1CM0A

Crystal structure of the pcaf/coenzyme-a complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
162
structure length
162
Chain Sequence
KVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords P300/CBP ASSOCIATING FACTOR
publication title Crystal structure of the histone acetyltransferase domain of the human PCAF transcriptional regulator bound to coenzyme A.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 1999-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1cm0A00
5JQ4A 2H5MA 2Q4YA 3EXNA 4L8AA 2VQYA 1XEBA 2VEZA 4R3KA 3DNSA 3TT2A 3WR7A 4AVAA 5J8CA 4MY0A 3SHPA 3P2HA 1V0CA 5GCNA 3NE7A 1XMTA 2P6EA 4ZBGA 4NEXA 2QIRA 1B87A 3TOBA 2CNTA 3T90A 3FIXA 3LODA 4FD6A 5F49A 1M4DA 3I3GA 4E0AA 1LRZA 4PK3A 4YRHA 4I49A 2J8MA 4NF1A 5IB0A 2ATRA 1IIDA 5EBVA 2BUEA 5E96A 1QSMA 2OZUA 2HV2A 2OZGA 2WPWA 3GY9A 2GE3A 5KTCA 4AVCA 4FD7A 2Q44A 3JUWA 3TFYA 4B5PA 2I79A 4CAWA 1S7NA 4II9A 3TE4A 4PK2A 4KVME 2BSWA 3F5BA 3DDDA 4UA3A 2PQ8A 2CNSA 2KCWA 3T9YA 4E2AA 2AJ6A 2GANA 3EY5A 2REFA 4AG9A 3TOAA 2FT0A 1Z4RA 2D4OA 3PP9A 2HQYA 2R1IA 2B4DB 4XPLA 4HNYB 3H4QA 3R9EA 1Q2YA 2R98A 5HMNA 4AVBA 2FXFA 2AE6A 1YK3A 1L0CA 1S7KA 1Q2DA 2B3UA 2JDDA 4KORA 1NMTA 3IWGA 2Z0ZA 3OWCA 4UWJA 3DR8A 4KOTA 4GS4A 4CAXA 2VI7A 1IYLA 4IF5A 5F47A 1N71A 1K4JA 2JEVA 3K9UA 2EVNA 3EFAA 2VXKA 3N7ZA 2D4PA 1ON0A 2BEIA 1P4NA 4UBRA 3IGRA 3W6XA 1S3ZA 3E0KA 3FXTA 4KUAA 1M1DA 4XPDB 5FVJA 3FRMA 4QB9A 5CNPA 1NE9A 1TIQA 3DSBA 4AG7A 4RI1A 2Z11A 4JJXA 4RS2A 4NSQA 2WPXA 4MBUA 3D2PA 3R9GA 5C82A 2J8NA 2VZZA 4ONUA 5F46A 2G3AA 1IB1E 2FIWA 1GHEA 4KOWA 4JLYA 1RXTA 3CXSA 3TO7A 4F0YA 1NSLA 2ZW6A 1VHSA 4F6AA 4ORFA 3EO4A 3P2FA 5ISVA 1I1DA 3PGPA 1FY7A 2C27A 1XF8A 1Y9WA 4JD6A 2P6GA 4X5KA 4PV6A 2Y0MA 2OB0A 2Q4VA 4LUAA 4OAEA 3SXNA 2P0WA 2P6FA 2G3TA 3PZJA 4B5OA 2QECA 2B58A 3FYNA 4YFJA 3SXOA 2R8VA 4PSWA 1YVOA 1SQHA 1YR0A 4L89A 4CAVA 2B5GB 3DR6A 2Q04A 3W6SA 3EC4A 4FD5A 1P0HA 4KVOE 2I00A 4QVTA 1BO4A 2X7BA 1S60A 4KOXA 2K5TA 5F48A 2Q0YA 2JDCA 2OH1A 2FE7A 4H89A 5JPHA 2GIVA 4E8OA 1YGHA 1WK4A 2ZW7A 1PUAA 2ZXVA 2PR8A 4R87A 1RO5A 4BMHA 3GKRA 2Q7BA 1YREA 4AB7A 2HUZA 4H6ZA 3V8IA 3MGDA 4R9MA 4IUSA 4OADA 3R1KA 1KUXA 4Y49B 1BOBA 1CM0A 1YX0A 5H84A 4NCZA 1Q2CA 3D8PA 4OLLA 4UWIA 3S6GA 3FB3A 1WWZA 1Y9KA 4M85A 1S7LA 2FIAA 1KZFA 4XNHB 2ZPAA 5KTAA 2ZW4A 1IYKA 2FS5A 3VWEA 2EUIA 4FD4A 4JXRA 4XPKA 2ARHA 1J4JA 4NXYA 5H86A 2ZW5A 4MJ8A 2OZHA 3FNCA 5IX3A 2IL4A 3F0AA 1S5KA 4YGOA 4CRYB 1B6BA 1KUYA 1S7FA 3D3SA 1VKCA 4JWPA 5DWNA 4KUBA 3QB8A 4MI4A 3LD2A 3BLNA 3ZZIA 3VWDA 2VZYA 2DXQA 4MY3A 3KKWA 2B4BA 5C88A 1QSRA 1QSOA 3F8KA 1Z9UA 3TCVA 4HNWB 3TTHA 4U9ZA 2A4NA 4MHDA 4KOYA 3UY5A 2Z10A 3G3SA 5EC4A 3JVNA 3R96A 2PSWA 1KUVA 4KOUA 1I12A 4H6UA 2PRBA 3GYAA 4HNXB 3RYOA 2B5GA 2FL4A 3S6HA 1M4IA 4J3GA 3G8WA 4QUSA 4CS0B 4M3SA 1OZPA 1I21A 4KOVA 4QC6A 4KLWA 2B4DA 2FSRA 3R9FA 2FCKA 2J8RA 4QBJA 4KLVA 1IICA 2PDOA 1XE4A 1CJWA 2QMLA 3TO6A 2PC1A 1QSTA 4JXQA 3FBUA 5J8FA 2B3VA 5HH1A 3ZJ0A 3BJ8A 4HKFA 3R95A 1MJBA 4KVXA 5DWMA 3B8GA 4B5PB 3CXPA 2BL1A 2CNMA 3TO9A 3QAHA 2R7HA 3S6FA 4DNCA 1MJAA 1QSNA 3D2MA 1U6MA 2NMTA 4K30A 2G0BA 4LX9A 1MK4A 5IV0A 2RC4A 3S6KA 2F5IA 4KOSA 4PSXA 4R3LA 1M4GA 4Y49C 1Z4EA 1UFHA 2PR1A 1MJ9A 2JLMA 2OU2A 1M44A 4KZTA 1Y7RA 2REEA 4R57A 4U9YA 4XNHC 4EVYA 4U5YA 1XIXA 5I0CA 1PU9A 3BJ7A 1R57A 1YVKA 2CY2A 3I9SA 2VBQA 5KTDA 3C26A 2O28A 4CRZB 4XPDC 3W91A 1YLEA 3CXQA
chains in the Genus database with same CATH superfamily
1Z8TA 5JQ4A 2H5MA 2Q4YA 3EXNA 1XOVA 4OC4A 3D7GA 4ZGYB 4C68A 4L8AA 2Z3KA 2Q7SA 2VQYA 1XEBA 2VEZA 4R3KA 5JM6A 3DNSA 3T8WA 3TT2A 1UWYA 5LYLA 3WR7A 2O53A 3I1UA 2PJ8A 2AFOA 2DEAA 2PJ5A 3FVLA 3JTKA 3PRTA 2PJ9A 3NE8A 4MY0A 3RBUA 4AVAA 1ZG9A 3SHPA 5J8CA 4NGTA 3P2HA 1V0CA 1TF9A 1ZG8A 5K8MA 4WJBA 5HVFA 2PVVA 3L2NA 4A30A 4GXHA 5GCNA 3NE7A 1XMTA 4OKOA 2P6EA 2GLFA 4ZBGA 4Q36A 1AUGA 4P4EA 4NEXA 4H2KA 5J1QA 2QIRA 1B87A 3TOBA 1ZLHA 4MCRA 2CNTA 3CZXA 4JYWA 2AFWA 2QJ8A 3T90A 3FIXA 3LODA 3FMCA 5D29A 3TX8A 2XEJA 3PFOA 5HVGA 4FD6A 5F49A 1M4DA 4R7MA 3I3GA 5A27A 3RAMA 2PJ7A 1ZLIA 2PCUA 4F9UA 3B3TA 4MFQA 