2PCUA

Human carboxypeptidase a4 in complex with a cleaved hexapeptide.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
305
structure length
305
Chain Sequence
NNFNYGAYHSLEAIYHEMDNIAADFPDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGPHANSEVEVKSVVDFIQKHGNFKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELRDTGTYGFLLPANQIIPTAEETWLGLKTIMEHVRDNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxypeptidase A4
publication title Caught after the Act: a human A-type metallocarboxypeptidase in a product complex with a cleaved hexapeptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 115
structure length 305
sequence length 305
ec nomenclature ec 3.4.17.-:
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2pcuA00
1LAMA 2V8DA 2CIJA 4X3RA 3CPXA 4ZYQA 4UF4A 3B3VA 1KWMA 2WZNA 4YU9A 3FH4A 1Z8LA 4H2KA 3VH9A 3KQZA 4MXUA 4NGSA 4PXCA 3GUXA 4MCQA 5K8NA 1ARMA 3KI9A 2ZEDA 3WABA 3I1UA 5I4MA 1Z5RA 1F57A 2JBJA 4MHZA 3VARA 2Q4ZA 1UWYA 3PB7X 4PXEA 3BHXA 4UEEA 3FX6A 4WJBA 4OC4A 3SJEA 3S9LA 2ZOGA 3IC1A 3D66A 1Q7LA 3CPAA 6CPAA 4DUKA 4P4JA 3NH5A 2F8HA 4NGMA 1GYTA 2AFWA 4W9YA 2PIZA 3K2KA 3SJGA 4FBEA 1IGBA 2EWBA 2ZOFA 1CP6A 2ZENA 4EFDA 5K8MA 3MN8A 2AFMA 4R7MA 1CPXA 4P44A 2QJ8A 4P45A 4MHNA 3RBUA 2PJ8A 2BO9A 4OKOA 1F2PA 3SI2A 2GREA 3B3TA 4TNUA 2PJ5A 4F9UA 2PJ2A 2O53A 4AXVA 2IJZA 2GLJA 3V7ZA 2ZELA 4PQAA 2XEFA 3B3CA 2C6PA 2PJCA 1TF9A 3FMCA 4P10A 5CBMA 4FWUA 2PIYA 1IY7A 1VHOA 5LYLA 1R3NA 1Y0RA 3HLPA 2ZEEA 3FF3A 1TKHA 1BAVA 4ONWA 4A94A 4OC3A 3WT4A 4P4DA 2G9DA 4OMEA 3BI1A 2Q43A 2AFZA 2QYVA 2PJAA 3D68A 1XFOA 4DYOA 1CP7A 1Y7EA 3FEEA 3SI0A 2PRQA 2JEWA 4OC5A 3FEDA 1HDQA 3NFZA 1TKJA 3H8FA 2PJ1A 1YSJA 4MCSA 1TKFA 5HVGA 4IHMA 2XEIA 4R8FA 4O23A 1QQ9A 3LWUA 2PVVA 1H8LA 2ZEFA 5ELYA 4MMOA 3FECA 3SJXA 2PJBA 2HB6A 2AFUA 3PBEA 2NYQA 3B2YA 1BLLE 3IIBA 3SI1A 4ZI6A 3T8WA 1Z2LA 1XBUA 1BPMA 2PJ4A 2ZEHA 5D29A 1M4LA 5JGFA 1VGYA 3D7HA 1AYEA 3DLJA 2BOAA 4A37A 3IO1A 3CDXA 2GU2A 5LRJA 2PE3A 4NGNA 4OC2A 4R76A 2RB7A 2C1CA 2AFXA 4PPZA 2HC9A 4WWVA 3LMSA 1LCPA 2FVGA 5THWA 4UIBA 5LRKA 3L2NA 2V8HA 2PJ7A 5K8OA 3FVLA 1HEEA 4NJRA 3DGVA 2C6GA 3PB4X 1YW6A 2QVPA 1ZLHA 4OC0A 2AFOA 3TC8A 2Q51A 4UEZA 4ZX9A 5J1QA 3KHZA 3K9TA 4ZY0A 3WC7A 7CPAA 2ZEGA 2CF4A 4IAVA 1XJOA 1XMBA 2VL1A 2IQ6A 4B6ZA 4IK2A 3PB8X 1TXRA 2PJ6A 3KZWA 2IMOA 3IEHA 4X8IA 1FT7A 3NA6A 3B35A 3B3SA 3IJ3A 2PVWA 4F9VA 4TWEA 1ZG9A 1CBXA 1EE3P 2NSMA 4LQGA 4CPAA 4OIDA 2PJ9A 3S9MA 4X2TA 4DJLA 4NFRA 2XEJA 3N5FA 1CX8A 4MCPA 1YMEA 8CPAA 4UEFA 2V8VA 4OP4A 3NH4A 