2PCUA

Human carboxypeptidase a4 in complex with a cleaved hexapeptide.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
305
structure length
305
Chain Sequence
NNFNYGAYHSLEAIYHEMDNIAADFPDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGPHANSEVEVKSVVDFIQKHGNFKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELRDTGTYGFLLPANQIIPTAEETWLGLKTIMEHVRDNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxypeptidase A4
publication title Caught after the Act: a human A-type metallocarboxypeptidase in a product complex with a cleaved hexapeptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 115
structure length 305
sequence length 305
ec nomenclature ec 3.4.17.-:
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2pcuA00
4MHPA 1LOKA 4KSIA 2OOTA 2ABZA 2OR4A 5LRJA 2FVGA 4YWYA 5LRKA 3VATA 3MRUA 2PJ9A 3ISXA 2VL1A 6CPAA 3DLJA 2HC9A 5DS0A 3SI1A 2NYQA 3H8FA 1QMUA 2V8GA 4ZX9A 2CTCA 1ARMA 1RTQA 2PIYA 3BI0A 1HEEA 3KZWA 3WC6A 3KHXA 2AFOA 3I1UA 4P6YA 2EWBA 2CTBA 2JBKA 4NJRA 3PFEA 4OC3A 3B3CA 3IO1A 3PB8X 3S9NA 1LAMA 3NH5A 5LYDA 5LYLA 4FUUA 2PCUA 4OC4A 1PYTB 4GM5A 3IEHA 4H2KA 4NGPA 2PJ5A 1R43A 3IJ3A 3TX8A 4OMEA 2PJ3A 1Y7EA 2G9DA 2C6GA 4P4DA 4DJLA 2ANPA 1Z2LA 3FH4A 3KASA 1CPXA 2ZELA 4UIAA 8CPAA 1YLOA 1AYEA 3PEIA 2PIZA 3FJUA 4MRIA 3NFZA 3IC1A 4PXCA 3IFEA 3KHZA 3PB4X 2PJ7A 4PXEA 3IIBA 1IGBA 3WABA 3PB7X 2PVWA 1IY7A 4OP4A 2RB7A 1Z8LA 2V77A 4UEZA 2AFWA 4DYOA 5K8PA 4OC2A 2F8HA 3B3SA 1XMBA 1ZG8A 3LWUA 3KQXA 1DE4C 1TXRA 1TKJA 4ZY0A 2ZEPA 3SJGA 5HXDA 4WJBA 1EE3P 5D29A 4NGNA 3FEEA 4W9YA 5K8NA 3B3WA 4FAIA 2PJ8A 3FF3A 3CDXA 2ZEMA 3D4UA 3PBEA 2IJZA 3D67A 1XFOA 1LCPA 5CPAA 4G1PA 3RBUA 5HVGA 4A94A 1FNOA 2GU2A 1CBXA 4JZ0A 2IMOA 5JH9A 5LYFA 2PJAA 3KL9A 1YW6A 2HB6A 1Y0YA 2Q4ZA 4K3NA 1CP7A 2EK9A 1BLLE 3GUXA 1ELMP 4B6ZA 5JM6A 4P45A 5I4MA 1ZLIA 3D7GA 4R7MA 3CT9A 2GREA 4R6TA 3B35A 2V8DA 2PJBA 1TF8A 5HVHA 3KI9A 3V7ZA 4CPAA 1BPMA 2ZOFA 2IQ6A 3NA6A 4NGTA 4TWEA 2V8HA 4X2TA 5IB9A 4RUHA 3L2NA 4UIBA 5CBMA 4PXBA 1R3NA 1YSJA 1PCAA 3BHXA 1Q7LA 3IWWA 4UF4A 3WT4A 4WWVA 2XEFA 3VARA 4PPZA 3FEDA 2BO9A 4OIDA 4EFDA 2PJ0A 5JGFA 5J1QA 2ZEEA 1CX8A 5F09A 1M4LA 1TF9A 3SJEA 4MCRA 3B3VA 4IK2A 2AFMA 4FBEA 3H8GA 1TKFA 4YU9A 2QVPA 2J9AA 1VHEA 2ZEGA 3HLPA 4NGRA 3B7IA 1GYTA 4ZY1A 3KGQA 2O4HA 5ELYA 2QJ8A 4X3RA 1JQGA 3SI0A 3RAMA 3S9MA 3H8EA 1ZG7A 2F7VA 2PRQA 2POKA 4X8IA 7CPAA 4MCPA 2I3CA 3DGVA 1VGYA 4P10A 2ZENA 4ZYQA 4ONWA 3PRTA 2PJ1A 2JBJA 3MN8A 3BXMA 4Q7AA 2ZOGA 5LRGA 2PJCA 1H8LA 2AFSA 3CPXA 2PJ2A 3GB0A 3D7HA 1ELLP 3RZAA 2O53A 4NGQA 3BI1A 3JRUA 1UWYA 1TKHA 2GLJA 3SI2A 2WZNA 4FWUA 4JYWA 4A39A 2BOAA 3WC5A 4EMEA 4NGSA 4PQAA 4EWTA 2PJ4A 4F8ZA 1VIXA 1LFWA 3D7DA 3B2YA 1YMEA 3D68A 4ZX8A 5HVFA 3WC7A 4BD9A 1XBUA 3V38A 2V8VA 1Z5RA 2JEWA 2DEAA 2BCOA 1XRYA 2Q51A 5LYIA 1F57A 2ZEDA 3K2KA 4ZY2A 4A38A 4PXDA 3VH9A 2XEJA 1FT7A 2WYRA 5K8OA 3S9LA 4P4EA 2XEIA 5K8MA 5THWA 1QQ9A 2C1CA 2RFHA 4OC0A 3TC8A 1F2PA 2GLFA 4R8FA 4DUKA 3KR4A 4P4FA 4AXVA 4P4BA 5D8NA 2C6CA 2CIJA 2PJ6A 1OBRA 3KQZA 2PVVA 4OC5A 4IAVA 4P44A 1HDUA 3FVLA 2AFXA 1Y0RA 1YW4A 1KWMA 4MHZA 4MMOA 3D66A 4P4IA 4NFRA 4MCSA 2Q43A 3PB6X 1XJOA 2AFUA 4UEFA 3FECA 1ZG9A 4OC1A 3FMCA 1CG2A 1LANA 2ZEHA 3K9TA 3SJXA 4MHNA 3QNVA 2C6PA 3B3TA 4F9UA 3T8WA 3NH4A 4MXUA 1HDQA 1CPSA 2PE3A 3SJFA 4NJQA 1LAPA 4P4JA 3D7FA 1DTDA 2AFZA 4OIWA 3ISZA 4MHYA 3N5FA 2QYVA 3NH8A 2ZEFA 4R76A 4A37A 4OKOA 4TNUA 3CPAA 2XEGA 1F2OA 4O23A 1ARLA 3FX6A 4ZI6A 1CP6A 3LMSA 1VHOA 4Z65A 1BPNA 1NSAA 3KR5A 4UEEA 3PB9X 1BAVA 2NSMA 2ZEOA 3PFOA 4MCQA 3GLJA 2EK8A 4F9VA 3HUVA 4NGMA 4LQGA 2CF4A 4IHMA 3PBBA 1AMPA 1ZLHA
chains in the Genus database with same CATH superfamily
