2GFQA

Structure of protein of unknown function ph0006 from pyrococcus horikoshii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
288
structure length
288
Chain Sequence
HSSGRENLYFQGHMKVIMTTKVDKASMNIMNKLIENFGFKETEYVFEGNPVYKRGDVLILTTNDEMIYYDYLDREIENQLGFKPEIIAFASRHSSKQKLPALTTHVTGNWGKAMYGGKDESFAVAIPSAMKLSLLKMSELNDLGWTVCYEATHHGPTELEVPSFFIEIGSSEEEWINDRAGEIIAETIIYVLDNYEKGRSKFKVALGIGGGHYAPKQTKRALEGDLAFGHILPKYAQPVSRDVMIKALNRFGEKVEAIYVDWKGSRGETRQLAKSLAQELGLEFIKDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0204 protein PH0006
publication title Structure of hypothetical protein ph0006 from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 107
structure length 288
sequence length 288
chains with identical sequence B, C
ec nomenclature ec 3.1.1.96: D-aminoacyl-tRNA deacylase.
pdb deposition date 2006-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04414 tRNA_deacylase D-aminoacyl-tRNA deacylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold AF0625-like 2gfqA02
3.40.630.50 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase AF0625-like 2gfqA01
1YQEA 2GFQA
chains in the Genus database with same CATH superfamily
5C8VA 4P4NA 4RIIA 1U5BB 2XWJI 2C4NA 2C96A 4EUKA 4Q01A 2O2YA 2OVBA 2Q2WA 5DULA 2ISQA 3P19A 5L9AA 4HHEA 1MC8A 3CFYA 1PV4A 3RKSA 3LT2A 1W48A 3DOOA 3KQWA 3ZJTA 5TE9A 1LF0A 3IVRA 3PP8A 1IRXA 2AJBA 3E6AA 3O3OB 3HCNA 5FO0A 2X9NA 3FIJA 5KI6A 3HKCA 1UBHS 5FTNA 3LYUA 5L4SA 1BTOA 4IDOA 1DDIA 4BNLA 2ZUEA 2PWPA 5JPDA 3VVBA 1LOKA 3OJCA 4EHLA 1TD9A 4J9VA 3MBIA 1C1HA 3PFEA 4HP8A 1VA5A 4B9AA 4JLMA 3HV2A 1KIAA 3K94A 2OV2A 1R0WA 4PX9A 5K3FB 2CF5A 1TIBA 4P83A 1CD5A 1XBUA 3F6SA 3SHWA 4E5MA 2H1HA 5F1PA 4QXAA 2M6RA 4HB2A 2ZENA 1J4AA 4XJVA 1N5MA 4NOKA 2IZ7A 3FJYA 4M89A 3KQLA 3EA5A 2ZKIA 4MYRA 4ASUD 4YCLA 3B89A 3TM4A 3Q7QA 4CF6A 2AEMA 3HS3A 2C2MA 4ZX9A 1BVRA 1S2IA 5T4FA 2PZAA 3U4MA 1VJTA 5TGDA 1NSAA 2XF2A 5DGHA 5A0TA 1U2EA 821PA 3FHLA 1GQQA 2QMHA 1ENOA 4I5IA 3UYKA 5TF4A 2QYVA 1L4YA 2A0XA 4EG5A 3TZEA 2NOAA 2ZJFA 2GANA 1QHHA 1SUFA 4EG4A 3ZVKA 1B6GA 3ENZA 3ODGA 3LHSA 1IQUA 4FS8A 4RFSB 4AJ2A 5IULC 2V8GA 2IK8A 1L4LA 3FHCB 3ZZIA 3D02A 3R7BA 1RABA 3LWNA 3DFIA 1PFKA 3CN7A 3FHJA 4ZCLA 2Z2XA 4HWRA 4YAGA 1DEAA 3GIDA 2AJTA 3OCUA 2PIAA 4B85A 1MRNA 2C4TA 4BFVA 4N6NA 3ANXA 4NATA 3KR4A 2BEVB 2GN6A 3OMWA 5CXUA 5AVXA 1U0RA 4XUDA 3FSRA 5H68A 3G68A 4EYGA 2C2XA 4CRYB 4QDJA 1DAOA 3MPUA 2QXTA 4OAEA 4X6YA 3FCCA 3WGNA 4FYXA 2EBWA 1EFRD 5HIAA 1SBQA 3RH0A 3KB2A 3PDWA 5DMHA 4O8CA 3PSHA 1U4NA 3PCTA 3DAPA 4RFSA 1U02A 3C5HA 1VIAA 1J42A 2XUZA 2P77A 4KW7A 2XECA 3DE6X 1KZ6A 1A4XA 2D5LA 5IVIA 2E5WA 2NXEA 1SRQA 2RGNA 4GRAA 1LQTA 5BY2A 1QRSA 5BW5A 2WJPA 3MJ4A 4ZD6A 4OXYA 1EE2A 2YJGA 3K0FA 5KNDH 3MPOA 5SY9A 1YRAA 2QL9A 5LXTB 5IPFA 4R2HA 4YAKA 1RD4A 2OZPA 3PXXA 2J0VA 2GRUA 4A7PA 3B6EA 5J47A 2H5JA 2P0EA 3B7WA 3FDZB 1T36A 2GHTA 4QBIA 1A7UA 2J3KA 3IVMA 3L6UA 2OXEA 2O06A 4NYIR 3DHEA 4G3XA 1MJGM 5H16A 1DLIA 4M60A 2I6SA 1VSBA 2ACKA 1FP6A 5ULLA 4XWKA 3V9PA 1QFMA 1NN0A 5F3WB 3A7DA 1A9SA 2BFFB 4DLAA 4YAIA 2QT9A 3EXG2 5T6BA 2PUDA 4Y18A 3R9FA 1LAMA 4B4OA 2JFBA 4NCNA 1EK1A 2QVCA 1MENA 4PZ9A 4DKJA 1P5RA 2HXSA 1EZ4A 2H4HA 1EVYA 3IODA 2RD2A 4BFLA 4BE4A 1LFWA 2E4XA 4YMWA 3GLHA 1V8PA 4TX1A 4CAWA 1BKYA 3TNDA 1D04A 4MVJF 2QLBA 4ROSA 1C7IA 4G2TA 3HXTA 2J6IA 2O8FB 4N48A 2CJPA 2XDWA 1RXEA 2X8JB 3DR6A 3MZ0A 2P3QA 4B8ZA 2HRZA 3IU2A 3AL3A 3QFHA 2GF2A 3SGLA 5ALLA 2OKGA 4B34A 5AOVA 4DYOA 1KYTA 4TMKA 5JHHB 2NU6B 1M66A 4UEQA 1ZM9A 5FBKA 1IE3A 2VHEA 5JCXA 1Z2CA 5T3UA 1XTRA 4W6ZA 4QOEA 3MMPA 3A4LA 4IJ5A 4BX8A 1H2BA 4O4JA 1HT2E 4JP3A 3THXB 3CSDA 4MP3A 2JFPA 2FMHA 5HKAA 1GFZA 1BAPA 1XAHA 5E6SA 1S1MA 4PIVA 1W4CA 1X9HA 3L41A 2K5UA 4C14A 1HDUA 2YUTA 2R6AA 1B15A 2PJ1A 2HA5A 3ZHCA 5KYXA 2O8FA 2VPZA 4K26A 3MINA 4DMRA 2IQ5A 3UHPA 1CF2O 1PVDA 1NVAA 2WFAA 1EESA 1Z12A 1XCPA 4UCFA 4E13A 3DQPA 2AJ8A 3IE2A 3DONA 4NS1A 4BNYA 1PRYA 4WOPA 3NTRA 2NU6A 3GI1A 4B12A 2A0YA 1WY5A 5F35A 4RV5A 3VR3A 1MAAA 3EXHC 1H6DA 4OHFA 4QPPA 3O8RA 1JDUA 3VNRA 4EB3A 1BLLE 3I8XA 3EIQA 3THXA 1VPWA 3EARA 1J4JA 3PUXA 3WICA 5DHUA 3HCFA 2WWTA 3T35A 4J7UA 4TT3D 2NT3A 2H4FA 2FFAA 4R5MA 5HVHA 4X6XA 1DRJA 2CFCA 4F86A 5C9ZA 1EA7A 2B3TA 3O74A 4BXOB 4CUJA 4KBYA 2BI4A 1CRWG 4XVHA 1H6AA 1WQ3A 4YJ2B 1P80A 5EXSA 1ESNA 2WD8A 2XR1A 1GZ5A 3X1XA 3ZNOA 3BZWA 1SBTA 1KPGA 5ALHA 2Q8PA 3UY4A 5JCPA 2OH1A 5CNMA 3ZC3A 2PM8A 2C5SA 1XDWA 4LF5B 4ZGGA 1N4AA 4EPRA 3MWFA 1HORA 2OCBA 2ZI6A 5GOTA 1GSHA 1M1NA 3ITDA 2A9OA 3GZ4A 4LTDA 2VF2A 4HDCA 1C3OB 1P81A 5HH1A 2Y2VA 2Z95A 2AOXA 5EXDA 3ZIUA 2I2FA 1U0JA 1UBUS 1MHPA 3D8UA 2PA0A 1K89A 1JIKA 2IEGA 1TEHA 1KEEB 3FFTA 3QPUA 1P39A 4HSGA 4MWDA 1RHUA 2KPOA 1Q95A 1XVIA 4TSKA 1PKEA 2QP4A 2VHXA 3E2MA 4NCJA 4IDPA 3M33A 7AT1A 4WFIA 3P9YA 4YJ2A 2CK3D 3CLTD 1E4YA 2BHNA 4B10A 2IXTA 1LPNA 2B5WA 4Y7CA 2D1FA 3TLXA 1MAHA 5ARDA 4L0MA 3KHUA 5FWNA 1Q83A 2XMCA 3ZCXA 4XPIB 1AUOA 3E2IA 3IGRA 2WYHA 4J0GA 3MTIA 1IEWA 1GZ7A 4QFMA 5E8JA 4PQFA 4LQLA 1AO3A 1XMOB 1W46A 3N3AC 2X7HA 1UK7A 1NUAA 2J32A 3OPYI 4JSTA 4MX8A 5C37A 2ANCA 4M99A 5AVJA 2HSWA 3ZDEA 2DYKA 1Q17A 2YJ6A 5AXBA 5TPWB 5JEDA 3IFSA 3WGZA 3SG0A 2NQ2C 3TSAA 3L4JA 