3PRTA 5LRGA 3H8EA 1QMUA 4KSIA 4OIWA 3VATA 5HVHA 4JZ0A 2PJ0A 3BXMA 3KGQA 3B7IA 1DTDA 2PJ3A 2XEGA 1RTQA 4ZX8A 5F09A 3D67A 4FUUA 1R43A 3PFEA 2JBKA 2J9AA 3D4UA 2PCUA 4UIAA 1PCAA 2AFSA 5HXDA 2V77A 1ELMP 3KASA 5IB9A 4PXBA 1LAPA 1JQGA 1YW4A 4OC1A 2EK9A 4BD9A 3PEIA 2F7VA 3PFOA 4R6TA 4NGTA 4GM5A 4P4IA 4A38A 2ZEMA 4Z65A 1NSAA 2ABZA 3PB6X 5JH9A 4NJQA 3KQXA 3D7FA 5HVFA 4NGPA 3D7DA 2WYRA 3ISXA 3GB0A 4G1PA 4ZY1A 4EWTA 2ZEPA 1ZG8A 2OR4A 3CT9A 4A39A 5LYDA 3IFEA 3B3WA 2POKA 2V8GA 3BI0A 4P4BA 1AMPA 2DEAA 4MRIA 4JYWA 3WC5A 1VIXA 3NH8A 3KL9A 2O4HA 3PBBA 1F2OA 2RFHA 5K8PA 3D7GA 5LYIA 1XRYA 3S9NA 2ANPA 2OOTA 3SJFA 1ZLIA 2BCOA 3PB9X 3ISZA 3H8GA 4NGRA 3GLJA 4K3NA 4RUHA 4Q7AA 4MCRA 3KR5A 1TF8A 3TX8A 4YWYA 3JRUA 1LFWA 3MRUA 5DS0A 1VHEA 4F8ZA 4PXDA 1LANA 2CTCA 3IWWA 1FNOA 1YLOA 4P4EA 3KHXA 1PYTB 2CTBA 1CG2A 1ARLA 4NGQA 4MHPA 2ZEOA 1LOKA 2EK8A 3KR4A 4P6YA 3RZAA 1ZG7A 4FAIA 1ELLP 1HDUA 4EMEA 1BPNA 1CPSA 3HUVA 3FJUA 5D8NA 5LYFA 4P4FA 1DE4C 2I3CA 1Y0YA 3V38A 3WC6A 3QNVA 2C6CA 1OBRA 3RAMA 5CPAA 4ZY2A 4MHYA 5JM6A 2GLFA
chains in the Genus database with same CATH superfamily
1LAMA 2V8DA 4NF1A 2YNDA 4CGNA 1PUAA 3TO6A 3I3GA 2CIJA 2R7HA 1QSRA 2EO8A 4XPKA 3IU2A 4X3RA 3CPXA 4ZYQA 4UF4A 2GFQA 4RI1A 4CYPA 1B6BA 3B3VA 1KWMA 2WZNA 4YU9A 3RO0A 3FH4A 1Z8LA 1UFHA 4H2KA 3LACA 4OAEA 3R9GA 3KQZA 4MXUA 3VH9A 2PR1A 3DR6A 1YQEA 4NGSA 2D4OA 4PSXA 2ATRA 4PXCA 2R1IA 3GUXA 4ZBGA 5G20A 4MCQA 4NEXA 4ONUA 5K8NA 2JLMA 1YLEA 4KOTA 1ARMA 5G21A 3KI9A 2ZEDA 3VWDA 2Q7BA 3F5BA 3WABA 2ZXVA 5C88A 3I1UA 4R57A 5I4MA 3N7ZA 1Z4RA 1F57A 1Z5RA 2ZW5A 3EXNA 4CAXA 2JBJA 1Z8TA 2ZPAA 4MHZA 2Q4ZA 3VARA 1UWYA 4E2AA 3PB7X 5IV0A 4PXEA 3EY5A 3RYOA 3BHXA 4UEEA 1YX0A 3FX6A 4MFZA 4WJBA 4OC4A 3SJEA 3S9LA 2ZOGA 4UCPA 4KZTA 2VEZA 3IC1A 3D66A 1Q7LA 1MK4A 3GIUA 1IU8A 3CPAA 3JVNA 1XMTA 4DUKA 6CPAA 1X10A 1YREA 3NH5A 4P4JA 2F8HA 4NGMA 4A33A 1GYTA 4F0YA 2AFWA 3DDDA 1IIDA 3R1KA 4W9YA 2PIZA 3K2KA 4CAFA 3SJGA 3H4QA 4KOWA 3RNZA 4CAVA 2G3TA 1YVKA 4FBEA 5F49A 3FNCA 4M6HA 1IGBA 2EWBA 2ZOFA 1CP6A 1WK4A 3EO4A 2ZENA 4KSFA 4AG9A 4EFDA 4H89A 5K8MA 3MN8A 4C68A 5KTDA 1M4IA 1P4NA 2WUUA 2AFMA 4R7MA 1CPXA 1J4JA 3DNSA 4P44A 2QJ8A 4LX9A 4XPDB 5CNPA 1LRZA 2FS5A 4X5KA 3ZJ0A 4E0AA 4P45A 4KORA 4XNHB 2BEIA 5GCNA 2PSWA 4MHNA 3RBUA 3BLNA 2PJ8A 1VHSA 2BO9A 4CAWA 1V0CA 4QUSA 3LD2A 4MFQA 1YGHA 4OKOA 3R95A 3PP9A 4DNCA 2OZUA 4MJ8A 4II9A 1F2PA 1K4JA 2I79A 5H86A 3SI2A 2GREA 4OLLA 3B3TA 4TNUA 2PJ5A 1S7NA 1M4DA 4FD7A 4F9UA 2PJ2A 2O53A 1U6MA 1FY7A 1M44A 2IJZA 2GLJA 3DSBA 4AXVA 4B13A 