4X2TA 2GU2A 4UIBA 4P10A 4E0AA 5CPAA 1LRZA 3D4UA 1VHOA 1VGYA 4PK3A 4YRHA 1JQGA 4I49A 2J8MA 3GUXA 4NF1A 4A31A 1XBUA 5IB0A 4R8FA 2ATRA 2ZELA 2CTBA 1IIDA 1TXRA 5EBVA 3WC5A 2BUEA 3D7HA 5E96A 3B35A 4F9VA 3VATA 2JBJA 3SJFA 1QSMA 2OZUA 3H8EA 4MHNA 1PCAA 2HV2A 3WT4A 4LQGA 2OZGA 2WPWA 2YNCA 2GE3A 1QMUA 3GY9A 5KTCA 3VH9A 1LANA 1CX8A 4FD7A 2Q44A 3JUWA 1X12A 4AVCA 3TFYA 2XEIA 2EO8A 4B5PA 1CP6A 3LMSA 2I79A 4A38A 4CAWA 2PJBA 4UEFA 1S7NA 4MMOA 4II9A 1Y7EA 3TE4A 4PK2A 4KVME 2BSWA 3F5BA 1Z8LA 4R76A 3DDDA 1GYTA 2PQ8A 2CNSA 2KCWA 3PFEA 4IHMA 4MHZA 4UA3A 3T9YA 4A32A 4CGOA 4DUKA 4E2AA 4MFLA 2AJ6A 3CT9A 4B10A 4B6ZA 2GANA 1ELMP 3BI1A 2Z3MA 3EY5A 2YNCC 1TKJA 2REFA 4AG9A 2EK8A 4CGPA 4P6YA 3TOAA 2FT0A 3RO0A 1Z4RA 2D4OA 2YGWA 3PP9A 4MHPA 3D68A 3PB9X 5AG6A 3SJXA 1IOFA 2HQYA 1YW4A 4HPSA 2R1IA 2B4DB 4XPLA 4HNYB 5G1ZA 4ZY0A 3H4QA 2CTCA 3N5FA 4MFPA 4P4DA 3R9EA 2F8HA 1AYEA 4UCNA 1Q2YA 2R98A 3KASA 4FUUA 3RNZA 5HMNA 4AVBA 1F57A 3FX6A 4CPAA 2PVWA 3NH5A 3V7ZA 2FXFA 3B3CA 2AE6A 3DGVA 1CBXA 1YK3A 2C6PA 2PIZA 3BI0A 3K9TA 4K3NA 3IJ3A 3PB8X 1L0CA 1S7KA 2AFMA 5G22A 1Q2DA 7CPAA 2NSMA 2B3UA 1IY7A 4A2ZA 4B11A 2ABZA 1JWQA 4OP4A 2JDDA 4C2ZA 4KORA 1NMTA 3IWGA 4OC3A 2Z0ZA 4UFXA 3OWCA 4UWJA 4X3RA 3DR8A 1QQ9A 4KOTA 4JZ0A 2Z3NA 8CPAA 4GS4A 4FAIA 4CAXA 5BWAB 2VI7A 1IYLA 4IF5A 5F47A 3D7FA 1N71A 1K4JA 3FECA 3NFZA 2JEVA 3S9MA 3FJUA 3K9UA 2C6GA 2EVNA 3EFAA 2GLJA 3IWWA 4UIAA 1YMEA 2HC9A 2VXKA 3N7ZA 4P44A 4P4JA 2D4PA 2V8GA 1ON0A 2BEIA 1P4NA 3PB6X 4UBRA 3IGRA 3W6XA 2EBJA 1VIXA 1S3ZA 2NYQA 3E0KA 3FXTA 4KUAA 1M1DA 3KI9A 4Q7AA 4XPDB 5FVJA 3FRMA 3FH4A 1ZO0A 4QB9A 2QVPA 3KGQA 1ZG7A 5CNPA 1NE9A 4OC5A 5AG4A 2EK9A 4KS9A 4LQ6A 4UEZA 5D8NA 1H8LA 2OOTA 2CF4A 3GIUA 1TIQA 3DSBA 4OC1A 4AG7A 4RI1A 2Z11A 4JJXA 4RS2A 4NSQA 2WPXA 2XEFA 4MBUA 3D2PA 3R9GA 5C82A 4B13A 2J8NA 2VZZA 4ONUA 5F46A 2G3AA 5HVHA 4UFVA 3PB7X 3PB4X 1IB1E 2FIWA 1GHEA 2ZEHA 4KOWA 4JLYA 1RXTA 2BCOA 2RFHA 3CXSA 2AFZA 1Y0YA 3TO7A 3NH4A 2C6CA 3WC6A 1NSLA 4F0YA 1NSAA 4ONWA 2ZW6A 1VHSA 4F6AA 5AG5A 1HDUA 4ORFA 4YWYA 3HLPA 4NGPA 3EO4A 2AFSA 3P2FA 4CYQA 5ISVA 3BXMA 1KWMA 2EWBA 1F2OA 1Z8WA 1ELLP 4MFKA 4MCPA 3KZWA 2WYRA 1I1DA 1ARLA 3PGPA 1FY7A 5HXDA 2C27A 2DF5A 1XF8A 3WC7A 1Y9WA 4JD6A 2P6GA 4X5KA 4PV6A 2Y0MA 2ZOGA 4ZY1A 4AXVA 2OB0A 2Q4VA 4A37A 3SJGA 1OBRA 4LUAA 4OAEA 1YSJA 1Z2LA 3SXNA 4EMEA 4BBHA 2P0WA 1HEEA 2ZEMA 4MCQA 2P6FA 3SJEA 2G3TA 3PZJA 3V38A 4B5OA 1DE4C 2QECA 2B58A 1LOKA 2PJAA 1F2PA 2PE3A 3FYNA 4YFJA 3SXOA 4ZI6A 2R8VA 4F8ZA 4PSWA 1XFOA 4P4IA 1YVOA 1SQHA 1YR0A 2Q4ZA 4L89A 4CAVA 3WABA 2B5GB 4FBEA 3DR6A 2IQ6A 5G21A 4NGSA 2CXAA 2Q04A 3H8GA 3W6SA 3EC4A 4FD5A 2PJCA 4NJRA 2Q51A 2QYVA 1P0HA 4KVOE 2I00A 4QVTA 3NH8A 1LFWA 1BO4A 2X7BA 1S60A 3A9LA 4KOXA 3FF3A 2K5TA 4OIDA 5F48A 2Q0YA 3KR5A 2JDCA 2OH1A 2FE7A 3KQZA 3IFEA 4H89A 5JPHA 2GIVA 2Z3LA 4E8OA 4OIWA 4CGMA 1YGHA 1FT7A 1WK4A 5DS0A 2ZW7A 1PUAA 2FVGA 2ZXVA 2PR8A 3FEDA 3IU2A 4NJQA 1RO5A 4R87A 4BMHA 1TF8A 4A95A 3GKRA 3IU1A 2Q7BA 1YREA 4AB7A 4NGQA 2HUZA 2GREA 4H6ZA 4M6GA 2ANPA 3V8IA 3MGDA 3IEHA 4R9MA 3H8FA 4X8IA 3S9NA 4PXBA 4IUSA 4OADA 3R1KA 1KUXA 3HUVA 2V77A 2ZEDA 2DPSA 2GFQA 4Y49B 1YLOA 3PEIA 1BOBA 1CM0A 1YX0A 5H84A 4A33A 5LRKA 4NCZA 1Q2CA 3SI0A 1PYTB 3D8PA 4OLLA 4UWIA 3S6GA 2V8VA 4CYOA 4CYNA 2JEWA 4MFZA 1IU8A 3FB3A 3D67A 1WWZA 1Y9KA 4M85A 1S7LA 1XRYA 4Z65A 2C1CA 2PJ4A 2FIAA 1KZFA 2V8HA 3B3VA 3KL9A 1XJOA 2O4HA 4XNHB 3D7DA 3SI2A 4WWVA 2ZPAA 4P4BA 4RN7A 1Q7LA 4A94A 5KTAA 2ZW4A 1IYKA 2FS5A 2PJ1A 3VWEA 2EUIA 2ZEFA 1TKHA 4PXCA 1X10A 4FD4A 4JXRA 3B3WA 2ARHA 2ZENA 4TNUA 4XPKA 4Q38A 4UFWA 1DTDA 1J4JA 4TWEA 4NXYA 5H86A 2CIJA 2ZW5A 1A2ZA 4A39A 1Z5RA 4C2XA 4MJ8A 2OZHA 1EE3P 3FNCA 4YU9A 5IX3A 4KSIA 3BHXA 2I3CA 2IL4A 2ZOFA 3B7IA 3F0AA 3CPXA 1S5KA 4YGOA 5JGFA 4CRYB 2PJ0A 2F7VA 1CG2A 1B6BA 4OC0A 5K8NA 4UEEA 1IOIA 1KUYA 1S7FA 3D3SA 3KHXA 1VKCA 4JWPA 4O23A 5DWNA 4CGLA 4MRIA 2J9AA 1ARMA 2PJ6A 3H5ZA 4KUBA 4BINA 2ZEEA 4CAFA 3FEEA 4ZY2A 3QB8A 4EFDA 4MI4A 3LD2A 2HB6A 2AFXA 4MCSA 3BLNA 3KR4A 3ZZIA 3K2KA 3VWDA 4DYOA 3S9LA 2VZYA 2DXQA 1LAMA 4MY3A 3KKWA 2POKA 5LRJA 3MRUA 2B4BA 5C88A 