1IY1A 4KQGA 3HJRA 2VYNA 4E11A 3L82B 2CBXA 1X7YB 2Q7BA 5IUKC 3SE7A 4JJXA 3IB6A 1TUBB 5FHRA 1QYDA 3A9VA 3LBIA 4GBJA 2BTEA 3OQHA 3VUEA 1F4LA 3IU1A 2QVGA 4COOA 4ZPXA 3IKTA 3ZD6A 1F06A 2XGSA 4I3HA 4QO7A 5K3AA 3T7CA 4OHOA 1SQGA 1SC3A 4AMVA 1OU0A 2QTLA 2HLHA 3OZCA 1N1GA 1KP3A 3IXQA 1EIZA 3CR8A 2PXCA 5G22A 3AUSA 1ZUIA 4F5ZA 4F46A 1QB8A 1JPNA 2B1JA 3HYCA 4YR9A 2J3HA 4KXFB 2QN6A 3CLHA 3T5TA 2EZ8A 2H5LA 5BRNA 3OSUA 1TVKB 3CVJA 5TPWA 4Y3UA 5ITSA 3R8FA 1PV2A 3LC1O 4IFIA 3W3ZB 2A3NA 2OZUA 1U3DA 2VTBB 3ZVNA 2ZUUA 1R9JA 2KQUA 2NQ8A 2IYUA 2VTEA 3HACA 2CBZA 3CIOA 2GF9A 1WSBA 3S1AB 2F8HA 3V8NA 2C3YA 4QARA 2J5KA 3OA2A 4TVBA 4RTOA 4J8PA 4HVLA 3PFOA 4W5HA 4QLBA 3FPAA 1UMKA 1KYWA 1OGJA 3P0FA 3WA6A 1NYQA 4ACAA 5IJ9B 1MB9A 1NXTA 3UGJA 4ETMA 3WMFA 5AW9A 1JZTA 4YBZA 2V58A 4L3WA 3TZHA 1XRMA 5AVVA 4BMDA 2JFZA 1VBNA 5MN5A 5EKSA 3ABIA 2C0PA 4LZLA 3PJRA 5HG0A 3ZWOA 2G72A 2ZAMA 2IQIA 4JC5A 1UK9A 2VSFA 1M1DA 1OLUB 5LOVB 1G3RA 4MI1A 3OUTA 1LFDB 4AJIA 3ICWA 1VIYA 3OUUA 1M2JA 3G2JA 4P44A 2WE7A 1UKAA 4S2UA 4R9SA 4AJEA 2AF3C 3ELYA 4KPGA 4RA9A 1VXOA 2Y99A 2ZOSA 2GVZC 1T1RA 1TC1A 5JFTA 2GETA 3OX3A 2P4SA 2RIRA 4IVQA 2C84A 2FPUA 4KGVA 5IJ9A 3VZDA 1O0BA 4NWIA 5EKXA 3STHA 1NOIA 2VKTA 3LHKA 1LZKA 4V0LA 4ICIA 5G0UA 4IVNA 3VR4H 2IUYA 2QSUA 2VLIA 4WOBA 3UWSA 4Y6GB 2O3SA 2XYVA 2E4UA 5JARA 4EY6A 1ESCA 5ECYA 1CIVA 2JEYA 1RZVA 1FFDA 4XPLA 2MYPA 1XD9A 2YBEA 2ADOA 2JBJA 4RVSA 1X19A 2G67A 2PDOA 1MAWA 5J4VA 1KHHA 3UQZA 4ZYQA 1BYUA 2IA5A 4JU8A 4M76B 4TS1A 1NBME 1HZJA 2R751 5EGSA 4XIFA 3DC7A 1EVKA 3REFA 6NULA 4A0QA 4CU2A 4YWHA 4DMHA 1SCBA 5KKCA 1BN6A 4LJ6A 4MGHA 4KHZA 4TYWA 4RK5A 2UVDA 2H52A 1QGUB 1YH3A 3NWPA 2F17A 1M0TA 3PUKA 3WIUA 3O94A 2WE8A 3NYRA 1CUXA 2XWQA 4HLNA 1S3IA 5LMNB 1VLVA 3HC7A 2OCGA 1LV8A 3KD3A 1EFDN 3I83A 3DL7A 2HT1A 3RYOA 1FSPA 3ZUGA 3WHPA 1DUVG 1NMZA 5A62A 4MGYR 4J3NA 2GM3A 4TV8F 4QLAA 4P0QB 2W98A 1PGPA 1ZVQA 4RPCA 1CCWA 1W88A 4N5DA 5B2ZA 3C16C 5ELXA 4D97A 1WY7A 1K9VF 2EFYA 4RULA 1SOAA 4P4TA 2I7XA 3N87A 9ATCA 1Z8LA 4H6PA 2IOQA 3LP5A 3UJBA 4YP0A 1GP2A 1XZLA 4D6PA 4LK3A 1VGYA 2YWDA 3EQ7A 4GLJA 1M34E 2JFFA 3I5YA 1QP0A 5T4EA 1IICA 4EARA 2PLFA 5FQOA 2O4HA 5EYPB 1BE8A 1Y3IA 2PRSA 1AGPA 1FFEA 2VN8A 3PV0A 3OAAA 2BH9A 2PGLA 4JP1A 2RKBA 4ZZ1A 3OU7A 2ERXA 2JI8A 4FHEA 5LYJB 4CMKA 4K6KA 2WM8A 4YPFA 3SPXA 2IHJA 3UV6A 2HOQA 4DQUA 5LUAA 2J67A 5BN1A 2Q3LA 3DZKA 2BKUA 4OG2A 1NBIA 1ULZA 2WWYA 2EKZA 3G2PA 1ZG8A 3DOIA 3GP8A 2RK6A 1IC6A 4ENSA 3P4YA 4R0NA 3K3PA 3VR2D 5DWDA 4TV9F 5JZBA 3OP4A 4PV7A 3ASVA 2H9AA 2WVAA 1JTFA 3T5DA 1Z88A 3NHYA 3CF4G 4H0CA 4FTWA 4DC9A 2H2AA 5KKAA 1M8PA 2OMKA 2VYVA 4KTTE 3KETA 1RNLA 1ZM3A 2DQZA 5THKA 2ZYDA 4JLPA 4MR9A 5I7WA 1SQ0A 4R8KA 2WF9A 1E1RA 4TRJA 4AZSA 1I80A 4DLVA 1XIXA 1C1XB 4F2DA 3RAMA 3EE6A 4MQFA 3PC8A 4REQB 3UF0A 4W8GA 3I3OA 2DB3A 1MB3A 4WUVA 3BZBA 1MQ9A 1ODSA 2AZMA 2NSLA 5HJ2A 5DJ5A 2RCNA 1F9AA 3S1LA 4RUHA 2QD2A 2V8BA 3K09A 5I4CA 3W1EA 3D4PA 2RIPA 5LKRA 1GU1A 1R1DA 3EIWA 3QE4A 4X5OA 2A14A 1QTNA 1YV9A 4OF4A 2QT1A 2PJ2A 4HVAA 4N8EA 4Q34A 4V0KA 5REQB 5TIIA 4AYTA 1DINA 4Z8YA 4ZXFA 1SUPA 4H4EA 4ARZB 221PA 2GDJA 1XWIA 3ORYA 5L51A 3ETDA 4F8EA 1ICIA 4NF2A 1Y9ZA 4UD6A 2FMUA 3HKDA 5IANA 3GY0A 2HA6A 4CCWA 4CLRB 1R5BA 4E4TA 2VPWA 2HMVA 2W6JA 1Z3IX 3NHJA 2VJYA 4REQA 3HBNA 2I91A 4DR5B 2X86A 3PVCA 2PZGA 4UM9D 4Q03A 1S60A 1G55A 5L7YA 3FSEA 4RHCA 4MI4A 3RVRA 4ITUA 4ENQA 4LECA 2WQ6A 1UJ2A 3DBHB 3JX9A 4PVDA 2PLAA 5AUNB 4NYMR 2ZQYA 3D43A 5I4KA 4KSFA 1QTRA 3D4BA 3FFBA 4LJKA 4EG8A 1MV5A 3AINA 2J59A 4NECA 3QFTA 5EIBC 4MRMB 1T9HA 4ARZA 3QW2A 4EMEA 1N33B 1RJ9B 2ETXA 1GUDA 3TG8A 2JFOA 2OO3A 4JR0A 4X91A 5CB4F 3ZW9A 3IAS6 4WINA 3MJHA 2BKLA 4ZQGA 4RSHA 4PQEA 4QFBA 2MJLA 3JQGB 1M5UA 3LQ4A 4Q5IA 1ZSVA 4OYLA 3W5DA 2OOTA 1TO1E 2CCKA 1R0YA 4HPSA 1ON0A 3HY3A 2Z8XA 5F77A 1ISPA 4ZJPA 5FT9A 2ZUBA 1UQTA 4EATA 4OK5A 3RSFA 4BRWA 1PWXA 3F1KA 1A5ZA 3DKVA 3JALA 3S7TA 4BWYA 4TS9A 3EGEA 1ST3A 1N5LA 2WV9A 4UCWA 4IZ6A 1HLGA 1O95C 2FL4A 3N0RA 1AQNA 4EW3A 3D8NA 3AX6A 3CUSA 1WSWA 4B71A 4G9EA 2YYSA 3LQFA 4HH4A 1D2CA 4QGFA 1I2BA 1RM3A 3V7NA 1PJLA 2FW9A 1QGZA 2WPXA 1M6HA 4EYQA 4YQEA 1CUWA 3E8MA 4WZ6A 3CPJB 3H5LA 4ZHQA 4EMUA 4OHCA 2BRUC 4M9ZA 1QP7A 1JLMA 3TBHA 3WGJA 4YNBA 2GAFA 4DIOA 5JT1A 4OJMX 1CX9B 1JIJA 4IDDA 3VQTA 2FZCA 3VSBA 4IIBA 4U0JA 3KR0A 4RD2A 1GZDA 1N5JA 2PKQO 1V5EA 1XSEA 4HZUB 3URKA 3LPCA 3AI1A 4DV5B 3IPYA 5DRTA 1GNRA 1XZBA 5CFQA 2C42A 2C3MA 3O4RA 4E30A 2D0OB 1E6EA 3LT5A 2O9JA 3PXDA 1PW5A 2AN3A 4UEWA 1CUEA 1N9ZA 2OCIA 1FRVA 3VZQA 5D1HA 5JNUA 2EBHX 4KQ6A 3AB8A 3A4IA 4LI0A 2RGEA 2ZSHA 4G8CA 2Z6QA 2A9FA 3E18A 2LTAA 2DBZA 4TWRA 2GTIA 1XMVA 3PX2A 4DUKA 1TXRA 3WWEA 4QYWA 5L40A 1UCFA 3DTTA 2XT0A 4Q4LA 3K7EA 4YREA 4L4XA 4MW9A 1HTTA 4KFTA 2ZYWX 1XHLA 4RSRA 5AVTA 2VWQA 3KZCA 1O8BA 1I1OA 4ZO6A 2B35A 5J8CA 3DNFA 1A4IA 3PPIA 1I2ZA 1EQAA 4FINA 2GF0A 1EB9A 2QTMA 2ZRLA 5K5EA 1XRYA 3ER9A 4RLQA 1IOFA 1UKEA 3VI4B 2ZI5A 2HUZA 2WFLA 5BMOA 1EXVA 1SUAA 1CIJA 4OC1A 1A82A 1X1RA 4N3NA 4FIZA 2YIJA 3ZVRA 2YJ4A 4R3WA 4BRSA 1ZISA 3KNZA 3L7IA 1WCYA 1VFNA 1OI3A 1N9GA 5BV1A 5F2NA 1P2GA 1FXWA 1GZUA 4PS0A 5LZ8A 2KB0A 3PEWA 1N4DA 1ZONA 1QLJA 2VP6A 1ZHOA 3SWWA 2YZMA 4ZO4A 3CHYA 1HX7A 3ZX4A 