2PCUA

Human carboxypeptidase a4 in complex with a cleaved hexapeptide.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
305
structure length
305
Chain Sequence
b'NNFNYGAYHSLEAIYHEMDNIAADFPDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGPHANSEVEVKSVVDFIQKHGNFKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELRDTGTYGFLLPANQIIPTAEETWLGLKTIMEHVRDNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxypeptidase A4
publication title Caught after the Act: a human A-type metallocarboxypeptidase in a product complex with a cleaved hexapeptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 115
structure length 305
sequence length 305
ec nomenclature ec 3.4.17.-:
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2pcuA00
4MXUA 4P4EA 2HB6A 3NH4A 2V77A 2EK8A 1CG2A 4EFDA 3FF3A 3PB7X 2DEAA 5HVFA 2C6CA 4NGRA 3V7ZA 5CPAA 4JYWA 1Z2LA 2PJ0A 4B6ZA 3VATA 1BPMA 2PJ1A 2JBKA 4R76A 1F2PA 3FEEA 1TXRA 2FVGA 3T8WA 4IK2A 4A38A 2ZOGA 3FH4A 3NA6A 2OR4A 4DJLA 2ZENA 6CPAA 4KSIA 2AFMA 4MCPA 3FMCA 3IIBA 2V8HA 4MRIA 1XMBA 1Z8LA 1XBUA 5JH9A 2PJ8A 2XEJA 3SI2A 1ELMP 3TX8A 1OBRA 1YW6A 3PBBA 3CPAA 4OIWA 3DLJA 3PB9X 4MHPA 1CPXA 1HDQA 5LYDA 3MN8A 1XRYA 3KASA 2PIYA 1RTQA 4Z65A 3HLPA 4MCRA 1TKFA 1R3NA 3S9LA 4UIAA 2PJ6A 2F8HA 2PE3A 4YU9A 4FBEA 4PXBA 2CIJA 2QJ8A 1TF9A 2ZEMA 3D67A 2IJZA 4UIBA 4NGNA 3WABA 3IWWA 4P4BA 4X2TA 1XJOA 3SJXA 2WZNA 4IAVA 2Q43A 4FWUA 4NGTA 4A94A 1YLOA 4DYOA 2GLJA 5LYLA 5JGFA 1F57A 2VL1A 4ZYQA 3KR5A 1TKHA 8CPAA 4OIDA 3MRUA 1LAMA 3SJGA 2RB7A 1XFOA 2Q51A 2JBJA 3KZWA 4ZI6A 3S9MA 4P10A 4PXEA 1Y7EA 4R8FA 3SI0A 1TF8A 3PFOA 1KWMA 4NJRA 5HVGA 1H8LA 3H8GA 2I3CA 4NGSA 3TC8A 4P44A 2ABZA 2PRQA 1UWYA 4H2KA 2V8GA 3LWUA 5D8NA 4MHYA 1IGBA 2C6PA 1ZLHA 3KI9A 1Z5RA 1CPSA 3D7FA 1HDUA 5JM6A 4BD9A 3D66A 1ZG7A 3B7IA 4TWEA 5K8PA 1NSAA 4P4JA 1YW4A 4UEEA 2PVWA 3GB0A 2PVVA 1HEEA 5THWA 4P6YA 3WC5A 4A39A 2RFHA 4RUHA 2PJCA 3JRUA 3BI0A 3CPXA 4JZ0A 2AFWA 3BHXA 1ELLP 1ARMA 1PYTB 4NGMA 3WC6A 3IFEA 2PJ5A 4PQAA 4PXCA 3PB6X 4MHNA 4DUKA 2Q4ZA 1JQGA 4P45A 2ZELA 5DS0A 4R7MA 2PJ7A 2QYVA 2IMOA 1FT7A 3H8FA 1ZG9A 1AYEA 5LRKA 1AMPA 3HUVA 3FJUA 4LQGA 2ZEFA 4OMEA 4ZY2A 3NFZA 4UEZA 3PFEA 2BO9A 5LYFA 3I1UA 4YWYA 4GM5A 2ZEDA 1BAVA 1LAPA 2ZEHA 5LRJA 5K8OA 1LANA 3KHZA 2C1CA 2NSMA 4OP4A 2PJ9A 2WYRA 3NH5A 2AFUA 4EWTA 1R43A 5K8NA 3NH8A 2G9DA 3RZAA 5IB9A 1LCPA 3GLJA 1CX8A 2PIZA 3B3SA 4ZX8A 3VARA 2CTBA 2F7VA 3SJEA 4NGQA 3D4UA 4OC0A 3WT4A 4WJBA 2BCOA 5ELYA 3FVLA 2EWBA 4PPZA 3IJ3A 4FAIA 1PCAA 2PCUA 2XEGA 3D7GA 4UF4A 2AFOA 3SJFA 3RBUA 2XEIA 5F09A 3IO1A 1CBXA 4WWVA 2BOAA 4MMOA 2ZEEA 3KQZA 1Q7LA 1VHOA 4G1PA 3B3VA 1FNOA 2O53A 3KL9A 5HVHA 5LRGA 4NJQA 3LMSA 3KHXA 1LOKA 3B3WA 2GU2A 3BXMA 4NFRA 1DE4C 4ZX9A 3DGVA 2IQ6A 3FX6A 4OKOA 1QQ9A 5I4MA 4F8ZA 3FECA 3PEIA 2XEFA 2ZOFA 4F9UA 5LYIA 4P4FA 4OC3A 2QVPA 3D7DA 2V8VA 4O23A 4EMEA 2AFSA 2O4HA 3S9NA 1BPNA 3KGQA 3KR4A 3QNVA 3D68A 3RAMA 1Y0RA 3CT9A 1TKJA 1Y0YA 5CBMA 1EE3P 3FEDA 4OC2A 2PJ2A 1LFWA 3B3TA 4FUUA 3IC1A 4A37A 2J9AA 1M4LA 4ONWA 2CF4A 1VHEA 1ZG8A 1VGYA 4PXDA 4F9VA 2ZEGA 3K2KA 4W9YA 3PRTA 2AFZA 3L2NA 2AFXA 3IEHA 3ISZA 4IHMA 4MCSA 4X8IA 3K9TA 1YSJA 2POKA 2JEWA 4TNUA 3SI1A 3PB4X 2NYQA 3H8EA 4MCQA 4OC5A 2PJ4A 3V38A 2ZEOA 3N5FA 1CP6A 4OC1A 4MHZA 2OOTA 3KQXA 4X3RA 2PJ3A 2GREA 3B3CA 1GYTA 5K8MA 2HC9A 4UEFA 3B35A 3PBEA 1YMEA 2PJBA 2PJAA 1ARLA 1CP7A 4R6TA 2CTCA 4NGPA 4OC4A 1BLLE 1VIXA 2GLFA 4CPAA 1DTDA 1ZLIA 4Q7AA 3BI1A 4P4DA 4ZY0A 2C6GA 4P4IA 3ISXA 1QMUA 1IY7A 4AXVA 2ZEPA 3D7HA 1F2OA 5HXDA 2V8DA 3B2YA 3CDXA 3PB8X 7CPAA 4ZY1A 4K3NA 3GUXA 2EK9A 2ANPA 5D29A 3WC7A 5J1QA 3VH9A
chains in the Genus database with same CATH superfamily