5THWA 4P4FA 1QSRA 4IK2A 4KSFA 2ZEGA 1QSOA 3F8KA 4KSAA 4UF4A 1Z9UA 3TCVA 4P45A 4HNWB 1BPMA 4CYPA 2IMOA 4CGNA 3TTHA 4U9ZA 2A4NA 4MHDA 2WUUA 4KOYA 4ZX8A 2PRQA 3UY5A 4CAEA 2Z10A 3G3SA 1YQEA 5EC4A 3SI1A 3JVNA 4G1PA 3R96A 2PSWA 1KUVA 2Q43A 1I12A 4KOUA 4NGNA 4H6UA 5EMIA 1IGBA 2PRBA 3GYAA 4HNXB 2Z3PA 2B5GA 4W9YA 2FL4A 3RYOA 3S6HA 4ZX9A 1M4IA 4J3GA 2AFUA 5LYDA 5CBMA 3G8WA 4QUSA 4PPZA 1LCPA 4M3SA 4CS0B 3PBEA 1OZPA 1I21A 4KOVA 4PXDA 1BPNA 4C2YA 4F0XA 4M6IA 4QC6A 1CP7A 3IIBA 4KLWA 3QNVA 2B4DA 2FSRA 3B3SA 3R9FA 1HDQA 1R3NA 2FCKA 2RB7A 2J8RA 2YNEA 4QBJA 3B2YA 4KLVA 1IICA 2PDOA 1XE4A 1CJWA 4PQAA 2QMLA 3TO6A 2PC1A 4GM5A 1QSTA 1RTQA 5ELYA 2WSAA 2PIYA 3LWUA 1BAVA 3FBUA 4JXQA 4NFRA 2B3VA 5HH1A 5J8FA 1R43A 3ZJ0A 5F09A 5LYFA 3BJ8A 4HKFA 3CPAA 3KQXA 4RUHA 3GB0A 3R95A 2PJ3A 1M4LA 1CPSA 3PBBA 5K8OA 3IO1A 2ODFA 1MJBA 1XMBA 4KVXA 1VHEA 5DWMA 3B8GA 4B12A 4NGRA 2IJZA 4MFJA 2YNDA 1CPXA 4B5PB 3CXPA 5I4MA 2BL1A 2CNMA 3TO9A 3QAHA 2R7HA 4FWUA 3S6FA 3KHZA 4DNCA 4EWTA 1MJAA 1QSNA 3TC8A 1AMPA 3D2MA 1U6MA 3DLJA 2NMTA 4K30A 2G0BA 5G20A 1MK4A 4LX9A 4B14A 4NGMA 4BD9A 4IAVA 4MHYA 4MXUA 2RC4A 5IV0A 3S6KA 4OC2A 2F5IA 3D66A 4KOSA 4OMEA 4PSXA 1Z8XA 6CPAA 3NA6A 4C7IA 2XEGA 3JRUA 4PXEA 4R3LA 3RZAA 3QAYA 1LAPA 1M4GA 4Y49C 1BLLE 1Z4EA 1UFHA 2PR1A 5K8PA 2JBKA 4UCPA 4ZYQA 1Y0RA 1MJ9A 2G9DA 2JLMA 2OR4A 2V8DA 2OU2A 1M44A 5AG7A 4KZTA 5IB9A 1Y7RA 2REEA 4R57A 2DPTA 4U9YA 5JH9A 4UCMA 4R6TA 4XNHC 5AGEA 4C7HA 4EVYA 3IC1A 3VARA 4U5YA 2ZEPA 1XIXA 5LRGA 5I0CA 1PU9A 2PJ2A 2Z3OA 5LYIA 3BJ7A 1R57A 1YVKA 3ISXA 2CY2A 3I9SA 2WZNA 5A28A 1YW6A 2VBQA 3LACA 5KTDA 4M6HA 3CDXA 3C26A 2O28A 2ZEOA 4XPDC 4CRZB 1TKFA 2BO9A 2BOAA 2VL1A 3GLJA 3IWEA 3W91A 4DJLA 1FNOA 1YLEA 3ISZA 3CXQA 3MN8A
chains in the Genus database with same CATH topology
5JQ4A 2H5MA 2Q4YA 3EXNA 4ZGYB 4C68A 4L8AA 2Z3KA 2VQYA 1XEBA 2VEZA 4R3KA 3DNSA 3TT2A 3WR7A 3JTKA 4AVAA 5J8CA 4MY0A 3SHPA 3P2HA 1V0CA 4A30A 5GCNA 3NE7A 1XMTA 2P6EA 4ZBGA 4Q36A 4NEXA 2QIRA 1B87A 3TOBA 2CNTA 3T90A 3FIXA 3LODA 4FD6A 5F49A 1M4DA 3I3GA 5A27A 4MFQA 4E0AA 1LRZA 4PK3A 4YRHA 4I49A 2J8MA 4NF1A 4A31A 5IB0A 2ATRA 1IIDA 5EBVA 2BUEA 5E96A 1QSMA 2OZUA 2HV2A 2OZGA 2WPWA 2YNCA 2GE3A 3GY9A 5KTCA 4AVCA 4FD7A 2Q44A 3JUWA 3TFYA 4B5PA 2I79A 4CAWA 1S7NA 4II9A 3TE4A 4PK2A 4KVME 2BSWA 3F5BA 3DDDA 4UA3A 2PQ8A 2CNSA 2KCWA 3T9YA 4A32A 4E2AA 4CGOA 4MFLA 2AJ6A 4B10A 2GANA 3EY5A 2Z3MA 2YNCC 2REFA 4AG9A 4CGPA 3TOAA 2FT0A 1Z4RA 2D4OA 2YGWA 3PP9A 5AG6A 2HQYA 2R1IA 2B4DB 4XPLA 4HNYB 5G1ZA 3H4QA 4MFPA 3R9EA 4UCNA 1Q2YA 2R98A 5HMNA 4AVBA 2FXFA 2AE6A 1YK3A 1L0CA 1S7KA 5G22A 1Q2DA 2B3UA 4A2ZA 4B11A 4C2ZA 2JDDA 4KORA 1NMTA 3IWGA 2Z0ZA 4UFXA 3OWCA 4UWJA 3DR8A 4KOTA 2Z3NA 4GS4A 4CAXA 5BWAB 2VI7A 1IYLA 4IF5A 5F47A 1N71A 1K4JA 2JEVA 3K9UA 2EVNA 3EFAA 2VXKA 3N7ZA 2D4PA 1ON0A 2BEIA 1P4NA 4UBRA 3IGRA 3W6XA 1S3ZA 3E0KA 3FXTA 4KUAA 1M1DA 4XPDB 5FVJA 3FRMA 1ZO0A 4QB9A 5CNPA 1NE9A 5AG4A 4KS9A 1TIQA 3DSBA 4AG7A 4RI1A 2Z11A 4JJXA 4RS2A 4NSQA 2WPXA 4MBUA 3D2PA 3R9GA 5C82A 4B13A 2J8NA 2VZZA 4ONUA 5F46A 2G3AA 4UFVA 1IB1E 2FIWA 1GHEA 4KOWA 4JLYA 1RXTA 3CXSA 3TO7A 4F0YA 1NSLA 2ZW6A 1VHSA 4F6AA 5AG5A 4ORFA 3EO4A 3P2FA 4CYQA 5ISVA 4MFKA 1I1DA 3PGPA 1FY7A 2C27A 1XF8A 1Y9WA 4JD6A 2P6GA 4X5KA 4PV6A 2Y0MA 2OB0A 2Q4VA 4LUAA 4OAEA 3SXNA 4BBHA 2P0WA 2P6FA 2G3TA 3PZJA 4B5OA 2QECA 2B58A 3FYNA 4YFJA 3SXOA 2R8VA 4PSWA 1YVOA 1SQHA 1YR0A 4L89A 4CAVA 2B5GB 3DR6A 5G21A 2CXAA 2Q04A 3W6SA 3EC4A 4FD5A 1P0HA 4KVOE 2I00A 4QVTA 1BO4A 2X7BA 1S60A 3A9LA 4KOXA 2K5TA 5F48A 2Q0YA 2JDCA 2OH1A 2FE7A 4H89A 5JPHA 2GIVA 2Z3LA 4E8OA 4CGMA 1YGHA 1WK4A 2ZW7A 1PUAA 2ZXVA 2PR8A 3IU2A 4R87A 1RO5A 4BMHA 4A95A 3GKRA 3IU1A 2Q7BA 1YREA 4AB7A 2HUZA 4H6ZA 3V8IA 3MGDA 4R9MA 4IUSA 4OADA 3R1KA 1KUXA 2DPSA 4Y49B 1BOBA 1CM0A 1YX0A 5H84A 4A33A 4NCZA 1Q2CA 3D8PA 4OLLA 4UWIA 3S6GA 4CYOA 4CYNA 4MFZA 3FB3A 1WWZA 1Y9KA 4M85A 1S7LA 2FIAA 1KZFA 4XNHB 2ZPAA 5KTAA 2ZW4A 1IYKA 2FS5A 3VWEA 2EUIA 4FD4A 4JXRA 4XPKA 2ARHA 4Q38A 4UFWA 1J4JA 4NXYA 5H86A 2ZW5A 4C2XA 4MJ8A 2OZHA 3FNCA 5IX3A 2IL4A 3F0AA 1S5KA 4YGOA 4CRYB 1B6BA 