 7MDHA 3LRXA 3UBTA 2A5JA 2DWUA 4M0EA 3N05A 4IUSA 3VJRA 3G9ZA 5HCNA 4IDOA 4UU0A 3OLYA 2XA9A 1Z7GA 3NBFA 2BFBA 5F09A 4CMKA 5JMTA 1E7SA 2WBLC 5I7FA 5D3MA 1ZD8A 1HYEA 4G65A 3G2QA 2VQSA 1G21B 1H0HA 3UWKA 4PR3A 1TIBA 2CSXA 1XQ6A 1JG2A 1Q92A 4GSLA 3HK2A 4TWJA 1WMEA 2G83A 2J0QA 4PINA 2W8ZA 2IU3A 2ZOSA 1VCNA 1E8MA 3FZQA 5BXQC 2CD7A 1QCCA 4EGJA 2Y1LA 4KOTA 4HN9A 3WXBA 4DYHA 1SNYA 3R1KA 1D6NA 1ADCA 4Q3BA 2NZ8A 4MCAA 2BEVB 5SY9A 2C78A 3LGAA 4MKIA 1JWBB 3HCBA 2HJHA 1ONPA 2JAQA 3UK0A 4XIJA 2W0MA 2PBZA 4M0PA 2DF5A 4Q6BA 3NX4A 3JQAB 2PJ8A 3PNPA 4KPYA 1IVNA 2YHUA 4EG8A 3E9ZA 1G291 4AW9A 1H22A 1OB5A 2AQHA 1M2VA 2ZATA 3K9UA 3VR1A 4Q7AA 1PQ4A 4XFKA 2M6LA 1LPBB 2PUCA 4CL2A 3KOYA 2F64A 2FIWA 4O08A 1HDQA 1GOTA 3WRXA 4COOA 5ADUS 2Q5LA 3R0QA 2QMUA 4HGQA 4M1ZA 2IZ0A 1E2HA 2P6UA 3DL4A 1R1DA 4BO0A 1MIOB 5CUQA 3CJQA 5DBFA 1GNTA 2ZR9A 4QRHA 3NH9A 3WV5A 4JVLA 2H5JA 1KSGA 3LZCA 4OGLA 2SKCA 4K8RB 3VKGA 3EUEA 1QQ9A 4GHWA 3QTLA 3VZPA 3H5LA 2VWPA 3A26A 4KKXB 1SQ6A 4RV9A 2ANPA 3I01A 4G1CA 4L7VA 3VTAA 1D2RA 2PY6A 1UJCA 2B7CA 3EGWA 1BEEA 4YCDA 1E9CA 3GJ6A 1CF2O 4OK5A 2O54A 3G68A 4YQEA 1W59A 2QR5A 1LK7A 1NE7A 1OWOA 4QQNA 3HBJA 5KTKA 5JQGF 1EQ2A 2M32A 3FCYA 5CVTA 4GWLA 2VDOB 4RV4A 2Z1NA 4J1QA 1U3FA 5ICGA 3VQTA 2GFHA 4DJFC 1WXWA 1LPNA 5KDDA 1A4XA 5BVHA 4KAXA 3WLPA 3MSXA 2C3OA 4HDRA 1UOEA 1MQSA 4YN3A 1K3UB 4M1KA 3AF3A 1VKJA 3UY4A 2OMKA 1HFKA 1V95A 3IU1A 3D0QA 1NVVQ 1Z7BA 4LCJA 4MKZA 5CFPA 5A9SA 2P5YA 4LRUA 4MHOA 1O95C 5J3JA 2KE5A 2J3LA 4DNFA 3I72A 4M3NA 5JHGB 1CY2A 2OYSA 1E98A 3O4HA 1E18A 3NOOA 2VNHA 2XR1A 4J3FA 3MJEA 1H6CA 5J2UA 4MYUA 1WPQA 2F62A 1M4GA 4MV5A 5BUSA 4I8DA 4EELA 3BL5A 3Q0EA 4Q9HA 1AXEA 5AM2A 3QWFA 4GYWA 3HU3A 3U9SA 2PRQA 2PX8A 4MARA 1PJCA 1E1QA 3F3KA 2P3LA 1CZHA 3RBAA 1V4BA 4RD4A 3SVLA 2WZDA 4Q7KA 4GMFA 3BJMA 2GHIA 4P4NA 2PKYX 5REQA 1UPTA 4QTXA 1KR5A 2I5PO 1XKLA 2UZ1A 2E1RA 3Q41A 1PZFA 1GL3A 3H6KA 2FZCA 1OLSA 3EMKA 3LWNA 1DL5A 1GNRA 4OI1A 5ED4A 2IYTA 3QUSA 4MJ7A 3BKXA 4PAWA 3NVMB 5ARCA 5GADl 4O4JB 1YGPA 3R7SA 4YMLA 4P4GA 4D4GA 3DEYX 3DLIA 3P9QA 4NOKA 1KFBB 4BHTA 2JLCA 2OOKA 5AVOA 1C30A 4H0NA 5C4GB 3J81A 3IVAA 2VZZA 1EVIA 4EGCB 2GM5A 1XYYA 4RS3A 1I6MA 4PYMA 2PRJA 4Z9YA 4RK1A 4A23A 4TTIA 3FFTA 4YPFA 2G3AA 3G0DA 4X92A 3P96A 4J75A 5F1OA 3I45A 1JT9A 1M1YA 4HQKA 4IHJB 1YE5A 1VHQA 4R05A 4OSEA 1NN3A 3QUCA 5TJHA 1U7TA 4QICA 2NZXA 4HH3C 4L89A 2P2SA 2PKRA 3R6LA 1DKUA 2NOAA 4PHCA 3I04A 2HLDA 3GAFA 3RU2A 3W1VA 3U1TA 3MIIA 3K1ZA 3O38A 1DMSA 3PJGA 1VG8A 2ZRFA 2P4QA 4RF5A 2ODNA 3EFBA 2FZ4A 1YF3A 3C6BA 1F2PA 4DE5A 5JNRA 1NF9A 1U9CA 4LGVA 2PMFA 1LRLA 2XB9A 3I0NA 3A1WA 4YRDA 1TYZA 2HF2A 3ECCA 4DJTA 4IXTA 3UMFA 5CR9A 1XIXA 1FFSA 1HEEA 3GD5A 3KYBA 1ZYUA 3L07A 3SYMA 3S1SA 2Q1TA 3K6SB 4DCJA 1M6EX 2ZT6A 2H52A 1L5QA 1RHJA 2ZFUA 4LJ6A 2NUAA 3THYB 4M0KA 3WR5A 1U5CA 3NV7A 5D5HA 1PE0A 1EUYA 4LG1A 3QVTA 1V96A 4OXYA 1LWOA 5B7PA 1WXFA 4OXXA 3TIGA 2P6PA 3RS0A 4BXOB 1ZI9A 2TECE 1BQ4A 5DM1A 2GCNA 3RWBA 2LGJA 2JHPA 5DHTA 4GMDA 1EBBA 4U6QA 4MRNA 4EGSA 3BEOA 2WVHA 1YMUA 5E2BA 3JYLA 5JQWA 5J2UF 5CJ2A 1XPJA 4R7MA 3IR5A 1OUMA 4DPMA 2I3CA 1GTSA 1A9PA 3ZJ0A 1YVOA 5E3HA 4EKYA 2PQ0A 5KINB 3P9CA 5DNCA 2D6FA 5DGHA 3R4CA 3ND6A 1QNLA 1L4UA 3K8OE 3O75A 3KQUA 1C0PA 1HLPA 4UBRA 2Q7XA 3A6ZA 2N46A 3FPJA 2REXB 4YFJA 1BOOA 5JBIA 3RRFA 4DWVA 3SBDA 2OZUA 3EZYA 3WZMA 3TIVA 1J0BA 1Z5GA 3R6TA 4ISBA 4OGWA 1ZRSA 4OPMA 4NE7A 1NOKA 2G67A 1UKCA 1FTNA 1UPCA 3FNRA 1ZGBA 4UUNA 3LHIA 4MAAA 3LGXA 4BNLA 4N48A 4UFOA 2PX3A 3ZH9B 1NLMA 3OSZA 3ONFA 3P94A 3MAGA 3U40A 2P2ZA 2PMWB 4ALJA 2V6IA 2D8MA 1YLOA 1U6IA 3OP4A 4B12A 4L4RA 5F73A 3X44A 4FYXA 1MW8X 3A1SA 1W30A 4XPDC 4R1MA 2ZRDA 3RDPA 4ARUA 3R5FA 5JRJA 1U9IA 1ZUWA 2IBMA 1Z7WA 2Y92A 1NOJA 1K8XB 3C43A 4PZZA 3S99A 2VYCA 1VSTA 4FMCB 4DDTA 1A9XB 2NPOA 4KXVA 5GONA 3N28A 6REQA 4Y2JA 5AVRA 1QH8A 4PSDA 1VIYA 2WM2A 4JWKA 4NQRA 3NRJA 4Q34A 5IMSA 3P9KA 2DBVO 4FGZA 5T8KA 1LFDB 2RI1A 4BX8A 1RTTA 1UBHS 5DTIA 3BWBA 1Z75A 1J22A 2JRLA 3BRQA 1ULSA 1HR0B 1Z28A 4OLBA 1Z73A 3I5YA 1OHHD 3QFTA 3KVYA 4HC4A 1XL1A 4BAUA 2EK9A 2W58A 2Q44A 2J3JA 4U2EA 4MAMA 2QVCA 3DEIA 3ODPA 4LDJA 2ZEDA 2O4CA 3DCNA 4UVDA 1H2YA 5KTSA 3WR7A 1SIWA 4D8TA 4JBWA 4P58A 2C58A 1VJTA 1VXRA 1GPWB 1YKGA 4B3JA 3LLVA 3DMTA 4LIPD 4LPKA 1AF7A 4IV0A 1EGVB 3W6XA 3FXAA 3PR3A 1H2FA 1DAEA 4D9GA 1BE1A 3Q98A 4DAEA 4DKJA 2VJOA 1A9QA 3FWPA 3GN2A 2FUEA 1OZ0A 5L3SB 5BRNA 3FUCA 3M0EA 2G0NA 1XDWA 1QRSA 1L6IA 