4RIGA 5THXA 1UPCA 4I4NA 1E1QA 3RYTC 3AKEA 3IT0A 3CG0A 2PUFA 3TOAA 2GLJA 5IK2A 1D0VA 4RF3A 3LNCA 1IPEA 4K6OA 1XCBA 2ZT6A 1DQPA 3IVCA 2YDXA 2CE2X 5LPNA 2MOKA 2IUEA 3U3OA 3EGDB 1R6UA 2VTDA 3ETCA 2H7CA 3BDAA 3RRYA 4KAXA 4EW1A 1K6JA 2Q7OE 1XYYA 5E3HA 4NXYA 4UDNA 3R6GA 3L7DA 2BEIA 2O53A 4H7EA 3PJFA 3WABA 5DLQC 1SCNE 1PLKA 5HJ5A 3SNKA 1I3MA 1PJZA 3I6QA 3OTGA 1ZN2A 2JH9A 1WBJB 3DEYX 1VKRA 3AQIA 1C30A 3MMXA 1N2IA 1D5WA 2BSXA 1CJBA 1W36C 5AHOA 5KSPA 1P6UA 2V8VA 1FYEA 3CC8A 1SD5A 1U28C 3P2EA 2NV2B 2ONKA 1UPXA 2KBEA 4HQ6A 4TKMA 2P2DA 4O5AA 1ODKA 5T64A 3EGDA 1N1MA 3AOEC 5THWA 2WT8A 2F8SA 4PXBA 3V7YA 4PSVA 4PC7A 1T6XA 4FFPA 5ER9A 3HYLA 3B53X 4QREA 1OH6A 7YASA 1GM5A 4A9AA 2HLDD 1L4EA 3PRYA 3FYUC 3ZGXA 3CRRA 4HJRA 3E1GA 3G85A 1O94D 4AJOA 3K31A 4WZAB 4UEFA 4MHNA 1ONBA 4PG5A 1RM4A 2FEWB 3NAZA 1NUSA 2GN1A 5ESRA 3EXHA 5DNWA 4TWZA 2V1UA 2ATEA 3EDQA 4OMCA 5EP2A 3ORQA 5HQJA 2CVFA 3CEPB 1V96A 2VBFA 2PGNA 1XD8A 3RFTA 2W4IA 4LRUA 2YW2A 1YQGA 3WTBA 1F1JA 1XNGA 3CXUA 1F17A 4R1MA 1GZHB 1BS9A 4YUVA 2LNDA 3U1BA 2REQA 5MFZA 1ZCJA 4LYHA 3VO8A 1YVUA 2VYCA 3GD5A 1WIWA 2BGNA 4G4SO 4Q4HA 3MYRA 3B3CA 4WZAA 3IELA 4W9NA 3ROTA 1GVHA 4GLFA 1YKFA 3QVTA 4JQZA 5HIJA 3BMOB 2HSGA 3N2EA 3P97A 2W2XA 4FT4A 1SB9A 2VOEA 2YR0A 1E0JA 1A8PA 3T7RA 2VNHA 1GPJA 3IFEA 3GAMA 3BB4A 3NIWA 4EGFA 4X60A 5H83A 1S8NA 3FPCA 4R8MA 4HKTA 5ARBA 2R3SA 1ZLIA 1VHOA 1RXCA 5IX8A 3Q11A 3OZXA 5I4MA 5JU6A 2ACVA 2FDRA 4IVRA 2XB6A 5IFKA 4FWIB 2MSKA 5JZMA 4WHMA 1W94A 4R57A 4Y8VA 5E4TA 3WA7A 3EIXA 2QD5A 1E1CB 1A8IA 2XUHA 1M73E 2P1DA 4EY3A 1M6VA 2XGGA 5KNLA 4NMMA 2A4KA 3HUVA 4DR6B 2V5AA 2C9ZA 1X8KA 4EY8A 4YRCA 4OGWA 3AEYA 4DEVA 4OM7A 1AB5A 4HY3A 3FEDA 4M8NE 4LWPA 3H0KA 2EYUA 1U9CA 1Z2EA 2O7NA 3IMCA 3E8XA 5CR9A 3B6ZA 3BE6A 2P6GA 5G53C 1EK5A 3CINA 1QLWA 2PUBA 2EO8A 3CEJA 4ZQBA 4CQMD 2FRDC 3NJ4A 2VAMA 4WDRA 2JJ2D 4HH3C 2JFVA 4G1EB 1AUVA 4EEZA 2JJYA 1HA3A 4U0KA 1O87A 4RTLA 4ARCA 2R4QA 1SOUA 4QUIA 1ABBA 1E7YA 1P7WA 2R68A 3E70C 1DUSA 4RPIA 3BS4A 3BYZA 5AJYA 5EE5B 4EPXA 2BP7A 2EP8A 4JXKA 4D8YA 1L3IA 4E1VA 5FTWA 5CW2A 1AYEA 1I8TA 3KLOA 2HDNB 5TMEA 2I87A 2WJWA 1UBJS 2QM7A 1GGJA 2QKYA 1YB5A 3KTAB 5DWNA 2IEZA 3EGWA 4IR7A 5LNK6 2W6CX 2B58A 1PR5A 1BROA 4WGFA 1XJWA 1O7JA 2QSJA 2QRUA 4D96A 1KMIY 1NXWA 1QHIA 2AXQA 2I76A 1X8XA 4WA7A 1CZKA 1JBEA 4UXIA 2O2EA 5JOQA 3RAGA 2NP6A 1LVGA 3TOSA 6YASA 3W7VA 3ND5A 4Y1GA 4R1NA 4KE9A 2AQIA 1BW9A 3SN6A 1NXXA 4R0VA 3Q3HA 4QPNA 1B74A 3GH1A 2HZBA 4ECEA 4ZI3A 3VU1A 1UBKS 4ZKEA 4XFKA 3F5DA 1DRKA 1GKUB 3VO1A 4OJQA 3RO0A 4M46A 3USES 1L4MA 3O31A 3N8HA 5IUNC 3QAHA 1NJSA 1RMQA 3LACA 3I76A 5L3QB 4WKGA 3BJ7A 3FBUA 2ZAOA 2DOKA 3KQOA 5CJJA 3IQEA 3RFVA 2VAVA 3GFFA 2AQ8A 1X8JA 5TJ9A 1RXVA 1TQ6A 2JBKA 1LD3A 5M2QA 5E1MA 3NAQA 1FPQA 1FDVA 4XE5A 2OZLB 4LJ9A 3WYCA 2FPIB 2XCQA 2GM5A 4GOJA 4OXRA 4P3KA 4FXOA 2LGJA 4RQBA 5A1TA 1GT91 2X0FA 3KQYA 2EC5A 2PMBA 3U9TA 4L76A 3DE0X 4BECA 5IJWA 4DMKA 2B7LA 4IG4A 2FA9A 3QBEA 2P69A 1NSFA 4M6WB 1KSHA 4FW9A 5JAUA 3R3UA 1JVBA 2ZYRA 1NYRA 2W6IA 4PPGA 1P5ZB 3DJFA 1SHJA 1QHNA 6CHYA 4Y7DA 3JVEA 5CRIA 2X9LA 3OPQA 4C6TA 1P5FA 3ZE1B 5EIHA 5KWEA 2EDCA 4AIIA 3RS8A 3WK5A 2CY2A 2PGJA 4D8VA 4J75A 2AT1A 4MLPA 5EESA 4UTOA 5K0EA 3WB1A 2DF8A 2FPIA 2HF9A 3PQFA 2QOEA 3RLFA 3CURA 3TE7A 4HFJA 1JECA 2EBUA 2CLDX 2QG6A 4XVCA 4QJIA 3CX6A 4ZVKA 3M4NA 2DPGA 4H4CA 1TA0A 3O9VA 2HRBA 1Z4KA 4UHKA 2PZKA 2Q4ZA 3MGGA 2EFJA 4ZRMA 1Q92A 2YWEA 5E0OA 3R77A 1HDOA 3JRXA 5M3BA 3TT2A 4I4TA 3G02A 4EUNA 4IOKA 1ZM4A 3UUGA 3PHGA 4FUTA 3VX4A 1WRBA 2COEA 5I0CA 3GFOA 1C9DB 3SS8A 4KSYA 2Z0MA 3NVKI 1YZUA 3ERCA 1JG4A 2BEJA 4WNCA 3LWBA 4MUNA 4ETIA 4ACBA 4ND3A 5CVCA 5TV2A 3OE5A 5EPUA 3MS2A 2XGOA 3VNVA 4G0MA 4U5YA 4A8PA 1H22A 3KALA 1QH8B 3ZH2A 2B3DA 3WKBA 2MYNA 4DCMA 1KY5A 4ZOAA 1WUIS 4IIVA 4FUUA 5EWJB 4YV1A 3EGXB 1CP6A 4JEHA 2HM7A 2XUIA 4TWJA 2FMTA 1PZHA 3LGAA 4F7DA 3R76A 2XSZD 3HGMA 1P91A 2JLQA 1SU6A 4FMDF 1V1RA 5EG5A 4LDQA 3R7DA 4I0WB 3K2KA 2ASEA 2VP3A 4NJEA 5C3MA 2XQFA 3GGDA 4F60A 2UUAB 1CETA 2IGBA 4ARBA 4OKIA 4E5VA 2VK8A 1CEYA 1O3YA 1OYOA 2OORA 2CNWA 2AYYA 3LMSA 4S1VA 3S6HA 3ET5A 1U9IC 1YOBA 1XG5A 3K35A 4N49A 1D8TA 2IYFA 1DV1A 4B87A 3G5LA 5EWJA 5ELLA 2H65A 1UBRS 4OYHA 3BXFA 5H1YA 3WXMA 5IWCA 3KL4A 1HDEA 4AYXA 2OQRA 2VAXA 5CLFA 4QUEA 1ETUA 2Q46A 1Y81A 2OP1A 4URYR 2QM3A 3JRUA 5EMIA 3MUNA 3B6JA 3ZWWA 2P2CA 3ASUA 4J76A 3EVGA 4C2ZA 4QULA 1S7CA 1W29A 4PYNA 1G5QA 2VUUA 1NKSA 4LX9A 5AFSA 3H6HA 3UVEA 5ENDA 4MHDA 3KJHA 4LX8A 4JFAA 1WU8A 4M1WA 1O8CA 4PG7A 1NX6A 4OHXA 5EAIA 5JSQA 1I51A 4PYMA 5AXAA 1A1SA 3K8OE 3O82A 4P3YA 1FNCA 2YNMC 2ZIEA 1PX2A 4C03A 5I47A 3G13A 4JI7B 1XN1A 2QPAA 2BV3A 5I9NA 1P3Y1 4P22A 3H42B 1QH1A 1OXUA 2YJZA 3OLWA 1QHHB 3U7HB 3NFYA 3ZGLA 3VR4A 2IS4A 4MCIA 3AM4A 3I5UA 1PTKA 4LMRA 4B7UA 3VYUB 5J59A 2C7PA 1JI3A 2R00A 2I33A 4L7QA 1DAHA 2WJ4A 5AK4A 1OMOA 3A0UA 3Q40A 1L8QA 2QIOA 1HE5A 4JJ8A 2DP4E 4JI0B 1A2BA 1OHHD 2LZ0A 1U0GA 5H8WA 2FSPA 2ONJA 2P65A 2JBWA 2HUNA 1JDBC 1MB4A 5CPBA 4ENTA 4O33A 1XA3A 4MUGA 2NZVG 3TIIA 1SKMA 2R7MA 2AKAB 4QQFA 1XZHA 3UTDA 3O8OA 3PQ5A 1GFSA 1T10A 4BWVA 5JFGA 1N36B 2XUOA 4JXRA 4MAAA 1WEKA 2EW2A 2C77A 2QN8A 4R71A 2D6FA 4QBJA 4QOIA 3DDDA 5A0FA 1LK0A 4JYCA 2XXJA 4BZWA 