1KUYA 1S7FA 3D3SA 1VKCA 4JWPA 5DWNA 4CGLA 4CYPA 4KUBA 3H5ZA 4CAFA 3QB8A 4MI4A 3LD2A 3BLNA 3ZZIA 3VWDA 2VZYA 2DXQA 4MY3A 3KKWA 2B4BA 5C88A 1QSRA 4KSFA 1QSOA 3F8KA 4KSAA 1Z9UA 3TCVA 4HNWB 4CGNA 3TTHA 4U9ZA 2A4NA 4MHDA 2WUUA 4KOYA 3UY5A 4CAEA 2Z10A 3G3SA 5EC4A 3JVNA 3R96A 2PSWA 1KUVA 4KOUA 1I12A 4H6UA 2PRBA 3GYAA 4HNXB 2Z3PA 2B5GA 3RYOA 2FL4A 3S6HA 1M4IA 4J3GA 3G8WA 4QUSA 4CS0B 4M3SA 1OZPA 1I21A 4KOVA 4F0XA 4C2YA 4QC6A 4KLWA 2B4DA 2FSRA 3R9FA 2FCKA 2J8RA 2YNEA 4QBJA 4KLVA 1IICA 2PDOA 1XE4A 1CJWA 2QMLA 3TO6A 2PC1A 1QSTA 2WSAA 4JXQA 3FBUA 5J8FA 2B3VA 5HH1A 3ZJ0A 3BJ8A 4HKFA 3R95A 1MJBA 4KVXA 5DWMA 3B8GA 4B12A 4MFJA 2YNDA 4B5PB 3CXPA 2BL1A 2CNMA 3TO9A 3QAHA 2R7HA 3S6FA 4DNCA 1MJAA 1QSNA 3D2MA 1U6MA 2NMTA 4K30A 2G0BA 5G20A 1MK4A 4LX9A 4B14A 5IV0A 2RC4A 3S6KA 2F5IA 4KOSA 4PSXA 4C7IA 4R3LA 1M4GA 4Y49C 1Z4EA 1UFHA 2PR1A 4UCPA 1MJ9A 2JLMA 2OU2A 1M44A 5AG7A 4KZTA 1Y7RA 2REEA 4R57A 2DPTA 4U9YA 4UCMA 4XNHC 5AGEA 4C7HA 4EVYA 4U5YA 1XIXA 5I0CA 1PU9A 2Z3OA 3BJ7A 1R57A 1YVKA 2CY2A 3I9SA 5A28A 2VBQA 5KTDA 3C26A 2O28A 4CRZB 4XPDC 3IWEA 3W91A 1YLEA 3CXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JQ4 A;  2H5M A;  2Q4Y A;  3EXN A;  4L8A A;  2VQY A;  1XEB A;  2VEZ A;  4R3K A;  3DNS A;  3TT2 A;  3WR7 A;  4AVA A;  5J8C A;  4MY0 A;  3SHP A;  3P2H A;  1V0C A;  5GCN A;  3NE7 A;  1XMT A;  2P6E A;  4ZBG A;  4NEX A;  2QIR A;  1B87 A;  3TOB A;  2CNT A;  3T90 A;  3FIX A;  3LOD A;  4FD6 A;  5F49 A;  1M4D A;  3I3G A;  4E0A A;  1LRZ A;  4PK3 A;  4YRH A;  4I49 A;  2J8M A;  4NF1 A;  5IB0 A;  2ATR A;  1IID A;  5EBV A;  2BUE A;  5E96 A;  1QSM A;  2OZU A;  2HV2 A;  2OZG A;  2WPW A;  3GY9 A;  2GE3 A;  5KTC A;  4AVC A;  4FD7 A;  2Q44 A;  3JUW A;  3TFY A;  4B5P A;  2I79 A;  4CAW A;  1S7N A;  4II9 A;  3TE4 A;  4PK2 A;  4KVM E;  2BSW A;  3F5B A;  3DDD A;  4UA3 A;  2PQ8 A;  2CNS A;  2KCW A;  3T9Y A;  4E2A A;  2AJ6 A;  2GAN A;  3EY5 A;  2REF A;  4AG9 A;  3TOA A;  2FT0 A;  1Z4R A;  2D4O A;  3PP9 A;  2HQY A;  2R1I A;  2B4D B;  4XPL A;  4HNY B;  3H4Q A;  3R9E A;  1Q2Y A;  2R98 A;  5HMN A;  4AVB A;  2FXF A;  2AE6 A;  1YK3 A;  1L0C A;  1S7K A;  1Q2D A;  2B3U A;  2JDD A;  4KOR A;  1NMT A;  3IWG A;  2Z0Z A;  3OWC A;  4UWJ A;  3DR8 A;  4KOT A;  4GS4 A;  4CAX A;  2VI7 A;  1IYL A;  4IF5 A;  5F47 A;  1N71 A;  1K4J A;  2JEV A;  3K9U A;  2EVN A;  3EFA A;  2VXK A;  3N7Z A;  2D4P A;  1ON0 A;  2BEI A;  1P4N A;  4UBR A;  3IGR A;  3W6X A;  1S3Z A;  3E0K A;  3FXT A;  4KUA A;  1M1D A;  4XPD B;  5FVJ A;  3FRM A;  4QB9 A;  5CNP A;  1NE9 A;  1TIQ A;  3DSB A;  4AG7 A;  4RI1 A;  2Z11 A;  4JJX A;  4RS2 A;  4NSQ A;  2WPX A;  4MBU A;  3D2P A;  3R9G A;  5C82 A;  2J8N A;  2VZZ A;  4ONU A;  5F46 A;  2G3A A;  1IB1 E;  2FIW A;  1GHE A;  4KOW A;  4JLY A;  1RXT A;  3CXS A;  3TO7 A;  4F0Y A;  1NSL A;  2ZW6 A;  1VHS A;  4F6A A;  4ORF A;  3EO4 A;  3P2F A;  5ISV A;  1I1D A;  3PGP A;  1FY7 A;  2C27 A;  1XF8 A;  1Y9W A;  4JD6 A;  2P6G A;  4X5K A;  4PV6 A;  2Y0M A;  2OB0 A;  2Q4V A;  4LUA A;  4OAE A;  3SXN A;  2P0W A;  2P6F A;  2G3T A;  3PZJ A;  4B5O A;  2QEC A;  2B58 A;  3FYN A;  4YFJ A;  3SXO A;  2R8V A;  4PSW A;  1YVO A;  1SQH A;  1YR0 A;  4L89 A;  4CAV A;  2B5G B;  3DR6 A;  2Q04 A;  3W6S A;  3EC4 A;  4FD5 A;  1P0H A;  4KVO E;  2I00 A;  4QVT A;  1BO4 A;  2X7B A;  1S60 A;  4KOX A;  2K5T A;  5F48 A;  2Q0Y A;  2JDC A;  2OH1 A;  2FE7 A;  4H89 A;  5JPH A;  2GIV A;  4E8O A;  1YGH A;  1WK4 A;  2ZW7 A;  1PUA A;  2ZXV A;  2PR8 A;  4R87 A;  1RO5 A;  4BMH A;  3GKR A;  2Q7B A;  1YRE A;  4AB7 A;  2HUZ A;  4H6Z A;  3V8I A;  3MGD A;  4R9M A;  4IUS A;  4OAD A;  3R1K A;  1KUX A;  4Y49 B;  1BOB A;  1CM0 A;  1YX0 A;  5H84 A;  4NCZ A;  1Q2C A;  3D8P A;  4OLL A;  4UWI A;  3S6G A;  3FB3 A;  1WWZ A;  1Y9K A;  4M85 A;  1S7L A;  2FIA A;  1KZF A;  4XNH B;  2ZPA A;  5KTA A;  2ZW4 A;  1IYK A;  2FS5 A;  3VWE A;  2EUI A;  4FD4 A;  4JXR A;  4XPK A;  2ARH A;  1J4J A;  4NXY A;  5H86 A;  2ZW5 A;  4MJ8 A;  2OZH A;  3FNC A;  5IX3 A;  2IL4 A;  3F0A A;  1S5K A;  4YGO A;  4CRY B;  1B6B A;  1KUY