3A6GA 4KZKA 4CGMA 4P6YA 3BXOA 1LI4A 3DE0X 1ZIDA 1VXOA 4F4FA 1Q21A 1OF1A 1W5AA 2ID8A 2XHEA 4K1LA 4DBLC 4PCAA 2WJZB 4AYTA 3TSYA 4EARA 4KE8A 1G20A 3NGXA 3R23A 3KP1A 2OTCA 4DIFA 2QTRA 1DQRA 3RVMA 2ZIZA 2YTZA 2PSJA 1L5YA 3SC4A 4H60A 5C1OA 3B7GA 1QHXA 4KUEA 5EIEA 1VJ5A 2YVAA 1UOOA 1D1TA 3WRYA 2QL5A 2A3RA 4HRXA 4NQZA 2ZI5A 3QMPA 1RVV1 4B6JA 5EP4A 5T5QA 3QBDA 2PR2A 1G41A 3EXEA 1SPXA 2ADOA 4EHIA 1ZK3A 4C4OA 3ESBA 3V2HA 5C5IA 3OHSX 4JXQA 2IQ5A 3DGEC 2X9NA 3B5JA 2VHQA 4MRMB 5HKAA 4MGKR 4DIMA 3KX2A 1TKAA 5JH7A 1ORVA 4HXFB 3E0XA 3T35A 4KQMA 1PEAA 2LVBA 2J1LA 3R6GA 4OHXA 4FEYA 1KI4A 1XZIA 4Y2HA 5ITZB 2W90A 4TMFA 1KUXA 4IPTA 2E6KA 2CJWA 4OP2A 2W6OA 4KMOA 2CCGA 4HF7A 4HXGA 3K35A 2P30A 2Y71A 3PVSA 3ER9A 4H27A 3ORSA 4BUJA 1XHEA 1EX9A 1L8OA 2H59A 3O9MA 5TGTA 3K2KA 3QPDA 3KT0A 1I4LD 5L7YA 1QO0D 4EFDA 4NSNA 3B60A 1TM7E 3KTDA 1J2UA 1GAEO 5HYVA 2N47A 4P53A 5A9RA 1QLHA 4HHEA 4MVWA 1A88A 4TZ0A 2BEUA 4Q5IA 4YJ2A 2F1OA 4YJGB 4RZSA 4RS4A 1DKNA 4N39A 5GONF 2ARKA 1JKXA 1Y6FA 3T06B 2EDCA 1EBUA 5DN9A 1PDVA 3PIRA 4CFYA 1E9VA 5BSFA 2Q6OA 3G9UA 2ZIAA 3RS2A 2X0FA 2OK8A 2Z3KA 3EQ6A 3UFXA 1B8NA 3D3QA 2WYWA 3LACA 2Z83A 4I50A 4KXWA 2NO9A 2ISCA 3O31A 4CHTA 4HQ0A 2UZ0A 3IAS1 2WEKA 3BF8A 3TE4A 4YUWA 1N7GA 3MT7A 4BNZA 4D46A 5CT6A 4FJ2A 4XKJA 4XYBA 1GPJA 2WYUA 2AOVA 4O4IB 3AM4A 3WLAA 1R3UA 2PVWA 1F0NA 3SC2A 3O3OB 1L8XA 4K03A 4EZBA 1U5BA 3P0HA 2G09A 3EGXA 3ZIDA 3CXRA 1L7DA 2QNIA 4ZGYB 4EJ2A 4MCJA 4O3MA 3WLEA 1Z18A 3BTUA 5KKNB 1Z29A 2XGSA 4LHVA 2NUTA 1CUVA 2DT5A 3LDHA 2FETA 1NPDA 4UEJA 1FJ2A 3D3WA 3KWLA 3TQRA 3M5DA 2BELA 3EY5A 1SKAA 1XXHB 3T90A 5KIAA 2ACWA 4Z1MA 1D8TA 1VLHA 5JCZA 2QU7A 5J5VA 1KNQA 2CFTA 3N5KA 3B70A 5FHRA 4QSHA 3BERA 2I65A 1GXSA 5IJ9A 3FDIA 4RYLA 3F6CA 4BAGA 3HYLA 4QTTB 3NAMA 5AKLA 2O1WA 3HU1A 4BECA 5B30A 2Y1GA 2PLFA 4I1SA 4MUXA 2F3QA 4DRZA 2PTGA 4HB2A 3EVBA 4E2ZA 4GR9A 1Q0RA 3PD0A 1YRBA 2WWFA 3VPGA 5ECYA 4BQQA 3JQBA 2VH1A 1UJ4A 2WNIA 3R3JA 1Y1LA 4D6YA 2V0NA 1SQHA 4YREA 3X1YA 3D2MA 3K0HA 2HNKA 5D29A 1FDSA 5MN6A 4PYLA 5D3QA 5A4MS 2H9IA 4MW4A 3ICQB 4KH1A 2BFPA 1GTMA 3O8RA 1C3LA 3VO8A 2B25A 4I66A 4MR8A 3SPXA 1KRXA 2UYHA 5HUHA 2LR0A 2B1QA 4MZDA 3G7UA 4BBHA 4UJ3A 2EO8A 3AEXA 3CRVA 2HA6A 3VR3D 3PFEA 1G1MA 3FA2A 3QUAA 2OT3B 3L6RA 1P18A 1PUXA 3K9CA 5LKAA 3PX7A 2WD8A 3EAGA 5EPOA 2JHGA 1GGMA 2IPLA 3T5PA 2YIMA 4M6WA 1XTVA 3ZDBA 1Z07A 3JU3A 2CC2A 3C3EA 1THZA 3DDWA 5EIOA 1P0CA 1ZIXA 3UT0A 4DV6B 3T7AA 3MTAA 2EFJA 5ARBA 3NANA 1XLWA 1POXA 2B4DA 3ADCA 5C1PA 5ARDA 2XQVA 2BJHA 3HDGA 2Z3VA 4NCAA 1EX7A 4P8RA 3CY6A 3L93A 4DHEA 1DC8A 1ZH6A 3WIEA 4LAFA 1H6DA 1PG0A 5IM5A 1D2MA 1GPH1 2ZIFA 3DE7X 2ETXA 4NF1A 1AM4D 4RF2A 3DE3X 4Q9AA 3DYVA 1F2TB 3PL1A 4V1CI 3BGSA 2BHSA 1IEVA 4DMMA 2HPHA 3N8GA 2FN8A 4TLCA 4O0MA 3G0BA 4MKFA 4QNRA 4IQFA 4FI3C 4WCDA 1TF5A 3ZHVA 3MGKA 1BO4A 5EBVA 2FX2A 4IILA 4CF6A 2QL6A 4DC0A 3PDWA 4DT1A 3LCUA 5G53C 1P1RA 3K8QA 2BP7B 3D6TB 4OYLA 4YP5A 2FW7A 4YCBA 4KI0A 3AFHA 1KYVA 1OZAA 1ZPDA 3COJA 2R98A 1KEEB 2YS7A 4BASA 1I0LA 3D2LA 1PNRA 3ZKWB 1Y3AA 3T9DA 5TQ2A 3STUA 4UFWA 3ZCUA 4YBZA 1X1AA 4MKXA 3KLNA 5B6JA 3P2EA 2PCJA 1TEXA 2B1RA 1TL7C 4F4DA 4UBJA 5JCOC 1K2WA 5EP1A 3QSYA 5CIQA 2TMKA 1OGIA 1XMOB 1Q84A 5ALVA 3VJMA 5EJIA 3ZW8A 3VBCA 4GOLD 1YBAA 1L9XA 4CM4B 4F6RB 2BCJQ 2DXIA 1RYHA 4MZXA 3VNQA 5HXAA 1YGYA 2FLKA 4AL4A 3B13B 1QXSA 4TPKA 1ZVMA 2QAGA 3H9JA 5FUBA 3KJIA 2VDVE 3BJIC 4AF7A 4C7HA 4PNEA 2BZSA 1QQTA 4Z0HO 2EUIA 2O6HA 4H7EA 4XSGA 3RVLA 1I5EA 2J0VA 1P19A 4WKOA 1Y5NA 2ZIGA 3D3SA 1V25A 4AUMA 1YULA 4M49A 1JMVA 2WYRA 1TUBA 5G1PA 4QQKA 1XRMA 1L5NA 1P74A 4ZVOA 2FN9A 3VWDA 3OJWA 4GO1A 4JXXA 4XVCA 4ODIA 2Q4RA 2XPCA 5EKUA 5ENZA 3SKVA 2GR9A 3USES 1BOFA 3FCCA 2WU8A 1BU5A 1GV1A 2ZTMA 3EOAI 1Z5PA 4JWTA 5KQLA 3OQJA 3QJ5A 5CU7A 3GH3A 3DDNA 3G8DA 4MVJG 4Z8XA 2F1RA 2H17A 4DCSA 3OM8A 5COBA 1RJWA 2OUIA 2AE6A 1JSCA 1JMKC 1XPRA 1CUSA 3PT9A 1ZUIA 4Q19A 1FYFA 3OT4A 4IWXA 1QHHB 2UUAB 1ZWKA 4E30A 1MCZA 1LCPA 5A7FA 1ZU4A 3L2OB 3N76A 2EZUA 4U7DA 3E3NA 1IN5A 4YJDA 3U26A 1IULA 1YBFA 1SUEA 2WT8A 3F7MA 4L3OA 3UXYA 4O1IA 4OX9B 1K7YA 2HWUA 5H5JA 4KR2A 4A8TA 1Z8LA 3DC7A 2P2GA 3TJRA 3KR9A 3QLUC 4E3ZA 2ZTLA 4CQMB 3RAGA 1WK4A 5LP6C 5SZIA 1ISSA 1RAIA 4UHKA 3SR0A 3OQNA 4FXOA 2BGTA 3UT5B 5BQXA 5JI3E 1S0UA 3OMWA 1NX9A 1X7XB 1WD7A 1FNCA 1SBNE 1PHRA 5LC1A 2PFKA 3H5OA 4ZPXA 4QWWA 3WMRA 4O25A 3IP5A 3OPXA 1V5EA 4DV1B 4Q1VA 4RHEA 4IVQA 4MQMA 1C7ZA 1J9GA 2NO4A 4C4ZA 2HMUA 1YKSA 