4MXUA 4KUAA 1Y7RA 4P4EA 3RO0A 2HB6A 3NH4A 3TOBA 4UBRA 2P6FA 2EK8A 1CG2A 2V77A 2GIVA 4A30A 4EFDA 1MJ9A 3F5BA 3FF3A 4AVAA 3PB7X 2DEAA 2JDDA 4XNHB 5HVFA 1YLEA 2C6CA 4M6GA 4NGRA 4H6ZA 3V7ZA 5CPAA 4JYWA 4KZTA 1Z2LA 2PJ0A 4UFWA 4B6ZA 3VATA 4MJ8A 1BPMA 2CXAA 1RO5A 2PJ1A 2X7BA 2JBKA 4R76A 2PQ8A 3PGPA 1F2PA 3FEEA 3C26A 1KUXA 1TXRA 3TO9A 4CAXA 2VZYA 2FVGA 5AGEA 2PC1A 3T8WA 4IK2A 4A38A 2ZOGA 3FH4A 2PR8A 3NA6A 2Z11A 1S7KA 4R57A 4KVOE 5KTDA 2OR4A 1YK3A 4DJLA 2ZENA 6CPAA 5KTAA 4II9A 5ISVA 4B13A 4KSIA 3EC4A 2EVNA 2AFMA 4MCPA 3A9LA 3FMCA 4UWIA 3IIBA 5HMNA 2V8HA 1KZFA 3FYNA 1N71A 5F48A 1XEBA 2FE7A 4MRIA 1YR0A 1XMBA 1Z8LA 1IYKA 1XBUA 4OLLA 3EO4A 5JH9A 4KSFA 4M6HA 3WR7A 3FRMA 2PJ8A 1NE9A 4M85A 5AG7A 2XEJA 3SI2A 1V0CA 3I9SA 3PP9A 1ELMP 4AB7A 3TX8A 4CGMA 1OBRA 1YW6A 3PBBA 2Z3LA 4KSAA 4CRYB 3CPAA 5IV0A 1QSTA 2B3UA 3DLJA 4OIWA 3D8PA 2EO8A 1X10A 3PB9X 5J8CA 3DDDA 4MHPA 1CPXA 1HDQA 2G0BA 1Y9KA 2R1IA 3MN8A 1XRYA 5LYDA 4B5PA 3KASA 4IF5A 5A28A 2PIYA 5J8FA 1RTQA 3DNSA 3HLPA 4Z65A 3EY5A 1TKFA 1WK4A 4MCRA 1R3NA 2DF5A 3G8WA 1OZPA 3LD2A 4QC6A 1CM0A 2GANA 3S6GA 3S9LA 4UIAA 3T90A 2PJ6A 5A27A 2F8HA 2CNTA 2FIAA 4M3SA 2PE3A 4YU9A 4JWPA 4FBEA 4PXBA 2CIJA 2QJ8A 2VZZA 1TF9A 3FB3A 2ZEMA 4JXRA 3D67A 4L89A 2IJZA 2VQYA 4UIBA 2VEZA 4NGNA 4Q38A 1IYLA 1M44A 4R9MA 3NE8A 3DR8A 4I49A 2B58A 3WABA 3IWWA 4P4BA 4X2TA 2B4BA 3EXNA 2CY2A 4MFQA 1XJOA 4A95A 3SJXA 3R96A 2JLMA 2DXQA 2WZNA 4IAVA 2Q44A 2Q43A 3IU2A 4FWUA 1YLOA 4KORA 2GLJA 4NGTA 5HH1A 4A94A 4DYOA 5JGFA 5LYLA 1F57A 2VL1A 2Z3MA 4ZYQA 3KR5A 1TKHA 2F5IA 2HUZA 4CAEA 8CPAA 4OIDA 3MRUA 1GHEA 1LAMA 2Z0ZA 2FIWA 1Z8XA 4J3GA 3SJGA 2OH1A 2VXKA 2RB7A 3CXPA 3BJ8A 1XFOA 2ATRA 4KOWA 3D2MA 5G1ZA 1KUYA 1A2ZA 2Q51A 4C2XA 2JBJA 3KZWA 4B5OA 4ZI6A 3S9MA 4P10A 4PXEA 4UCNA 2Z3PA 1Y7EA 1VKCA 1S60A 4R8FA 2ODFA 4KOXA 4E0AA 4KLVA 3SI0A 1QSOA 1TF8A 3BJ7A 3PFOA 5G20A 1KWMA 4NJRA 5HVGA 5AG5A 1H8LA 3H8GA 2I3CA 4NGSA 5E96A 1P0HA 1S7FA 1XF8A 3FBUA 2GE3A 4KVXA 4P44A 3TC8A 2ABZA 2PRQA 3OWCA 2B4DB 1UWYA 4H2KA 4UCMA 2Q7SA 2K5TA 3R1KA 1XOVA 2V8GA 3LODA 4CGLA 3LWUA 5D8NA 2QECA 4RI1A 4KOUA 1S7NA 2AJ6A 1IGBA 4MHYA 5IB0A 2C6PA 5JQ4A 3W91A 1ZLHA 3KI9A 4JD6A 4CAVA 3H5ZA 1Z5RA 1CPSA 2G3TA 3D7FA 1HDUA 2H5MA 2Q4YA 3F0AA 3JUWA 4BINA 5JM6A 4JLYA 4BD9A 3S6KA 2O28A 4CYNA 1MJAA 3D66A 1ZG7A 3B7IA 3FNCA 4TWEA 5K8PA 1NSAA 4P4JA 5H86A 4QVTA 2B5GA 1QSNA 1YW4A 4UEEA 4MFPA 2GFQA 2JEVA 2PVWA 3GB0A 4FD4A 2PVVA 4YGOA 4A31A 1HEEA 2EBJA 2KCWA 2ZW6A 3GYAA 1B6BA 4P6YA 5THWA 3UY5A 5C88A 3WC5A 4A39A 2RFHA 4RUHA 2PJCA 3CZXA 4C68A 3TTHA 2CNMA 3JRUA 3BI0A 3CPXA 4ONUA 3RNZA 2ZW5A 3GIUA 4JZ0A 2AFWA 4LUAA 3BHXA 1ELLP 2I79A 1IICA 4U9YA 2JDCA 1IB1E 1XMTA 1ARMA 1PYTB 3V8IA 5I0CA 4NGMA 4CYOA 3SHPA 3WC6A 3IFEA 2PJ5A 4PQAA 4PXCA 4KUBA 3PB6X 4YRHA 4UFVA 4PV6A 2Q4VA 3W6XA 2Y0MA 3IWGA 1CJWA 4MHNA 4KOYA 3DSBA 4AVCA 4DUKA 2Q4ZA 4ZGYB 1JQGA 4H6UA 1BO4A 4HKFA 4P45A 2ZELA 3DR6A 4CGNA 1FY7A 5DS0A 4KVME 1B87A 4L8AA 4R7MA 1M4DA 2PJ7A 2QYVA 4NXYA 2IMOA 5IX3A 4B10A 4BMHA 1NMTA 1ON0A 2D4PA 4EVYA 1FT7A 5EC4A 3FXTA 3E0KA 3H8FA 4Y49C 5EBVA 1ZG9A 1Z9UA 1AYEA 5LRKA 1AMPA 3HUVA 3FJUA 4LQGA 2ZEFA 4OMEA 3KKWA 2QMLA 4PK3A 4MHDA 4ZY2A 3NFZA 3T9YA 4UEZA 3PFEA 2BO9A 5LYFA 4B11A 1IIDA 2NMTA 3TO6A 3I1UA 2P6EA 4HNXB 1M4GA 4YWYA 5JPHA 1ZO0A 2BEIA 4AG7A 4K30A 4GM5A 2ZEDA 1BAVA 1LAPA 2HQYA 1NSLA 2ZEHA 5LRJA 3R9GA 3RYOA 3QAYA 4F6AA 5K8OA 1LANA 3IU1A 4CS0B 1U6MA 3KHZA 2C1CA 2NSMA 2PR1A 1I21A 4KLWA 4OP4A 2P6GA 2PJ9A 2R8VA 3H4QA 2WYRA 2HV2A 3F8KA 4XPKA 3NH5A 2AFUA 4EWTA 4A33A 3R9EA 1Q2CA 3B8GA 2YNCA 2P0WA 4GS4A 1R43A 1YREA 2Q0YA 5K8NA 3EFAA 4UWJA 3GY9A 3NH8A 3R9FA 4CYPA 1YX0A 2G9DA 2YGWA 5DWNA 4CAFA 2R98A 1YQEA 4ZBGA 3RZAA 1LCPA 5IB9A 4F0XA 3GLJA 1CX8A 2PIZA 3B3SA 4ZX8A 3VARA 2CTBA 2ZPAA 2FCKA 4RN7A 2FSRA 2F7VA 3TO7A 2Q04A 2Z3OA 3SJEA 2D4OA 1LRZA 4NGQA 3D4UA 4QUSA 4OC0A 3VWEA 2WPWA 1Z8WA 3WT4A 4QB9A 4WJBA 2BCOA 4PSWA 5ELYA 3FVLA 2EWBA 4NF1A 3IJ3A 4PPZA 4FAIA 2RC4A 2ZW4A 1PCAA 2PCUA 2XEGA 2J8RA 3D7GA 3ZZIA 4UF4A 2AFOA 3BLNA 3I3GA 4B5PB 1QSRA 3SJFA 2OU2A 1L0CA 3RBUA 2IL4A 2XEIA 5AG4A 5F09A 4NSQA 2DPTA 3VWDA 4UA3A 4C2YA 3IO1A 3TCVA 1BOBA 1CBXA 4WWVA 2BOAA 4MMOA 2ZEEA 3KQZA 