A;  1S7F A;  3D3S A;  1VKC A;  4JWP A;  5DWN A;  4KUB A;  3QB8 A;  4MI4 A;  3LD2 A;  3BLN A;  3ZZI A;  3VWD A;  2VZY A;  2DXQ A;  4MY3 A;  3KKW A;  2B4B A;  5C88 A;  1QSR A;  1QSO A;  3F8K A;  1Z9U A;  3TCV A;  4HNW B;  3TTH A;  4U9Z A;  2A4N A;  4MHD A;  4KOY A;  3UY5 A;  2Z10 A;  3G3S A;  5EC4 A;  3JVN A;  3R96 A;  2PSW A;  1KUV A;  4KOU A;  1I12 A;  4H6U A;  2PRB A;  3GYA A;  4HNX B;  3RYO A;  2B5G A;  2FL4 A;  3S6H A;  1M4I A;  4J3G A;  3G8W A;  4QUS A;  4CS0 B;  4M3S A;  1OZP A;  1I21 A;  4KOV A;  4QC6 A;  4KLW A;  2B4D A;  2FSR A;  3R9F A;  2FCK A;  2J8R A;  4QBJ A;  4KLV A;  1IIC A;  2PDO A;  1XE4 A;  1CJW A;  2QML A;  3TO6 A;  2PC1 A;  1QST A;  4JXQ A;  3FBU A;  5J8F A;  2B3V A;  5HH1 A;  3ZJ0 A;  3BJ8 A;  4HKF A;  3R95 A;  1MJB A;  4KVX A;  5DWM A;  3B8G A;  4B5P B;  3CXP A;  2BL1 A;  2CNM A;  3TO9 A;  3QAH A;  2R7H A;  3S6F A;  4DNC A;  1MJA A;  1QSN A;  3D2M A;  1U6M A;  2NMT A;  4K30 A;  2G0B A;  4LX9 A;  1MK4 A;  5IV0 A;  2RC4 A;  3S6K A;  2F5I A;  4KOS A;  4PSX A;  4R3L A;  1M4G A;  4Y49 C;  1Z4E A;  1UFH A;  2PR1 A;  1MJ9 A;  2JLM A;  2OU2 A;  1M44 A;  4KZT A;  1Y7R A;  2REE A;  4R57 A;  4U9Y A;  4XNH C;  4EVY A;  4U5Y A;  1XIX A;  5I0C A;  1PU9 A;  3BJ7 A;  1R57 A;  1YVK A;  2CY2 A;  3I9S A;  2VBQ A;  5KTD A;  3C26 A;  2O28 A;  4CRZ B;  4XPD C;  3W91 A;  1YLE A;  3CXQ A; 
#chains in the Genus database with same CATH topology
 1Z8T A;  5JQ4 A;  2H5M A;  2Q4Y A;  3EXN A;  1XOV A;  4OC4 A;  3D7G A;  4ZGY B;  4C68 A;  4L8A A;  2Z3K A;  2Q7S A;  2VQY A;  1XEB A;  2VEZ A;  4R3K A;  5JM6 A;  3DNS A;  3T8W A;  3TT2 A;  1UWY A;  5LYL A;  3WR7 A;  2O53 A;  3I1U A;  2PJ8 A;  2AFO A;  2DEA A;  2PJ5 A;  3FVL A;  3JTK A;  3PRT A;  2PJ9 A;  3NE8 A;  4MY0 A;  3RBU A;  4AVA A;  1ZG9 A;  3SHP A;  5J8C A;  4NGT A;  3P2H A;  1V0C A;  1TF9 A;  1ZG8 A;  5K8M A;  4WJB A;  5HVF A;  2PVV A;  3L2N A;  4A30 A;  4GXH A;  5GCN A;  3NE7 A;  1XMT A;  4OKO A;  2P6E A;  2GLF A;  4ZBG A;  4Q36 A;  1AUG A;  4P4E A;  4NEX A;  4H2K A;  5J1Q A;  2QIR A;  1B87 A;  3TOB A;  1ZLH A;  4MCR A;  2CNT A;  3CZX A;  4JYW A;  2AFW A;  2QJ8 A;  3T90 A;  3FIX A;  3LOD A;  3FMC A;  5D29 A;  3TX8 A;  2XEJ A;  3PFO A;  5HVG A;  4FD6 A;  5F49 A;  1M4D A;  4R7M A;  3I3G A;  5A27 A;  3RAM A;  2PJ7 A;  1ZLI A;  2PCU A;  4F9U A;  3B3T A;  4MFQ A;  4X2T A;  2GU2 A;  4UIB A;  4P10 A;  4E0A A;  5CPA A;  1LRZ A;  3D4U A;  1VHO A;  1VGY A;  4PK3 A;  4YRH A;  1JQG A;  4I49 A;  2J8M A;  3GUX A;  4NF1 A;  4A31 A;  1XBU A;  5IB0 A;  4R8F A;  2ATR A;  2ZEL A;  2CTB A;  1IID A;  1TXR A;  5EBV A;  3WC5 A;  2BUE A;  3D7H A;  5E96 A;  3B35 A;  4F9V A;  3VAT A;  2JBJ A;  3SJF A;  1QSM A;  2OZU A;  3H8E A;  4MHN A;  1PCA A;  2HV2 A;  3WT4 A;  4LQG A;  2OZG A;  2WPW A;  2YNC A;  2GE3 A;  1QMU A;  3GY9 A;  5KTC A;  3VH9 A;  1LAN A;  1CX8 A;  4FD7 A;  2Q44 A;  3JUW A;  1X12 A;  4AVC A;  3TFY A;  2XEI A;  2EO8 A;  4B5P A;  1CP6 A;  3LMS A;  2I79 A;  4A38 A;  4CAW A;  2PJB A;  4UEF A;  1S7N A;  4MMO A;  4II9 A;  1Y7E A;  3TE4 A;  4PK2 A;  4KVM E;  2BSW A;  3F5B A;  1Z8L A;  4R76 A;  3DDD A;  1GYT A;  2PQ8 A;  2CNS A;  2KCW A;  3PFE A;  4IHM A;  4MHZ A;  4UA3 A;  3T9Y A;  4A32 A;  4CGO A;  4DUK A;  4E2A A;  4MFL A;  2AJ6 A;  3CT9 A;  4B10 A;  4B6Z A;  2GAN A;  1ELM P;  3BI1 A;  2Z3M A;  3EY5 A;  2YNC C;  1TKJ A;  2REF A;  4AG9 A;  2EK8 A;  4CGP A;  4P6Y A;  3TOA A;  2FT0 A;  3RO0 A;  1Z4R A;  2D4O A;  2YGW A;  3PP9 A;  4MHP A;  3D68 A;  3PB9 X;  5AG6 A;  3SJX A;  1IOF A;  2HQY A;  1YW4 A;  4HPS A;  2R1I A;  2B4D B;  4XPL A;  4HNY B;  5G1Z A;  4ZY0 A;  3H4Q A;  2CTC A;  3N5F A;  4MFP A;  4P4D A;  3R9E A;  2F8H A;  1AYE A;  4UCN A;  1Q2Y A;  2R98 A;  3KAS A;  4FUU A;  3RNZ A;  5HMN A;  4AVB A;  1F57 A;  3FX6 A;  4CPA A;  2PVW A;  3NH5 A;  3V7Z A;  2FXF A;  3B3C A;  2AE6 A;  3DGV A;  1CBX A;  1YK3 A;  2C6P A;  2PIZ A;  3BI0 A;  3K9T A;  4K3N A;  3IJ3 A;  3PB8 X;  1L0C A;  1S7K A;  2AFM A;  5G22 A;  1Q2D A;  7CPA A;  2NSM A;  2B3U A;  1IY7 A;  