1A5SB 4WZAE 1NW3A 2BBSA 4J76A 3N3AC 1DC3A 2HRCA 2COKA 1H3NA 2SCUB 1E2JA 2XNJA 1A5ZA 1ZY2A 5KVVA 4B48A 1QU2A 2IWRA 1I01A 3CNHA 4XQ0A 4AECA 4YRAA 4JOSA 5LLTA 3IRUA 1BAVA 2VJLA 4WLVA 1KYTA 3T3MB 1Q50A 2HHHB 1I21A 5DGXA 3GZNB 3A25A 4AZWA 2H06A 5F64A 1B14A 3PFBA 4OJNA 2QW1A 1B8PA 3FVLA 2Q2OA 2P68A 4H77A 1NATA 1ENOA 2EEPA 3ROZA 2UXDB 2Y0PA 1L4MA 4WKNA 3CURA 3DKKA 3GNLA 1PJZA 4TSKA 2QGNA 4OKOA 3RFUA 2ARHA 2G9NA 1YZYA 3SVZA 5DK6A 2QVYX 4PX5A 3ZHZA 1JHMA 2JZOA 4B4KA 4ZU1X 4AWXA 3NQ41 3GLFA 1A82A 3W7AA 3I8OA 4ZOBA 4NDAA 3UMMA 2EBJA 3CRZA 4F1WA 4YH1A 3CC8A 4JP3A 4ZEVA 5FIUA 2FDRA 4QLAA 3ZHSA 2EGHA 1PJLA 3VHXB 4IWNA 4R2LA 5CA0B 3OIFA 4FBEA 4XB6B 3P5BA 3IJPA 3U7RA 3HVKA 1ZOIA 2V8HA 3FYNA 1Y9AA 1SC4A 4DMHA 4PSAA 3RT1A 3JQCA 2W98A 4ZI3A 4QVKA 4N65A 1KJIA 2FNAA 3I5AA 3EIHA 3O0TA 5L9AA 2Q5FA 4MW1A 1YL6A 4D6XA 3A6FA 1W2WB 4N3BA 3EW9A 1L4NA 1SZJG 3GT3A 1E92A 2C20A 3VFDA 1RRCA 1IN1A 5BN3A 3GEPA 1TM3E 5IJZA 4P3PA 3WYNA 1S4MA 1L0BA 1SN7A 4E11A 3M1LA 1JDSA 4Q15A 1CNEA 4CIYA 3D68A 4BGIA 3ONNA 3ZDAA 1RACA 3LLCA 4PNZA 1PKEA 1MT0A 2Z08A 1A1SA 3WL3A 1JH8A 4EY7A 3ZGOA 4HNXB 2KM1A 1VE3A 3UK7A 3AERA 3IMKA 2DXQA 1HUQA 2YW2A 3DVAB 4CR8A 1JJ7A 1AH2A 4ERXA 1QPGA 3FCEA 2B3DA 3QX8A 5JDIC 4EVIA 2JFWA 4A7PA 2OQRA 2GVZC 4R6XA 2C9BA 2WTUA 2UZ3A 2VF2A 1JJIA 5DM60 5C8ZA 4KHPB 1Z0FA 1YIOA 4MVJE 2FPLA 1XD8A 1AKTA 1V5GA 3PHIA 2GT1A 4YAFA 2GAOA 4O4LA 4EHBA 5GTDA 4LDPA 1UZNA 1V71A 2RK6A 4DR5B 4Z8YA 1YS2X 3CPXA 3ZHYA 4L15A 3RB8A 2PO5A 2IHTA 3ESAA 3NUGA 3GHHA 3TAXA 2GBLA 3U4QA 2P6RA 4HMQA 4ZQEA 5G3ZA 4BMDA 4OBXA 2BC9A 3M5WA 1HT3A 2EBFX 1K88A 4G89A 3FLBA 1QP4A 1KS2A 2F3PA 1QGDA 1D4AA 4J94A 1M8KA 2XNCA 4O63O 4WN3A 5EMHA 1NVAA 3DLCA 1AK1A 5F35A 1PJBA 3RU7A 2NTJA 4YT5A 4JS0A 3SXPA 2WHYA 4RMIA 1GCUA 4URUR 4F97A 1H9CA 4MP8A 1ZUHA 1P0HA 2XWBF 1Q0QA 3TGWA 2JIPA 1O5OA 2OCDA 1IWPB 3G89A 3T94A 2YXEA 1Z8TA 4B3HA 1NLUA 4URVR 2VJAA 4OBWA 1P7ZA 1RP1A 1Q7TA 2C2HA 4CMIA 1TLTA 1RPJA 4US2R 4I36A 2ZPTX 1N2GA 2FWIA 5FOXA 1Z06A 3KJXA 4JD5A 4PX2A 1I12A 4URXR 2ODAA 1VKHA 2FZGA 1DIAA 3COZA 1QIKA 2G80A 2FUG1 3DZBA 4N1AA 4OHMA 4UEEA 1Y1KE 3B6IA 2CE2X 1A9YA 1NT2A 2GCIA 3DZ8A 3PBKA 3CLKA 4LRQA 3CEMA 5H3HA 2QMZA 1SU7A 1W0JD 1OWPA 4OQNA 5CYFA 4FNGA 4DADA 3GJ0A 1UFOA 1RQ2A 2WTEA 4ECEA 1JEQA 3DAHA 3FROA 4BB5A 3PEFA 1HETA 3QA9A 1M4LA 1DOAA 3CUEF 4TYMA 2CL0X 4HX2A 2RHDA 4HZGA 5DCUA 1ZG9A 3AEQB 1RHQA 4EJSB 1DKOA 3S9MA 5T64A 3VHQA 3LY8A 4BFVA 5CCXA 4Q00A 1GUFA 1PAUA 1Z74A 1S7KA 4MYRA 4N18A 4KOXA 2JZNA 1BGVA 1HNNA 1HF3A 4HSEA 2XYVA 2X19A 2LDBA 1MJHA 3IWGA 4ZAVA 4IIJB 4LF9B 1H0RA 2LW7A 2ZLBA 3G8AA 2B35A 2O2GA 4JQSA 5AW9A 1X0VA 1JUDA 2QT0A 1YS1X 4IIBA 2R6ZA 4RHCA 4TLLB 2FH5B 2F67A 3KQXA 1WV1A 4V39A 1ELOA 1I33A 1W5SA 4D8UA 3M6IA 1N5DA 4CTKA 2D54A 4P31A 2XDQA 1T15A 1FUYB 4KR6A 3WB0A 1JHAA 4LS3A 1IZZA 2WILA 3HVIA 5LWHA 1A0OA 1D9ZA 3R7AA 1Y3IA 1W94A 2KI5A 5EJGA 3V3TA 4ENRA 3ZVMA 5AKEA 1LBSA 3ZNPA 5C52B 4OMDA 3M6AA 1EDOA 2VF5X 3ZY3A 2RK4A 1FSGA 5A0VA 2B3UA 3RSHA 4CQNA 2WFLB 2X7HA 4KS9A 3FBUA 1Z5NA 1K8RA 3EA4A 3GYGA 2QLJA 1KETA 2BV3A 4MMOA 1L0CA 1J00A 4U9ZA 1HRKA 1R8SA 2Q5QA 5IX8A 3G5MA 4R2IA 5EWJB 3OHMA 4JOBA 3GFSA 1NXQA 3LAWA 3FI9A 3E9NA 3LSTA 3HFGA 3NWJA 3AY3A 2B8EA 5DGTA 2ZRHA 5A0TA 3SYTA 5JLJA 2QEQA 5HCIA 3WYAA 1ELLP 5JV5A 2PKQP 1JDNA 1OROA 1IUKA 6ABPA 2XRZA 4OQLA 4WK2B 3IDOA 4OB6A 4C78A 4L2IB 4YECA 3GUYA 4RVHA 4JIMA 1Y7PA 3ZEIA 1U2DC 3DULA 4L9RA 4RSRA 3PT5A 4TYNA 2C9OA 3JATA 2HA0A 2YV4A 1YQTA 2ZDQA 5IXJA 1V45E 4LNAA 4JKOA 3QX7A 2HO5A 1XJQA 3LK7A 3ZLUA 4ZV9A 2HJWA 2KS6A 3LUGA 1X1DA 2J4DA 3R20A 1U2ZA 4GZMA 1RS0A 1QSTA 1Q1EA 2FW9A 3PTAA 4ZCQA 2CWWA 4DARA 3FVQA 2VYVA 2R7NA 2HMYB 2WF6A 3M9WA 4RIEA 5FR1A 4OYHA 4ZT3A 3AI7A 2H00A 2GVDC 3GLRA 2OECA 1FUUA 2IIPA 4HXEB 5H84A 3VZSA 4WOJA 4JYMA 1G9XA 1HDEA 3KLMX 5FLXA 1IXZA 5KYWA 3VH2A 2IWHA 3AJAA 1KFKB 3EXHB 1QB8A 2JFNA 3V48A 1MENA 4IRMA 2HFKA 2BKVA 3IS3A 5AM1A 1SCBA 2POKA 5F2OA 4TKMA 4PSUA 3UMYA 1N4DA 5CNPA 4DLPA 4RZUA 2IF2A 2X4DA 5DULA 5E1DA 4AMYA 4JLYA 3RGGA 1T24A 2QRVA 3IUBA 3JYPA 3VC7A 3A4VA 3V7NA 4G5RA 5L53A 1C1XA 5LIRA 2EC5A 3OQIA 4RA6B 4HNYB 1MABB 3TRIA 5AUPB 5DBIA 3N74A 4LDRA 1KGDA 4Y9RA 2D4OA 3SLKA 2RGWA 3V8EA 3MXTA 4MVCA 3BWEA 4CMGA 4DM7A 4JI4B 4NXNB 3KHXA 2XRYA 3KPJA 4KN6A 3RTDA 3FNQA 1CY7A 1W48A 4ZC1A 3NLLA 3CF2A 3DR6A 1P1BA 2ILVA 1N71A 1AGYA 4F9UA 1NUQA 3ABQB 1DCKA 4HBGA 2QVPA 5D6NA 4HNVA 4ENSA 1JB1A 4EJ0A 4EKIA 1USUA 1JQ5A 