1Q7LA 1VHOA 4G1PA 4C2ZA 4MFZA 1MJBA 3B3VA 1FNOA 3SXNA 1SQHA 2VI7A 4MY3A 2O53A 3G3SA 2YNDA 3KL9A 4OAEA 4MFLA 5HVHA 4C7HA 5LRGA 4NJQA 1Z4RA 4KOTA 5F46A 3LMSA 3KHXA 1LOKA 4MI4A 4HNYB 2J8NA 4H89A 4Y49B 2OZHA 4CGPA 4HNWB 1YVOA 5BWAB 3IGRA 2Q7BA 3B3WA 2GU2A 2FXFA 3BXMA 4NFRA 1DE4C 1MK4A 4ZX9A 2PRBA 3DGVA 3QB8A 2BL1A 4MFJA 2BUEA 2ARHA 4A2ZA 2IQ6A 1P4NA 3FX6A 4OKOA 1R57A 1QQ9A 3IWEA 5I4MA 2EUIA 2OZGA 4F8ZA 4XPDC 3FECA 2VBQA 3NE7A 3PEIA 2XEFA 2ZOFA 4XPLA 5F49A 4C7IA 4MBUA 5LYIA 4F9UA 4PSXA 4ORFA 4P4FA 3R95A 1XE4A 4OC3A 2QVPA 3S6FA 3D7DA 4R87A 3MGDA 3CXQA 4FD6A 2R7HA 2V8VA 3FIXA 4O23A 4E2AA 4EMEA 3TE4A 5GCNA 2BSWA 3W6SA 2AFSA 4CAWA 5KTCA 2O4HA 4RS2A 3S9NA 1BPNA 3KGQA 1M1DA 3KR4A 3QNVA 4UFXA 4U5YA 1IOFA 3D68A 3RAMA 1Y0RA 4JJXA 3CT9A 1TKJA 1Y0YA 1RXTA 5CBMA 1EE3P 2REEA 3FEDA 4OC2A 2PJ2A 1LFWA 3B3TA 4B14A 4FUUA 3IC1A 4A37A 2J9AA 1M4LA 2ZW7A 4NCZA 4ONWA 1I1DA 4Q36A 5G21A 2CF4A 1VHEA 1ZG8A 2G3AA 4MFKA 1VGYA 4PXDA 4F9VA 1M4IA 2ZEGA 3K2KA 3K9UA 4W9YA 4R3LA 2DPSA 5C82A 5G22A 3PRTA 4GXHA 4A32A 2AFZA 2YNEA 3L2NA 1I12A 2AFXA 2REFA 2Z3KA 4HPSA 3IEHA 4JXQA 4CYQA 4XNHC 3ISZA 4IHMA 4MCSA 2QIRA 4X8IA 3K9TA 1YSJA 2POKA 2YNCC 4M6IA 2AE6A 4E8OA 1K4JA 2JEWA 2WPXA 4TNUA 4CRZB 2J8MA 5DWMA 3SI1A 1Z8TA 1TIQA 3PB4X 2NYQA 3H8EA 4MCQA 2B4DA 4OC5A 1KUVA 4KOSA 1AUGA 2A4NA 2B5GB 4AVBA 2PJ4A 4BBHA 1Q2DA 3V38A 1Q2YA 4YFJA 3QAHA 1VHSA 2OB0A 2Z3NA 2ZEOA 3D3SA 1X12A 2WSAA 3N5FA 4PK2A 4B12A 4MY0A 5CNPA 1CP6A 4OC1A 5EMIA 4MHZA 2OOTA 3KQXA 4X3RA 2PJ3A 2GREA 3B3CA 1GYTA 4U9ZA 4DNCA 5K8MA 2HC9A 1J4JA 1IU8A 4LX9A 4AG9A 4UEFA 2FT0A 3B35A 3N7ZA 3PBEA 4R3KA 3ZJ0A 1YMEA 2PJBA 1IOIA 2C27A 2PJAA 3TOAA 1ARLA 1CP7A 4R6TA 4F0YA 1Z4EA 2CTCA 2PDOA 4NGPA 4UCPA 4XPDB 4KOVA 4X5KA 4OC4A 3TT2A 1YGHA 1BLLE 1S7LA 1VIXA 3S6HA 2GLFA 5AG6A 3P2HA 4CPAA 1DTDA 3TFYA 1Y9WA 1ZLIA 4FD5A 4Q7AA 1XIXA 3BI1A 4P4DA 4ZY0A 3LACA 2C6GA 2FS5A 3GKRA 3CXSA 4P4IA 3ISXA 1PU9A 1PUAA 1WWZA 3P2FA 4QBJA 3D2PA 1QMUA 1IY7A 2CNSA 4IUSA 1UFHA 4AXVA 2ZEPA 3D7HA 1F2OA 1S5KA 3PZJA 5F47A 5H84A 2Z10A 4OADA 4LQ6A 4NEXA 5HXDA 5FVJA 2V8DA 3B2YA 3CDXA 4KS9A 3SXOA 1JWQA 3PB8X 7CPAA 2FL4A 2B3VA 4ZY1A 4FD7A 4K3NA 2I00A 2OZUA 3GUXA 2EK9A 4CGOA 3JTKA 1QSMA 1YVKA 2ANPA 2WUUA 5D29A 2ZXVA 2PSWA 3WC7A 5J1QA 3VH9A 3JVNA 1S3ZA
chains in the Genus database with same CATH topology
4MXUA 4P4EA 2HB6A 3NH4A 2V77A 2EK8A 1CG2A 4EFDA 3FF3A 3PB7X 2DEAA 5HVFA 2C6CA 4NGRA 3V7ZA 5CPAA 4JYWA 1Z2LA 2PJ0A 4B6ZA 3VATA 1BPMA 2PJ1A 2JBKA 4R76A 1F2PA 3FEEA 1TXRA 2FVGA 3T8WA 4IK2A 4A38A 2ZOGA 3FH4A 3NA6A 2OR4A 4DJLA 2ZENA 6CPAA 4KSIA 2AFMA 4MCPA 3FMCA 3IIBA 2V8HA 4MRIA 1XMBA 1Z8LA 1XBUA 5JH9A 2PJ8A 2XEJA 3SI2A 1ELMP 3TX8A 1OBRA 1YW6A 3PBBA 3CPAA 4OIWA 3DLJA 3PB9X 4MHPA 1CPXA 1HDQA 5LYDA 3MN8A 1XRYA 3KASA 2PIYA 1RTQA 4Z65A 3HLPA 4MCRA 1TKFA 1R3NA 3S9LA 4UIAA 2PJ6A 2F8HA 2PE3A 4YU9A 4FBEA 4PXBA 2CIJA 2QJ8A 1TF9A 2ZEMA 3D67A 2IJZA 4UIBA 4NGNA 3WABA 3IWWA 4P4BA 4X2TA 1XJOA 3SJXA 2WZNA 4IAVA 2Q43A 4FWUA 4NGTA 4A94A 1YLOA 4DYOA 2GLJA 5LYLA 5JGFA 1F57A 2VL1A 4ZYQA 3KR5A 1TKHA 8CPAA 4OIDA 3MRUA 1LAMA 3SJGA 2RB7A 1XFOA 2Q51A 2JBJA 3KZWA 4ZI6A 3S9MA 4P10A 4PXEA 1Y7EA 4R8FA 3SI0A 1TF8A 3PFOA 1KWMA 4NJRA 5HVGA 1H8LA 3H8GA 2I3CA 4NGSA 3TC8A 4P44A 2ABZA 2PRQA 1UWYA 4H2KA 2V8GA 3LWUA 5D8NA 4MHYA 1IGBA 2C6PA 1ZLHA 3KI9A 1Z5RA 1CPSA 3D7FA 1HDUA 5JM6A 4BD9A 3D66A 1ZG7A 3B7IA 4TWEA 5K8PA 1NSAA 4P4JA 1YW4A 4UEEA 2PVWA 3GB0A 2PVVA 1HEEA 5THWA 4P6YA 3WC5A 4A39A 2RFHA 4RUHA 2PJCA 3JRUA 3BI0A 3CPXA 4JZ0A 2AFWA 3BHXA 1ELLP 1ARMA 1PYTB 4NGMA 3WC6A 3IFEA 2PJ5A 4PQAA 4PXCA 3PB6X 4MHNA 4DUKA 2Q4ZA 1JQGA 4P45A 2ZELA 5DS0A 4R7MA 2PJ7A 2QYVA 2IMOA 1FT7A 3H8FA 1ZG9A 1AYEA 5LRKA 1AMPA 3HUVA 3FJUA 4LQGA 2ZEFA 4OMEA 4ZY2A 3NFZA 4UEZA 3PFEA 2BO9A 5LYFA 3I1UA 4YWYA 4GM5A 2ZEDA 1BAVA 1LAPA 2ZEHA 5LRJA 5K8OA 1LANA 3KHZA 2C1CA 2NSMA 4OP4A 2PJ9A 2WYRA 3NH5A 2AFUA 4EWTA 1R43A 5K8NA 3NH8A 2G9DA 3RZAA 5IB9A 1LCPA 