4A2Z A;  4B11 A;  2ABZ A;  1JWQ A;  4OP4 A;  2JDD A;  4C2Z A;  4KOR A;  1NMT A;  3IWG A;  4OC3 A;  2Z0Z A;  4UFX A;  3OWC A;  4UWJ A;  4X3R A;  3DR8 A;  1QQ9 A;  4KOT A;  4JZ0 A;  2Z3N A;  8CPA A;  4GS4 A;  4FAI A;  4CAX A;  5BWA B;  2VI7 A;  1IYL A;  4IF5 A;  5F47 A;  3D7F A;  1N71 A;  1K4J A;  3FEC A;  3NFZ A;  2JEV A;  3S9M A;  3FJU A;  3K9U A;  2C6G A;  2EVN A;  3EFA A;  2GLJ A;  3IWW A;  4UIA A;  1YME A;  2HC9 A;  2VXK A;  3N7Z A;  4P44 A;  4P4J A;  2D4P A;  2V8G A;  1ON0 A;  2BEI A;  1P4N A;  3PB6 X;  4UBR A;  3IGR A;  3W6X A;  2EBJ A;  1VIX A;  1S3Z A;  2NYQ A;  3E0K A;  3FXT A;  4KUA A;  1M1D A;  3KI9 A;  4Q7A A;  4XPD B;  5FVJ A;  3FRM A;  3FH4 A;  1ZO0 A;  4QB9 A;  2QVP A;  3KGQ A;  1ZG7 A;  5CNP A;  1NE9 A;  4OC5 A;  5AG4 A;  2EK9 A;  4KS9 A;  4LQ6 A;  4UEZ A;  5D8N A;  1H8L A;  2OOT A;  2CF4 A;  3GIU A;  1TIQ A;  3DSB A;  4OC1 A;  4AG7 A;  4RI1 A;  2Z11 A;  4JJX A;  4RS2 A;  4NSQ A;  2WPX A;  2XEF A;  4MBU A;  3D2P A;  3R9G A;  5C82 A;  4B13 A;  2J8N A;  2VZZ A;  4ONU A;  5F46 A;  2G3A A;  5HVH A;  4UFV A;  3PB7 X;  3PB4 X;  1IB1 E;  2FIW A;  1GHE A;  2ZEH A;  4KOW A;  4JLY A;  1RXT A;  2BCO A;  2RFH A;  3CXS A;  2AFZ A;  1Y0Y A;  3TO7 A;  3NH4 A;  2C6C A;  3WC6 A;  1NSL A;  4F0Y A;  1NSA A;  4ONW A;  2ZW6 A;  1VHS A;  4F6A A;  5AG5 A;  1HDU A;  4ORF A;  4YWY A;  3HLP A;  4NGP A;  3EO4 A;  2AFS A;  3P2F A;  4CYQ A;  5ISV A;  3BXM A;  1KWM A;  2EWB A;  1F2O A;  1Z8W A;  1ELL P;  4MFK A;  4MCP A;  3KZW A;  2WYR A;  1I1D A;  1ARL A;  3PGP A;  1FY7 A;  5HXD A;  2C27 A;  2DF5 A;  1XF8 A;  3WC7 A;  1Y9W A;  4JD6 A;  2P6G A;  4X5K A;  4PV6 A;  2Y0M A;  2ZOG A;  4ZY1 A;  4AXV A;  2OB0 A;  2Q4V A;  4A37 A;  3SJG A;  1OBR A;  4LUA A;  4OAE A;  1YSJ A;  1Z2L A;  3SXN A;  4EME A;  4BBH A;  2P0W A;  1HEE A;  2ZEM A;  4MCQ A;  2P6F A;  3SJE A;  2G3T A;  3PZJ A;  3V38 A;  4B5O A;  1DE4 C;  2QEC A;  2B58 A;  1LOK A;  2PJA A;  1F2P A;  2PE3 A;  3FYN A;  4YFJ A;  3SXO A;  4ZI6 A;  2R8V A;  4F8Z A;  4PSW A;  1XFO A;  4P4I A;  1YVO A;  1SQH A;  1YR0 A;  2Q4Z A;  4L89 A;  4CAV A;  3WAB A;  2B5G B;  4FBE A;  3DR6 A;  2IQ6 A;  5G21 A;  4NGS A;  2CXA A;  2Q04 A;  3H8G A;  3W6S A;  3EC4 A;  4FD5 A;  2PJC A;  4NJR A;  2Q51 A;  2QYV A;  1P0H A;  4KVO E;  2I00 A;  4QVT A;  3NH8 A;  1LFW A;  1BO4 A;  2X7B A;  1S60 A;  3A9L A;  4KOX A;  3FF3 A;  2K5T A;  4OID A;  5F48 A;  2Q0Y A;  3KR5 A;  2JDC A;  2OH1 A;  2FE7 A;  3KQZ A;  3IFE A;  4H89 A;  5JPH A;  2GIV A;  2Z3L A;  4E8O A;  4OIW A;  4CGM A;  1YGH A;  1FT7 A;  1WK4 A;  5DS0 A;  2ZW7 A;  1PUA A;  2FVG A;  2ZXV A;  2PR8 A;  3FED A;  3IU2 A;  4NJQ A;  1RO5 A;  4R87 A;  4BMH A;  1TF8 A;  4A95 A;  3GKR A;  3IU1 A;  2Q7B A;  1YRE A;  4AB7 A;  4NGQ A;  2HUZ A;  2GRE A;  4H6Z A;  4M6G A;  2ANP A;  3V8I A;  3MGD A;  3IEH A;  4R9M A;  3H8F A;  4X8I A;  3S9N A;  4PXB A;  4IUS A;  4OAD A;  3R1K A;  1KUX A;  3HUV A;  2V77 A;  2ZED A;  2DPS A;  2GFQ A;  4Y49 B;  1YLO A;  3PEI A;  1BOB A;  1CM0 A;  1YX0 A;  5H84 A;  4A33 A;  5LRK A;  4NCZ A;  1Q2C A;  3SI0 A;  1PYT B;  3D8P A;  4OLL A;  4UWI A;  3S6G A;  2V8V A;  4CYO A;  4CYN A;  2JEW A;  4MFZ A;  1IU8 A;  3FB3 A;  3D67 A;  1WWZ A;  1Y9K A;  4M85 A;  1S7L A;  1XRY A;  4Z65 A;  2C1C A;  2PJ4 A;  2FIA A;  1KZF A;  2V8H A;  3B3V A;  3KL9 A;  1XJO A;  2O4H A;  4XNH B;  3D7D A;  3SI2 A;  4WWV A;  2ZPA A;  4P4B A;  4RN7 A;  1Q7L A;  4A94 A;  5KTA A;  2ZW4 A;  1IYK A;  2FS5 A;  2PJ1 A;  3VWE A;  2EUI A;  2ZEF A;  1TKH A;  4PXC A;  1X10 A;  4FD4 A;  4JXR A;  3B3W A;  2ARH A;  2ZEN A;  4TNU A;  4XPK A;  4Q38 A;  4UFW A;  1DTD A;  1J4J A;  4TWE A;  4NXY A;  5H86 A;  2CIJ A;  2ZW5 A;  1A2Z A;  4A39 A;  1Z5R A;  4C2X A;  4MJ8 A;  2OZH A;  1EE3 P;  3FNC A;  4YU9 A;  5IX3 A;  4KSI A;  3BHX A;  2I3C A;  2IL4 A;  2ZOF A;  3B7I A;  3F0A A;  3CPX A;  1S5K A;  4YGO A;  5JGF A;  4CRY B;  2PJ0 A;  2F7V A;  1CG2 A;  1B6B A;  4OC0 A;  5K8N A;  4UEE A;  1IOI A;  1KUY A;  1S7F A;  3D3S A;  3KHX A;  1VKC A;  4JWP A;  4O23 A;  5DWN