1JU3A 2HY7A 3QVJA 2FSGA 2W6OA 4WFQA 3YASA 3M9LA 5JLJA 3QA9A 2GNAA 1OROA 3CWZA 3L8FA 4B5KA 1DRWA 1UJ4A 1X1DA 3GVCA 1P6XA 2JI6A 3NI2A 3K0FB 4J0IA 3S68A 2O2HA 4LJRA 5HSGA 2FE4A 3OKFA 2XE4A 1VIVA 3AP3A 1SPXA 2QLJA 1KJYA 4N5IX 5ICGA 1DMRA 2G4VA 4MB6A 3FW1A 5HF9A 1T36B 1GZ4A 4WJZA 3KOMA 2YQ5A 2PVVA 3NHLA 3TWOA 1YRWA 1X7WB 3MCZA 4YRRA 2CLLB 1TF5A 2CDAA 5JMWA 2X0RA 2GBLA 2O4UX 4C6HA 4CL2A 4GL4A 2ZTUA 1FJHA 4EMBA 2P67A 3VNBA 4BB6A 4MIYA 1FQKA 1VG0B 3X1YA 5HFJA 4IGFA 4BU1A 1VL2A 3SI1A 3IQGX 4GSKA 1P7PA 2JIOA 2AWNA 3ZCSA 4BL5A 3GLHB 5CDHA 5ITWA 2IU6A 4FPXA 1DKUA 5ITZA 4B3JA 4LFAB 3QXXA 3K05A 3D6MA 5JD6A 3RASA 1W4ZA 3UWMA 3RGWS 1JYEA 4OI2A 4AD8A 2HD4A 4HAIA 1U9ZA 1X7WA 4FHFA 1IQRA 2X9QA 4NH0A 1KGSA 1K5HA 4CT0A 1X15A 2AG5A 4L4YA 4IRMA 1I4LD 1XJCA 2P1ZA 3QI7A 1U1CA 3VSDA 2CHEA 2JFQA 3KR1A 1GPYA 4NBVA 2J09A 3FVTA 2V7EA 2V98A 3QBVA 2IX9A 3LCVB 3DV9A 5CVEA 3ULKA 1UBOS 3UH0A 2C95A 1STOA 4BX3A 4O4JB 1KQFA 1ZIXA 3OZSA 1W1WA 3DL2A 4G0PA 1BFDA 4O2LA 4LE2A 5JISA 5E6SB 2OCDA 4P6YA 3TMKA 3T8WA 5LZ9A 3TLEA 3P94A 3WL3A 4BNFA 3R7WB 4QRDA 1FX1A 1KNXA 3UXHA 3GB9A 5HKLA 5KYXB 3MINB 1EVIA 1FSZA 3ANYB 3O3CA 1UPTA 1QAQA 4EO7A 1VXRA 4JX9A 3EWNA 3VM6A 3U7EB 3QE0A 1BMQA 5EE1A 4H3KB 4KLWA 3I9NA 4OOEA 2O7SA 4B7ZA 4V3CA 4DDKA 4KR2A 4RVFA 2C1ZA 4S12A 2X5KO 3AFGA 2EJVA 4BUJA 2K87A 1NNEA 4XSHA 2G9ZA 4IXTA 1JLKA 1CDDA 3GK3A 1YBHA 3E7DA 1VE3A 1USKA 3AFMA 4EZBA 1A2KC 4CMCA 4K03A 5BMVA 3NP9A 3WP1B 1E5QA 4AAYA 3R7WA 1PFQA 1Q7TA 5JPCA 3CZMA 5KINB 3DP9A 3QH4A 1KIFA 1C9YA 1MMFB 2FVGA 2M6LA 1V7ZA 2IYXA 3GLKA 1YBFA 2XUQA 2J6BA 1KTVA 3GEGA 3JRWA 4AZWA 2Y4NA 1ZCBA 3O6VA 3HCRA 3H4MA 2UU9B 1ISIA 5BOSA 2ZR9A 3RFFA 2BFPA 1ZD3A 4FCTA 3ADKA 1BWPA 3D7MA 2MSEB 3SX4A 1Y7IA 2B4YA 1OD6A 2ET6A 1M1NB 1Q3KA 1IUOA 4WD3A 2BGWA 1NZJA 3F9RA 3W4IA 2QTHA 5ICMA 2A84A 4BYGA 1BFKA 4FOLA 3NMUF 1NJ8A 1U28A 2NO6A 2ZB3A 1TM1E 1OWNA 1T4MA 5TS2A 1A2QA 1FC0A 4ZGYB 2OYCA 3V1TC 4D43A 5JPHA 1XX6A 1FXUA 1AGYA 5JQGA 2C00A 3EDYA 3AOEA 2H8GA 2GBCA 4H1WA 4E21A 3CJRA 2C2KA 3FUTA 2VXYA 5AVZA 4GIBA 4NYIQ 3NUQA 3BN3A 3THYA 3KOOA 5EUMA 2Q99A 1YZTA 3H2YA 3FMPB 1U7ZA 3R5KA 4IGKA 2IXFA 1T2CA 5CH5A 2I9KA 3FYUA 1E1DA 1Y6GA 4PRZA 3GF4A 4Z7OB 3OVMA 4H6ZA 3AR5A 2B9VA 4GS5A 4GLBA 3A3OA 3C6BA 1CJMA 5I7UA 1BMDA 4CIVA 3BRCA 2IBMA 2A1TR 5EQJB 4HN2A 2OFPA 3P71T 2VK4A 2EQAA 3FZEA 3C5EA 4GQBA 3FSJX 4YA6A 1SKBA 4RA6A 2E4VA 4R1OA 4HEHA 4K1LA 4BKMA 3HDYA 1AK1A 4BVBA 2PUAA 1M6EX 1E3IA 4AQDA 4EB6B 4WLFA 2O8NA 1ND6A 2R25B 4L95C 4P0TA 1H4VB 4OBXA 2GFIA 5CYPA 1YR8A 3P2HA 4GPZA 2B4DA 5AVYA 3QPBA 2AR0A 4PLYA 1DIGA 2W37A 3R3XA 4UNSA 2XYQA 2QV7A 3ICQB 1CQXA 3P9KA 3WGVA 5FOTA 2QRKA 5CLHA 1QMPA 3QGMA 3V38A 1VHWA 3GNTA 4BZZA 2P0YA 2Y71A 3L7MA 3QX7A 4A26A 1UBMS 1ZJJA 3OFSA 4Z4QA 2BZ1A 1PS8A 3A9TA 3UAVA 4JXXA 1Y9JA 3B52X 3QY9A 3O8DA 3IIJA 5DDIP 2E18A 1HEYA 5GINE 2C2HA 1JR6A 3ZY4A 4EB6A 1JQGA 2Z3WA 2QB5A 4OI4A 3LBNA 3IEPA 3AVUA 3DO6A 4MO2A 1XTJA 4I1VA 3WLPA 3RFXA 4R6TA 2Z6VA 3IP7A 2WG2A 2CXPA 3M9WA 3K9QO 1H65A 1I9CA 4A8JC 2J3QA 1OFUX 3CLKA 1D0IA 5KQSA 4JA2A 1RRMA 2GO1A 4L73A 3AF6A 5KYTA 2A88A 3LDAA 4UE3S 2CLSA 4LS3A 3P9NA 4RGBA 3KSMA 2WSBA 2PH5A 2GDZA 2NTNA 3DEAA 2FUG6 3OZFA 4IOLA 4D8XA 4QNMA 4GM5A 4IDGA 2ZR8A 4YRAA 1CNEA 4BEBA 1G66A 2JCSA 2XCSB 3FR8A 3QIVA 4OP4A 3NHZA 1ZGBA 2TECE 1SHKA 1NG9A 5FYQA 3EUWA 5LCXA 5HQ3B 4EJSC 1C4OA 2C5LA 1DHRA 1KYVA 4GP7A 4RY9A 1XP5A 4Y2RA 1BAVA 4MVYA 3R96A 5AR1A 4GI1A 1KZ1A 2O2JA 2C5FA 3MHPA 4JVSB 4RA9B 1UC5B 2ATXA 2PWBA 5E9WA 4EO9A 2H1WA 2GXUA 1JEJA 5TNXA 1KK0A 3IP6A 1MOQA 5IH7A 3NBXX 3MLBA 2VP5A 4AKHA 5IBPA 2MMCA 4L3VA 2DEUA 2P2GA 3A6HA 2FSUA 1UBLS 2ZS7A 3AHEA 2HU8A 4I46A 4DQLA 4LQGA 4G0QA 1FW8A 1DFGA 1RBYA 4N3BA 3I6ZA 4J94A 1GU0A 1Y98A 4TLCA 1AVTA 1RT9A 1P73A 4IEFB 5HQ3A 1SN7A 3COJA 1MJ9A 1F0PA 2VHTA 3NTXA 3RS7A 4LC9A 2PFSA 2XGMA 4QFDA 3NH9A 3HZHA 4B5LA 2DTEA 2FN7A 1FX0A 4EGCB 5AHXA 3ZQKA 4J0EA 1ZI9A 2WTEA 3WHKA 1NVXQ 5JSKA 1A76A 5J2TA 2BO9A 1ES9A 4WEOA 4UWIA 5TQ2A 1PZNA 1ZEJA 2I2CA 3COSA 3FE2A 2YJ3A 2I7TA 2CKDA 3TL2A 2ZR0A 3ZDCA 2W90A 1SVMA 2E89A 3UICA 3K9FC 4BIMA 1QZZA 3KC2A 1YS6A 3JYQA 1X42A 4UUAA 2ZI3A 3ICCA 4TZKA 2A1TS 1GUAA 3UXMA 2P11A 5C7YA 3EVEA 1KMCA 4B74A 4DCOA 4QGSA 3M49A 3P9CA 4DN6A 3VTKA 3R5XA 1Z4QA 5EZYA 4MUFA 2O5EA 2FWIA 3GARA 3CLUD 2Z4TA 3GBVA 5A3VA 3VYVA 1W88B 1NN1A 3LYLA 4B6OA 1LLDA 1II9A 1EZ1A 3CW9A 1R0RE 1C50A 3RTBA 1XHFA 2QVXX 3S3TA 3HP1A 3IGFA 4HDOB 3M4XA 3E27A 5L6LB 1GG5A 3ZHQA 2Y0PA 4MZDA 3HB0A 1AUPA 5DBGA 3O83A 1K92A 3VJKA 4JBIA 2O52A 1PGOA 2GPSA 2CLEB 3LLMA 5IAOA 4RS4A 3WP0A 2FPSA 4FYKA 5DO9A 4RH0A 3ENKA 4RIFA 5BN3A 3KS9A 1MX3A 4F3CA 3NP7A 2UV8A 4CMAA 4B73A 4EI8A 2PQ0A 3CUYA 2IJZA 1XN4A 1YMVA 3T0FA 5GGXA 1ISHA 5U1PA 3QLTA 1TMOA 5EJ7A 3I9LA 4LC1A 3NDBB 1W581 2R86A 3QVOA 2WZCA 1COWA 3A1CA 4I9UA 1OFIA 2O2ZA 2ZYIA 2RAPA 1Y9EA 3E8SA 4UDOA 1P0QA 5G3YA 2E1PA 1OGYA 2VA9A 5IHPA 4XGNA 3BCHA 2ZYSA 4LBZA 2NZWA 4UTNA 1O0SA 1HV8A 3AIKA 5J8FA 4FGWA 1N1DA 4K5QA 4CXMA 2Z4RA 4JJ7A 3UWPA 1U6JA 3ZZMA 4QG7A 4NBSA 1S8FA 3Q9UA 1E60A 1A9RA 2CMDA 4E22A 1R0LA 5K0TA 5HP4A 3U26A 3BHXA 1ADCA 4PYOA 1ELLP 5TMBA 1T5IA 2IXGA 3VMFA 4K2HA 5EC8A 1XQYA 3U7QA 4MR9B 1M6WA 2KI5A 2PRIA 1JLLB 1QFJA 1L5MA 