1KAMA 3ZIUA 4KFRA 2P78A 1ORTA 3SJUA 3LUAA 3UQZA 1J2RA 1XU9A 4KXQA 4DMKA 1YZQA 4DLRA 3WSWA 2BZ0A 5AI9A 4XSVA 4HPXB 4RV5A 2CV2A 4BV2A 2B6NA 4R7GA 3G7NA 3L0CA 4AQ7A 2FJ0A 3MAAC 2W6ID 4C6TB 5KX5A 4AJ2A 3EBOA 5C35A 3AWIA 4EDFA 1FUKA 4WBNB 3ON5A 3N2EA 1QRAA 1P5JA 2IPNA 1RXYA 4A33A 2NW6A 4PSWA 5LUBA 4LE2A 2YY7A 1CS4C 3PFHA 3J7TA 1EA5A 4RXUA 1IJFA 2D4AA 1JTEA 3FIUA 4AS2A 5EUQB 4DV3B 5CFMA 3NT4A 1JE1A 5KWEA 3ROEA 2IJGX 1TZCA 3KJFA 1ZBQA 4PK2A 4ENUA 1B4DA 5TIIA 3EF3A 1TVKA 4QQFA 1JR6A 1RI4A 4KOUA 2IDJA 1TW3A 4GOND 2W6JA 1QHSA 5KNBA 4JWPA 1BDHA 1CG6A 1JPVA 3O7MA 5KB3A 5A1TA 5FWAA 2QE7A 1XZMA 3TTUA 3TMYA 2XGGA 2ZW6A 1T5BA 1A5BB 3MNFA 3RAPR 4JI7B 3U7QA 4HNAA 3HKDB 1NBME 2VXKA 3I2KA 2XWPA 2B1JA 4S1OA 5DX8A 4P32A 4F1JA 1UAYA 2CXHA 3QWAA 3MQ4A 2W9XA 2PK3A 3KEMA 2A8YA 1O5TA 4NZ9A 4TS1A 3GQVA 4W1QA 2CSUA 4XDZA 5SYNA 3C6KA 4BMNA 4YRZA 1Y98A 1ZLYA 1NX6A 3CVYA 2QMLA 4Y1RA 4X1YA 4AK9A 1V8FA 2PH5A 4WCFB 1PD1A 2C94A 4AXBA 1NY5A 1PV1A 4KXYA 2AI1A 1XHLA 2X76A 3KQTA 2YNDA 2ORYA 2J6CA 1G7TA 4YJ3B 4DXAA 1Z47A 5FWXA 5GV8A 1T2VA 1MO5A 4QU5A 4I1VA 4TV8B 3K9FC 2QJRA 3LBAA 2HIHA 1R3DA 1CDEA 5AXCA 3HUVA 2HJGA 2RIPA 4HI0E 2R7MA 4BIMA 4Q48A 1P2UA 1RWQA 1A76A 1VE1A 1S02A 3DKPA 3LQ1A 4L72A 1G8MA 2FHPA 1Z2DA 3GT0A 1MVNA 1G6OA 3HH8A 2XWQA 1H65A 4PO8A 2QJOA 4OUDA 3C5EA 2O2EA 3O8QB 3W2HA 4KOAA 3OCYA 3GY0A 4KUGA 3G17A 1BKDR 2ZJ5A 4LXIA 5E6RA 5ALQA 2VZ9A 4U6SA 1IAQA 4CCYA 1OSNA 3N1UA 4LC9A 1II8A 4NG5A 3IUYA 4B10A 3WLIA 1QLJA 2HYDA 2YRWA 3X1JA 4MI3A 2I3BA 1UKVY 2OUKA 3OFKA 1ZHHA 4RF4A 5IFKA 5KOYA 1ZSNA 1NUHA 4EPTA 3ETLA 4ZI5A 2MSWA 5CB0A 1IBSA 2JVKA 3JQQA 1MQ9A 3W2EA 1TQ2A 3TKLA 5AK6A 1SKMA 3V8BA 2FT0A 5A3SA 4ZVQA 1SXHA 1YONA 5KNDA 1WU7A 4PHGA 1AURA 3HSSA 2Q3CA 4JU9A 5IEJA 1HQYE 1G8PA 4ARCA 3M1YA 2QVLA 3D64A 5KX5F 3ROXA 4YCNA 5KJ6A 2XOKA 2AFIA 4F2DA 3CG0A 2YWEA 1T6NA 1FEZA 2IQ6A 3VC2A 2F1KA 4DFDA 3IGRA 4NBVA 2AL7A 4ZV7A 1C7JA 4JIGA 2KLHA 3FYDA 1V1JA 4BMPB 2ST1A 2IZ7A 2FR8A 3NR2A 2MSNA 1D4FA 2BH9A 4QG3A 3HYSA 1J5XA 1Y5LA 1I2MA 2HZBA 3T3EA 3ZX5A 1WDTA 2PRSA 3VYTB 2O8CB 2E4WA 1OKKA 4BUCA 3V7YA 1T36B 1GKLA 1M2NA 1K9VF 4XYMA 3S40A 4D2IA 1UP4A 2VHYA 3VUFA 2XADA 3H1BA 4ZHQB 2BLLA 2O50A 5ICEA 1JEYB 2HZ7A 3HJUA 3MINA 2ZTHA 3ZZNA 1EUDA 2WJHA 2RKOA 1O54A 2FN4A 3UB3A 5TPWA 3B48A 1LD3A 1BX1A 4YA6A 1ORWA 3PC4A 2NU6B 1Q0PA 4OBBA 4LY3A 2UV8A 4FUQA 2FSPA 2JCSA 2B4QA 5HXDA 4F84A 3WQSB 1YR1A 2ZYGA 3BCHA 3I2JA 3GJXC 3K4QA 3LRPA 5AW5A 3GFQA 4QEDA 4X5OA 4F2HA 4B5PB 4DCTA 1QIMA 2OM6A 1N33B 1QK4A 2FCRA 2BFOA 3BL8A 3L4BC 1IY7A 3RW9A 1OXXK 1EFRD 4HUQB 5CM8B 1DG3A 2AMVA 2BBTA 4WQMA 4YXFA 1Q5PA 4IMIB 4FEAA 2PRBA 2Z1DA 3TRHA 2C1XA 2HNAA 2QXTA 5HFJA 5FBHA 2WHPB 3CCFA 3ANSA 3PFGA 4NYJR 2ZBVA 4R40A 3LMSA 1ZLXA 4CYNA 3Q2KA 1YDEA 1OI7A 5JCJD 4P3YA 2IH5A 3HN7A 2VTBA 1BIFA 3W5IA 1WHTA 2BTOA 4PPZA 3H4TA 1KI1A 4TV9F 1GKKA 2JHFA 1PK7A 1WL8A 3BGOS 1V4VA 3GFOA 1GDTA 2DAPA 3SE0A 4JLWA 1L5MA 1HK7A 3JQ6A 3TSWA 1VLMA 4U3JB 5SZHB 1T3LA 3IO1A 3O3CA 4ROSA 4OQDA 4DYOA 2PUTA 1CG2A 4MVYA 3OZAA 3S6JA 1QX3A 4JC0A 4KRFA 1I2AA 3DTYA 4H16A 2VSYA 3A3YA 3SI2A 3TW4A 1J0EA 4OJYA 4HDSB 4O8CA 1P9LA 1FFHA 4E8OA 4BO5A 2XCUA 2GN2A 3H17A 2CCKA 4D9HA 3QVXA 2ZEEA 2PH7A 3UXMA 3BIOA 3OF2A 4ZJYA 1JS1X 5BQ3A 2RG1A 4PCVA 2W5UA 1SKQA 4M1QA 4IIFA 2GPTA 4DKXA 4QRDA 3X1KA 4CLXA 3M6WA 3CSSA 2GERA 2D74A 1X70A 3OBBA 2CXTA 4BQRA 3CR3C 1OWMA 2ZT8A 3DOEA 3FD8A 1Q83A 3L4EA 3RH0A 4IX1A 3O2NA 1P81A 3HACA 4UBMA 3DCYA 3G2HA 3OOWA 3HJNA 1IBRA 3NRBA 1USVA 4ND2A 3ZE9A 2Q1XA 1WB5A 1FRZA 2XEIA 4QULA 1RR6A 3MFQA 2LUOA 4C88A 4KLAA 3U44B 3CWQA 3NI2A 1KQOA 4RFLA 1SQ5A 1A97A 2WWHA 4XUEA 4X3OA 2XT9A 4AURA 4H1VA 1SVWA 1SH7A 2WIBA 2YN2A 4K26A 5AKYA 2PX2A 2D5CA 2X77A 2Q1SA 4TL9A 3N2KB 4LW8A 3SR4A 4RDCA 1P39A 5DSZA 2CZQA 1UT6A 2MINA 3H0EA 4BP1A 3MRUA 3VTFA 1QIHA 2WAOA 5I9LA 1DJNA 4HK4A 2WWIA 5KDLA 3RU3A 4OI2A 2OWEA 5A6SB 1T5LA 3LL7A 3BMXA 4JXZA 1J8YF 4JVOA 4OLAA 3NT5A 3TH5A 5DYWA 1J9EA 3Q3HA 1UM9B 2QNBA 4UEOA 3KAJA 4C0QC 4N0MA 2R25B 2GJSA 1T2NA 3K4PA 3T3GA 5TQVA 4JZKA 2BIFA 1FFDA 1OIXA 4YGYA 3O4FA 2IYNA 2DU8A 4UNSA 5AK0A 3OFND 4KSBA 4AJNA 3P0EA 5FNVB 4KOSA 4NZYA 4X3PA 3JQRA 4H31A 1V1MA 2Q9BA 3ZWMA 3CUWA 3RG8A 3ORQA 5F48A 3L8HA 4H89A 3IQHX 5I8PA 4KVGA 1O4WA 1QCDA 3EG9A 4X61A 4HDCA 4BKOA 2OYRA 4IH1A 3KEGA 1LRZA 5E9QA 3ZWWA 2J31A 3JW8A 4OXIA 2I3DA 8ABPA 2ZIXA 1YR2A 2F90A 3LTEA 4Y49B 3DXZA 1IC6A 3CNOA 5CT8A 3FPKA 3SI7A 2V7VA 4D3FA 