4MHPA 1LOKA 4KSIA 2OOTA 2ABZA 2R98A 2PR1A 2OR4A 5LRJA 4F0YA 4M85A 1I1DA 1B6BA 2FVGA 4MY0A 5EBVA 4KUAA 4YWYA 5LRKA 2ZXVA 4JWPA 3VATA 3MRUA 3SHPA 2PJ9A 2WUUA 1ON0A 3TCVA 3ISXA 4JJXA 3IU2A 2VL1A 4AB7A 1XF8A 6CPAA 3I3GA 3DLJA 2HC9A 5DS0A 4Q38A 2NYQA 3H8FA 3SI1A 1QMUA 2V8GA 5G1ZA 4B12A 1S7KA 4ZX9A 5E96A 3R9EA 2CTCA 2YNEA 2R8VA 1ARMA 1RTQA 1IB1E 4U9YA 2PIYA 3BI0A 5G21A 3D3SA 4KLWA 1HEEA 3KZWA 2ODFA 4M6HA 1XOVA 3WC6A 3IGRA 4PK2A 4MI4A 3KHXA 2AFOA 3I1UA 2Z3KA 4P6YA 5IV0A 1UFHA 2EWBA 2CTBA 2JBKA 2WSAA 4NJRA 3PFEA 1CJWA 3OWCA 3B3CA 4OC3A 4KORA 2JDDA 3IO1A 3PB8X 3S9NA 1S5KA 4FD4A 1LAMA 2Q4VA 1Z8XA 2D4PA 2YNDA 3NH5A 4KZTA 4JD6A 5LYDA 5LYLA 1M1DA 2FE7A 3GYAA 1Z8WA 4FUUA 4QC6A 4C2XA 2PCUA 2OZGA 3NE7A 1PYTB 4OC4A 2CNSA 3FIXA 4GM5A 3V8IA 3IEHA 3QB8A 4H2KA 4B14A 3TO9A 2Z10A 1XIXA 4NGPA 1Z8TA 2HV2A 4KOXA 3S6FA 3FYNA 2PJ5A 1R43A 3IJ3A 4RN7A 3TX8A 4CGMA 4OMEA 2PJ3A 1Y7EA 2G9DA 4F6AA 2B4DB 3MGDA 1ZO0A 2C6GA 2GIVA 3QAYA 5JQ4A 2ZW6A 4P4DA 1MK4A 4DJLA 1IYKA 2ANPA 1YQEA 1Z2LA 4A2ZA 1Z9UA 3FH4A 3KASA 3T9YA 2B5GA 1CPXA 1NMTA 3C26A 2ZELA 4HNXB 4UWJA 4UIAA 4R3KA 3BJ8A 8CPAA 1YLOA 1AYEA 2BUEA 1Y9KA 2FCKA 3PEIA 2PIZA 1KUXA 3FJUA 4HNWB 4MRIA 4UFVA 3NFZA 3IC1A 4OAEA 4PXCA 3IFEA 3IWEA 3KHZA 3PB4X 2PJ7A 4XPLA 1Z4EA 4PXEA 1OZPA 4NF1A 4KOYA 3IIBA 4H6UA 2P6GA 4JXQA 2Z0ZA 2YGWA 1CM0A 1IGBA 4RI1A 2CNMA 1M4GA 3PB7X 3WABA 1QSRA 4U5YA 2PVWA 1IY7A 2OZHA 4OP4A 2RB7A 3TT2A 1Z4RA 1Z8LA 2V77A 4OLLA 2GANA 1YLEA 4UEZA 2AFWA 4DYOA 4F0XA 2PC1A 2H5MA 4K30A 2FIAA 4IF5A 4UA3A 2YNCA 2WPXA 5K8PA 4OC2A 2F8HA 2Z3PA 4PK3A 4CAXA 3KKWA 2G3AA 3B3SA 1XMBA 3JUWA 1YVKA 3IWGA 4CAWA 1ZG8A 3LWUA 2AJ6A 3KQXA 1DE4C 1TXRA 1TKJA 4ZY0A 1IICA 1JWQA 2ZEPA 3QAHA 3LD2A 2ATRA 2RC4A 3SJGA 5HXDA 4UCPA 1YX0A 2FIWA 3GY9A 3RYOA 3FRMA 4X5KA 4WJBA 1EE3P 4KVME 1NSLA 5D29A 4NGNA 3FEEA 4W9YA 5F48A 5DWMA 5K8NA 3B3WA 1KUVA 2PJ8A 2VEZA 4FAIA 3FF3A 2Q7BA 3CDXA 2Q7SA 3I9SA 2ZEMA 5KTCA 3TE4A 1SQHA 3D4UA 4C2YA 5IX3A 4YRHA 3PBEA 4MY3A 2IJZA 2VI7A 3D67A 1WWZA 1XFOA 4MJ8A 1LCPA 5EMIA 5GCNA 4A31A 5CPAA 2ZW4A 2P6EA 4G1PA 4UFWA 4EVYA 4A32A 3RBUA 5HVGA 3R96A 4A94A 3CZXA 4C7HA 3W91A 2JEVA 2OZUA 2DPSA 3D8PA 1Q2YA 1FNOA 4MFKA 2GU2A 4B5PB 1CBXA 4AVAA 3BLNA 4JZ0A 2IMOA 2PDOA 5JH9A 5LYFA 2PJAA 3KL9A 2JDCA 1YW6A 2R7HA 2HB6A 2EBJA 2PQ8A 4CYOA 1Y0YA 2Q4ZA 4K3NA 1IYLA 3ZZIA 1CP7A 1P0HA 2EK9A 1BLLE 3E0KA 2VXKA 4R57A 5DWNA 3GUXA 2EVNA 2I00A 1ELMP 1U6MA 4B6ZA 3G3SA 4P45A 5I4MA 4CGPA 4HPSA 5JM6A 1ZLIA 3D7GA 4R7MA 3CT9A 1XE4A 2GREA 4FD7A 4KSFA 4R6TA 2VQYA 2C27A 3F8KA 5G20A 4BMHA 3B35A 2V8DA 4ONUA 2PJBA 1TF8A 2B58A 5HVHA 3P2HA 3KI9A 3DDDA 2B4BA 5JPHA 3PP9A 3V7ZA 4CPAA 1QSTA 1BPMA 4B5PA 2ZOFA 2IQ6A 4FD5A 3TO6A 3NA6A 4NGTA 4TWEA 3EXNA 2FL4A 2V8HA 4X2TA 5IB9A 2G3TA 3TO7A 2B5GB 2VBQA 1IOFA 2B3VA 4MFPA 4RUHA 3L2NA 4UIBA 4LX9A 5CBMA 2FXFA 3FXTA 4PXBA 4R87A 1R3NA 1RO5A 3PZJA 1YSJA 4M6IA 1PCAA 4CRZB 4J3GA 2Z3OA 1KZFA 3BHXA 4R9MA 4CAEA 4UWIA 2J8NA 4MFJA 4PSWA 4CRYB 1Q7LA 3IWWA 2YNCC 4UF4A 2P6FA 3WT4A 2NMTA 4B10A 4WWVA 2XEFA 3VARA 4PPZA 2DXQA 2ARHA 4QUSA 2EUIA 2REEA 3CXSA 3H5ZA 1MJAA 2IL4A 3FEDA 2B3UA 2BO9A 4OIDA 3DR6A 3TOBA 4EFDA 3P2FA 2PJ0A 4HNYB 4QB9A 1L0CA 4A33A 3JTKA 5JGFA 5J1QA 2ZEEA 3JVNA 2I79A 1CX8A 4QVTA 5F09A 1M4LA 1TF9A 3SJEA 4MCRA 4E2AA 1XEBA 2F5IA 2FSRA 2QECA 3B3VA 1M4DA 4PV6A 2JLMA 4IK2A 2AFMA 2Z11A 4FBEA 1S60A 4YGOA 3FNCA 3H8GA 1TKFA 4YU9A 4KLVA 3K9UA 2BL1A 2QVPA 2J9AA 1VHEA 2ZEGA 3HLPA 4NGRA 3B7IA 1GYTA 3PGPA 4AVBA 3KGQA 4ZY1A 2O4HA 4II9A 1P4NA 5ELYA 1K4JA 4XNHC 4KSAA 2QJ8A 2Q04A 4X3RA 5AG7A 1JQGA 2Z3LA 5HMNA 2HQYA 3SI0A 4IUSA 3RAMA 4UCNA 3H8EA 3S9MA 3WR7A 5A28A 1ZG7A 2F7VA 4KUBA 2PRQA 2CY2A 2PR8A 2POKA 5BWAB 4X8IA 7CPAA 3S6GA 4MCPA 2R1IA 4MBUA 3SXOA 2I3CA 3DGVA 1Y7RA 1VGYA 2PRBA 4FD6A 4KS9A 4Y49B 4NXYA 4CGNA 4A30A 4XNHB 4C2ZA 4CYQA 4P10A 3BJ7A 2ZENA 4ZYQA 4ONWA 3PRTA 4KOTA 3VWDA 1PU9A 2DF5A 2PJ1A 2JBJA 1X10A 1QSNA 3MN8A 4AVCA 1NE9A 2J8RA 5C88A 2BEIA 3BXMA 4MFLA 2DPTA 4Q7AA 5F47A 4E8OA 2ZOGA 5LRGA 2PJCA 1H8LA 2Q0YA 3N7ZA 3D2MA 2Q4YA 1YVOA 5AG4A 2AFSA 3CPXA 2PJ2A 3GB0A 3R9GA 2OB0A 3D7HA 1ELLP 3RZAA 1BOBA 2O53A 4RS2A 1TIQA 4NGQA 3F0AA 4CYNA 3BI1A 3JRUA 1UWYA 1TKHA 4KVOE 2GLJA 