2NO1A 1AT1A 4KQ9A 4ZC8A 4AURA 4MQFB 3C3AA 2IH2A 1JSZA 3MT9A 4F2GA 1SXJA 4EAQA 2QW0X 1M76A 2R5WA 3IUMA 3M4YA 1XEWY 5F23A 2R4TA 3KOWA 2PHZA 1OX5A 2X0NA 2R0QC 4C0LA 4CNBA 2FK7A 3VZBA 2NN3C 4KGDA 3O1LA 2DQYA 2ZT8A 1SBNE 4DR4B 1CJSA 1C2TA 3A3YA 2OC9A 1R8QA 3LQQA 4NRDA 1JXAA 5IG2A 1KE2A 3KYIB 1GEEA 3GXBA 1QOQB 4KO3S 1RXTA 1QIMA 4ZAWA 4ZPJA 4GNRA 4G41A 3FHOA 1XZFA 2JG3A 1PT7A 2IYVA 1YJXA 4FFNA 3S2UA 2E85A 2PJZA 3HKDB 1W49A 4UPDA 3B2YA 3KXDA 1JLLA 3O4GA 1OW3B 3NCHA 3OC0A 1QVAA 1GUBA 1KFKB 1X7HA 3RPEA 2MT9A 3QUTA 2VXBA 5FPQA 2UUPA 2BFCA 3A6GA 4G8JA 1ORTA 4ITVA 2X13A 2Q1WA 1AC5A 2MSWA 1NDUA 3FA2A 4KYIB 1MJFA 3OIFA 1E3TA 4N0EA 4J4BA 2VJNA 4HNGA 1EG2A 1HO3A 2JI4A 2HH9A 3ESXA 4YH1A 1SKYE 2XPCA 4EG3A 3LYAA 4UUPA 4WVFA 2YZKA 2XCLA 5I5GA 1DC5A 4F92B 1YE8A 3CNBA 1YZHA 2RKOA 3QK7A 2O3QA 1GPH1 5IKXA 2OCKA 2CF6A 1ZEMA 1JR2A 4N0QA 1CS4C 5A28A 1BWRA 1J70A 1AXEA 1DX6A 3PT5A 3E3LA 3U5ZB 4CM7A 1WPRA 4D9GA 1NXSA 4P4JA 4P33A 5HVGA 1JTVA 3NT2A 4PZLA 3BVPA 3L1VA 3RO7A 5LB4A 4ER7A 2HDHA 2HV2A 3HHEA 1Q2DA 1XXHE 3JALB 1G98A 2C7QA 2X5XA 3L92A 3ROKA 5HILA 1DCFA 2WC1A 4AX4A 1BGXT 1IIBA 3HB5X 3MGKA 5F78A 3IIMA 5KOHA 4ZFNA 3MLAA 2CTCA 4G5SA 1NMXA 4EMTA 4ABYA 1KEVA 3KX2A 5CCEA 4UHJA 3E22A 5IKEA 4ZHQB 2NVWA 4AJLA 2NAPA 2IIVA 3OTHA 3EGVA 3KQQA 3EZNA 2FXVA 1FEZA 4R8SA 2QY9A 1NNUA 3PFBA 3RVMA 1EEXB 3UC9A 3TZKA 4EJMA 5JSUA 3TR5A 3RF7A 1YQEA 4NULA 2K5TA 1K6EA 4BE7B 1QQTA 4MHYA 4L02A 1P9RA 3MSXA 1Z7WA 3EFBA 2XMRA 1Y5NA 2W8ZA 4R2XA 4M7PA 2QRMA 4V0NA 5DM4A 3OQNA 4U7JA 3T4UA 3VR5D 2AFZA 4OKSA 5LA6B 2V0NA 2Q4EA 1NP6A 3W5SA 1UBNA 1DCTA 4EG1A 3KUUA 1WZNA 3CCBA 1Q7LA 1YHNA 3TYXA 3RARA 2ZIFA 2QM8A 3ROGA 1ZUNA 3Q6NA 4KRGA 2EJCA 3DOHA 1Q7RA 4LKOA 3K0CC 3C15C 3DTYA 5JHGB 3A6LA 5L3ZA 2HKIA 1OXSC 1X0XA 1KOLA 1RWWA 4ONUA 2R1VA 4LN1A 2QMLA 2VQFB 3BAZA 1RMTA 4JASB 2WJ3A 2WFLB 3N74A 2C03A 1WCXA 4RWEA 3KT3A 3OIDA 1OZ0A 4P7JA 1GAQA 2EEPA 2OHXA 5LA6A 1U8ZA 2QR2A 4DMFA 2W4MA 3VPDA 2XIQA 1N9GB 2HMWA 2FPLA 2ZXVA 3DBVO 3O8QA 4Z7NB 1DJOA 4BNIA 2RARA 2V55B 5FPHA 1G5IA 2JD1A 1OI2A 4NY1A 4KN8A 2G8NA 1AQLA 1P1IA 5LDDC 5AWFC 4UVEA 5G40A 1FJXA 3CUWA 1PU9A 2VCHA 4CG0A 4IHJB 2NMVA 5CBPA 3FMFA 4BBZA 5T5QA 1AKQA 3AILA 4Y0AA 2D5BA 1L4GA 1JW9B 4NYMQ 1I4WA 2G1JA 3S2ZA 3IJRA 4EDHA 4HXEB 1IUPA 5KWJA 5IW8A 2HMAA 1IBCA 1OXVA 4PE5B 5L3RA 3OD1A 4I9NA 4XYEA 4N5NA 1BX0A 4BNVA 5D8NA 4L28A 3AB3A 3GRAA 5JWOA 3EZ7A 7REQA 3TAUA 3HO1A 4CFYA 5BT8A 4HR7A 3WBKA 4A3SA 2I2BA 5EIFA 3QX9A 3H6GA 1KKMA 1QDEA 1C30B 5T6MA 3VR1A 1UK8A 3U3MA 1IEXA 4MPPA 2QTAA 1OPRA 2D1RA 4IHJA 3OOJA 2QTWB 1KO4A 3WGYA 3ZDDA 2I8LA 3GH3A 2JGNA 2C31A 2EFEB 3ZK7A 2IXDA 3V1KA 2CZGA 2Q5CA 1A96A 2QENA 2AKYA 2FF7A 4RD1A 4MRSA 3ZE9A 4P7KA 2J0EA 3EZ6A 4PGGA 5SZKB 4U9HS 5CPAA 4RU1A 4Y0NA 2H63A 3W90A 1PP4A 1RBMA 4ZOBA 3OE1A 2O2DA 3PGA1 5CT4A 4MAFA 1CSEE 4OGGA 1BNCA 1D4OA 2XMGA 4RK6A 3DOFA 4ME6A 3PLAE 3PJEA 2EZ9A 5K03A 3FB1A 3HSSA 1IH8A 4LE1A 3EXHB 2JLUA 2PQ6A 3NWBA 4F3NA 4LF8B 1UDWA 3VARA 1QCDA 1Q20A 2I4MA 5AUOB 4UBIA 3AVVA 3H4QA 4ZICA 4C5CA 3N58A 5EJAA 2YVKA 4DMGA 1FMLA 3VKFA 3CV3A 3HCWA 3AEUA 3TOZA 1KAMA 2Q3MA 3H87A 2G83A 2VLBA 2WWGA 2REQB 3T8YA 3DO8A 1E3DA 4H08A 5K0SA 1QBGA 2BR5A 2DTDA 1SVKA 4BTLA 4D0NA 2ANBA 4QGBA 1KO7A 4PYQA 1SULA 4NQRA 3P9IA 4Q4HB 3SICE 3L8YA 4KZTA 1QJ4A 4RQTA 1QYCA 4CG2A 1PUIA 3W8RA 3H6KA 2CT8A 5EHXA 1DKRA 2CHVA 5A04A 1EXNA 2BBTA 1F8XA 4Z9XA 4I6GA 4CKEA 2GVDC 1UJCA 3PHJA 4JP2A 3DV0B 4CLHA 3B9BA 1J2UA 3HKEA 1S2DA 4BKOA 2VSXA 3AZQA 2GHQA 2NO9A 2ZIUB 3I2HA 1OH5A 3VC3A 1JJFA 4X7PA 1DFHA 1XROA 4A0FA 3EUAA 1YFLA 1S2OA 1R5OA 4MA5A 3EX7C 3S29A 2R2AA 4WWVA 3ZQJA 1I2CA 4UREA 3D8RA 3RVJA 3HFSA 1T4GA 3RG8A 3GD7A 4Q15A 3Q8MA 4MGKR 2EBFX 1E96A 2A9PA 4FHZA 1ZM7A 3B38A 3E3OA 3P2OA 2I7DA 1T6BY 3RVBA 2V7BA 4R68A 3SYRA 2X5JO 5GOZA 3V2IA 1DU4A 4ZDWA 1IFXA 4RENA 2QM0A 2YUIA 3HCDA 3NNSA 4W7HA 1E61A 1Y4AE 5BV8A 2GZAA 1N0WA 4CM5A 1M6VB 3TVYA 3KAPA 3ER8A 2YS6A 3GJ5A 4X62B 3DV0A 3T3MB 5HZGA 2WIKA 2A9JA 2AA3A 5EQTA 5G41A 1ORHA 1GQFA 3N0WA 5LQNA 4RVDA 3IR7A 2YASA 3SIXA 2GN4A 5EUCA 1P74A 3H9UA 1WVIA 4U7FA 5PGMA 1B8NA 1HYBA 1JKIA 2BE9A 3ILHA 1MH9A 1ZLHA 1WTAA 4PLHA 3EQ8A 5B4VA 4Q7JB 3IC5A 1F8UA 2JDIA 2AFWA 3K1TA 3R0IA 4YJFA 3H83A 3N8NA 3I1FA 3VYTB 4YV7A 1RYEA 3K0BA 1T24A 4F4CA 4R6XA 3IBCA 1LCPA 4DGQA 5H4GA 5IAAA 1K27A 1RPZA 1W96A 5C1IA 4AY3A 3EBPA 3AH8A 4YGYA 4YPOA 3ETGA 1Z5WA 3BIOA 3FYSA 2F3SA 2NG1A 3P2JA 2O1EA 5JSHA 1C8KA 2BP7B 1PK8A 3Q2KA 1FUUA 1DJNA 4DAOA 5KNBH 4H27A 1E0AA 2PH7A 2YYAA 2D5IA 1L5HB 2XITA 2G6TA 3TTSA 4PVCA 1MAVA 1G4UR 3TQFA 3ASYA 4HEQA 3O2SB 2QE7D 1U80A 3HA7A 4R87A 1EWRA 1W5BA 1XQVA 4OP2A 1CUFA 4RHYA 3PD0A 4NFLA 4NFHA 4G0NA 1C1DA 1CR2A 3JQCA 2Q07A 1G3IA 2ZELA 2DQSA 2J0SA 2VSOA 1RVDA 4MDEA 4AWBA 2FJ0A 3DDZX 2W58A 3P4UA 1P31A 1XK6A 3SJFA 1YS7A 1G8YA 1CZUA 5KWVA 2IPXA 4JELA 1PWHA 3QFRA 3AR2A 3PNLA 1Y8QA 1BW9B 3ZH9B 5FNVA 1KBQA 2AUNA 1L5HA 1OXTA 1MVLA 4XVUA 4HYTA 4LSWA 1SD1A 4B40A 2XQGA 3GLJA 5EWMA 1RWOA 1SC9A 3CJQA 1Z7BA 5FWAA 3HEMA 3KT0A 3CNEA 1HXHA 1AUGA 3A4NA 5JCJA 3A9LA 2WSAA 5JYDA 1Z7EA 4X8HA 3W8NA 1QFSA 1SMKA 5KYGA 2VCYA 5AM1A 3D31A 2Z9DA 5DLDA 5IKOA 2JEVA 4EGQA 1YB4A 4DARA 3L6CA 1Z2OX 1F3OA 2PBLA 3ER6A 5T8KC 5H86A 