3P2IA 5CP8A 2PR1A 4BNYA 4CR7A 4D96A 1YJ8A 4CKYA 2C5GA 1JSZA 3CFYA 3ASUA 4IEEA 2H1SA 4EHFA 2A4NA 2R8VA 4NOMA 2PKCA 2WOJA 4UJ5A 3SNKA 3L40A 2B92A 4RVUA 3U31A 1IN6A 1U2PA 2PZMA 3IAFA 4HVCA 2VBFA 3AQ4A 3O3NB 3DUFA 4K86A 1EFKA 3CIFA 4EYGA 4XGRA 2ZROA 4CFSA 1P9WA 3PYLA 4CM7A 1S1CA 2AXQA 1JR3E 1YXMA 1PTJC 1KYXA 3UY5A 1V16B 2GZAA 2ZZMA 1BXRA 2RHTA 4I99A 3T1OA 2WSMA 1S9DA 1MJ9A 1FS4A 4B17A 4DZZA 4LCBA 3O4GA 2RGGA 5HJ2A 1WXDA 4OMUA 4B73A 1HNXB 3NHSA 1BD4A 2RJOA 5EWLB 5BV0A 4ORFA 4NZNA 3KHKA 3DYIA 3OD1A 2EW1A 2Q0QA 2H1LA 4B32A 2PZBA 4B6OA 3H5IA 4J0FA 3IAS6 1ZZGA 3GJ8A 3DVSX 1W36D 4QAQA 1FP7A 1C3OA 2XCOA 4ND8B 4CM8A 5KI6A 4WWHA 3GRKA 4IZ6A 2IPOA 5BYBA 3SX4A 2PVSA 2PNFA 3F46A 4JUCA 5J40A 2AXNA 3BIJA 2J85A 5ELYA 4GI3A 3K2BA 2AEFA 2IW3A 2AX3A 1M2OB 1VRWA 3UEOA 1HYGA 3M8KA 3RJTA 4FD7A 4UC0A 4B74A 4MIOA 4A8HA 1FW8A 5FWYA 4QOGA 4DA4A 4L0MA 1B0ZA 3HA7A 4F1KA 3TG8A 4FOOA 4BYGA 1V11A 3TTVA 2JFVA 3JWJA 3ENZA 1VGVA 5B3JC 1XMIA 2W42A 4IW3B 3BC1A 5BW8A 4CT0A 1NQWA 1PBTA 2D13A 1G21E 3FTDA 4O3FA 1KP9A 4Y2GA 2UZAA 3R6DA 4IP0A 4FZ3A 1K75A 1NQXA 3QG5A 1GPAA 5CYGA 3HKCA 4YAUA 1QC5B 2Q8QA 4EG6A 1T5DX 4L6AA 3R9XA 3CRRA 2IZOA 1R37A 3QOYA 4WSOA 2BGJA 4L5JA 2JHCA 3FYUB 3PZBA 2F8MA 3KR4A 5KSWB 1C1DB 4FC7A 1SCNE 1N1GA 4ETMA 3ZHBA 1B8VA 1PUJA 2EQ5A 2VHWA 4B4UA 2ZEFA 2FN3A 3QVJA 3C3YA 5HFAA 3OKCA 5BNIA 4PBTA 2ZQ5A 3CYFA 1NNSA 2FA9A 2QX6A 4B6ZA 3O3MB 5IT4A 1UJ2A 5BSTA 4CYMA 4MJ8A 3SYRA 2AZDA 5JAUA 3CEPB 1IXSB 5CIYA 5ICSA 5AH0A 4D4IA 3UANA 2HSJA 3CMMA 2DBZA 3VJLA 4CODB 4E08A 2O8FA 4NGNA 2GKOA 3ZWCA 4EUSA 4AQDA 3OG9A 1LSOA 2V9CA 1QHIA 1AHHA 5BWNA 1XEXB 3NBMA 3LT5A 3DE1X 3I1JA 4A0FA 3PLRA 1K6JA 5FBRB 2JGMA 4R31A 3KJGA 3GJ3A 3V00A 2A67A 4EUHA 2P8SA 3V7FA 2P9CA 1QG6A 4AROA 5T67A 5BRAA 3U7GA 2PWAA 3KZCA 3PRTA 1M54A 1N75A 1PT9A 4V1CA 2Z3ZA 3U9LA 4AZTA 2ANBA 2GDJA 1QOPB 5DZSA 5M2QA 1T4CA 1AK2A 4WJZA 2BHLA 1TA9A 4ABYA 1CUGA 1NRJB 1CE8B 5FOSA 4DRYA 3IESA 2NNWB 1Z39A 2AD1A 4CLHA 1YC2A 5AICA 3RJ9A 3AHGA 1VOTA 3UMSA 3WC6A 2Y1KA 3V4OA 3GPCA 2GK7A 3HPRA 4ZODA 3S8YA 2IYAA 4LVNA 1UMKA 3FEDA 3W6ZA 4QYIB 2FMTA 1B6RA 1ILWA 1YK0A 3Q5DA 4KW7A 2V8BA 1QDEA 1WZ2A 2I1LA 2CNLA 2VBQA 3TAHA 3WT4A 4QUAA 2AF3C 1AGPA 4N6GA 5HCUA 2R3SA 2R1UA 1HZZC 2JJ1D 3VPAA 4U1RA 5TXGA 4J1TC 1ZMXA 4AXXA 5C37A 1BMQA 5CTJA 4CGNA 2HBQA 1FUIA 4QEKA 3DMRA 1QP8A 2AI2A 2XJ9A 2SICE 4YMWA 2PM8A 2Z4TA 2MOKA 2J8ZA 3P4XA 4HWGA 4QPPA 1S2OA 5H82A 3PKIA 4DM4A 3B1KA 3L1IA 5IDWA 2KX7A 1K3FA 1NURA 4NLLA 2UYQA 3IC1A 4KLRA 5BUQA 1O6BA 1JFLA 1EFVA 4X66B 2Z04A 4QXQA 1PZHA 4PCLA 4KC0A 2RHHA 3ZOKA 3O8LA 2O2ZA 3HJGA 5K8LA 1I9CA 4QQRA 3DKIA 2BISA 1KJ9A 4B31A 3AYXB 4M9QA 4WNCA 4F8YA 4WXPA 1ZK1A 1FT7A 3MYRA 3ENNA 3H1GA 4PFKA 4MULA 2VUIB 1SVSA 1R0WA 1Q11A 2Q62A 4R8KA 4E5DA 1HDGO 3D7RA 1TYAE 1AKYA 3I8SA 3GD7A 3GPDG 3QKIA 2PSFA 1WSWA 2XTZA 4YLGA 3ZR4B 1ETHA 3OJEA 1OHHA 2IU4A 2IS2A 4GP9A 2BDEA 1ZGZA 1JHVA 1O08A 4FWIB 2CNWD 3PEUA 4EYQA 4RETA 2VS1A 2FZWA 2BKLA 1YDFA 2R7AA 2EIXA 4DV7B 3T1VA 1YACA 2NV2B 4GSKA 1P5ZB 3C16C 2E49A 2WM8A 3F6YA 3H4VA 1XMPA 3RF6A 1U31A 2DP4E 3MZ0A 4BE4A 5EINA 3WNZA 3E9MA 3PGVA 4UQPA 3GIWA 1EP2B 2PS3A 1T9BA 1TM2A 1J5EB 3FNFA 4D8VA 5GV7A 2ZVQX 1UFQA 1P4HA 3HXMA 3LHSA 3T5CA 3TCXB 3WMWA 2IXDA 1IOWA 2RGNA 1N5RA 5FI3A 4BVLA 4TZKA 2Z5GA 1YR8A 5IUJC 4FEEA 3LNCA 1GYPA 3CF4G 3WL7A 1IG3A 2IOYA 2D0IA 2M6SA 2W70A 2ODTX 3GCDA 2BRUC 4YWJA 2QMHA 4YRSA 2D1TA 4GLOA 2PZ8A 3B38A 4MYDA 5HX7A 3VVCA 121PA 5JY1A 1PSWA 3DV0A 4I8XA 5GGXA 4BNIA 2WFAA 2C9DA 4IAOA 1GDDA 3ZHTA 3WBFA 2Q6VA 1AYEA 4YHBA 3LY5A 1ZISA 1KTIA 2GM4A 3GRYA 2ZWAA 2M2IA 3K6JA 2QQ0A 3M83A 3OH8A 3D67A 1ACMA 3KZKA 5JT1A 1W7AA 3TXYA 3P9ZA 4AULA 2PUWA 5K8MA 1SC3A 3W78A 3ACDA 3OQPA 1OGYA 3MB5A 3ZJUA 1ZG8A 1GG5A 4FZ5A 3MUOA 3U81A 2V4ZA 3GL9A 2C1CA 4B87A 1TOAA 3NTUA 3ZCXA 4L3VA 3GDOA 2RC6A 4EO7A 1XCLA 1SUIA 4M6GA 1TMKA 1X86B 3RLIA 3ZPXA 2H6EA 5HHTA 3QVGB 1TIKA 4N40A 3QLVC 1F12A 1N77A 1I2DA 4JJAA 1P1CA 1E7YA 2Q9AA 5JROA 3CH4B 1DJMA 4UM9D 3QEMB 3AESA 4B34A 4ZOAA 2RAFA 3CZXA 2VOEA 4X8MA 2BFEA 1QVRA 3OCZA 1NW5A 4FE4A 3ORYA 3ANNA 4YS6A 3K9QO 4BNDB 1XDZA 1WSDA 3H9GA 2GZSA 4NC9A 1V2GA 4CCAA 3OJ0A 1MX9A 4US0R 1CYDA 1KMHB 1SWWA 2SKEA 3LLMA 1WEHA 5EA2A 4LYFA 4BQIA 1AQJA 2OZLB 5HW0A 1PJQA 2ZUWA 4D45A 3HY3A 1EAYA 4BVAA 4TZ6A 3P9PA 3L2NA 2FXIA 2GLUA 2AN1A 1Y89A 4QM7A 4WKGA 1SUFA 5LWQA 1PVDA 2QBYA 1VE5A 1FFEA 2NTYC 3K0CA 3SMQA 2DUUA 1V39A 3GEMA 3A9WA 2GHTA 1X3SA 