2Z3NA 3LODA 3DR8A 3SI2A 2WZNA 4FWUA 4JYWA 3UY5A 4A39A 2BOAA 3WC5A 3G8WA 4L89A 4NGSA 4PQAA 4A95A 4EMEA 4CYPA 1VHSA 2HUZA 5AG6A 4EWTA 3GKRA 4CGLA 2PJ4A 1BO4A 4F8ZA 1VIXA 1LFWA 3D7DA 5H86A 1IOIA 3B2YA 4L8AA 4MHDA 1YMEA 3D68A 4ZX8A 5HVFA 1PUAA 3WC7A 4XPKA 4BD9A 1XBUA 2PSWA 2Y0MA 2V8VA 3V38A 5J8CA 2AE6A 1Z5RA 2BSWA 1VKCA 2JEWA 2DEAA 2BCOA 4ORFA 1XRYA 2Q51A 5LYIA 1XMTA 1F57A 2ZEDA 4XPDC 2GFQA 1YR0A 4B13A 3K2KA 2CXAA 3GIUA 4ZY2A 3TFYA 4A38A 4KOSA 4CS0B 4PXDA 1X12A 1QSMA 5A27A 5EC4A 2EO8A 2OH1A 4MFZA 2XEJA 3VH9A 1FT7A 2WYRA 4OADA 5K8OA 4P4EA 3S9LA 2XEIA 3EY5A 5K8MA 5THWA 5J8FA 3S6HA 2D4OA 4MFQA 1QQ9A 4B11A 5AG5A 2C1CA 2RFHA 4OC0A 4R3LA 3RO0A 1S7LA 3TC8A 1F2PA 2GLFA 4KOWA 4R8FA 2FS5A 4DUKA 4XPDB 3KR4A 4P4FA 4AXVA 4P4BA 1MJ9A 1YREA 3EC4A 5D8NA 2C6CA 4ZBGA 4NEXA 4PSXA 5G22A 1RXTA 2CIJA 3TTHA 2PJ6A 4C68A 1OBRA 3KQZA 2Z3MA 2FT0A 4M6GA 2PVVA 1YGHA 4OC5A 4IAVA 4P44A 1HDUA 1Q2DA 3FVLA 3DNSA 5F46A 2AFXA 3EO4A 1Y0RA 1YW4A 3W6XA 4M3SA 4HKFA 3FBUA 4C7IA 2VZZA 1KWMA 1M4IA 2CNTA 4MHZA 4MMOA 3R9FA 4NSQA 3D66A 1J4JA 4P4IA 1AUGA 2P0WA 5FVJA 4E0AA 4H89A 4NFRA 2ZPAA 5HH1A 4MCSA 2WPWA 2REFA 2Q43A 1LRZA 3PB6X 1XJOA 1QSOA 2AFUA 5AGEA 4UEFA 2QMLA 1B87A 4KVXA 1GHEA 3NE8A 2Q44A 1V0CA 4ZGYB 1FY7A 5C82A 3FECA 1ZG9A 1R57A 4OC1A 3FMCA 4Y49C 3RNZA 1CG2A 1LANA 3W6SA 2K5TA 2ZEHA 1A2ZA 3FB3A 1Q2CA 3K9TA 3EFAA 2ZW7A 1I21A 4CAFA 4NCZA 4LUAA 3S6KA 2OU2A 3A9LA 1KUYA 4H6ZA 3VWEA 3CXQA 3SJXA 1Y9WA 2ZW5A 4KOVA 1IIDA 4MHNA 3QNVA 2C6PA 3B3TA 5I0CA 4B5OA 4F9UA 3T8WA 3NH4A 2J8MA 4QBJA 4MXUA 1HDQA 4CGOA 1CPSA 2PE3A 4UCMA 4NJQA 3SJFA 4AG9A 1S3ZA 3CXPA 2B4DA 1LAPA 3D2PA 4P4JA 4YFJA 3D7FA 1DTDA 2AFZA 1M44A 4OIWA 1N71A 3ISZA 4JXRA 4MHYA 3N5FA 2QYVA 3NH8A 5CNPA 2ZEFA 3H4QA 2X7BA 1WK4A 3IU1A 3LACA 4BBHA 4R76A 2QIRA 4A37A 4OKOA 5ISVA 4TNUA 1IU8A 3CPAA 2XEGA 3T90A 4Q36A 1F2OA 1I12A 4GXHA 2GE3A 4O23A 1ARLA 3FX6A 4ZI6A 1CP6A 1S7NA 3LMSA 1VHOA 3ZJ0A 4Z65A 1BPNA 1NSAA 3KR5A 4UEEA 4BINA 4DNCA 4I49A 3PB9X 1BAVA 3B8GA 3F5BA 3R1KA 4JLYA 4UFXA 5F49A 2NSMA 2ZEOA 4CAVA 1MJBA 3PFOA 4MCQA 5IB0A 3GLJA 3DSBA 4GS4A 5H84A 2VZYA 4KOUA 2EK8A 4LQ6A 4F9VA 4UBRA 3HUVA 2KCWA 5KTAA 2O28A 5KTDA 3SXNA 2A4NA 3R95A 2G0BA 4NGMA 4LQGA 4U9ZA 2CF4A 4IHMA 4AG7A 3PBBA 1AMPA 1ZLHA 1YK3A 1S7FA 3TOAA
chains in the Genus database with same CATH topology
4MHPA 1LOKA 4KSIA 2OOTA 2ABZA 2OR4A 5LRJA 2FVGA 4YWYA 5LRKA 3VATA 3MRUA 2PJ9A 3ISXA 2VL1A 6CPAA 3DLJA 2HC9A 5DS0A 3SI1A 2NYQA 3H8FA 1QMUA 2V8GA 4ZX9A 2CTCA 1ARMA 1RTQA 2PIYA 3BI0A 1HEEA 3KZWA 3WC6A 3KHXA 2AFOA 3I1UA 4P6YA 2EWBA 2CTBA 2JBKA 4NJRA 3PFEA 4OC3A 3B3CA 3IO1A 3PB8X 3S9NA 1LAMA 3NH5A 5LYDA 5LYLA 4FUUA 2PCUA 4OC4A 1PYTB 4GM5A 3IEHA 4H2KA 4NGPA 2PJ5A 1R43A 3IJ3A 3TX8A 4OMEA 2PJ3A 1Y7EA 2G9DA 2C6GA 4P4DA 4DJLA 2ANPA 1Z2LA 3FH4A 3KASA 1CPXA 2ZELA 4UIAA 8CPAA 1YLOA 1AYEA 3PEIA 2PIZA 3FJUA 4MRIA 3NFZA 3IC1A 4PXCA 3IFEA 3KHZA 3PB4X 2PJ7A 4PXEA 3IIBA 1IGBA 3WABA 3PB7X 2PVWA 1IY7A 4OP4A 2RB7A 1Z8LA 2V77A 4UEZA 2AFWA 4DYOA 5K8PA 4OC2A 2F8HA 3B3SA 1XMBA 1ZG8A 3LWUA 3KQXA 1DE4C 1TXRA 1TKJA 4ZY0A 2ZEPA 3SJGA 5HXDA 4WJBA 1EE3P 5D29A 4NGNA 3FEEA 4W9YA 5K8NA 3B3WA 4FAIA 2PJ8A 3FF3A 3CDXA 2ZEMA 3D4UA 3PBEA 2IJZA 3D67A 1XFOA 1LCPA 5CPAA 4G1PA 3RBUA 5HVGA 4A94A 1FNOA 2GU2A 1CBXA 4JZ0A 2IMOA 5JH9A 5LYFA 2PJAA 3KL9A 1YW6A 2HB6A 1Y0YA 2Q4ZA 4K3NA 1CP7A 2EK9A 1BLLE 3GUXA 1ELMP 4B6ZA 5JM6A 4P45A 5I4MA 1ZLIA 3D7GA 4R7MA 3CT9A 2GREA 4R6TA 3B35A 2V8DA 2PJBA 1TF8A 5HVHA 3KI9A 3V7ZA 4CPAA 1BPMA 2ZOFA 2IQ6A 3NA6A 4NGTA 4TWEA 2V8HA 4X2TA 5IB9A 4RUHA 3L2NA 4UIBA 5CBMA 4PXBA 1R3NA 1YSJA 1PCAA 3BHXA 1Q7LA 3IWWA 4UF4A 3WT4A 4WWVA 2XEFA 3VARA 4PPZA 3FEDA 2BO9A 4OIDA 4EFDA 2PJ0A 5JGFA 5J1QA 2ZEEA 1CX8A 5F09A 1M4LA 1TF9A 3SJEA 4MCRA 3B3VA 4IK2A 2AFMA 4FBEA 3H8GA 1TKFA 4YU9A 2QVPA 2J9AA 1VHEA 2ZEGA 3HLPA 4NGRA 3B7IA 1GYTA 4ZY1A 3KGQA 2O4HA 5ELYA 2QJ8A 4X3RA 1JQGA 3SI0A 3RAMA 3S9MA 3H8EA 1ZG7A 2F7VA 2PRQA 