3GLJA 1CX8A 2PIZA 3B3SA 4ZX8A 3VARA 2CTBA 2F7VA 3SJEA 4NGQA 3D4UA 4OC0A 3WT4A 4WJBA 2BCOA 5ELYA 3FVLA 2EWBA 4PPZA 3IJ3A 4FAIA 1PCAA 2PCUA 2XEGA 3D7GA 4UF4A 2AFOA 3SJFA 3RBUA 2XEIA 5F09A 3IO1A 1CBXA 4WWVA 2BOAA 4MMOA 2ZEEA 3KQZA 1Q7LA 1VHOA 4G1PA 3B3VA 1FNOA 2O53A 3KL9A 5HVHA 5LRGA 4NJQA 3LMSA 3KHXA 1LOKA 3B3WA 2GU2A 3BXMA 4NFRA 1DE4C 4ZX9A 3DGVA 2IQ6A 3FX6A 4OKOA 1QQ9A 5I4MA 4F8ZA 3FECA 3PEIA 2XEFA 2ZOFA 4F9UA 5LYIA 4P4FA 4OC3A 2QVPA 3D7DA 2V8VA 4O23A 4EMEA 2AFSA 2O4HA 3S9NA 1BPNA 3KGQA 3KR4A 3QNVA 3D68A 3RAMA 1Y0RA 3CT9A 1TKJA 1Y0YA 5CBMA 1EE3P 3FEDA 4OC2A 2PJ2A 1LFWA 3B3TA 4FUUA 3IC1A 4A37A 2J9AA 1M4LA 4ONWA 2CF4A 1VHEA 1ZG8A 1VGYA 4PXDA 4F9VA 2ZEGA 3K2KA 4W9YA 3PRTA 2AFZA 3L2NA 2AFXA 3IEHA 3ISZA 4IHMA 4MCSA 4X8IA 3K9TA 1YSJA 2POKA 2JEWA 4TNUA 3SI1A 3PB4X 2NYQA 3H8EA 4MCQA 4OC5A 2PJ4A 3V38A 2ZEOA 3N5FA 1CP6A 4OC1A 4MHZA 2OOTA 3KQXA 4X3RA 2PJ3A 2GREA 3B3CA 1GYTA 5K8MA 2HC9A 4UEFA 3B35A 3PBEA 1YMEA 2PJBA 2PJAA 1ARLA 1CP7A 4R6TA 2CTCA 4NGPA 4OC4A 1BLLE 1VIXA 2GLFA 4CPAA 1DTDA 1ZLIA 4Q7AA 3BI1A 4P4DA 4ZY0A 2C6GA 4P4IA 3ISXA 1QMUA 1IY7A 4AXVA 2ZEPA 3D7HA 1F2OA 5HXDA 2V8DA 3B2YA 3CDXA 3PB8X 7CPAA 4ZY1A 4K3NA 3GUXA 2EK9A 2ANPA 5D29A 3WC7A 5J1QA 3VH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MXU A;  4P4E A;  2HB6 A;  3NH4 A;  2V77 A;  2EK8 A;  1CG2 A;  4EFD A;  3FF3 A;  3PB7 X;  2DEA A;  5HVF A;  2C6C A;  4NGR A;  3V7Z A;  5CPA A;  4JYW A;  1Z2L A;  2PJ0 A;  4B6Z A;  3VAT A;  1BPM A;  2PJ1 A;  2JBK A;  4R76 A;  1F2P A;  3FEE A;  1TXR A;  2FVG A;  3T8W A;  4IK2 A;  4A38 A;  2ZOG A;  3FH4 A;  3NA6 A;  2OR4 A;  4DJL A;  2ZEN A;  6CPA A;  4KSI A;  2AFM A;  4MCP A;  3FMC A;  3IIB A;  2V8H A;  4MRI A;  1XMB A;  1Z8L A;  1XBU A;  5JH9 A;  2PJ8 A;  2XEJ A;  3SI2 A;  1ELM P;  3TX8 A;  1OBR A;  1YW6 A;  3PBB A;  3CPA A;  4OIW A;  3DLJ A;  3PB9 X;  4MHP A;  1CPX A;  1HDQ A;  5LYD A;  3MN8 A;  1XRY A;  3KAS A;  2PIY A;  1RTQ A;  4Z65 A;  3HLP A;  4MCR A;  1TKF A;  1R3N A;  3S9L A;  4UIA A;  2PJ6 A;  2F8H A;  2PE3 A;  4YU9 A;  4FBE A;  4PXB A;  2CIJ A;  2QJ8 A;  1TF9 A;  2ZEM A;  3D67 A;  2IJZ A;  4UIB A;  4NGN A;  3WAB A;  3IWW A;  4P4B A;  4X2T A;  1XJO A;  3SJX A;  2WZN A;  4IAV A;  2Q43 A;  4FWU A;  4NGT A;  4A94 A;  1YLO A;  4DYO A;  2GLJ A;  5LYL A;  5JGF A;  1F57 A;  2VL1 A;  4ZYQ A;  3KR5 A;  1TKH A;  8CPA A;  4OID A;  3MRU A;  1LAM A;  3SJG A;  2RB7 A;  1XFO A;  2Q51 A;  2JBJ A;  3KZW A;  4ZI6 A;  3S9M A;  4P10 A;  4PXE A;  1Y7E A;  4R8F A;  3SI0 A;  1TF8 A;  3PFO A;  1KWM A;  4NJR A;  5HVG A;  1H8L A;  3H8G A;  2I3C A;  4NGS A;  3TC8 A;  4P44 A;  2ABZ A;  2PRQ A;  1UWY A;  4H2K A;  2V8G A;  3LWU A;  5D8N A;  4MHY A;  1IGB A;  2C6P A;  1ZLH A;  3KI9 A;  1Z5R A;  1CPS A;  3D7F A;  1HDU A;  5JM6 A;  4BD9 A;  3D66 A;  1ZG7 A;  3B7I A;  4TWE A;  5K8P A;  1NSA A;  4P4J A;  1YW4 A;  4UEE A;  2PVW A;  3GB0 A;  2PVV A;  1HEE A;  5THW A;  4P6Y A;  3WC5 A;  4A39 A;  2RFH A;  4RUH A;  2PJC A;  3JRU A;  3BI0 A;  3CPX A;  4JZ0 A;  2AFW A;  3BHX A;  1ELL P;  1ARM A;  1PYT B;  4NGM A;  3WC6 A;  3IFE A;  2PJ5 A;  4PQA A;  4PXC A;  3PB6 X;  4MHN A;  4DUK A;  2Q4Z A;  1JQG A;  4P45 A;  2ZEL A;  5DS0 A;  4R7M A;  2PJ7 A;  2QYV A;  2IMO A;  1FT7 A;  3H8F A;  1ZG9 A;  1AYE A;  5LRK A;  1AMP A;  3HUV A;  3FJU A;  4LQG A;  2ZEF A;  4OME A;  4ZY2 A;  3NFZ A;  4UEZ A;  3PFE A;  2BO9 A;  5LYF A;  3I1U A;  4YWY A;  4GM5 A;  2ZED A;  1BAV A;  1LAP A;  2ZEH A;  5LRJ A;  5K8O A;  1LAN A;  3KHZ A;  2C1C A;  2NSM A;  4OP4 A;  2PJ9 A;  2WYR A;  3NH5 A;  2AFU A;  4EWT A;  1R43 A;  5K8N A;  3NH8 A;  2G9D A;  3RZA A;  5IB9 A;  1LCP A;  3GLJ A;  1CX8 A;  2PIZ A;  3B3S A;  4ZX8 A;  3VAR A;  2CTB A;  2F7V A;  3SJE A;  4NGQ A;  3D4U A;  4OC0 A;  3WT4 A;  4WJB A;  2BCO A;  5ELY A;  3FVL A;  2EWB A;  4PPZ A;  3IJ3 A;  4FAI A;  1PCA A;  2PCU A;  2XEG A;  3D7G A;  4UF4 