1Z4OA 1KI8A 2C5AA 4UCPA 1YLEA 1NW8A 3KYDB 4MP3A 2VEZA 2J5KA 4UASA 3RUFA 2YHIB 3PX3A 1N5JA 3UV3A 2XCQA 5EE1A 2R1VB 1OTXA 4QGAA 1J5PA 3NP9A 1S5KA 1ZK4A 2IX9A 2HC9A 3ZZIA 1NVKA 3AY6A 4RCYA 3F71A 5K1ZA 3DHWC 4GP7A 4X1KB 4HNTA 4WN9A 4Q3NA 2R8RA 2XYRA 2WTMA 3DSBA 1SBZA 1UWLA 3K0SA 4BN4A 2XSZD 4B83A 2PR7A 3OP1A 4RCZA 5JD6A 3UFBA 1CQWA 2EJTA 1E2QA 1FMTA 4I3HA 3L43A 4TQ9A 3BPSA 4G1UC 2QYHA 3SVTA 3CN9A 3TSZA 3ZDZB 3WQHA 2OV8A 3M89A 3O74A 4Q01A 3QF7A 3M3HA 3HN2A 5KNLA 3U2QA 4DZRA 2YDYA 1EQAA 4NCXA 3Q9LA 3OZ7A 3RBXA 3ZGZA 5L6MB 2FPKA 1R9MA 5CH5A 3G6KA 3BA1A 1CJUC 1DGQA 4OBEA 2VHCA 4G67A 2ZI4A 4TYPA 5CYOA 3GY9A 1C0IA 3NB0A 2BFFB 5AJYA 3ADPA 3NHUA 2E4AA 2LV8A 4IICA 1QNFA 4I9FA 3SZMA 1AK9A 2ZREA 4FKBA 1FYEA 1S9HA 4CYPA 1KY3A 3SI1A 2B9VA 4QTYA 4CLRB 4R1TA 3ZTWA 1SQSA 5AJXA 1KDOA 4EB6B 5EC4A 3A58B 1X1RA 4D4MA 2A9QA 2H08A 1ZNZA 1Z5OA 2NU7A 5KTRA 1UMBA 2FP3A 1EDEA 1NIPA 2BHNA 1E77A 2ECPA 1YJBA 3PYMA 5CEEA 3FPFA 3E23A 1NW4A 4QWMA 3IWEA 5EE9A 1DAPA 1EFPA 1NLZA 3L7OA 2QRGA 2GFIA 4TWIA 3D8BA 1N5KA 1XCGB 1XTIA 4CE6A 3T34A 4QOHA 3CJTA 3K05A 4BRZA 2AOTA 5EXTA 2OORC 3R5TA 4Z2AA 1RYEA 1H05A 2JFQA 4LWPA 1X7GA 2UYOA 3STTA 3H1FA 1XFOA 3AVVA 1OT3A 4FFNA 4ABTA 3TUIC 3ZE2B 1U6MA 4QPZA 1LDGA 1E7RA 1GTG1 1KSJA 4IIHA 2B9EA 3JR7A 2KMLA 5BN4B 4ERNA 1TRKA 2V1UA 4FFLA 2XA2A 1WMAA 3H9EO 2IHUA 4F3KA 1U65A 4DA6A 3WGOA 2OGUA 4LYGA 5JI2E 3L7MA 4IK2A 2ZBRA 3T4PA 1N2EA 4GQBA 3DDHA 1IE3A 3PJRA 5SY4A 2ZUVA 4OXKA 4B0PA 3TXXA 2FSFA 1NJ6A 4CKWB 3A31A 5FTJA 5CYPA 4M54A 1Y9KA 1OI4A 2QSZA 2CYCA 1BRMA 3WISA 2VP4A 2WI8A 4H6ZA 2WFZA 2DWOA 3JVEA 2ISSD 2HAEA 4FDUA 3T4XA 4MHSA 2VNAA 2EYUA 2O2SA 5BSWA 3LHFA 2DHCA 5LDHA 2V7WA 3G59A 1RWVA 1TNDA 2VA8A 2R87A 4FBMA 4HWSA 1Y7HA 1YJQA 1SZDA 2ADMA 3HBNA 4MYHA 3BB4A 5KYUB 1JBEA 3KJZA 2I66A 3E84A 1PF7E 3M81A 2VSNA 5LOVF 3IDZA 1GPDG 4HAIA 5EJ8A 3AEKB 1IHYA 1QTRA 1NP7A 4URWR 2D2EA 4BU1A 2V4MA 1U5AA 4E1AA 1ZDMA 2WHQA 5F5LA 1CY6A 1O95A 3MN8A 4K6OA 1Z5UA 3PLAE 4S24A 3F73A 4K6KA 1PGNA 4TOIA 4A27A 2ZYHA 3TLYA 3IP9A 4LSMA 3SFVA 2HEGA 4JOCA 3ZE0B 4Q02A 3ZWXA 1XPOA 3VSDA 4U2DA 1J20A 1X7ZB 3B9RA 2QM7A 2EKLA 1XBUA 3VPSA 4M8LA 3O4VA 5HKOA 4GG1A 3SZGA 2J4CA 3JAMA 2JCVA 2R6DA 3MWGA 4LZLA 3CUKA 3TBFA 1R9JA 2P91A 1KSHA 4FR0A 2I80A 4U0KA 4MCRA 4ZAYA 4BNUA 1YSJA 5C5DA 2E4ZA 4M9CA 4X64B 1OJ7A 3ZV6A 2PU7A 2FSVC 1OBFO 1XXHE 3ZXUB 4QC6A 3L0DA 2JASA 1Q1BA 1Y3DE 1RNLA 1GGHA 4W9RA 1GAWA 2GU2A 2Z8YA 2ZPAA 1BJRE 3MVEA 1KJNA 4ZZIA 4OAPA 2ZRNA 4IWYA 4C01A 1Q19A 1GO2A 3E35A 4Z4FA 1GCAA 2JJQA 2HRBA 2QM0A 3CB4A 5BR1A 3AEUB 4IYRA 5IYZB 3HO8A 4OA5A 1SZCA 5FYQA 4G0WA 2GI4A 2C99A 3T9AA 4BP9A 1WQ3A 3LCMA 2ZT7A 2Q21A 3CZRA 5FPHA 5E38A 3TSAA 5GQSA 2HSZA 3OM9A 1U28C 5CFZA 5JTTA 4AC9A 4FT2A 2OV1A 4KDFA 3I58A 4JGGA 3KDPA 3QPUA 2Y0DA 3BFJA 4EQ6B 2NO0A 1S6YA 5E4JA 2ZCUA 2PMEA 1UZMA 2BUBA 3EDQA 3B2NA 1ONBA 3W5BA 5E6SA 4HFMA 2XUAA 4BVHA 1U1IA 3PUXA 1QUEA 4P4BA 4UTXA 4E4RA 3UKDA 2HJSA 2LE0A 5LQUA 2VYQA 3WB2A 5C1DA 2JCXA 2GUGA 5DBOA 1RQXA 4KO8A 3LBFA 2J09A 2PJ4A 3PX2A 3MGBA 2YV2A 1FB5A 1N2BA 1Q2UA 5ENVA 3VPFA 1ZR2A 3E5NA 4LY6A 2WJWA 1RM0A 5JYCA 1XWIA 1TRHA 3HLYA 4KVAA 4MICA 2Q5JA 3RVBA 1W36C 3CEHA 3RIEA 4EQZA 1OFGA 2ZEPA 5TEVA 5CDFA 5KYYB 3KFXA 5K0NA 5HRAA 1W5BA 4GNRA 3G7SA 4DDUA 1GHEA 3BMOB 3OQBA 1CS0B 2HXYA 4PV7A 3GFRA 5JD5A 3S44A 1GSHA 4DR2B 1CF4A 3NIWA 2AE2A 2PWPA 4UUAA 2GHQA 2XMGA 5JSFA 3CVVA 1TO2E 4I1RA 1W0KD 2XX3A 3P9IA 4OMCA 2XB2A 1GPUA 2EKPA 1IY9A 4HGYA 1VBNA 4IJWA 1T3TA 2IEDA 4HTFB 4MXDA 5I9TA 3VOBA 4TLAA 3V42A 2O3RA 4NBRA 4JT9A 3TAUA 3ND7A 2MTBA 1PFVA 2Q29A 1N5LA 5JJIA 4P5EA 4AWAA 2I54A 3E22A 5F78A 4BV3A 1VGRA 3P52A 4MKHA 2I6GA 2NACA 4MS4A 5C46F 1BX3A 4RTLA 2H4WA 1N8TA 2J0EA 3I37X 4PLZA 3VZCA 1V2HE 4JT2A 2GZRA 1EVJA 4EMEA 4JUAA 1K92A 3D7NA 1YMQA 3AX6A 4Z0PA 4ARZB 1AY0A 4DIBA 4JBGA 3PFKA 2FOXA 1KR2A 3EEQA 4F0YA 4G4GA 1LK5A 4JB8A 1K63A 1Y4UA 3MUFA 4C2BA 1UDRA 3IKVA 1XZJA 1P6XA 3IA2A 4P80A 3L7IA 2IV2X 2ZRCA 3GLKA 3WHKA 4PYIA 1F60A 4C0HA 1NXWA 3QK7A 2A9FA 1U8CB 5E0OA 4LQLA 4NY1A 1D1PA 3SZRA 2WJJA 2ZVPX 3TZBA 4ITVA 3RIGA 1WEKA 1XQVA 4WZZA 3MLBA 1OV6A 1IOZA 2RBKA 1XB2A 4P4IA 2O8BA 1T5OA 2F5IA 3N0XA 4Y18A 1GCOA 4WUTA 2B58A 4UBNA 4W1PA 3RSOA 1NAHA 1Q44A 2Z4SA 1UFKA 1Z0AA 3RS7A 4ZICA 4MUMA 1ADBA 2QY9A 1OAOC 2FSRA 1JLLA 3L0OA 3X2SA 4Z7NB 4DSUA 4S1VA 5F3RA 4AVCA 5FEMA 4E13A 1RAEA 2FVGA 1MIHA 4LJLA 3C6YA 2P1RA 2ZWMA 2PIAA 4OVKA 4TL6A 3FNEA 3ZV4A 4D3XA 5JE8A 