2POKA 4X8IA 7CPAA 4MCPA 2I3CA 3DGVA 1VGYA 4P10A 2ZENA 4ZYQA 4ONWA 3PRTA 2PJ1A 2JBJA 3MN8A 3BXMA 4Q7AA 2ZOGA 5LRGA 2PJCA 1H8LA 2AFSA 3CPXA 2PJ2A 3GB0A 3D7HA 1ELLP 3RZAA 2O53A 4NGQA 3BI1A 3JRUA 1UWYA 1TKHA 2GLJA 3SI2A 2WZNA 4FWUA 4JYWA 4A39A 2BOAA 3WC5A 4EMEA 4NGSA 4PQAA 4EWTA 2PJ4A 4F8ZA 1VIXA 1LFWA 3D7DA 3B2YA 1YMEA 3D68A 4ZX8A 5HVFA 3WC7A 4BD9A 1XBUA 3V38A 2V8VA 1Z5RA 2JEWA 2DEAA 2BCOA 1XRYA 2Q51A 5LYIA 1F57A 2ZEDA 3K2KA 4ZY2A 4A38A 4PXDA 3VH9A 2XEJA 1FT7A 2WYRA 5K8OA 3S9LA 4P4EA 2XEIA 5K8MA 5THWA 1QQ9A 2C1CA 2RFHA 4OC0A 3TC8A 1F2PA 2GLFA 4R8FA 4DUKA 3KR4A 4P4FA 4AXVA 4P4BA 5D8NA 2C6CA 2CIJA 2PJ6A 1OBRA 3KQZA 2PVVA 4OC5A 4IAVA 4P44A 1HDUA 3FVLA 2AFXA 1Y0RA 1YW4A 1KWMA 4MHZA 4MMOA 3D66A 4P4IA 4NFRA 4MCSA 2Q43A 3PB6X 1XJOA 2AFUA 4UEFA 3FECA 1ZG9A 4OC1A 3FMCA 1CG2A 1LANA 2ZEHA 3K9TA 3SJXA 4MHNA 3QNVA 2C6PA 3B3TA 4F9UA 3T8WA 3NH4A 4MXUA 1HDQA 1CPSA 2PE3A 3SJFA 4NJQA 1LAPA 4P4JA 3D7FA 1DTDA 2AFZA 4OIWA 3ISZA 4MHYA 3N5FA 2QYVA 3NH8A 2ZEFA 4R76A 4A37A 4OKOA 4TNUA 3CPAA 2XEGA 1F2OA 4O23A 1ARLA 3FX6A 4ZI6A 1CP6A 3LMSA 1VHOA 4Z65A 1BPNA 1NSAA 3KR5A 4UEEA 3PB9X 1BAVA 2NSMA 2ZEOA 3PFOA 4MCQA 3GLJA 2EK8A 4F9VA 3HUVA 4NGMA 4LQGA 2CF4A 4IHMA 3PBBA 1AMPA 1ZLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MHP A;  1LOK A;  4KSI A;  2OOT A;  2ABZ A;  2OR4 A;  5LRJ A;  2FVG A;  4YWY A;  5LRK A;  3VAT A;  3MRU A;  2PJ9 A;  3ISX A;  2VL1 A;  6CPA A;  3DLJ A;  2HC9 A;  5DS0 A;  3SI1 A;  2NYQ A;  3H8F A;  1QMU A;  2V8G A;  4ZX9 A;  2CTC A;  1ARM A;  1RTQ A;  2PIY A;  3BI0 A;  1HEE A;  3KZW A;  3WC6 A;  3KHX A;  2AFO A;  3I1U A;  4P6Y A;  2EWB A;  2CTB A;  2JBK A;  4NJR A;  3PFE A;  4OC3 A;  3B3C A;  3IO1 A;  3PB8 X;  3S9N A;  1LAM A;  3NH5 A;  5LYD A;  5LYL A;  4FUU A;  2PCU A;  4OC4 A;  1PYT B;  4GM5 A;  3IEH A;  4H2K A;  4NGP A;  2PJ5 A;  1R43 A;  3IJ3 A;  3TX8 A;  4OME A;  2PJ3 A;  1Y7E A;  2G9D A;  2C6G A;  4P4D A;  4DJL A;  2ANP A;  1Z2L A;  3FH4 A;  3KAS A;  1CPX A;  2ZEL A;  4UIA A;  8CPA A;  1YLO A;  1AYE A;  3PEI A;  2PIZ A;  3FJU A;  4MRI A;  3NFZ A;  3IC1 A;  4PXC A;  3IFE A;  3KHZ A;  3PB4 X;  2PJ7 A;  4PXE A;  3IIB A;  1IGB A;  3WAB A;  3PB7 X;  2PVW A;  1IY7 A;  4OP4 A;  2RB7 A;  1Z8L A;  2V77 A;  4UEZ A;  2AFW A;  4DYO A;  5K8P A;  4OC2 A;  2F8H A;  3B3S A;  1XMB A;  1ZG8 A;  3LWU A;  3KQX A;  1DE4 C;  1TXR A;  1TKJ A;  4ZY0 A;  2ZEP A;  3SJG A;  5HXD A;  4WJB A;  1EE3 P;  5D29 A;  4NGN A;  3FEE A;  4W9Y A;  5K8N A;  3B3W A;  4FAI A;  2PJ8 A;  3FF3 A;  3CDX A;  2ZEM A;  3D4U A;  3PBE A;  2IJZ A;  3D67 A;  1XFO A;  1LCP A;  5CPA A;  4G1P A;  3RBU A;  5HVG A;  4A94 A;  1FNO A;  2GU2 A;  1CBX A;  4JZ0 A;  2IMO A;  5JH9 A;  5LYF A;  2PJA A;  3KL9 A;  1YW6 A;  2HB6 A;  1Y0Y A;  2Q4Z A;  4K3N A;  1CP7 A;  2EK9 A;  1BLL E;  3GUX A;  1ELM P;  4B6Z A;  5JM6 A;  4P45 A;  5I4M A;  1ZLI A;  3D7G A;  4R7M A;  3CT9 A;  2GRE A;  4R6T A;  3B35 A;  2V8D A;  2PJB A;  1TF8 A;  5HVH A;  3KI9 A;  3V7Z A;  4CPA A;  1BPM A;  2ZOF A;  2IQ6 A;  3NA6 A;  4NGT A;  4TWE A;  2V8H A;  4X2T A;  5IB9 A;  4RUH A;  3L2N A;  4UIB A;  5CBM A;  4PXB A;  1R3N A;  1YSJ A;  1PCA A;  3BHX A;  1Q7L A;  3IWW A;  4UF4 A;  3WT4 A;  4WWV A;  2XEF A;  3VAR A;  4PPZ A;  3FED A;  2BO9 A;  4OID A;  4EFD A;  2PJ0 A;  5JGF A;  5J1Q A;  2ZEE A;  1CX8 A;  5F09 A;  1M4L A;  1TF9 A;  3SJE A;  4MCR A;  3B3V A;  4IK2 A;  2AFM A;  4FBE A;  3H8G A;  1TKF A;  4YU9 A;  2QVP A;  2J9A A;  1VHE A;  2ZEG A;  3HLP A;  4NGR A;  3B7I A;  1GYT A;  4ZY1 A;  3KGQ A;  2O4H A;  5ELY A;  2QJ8 A;  4X3R A;  1JQG A;  3SI0 A;  3RAM A;  3S9M A;  3H8E A;  1ZG7 A;  2F7V A;  2PRQ A;  2POK A;  4X8I A;  7CPA A;  4MCP A;  2I3C A;  3DGV A;  1VGY A;  4P10 A;  2ZEN A;  4ZYQ A;  4ONW A;  3PRT A;  2PJ1 A;  2JBJ A;  3MN8 A;  3BXM A;  4Q7A A;  2ZOG A;  5LRG A;  2PJC A;  1H8L A;  2AFS A;  3CPX A;  2PJ2 A;  3GB0 A;  3D7H A;  