A;  2AFO A;  3SJF A;  3RBU A;  2XEI A;  5F09 A;  3IO1 A;  1CBX A;  4WWV A;  2BOA A;  4MMO A;  2ZEE A;  3KQZ A;  1Q7L A;  1VHO A;  4G1P A;  3B3V A;  1FNO A;  2O53 A;  3KL9 A;  5HVH A;  5LRG A;  4NJQ A;  3LMS A;  3KHX A;  1LOK A;  3B3W A;  2GU2 A;  3BXM A;  4NFR A;  1DE4 C;  4ZX9 A;  3DGV A;  2IQ6 A;  3FX6 A;  4OKO A;  1QQ9 A;  5I4M A;  4F8Z A;  3FEC A;  3PEI A;  2XEF A;  2ZOF A;  4F9U A;  5LYI A;  4P4F A;  4OC3 A;  2QVP A;  3D7D A;  2V8V A;  4O23 A;  4EME A;  2AFS A;  2O4H A;  3S9N A;  1BPN A;  3KGQ A;  3KR4 A;  3QNV A;  3D68 A;  3RAM A;  1Y0R A;  3CT9 A;  1TKJ A;  1Y0Y A;  5CBM A;  1EE3 P;  3FED A;  4OC2 A;  2PJ2 A;  1LFW A;  3B3T A;  4FUU A;  3IC1 A;  4A37 A;  2J9A A;  1M4L A;  4ONW A;  2CF4 A;  1VHE A;  1ZG8 A;  1VGY A;  4PXD A;  4F9V A;  2ZEG A;  3K2K A;  4W9Y A;  3PRT A;  2AFZ A;  3L2N A;  2AFX A;  3IEH A;  3ISZ A;  4IHM A;  4MCS A;  4X8I A;  3K9T A;  1YSJ A;  2POK A;  2JEW A;  4TNU A;  3SI1 A;  3PB4 X;  2NYQ A;  3H8E A;  4MCQ A;  4OC5 A;  2PJ4 A;  3V38 A;  2ZEO A;  3N5F A;  1CP6 A;  4OC1 A;  4MHZ A;  2OOT A;  3KQX A;  4X3R A;  2PJ3 A;  2GRE A;  3B3C A;  1GYT A;  5K8M A;  2HC9 A;  4UEF A;  3B35 A;  3PBE A;  1YME A;  2PJB A;  2PJA A;  1ARL A;  1CP7 A;  4R6T A;  2CTC A;  4NGP A;  4OC4 A;  1BLL E;  1VIX A;  2GLF A;  4CPA A;  1DTD A;  1ZLI A;  4Q7A A;  3BI1 A;  4P4D A;  4ZY0 A;  2C6G A;  4P4I A;  3ISX A;  1QMU A;  1IY7 A;  4AXV A;  2ZEP A;  3D7H A;  1F2O A;  5HXD A;  2V8D A;  3B2Y A;  3CDX A;  3PB8 X;  7CPA A;  4ZY1 A;  4K3N A;  3GUX A;  2EK9 A;  2ANP A;  5D29 A;  3WC7 A;  5J1Q A;  3VH9 A; 
#chains in the Genus database with same CATH topology
 4MXU A;  4KUA A;  1Y7R A;  4P4E A;  3RO0 A;  2HB6 A;  3NH4 A;  3TOB A;  4UBR A;  2P6F A;  2EK8 A;  1CG2 A;  2V77 A;  2GIV A;  4A30 A;  4EFD A;  1MJ9 A;  3F5B A;  3FF3 A;  4AVA A;  3PB7 X;  2DEA A;  2JDD A;  4XNH B;  5HVF A;  1YLE A;  2C6C A;  4M6G A;  4NGR A;  4H6Z A;  3V7Z A;  5CPA A;  4JYW A;  4KZT A;  1Z2L A;  2PJ0 A;  4UFW A;  4B6Z A;  3VAT A;  4MJ8 A;  1BPM A;  2CXA A;  1RO5 A;  2PJ1 A;  2X7B A;  2JBK A;  4R76 A;  2PQ8 A;  3PGP A;  1F2P A;  3FEE A;  3C26 A;  1KUX A;  1TXR A;  3TO9 A;  4CAX A;  2VZY A;  2FVG A;  5AGE A;  2PC1 A;  3T8W A;  4IK2 A;  4A38 A;  2ZOG A;  3FH4 A;  2PR8 A;  3NA6 A;  2Z11 A;  1S7K A;  4R57 A;  4KVO E;  5KTD A;  2OR4 A;  1YK3 A;  4DJL A;  2ZEN A;  6CPA A;  5KTA A;  4II9 A;  5ISV A;  4B13 A;  4KSI A;  3EC4 A;  2EVN A;  2AFM A;  4MCP A;  3A9L A;  3FMC A;  4UWI A;  3IIB A;  5HMN A;  2V8H A;  1KZF A;  3FYN A;  1N71 A;  5F48 A;  1XEB A;  2FE7 A;  4MRI A;  1YR0 A;  1XMB A;  1Z8L A;  1IYK A;  1XBU A;  4OLL A;  3EO4 A;  5JH9 A;  4KSF A;  4M6H A;  3WR7 A;  3FRM A;  2PJ8 A;  1NE9 A;  4M85 A;  5AG7 A;  2XEJ A;  3SI2 A;  1V0C A;  3I9S A;  3PP9 A;  1ELM P;  4AB7 A;  3TX8 A;  4CGM A;  1OBR A;  1YW6 A;  3PBB A;  2Z3L A;  4KSA A;  4CRY B;  3CPA A;  5IV0 A;  1QST A;  2B3U A;  3DLJ A;  4OIW A;  3D8P A;  2EO8 A;  1X10 A;  3PB9 X;  5J8C A;  3DDD A;  4MHP A;  1CPX A;  1HDQ A;  2G0B A;  1Y9K A;  2R1I A;  3MN8 A;  1XRY A;  5LYD A;  4B5P A;  3KAS A;  4IF5 A;  5A28 A;  2PIY A;  5J8F A;  1RTQ A;  3DNS A;  3HLP A;  4Z65 A;  3EY5 A;  1TKF A;  1WK4 A;  4MCR A;  1R3N A;  2DF5 A;  3G8W A;  1OZP A;  3LD2 A;  4QC6 A;  1CM0 A;  2GAN A;  3S6G A;  3S9L A;  4UIA A;  3T90 A;  2PJ6 A;  5A27 A;  2F8H A;  2CNT A;  2FIA A;  4M3S A;  2PE3 A;  4YU9 A;  4JWP A;  4FBE A;  4PXB A;  2CIJ A;  2QJ8 A;  2VZZ A;  1TF9 A;  3FB3 A;  2ZEM A;  4JXR A;  3D67 A;  4L89 A;  2IJZ A;  2VQY A;  4UIB A;  2VEZ A;  4NGN A;  4Q38 A;  1IYL A;  1M44 A;  4R9M A;  3NE8 A;  3DR8 A;  4I49 A;  2B58 A;  3WAB A;  3IWW A;  4P4B A;  4X2T A;  2B4B A;  3EXN A;  2CY2 A;  4MFQ A;  1XJO A;  4A95 A;  3SJX A;  3R96 A;  2JLM A;  2DXQ A;  2WZN A;  4IAV A;  2Q44 A;  2Q43 A;  3IU2 A;  4FWU A;  1YLO A;  4KOR A;  2GLJ A;  4NGT A;  5HH1 A;  4A94 A;  4DYO