3V7ZA 4Q36A 1NMTA 2OU2A 4CGMA 4F6AA 2ZELA 3PGPA 2B3VA 4PQAA 2XEFA 4UFVA 4OADA 1Y9WA 3B3CA 2C6PA 1CJWA 3S6KA 4K30A 2PJCA 1TF9A 3FMCA 4P10A 1IICA 2OZGA 5CBMA 4FWUA 4KOSA 2PIYA 1IY7A 1VHOA 2Q4VA 4MBUA 4RN7A 4ZGYB 1YR0A 3SXOA 5LYLA 2BL1A 2Z3LA 1R3NA 1Y0RA 3HLPA 2ZEEA 4IUSA 3FF3A 1TKHA 1BAVA 4ONWA 4A94A 4OC3A 3WT4A 5KTCA 2CNTA 4MFKA 3TFYA 1OZPA 4P4DA 2G9DA 4OMEA 5AG6A 3BI1A 2Q43A 2AFZA 3FYNA 2AE6A 2QYVA 1KZFA 2PJAA 1S60A 3D68A 1XIXA 4B10A 5F46A 1XFOA 3H5ZA 4DYOA 3T9YA 2JEVA 1ZO0A 1CP7A 1Y7EA 3FEEA 3SI0A 2PRQA 4KVXA 2B3UA 4CGLA 2JEWA 4OC5A 3FEDA 1IB1E 3KKWA 1HDQA 4CYNA 2ZW7A 1TKJA 3NFZA 2G0BA 3H8FA 2ZW4A 2ARHA 2PJ1A 1YSJA 3NE8A 2FXFA 3DR8A 4MCSA 1TKFA 3EC4A 5D8NA 5HVGA 3R9EA 4IHMA 4UCNA 3WR7A 2XEIA 4R8FA 3IU1A 4O23A 4HKFA 1QQ9A 3LWUA 4Y49C 4U5YA 2PVVA 1H8LA 2ZEFA 5ELYA 4KOVA 1KUYA 3IWEA 1CM0A 4GS4A 4AVBA 3D2PA 4C2ZA 4QVTA 4NXYA 4MMOA 3FECA 4HNYB 4R3LA 3SJXA 5J8CA 4C7HA 2QMLA 2FE7A 2PJBA 2D4PA 4IF5A 2HB6A 3SXNA 4UA3A 1Z4EA 2AFUA 3PBEA 2NYQA 3B2YA 1BLLE 3C26A 3I9SA 3IIBA 3MGDA 3SI1A 1Z2LA 3T8WA 2VQYA 1XBUA 1BPMA 2O28A 2B5GB 4KVME 4R3KA 2PJ4A 4J3GA 2ZEHA 2R8VA 4JXQA 4MFJA 1M4LA 3CZXA 5AG7A 5D29A 5JGFA 1IOIA 4B11A 1VGYA 3W6XA 3D7HA 1QSMA 1AYEA 4M3SA 3DLJA 2BOAA 3CXPA 1SQHA 2OH1A 2OZHA 4A37A 3IO1A 3TO9A 3CDXA 2GU2A 2ZW6A 4UBRA 5LRJA 3K9UA 2PE3A 4KUAA 4NGNA 4OC2A 2B5GA 2DXQA 3LODA 3P2FA 1AUGA 1ON0A 2PRBA 2Q7SA 2BSWA 2REFA 2X7BA 2P6EA 4R76A 4PSWA 4HNWB 2RB7A 2C1CA 2JDDA 2VZZA 2AFXA 3V8IA 4A32A 3BJ8A 4PPZA 2HC9A 4M6GA 4WWVA 3LMSA 1RO5A 4BINA 1LCPA 2FVGA 1Z9UA 4CGPA 5THWA 1R57A 4UIBA 3S6GA 2QIRA 5LRKA 3L2NA 4A95A 2V8HA 2PJ7A 5K8OA 3FVLA 1HEEA 4NJRA 3DGVA 2C6GA 3PB4X 2DPTA 2FIWA 5EMIA 1NSLA 5C82A 3G8WA 1YW6A 3A9LA 2Z3KA 2Z0ZA 1IOFA 2QVPA 1Y9KA 4ORFA 1ZLHA 4OC0A 1XOVA 1IYLA 2AFOA 2CNMA 2QECA 1M1DA 3TC8A 2EVNA 2Q51A 4UEZA 4ZX9A 3KHZA 4UCMA 5J1QA 3K9TA 4KS9A 4ZY0A 3WC7A 7CPAA 2FL4A 2ZEGA 2CF4A 2Q44A 4IAVA 1XJOA 2B58A 3ZZIA 4C7IA 3EFAA 4MY0A 1XMBA 2VL1A 3FXTA 2IQ6A 2NMTA 3GKRA 4FD4A 5IB0A 4U9YA 4B6ZA 4BMHA 4R9MA 2Y0MA 4IK2A 1XEBA 2OB0A 5FVJA 1Y7RA 3PB8X 4PK2A 5F48A 2B4DB 1TXRA 2PJ6A 4KOXA 2HQYA 2R98A 1B87A 3KZWA 1S7KA 2IMOA 2Z3OA 3IEHA 1Z8XA 4X8IA 3R96A 4Q38A 3TCVA 1FT7A 3NA6A 3B35A 2YNEA 3BJ7A 4JWPA 5DWNA 4AB7A 3B3SA 4CS0B 1IYKA 3IJ3A 4CRYB 5I0CA 2PVWA 4MFLA 3FB3A 4AVAA 4QBJA 1MJ9A 3W91A 2B4DA 1PU9A 4F9VA 4TWEA 1ZG9A 3TE4A 1CBXA 4B5PB 1EE3P 2NSMA 4LQGA 4CPAA 4B5OA 4MY3A 4OIDA 4M6IA 2PJ9A 3S9MA 4UFXA 3S6FA 4X2TA 2PDOA 2GE3A 2J8NA 3FIXA 4C2XA 4NFRA 2XEJA 4DJLA 3N5FA 3FRMA 1CX8A 