1ELL P;  3RZA A;  2O53 A;  4NGQ A;  3BI1 A;  3JRU A;  1UWY A;  1TKH A;  2GLJ A;  3SI2 A;  2WZN A;  4FWU A;  4JYW A;  4A39 A;  2BOA A;  3WC5 A;  4EME A;  4NGS A;  4PQA A;  4EWT A;  2PJ4 A;  4F8Z A;  1VIX A;  1LFW A;  3D7D A;  3B2Y A;  1YME A;  3D68 A;  4ZX8 A;  5HVF A;  3WC7 A;  4BD9 A;  1XBU A;  3V38 A;  2V8V A;  1Z5R A;  2JEW A;  2DEA A;  2BCO A;  1XRY A;  2Q51 A;  5LYI A;  1F57 A;  2ZED A;  3K2K A;  4ZY2 A;  4A38 A;  4PXD A;  3VH9 A;  2XEJ A;  1FT7 A;  2WYR A;  5K8O A;  3S9L A;  4P4E A;  2XEI A;  5K8M A;  5THW A;  1QQ9 A;  2C1C A;  2RFH A;  4OC0 A;  3TC8 A;  1F2P A;  2GLF A;  4R8F A;  4DUK A;  3KR4 A;  4P4F A;  4AXV A;  4P4B A;  5D8N A;  2C6C A;  2CIJ A;  2PJ6 A;  1OBR A;  3KQZ A;  2PVV A;  4OC5 A;  4IAV A;  4P44 A;  1HDU A;  3FVL A;  2AFX A;  1Y0R A;  1YW4 A;  1KWM A;  4MHZ A;  4MMO A;  3D66 A;  4P4I A;  4NFR A;  4MCS A;  2Q43 A;  3PB6 X;  1XJO A;  2AFU A;  4UEF A;  3FEC A;  1ZG9 A;  4OC1 A;  3FMC A;  1CG2 A;  1LAN A;  2ZEH A;  3K9T A;  3SJX A;  4MHN A;  3QNV A;  2C6P A;  3B3T A;  4F9U A;  3T8W A;  3NH4 A;  4MXU A;  1HDQ A;  1CPS A;  2PE3 A;  3SJF A;  4NJQ A;  1LAP A;  4P4J A;  3D7F A;  1DTD A;  2AFZ A;  4OIW A;  3ISZ A;  4MHY A;  3N5F A;  2QYV A;  3NH8 A;  2ZEF A;  4R76 A;  4A37 A;  4OKO A;  4TNU A;  3CPA A;  2XEG A;  1F2O A;  4O23 A;  1ARL A;  3FX6 A;  4ZI6 A;  1CP6 A;  3LMS A;  1VHO A;  4Z65 A;  1BPN A;  1NSA A;  3KR5 A;  4UEE A;  3PB9 X;  1BAV A;  2NSM A;  2ZEO A;  3PFO A;  4MCQ A;  3GLJ A;  2EK8 A;  4F9V A;  3HUV A;  4NGM A;  4LQG A;  2CF4 A;  4IHM A;  3PBB A;  1AMP A;  1ZLH A; 
#chains in the Genus database with same CATH topology
 4MHP A;  1LOK A;  4KSI A;  2OOT A;  2ABZ A;  2R98 A;  2PR1 A;  2OR4 A;  5LRJ A;  4F0Y A;  4M85 A;  1I1D A;  1B6B A;  2FVG A;  4MY0 A;  5EBV A;  4KUA A;  4YWY A;  5LRK A;  2ZXV A;  4JWP A;  3VAT A;  3MRU A;  3SHP A;  2PJ9 A;  2WUU A;  1ON0 A;  3TCV A;  3ISX A;  4JJX A;  3IU2 A;  2VL1 A;  4AB7 A;  1XF8 A;  6CPA A;  3I3G A;  3DLJ A;  2HC9 A;  5DS0 A;  4Q38 A;  2NYQ A;  3H8F A;  3SI1 A;  1QMU A;  2V8G A;  5G1Z A;  4B12 A;  1S7K A;  4ZX9 A;  5E96 A;  3R9E A;  2CTC A;  2YNE A;  2R8V A;  1ARM A;  1RTQ A;  1IB1 E;  4U9Y A;  2PIY A;  3BI0 A;  5G21 A;  3D3S A;  4KLW A;  1HEE A;  3KZW A;  2ODF A;  4M6H A;  1XOV A;  3WC6 A;  3IGR A;  4PK2 A;  4MI4 A;  3KHX A;  2AFO A;  3I1U A;  2Z3K A;  4P6Y A;  5IV0 A;  1UFH A;  2EWB A;  2CTB A;  2JBK A;  2WSA A;  4NJR A;  3PFE A;  1CJW A;  3OWC A;  3B3C A;  4OC3 A;  4KOR A;  2JDD A;  3IO1 A;  3PB8 X;  3S9N A;  1S5K A;  4FD4 A;  1LAM A;  2Q4V A;  1Z8X A;  2D4P A;  2YND A;  3NH5 A;  4KZT A;  4JD6 A;  5LYD A;  5LYL A;  1M1D A;  2FE7 A;  3GYA A;  1Z8W A;  4FUU A;  4QC6 A;  4C2X A;  2PCU A;  2OZG A;  3NE7 A;  1PYT B;  4OC4 A;  2CNS A;  3FIX A;  4GM5 A;  3V8I A;  3IEH A;  3QB8 A;  4H2K A;  4B14 A;  3TO9 A;  2Z10 A;  1XIX A;  4NGP A;  1Z8T A;  2HV2 A;  4KOX A;  3S6F A;  3FYN A;  2PJ5 A;  1R43 A;  3IJ3 A;  4RN7 A;  3TX8 A;  4CGM A;  4OME A;  2PJ3 A;  1Y7E A;  2G9D A;  4F6A A;  2B4D B;  3MGD A;  1ZO0 A;  2C6G A;  2GIV A;  3QAY A;  5JQ4 A;  2ZW6 A;  4P4D A;  1MK4 A;  4DJL A;  1IYK A;  2ANP A;  1YQE A;  1Z2L A;  4A2Z A;  1Z9U A;  3FH4 A;  3KAS A;  3T9Y A;  2B5G A;  1CPX A;  1NMT A;  3C26 A;  2ZEL A;  4HNX B;  4UWJ A;  4UIA A;  4R3K A;  3BJ8 A;  8CPA A;  1YLO A;  1AYE A;  2BUE A;  1Y9K A;  2FCK A;  3PEI A;  2PIZ A;  1KUX A;  3FJU A;  4HNW B;  4MRI A;  4UFV A;  3NFZ A;  3IC1 A;  4OAE A;  4PXC A;  3IFE A;  3IWE A;  3KHZ A;  3PB4 X;  2PJ7 A;  4XPL A;  1Z4E A;  4PXE A;  1OZP A;  4NF1 A;  4KOY A;  3IIB A;  4H6U A;  2P6G A;  4JXQ A;  2Z0Z A;  2YGW A;  1CM0 A;  1IGB A;  4RI1 A;  2CNM A;  1M4G A;  3PB7 X;  3WAB A;  1QSR A;  4U5Y A;  2PVW A;  1IY7 A;  2OZH A;  4OP4 A;  2RB7 A;  3TT2 A;  1Z4R A;  1Z8L A;  2V77 A;  4OLL A;  2GAN A;  1YLE A;  4UEZ A;  2AFW A;  4DYO A;  4F0X A;  2PC1 A;  2H5M