A;  5JGF A;  5LYL A;  1F57 A;  2VL1 A;  2Z3M A;  4ZYQ A;  3KR5 A;  1TKH A;  2F5I A;  2HUZ A;  4CAE A;  8CPA A;  4OID A;  3MRU A;  1GHE A;  1LAM A;  2Z0Z A;  2FIW A;  1Z8X A;  4J3G A;  3SJG A;  2OH1 A;  2VXK A;  2RB7 A;  3CXP A;  3BJ8 A;  1XFO A;  2ATR A;  4KOW A;  3D2M A;  5G1Z A;  1KUY A;  1A2Z A;  2Q51 A;  4C2X A;  2JBJ A;  3KZW A;  4B5O A;  4ZI6 A;  3S9M A;  4P10 A;  4PXE A;  4UCN A;  2Z3P A;  1Y7E A;  1VKC A;  1S60 A;  4R8F A;  2ODF A;  4KOX A;  4E0A A;  4KLV A;  3SI0 A;  1QSO A;  1TF8 A;  3BJ7 A;  3PFO A;  5G20 A;  1KWM A;  4NJR A;  5HVG A;  5AG5 A;  1H8L A;  3H8G A;  2I3C A;  4NGS A;  5E96 A;  1P0H A;  1S7F A;  1XF8 A;  3FBU A;  2GE3 A;  4KVX A;  4P44 A;  3TC8 A;  2ABZ A;  2PRQ A;  3OWC A;  2B4D B;  1UWY A;  4H2K A;  4UCM A;  2Q7S A;  2K5T A;  3R1K A;  1XOV A;  2V8G A;  3LOD A;  4CGL A;  3LWU A;  5D8N A;  2QEC A;  4RI1 A;  4KOU A;  1S7N A;  2AJ6 A;  1IGB A;  4MHY A;  5IB0 A;  2C6P A;  5JQ4 A;  3W91 A;  1ZLH A;  3KI9 A;  4JD6 A;  4CAV A;  3H5Z A;  1Z5R A;  1CPS A;  2G3T A;  3D7F A;  1HDU A;  2H5M A;  2Q4Y A;  3F0A A;  3JUW A;  4BIN A;  5JM6 A;  4JLY A;  4BD9 A;  3S6K A;  2O28 A;  4CYN A;  1MJA A;  3D66 A;  1ZG7 A;  3B7I A;  3FNC A;  4TWE A;  5K8P A;  1NSA A;  4P4J A;  5H86 A;  4QVT A;  2B5G A;  1QSN A;  1YW4 A;  4UEE A;  4MFP A;  2GFQ A;  2JEV A;  2PVW A;  3GB0 A;  4FD4 A;  2PVV A;  4YGO A;  4A31 A;  1HEE A;  2EBJ A;  2KCW A;  2ZW6 A;  3GYA A;  1B6B A;  4P6Y A;  5THW A;  3UY5 A;  5C88 A;  3WC5 A;  4A39 A;  2RFH A;  4RUH A;  2PJC A;  3CZX A;  4C68 A;  3TTH A;  2CNM A;  3JRU A;  3BI0 A;  3CPX A;  4ONU A;  3RNZ A;  2ZW5 A;  3GIU A;  4JZ0 A;  2AFW A;  4LUA A;  3BHX A;  1ELL P;  2I79 A;  1IIC A;  4U9Y A;  2JDC A;  1IB1 E;  1XMT A;  1ARM A;  1PYT B;  3V8I A;  5I0C A;  4NGM A;  4CYO A;  3SHP A;  3WC6 A;  3IFE A;  2PJ5 A;  4PQA A;  4PXC A;  4KUB A;  3PB6 X;  4YRH A;  4UFV A;  4PV6 A;  2Q4V A;  3W6X A;  2Y0M A;  3IWG A;  1CJW A;  4MHN A;  4KOY A;  3DSB A;  4AVC A;  4DUK A;  2Q4Z A;  4ZGY B;  1JQG A;  4H6U A;  1BO4 A;  4HKF A;  4P45 A;  2ZEL A;  3DR6 A;  4CGN A;  1FY7 A;  5DS0 A;  4KVM E;  1B87 A;  4L8A A;  4R7M A;  1M4D A;  2PJ7 A;  2QYV A;  4NXY A;  2IMO A;  5IX3 A;  4B10 A;  4BMH A;  1NMT A;  1ON0 A;  2D4P A;  4EVY A;  1FT7 A;  5EC4 A;  3FXT A;  3E0K A;  3H8F A;  4Y49 C;  5EBV A;  1ZG9 A;  1Z9U A;  1AYE A;  5LRK A;  1AMP A;  3HUV A;  3FJU A;  4LQG A;  2ZEF A;  4OME A;  3KKW A;  2QML A;  4PK3 A;  4MHD A;  4ZY2 A;  3NFZ A;  3T9Y A;  4UEZ A;  3PFE A;  2BO9 A;  5LYF A;  4B11 A;  1IID A;  2NMT A;  3TO6 A;  3I1U A;  2P6E A;  4HNX B;  1M4G A;  4YWY A;  5JPH A;  1ZO0 A;  2BEI A;  4AG7 A;  4K30 A;  4GM5 A;  2ZED A;  1BAV A;  1LAP A;  2HQY A;  1NSL A;  2ZEH A;  5LRJ A;  3R9G A;  3RYO A;  3QAY A;  4F6A A;  5K8O A;  1LAN A;  3IU1 A;  4CS0 B;  1U6M A;  3KHZ A;  2C1C A;  2NSM A;  2PR1 A;  1I21 A;  4KLW A;  4OP4 A;  2P6G A;  2PJ9 A;  2R8V A;  3H4Q A;  2WYR A;  2HV2 A;  3F8K A;  4XPK A;  3NH5 A;  2AFU A;  4EWT A;  4A33 A;  3R9E A;  1Q2C A;  3B8G A;  2YNC A;  2P0W A;  4GS4 A;  1R43 A;  1YRE A;  2Q0Y A;  5K8N A;  3EFA A;  4UWJ A;  3GY9 A;  3NH8 A;  3R9F A;  4CYP A;  1YX0 A;  2G9D A;  2YGW A;  5DWN A;  4CAF A;  2R98 A;  1YQE A;  4ZBG A;  3RZA A;  1LCP A;  5IB9 A;  4F0X A;  3GLJ A;  1CX8 A;  2PIZ A;  3B3S A;  4ZX8 A;  3VAR A;  2CTB A;  2ZPA A;  2FCK A;  4RN7 A;  2FSR A;  2F7V A;  3TO7 A;  2Q04 A;  2Z3O A;  3SJE A;  2D4O A;  1LRZ A;  4NGQ A;  3D4U A;  4QUS A;  4OC0 A;  3VWE A;  2WPW A;  1Z8W A;  3WT4 A;  4QB9 A;  4WJB A;  2BCO A;  4PSW A;  5ELY A;  3FVL A;  2EWB A;  4NF1 A;  3IJ3 A;  4PPZ A;  4FAI A;  2RC4 A;  2ZW4 A;  1PCA A;  2PCU A;  2XEG A;  2J8R A;  3D7G A;  3ZZI A;  4UF4 A;  2AFO A;  3BLN A;  3I3G A;  4B5P B;  1QSR A;  3SJF A;  2OU2 A;  1L0C A;  3RBU A;  2IL4 A;  2XEI A;  5AG4 A;  5F09 A;  4NSQ A;  2DPT A;  3VWD A;  4UA3 A;  4C2Y A;  3IO1 A;  