4XPDC 3TOBA 4MCPA 1YMEA 4B5PA 8CPAA 4UEFA 2WSAA 2V8VA 4OP4A 3UY5A 4M85A 3NH4A 3PRTA 2P6FA 1S5KA 2YNCC 2VZYA 4QB9A 5LRGA 2FIAA 1QMUA 3H8EA 4HNXB 4KSIA 4FD6A 4ZI6A 4OIWA 3VATA 5HVHA 4JZ0A 2PJ0A 3BXMA 3P2HA 4A31A 1QSNA 3E0KA 4EVYA 3KGQA 4JLYA 5A27A 3B7IA 2Q4YA 1DTDA 2PJ3A 2XEGA 1RTQA 2Z3MA 4ZX8A 1I1DA 2VI7A 3D67A 5F09A 2H5MA 1A2ZA 3GYAA 1YVOA 4FUUA 4LUAA 3CXSA 1R43A 3PFEA 3SHPA 1BOBA 2JBKA 2WPWA 3F8KA 2J9AA 1YK3A 3D4UA 2FT0A 4L8AA 4R87A 4CAEA 4KLWA 2PCUA 4UIAA 1PCAA 5EC4A 2Q04A 5A28A 2AFSA 5HXDA 2V77A 4A2ZA 3NE7A 4B12A 4YFJA 2C27A 3TO7A 1ELMP 2FSRA 3KASA 5IB9A 4PXBA 1LAPA 4YRHA 3FBUA 1JQGA 4I49A 1YW4A 2WPXA 3B8GA 3QAHA 4OC1A 3CXQA 4PV6A 2EK9A 2J8MA 4BD9A 3PEIA 2F7VA 3PFOA 4CRZB 4R6TA 4NGTA 3IGRA 3R9FA 3W6SA 5JPHA 4GM5A 3JUWA 4P4IA 3D3SA 2CNSA 4GXHA 4A38A 2GIVA 2ZEMA 3D2MA 1NSAA 3G3SA 4U9ZA 4Z65A 2ABZA 2IL4A 3PB6X 4UWJA 5ISVA 5JH9A 4NJQA 2HUZA 4KSAA 5HH1A 3KQXA 2DPSA 2F5IA 3D7FA 5HVFA 5KTAA 3D8PA 4QC6A 1MJBA 4NGPA 2A4NA 4H6ZA 4F0XA 3D7DA 3TOAA 2WYRA 2K5TA 3ISXA 1Z8WA 3S6HA 3GB0A 3VWEA 5E96A 4G1PA 4MHDA 4C2YA 4ZY1A 4EWTA 1JWQA 2ZEPA 1ZG8A 1Q2YA 2P6GA 3PZJA 4A30A 4AG7A 2OR4A 4HPSA 3CT9A 5DWMA 4A39A 5LYDA 5G22A 4KOUA 2JDCA 3IFEA 4KVOE 4CYOA 5H84A 3T90A 3B3WA 4JXRA 1NE9A 1S3ZA 2POKA 2V8GA 4CGOA 3BI0A 4P4BA 2CXAA 5AG4A 1N71A 1TIQA 1AMPA 2BUEA 2G3AA 2DEAA 4KOYA 4MRIA 4JYWA 2I00A 3WC5A 1VIXA 2EBJA 2VXKA 3NH8A 3KL9A 2Z10A 2DF5A 3IWGA 3QB8A 2O4HA 3PBBA 4NSQA 2VBQA 1F2OA 4UFWA 2RFHA 2REEA 3D7GA 4KUBA 5LYIA 5BWAB 5K8PA 1GHEA 1XRYA 5EBVA 3S9NA 2ANPA 2Z11A 2OOTA 3SJFA 1ZLIA 2PR8A 4NCZA 3TT2A 2BCOA 3PB9X 1QSOA 3ISZA 4RS2A 4LQ6A 5F47A 3H8GA 1RXTA 4NGRA 1XF8A 4H6UA 5HMNA 2HV2A 3GLJA 4K3NA 1I21A 1Q2CA 4B14A 4XPLA 5J8FA 4JJXA 1P0HA 4RUHA 4Q7AA 4MCRA 2CY2A 4E8OA 3KR5A 1TF8A 4L89A 4UWIA 3TX8A 2YNCA 4YGOA 4FD5A 5JQ4A 1XE4A 4YWYA 3JRUA 1KUVA 1LFWA 3MRUA 5DS0A 2P0WA 1VHEA 4KLVA 4F8ZA 4PXDA 1LANA 2CTCA 3IWWA 1FNOA 2YGWA 1YLOA 4P4EA 3KHXA 4Y49B 1PYTB 1QSTA 1X12A 2CTBA 1KUXA 2Q0YA 1S7LA 1CG2A 2KCWA 1ARLA 4PK3A 2FCKA 3GY9A 5IX3A 4NGQA 4MHPA 4XNHC 4CYQA 1WWZA 5AGEA 3TTHA 2ZEOA 3OWCA 1LOKA 2EK8A 3KR4A 4P6YA 3RZAA 1ZG7A 4BBHA 4FAIA 2PC1A 4MFPA 1BO4A 1ELLP 1HDUA 2B4BA 1BPNA 5G1ZA 4AVCA 4EMEA 1CPSA 3JTKA 3HUVA 2PQ8A 2RC4A 2GANA 2EUIA 3FJUA 1M4GA 1S7FA 1DE4C 2J8RA 4P4FA 2I3CA 5LYFA 1Y0YA 2AJ6A 3V38A 4JD6A 3WC6A 4MI4A 1MJAA 3QNVA 3QAYA 1I12A 2C6CA 2Z3NA 2Z3PA 1L0CA 1OBRA 3RAMA 5CPAA 4ZY2A 1VKCA 1Q2DA 5AG5A 4MHYA 5JM6A 2ODFA 2GLFA 3F0AA
chains in the Genus database with same CATH topology