A;  4K30 A;  2FIA A;  4IF5 A;  4UA3 A;  2YNC A;  2WPX A;  5K8P A;  4OC2 A;  2F8H A;  2Z3P A;  4PK3 A;  4CAX A;  3KKW A;  2G3A A;  3B3S A;  1XMB A;  3JUW A;  1YVK A;  3IWG A;  4CAW A;  1ZG8 A;  3LWU A;  2AJ6 A;  3KQX A;  1DE4 C;  1TXR A;  1TKJ A;  4ZY0 A;  1IIC A;  1JWQ A;  2ZEP A;  3QAH A;  3LD2 A;  2ATR A;  2RC4 A;  3SJG A;  5HXD A;  4UCP A;  1YX0 A;  2FIW A;  3GY9 A;  3RYO A;  3FRM A;  4X5K A;  4WJB A;  1EE3 P;  4KVM E;  1NSL A;  5D29 A;  4NGN A;  3FEE A;  4W9Y A;  5F48 A;  5DWM A;  5K8N A;  3B3W A;  1KUV A;  2PJ8 A;  2VEZ A;  4FAI A;  3FF3 A;  2Q7B A;  3CDX A;  2Q7S A;  3I9S A;  2ZEM A;  5KTC A;  3TE4 A;  1SQH A;  3D4U A;  4C2Y A;  5IX3 A;  4YRH A;  3PBE A;  4MY3 A;  2IJZ A;  2VI7 A;  3D67 A;  1WWZ A;  1XFO A;  4MJ8 A;  1LCP A;  5EMI A;  5GCN A;  4A31 A;  5CPA A;  2ZW4 A;  2P6E A;  4G1P A;  4UFW A;  4EVY A;  4A32 A;  3RBU A;  5HVG A;  3R96 A;  4A94 A;  3CZX A;  4C7H A;  3W91 A;  2JEV A;  2OZU A;  2DPS A;  3D8P A;  1Q2Y A;  1FNO A;  4MFK A;  2GU2 A;  4B5P B;  1CBX A;  4AVA A;  3BLN A;  4JZ0 A;  2IMO A;  2PDO A;  5JH9 A;  5LYF A;  2PJA A;  3KL9 A;  2JDC A;  1YW6 A;  2R7H A;  2HB6 A;  2EBJ A;  2PQ8 A;  4CYO A;  1Y0Y A;  2Q4Z A;  4K3N A;  1IYL A;  3ZZI A;  1CP7 A;  1P0H A;  2EK9 A;  1BLL E;  3E0K A;  2VXK A;  4R57 A;  5DWN A;  3GUX A;  2EVN A;  2I00 A;  1ELM P;  1U6M A;  4B6Z A;  3G3S A;  4P45 A;  5I4M A;  4CGP A;  4HPS A;  5JM6 A;  1ZLI A;  3D7G A;  4R7M A;  3CT9 A;  1XE4 A;  2GRE A;  4FD7 A;  4KSF A;  4R6T A;  2VQY A;  2C27 A;  3F8K A;  5G20 A;  4BMH A;  3B35 A;  2V8D A;  4ONU A;  2PJB A;  1TF8 A;  2B58 A;  5HVH A;  3P2H A;  3KI9 A;  3DDD A;  2B4B A;  5JPH A;  3PP9 A;  3V7Z A;  4CPA A;  1QST A;  1BPM A;  4B5P A;  2ZOF A;  2IQ6 A;  4FD5 A;  3TO6 A;  3NA6 A;  4NGT A;  4TWE A;  3EXN A;  2FL4 A;  2V8H A;  4X2T A;  5IB9 A;  2G3T A;  3TO7 A;  2B5G B;  2VBQ A;  1IOF A;  2B3V A;  4MFP A;  4RUH A;  3L2N A;  4UIB A;  4LX9 A;  5CBM A;  2FXF A;  3FXT A;  4PXB A;  4R87 A;  1R3N A;  1RO5 A;  3PZJ A;  1YSJ A;  4M6I A;  1PCA A;  4CRZ B;  4J3G A;  2Z3O A;  1KZF A;  3BHX A;  4R9M A;  4CAE A;  4UWI A;  2J8N A;  4MFJ A;  4PSW A;  4CRY B;  1Q7L A;  3IWW A;  2YNC C;  4UF4 A;  2P6F A;  3WT4 A;  2NMT A;  4B10 A;  4WWV A;  2XEF A;  3VAR A;  4PPZ A;  2DXQ A;  2ARH A;  4QUS A;  2EUI A;  2REE A;  3CXS A;  3H5Z A;  1MJA A;  2IL4 A;  3FED A;  2B3U A;  2BO9 A;  4OID A;  3DR6 A;  3TOB A;  4EFD A;  3P2F A;  2PJ0 A;  4HNY B;  4QB9 A;  1L0C A;  4A33 A;  3JTK A;  5JGF A;  5J1Q A;  2ZEE A;  3JVN A;  2I79 A;  1CX8 A;  4QVT A;  5F09 A;  1M4L A;  1TF9 A;  3SJE A;  4MCR A;  4E2A A;  1XEB A;  2F5I A;  2FSR A;  2QEC A;  3B3V A;  1M4D A;  4PV6 A;  2JLM A;  4IK2 A;  2AFM A;  2Z11 A;  4FBE A;  1S60 A;  4YGO A;  3FNC A;  3H8G A;  1TKF A;  4YU9 A;  4KLV A;  3K9U A;  2BL1 A;  2QVP A;  2J9A A;  1VHE A;  2ZEG A;  3HLP A;  4NGR A;  3B7I A;  1GYT A;  3PGP A;  4AVB A;  3KGQ A;  4ZY1 A;  2O4H A;  4II9 A;  1P4N A;  5ELY A;  1K4J A;  4XNH C;  4KSA A;  2QJ8 A;  2Q04 A;  4X3R A;  5AG7 A;  1JQG A;  2Z3L A;  5HMN A;  2HQY A;  3SI0 A;  4IUS A;  3RAM A;  4UCN A;  3H8E A;  3S9M A;  3WR7 A;  5A28 A;  1ZG7 A;  2F7V A;  4KUB A;  2PRQ A;  2CY2 A;  2PR8 A;  2POK A;  5BWA B;  4X8I A;  7CPA A;  3S6G A;  4MCP A;  2R1I A;  4MBU A;  3SXO A;  2I3C A;  3DGV A;  1Y7R A;  1VGY A;  2PRB A;  4FD6 A;  4KS9 A;  4Y49 B;  4NXY A;  4CGN A;  4A30 A;  4XNH B;  4C2Z A;  4CYQ A;  4P10 A;  3BJ7 A;  2ZEN A;  4ZYQ A;  4ONW A;  3PRT A;  4KOT A;  3VWD A;  1PU9 A;  2DF5 A;  2PJ1 A;  2JBJ A;  1X10 A;  1QSN A;  3MN8 A;  4AVC A;  1NE9 A;  2J8R A;  5C88 A;  2BEI A;  3BXM A;  4MFL A;  2DPT A;  4Q7A A;  5F47 A;  4E8O A;  2ZOG A;  5LRG A;  2PJC A;  1H8L A;  2Q0Y A;  3N7Z A;  3D2M A;  2Q4Y A;  1YVO A;  5AG4 A;  2AFS A;  3CPX A;  2PJ2 A;  3GB0 A;  3R9G A;  2OB0 A;  3D7H A;  1ELL P;  3RZA A;  1BOB A;  2O53 A;  4RS2 A;  1TIQ A;  