3TCV A;  1BOB A;  1CBX A;  4WWV A;  2BOA A;  4MMO A;  2ZEE A;  3KQZ A;  1Q7L A;  1VHO A;  4G1P A;  4C2Z A;  4MFZ A;  1MJB A;  3B3V A;  1FNO A;  3SXN A;  1SQH A;  2VI7 A;  4MY3 A;  2O53 A;  3G3S A;  2YND A;  3KL9 A;  4OAE A;  4MFL A;  5HVH A;  4C7H A;  5LRG A;  4NJQ A;  1Z4R A;  4KOT A;  5F46 A;  3LMS A;  3KHX A;  1LOK A;  4MI4 A;  4HNY B;  2J8N A;  4H89 A;  4Y49 B;  2OZH A;  4CGP A;  4HNW B;  1YVO A;  5BWA B;  3IGR A;  2Q7B A;  3B3W A;  2GU2 A;  2FXF A;  3BXM A;  4NFR A;  1DE4 C;  1MK4 A;  4ZX9 A;  2PRB A;  3DGV A;  3QB8 A;  2BL1 A;  4MFJ A;  2BUE A;  2ARH A;  4A2Z A;  2IQ6 A;  1P4N A;  3FX6 A;  4OKO A;  1R57 A;  1QQ9 A;  3IWE A;  5I4M A;  2EUI A;  2OZG A;  4F8Z A;  4XPD C;  3FEC A;  2VBQ A;  3NE7 A;  3PEI A;  2XEF A;  2ZOF A;  4XPL A;  5F49 A;  4C7I A;  4MBU A;  5LYI A;  4F9U A;  4PSX A;  4ORF A;  4P4F A;  3R95 A;  1XE4 A;  4OC3 A;  2QVP A;  3S6F A;  3D7D A;  4R87 A;  3MGD A;  3CXQ A;  4FD6 A;  2R7H A;  2V8V A;  3FIX A;  4O23 A;  4E2A A;  4EME A;  3TE4 A;  5GCN A;  2BSW A;  3W6S A;  2AFS A;  4CAW A;  5KTC A;  2O4H A;  4RS2 A;  3S9N A;  1BPN A;  3KGQ A;  1M1D A;  3KR4 A;  3QNV A;  4UFX A;  4U5Y A;  1IOF A;  3D68 A;  3RAM A;  1Y0R A;  4JJX A;  3CT9 A;  1TKJ A;  1Y0Y A;  1RXT A;  5CBM A;  1EE3 P;  2REE A;  3FED A;  4OC2 A;  2PJ2 A;  1LFW A;  3B3T A;  4B14 A;  4FUU A;  3IC1 A;  4A37 A;  2J9A A;  1M4L A;  2ZW7 A;  4NCZ A;  4ONW A;  1I1D A;  4Q36 A;  5G21 A;  2CF4 A;  1VHE A;  1ZG8 A;  2G3A A;  4MFK A;  1VGY A;  4PXD A;  4F9V A;  1M4I A;  2ZEG A;  3K2K A;  3K9U A;  4W9Y A;  4R3L A;  2DPS A;  5C82 A;  5G22 A;  3PRT A;  4GXH A;  4A32 A;  2AFZ A;  2YNE A;  3L2N A;  1I12 A;  2AFX A;  2REF A;  2Z3K A;  4HPS A;  3IEH A;  4JXQ A;  4CYQ A;  4XNH C;  3ISZ A;  4IHM A;  4MCS A;  2QIR A;  4X8I A;  3K9T A;  1YSJ A;  2POK A;  2YNC C;  4M6I A;  2AE6 A;  4E8O A;  1K4J A;  2JEW A;  2WPX A;  4TNU A;  4CRZ B;  2J8M A;  5DWM A;  3SI1 A;  1Z8T A;  1TIQ A;  3PB4 X;  2NYQ A;  3H8E A;  4MCQ A;  2B4D A;  4OC5 A;  1KUV A;  4KOS A;  1AUG A;  2A4N A;  2B5G B;  4AVB A;  2PJ4 A;  4BBH A;  1Q2D A;  3V38 A;  1Q2Y A;  4YFJ A;  3QAH A;  1VHS A;  2OB0 A;  2Z3N A;  2ZEO A;  3D3S A;  1X12 A;  2WSA A;  3N5F A;  4PK2 A;  4B12 A;  4MY0 A;  5CNP A;  1CP6 A;  4OC1 A;  5EMI A;  4MHZ A;  2OOT A;  3KQX A;  4X3R A;  2PJ3 A;  2GRE A;  3B3C A;  1GYT A;  4U9Z A;  4DNC A;  5K8M A;  2HC9 A;  1J4J A;  1IU8 A;  4LX9 A;  4AG9 A;  4UEF A;  2FT0 A;  3B35 A;  3N7Z A;  3PBE A;  4R3K A;  3ZJ0 A;  1YME A;  2PJB A;  1IOI A;  2C27 A;  2PJA A;  3TOA A;  1ARL A;  1CP7 A;  4R6T A;  4F0Y A;  1Z4E A;  2CTC A;  2PDO A;  4NGP A;  4UCP A;  4XPD B;  4KOV A;  4X5K A;  4OC4 A;  3TT2 A;  1YGH A;  1BLL E;  1S7L A;  1VIX A;  3S6H A;  2GLF A;  5AG6 A;  3P2H A;  4CPA A;  1DTD A;  3TFY A;  1Y9W A;  1ZLI A;  4FD5 A;  4Q7A A;  1XIX A;  3BI1 A;  4P4D A;  4ZY0 A;  3LAC A;  2C6G A;  2FS5 A;  3GKR A;  3CXS A;  4P4I A;  3ISX A;  1PU9 A;  1PUA A;  1WWZ A;  3P2F A;  4QBJ A;  3D2P A;  1QMU A;  1IY7 A;  2CNS A;  4IUS A;  1UFH A;  4AXV A;  2ZEP A;  3D7H A;  1F2O A;  1S5K A;  3PZJ A;  5F47 A;  5H84 A;  2Z10 A;  4OAD A;  4LQ6 A;  4NEX A;  5HXD A;  5FVJ A;  2V8D A;  3B2Y A;  3CDX A;  4KS9 A;  3SXO A;  1JWQ A;  3PB8 X;  7CPA A;  2FL4 A;  2B3V A;  4ZY1 A;  4FD7 A;  4K3N A;  2I00 A;  2OZU A;  3GUX A;  2EK9 A;  4CGO A;  3JTK A;  1QSM A;  1YVK A;  2ANP A;  2WUU A;  5D29 A;  2ZXV A;  2PSW A;  3WC7 A;  5J1Q A;  3VH9 A;  3JVN A;  1S3Z A; 
#chains in the Genus database with same CATH homology