1LAMA 2V8DA 2CIJA 4X3RA 3CPXA 4ZYQA 4UF4A 3B3VA 1KWMA 2WZNA 4YU9A 3FH4A 1Z8LA 4H2KA 3VH9A 3KQZA 4MXUA 4NGSA 4PXCA 3GUXA 4MCQA 5K8NA 1ARMA 3KI9A 2ZEDA 3WABA 3I1UA 5I4MA 1Z5RA 1F57A 2JBJA 4MHZA 3VARA 2Q4ZA 1UWYA 3PB7X 4PXEA 3BHXA 4UEEA 3FX6A 4WJBA 4OC4A 3SJEA 3S9LA 2ZOGA 3IC1A 3D66A 1Q7LA 3CPAA 6CPAA 4DUKA 4P4JA 3NH5A 2F8HA 4NGMA 1GYTA 2AFWA 4W9YA 2PIZA 3K2KA 3SJGA 4FBEA 1IGBA 2EWBA 2ZOFA 1CP6A 2ZENA 4EFDA 5K8MA 3MN8A 2AFMA 4R7MA 1CPXA 4P44A 2QJ8A 4P45A 4MHNA 3RBUA 2PJ8A 2BO9A 4OKOA 1F2PA 3SI2A 2GREA 3B3TA 4TNUA 2PJ5A 4F9UA 2PJ2A 2O53A 4AXVA 2IJZA 2GLJA 3V7ZA 2ZELA 4PQAA 2XEFA 3B3CA 2C6PA 2PJCA 1TF9A 3FMCA 4P10A 5CBMA 4FWUA 2PIYA 1IY7A 1VHOA 5LYLA 1R3NA 1Y0RA 3HLPA 2ZEEA 3FF3A 1TKHA 1BAVA 4ONWA 4A94A 4OC3A 3WT4A 4P4DA 2G9DA 4OMEA 3BI1A 2Q43A 2AFZA 2QYVA 2PJAA 3D68A 1XFOA 4DYOA 1CP7A 1Y7EA 3FEEA 3SI0A 2PRQA 2JEWA 4OC5A 3FEDA 1HDQA 3NFZA 1TKJA 3H8FA 2PJ1A 1YSJA 4MCSA 1TKFA 5HVGA 4IHMA 2XEIA 4R8FA 4O23A 1QQ9A 3LWUA 2PVVA 1H8LA 2ZEFA 5ELYA 4MMOA 3FECA 3SJXA 2PJBA 2HB6A 2AFUA 3PBEA 2NYQA 3B2YA 1BLLE 3IIBA 3SI1A 4ZI6A 3T8WA 1Z2LA 1XBUA 1BPMA 2PJ4A 2ZEHA 5D29A 1M4LA 5JGFA 1VGYA 3D7HA 1AYEA 3DLJA 2BOAA 4A37A 3IO1A 3CDXA 2GU2A 5LRJA 2PE3A 4NGNA 4OC2A 4R76A 2RB7A 2C1CA 2AFXA 4PPZA 2HC9A 4WWVA 3LMSA 1LCPA 2FVGA 5THWA 4UIBA 5LRKA 3L2NA 2V8HA 2PJ7A 5K8OA 3FVLA 1HEEA 4NJRA 3DGVA 2C6GA 3PB4X 1YW6A 2QVPA 1ZLHA 4OC0A 2AFOA 3TC8A 2Q51A 4UEZA 4ZX9A 5J1QA 3KHZA 3K9TA 4ZY0A 3WC7A 7CPAA 2ZEGA 2CF4A 4IAVA 1XJOA 1XMBA 2VL1A 2IQ6A 4B6ZA 4IK2A 3PB8X 1TXRA 2PJ6A 3KZWA 2IMOA 3IEHA 4X8IA 1FT7A 3NA6A 3B35A 3B3SA 3IJ3A 2PVWA 4F9VA 4TWEA 1ZG9A 1CBXA 1EE3P 2NSMA 4LQGA 4CPAA 4OIDA 2PJ9A 3S9MA 4X2TA 4DJLA 4NFRA 2XEJA 3N5FA 1CX8A 4MCPA 1YMEA 8CPAA 4UEFA 2V8VA 4OP4A 3NH4A 3PRTA 5LRGA 3H8EA 1QMUA 4KSIA 4OIWA 3VATA 5HVHA 4JZ0A 2PJ0A 3BXMA 3KGQA 3B7IA 1DTDA 2PJ3A 2XEGA 1RTQA 4ZX8A 5F09A 3D67A 4FUUA 1R43A 3PFEA 2JBKA 2J9AA 3D4UA 2PCUA 4UIAA 1PCAA 2AFSA 5HXDA 2V77A 1ELMP 3KASA 5IB9A 4PXBA 1LAPA 1JQGA 1YW4A 4OC1A 2EK9A 4BD9A 3PEIA 2F7VA 3PFOA 4R6TA 4NGTA 4GM5A 4P4IA 4A38A 2ZEMA 4Z65A 1NSAA 2ABZA 3PB6X 5JH9A 4NJQA 3KQXA 3D7FA 5HVFA 4NGPA 3D7DA 2WYRA 3ISXA 3GB0A 4G1PA 4ZY1A 4EWTA 2ZEPA 1ZG8A 2OR4A 3CT9A 4A39A 5LYDA 3IFEA 3B3WA 2POKA 2V8GA 3BI0A 4P4BA 1AMPA 2DEAA 4MRIA 4JYWA 3WC5A 1VIXA 3NH8A 3KL9A 2O4HA 3PBBA 1F2OA 2RFHA 5K8PA 3D7GA 5LYIA 1XRYA 3S9NA 2ANPA 2OOTA 3SJFA 1ZLIA 2BCOA 3PB9X 3ISZA 3H8GA 4NGRA 3GLJA 4K3NA 4RUHA 4Q7AA 4MCRA 3KR5A 1TF8A 3TX8A 4YWYA 3JRUA 1LFWA 3MRUA 5DS0A 1VHEA 4F8ZA 4PXDA 1LANA 2CTCA 3IWWA 