A;  4CGL A;  4MRI A;  2J9A A;  1ARM A;  2PJ6 A;  3H5Z A;  4KUB A;  4BIN A;  2ZEE A;  4CAF A;  3FEE A;  4ZY2 A;  3QB8 A;  4EFD A;  4MI4 A;  3LD2 A;  2HB6 A;  2AFX A;  4MCS A;  3BLN A;  3KR4 A;  3ZZI A;  3K2K A;  3VWD A;  4DYO A;  3S9L A;  2VZY A;  2DXQ A;  1LAM A;  4MY3 A;  3KKW A;  2POK A;  5LRJ A;  3MRU A;  2B4B A;  5C88 A;  5THW A;  4P4F A;  1QSR A;  4IK2 A;  4KSF A;  2ZEG A;  1QSO A;  3F8K A;  4KSA A;  4UF4 A;  1Z9U A;  3TCV A;  4P45 A;  4HNW B;  1BPM A;  4CYP A;  2IMO A;  4CGN A;  3TTH A;  4U9Z A;  2A4N A;  4MHD A;  2WUU A;  4KOY A;  4ZX8 A;  2PRQ A;  3UY5 A;  4CAE A;  2Z10 A;  3G3S A;  1YQE A;  5EC4 A;  3SI1 A;  3JVN A;  4G1P A;  3R96 A;  2PSW A;  1KUV A;  2Q43 A;  1I12 A;  4KOU A;  4NGN A;  4H6U A;  5EMI A;  1IGB A;  2PRB A;  3GYA A;  4HNX B;  2Z3P A;  2B5G A;  4W9Y A;  2FL4 A;  3RYO A;  3S6H A;  4ZX9 A;  1M4I A;  4J3G A;  2AFU A;  5LYD A;  5CBM A;  3G8W A;  4QUS A;  4PPZ A;  1LCP A;  4M3S A;  4CS0 B;  3PBE A;  1OZP A;  1I21 A;  4KOV A;  4PXD A;  1BPN A;  4C2Y A;  4F0X A;  4M6I A;  4QC6 A;  1CP7 A;  3IIB A;  4KLW A;  3QNV A;  2B4D A;  2FSR A;  3B3S A;  3R9F A;  1HDQ A;  1R3N A;  2FCK A;  2RB7 A;  2J8R A;  2YNE A;  4QBJ A;  3B2Y A;  4KLV A;  1IIC A;  2PDO A;  1XE4 A;  1CJW A;  4PQA A;  2QML A;  3TO6 A;  2PC1 A;  4GM5 A;  1QST A;  1RTQ A;  5ELY A;  2WSA A;  2PIY A;  3LWU A;  1BAV A;  3FBU A;  4JXQ A;  4NFR A;  2B3V A;  5HH1 A;  5J8F A;  1R43 A;  3ZJ0 A;  5F09 A;  5LYF A;  3BJ8 A;  4HKF A;  3CPA A;  3KQX A;  4RUH A;  3GB0 A;  3R95 A;  2PJ3 A;  1M4L A;  1CPS A;  3PBB A;  5K8O A;  3IO1 A;  2ODF A;  1MJB A;  1XMB A;  4KVX A;  1VHE A;  5DWM A;  3B8G A;  4B12 A;  4NGR A;  2IJZ A;  4MFJ A;  2YND A;  1CPX A;  4B5P B;  3CXP A;  5I4M A;  2BL1 A;  2CNM A;  3TO9 A;  3QAH A;  2R7H A;  4FWU A;  3S6F A;  3KHZ A;  4DNC A;  4EWT A;  1MJA A;  1QSN A;  3TC8 A;  1AMP A;  3D2M A;  1U6M A;  3DLJ A;  2NMT A;  4K30 A;  2G0B A;  5G20 A;  1MK4 A;  4LX9 A;  4B14 A;  4NGM A;  4BD9 A;  4IAV A;  4MHY A;  4MXU A;  2RC4 A;  5IV0 A;  3S6K A;  4OC2 A;  2F5I A;  3D66 A;  4KOS A;  4OME A;  4PSX A;  1Z8X A;  6CPA A;  3NA6 A;  4C7I A;  2XEG A;  3JRU A;  4PXE A;  4R3L A;  3RZA A;  3QAY A;  1LAP A;  1M4G A;  4Y49 C;  1BLL E;  1Z4E A;  1UFH A;  2PR1 A;  5K8P A;  2JBK A;  4UCP A;  4ZYQ A;  1Y0R A;  1MJ9 A;  2G9D A;  2JLM A;  2OR4 A;  2V8D A;  2OU2 A;  1M44 A;  5AG7 A;  4KZT A;  5IB9 A;  1Y7R A;  2REE A;  4R57 A;  2DPT A;  4U9Y A;  5JH9 A;  4UCM A;  4R6T A;  4XNH C;  5AGE A;  4C7H A;  4EVY A;  3IC1 A;  3VAR A;  4U5Y A;  2ZEP A;  1XIX A;  5LRG A;  5I0C A;  1PU9 A;  2PJ2 A;  2Z3O A;  5LYI A;  3BJ7 A;  1R57 A;  1YVK A;  3ISX A;  2CY2 A;  3I9S A;  2WZN A;  5A28 A;  1YW6 A;  2VBQ A;  3LAC A;  5KTD A;  4M6H A;  3CDX A;  3C26 A;  2O28 A;  2ZEO A;  4XPD C;  4CRZ B;  1TKF A;  2BO9 A;  2BOA A;  2VL1 A;  3GLJ A;  3IWE A;  3W91 A;  4DJL A;  1FNO A;  1YLE A;  3ISZ A;  3CXQ A;  3MN8 A; 
#chains in the Genus database with same CATH homology
 5JQ4 A;  2H5M A;  2Q4Y A;  3EXN A;  4ZGY B;  4C68 A;  4L8A A;  2Z3K A;  2VQY A;  1XEB A;  2VEZ A;  4R3K A;  3DNS A;  3TT2 A;  3WR7 A;  3JTK A;  4AVA A;  5J8C A;  4MY0 A;  3SHP A;  3P2H A;  1V0C A;  4A30 A;  5GCN A;  3NE7 A;  1XMT A;  2P6E A;  4ZBG A;  4Q36 A;  4NEX A;  2QIR A;  1B87 A;  3TOB A;  2CNT A;  3T90 A;  3FIX A;  3LOD A;  4FD6 A;  5F49 A;  1M4D A;  3I3G A;  5A27 A;  4MFQ A;  4E0A A;  1LRZ A;  4PK3 A;  4YRH A;  4I49 A;  2J8M A;  4NF1 A;  4A31 A;  5IB0 A;  2ATR A;  1IID A;  5EBV A;  2BUE A;  5E96 A;  1QSM A;  2OZU A;  2HV2 A;  2OZG A;  2WPW A;  2YNC A;  2GE3 A;  3GY9 A;  5KTC A;  4AVC A;  4FD7 A;  2Q44 A;  3JUW A;  3TFY A;  4B5P A;  2I79 A;  4CAW A;  1S7N A;  4II9 A;  3TE4 A;  4PK2 A;  4KVM E;  2BSW A;  3F5B A;  3DDD A;  4UA3 A;  2PQ8 A;  2CNS A;  2KCW A;  3T9Y A;  4A32 A;  4E2A A;  4CGO A;  4MFL A;  2AJ6 A;  4B10 A;  2GAN A;  3EY5 A;  2Z3M A;  2YNC C;  2REF A;  4AG9 A;  4CGP A;  3TOA A;  2FT0 A;  1Z4R A;  2D4O A;  2YGW A;  3PP9 A;  5AG6 A;  2HQY A;  2R1I A;  2B4D B;  4XPL A;  4HNY B;  