 4MXU A;  4P4E A;  2HB6 A;  3NH4 A;  2V77 A;  2EK8 A;  1CG2 A;  4EFD A;  3FF3 A;  3PB7 X;  2DEA A;  5HVF A;  2C6C A;  4NGR A;  3V7Z A;  5CPA A;  4JYW A;  1Z2L A;  2PJ0 A;  4B6Z A;  3VAT A;  1BPM A;  2PJ1 A;  2JBK A;  4R76 A;  1F2P A;  3FEE A;  1TXR A;  2FVG A;  3T8W A;  4IK2 A;  4A38 A;  2ZOG A;  3FH4 A;  3NA6 A;  2OR4 A;  4DJL A;  2ZEN A;  6CPA A;  4KSI A;  2AFM A;  4MCP A;  3FMC A;  3IIB A;  2V8H A;  4MRI A;  1XMB A;  1Z8L A;  1XBU A;  5JH9 A;  2PJ8 A;  2XEJ A;  3SI2 A;  1ELM P;  3TX8 A;  1OBR A;  1YW6 A;  3PBB A;  3CPA A;  4OIW A;  3DLJ A;  3PB9 X;  4MHP A;  1CPX A;  1HDQ A;  5LYD A;  3MN8 A;  1XRY A;  3KAS A;  2PIY A;  1RTQ A;  4Z65 A;  3HLP A;  4MCR A;  1TKF A;  1R3N A;  3S9L A;  4UIA A;  2PJ6 A;  2F8H A;  2PE3 A;  4YU9 A;  4FBE A;  4PXB A;  2CIJ A;  2QJ8 A;  1TF9 A;  2ZEM A;  3D67 A;  2IJZ A;  4UIB A;  4NGN A;  3WAB A;  3IWW A;  4P4B A;  4X2T A;  1XJO A;  3SJX A;  2WZN A;  4IAV A;  2Q43 A;  4FWU A;  4NGT A;  4A94 A;  1YLO A;  4DYO A;  2GLJ A;  5LYL A;  5JGF A;  1F57 A;  2VL1 A;  4ZYQ A;  3KR5 A;  1TKH A;  8CPA A;  4OID A;  3MRU A;  1LAM A;  3SJG A;  2RB7 A;  1XFO A;  2Q51 A;  2JBJ A;  3KZW A;  4ZI6 A;  3S9M A;  4P10 A;  4PXE A;  1Y7E A;  4R8F A;  3SI0 A;  1TF8 A;  3PFO A;  1KWM A;  4NJR A;  5HVG A;  1H8L A;  3H8G A;  2I3C A;  4NGS A;  3TC8 A;  4P44 A;  2ABZ A;  2PRQ A;  1UWY A;  4H2K A;  2V8G A;  3LWU A;  5D8N A;  4MHY A;  1IGB A;  2C6P A;  1ZLH A;  3KI9 A;  1Z5R A;  1CPS A;  3D7F A;  1HDU A;  5JM6 A;  4BD9 A;  3D66 A;  1ZG7 A;  3B7I A;  4TWE A;  5K8P A;  1NSA A;  4P4J A;  1YW4 A;  4UEE A;  2PVW A;  3GB0 A;  2PVV A;  1HEE A;  5THW A;  4P6Y A;  3WC5 A;  4A39 A;  2RFH A;  4RUH A;  2PJC A;  3JRU A;  3BI0 A;  3CPX A;  4JZ0 A;  2AFW A;  3BHX A;  1ELL P;  1ARM A;  1PYT B;  4NGM A;  3WC6 A;  3IFE A;  2PJ5 A;  4PQA A;  4PXC A;  3PB6 X;  4MHN A;  4DUK A;  2Q4Z A;  1JQG A;  4P45 A;  2ZEL A;  5DS0 A;  4R7M A;  2PJ7 A;  2QYV A;  2IMO A;  1FT7 A;  3H8F A;  1ZG9 A;  1AYE A;  5LRK A;  1AMP A;  3HUV A;  3FJU A;  4LQG A;  2ZEF A;  4OME A;  4ZY2 A;  3NFZ A;  4UEZ A;  3PFE A;  2BO9 A;  5LYF A;  3I1U A;  4YWY A;  4GM5 A;  2ZED A;  1BAV A;  1LAP A;  2ZEH A;  5LRJ A;  5K8O A;  1LAN A;  3KHZ A;  2C1C A;  2NSM A;  4OP4 A;  2PJ9 A;  2WYR A;  3NH5 A;  2AFU A;  4EWT A;  1R43 A;  5K8N A;  3NH8 A;  2G9D A;  3RZA A;  5IB9 A;  1LCP A;  3GLJ A;  1CX8 A;  2PIZ A;  3B3S A;  4ZX8 A;  3VAR A;  2CTB A;  2F7V A;  3SJE A;  4NGQ A;  3D4U A;  4OC0 A;  3WT4 A;  4WJB A;  2BCO A;  5ELY A;  3FVL A;  2EWB A;  4PPZ A;  3IJ3 A;  4FAI A;  1PCA A;  2PCU A;  2XEG A;  3D7G A;  4UF4 A;  2AFO A;  3SJF A;  3RBU A;  2XEI A;  5F09 A;  3IO1 A;  1CBX A;  4WWV A;  2BOA A;  4MMO A;  2ZEE A;  3KQZ A;  1Q7L A;  1VHO A;  4G1P A;  3B3V A;  1FNO A;  2O53 A;  3KL9 A;  5HVH A;  5LRG A;  4NJQ A;  3LMS A;  3KHX A;  1LOK A;  3B3W A;  2GU2 A;  3BXM A;  4NFR A;  1DE4 C;  4ZX9 A;  3DGV A;  2IQ6 A;  3FX6 A;  4OKO A;  1QQ9 A;  5I4M A;  4F8Z A;  3FEC A;  3PEI A;  2XEF A;  2ZOF A;  4F9U A;  5LYI A;  4P4F A;  4OC3 A;  2QVP A;  3D7D A;  2V8V A;  4O23 A;  4EME A;  2AFS A;  2O4H A;  3S9N A;  1BPN A;  3KGQ A;  3KR4 A;  3QNV A;  3D68 A;  3RAM A;  1Y0R A;  3CT9 A;  1TKJ A;  1Y0Y A;  5CBM A;  1EE3 P;  3FED A;  4OC2 A;  2PJ2 A;  1LFW A;  3B3T A;  4FUU A;  3IC1 A;  4A37 A;  2J9A A;  1M4L A;  4ONW A;  2CF4 A;  1VHE A;  1ZG8 A;  1VGY A;  4PXD A;  4F9V A;  2ZEG A;  3K2K A;  4W9Y A;  3PRT A;  2AFZ A;  3L2N A;  2AFX A;  3IEH A;  3ISZ A;  4IHM A;  4MCS A;  4X8I A;  3K9T A;  1YSJ A;  2POK A;  2JEW A;  4TNU A;  3SI1 A;  3PB4 X;  2NYQ A;  3H8E A;  4MCQ A;  4OC5 A;  2PJ4 A;  3V38 A;  2ZEO A;  3N5F A;  1CP6 A;  4OC1 A;  4MHZ A;  2OOT A;  3KQX A;  4X3R A;  2PJ3 A;  2GRE A;  3B3C A;  1GYT A;  5K8M A;  2HC9 A;  4UEF A;  3B35 A;  3PBE A;  1YME A;  2PJB A;  2PJA A;  1ARL A;  1CP7 A;  4R6T A;  2CTC A;  4NGP A;  4OC4 A;  1BLL E;  1VIX A;  2GLF A;  4CPA A;  1DTD A;  1ZLI A;  4Q7A A;  3BI1 A;  4P4D A;  4ZY0 A;  2C6G A;  4P4I A;  3ISX A;  1QMU A;  1IY7 A;  4AXV A;  2ZEP A;  3D7H A;  1F2O A;  5HXD A;  2V8D A;  3B2Y A;  3CDX A;  3PB8 X;  7CPA A;  4ZY1 A;  4K3N A;  3GUX A;  2EK9 A;  2ANP A;  5D29 A;  3WC7 A;  5J1Q A;  3VH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...