4EJSA 3FUUA 1ML3A 3CTMA 2XWSA 4OQQA 3WYFA 1XCLA 3IDSA 1X7DA 4BFWA 5K8IA 5JASA 4AKGA 1GPLA 3NIBA 2QTZA 1E9RA 1Z8DA 4UEZA 2PTGA 4INAA 4UBOA 2BHLA 3WLNA 2V3VA 1GR0A 2I8AA 1PS0A 4EVRA 3GFRA 3FPGA 4BLWA 5DTMA 4OK6A 3IQDB 1CS0B 1SVSA 1R00A 5K3CA 2ZJAA 1XCGB 3QKUA 1G6OA 5CTJA 3ZGNA 3T5GA 2EJBA 4D0RA 1A3CA 5IAKA 3R0XA 2PZFA 3FJOA 5K99A 4YRKA 4UHHA 4WY5A 3A2MA 2FHPA 1N6RA 1G0NA 2ORYA 2ZSKA 4C6TB 2QG4A 3U60B 2Q6VA 2UZ0A 4HRAA 1XWFA 1M0SA 1GTSA 1XALA 1ZGZA 3JRNA 2H48A 3G8BA 1NBMA 3ZV6A 3WDKA 3QVMA 1NP7A 3QLVC 1CRQA 3AM5A 1BE0A 4CF7A 4OKOA 4M21A 4QU9A 4OAPA 1R2QA 3EBLA 3I5MA 4RTRA 2OHJA 5C4IA 1Z0KA 5AK5A 4EJ2A 1RTQA 3FCUB 4JZKA 4DJTA 1C7JA 1Z0UA 3KLBA 3ZBQA 3LC0A 2PS9A 1CUUA 1C81A 1CS0A 2JKYA 2ZRIA 5F4ZA 2CJWB 4UIBA 4RMJA 2GBIA 5AXCA 2P2LA 3IA2A 3P0EA 1QFXA 2PX4A 4IV8A 1IMOA 1FTNA 1Y7HA 2VH2A 1XELA 3F3MA 4I4TB 5F51A 3IUPA 2ZVDA 4PG8A 4HB3A 3KAKA 4JLAA 5EZSA 2A35A 3D54D 3GRZA 5IVPA 1MR3F 4KODA 1J1ZA 1REQA 2VAPA 2X6TA 4PQAA 2NNWB 1B2RA 3NOOA 3TJZA 2P8SA 5GCNA 5DNYB 4B3HA 4PGAA 1AURA 4OL0A 4Z4IA 3WWYA 3OJLA 5CM8B 2C61A 1PN3A 2PBFA 1GPMA 2OBFA 2G9VA 5KTKA 3CX8A 6GPBA 5ABPA 2FZLA 1O5IA 1YBMA 1LX7A 1M34A 1VSVA 4CE6A 2CJWA 4PM4A 2ATVA 4HDQB 1L0BA 3QKWA 1XZDA 4A16A 3TUIC 1XNJA 2C2YA 3C8ZA 4QQRA 1Z83A 2D8AA 1JR3E 1V1RB 3QWFA 1Q2YA 5DOZA 3A9RA 2AUMA 3H04A 2EFGA 5DIFA 2AX3A 2JCGA 4IWNA 1HRDA 1SGWA 4PO9A 4H2KA 4MKHA 3QU4A 1MEJA 3AFHA 4NJEB 2C78A 3A2NA 4FEYA 3QUBA 3RQSA 3PZRA 3QVSA 5KOYA 3OE7A 3KO8A 4JLJA 1L4HA 2BCJQ 4PWZA 2DUWA 2H29A 4ZDJA 3KZKA 3VTFA 4W5WA 3VYWA 1Z4EA 5K6TA 4QTTB 1ZHHA 3JATB 4RH3A 4A32A 1VLHA 1ONSA 3NDRA 4DG5A 3WL4A 4NHEA 3HL0A 1DGQA 5G0TA 4CS0B 4YMHA 3B12A 5SY4A 1PYGA 2CNMA 2WDPA 3DBRB 5J1SB 1JWBB 4JUCA 4O4IF 3W6PA 3IL2A 2R6GA 2PCJA 2X40A 2XMPA 3T5AA 5DKFA 1U2DC 5ICFA 3T1NA 3TPZA 1IBMB 4DLXA 1G9TA 4KAJA 2PVSA 4M88A 4PANA 4ND6A 4DIKA 2G7ZA 4FBGA 1S89A 4M7RA 1S3ZA 4G81A 2OGZA 2P6EA 2RB4A 4PO8A 1YOVA 3W77A 1XA0A 2YWJA 3GPCA 5B3LA 3EMBA 2ID8A 5LZ7A 3X2SA 2JGEA 1YVOA 3JQEA 3UA3A 3JATA 2FGJA 2IODA 3GELA 2EHJA 4A82A 4EVSA 1QH1B 4MDFA 2JJ8A 5C7LO 5K0GA 2XKKA 5L7WA 2AEJA 1KQGA 3FOAA 3D3EA 4GKKB 3T3IA 4CRWB 5DYWA 4FJ1A 4I9HA 3ASZA 3E9NA 1NA5A 5K8CA 5BRJA 3DBRA 5AI0A 3QPWA 2NO5A 1WXGA 4N39A 2B4KA 4QHTA 3V34A 1AQ6A 1ILEA 3HEAA 2OTCA 2G5CA 3BF8A 4WBNA 1U81A 2ZE6A 3BJ8A 2FUKA 2JCXA 3UAGA 3R3ZA 4LA4A 4IW3B 5ADUS 4W1PA 3DOEA 2GKSA 2G9QA 1HFJA 3JWPA 2FAXA 4UTXA 5KHOC 3QY0A 1PCXA 3AEQB 2PSWA 3T3DA 2OD2A 1ORVA 3RRFA 5B7NA 1XU9A 3O8OB 4JX8A 1TNDA 2QQ5A 3BJEA 5AKXA 2O8EA 3A1SA 4AMBA 5AM0A 4AECA 3H5VA 3RG2A 1JRLA 1NMTA 2GESA 5KX5F 2ESRA 4XR4A 4ZYTA 4PGHA 3DMDA 4HX2A 5K01A 3TLAA 8ADHA 4ZDKA 1R4ZA 3P9ZA 3VC1A 3A1TA 4LHYA 1AY0A 1VPTA 3LQ2A 5HM8A 4D02A 2ID4A 2CDRA 3DMGA 5HVNA 5JAIA 1KAEA 5IM4A 1LW6E 3ND8A 1FDOA 1U99A 3CO5A 4AXBA 2H1LA 5IVKA 1DOZA 1U1EA 3AEQA 3DE7X 1CZLA 1XF1A 5F52A 4EA7A 5F5XA 2AUTA 4G84A 1R6BX 4RL4A 1UOOA 3W6NA 3PI7A 1E2KA 2VQ6A 3AO0B 3SSAA 5TQJA 1JIXA 1BXZA 4UTRA 2HU5A 3F46A 2P4EA 4IGIA 2BUEA 4HBGA 3JZFA 3T15A 2LXNA 5CG1A 3H9BA 3R5SA 1AUXA 4KKVA 4ESVA 1QQAA 5JALA 2OCPA 3SKXA 1JG6A 3W3AD 3T3OA 2J8NA 3G0BA 4DIUA 3MTDA 2Q6OA 2QN2A 4BZPA 3OO1A 4BVLA 3HXPA 4ZMSA 1Q57A 3MRUA 2AYXA 4E0BA 2WUVA 2ZSDA 4IXWA 1Z68A 2H06A 4OLFA 5K0JA 4TLDA 3HDHA 2CNTA 2ECPA 4TSFA 3TBKA 3L6RA 4X44A 4DCUA 3H17A 2PJ7A 5ICCA 1JA9A 1J20A 4IS2A 4II7A 2ZEHA 4QECA 2XA2A 1H6BA 5ITZB 1SZJG 5ALOA 4DLUA 3N5CA 4W9RA 4H3HB 3OCCA 3U17A 1O95A 3AG6A 1KOGA 3JTEA 3N8KA 3IHKA 5FVJA 2GOYA 4MULA 8GPBA 2FZEA 3CW2A 1P9NA 2H08A 4TQUS 1BN7A 3C8DA 2RGWA 1KARA 1C4WA 4OKNA 5KPDA 1K7XB 2EIHA 2NYRA 5SZHB 4P2BA 4MUAA 2BRUA 2NZUG 4FQ8A 1OH8A 2RKWA 2UXBB 3GNQA 1RZRA 3A0RB 5JJLA 1Q1EA 4HUTA 5DNDA 2OFWA 5IT0A 1Z36A 1V8OA 5K2OA 3P9SA 1Y3AA 1Q0TA 3JZIA 1THGA 5CDYA 5LU9A 2AXPA 4CMGA 1D2GA 3HB7A 2JLBA 1KY2A 4D57A 4MTCA 4QATA 2QECA 2ZLBA 4M0KA 3QFCA 1EUQA 1EIWA 3MAGA 4AZ0A 1WMFA 2Y1XA 1TF9A 2CXSA 3OEED 2ZRKA 1Q22A 4X8OA 4KPFC 3OICA 4CAFA 5BN4A 2QQGA 2PSDA 3KXLA 3WNDA 3IS3A 1GTG1 3ZTYA 1WZUA 1V3VA 1I33A 1ADJA 1J0EA 2INGX 2PX6A 4CL8A 4MAMA 2XEIA 3DDHA 3SDBA 4O08A 3EMKA 5BMVB 2H2IA 1SVIA 2GJSA 4PK3A 4TYPA 1W5SA 1W73A 4GKVA 3W2GA 1OZFA 1T5TA 1JF8A 5I9MA 5JGFA 1J2TA 1XZAA 3HWRA 1R8SA 3WFIA 2AD5A 1PT9A 5E1BA 3WC5A 4X1OA 4U2DA 3C8MA 3MCWA 4PICA 5DI3A 2EK8A 2FFJA 1IN8A 3ZY5A 2G0TA 3QVWA 1YZYA 5EIXA 3TTXA 4Q21A 5BOSB 4IXMA 5GONF 3CNOA 1OI4A 4LGMA 4MQ4A 4EM6A 4FT2A 1AH2A 4EH1A 1O5OA 1QRAA 4ZQIA 4JI8B 3GHYA 1CZNA 4BMOB 2WA2A 4DCCA 3IT2A 2P68A 2DPSA 4OU4A 2PIYA 3VOBA 2ZEDA 5FV4A 3HO6A 2VBQA 1Z82A 1K6XA 3T1OA 4IZIA 4YP9A 1FNSA 4QU8A 3U16A 3PD7A 4P08A 1W1UA 1Y6FA 1PVOA 4JP5A 2QJ8A 1ONOA 2Z6UA 2FQWA 1DAKA 1CWUA 5JQGB 2O1WA 2JGAA 5HUHA 1JDSA 3FPSA 1LK7A 3BHIA 1P9OA 3Q3EA 4B75A 3THYB 1E7MA 5KNCD 4UJ5A 2DXIA 3VJLA 2QMEA 3FYUB 4B3MB 3JD2A 2B7BA 3R1IA 4AJKA 2JBAA 1P1JA 2HQRA 2NYUA 3BUSA 4RHFA 1OGIA 2BONA 3UJDA 4ZTZB 1JDVA 4YJGB 2F64A 1CG6A 3I9V6 4G5XA 4PZCA 1RCTE 4RA6B 3BFPA 4PZDA 3ZN2A 5JSYA 2CV2A 2XOKA 2BE7A 4W6QA 2EU8A 3O4HA 3RRJA 2V59A 1NN3A 1TRHA 4KNYA 2HTEA 4PQGA 1V16B 2P9ZA 3IE1A 3RIYA 3LRPA 1DKOA 5BR7A 1M4DA 4ZIRB 4QXPA 1KMMA 4JH0A 1IPHA 2NACA 4RZXA 2GFHA 2I1WA 2WYIA 2IT1A 3ZHSA 