5G1Z A;  3H4Q A;  4MFP A;  3R9E A;  4UCN A;  1Q2Y A;  2R98 A;  5HMN A;  4AVB A;  2FXF A;  2AE6 A;  1YK3 A;  1L0C A;  1S7K A;  5G22 A;  1Q2D A;  2B3U A;  4A2Z A;  4B11 A;  4C2Z A;  2JDD A;  4KOR A;  1NMT A;  3IWG A;  2Z0Z A;  4UFX A;  3OWC A;  4UWJ A;  3DR8 A;  4KOT A;  2Z3N A;  4GS4 A;  4CAX A;  5BWA B;  2VI7 A;  1IYL A;  4IF5 A;  5F47 A;  1N71 A;  1K4J A;  2JEV A;  3K9U A;  2EVN A;  3EFA A;  2VXK A;  3N7Z A;  2D4P A;  1ON0 A;  2BEI A;  1P4N A;  4UBR A;  3IGR A;  3W6X A;  1S3Z A;  3E0K A;  3FXT A;  4KUA A;  1M1D A;  4XPD B;  5FVJ A;  3FRM A;  1ZO0 A;  4QB9 A;  5CNP A;  1NE9 A;  5AG4 A;  4KS9 A;  1TIQ A;  3DSB A;  4AG7 A;  4RI1 A;  2Z11 A;  4JJX A;  4RS2 A;  4NSQ A;  2WPX A;  4MBU A;  3D2P A;  3R9G A;  5C82 A;  4B13 A;  2J8N A;  2VZZ A;  4ONU A;  5F46 A;  2G3A A;  4UFV A;  1IB1 E;  2FIW A;  1GHE A;  4KOW A;  4JLY A;  1RXT A;  3CXS A;  3TO7 A;  4F0Y A;  1NSL A;  2ZW6 A;  1VHS A;  4F6A A;  5AG5 A;  4ORF A;  3EO4 A;  3P2F A;  4CYQ A;  5ISV A;  4MFK A;  1I1D A;  3PGP A;  1FY7 A;  2C27 A;  1XF8 A;  1Y9W A;  4JD6 A;  2P6G A;  4X5K A;  4PV6 A;  2Y0M A;  2OB0 A;  2Q4V A;  4LUA A;  4OAE A;  3SXN A;  4BBH A;  2P0W A;  2P6F A;  2G3T A;  3PZJ A;  4B5O A;  2QEC A;  2B58 A;  3FYN A;  4YFJ A;  3SXO A;  2R8V A;  4PSW A;  1YVO A;  1SQH A;  1YR0 A;  4L89 A;  4CAV A;  2B5G B;  3DR6 A;  5G21 A;  2CXA A;  2Q04 A;  3W6S A;  3EC4 A;  4FD5 A;  1P0H A;  4KVO E;  2I00 A;  4QVT A;  1BO4 A;  2X7B A;  1S60 A;  3A9L A;  4KOX A;  2K5T A;  5F48 A;  2Q0Y A;  2JDC A;  2OH1 A;  2FE7 A;  4H89 A;  5JPH A;  2GIV A;  2Z3L A;  4E8O A;  4CGM A;  1YGH A;  1WK4 A;  2ZW7 A;  1PUA A;  2ZXV A;  2PR8 A;  3IU2 A;  4R87 A;  1RO5 A;  4BMH A;  4A95 A;  3GKR A;  3IU1 A;  2Q7B A;  1YRE A;  4AB7 A;  2HUZ A;  4H6Z A;  3V8I A;  3MGD A;  4R9M A;  4IUS A;  4OAD A;  3R1K A;  1KUX A;  2DPS A;  4Y49 B;  1BOB A;  1CM0 A;  1YX0 A;  5H84 A;  4A33 A;  4NCZ A;  1Q2C A;  3D8P A;  4OLL A;  4UWI A;  3S6G A;  4CYO A;  4CYN A;  4MFZ A;  3FB3 A;  1WWZ A;  1Y9K A;  4M85 A;  1S7L A;  2FIA A;  1KZF A;  4XNH B;  2ZPA A;  5KTA A;  2ZW4 A;  1IYK A;  2FS5 A;  3VWE A;  2EUI A;  4FD4 A;  4JXR A;  4XPK A;  2ARH A;  4Q38 A;  4UFW A;  1J4J A;  4NXY A;  5H86 A;  2ZW5 A;  4C2X A;  4MJ8 A;  2OZH A;  3FNC A;  5IX3 A;  2IL4 A;  3F0A A;  1S5K A;  4YGO A;  4CRY B;  1B6B A;  1KUY A;  1S7F A;  3D3S A;  1VKC A;  4JWP A;  5DWN A;  4CGL A;  4CYP A;  4KUB A;  3H5Z A;  4CAF A;  3QB8 A;  4MI4 A;  3LD2 A;  3BLN A;  3ZZI A;  3VWD A;  2VZY A;  2DXQ A;  4MY3 A;  3KKW A;  2B4B A;  5C88 A;  1QSR A;  4KSF A;  1QSO A;  3F8K A;  4KSA A;  1Z9U A;  3TCV A;  4HNW B;  4CGN A;  3TTH A;  4U9Z A;  2A4N A;  4MHD A;  2WUU A;  4KOY A;  3UY5 A;  4CAE A;  2Z10 A;  3G3S A;  5EC4 A;  3JVN A;  3R96 A;  2PSW A;  1KUV A;  4KOU A;  1I12 A;  4H6U A;  2PRB A;  3GYA A;  4HNX B;  2Z3P A;  2B5G A;  3RYO A;  2FL4 A;  3S6H A;  1M4I A;  4J3G A;  3G8W A;  4QUS A;  4CS0 B;  4M3S A;  1OZP A;  1I21 A;  4KOV A;  4F0X A;  4C2Y A;  4QC6 A;  4KLW A;  2B4D A;  2FSR A;  3R9F A;  2FCK A;  2J8R A;  2YNE A;  4QBJ A;  4KLV A;  1IIC A;  2PDO A;  1XE4 A;  1CJW A;  2QML A;  3TO6 A;  2PC1 A;  1QST A;  2WSA A;  4JXQ A;  3FBU A;  5J8F A;  2B3V A;  5HH1 A;  3ZJ0 A;  3BJ8 A;  4HKF A;  3R95 A;  1MJB A;  4KVX A;  5DWM A;  3B8G A;  4B12 A;  4MFJ A;  2YND A;  4B5P B;  3CXP A;  2BL1 A;  2CNM A;  3TO9 A;  3QAH A;  2R7H A;  3S6F A;  4DNC A;  1MJA A;  1QSN A;  3D2M A;  1U6M A;  2NMT A;  4K30 A;  2G0B A;  5G20 A;  1MK4 A;  4LX9 A;  4B14 A;  5IV0 A;  2RC4 A;  3S6K A;  2F5I A;  4KOS A;  4PSX A;  4C7I A;  4R3L A;  1M4G A;  4Y49 C;  1Z4E A;  1UFH A;  2PR1 A;  4UCP A;  1MJ9 A;  2JLM A;  2OU2 A;  1M44 A;  5AG7 A;  4KZT A;  1Y7R A;  2REE A;  4R57 A;  2DPT A;  4U9Y A;  4UCM A;  4XNH C;  5AGE A;  4C7H A;  4EVY A;  4U5Y A;  1XIX A;  5I0C A;  1PU9 A;  2Z3O A;  3BJ7 A;  1R57 A;  1YVK A;  2CY2 A;  3I9S A;  5A28 A;  2VBQ A;  5KTD A;  3C26 A;  2O28 A;  4CRZ B;  4XPD C;  3IWE A;  3W91 A;  1YLE A;  3CXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...