1FNOA 1YLOA 4P4EA 3KHXA 1PYTB 2CTBA 1CG2A 1ARLA 4NGQA 4MHPA 2ZEOA 1LOKA 2EK8A 3KR4A 4P6YA 3RZAA 1ZG7A 4FAIA 1ELLP 1HDUA 4EMEA 1BPNA 1CPSA 3HUVA 3FJUA 5D8NA 5LYFA 4P4FA 1DE4C 2I3CA 1Y0YA 3V38A 3WC6A 3QNVA 2C6CA 1OBRA 3RAMA 5CPAA 4ZY2A 4MHYA 5JM6A 2GLFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LAM A;  2V8D A;  2CIJ A;  4X3R A;  3CPX A;  4ZYQ A;  4UF4 A;  3B3V A;  1KWM A;  2WZN A;  4YU9 A;  3FH4 A;  1Z8L A;  4H2K A;  3VH9 A;  3KQZ A;  4MXU A;  4NGS A;  4PXC A;  3GUX A;  4MCQ A;  5K8N A;  1ARM A;  3KI9 A;  2ZED A;  3WAB A;  3I1U A;  5I4M A;  1Z5R A;  1F57 A;  2JBJ A;  4MHZ A;  3VAR A;  2Q4Z A;  1UWY A;  3PB7 X;  4PXE A;  3BHX A;  4UEE A;  3FX6 A;  4WJB A;  4OC4 A;  3SJE A;  3S9L A;  2ZOG A;  3IC1 A;  3D66 A;  1Q7L A;  3CPA A;  6CPA A;  4DUK A;  4P4J A;  3NH5 A;  2F8H A;  4NGM A;  1GYT A;  2AFW A;  4W9Y A;  2PIZ A;  3K2K A;  3SJG A;  4FBE A;  1IGB A;  2EWB A;  2ZOF A;  1CP6 A;  2ZEN A;  4EFD A;  5K8M A;  3MN8 A;  2AFM A;  4R7M A;  1CPX A;  4P44 A;  2QJ8 A;  4P45 A;  4MHN A;  3RBU A;  2PJ8 A;  2BO9 A;  4OKO A;  1F2P A;  3SI2 A;  2GRE A;  3B3T A;  4TNU A;  2PJ5 A;  4F9U A;  2PJ2 A;  2O53 A;  4AXV A;  2IJZ A;  2GLJ A;  3V7Z A;  2ZEL A;  4PQA A;  2XEF A;  3B3C A;  2C6P A;  2PJC A;  1TF9 A;  3FMC A;  4P10 A;  5CBM A;  4FWU A;  2PIY A;  1IY7 A;  1VHO A;  5LYL A;  1R3N A;  1Y0R A;  3HLP A;  2ZEE A;  3FF3 A;  1TKH A;  1BAV A;  4ONW A;  4A94 A;  4OC3 A;  3WT4 A;  4P4D A;  2G9D A;  4OME A;  3BI1 A;  2Q43 A;  2AFZ A;  2QYV A;  2PJA A;  3D68 A;  1XFO A;  4DYO A;  1CP7 A;  1Y7E A;  3FEE A;  3SI0 A;  2PRQ A;  2JEW A;  4OC5 A;  3FED A;  1HDQ A;  3NFZ A;  1TKJ A;  3H8F A;  2PJ1 A;  1YSJ A;  4MCS A;  1TKF A;  5HVG A;  4IHM A;  2XEI A;  4R8F A;  4O23 A;  1QQ9 A;  3LWU A;  2PVV A;  1H8L A;  2ZEF A;  5ELY A;  4MMO A;  3FEC A;  3SJX A;  2PJB A;  2HB6 A;  2AFU A;  3PBE A;  2NYQ A;  3B2Y A;  1BLL E;  3IIB A;  3SI1 A;  4ZI6 A;  3T8W A;  1Z2L A;  1XBU A;  1BPM A;  2PJ4 A;  2ZEH A;  5D29 A;  1M4L A;  5JGF A;  1VGY A;  3D7H A;  1AYE A;  3DLJ A;  2BOA A;  4A37 A;  3IO1 A;  3CDX A;  2GU2 A;  5LRJ A;  2PE3 A;  4NGN A;  4OC2 A;  4R76 A;  2RB7 A;  2C1C A;  2AFX A;  4PPZ A;  2HC9 A;  4WWV A;  3LMS A;  1LCP A;  2FVG A;  5THW A;  4UIB A;  5LRK A;  3L2N A;  2V8H A;  2PJ7 A;  5K8O A;  3FVL A;  1HEE A;  4NJR A;  3DGV A;  2C6G A;  3PB4 X;  1YW6 A;  2QVP A;  1ZLH A;  4OC0 A;  2AFO A;  3TC8 A;  2Q51 A;  4UEZ A;  4ZX9 A;  5J1Q A;  3KHZ A;  3K9T A;  4ZY0 A;  3WC7 A;  7CPA A;  2ZEG A;  2CF4 A;  