3TTYA 3LO8A 2B4DB 5DBOA 4KV9A 4MWZA 3IQIX 4FDUA 2XNJA 3ZCQA 1NF3A 4JGIA 2X0IA 2XUGA 2FR1A 4GECA 2Q62A 5FADA 4ZOLB 4YJGA 1PNVA 2H0AA 2JLZA 4GPEA 4ZY2A 5CEJA 4CPDA 5LRGA 5LYIA 3CZRA 4LZNA 4KOXA 1ZVMA 2XNSA 2VEDA 2CVOA 2VOJA 2XT9A 1M6YA 1EXDA 1V16A 1FFAA 1QX4A 1KZYC 1R6AA 4G0ZA 2G3TA 3SQLA 3CRVA 3AY7A 5CT5A 4ZIRA 1AKRA 3L7KA 1VMEA 4WNIA 4I2NA 4EFDA 4C3OB 3G1WA 2B4QA 1WCWA 3HMKA 2ZUSA 5EJ6A 3RIMA 5D51S 1ZN9A 4MCSA 1ABEA 5JJ5A 4JIMA 1YQQA 2WVGA 3CGWA 1L5YA 1Y37A 4S1WA 3S9MA 3V55A 1N6OA 3RDPA 4ZOLA 4M1OA 3ICPA 2AGVA 3BGWA 4MKIA 1L7NA 5FNZA 1YB7A 5FUXA 1D7OA 4GH5A 3INTA 1FSGA 2NU9A 3DFKA 4MDHA 5IXJA 3RIHA 4LWQA 4RORA 1GILA 3JQAD 1ZGGA 1U8UA 2JLCA 4GR4A 4ER3A 5EZQA 4L6AA 2KBFA 3T90A 3BMQA 2XTJA 1RJWA 1IBKB 5L3SA 5JMPA 1R4NA 1ZMXA 2CCGA 3DC2A 1BE1A 3L77A 1MA3A 3OBBA 1BVHA 4IHMA 3D6HA 1TC2A 5KJFA 3JQRA 1NR1A 2M1XA 1M8JA 3G82C 1C0PA 3Q1KA 1N6NA 2EDAA 2IX3A 3JQ9C 5FEUA 1OJLA 3D7KA 3RM3A 4UAUA 2CWWA 3UHJA 4KOUA 5JYBA 1C29B 5FHQA 5EXEA 3GUCA 3V4ZA 3EAQA 5ADHA 5C51B 2VC2B 1Z8WA 1PQUA 2P75A 3WBBA 4TQGA 1OIXA 1GN9A 4QXRA 2LE0A 4GKAA 3AJRA 3BM5A 2Q3BA 2SNIE 3A6EA 1ZWKA 4RV4A 4UOZA 1KQNA 5AW2A 2I6QA 5BYBA 4W5RA 2FRDA 3W6XA 1XKTA 1GTZA 2XUPA 3CRQA 4WXYB 1S9HA 1QSGA 1LDEA 4URVR 2OLEA 3MIIA 4AF8A 4B48A 3M81A 3UATA 4GX1A 1J90A 3ENVA 3DZCA 1FX0B 1E9VA 1I24A 3RU7A 1ZGCA 3BG5A 3X3HA 1DAEA 1DI0A 5J2TB 5JO0A 4JI4B 5TQ2B 5KYVA 4JWPA 1WMEA 4D9EA 1G2IA 3UMFA 3D2AA 2ONCA 5H82A 1W0KA 4KS9A 2F1RA 4L5AA 3LF2A 1WXWA 2G3AA 3QEBZ 1SBIA 1N0VC 2WRZA 3FVWA 1ZIYA 3K9HA 1L5RA 5J4LA 2Z3KA 1RQRA 3PF9A 2PJ4A 4HUJA 1ZFNA 3D67A 3LUKA 4KG7A 4NCHA 1NE2A 2PG3A 4E5DA 5EZYB 1SM4A 3PDCA 5BUCA 4FM9A 4PLTA 1NGSA 1QHEA 4PLGA 4OC4A 4YCNA 4B0PA 3HJNA 3C6KA 3KU4A 1JA1A 3R4CA 3V2UA 1ZZEA 1L7RA 5T8KA 1G8MA 2JIPA 4DPKA 3EZ2A 4X0EA 1P0IA 2IDJA 3WB9A 1Z5GA 3HDQA 4HRYA 4KVZA 4QJ4A 4NCKA 3DFZA 4MV4A 1KUVA 4NFYA 3NQ41 1YUBA 2I5PO 2JZCA 1X7XB 2R8BA 1B41A 2WTBA 1SB8A 2P2NA 3L6OO 3FVLA 2PS1A 3BWXA 2PU5A 4YRJA 1DBQA 4RZHA 2EX4A 2BOAA 2FW6A 1YZNA 4P4DA 2ZKLA 5BN3B 3JWHA 1JDJA 4XRGA 3TPCA 4YRQA 1P77A 2QGNA 3RJ5A 1KHTA 4NL4H 4NZZA 1TM2A 3D5QA 3BTOA 1Z5UA 4D9JA 1EWQA 2QTBA 4UXJA 3U56A 4TWIA 3ET4A 3W5IA 2R48A 2FSVC 2YMLA 1XZIA 2PLWA 3FWNA 1RLOA 3CZQA 4L50A 3EK2A 3ZXXA 2FKAA 2BFEA 1HDYA 2IZ6A 2P5YA 2ASVA 4BNTA 1VMIA 4IJMA 4DMLA 3NC0C 1W9HA 4MBUA 1NJFA 2ZJOA 3U09A 2PYDA 2WIJA 2DJIA 3OTOB 1O96B 3LHIA 2GTHA 3IOBA 1JALA 1X7XA 3GVIA 4DSUA 1VIXA 4RCYA 4A6DA 1LWOA 2W00A 3OECA 1VFPA 4IIJF 4OADA 1F2OA 4F97A 4P32A 4P4UA 1ZSYA 2R8EA 1M54A 4PYRA 1G60A 4L8WB 1UOPA 3O73A 3U7QB 4A1OA 2C4MA 1O54A 1YKSA 5FR2A 2GWRA 4UIAA 5DBIA 2GAAA 3BWCA 1SXJB 3R23A 3AV3A 4IO0A 1KEWA 2YRWA 3I1JA 2WK1A 5JD4A 4TYNA 4INZA 1CUHA 4M1SA 3MQ4A 5FPYA 3AYZB 3PQ6A 5EJ9A 5COQA 1A2OA 5F9HA 4O0LA 3ISVA 1O96A 4XARA 5AKHA 5C8YA 2CSUA 3MG9A 5J2UF 1XIVA 5KNBA 2UXDB 1GNPA 4Y2VA 2DLDA 4F9FA 5D8DA 1WDLA 4DV1B 5A1JA 2YV2A 3P2IA 1IQPA 2XWPA 2XZLA 4H1UA 1FVOA 2IIPA 2B9EA 3QOFA 3V7WA 1IOLA 1OFTA 1FYWA 1VCOA 2B37A 2YMMA 1R64A 3RSHA 5KC8A 1N2SA 3WNVA 3FTNA 4BC1A 1VCNA 4EA8A 5JSFA 4ZEOA 3F74A 1DAIA 3LBFA 2XXBA 1Z16A 3IV9A 4HD8A 5EP1A 3KXIA 4ZCQA 2BFCB 1SU8A 2Q8QA 4DNOA 4D81A 3A58B 4CUZA 3N2ZB 1NTOA 5DEOA 5KYWA 2VF5X 3BA6A 1P8JA 1CP3A 3U7GA 4CM8A 3OIGA 3BERA 4YLEA 1TU3A 4LCBA 4JXZA 5KHAA 3C3EA 4I5GA 3CF0A 4YO7A 5CCXA 4ALLA 1J5PA 5DCYA 4JD5A 1MJ5A 3BMXA 2BEUB 4OQDA 4BVHA 2W48A 4KLAA 3BWDD 2YQZA 3QPDA 4DYDA 1SUEA 2C94A 3WV5A 1HKHA 1OAAA 1TF7A 1U1FA 4QYTA 1SUCA 2GAOA 3HJUA 4HMPA 2A67A 2IYAA 1ZL2A 4IIGA 2D3WA 2F9MA 1VJCA 2H1RA 2D2VA 2JJMA 2CN1A 2FDCA 3DBOB 1K5GA 5LYFA 4RTPA 2C20A 2Q3CA 5JADA 3VPXA 1U9IA 4KI0A 1ZXXA 3HABA 4YRHA 3NAGA 4UQLA 3TM5A 3QXSA 3VH3A 4EWLA 5KOHB 2VJDA 5EZ5A 1A5AB 4I4CA 3K32A 3GLFE 5H4HA 4CW7A 4YCCA 1ZC3A 1K7YA 1J8YF 3AK4A 3E22B 4J3FA 2BEUA 1ZZGA 3A4TA 2VATA 1DPFA 3I3GA 1ZESA 1Z34A 3L8GA 3FKQA 4TGLA 3RV4A 1H85A 4B43A 3T52A 3MAJA 4WX2B 2GD2A 1RKUA 4NAHA 1F0NA 4JB2A 1U0NA 4RD3A 3D3KA 4RK4A 4ZJZA 4AVCA 1NW3A 1PV1A 1JYSA 3IDAA 2DFDA 1NJ5A 3PG5A 4AWAA 1JDBB 4EKNB 1O1YA 4RW0A 4HNSA 4GSYA 2YNMA 1YU9A 3FF1A 1JE1A 2ACWA 4W5NA 1DXHA 3DTVA 5HXAA 1Z5ZA 5FV7A 3NDPA 2A59A 3FVRA 4AICA 4Z4CA 1Z63A 4AIRA 1PDVA 1F9EA 5EJ4A 5BN5A 3B1WA 3L4SO 3IHTA 1Y9AA 1XRLA 1QXSA 4KPUA 1IOZA 4DR2B 1ZUNB 4GXHA 3R9GA 3UEOA 4CMIA 4ZO9A 1AKUA 4QUAA 4KKXB 2R6JA 4IJUA 3FCEA 3AL2A 2R1VB 5CA0B 2GPTA 2OM2A 1USVA 3B1KA 1NQXA 3ZLBA 4Q9NA 1B8OA 2IPLA 3IPXA 2J07A 2W2TA 4IIYA 4B0OA 4B14A 2BVNA 4JUAA 4XKJA 2PE5A 3BE8A 3GLVA 2YMQA 1FRNA 4KFCA 5D84A 4QWMA 3PC4A 2QUBA 4LSMA 3BWVA 5A05A 3EAFA 4G5YA 1WUYA 3PT9A 1E1KA 3O8QB 1J5EB 5K20A 1VTKA 2ZIWB 3NYWA 3DDSA 3I42A 3RU2A 2VI7A 1U90A 4F72A 5CVVA 1LY1A 4CFZA 3L43A 2DLCX 5CA0A 5CBPB 3IB3A 4D4HA 1QC5A 1HYGA 4QYIB 4KLNA 3GFSA 2WSSA 1L2TA 4KXMA 4JVOA 1JGTA 1ULTA 3WR7A 5HJEA 2HA7A 4L9RA 2PD4A 4ZN6A 3UW1A 4ER0A 4TN1A 4XLZA 3I2YX 1JHAA 3U4QA 2Q6IA 3OX1A 3RFCA 2ATIA 2XVAA 4YWJA 5BSFA 4MQBA 3RANA 4U9YA 4M98A 7REQB 2JLAA 3L9WA 1YBVA 3GDHA 2JJQA 4M9RA 3PC7A 4O2BA 2EHDA 3LOUA 3LD2A 3OQBA 3VPAA 4XOUA 1SNYA 4X6LA 2BL1A 4D79A 1R8XA 5KTYA 2AFSA 4D9NA 4IVPA 2HBQA 2ZEMA 2QPTA 1PYOA 1N2EA 5MGNA 4ZYVA 4FC6A 3C3WA 1VPDA 4IX1A 4UE2A 1M4LA 2P5SA 5M5BA 4QYIA 2ZJ3A 4YJHA 5I48A 1IATA 1YSJA 2DR0A 1VQ1A 1YR9A 4HQRA 3H13A 4JNCA 2RB5A 1IWOA 5BW6B 4BQIA 1NZDA 4NAVA 1JIUA 3TMYA 5TGTA 5KTDA 4JKOA 3E9MA 3FDXA 4KFSA 4ERNA 5IJZA 1JQ5A 3WAJA 3QIAA 1XT6A 4JHXA 5EHNA 1KORA 1S1CA 1WXEA 1Y4SA 3FWHA 1KSGA 1JB9A 5F76A 4ID3A 1PNQA 5LMZA 4DL9A 1QIIA 1FJGB 4K87A 2BAGA 1L5ZA 1NPTO 3WQQA 1G7RA 1Z4JA 2HRDA 4KVME 1IM5A 2BCEA 1KRXA 4N41A 3F5QA 3DPIA 3KVNA 4FKBA 1PUXA 1M8KA 5IEBA 3TUJC 2C0CA 4RE6A 2ZPUA 3G9XA 4N18A 3AF4A 5BORA 1Z6AA 2FZKA 3WHIA 4X41A 2WAYA 3BH0A 1JFFA 2VRWA 4R1QA 4UQPA 2X2FA 1V25A 4YFVA 5KJ1A 3AEUB 4GMDA 2BGKA 4C05A 4OSPA 4U00A 4D3YA 3TKAA 2PX0A 3O8NA 2HJGA 4IXDA 3ZEIA 4CF4A 4QUHA 2WJZB 3MTAA 3BKXA 1F1BA 2YY7A 4P38A 3KJIA 4P5PA 3U9SA 2BT4A 1JEYA 3D4IA 4MQLA 4WLNA 3TOVA 2VHWA 3JW8A 2IXAA 1DEXA 4CKEB 1P29A 5BNFA 3WIEA 1UDXA 2BDEA 3NBKA 5EJGA 2H2GA 4TXNA 1LSSA 3HKEB 1WABA 1C9NA 1CFZA 3AJ8A 2DQ4A 3KB1A 3ZDBA 4BMNA 3R3WA 3SF0A 4JT8A 4PXDA 5EJ8A 4NGSA 3QEAZ 3F90A 4HZGA 1K6MA 3CONA 3F5BA 2PMWB 2HWWA 4WV3A 2G09A 1OBOA 3E9CA 1BDBA 4HBZA 1M2FA 2HU7A 3CVWA 1U2GC 1Q1ZA 2QHXA 4J7XA 3KYDA 4WBXC 2X8WA 1M4GA 1CUBA 5KU1A 2GSWA 4X20A 2WKSA 1XAGA 3K0AA 2ZITA 5CT9A 5ALRA 3WGTA 3QYAA 3MERA 3IUBA 2QF7A 3TIFA 3TMAA 3WIVA 1XBTA 2R8OA 4JIGA 2I7CA 4DSAA 3FX2A 2WYVA 5FL7A 5TEVA 1G38A 1HDQA 3CIFA 1X13A 3E1KA 2BFBB 2HPHA 4Q00A 4YAWA 1EP9A 1EPUA 3PB4X 1XDUA 3I92A 1DIBA 2IF0A 1IN7A 4CN8A 2ZRQA 1P72A 3G9ZA 3RC7A 2ZETA 1SCAA 1Y5LA 2QJFA 4LNHA 3DLPX 4DJAA 4YJFB 3KEMA 5IYZA 2NU7A 1Z5VA 3I52A 2X4LA 1F0YA 2W8BA 3VVLA 1A71A 1LV7A 3L2NA 1T3SA 3L8DA 4XWYA 4EKEA 3W1VA 2NZJA 1DP4A 1NMQA 3STVA 5HOEA 2ODQA 2GREA 4QIHA 1IVSA 3UK2A 2YKGA 2F9LA 3D7LA 4DTIA 3LXRA 4L6IA 1TMKA 5L53A 2X0KA 3GQVA 1P5JA 1YIDA 3G49A 4LV6A 1QDLB 1QRRA 3F6RA 1MJBA 2BFBA 1MFZA 4R01A 3IKVA 3EDOA 3EEQA 3W8DA 2IIQA 1K68A 4CIWA 4O1IA 2WF6A 1GIAA 3Q8KA 4MEJA 2X3FA 3M5WA 1Q2XA 3JASA 1C1DB 3UFXB 2XUKA 3HBMA 4KQMA 5FX2A 3QJYA 4LMAA 1WM1A 3FR7A 1CUJA 1SUBA 3PLNA 3RTCA 1WPXA 2RJ3A 4RHEA 3KZMA 2VF7A 4MR8A 2QSYA 4CWAA 2ZRGA 3OJ0A 2W6ZA 521PA 2F8MA 5B4TA 4HXYA 1Y8QB 2J46A 5FNVB 2J5XA 2ZGVA 4A1FA 4JT2A 1G17A 1PWEA 1TZJA 2JFHA 3ZDXB 4CR7A 4NZNA 2OL4A 2XZPA 2WSLA 4WKOA 5IBQA 4X6UA 5EWMB 3A25A 3PPWA 4N40A 2FR8C 5B55A 4DS3A 3UJPA 1POWA 3D59A 4KXUA 3OPNA 1XEAA 3UFXA 4H3VA 3GRKA 3JSAA 4XVQA 4KOAA 3TRKA 5BWNA 3KWMA 4I55F 2V7QD 5BRAA 2R62A 3HDVA 4NZPA 4KBGA 2Q5FA 3HU2A 2CC2A 3AI3A 1VE6A 1AOXA 4EJSB 4QDTA 4LVCA 1P2VA 1TXGA 3ZZUA 4D9CA 3R0QA 3DT6A 5C1DA 2GFQA 4QT4A 2H1CA 4BYMA 4PXEA 4A8JA 1MG0A 1QO0A 3M34A 2AHOA 2C7GA 1Y63A 5JATA 1KJZA 2FVYA 3HY4A 4ETWA 3W6ZA 4BNUA 2QYSA 2Q9CA 3D2MA 3ZD7A 5DLEA 3U37A 1RPJA 2QI9C 3DKRA 4O3MA 1YULA 5HBRA 4XTCS 4CDGA 1H42A 4DJ5X 4PFSA 2XDQA 2H2FA 2ZWOA 3MEQA 1BX1A 1K86A 3MGAA 1VSQA 3ESCA 1PJ8A 2FR0A 4XW2A 4JUDX 2FJUA 5A4KA 4R3KA 3Q3IA 3B3GA 2VYVD 4LIPD 3JQPA 3JR7A 2BPOA 1QO9A 3NOQA 3IEUA 3GWZA 2WFZA 4WKPA 4BNNA 1K88A 4H16A 4OD0A 4I1SA 1Z4MA 3MSCA 2RH4A 2BZ0A 1NJGA 2JDCA 2UDPA 2V65A 3B2EA 2IHUA 3K1JA 1VBMA 5LQJA 3A05A 2OP0A 2N46A 5GIOE 4B13A 3B6IA 4J4HA 4DQDA 4CODB 4JLNA 3S99A 5C81A 2ILTA 1ZR2A 1REQB 1YQXA 1YR7A 4XD7A 2QR3A 5A5GA 1E1LA 1NRWA 1O6GA 1ZAYA 1H2FA 2QWXA 4TN5A 5E7JA 5HUQA 2EVNA 2WOOA 3CPXA 3UAZA 2Z1MA 3MCVA 1RJDA 2X1MA 4NMXB 5B2EA 3GP5A 1YA8A 2Q0SA 3SSMA 2HMUA 2YFKA 3CKKA 3LPAA 3FTFA 4RDXA 1PO7A 3KEOA 1TM7E 1M34B 1WD5A 3EN0A 1EX6A 4FSHA 3GJ3A 1ZOPA 4S1NA 4GLOA 3KAJA 3RFUA 1XCMA 4DV6B 4EX7A 5FOSA 1GGFA 2BY4A 2EKLA 1RKVA 1HEEA 2HLNA 5AJXA 1KC3A 3O1JC 1S3GA 2PC1A 1FFYA 1QFZA 4LPKA 3S1SA 4CZ2A 5CYOA 3D7DA 3CTPA 1IXYA 4RE5A 3IAM1 3D6VA 1FOEB 2DHDA 3A1WA 1F7VA 3R0ZA 1UKVY 1ETHA 4OAOA 1IHDA 3TRFA 2FSVA 1Y7LA 3PYXA 3R6LA 4WAUA 1GYTA 3ACCA 3T7DA 4G26A 3OQVA 1VKOA 1UWYA 3R6DA 3NM6B 5AKYA 2V7PA 2P40A 3EC4A 5JH7A 1K2WA 1DO2A 3U19A 2IYNA 3FNGA 1F8FA 4UNNA 2NXCA 1SA0A 4ANFA 3AWIA 2ZIVB 4ZZ0A 4ZEMA 3P9RA 3TDMA 2ZWIA 2Z11A 3UK6A 1IXSB 2Y3IA 5D3ZA 2FUNB 4Q6BA 2VEZA 3AF2A 1CY1A 1UP7A 2PYIA 4XJSA 5CYFA 5BR8B 2ORED 5TGZA 2D4OA 2PN1A 1R6VA 2WTXA 1YZLA 5IWAB 4H89A 5U9CA 5FEMA 4BQOA 1PK9A 3V48A 3ZJ0A 5JV5A 2QLMA 1JYFA 5IV0A 4QVTA 4AXVA 2PK3A 2VBIA 3K4QA 3Q7PA 3S6JA 3D8PA 5AQ1A 1YOVB 3PEEA 3CBGA 2R6DA 3A6JA 3TL3A 2JRCA 1FF9A 1L7BA 4ZU3A 4U7WA 1ZVVA 3CVXA 2Q9UA 4P4FA 1SKYB 3S6KA 5ARCA 1NJ2A 2E7ZA 1LI7A 3RS5A 2GJ8A 1BO6A 5EJFA 4YI5A 2VQEB 1S02A 2EP5A 4YU9A 1MIHA 5DT2A 4B8YA 3I45A 4YQFA 4OQXA 2WPDD 2CXRA 2OQVA 3LY8A 5JH9A 4QDOA 3WKCA 4U5XA 3CB2A 2BSWA 3PXAA 5G21A 4AS3A 4WBNB 3EVFA 4BV3A 3N7UA 1KMQA 1LPOA 1ZKMA 2HF8A 4Z51A 1BMFD 3QB8A 3KKLA 2OBBA 3OOEA 3T0GA 3J81k 1TYBE 2OAP1 4FS3A 3NM4A 5JNTA 2Q1XA 4HGZA 1I3CA 2VJKA 4XYBA 1DEHA 2G36A 4UMDA 5LP6C 2XMSA 5DHFA 3WLTA 1DO8A 2B34A 4BJ5A 1WLYA 3EW7A 2O8EB 3IO3A 1XL1A 1Z6PA 2VPIA 1AS2A 4BQPA 3MOSA 5K0LA 4Z0HO 2ID7A 2WM3A 4U39A 3K2IA 4EHNA 2PMFA 4CAEA 3T34A 3B70A 4KOVA 3UENA 1MK4A 1GYQA 2QDXA 2IDZA 2I8CA 1WB6A 4BO6A 4PPNA 3D8TA 4CLDA 3CG4A 2E48A 1NI5A 1MKYA 5MDHA 4PZYA 1THMA 1XXHA 5DXFA 3ESBA 2IHZA 4LXIA 1ZIPA 1Y3BE 3CMMA 1J8FA 3EB9A 4O6VA 2P9TA 4E09A 2AFHE 3AT1A 1M2EA 4HV4A 3NB0A 1HQDA 1EBUA 4TTVA 4M0FA 3BI1A 3HGQA 4BQQA 4OSOA 4MXDA 5CLGA 4IOJA 4D3ZA 2HK6A 1VMDA 3KKQA 3TD9A 3ZWDA