4NGQ A;  3F0A A;  4CYN A;  3BI1 A;  3JRU A;  1UWY A;  1TKH A;  4KVO E;  2GLJ A;  2Z3N A;  3LOD A;  3DR8 A;  3SI2 A;  2WZN A;  4FWU A;  4JYW A;  3UY5 A;  4A39 A;  2BOA A;  3WC5 A;  3G8W A;  4L89 A;  4NGS A;  4PQA A;  4A95 A;  4EME A;  4CYP A;  1VHS A;  2HUZ A;  5AG6 A;  4EWT A;  3GKR A;  4CGL A;  2PJ4 A;  1BO4 A;  4F8Z A;  1VIX A;  1LFW A;  3D7D A;  5H86 A;  1IOI A;  3B2Y A;  4L8A A;  4MHD A;  1YME A;  3D68 A;  4ZX8 A;  5HVF A;  1PUA A;  3WC7 A;  4XPK A;  4BD9 A;  1XBU A;  2PSW A;  2Y0M A;  2V8V A;  3V38 A;  5J8C A;  2AE6 A;  1Z5R A;  2BSW A;  1VKC A;  2JEW A;  2DEA A;  2BCO A;  4ORF A;  1XRY A;  2Q51 A;  5LYI A;  1XMT A;  1F57 A;  2ZED A;  4XPD C;  2GFQ A;  1YR0 A;  4B13 A;  3K2K A;  2CXA A;  3GIU A;  4ZY2 A;  3TFY A;  4A38 A;  4KOS A;  4CS0 B;  4PXD A;  1X12 A;  1QSM A;  5A27 A;  5EC4 A;  2EO8 A;  2OH1 A;  4MFZ A;  2XEJ A;  3VH9 A;  1FT7 A;  2WYR A;  4OAD A;  5K8O A;  4P4E A;  3S9L A;  2XEI A;  3EY5 A;  5K8M A;  5THW A;  5J8F A;  3S6H A;  2D4O A;  4MFQ A;  1QQ9 A;  4B11 A;  5AG5 A;  2C1C A;  2RFH A;  4OC0 A;  4R3L A;  3RO0 A;  1S7L A;  3TC8 A;  1F2P A;  2GLF A;  4KOW A;  4R8F A;  2FS5 A;  4DUK A;  4XPD B;  3KR4 A;  4P4F A;  4AXV A;  4P4B A;  1MJ9 A;  1YRE A;  3EC4 A;  5D8N A;  2C6C A;  4ZBG A;  4NEX A;  4PSX A;  5G22 A;  1RXT A;  2CIJ A;  3TTH A;  2PJ6 A;  4C68 A;  1OBR A;  3KQZ A;  2Z3M A;  2FT0 A;  4M6G A;  2PVV A;  1YGH A;  4OC5 A;  4IAV A;  4P44 A;  1HDU A;  1Q2D A;  3FVL A;  3DNS A;  5F46 A;  2AFX A;  3EO4 A;  1Y0R A;  1YW4 A;  3W6X A;  4M3S A;  4HKF A;  3FBU A;  4C7I A;  2VZZ A;  1KWM A;  1M4I A;  2CNT A;  4MHZ A;  4MMO A;  3R9F A;  4NSQ A;  3D66 A;  1J4J A;  4P4I A;  1AUG A;  2P0W A;  5FVJ A;  4E0A A;  4H89 A;  4NFR A;  2ZPA A;  5HH1 A;  4MCS A;  2WPW A;  2REF A;  2Q43 A;  1LRZ A;  3PB6 X;  1XJO A;  1QSO A;  2AFU A;  5AGE A;  4UEF A;  2QML A;  1B87 A;  4KVX A;  1GHE A;  3NE8 A;  2Q44 A;  1V0C A;  4ZGY B;  1FY7 A;  5C82 A;  3FEC A;  1ZG9 A;  1R57 A;  4OC1 A;  3FMC A;  4Y49 C;  3RNZ A;  1CG2 A;  1LAN A;  3W6S A;  2K5T A;  2ZEH A;  1A2Z A;  3FB3 A;  1Q2C A;  3K9T A;  3EFA A;  2ZW7 A;  1I21 A;  4CAF A;  4NCZ A;  4LUA A;  3S6K A;  2OU2 A;  3A9L A;  1KUY A;  4H6Z A;  3VWE A;  3CXQ A;  3SJX A;  1Y9W A;  2ZW5 A;  4KOV A;  1IID A;  4MHN A;  3QNV A;  2C6P A;  3B3T A;  5I0C A;  4B5O A;  4F9U A;  3T8W A;  3NH4 A;  2J8M A;  4QBJ A;  4MXU A;  1HDQ A;  4CGO A;  1CPS A;  2PE3 A;  4UCM A;  4NJQ A;  3SJF A;  4AG9 A;  1S3Z A;  3CXP A;  2B4D A;  1LAP A;  3D2P A;  4P4J A;  4YFJ A;  3D7F A;  1DTD A;  2AFZ A;  1M44 A;  4OIW A;  1N71 A;  3ISZ A;  4JXR A;  4MHY A;  3N5F A;  2QYV A;  3NH8 A;  5CNP A;  2ZEF A;  3H4Q A;  2X7B A;  1WK4 A;  3IU1 A;  3LAC A;  4BBH A;  4R76 A;  2QIR A;  4A37 A;  4OKO A;  5ISV A;  4TNU A;  1IU8 A;  3CPA A;  2XEG A;  3T90 A;  4Q36 A;  1F2O A;  1I12 A;  4GXH A;  2GE3 A;  4O23 A;  1ARL A;  3FX6 A;  4ZI6 A;  1CP6 A;  1S7N A;  3LMS A;  1VHO A;  3ZJ0 A;  4Z65 A;  1BPN A;  1NSA A;  3KR5 A;  4UEE A;  4BIN A;  4DNC A;  4I49 A;  3PB9 X;  1BAV A;  3B8G A;  3F5B A;  3R1K A;  4JLY A;  4UFX A;  5F49 A;  2NSM A;  2ZEO A;  4CAV A;  1MJB A;  3PFO A;  4MCQ A;  5IB0 A;  3GLJ A;  3DSB A;  4GS4 A;  5H84 A;  2VZY A;  4KOU A;  2EK8 A;  4LQ6 A;  4F9V A;  4UBR A;  3HUV A;  2KCW A;  5KTA A;  2O28 A;  5KTD A;  3SXN A;  2A4N A;  3R95 A;  2G0B A;  4NGM A;  4LQG A;  4U9Z A;  2CF4 A;  4IHM A;  4AG7 A;  3PBB A;  1AMP A;  1ZLH A;  1YK3 A;  1S7F A;  3TOA A; 
#chains in the Genus database with same CATH homology