3QF4B 4PN7A 1L6RA 1QS0A 2LWIA 1N7JA 4FR5A 4ROTA 4WXHA 3L7NA 1AQ6A 3S6KA 4RTOA 1N3LA 3EQ7A 1EB8A 2GZDA 4R87A 1STOA 3ANXA 4WK6A 3S2YA 5H83A 1UWKA 2PUJA 3FYHA 4XGKA 2O0LA 3QNVA 2G5TA 3HB1A 3N5CA 1IJKA 5J58A 1ZAKA 4K6GA 4UUOA 3PD1A 3GWGA 3A4YA 3G9QA 1TJ4A 2Q3JA 2OR4A 2CUTA 1D9XA 2GUWA 4ZU3A 4K9DA 3C26A 2VDUE 1UANA 1CM0A 4CW7A 3V33A 2SECE 2PZGA 5JAIA 4MMYB 3PV0A 3Q7RA 2YXPX 2WZNA 4B3BA 1RU3A 2WKRA 3QXHA 4ZY2A 4GQIA 4Q7LA 1AKUA 4BTVA 4LOHA 2KPOA 1E94E 2Z9DA 3VBEA 5DNEA 5EIBD 1Z0IA 1CRQA 3TZKA 2DFDA 3GLIE 2H48A 4IH9A 1Q2XA 1LWNA 5FCDA 1F2VA 4JC8A 3VR2A 5B1YA 4JBIA 4ND3A 3K8ZA 3R1IA 1SA0B 5J23A 2B99A 2IODA 3RRBA 4UU7A 3ZW9A 3K5PA 3UC5A 2Y1OA 3AFGA 2BJVA 4M3SA 3DT9A 1KAGA 4QOSA 5E6UB 2Q9UA 1NI5A 1VKNA 5E8JA 2I3AA 4CXMA 4YAOA 3DP7A 4LHEA 4KIFA 2UKDA 1HSOA 2B5OA 4GOOD 4QLOA 1FFAA 4HX9A 1T10A 2I99A 3N2GA 3UTDA 2JJYA 2Y2UA 3N2ZB 2HSWA 2J9RA 4ZJZA 3QM1A 3I39X 4FGJA 4R8LA 1CY4A 2PYDA 2FPUA 4PQEA 1FXSA 3PEIA 4MIEA 1LLUA 1UZAA 3AIOA 4F5WA 2HTFA 1KP3A 3KZXA 3QPVA 3TLXA 5AK4A 5TARA 1C2YA 3TTYA 3QELA 3T9BA 4EH1A 5T4HA 3O21A 1ARLA 4M9UA 5CM9C 4R7TA 5IULC 3F7OA 5JXWA 2F1IA 4YR9A 1LSJA 4G0NA 1VL5A 4KPUA 1KC3A 4KGXA 3ELDA 4BMSA 1PT6A 1QE0A 3ZX4A 4QX6A 1IDOA 5J4LA 5A3QA 1LLQA 1US8A 3KPUA 3WG9A 1DTEA 1YI1A 1Z5VA 3UC9A 3H2GA 3K09C 1Z63A 2QTBA 3DZIA 2JBAA 3I6IA 3OD5A 4GM4A 4NXMB 1QVZA 2CUNA 1XTRA 3HCPA 4AY4A 3OJCA 4A73A 3RC3A 4EPWA 1ONOA 2D1SA 3CVJA 1IVSA 1UDWA 3BGVA 4JBHA 2D62A 2PJAA 1E9RA 3QNUA 4TV9A 4LVUA 4KNYA 2C42A 1P73A 3IEPA 4A8PA 4FP9A 4TL7A 1JQBA 4F71A 4JI6B 2YCBA 2ACVA 5B6IA 1JHYA 3D7FA 1SUWA 1IHUA 1OX4A 3E0KA 3QKUA 4KV7A 5K8VA 3NEYA 1UT5A 4KXFB 1AUPA 4C0XA 2AZTA 2Z98A 4EHJA 2GPWA 1VG0B 3GARA 4DLBA 3BREA 1UODA 2ACKA 2ZT5A 3QE4A 1IMOA 3W6OA 2HA2A 4TRNA 3FTCA 5KQRA 4QBTA 1E32A 3A4MA 3KE9A 5M34A 1F5NA 4DBVO 5FUMA 1CP6A 3QU9A 3TLCA 4NNJA 4C1NA 4X65B 3OZFA 4NJMB 1YR7A 3OIGA 2TYSB 3MT8A 1XZKA 3QXGA 4MUAA 2JIZD 4JLNA 1FU7A 3AVWA 3BKWA 4PSVA 3ZD7A 1DC5A 2PDAA 2FOLA 2B0CA 1BA2A 4FGWA 4FCTA 2G9ZA 2XVAA 3FZEA 3GOHA 1MB4A 4KLZA 5DE3A 2O3TA 2P35A 2A5GA 5HGXA 2VRCA 2X7BA 3QBVA 4OMEA 3WY9A 3AG5A 5A4IS 4R9MA 1CJKC 2VP0A 3H18A 1KY2A 5EYPA 4F8JA 1Y9DA 4JUFA 2M6RA 1YOVB 4RM3A 3GAAA 5EJEA 2DLCX 2PKQO 5LQSA 2BI7A 1Q0UA 4PZ9A 1T8YA 4ICIA 4GZ3A 3VGPA 1G16A 1LH0A 5IUKC 4MUYA 4RVNA 3JD2A 4KN5A 4YRCA 1A7UA 1M2EA 1M76A 5GMOA 2ZYSA 3VMMA 4P4SB 1DWOA 4M76B 2ZB2A 4RK4A 1WM1A 3LBHA 2HK8A 2XCIA 1JLRA 2BWJA 5KU7A 1JFRA 4D9JA 1GL7A 2O19A 3UJAA 5F2NA 4BKQA 4J0CA 3KB6A 2WA2A 1WUTA 2HV9A 2ZITA 3LUKA 2VP6A 4ENQA 3ILHA 4F2WA 3BXGA 4B7AA 1O8BA 3TF5A 3T7EA 2GESA 4IKPA 2MYUA 2FS5A 4CZ2A 2ZVDA 2ZYAA 1YIDA 4RK6A 3WMFA 4HH0A 1NONA 3E3AA 4TTQA 4WFKA 4B84A 1DCTA 3GG2A 2O2HA 1N57A 1W34A 4UQOA 4HJRA 3O92A 1HZZA 2Y66A 4NCHA 4GBED 5GP1A 2TSYB 2X22A 4J1TA 3PHJA 2QRMA 2ZJ7A 4ZGBA 5I9SA 3W5AA 2NVWA 3EGOA 2A9KA 1F5SA 1ZO0A 3O0DA 3RC9A 4FIZA 4KFCA 4ND6A 2JBJA 4OXNA 4RQUA 2Q51A 3DTVA 1DLIA 2OLJA 1KMIY 2W2MA 1GVNB 2BMWA 3GGCA 4Y0VA 2IU0A 3CW9A 3PHCA 2BTQA 4P5DA 4O4HA 2E85A 3W9SA 2PT9A 4TXNA 3F6SA 4D3ZA 3IE2A 1VIDA 2QTMA 4NYIQ 4L16A 2GAJA 3TNFA 2O1XA 4W7SA 1K7SN 1H23A 5K3SA 3T8WA 1II0A 5JAOA 4OL0A 3DBHB 3UV7A 5JW6A 2PT6A 3AHIA 1BXZA 1EWYA 3GDFA 2EQAA 4R3UC 2RAUA 2W6IA 1HE3A 3NUZA 1QZZA 2LDXA 3R7BA 1RBZA 4AZSA 2REQA 4GVPA 5HUJA 2GF2A 5IRCD 2A14A 2YZNA 1NMXA 1HWYA 2Q28A 1I14A 3CXPA 4IZIA 2BMEA 2PPLA 5AW8A 2M6KA 1V4NA 3H0CA 3NH5A 1PFWA 2M9MA 2AOUA 3UHPA 3HUUA 2YVLA 2J0UB 5DYTA 1SRQA 2VDWA 2G1UA 5IC4A 3B6KA 3MWDB 1XDUA 1ZCBA 1IOLA 2UUOA 4QM6A 3GLHB 4DA7A 4O5OA 2W22A 2RHMA 3V8IA 3D7SA 1YTUA 3WKEA 2QORA 3HKEB 1PDWA 2QRPA 2REEA 2XVXA 4D4LA 1IQ0A 2I4OA 5JCOA 4EWLA 3AR8A 4KQIA 4CNQA 3H42B 4XNHC 2O9JA 1PFKA 5CK5A 3U3XA 3P2FA 4R2WA 4RFVA 1MW9X 2IS6A 4Z4CA 2BF7A 3KTAB 2Z3MA 1XN4A 2PGAA 4HDKA 1HBJA 2Q0YA 4PWYA 1JILA 1WMBA 3K0AB 3VDXA 4G8BA 4NBKA 1N2XA 4GEKA 1ZK2A 3NEJA 3TMAA 2O2YA 3LUFA 3DD1A 2ZI6A 1ZJ6A 3LVRE 4C7XA 3KM0A 4E33A 3T54A 4DBZA 3FSJX 4GZ6A 4Y0NA 3ERCA 2WPDD 1ZOSA 3S0JA 3A6KA 4WOBA 1WZUA 3SLGA 3DVQX 2AFWA 1HX7A 1RHMA 4HLQB 4FYVA 4XQGA 1RBMA 3R76A 3N53A 4MI6A 5JSZB 4RM2A 2GAFA 5DPMA 3C85A 1DAGA 4AKGA 4JGIA 3NC1C 2FFHA 2VDJA 1E1DA 3WGGA 4FW9A 4DZTA 2IUTA 5K0SA 4UBKA 2GSWA 4FM9A 1XRSB 1JSXA 3ASYA 4B71A 4GAEA 2CF5A 2HIAA 3EGCA 5FTKA 1AUOA 2BEWA 3Q5GA 3P4UA 4R81A 1E7WA 3FM9A 1TFUA 2EP7A 2R4TA 1SG0A 3IEUA 4EHDA 3MIZA 3AETA 3KLPX 3N9IA 5BSUA 4RCVA 3LUHA 5EQFA 4RHTA 