 4MHP A;  1LOK A;  4KSI A;  2OOT A;  2ABZ A;  2OR4 A;  5LRJ A;  2FVG A;  4YWY A;  5LRK A;  3VAT A;  3MRU A;  2PJ9 A;  3ISX A;  2VL1 A;  6CPA A;  3DLJ A;  2HC9 A;  5DS0 A;  3SI1 A;  2NYQ A;  3H8F A;  1QMU A;  2V8G A;  4ZX9 A;  2CTC A;  1ARM A;  1RTQ A;  2PIY A;  3BI0 A;  1HEE A;  3KZW A;  3WC6 A;  3KHX A;  2AFO A;  3I1U A;  4P6Y A;  2EWB A;  2CTB A;  2JBK A;  4NJR A;  3PFE A;  4OC3 A;  3B3C A;  3IO1 A;  3PB8 X;  3S9N A;  1LAM A;  3NH5 A;  5LYD A;  5LYL A;  4FUU A;  2PCU A;  4OC4 A;  1PYT B;  4GM5 A;  3IEH A;  4H2K A;  4NGP A;  2PJ5 A;  1R43 A;  3IJ3 A;  3TX8 A;  4OME A;  2PJ3 A;  1Y7E A;  2G9D A;  2C6G A;  4P4D A;  4DJL A;  2ANP A;  1Z2L A;  3FH4 A;  3KAS A;  1CPX A;  2ZEL A;  4UIA A;  8CPA A;  1YLO A;  1AYE A;  3PEI A;  2PIZ A;  3FJU A;  4MRI A;  3NFZ A;  3IC1 A;  4PXC A;  3IFE A;  3KHZ A;  3PB4 X;  2PJ7 A;  4PXE A;  3IIB A;  1IGB A;  3WAB A;  3PB7 X;  2PVW A;  1IY7 A;  4OP4 A;  2RB7 A;  1Z8L A;  2V77 A;  4UEZ A;  2AFW A;  4DYO A;  5K8P A;  4OC2 A;  2F8H A;  3B3S A;  1XMB A;  1ZG8 A;  3LWU A;  3KQX A;  1DE4 C;  1TXR A;  1TKJ A;  4ZY0 A;  2ZEP A;  3SJG A;  5HXD A;  4WJB A;  1EE3 P;  5D29 A;  4NGN A;  3FEE A;  4W9Y A;  5K8N A;  3B3W A;  4FAI A;  2PJ8 A;  3FF3 A;  3CDX A;  2ZEM A;  3D4U A;  3PBE A;  2IJZ A;  3D67 A;  1XFO A;  1LCP A;  5CPA A;  4G1P A;  3RBU A;  5HVG A;  4A94 A;  1FNO A;  2GU2 A;  1CBX A;  4JZ0 A;  2IMO A;  5JH9 A;  5LYF A;  2PJA A;  3KL9 A;  1YW6 A;  2HB6 A;  1Y0Y A;  2Q4Z A;  4K3N A;  1CP7 A;  2EK9 A;  1BLL E;  3GUX A;  1ELM P;  4B6Z A;  5JM6 A;  4P45 A;  5I4M A;  1ZLI A;  3D7G A;  4R7M A;  3CT9 A;  2GRE A;  4R6T A;  3B35 A;  2V8D A;  2PJB A;  1TF8 A;  5HVH A;  3KI9 A;  3V7Z A;  4CPA A;  1BPM A;  2ZOF A;  2IQ6 A;  3NA6 A;  4NGT A;  4TWE A;  2V8H A;  4X2T A;  5IB9 A;  4RUH A;  3L2N A;  4UIB A;  5CBM A;  4PXB A;  1R3N A;  1YSJ A;  1PCA A;  3BHX A;  1Q7L A;  3IWW A;  4UF4 A;  3WT4 A;  4WWV A;  2XEF A;  3VAR A;  4PPZ A;  3FED A;  2BO9 A;  4OID A;  4EFD A;  2PJ0 A;  5JGF A;  5J1Q A;  2ZEE A;  1CX8 A;  5F09 A;  1M4L A;  1TF9 A;  3SJE A;  4MCR A;  3B3V A;  4IK2 A;  2AFM A;  4FBE A;  3H8G A;  1TKF A;  4YU9 A;  2QVP A;  2J9A A;  1VHE A;  2ZEG A;  3HLP A;  4NGR A;  3B7I A;  1GYT A;  4ZY1 A;  3KGQ A;  2O4H A;  5ELY A;  2QJ8 A;  4X3R A;  1JQG A;  3SI0 A;  3RAM A;  3S9M A;  3H8E A;  1ZG7 A;  2F7V A;  2PRQ A;  2POK A;  4X8I A;  7CPA A;  4MCP A;  2I3C A;  3DGV A;  1VGY A;  4P10 A;  2ZEN A;  4ZYQ A;  4ONW A;  3PRT A;  2PJ1 A;  2JBJ A;  3MN8 A;  3BXM A;  4Q7A A;  2ZOG A;  5LRG A;  2PJC A;  1H8L A;  2AFS A;  3CPX A;  2PJ2 A;  3GB0 A;  3D7H A;  1ELL P;  3RZA A;  2O53 A;  4NGQ A;  3BI1 A;  3JRU A;  1UWY A;  1TKH A;  2GLJ A;  3SI2 A;  2WZN A;  4FWU A;  4JYW A;  4A39 A;  2BOA A;  3WC5 A;  4EME A;  4NGS A;  4PQA A;  4EWT A;  2PJ4 A;  4F8Z A;  1VIX A;  1LFW A;  3D7D A;  3B2Y A;  1YME A;  3D68 A;  4ZX8 A;  5HVF A;  3WC7 A;  4BD9 A;  1XBU A;  3V38 A;  2V8V A;  1Z5R A;  2JEW A;  2DEA A;  2BCO A;  1XRY A;  2Q51 A;  5LYI A;  1F57 A;  2ZED A;  3K2K A;  4ZY2 A;  4A38 A;  4PXD A;  3VH9 A;  2XEJ A;  1FT7 A;  2WYR A;  5K8O A;  3S9L A;  4P4E A;  2XEI A;  5K8M A;  5THW A;  1QQ9 A;  2C1C A;  2RFH A;  4OC0 A;  3TC8 A;  1F2P A;  2GLF A;  4R8F A;  4DUK A;  3KR4 A;  4P4F A;  4AXV A;  4P4B A;  5D8N A;  2C6C A;  2CIJ A;  2PJ6 A;  1OBR A;  3KQZ A;  2PVV A;  4OC5 A;  4IAV A;  4P44 A;  1HDU A;  3FVL A;  2AFX A;  1Y0R A;  1YW4 A;  1KWM A;  4MHZ A;  4MMO A;  3D66 A;  4P4I A;  4NFR A;  4MCS A;  2Q43 A;  3PB6 X;  1XJO A;  2AFU A;  4UEF A;  3FEC A;  1ZG9 A;  4OC1 A;  3FMC A;  1CG2 A;  1LAN A;  2ZEH A;  3K9T A;  3SJX A;  4MHN A;  3QNV A;  2C6P A;  3B3T A;  4F9U A;  3T8W A;  3NH4 A;  4MXU A;  1HDQ A;  1CPS A;  2PE3 A;  3SJF A;  4NJQ A;  1LAP A;  4P4J A;  3D7F A;  1DTD A;  2AFZ A;  4OIW A;  3ISZ A;  4MHY A;  3N5F A;  2QYV A;  3NH8 A;  2ZEF A;  4R76 A;  4A37 A;  4OKO A;  4TNU A;  3CPA A;  2XEG A;  1F2O A;  4O23 A;  1ARL A;  3FX6 A;  4ZI6 A;  1CP6 A;  3LMS A;  1VHO A;  4Z65 A;  1BPN A;  1NSA A;  3KR5 A;  4UEE A;  3PB9 X;  1BAV A;  2NSM A;  2ZEO A;  3PFO A;  4MCQ A;  3GLJ A;  2EK8 A;  4F9V A;  3HUV A;  4NGM A;  4LQG A;  2CF4 A;  4IHM A;  3PBB A;  1AMP A;  1ZLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...