3WNVA 1X1CA 4IXDA 2GTIA 2C2YA 5ECGC 2D3WA 3Q1KA 5C34B 4GX1A 2EVWX 3R24A 2VI5A 4HPSA 1CR0A 1G8YA 4LYHA 3GQBA 3UWSA 4B13A 3QW4B 3B53X 1UBKS 4B5LA 4O4HF 3WIDA 1VMAA 2G5GX 3H2IA 4NAUA 4N5IX 2D5BA 1ECCA 1G3UA 5ELLA 2C1EA 3GMTA 4RD3A 1VZ2A 2AKAB 2JS7A 2DPSA 2Z5LA 1MOQA 4PAGA 2IEYA 1B42A 2AW3A 3QLUA 4IS3A 3RVRA 2H7VA 3BGDA 5LP6A 1SXJB 4CM9D 1SBYA 3HEBA 6ADHA 3PNVA 5AO9A 3SY8A 2W2VA 2SNIE 5U4XA 3LT0A 4DL9A 3THWB 1RMYA 2NN3C 4X20A 4MJ3A 3HI6A 1MJAA 1U3TA 1OFIA 3B36A 3FLEA 4CLOA 4FI3F 2H5IA 4CM1A 4Q1CA 5IKPA 3FSRA 1KYQA 2H07A 2CLHB 3HNOA 3HM2A 4OH1A 3KKMA 2OZPA 4PZPA 4PRZA 3H5NA 3N7UA 3TW8A 1SVUA 3OVMA 2XCRB 1IFXA 3QWIA 1RWXA 1EFHA 4WE3A 1FY7A 4LE1A 1X8JA 1OILA 4N03A 1GUAA 2CMKA 1FYXA 2ZS8A 4S12A 3N3BC 1GQOA 2PFSA 2YCLA 1WXEA 3ZYCA 3SG0A 3IXMA 4P08A 3OESA 4K5QA 3HVJA 1NDUA 2Q3EA 5FHQA 3T61A 4G5FA 2P9HA 4GH5A 1WD5A 1U7PA 3GRPA 2C0QA 1Y80A 3TR0A 1W1UA 1J33A 4UCWA 4A94A 4MINA 4QXPA 1H93A 1OY1A 3RV3A 3ZQJA 2IDMA 3G2NA 3Q1LA 1Q14A 3N6VA 2PX5A 1MHPA 3DOIA 1XA0A 3PHLA 1N1DA 4O2BF 5FBQB 2OYCA 4OADA 2Z10A 3MTQA 4L8LA 4LBYA 3BORA 2OBNA 3U4IA 3AB7A 3BH0A 3DMGA 2DB3A 3DW3X 1BE8A 5ALZA 3TMKA 1NW9B 2FG6C 1TTPB 3MPUA 2WKPA 1D07A 2HCRA 4QGHA 4EKNB 1L4LA 1ORHA 4Z4EA 4KQ1A 3CGWA 3J81k 2PWZA 2YC4C 1EDZA 3HKBB 5EUBA 1K1EA 1CFJA 1D03A 3CLRD 3NDIA 1L4KA 1SCUA 1YQUA 1EFCA 3OE7D 1M33A 1KO4A 3M7IA 1XMBA 3ELUA 1IEQA 2OHOA 4AO6A 3X1XA 3F47A 4JHXA 1YS4A 2I6UA 4BBJA 3RVNA 4UCMA 5DHSA 4NV0A 4J4HA 3DAOA 2DHEA 2V6GA 1P1IA 5TV2A 4RPHA 3H4MA 2B0JA 2V74B 4EECA 5DTQA 3WL6A 3T0FA 2XZOA 1CBUA 4FDLA 3W8DA 1UC9A 3THXA 3UK2A 3F3SA 5LD2B 1K5HA 2VJNA 1H5QA 3R74A 2YJGA 2O0HA 3MOIA 4PHFA 5JCJA 3PUJA 2FFBA 3VARA 4GOJA 1MRNA 2NTVA 4IUYA 4G5GA 4JLKA 4D44A 3UKOA 3RNLA 4U7PB 2EBHX 4JFRA 3GEDA 3EVGA 2VNIA 4A16A 3VYSB 2R66A 3NHYA 1YJXA 3RV4A 5JDIA 2BFCA 2XY4A 3KQQA 3HHEA 4CEIA 3FBWA 4CMCA 4TM7A 2WU4A 2XTNA 1VLVA 5HG0A 4C2TA 2W4QA 1QG4A 1EM8A 1S2GA 2HF9A 2P5UA 3ND8A 4KCGA 4QC2A 4ZGWA 4CRWB 2GLTA 13PKA 5LP6F 4H4EA 3ZWKA 4D43A 1G38A 2ZR7A 3HJBA 1XWFA 2DRIA 4O29A 2XRFA 1WU8A 4RSHA 4MQFB 3RBVA 5CFRA 4XJTA 4J0EA 1LC0A 3R3VA 4RFSA 2BHRA 2EIHA 2P1ZA 3GA5A 3MOSA 3ROFA 2R1IA 1QSMA 2DHRA 3DEKA 3TM4A 2RBGA 3KYIB 3MWLA 3L7YA 4QHSA 1UCFA 1QF6A 3FNIA 2ABWA 3T3OA 5DH9A 1NMTA 2OCAA 1RHRA 1XAHA 3T7JA 4D41A 1IIRA 5E96A 1H4TA 1L7RA 5DHAA 2N42A 3N59A 1FLVA 5E7IA 1KO8A 2B8WA 1I10A 3K9WA 4CI9A 3MHTA 5LXTA 1UIMA 3ZNOA 3RIMA 3FDZA 221PA 1SZPA 2FUCA 4CV1A 4X8LA 1JKJB 5BR4A 4YAJA 2ICAA 3MJTA 1AOXA 2OCYC 3E2PA 3RNZA 3T5BA 1CRLA 4QO8A 3UPTA 2PS0A 3WMGA 3ABOB 4OEHA 1V9SA 2C9CA 1MMFB 2KW5A 1DV1A 5HMMA 4A0HA 1YR9A 4A0GA 2QZJA 1BOBA 4B09A 1B43A 2CXSA 4Y7CA 5HGJA 4R9UC 4BBAA 1LF0A 1LJ8A 1SIOA 1EK1A 4Z0NA 1FYWA 4OQXA 2ZUBA 4QA9A 3RSGA 1UBMS 3K70B 5JYEA 3SHVA 1DEAA 5T3YA 4PQGA 4RK0A 4L5BA 1N0WA 3BXPA 3DL0A 1CD5A 1KA9H 4CKBA 2X6TA 2EHJA 4CV2A 3GUZA 4RZXA 4J4TA 3ZD8A 1G8SA 1DINA 2Q4VA 5LMZA 3L1JA 2VFAA 3JX9A 2QPLA 1ZI6A 1SUPA 1KFEB 1WNFA 4ZDJA 1YA6A 1HFEL 3DXFA 1RJFA 2R6AA 1ZONA 5ALSA 4NOJA 1F2OA 1VHJA 4K46A 2PXCA 3RS9A 3U61B 4C1BA 2FSVA 3G82C 3O2JA 2W4MA 3TTWA 3WGTA 1I13A 2MR5A 5BOSA 2HFJA 3PKJA 4RKQA 5EIBC 1GTZA 3E3OA 3CUYA 4F5DA 4CV0A 4REMA 3OOSA 3MBIA 4PIVA 1SD5A 2GRJA 3BMNB 3O9VA 1L4YA 1I5RA 3FFXA 2UZIR 5AK5A 3HN6A 1KDZA 2PJBA 3G3SA 2DQ4A 4JBLA 4BGDA 5AVVA 1ILEA 4EUEA 2DQZA 2AQ8A 2FAXA 2A9OA 4ONEA 2BM0A 4FCCA 2GD2A 3CZQA 4DG5A 5IUNC 4QGGA 2HPVA 5JC1A 2J30A 2JARA 2VJMA 2A94A 1DIHA 3RYIB 3RC7A 3KZVA 2B4TO 2I2FA 2QN6A 4PTYA 2BDUA 2GH1A 4QQ8A 4ON9A 2WPWA 2UU9B 4HYEA 3Q5EA 3TKYA 3UAYA 2CXNA 3NO4A 1JQAA 3M4YA 5C3UA 5L7WA 2QTVA 3H1AA 4Q4AB 3CR8A 4E4YA 3CW2A 4XEHA 2QQFA 1V5IA 2O0JA 1LJUA 3QVLA 3RSFA 2FEOA 3NHBA 4LNUA 2ID9A 5KWVA 2ZTVA 1BWQA 3VU8A 4UZSA 1SVOA 4KHZA 2Q1YA 1G8KA 5HM6A 4U7WA 1Y37A 4XCQA 1U2DA 1BE0A 2OMEA 1XZHA 3GJRA 1TUGA 1QO0A 2VZLA 1OI3A 4HWKA 2FLWA 5LXTF 2QW0X 1U1FA 2QGZA 3OICA 5EGSA 3R7DA 5DV9A 1YZ3A 1IM8A 1WXGA 1QRUA 4YMHA 3WOVA 1L8QA 4FB4A 5FNZA 2PRIA 2AI3A 5H86A 1XKTA 1Q2DA 1EDDA 1VPVA 3PB8X 1IJEA 1EYZA 2VIIA 4MV1A 3C3KA 3VNAA 2JGNA 2VWGA 5MN5A 4DTIA 2DSNA 3K8YA 3O8NA 5KMGB 4HAVA 1PWYE 3HGQA 4XR4A 4RTMA 3Q7IA 4MVJH 3UAWA 3DHYA 4RHFA 1U8TA 4NARA 1Q7RA 1C80A 4Q9NA 5ITSA 2A86A 2VT2A 3KQSA 3FHLA 4MFQA 1CZRA 4Y67A 1NBOA 1OIWA 2B3VA 2QTAA 1EVYA 3RI3A 3K16A 3WLSA 3IOBA 2QDXA 4GBMA 2QXUA 5IW8A 4QDXA 5AD1A 4XQEA 5KYXA 3PQ4A 2FWRA 1W5FA 5IVKA 2DSTA 5DWNA 3F6EX 3ID6C 1QTNA 3IIJA