4IAV A;  1XJO A;  1XMB A;  2VL1 A;  2IQ6 A;  4B6Z A;  4IK2 A;  3PB8 X;  1TXR A;  2PJ6 A;  3KZW A;  2IMO A;  3IEH A;  4X8I A;  1FT7 A;  3NA6 A;  3B35 A;  3B3S A;  3IJ3 A;  2PVW A;  4F9V A;  4TWE A;  1ZG9 A;  1CBX A;  1EE3 P;  2NSM A;  4LQG A;  4CPA A;  4OID A;  2PJ9 A;  3S9M A;  4X2T A;  4DJL A;  4NFR A;  2XEJ A;  3N5F A;  1CX8 A;  4MCP A;  1YME A;  8CPA A;  4UEF A;  2V8V A;  4OP4 A;  3NH4 A;  3PRT A;  5LRG A;  3H8E A;  1QMU A;  4KSI A;  4OIW A;  3VAT A;  5HVH A;  4JZ0 A;  2PJ0 A;  3BXM A;  3KGQ A;  3B7I A;  1DTD A;  2PJ3 A;  2XEG A;  1RTQ A;  4ZX8 A;  5F09 A;  3D67 A;  4FUU A;  1R43 A;  3PFE A;  2JBK A;  2J9A A;  3D4U A;  2PCU A;  4UIA A;  1PCA A;  2AFS A;  5HXD A;  2V77 A;  1ELM P;  3KAS A;  5IB9 A;  4PXB A;  1LAP A;  1JQG A;  1YW4 A;  4OC1 A;  2EK9 A;  4BD9 A;  3PEI A;  2F7V A;  3PFO A;  4R6T A;  4NGT A;  4GM5 A;  4P4I A;  4A38 A;  2ZEM A;  4Z65 A;  1NSA A;  2ABZ A;  3PB6 X;  5JH9 A;  4NJQ A;  3KQX A;  3D7F A;  5HVF A;  4NGP A;  3D7D A;  2WYR A;  3ISX A;  3GB0 A;  4G1P A;  4ZY1 A;  4EWT A;  2ZEP A;  1ZG8 A;  2OR4 A;  3CT9 A;  4A39 A;  5LYD A;  3IFE A;  3B3W A;  2POK A;  2V8G A;  3BI0 A;  4P4B A;  1AMP A;  2DEA A;  4MRI A;  4JYW A;  3WC5 A;  1VIX A;  3NH8 A;  3KL9 A;  2O4H A;  3PBB A;  1F2O A;  2RFH A;  5K8P A;  3D7G A;  5LYI A;  1XRY A;  3S9N A;  2ANP A;  2OOT A;  3SJF A;  1ZLI A;  2BCO A;  3PB9 X;  3ISZ A;  3H8G A;  4NGR A;  3GLJ A;  4K3N A;  4RUH A;  4Q7A A;  4MCR A;  3KR5 A;  1TF8 A;  3TX8 A;  4YWY A;  3JRU A;  1LFW A;  3MRU A;  5DS0 A;  1VHE A;  4F8Z A;  4PXD A;  1LAN A;  2CTC A;  3IWW A;  1FNO A;  1YLO A;  4P4E A;  3KHX A;  1PYT B;  2CTB A;  1CG2 A;  1ARL A;  4NGQ A;  4MHP A;  2ZEO A;  1LOK A;  2EK8 A;  3KR4 A;  4P6Y A;  3RZA A;  1ZG7 A;  4FAI A;  1ELL P;  1HDU A;  4EME A;  1BPN A;  1CPS A;  3HUV A;  3FJU A;  5D8N A;  5LYF A;  4P4F A;  1DE4 C;  2I3C A;  1Y0Y A;  3V38 A;  3WC6 A;  3QNV A;  2C6C A;  1OBR A;  3RAM A;  5CPA A;  4ZY2 A;  4MHY A;  5JM6 A;  2GLF A; 
#chains in the Genus database with same CATH topology
 1LAM A;  2V8D A;  4NF1 A;  2YND A;  4CGN A;  1PUA A;  3TO6 A;  3I3G A;  2CIJ A;  2R7H A;  1QSR A;  2EO8 A;  4XPK A;  3IU2 A;  4X3R A;  3CPX A;  4ZYQ A;  4UF4 A;  2GFQ A;  4RI1 A;  4CYP A;  1B6B A;  3B3V A;  1KWM A;  2WZN A;  4YU9 A;  3RO0 A;  3FH4 A;  1Z8L A;  1UFH A;  4H2K A;  3LAC A;  4OAE A;  3R9G A;  3KQZ A;  4MXU A;  3VH9 A;  2PR1 A;  3DR6 A;  1YQE A;  4NGS A;  2D4O A;  4PSX A;  2ATR A;  4PXC A;  2R1I A;  3GUX A;  4ZBG A;  5G20 A;  4MCQ A;  4NEX A;  4ONU A;  5K8N A;  2JLM A;  1YLE A;  4KOT A;  1ARM A;  5G21 A;  3KI9 A;  2ZED A;  3VWD A;  2Q7B A;  3F5B A;  3WAB A;  2ZXV A;  5C88 A;  3I1U A;  4R57 A;  5I4M A;  3N7Z A;  1Z4R A;  1F57 A;  1Z5R A;  2ZW5 A;  3EXN A;  4CAX A;  2JBJ A;  1Z8T A;  2ZPA A;  4MHZ A;  2Q4Z A;  3VAR A;  1UWY A;  4E2A A;  3PB7 X;  5IV0 A;  4PXE A;  3EY5 A;  3RYO A;  3BHX A;  4UEE A;  1YX0 A;  3FX6 A;  4MFZ A;  4WJB A;  4OC4 A;  3SJE A;  3S9L A;  2ZOG A;  4UCP A;  4KZT A;  2VEZ A;  3IC1 A;  3D66 A;  1Q7L A;  1MK4 A;  3GIU A;  1IU8 A;  3CPA A;  3JVN A;  1XMT A;  4DUK A;  6CPA A;  1X10 A;  1YRE A;  3NH5 A;  4P4J A;  2F8H A;  4NGM A;  4A33 A;  1GYT A;  4F0Y A;  2AFW A;  3DDD A;  1IID A;  3R1K A;  4W9Y A;  2PIZ A;  3K2K A;  4CAF A;  3SJG A;  3H4Q A;  4KOW A;  3RNZ A;  4CAV A;  2G3T A;  1YVK A;  4FBE A;  5F49 A;  3FNC A;  4M6H A;  1IGB A;  2EWB A;  2ZOF A;  1CP6 A;  1WK4 A;  3EO4 A;  2ZEN A;  4KSF A;  4AG9 A;  4EFD A;  4H89 A;  5K8M A;  3MN8 A;  4C68 A;  5KTD A;  1M4I A;  1P4N A;  2WUU A;  2AFM A;  4R7M A;  1CPX A;  1J4J A;  3DNS A;  4P44 A;  2QJ8 A;  4LX9 A;  4XPD B;  5CNP A;  1LRZ A;  2FS5 A;  4X5K A;  3ZJ0 A;  4E0A A;  4P45 A;  4KOR A;  4XNH B;  2BEI A;  5GCN A;  2PSW A;  4MHN A;  3RBU A;  3BLN A;  2PJ8 A;  1VHS A;  2BO9 A;  4CAW A;  1V0C A;  4QUS A;  3LD2 A;  4MFQ A;  1YGH A;  4OKO A;  3R95 A;  3PP9 A;  4DNC A;  2OZU A;  4MJ8 A;  4II9 A;  1F2P A;  1K4J A;  2I79 A;  5H86 A;  3SI2 A;  2GRE A;  4OLL A;  3B3T A;  4TNU A;  2PJ5 A;  1S7N A;  1M4D A;  4FD7 A;  4F9U A;  2PJ2 A;  2O53 A;  1U6M A;  1FY7 A;  1M44 A;  2IJZ A;  2GLJ A;  3DSB A;  4AXV A;  4B13 A;  3V7Z A;  4Q36 A;  1NMT A;  2OU2 A;  4CGM A;  4F6A A;  2ZEL A;  3PGP A;  2B3V A;  4PQA A;  2XEF A;  4UFV A;  4OAD A;  1Y9W A;  3B3C A;  2C6P A;  1CJW A;  3S6K A;  4K30 A;  2PJC A;  1TF9 A;  3FMC A;  4P10 A;  1IIC A;  2OZG A;  5CBM A;  4FWU A;  4KOS A;  2PIY A;  1IY7 A;  1VHO A;  2Q4V A;  4MBU A;  4RN7 A;  4ZGY B;  1YR0 A;  3SXO A;  5LYL A;  2BL1 A;  2Z3L A;  1R3N A;  1Y0R A;  3HLP A;  2ZEE A;  4IUS A;  3FF3 A;  1TKH A;  1BAV A;  4ONW A;  4A94 A;  4OC3 A;  3WT4 A;  5KTC A;  2CNT A;  4MFK A;  3TFY A;  1OZP A;  4P4D A;  2G9D A;  4OME A;  5AG6 A;  3BI1 A;  2Q43 A;  2AFZ A;  3FYN A;  2AE6 A;  2QYV A;  1KZF A;  2PJA A;  1S60 A;  3D68 A;  1XIX A;  4B10 A;  5F46 A;  1XFO A;  3H5Z A;  4DYO A;  3T9Y A;  2JEV A;  1ZO0 A;  1CP7 A;  1Y7E A;  3FEE A;  3SI0 A;  2PRQ A;  4KVX A;  2B3U A;  4CGL A;  2JEW A;  4OC5 A;  3FED A;  1IB1 E;  3KKW A;  1HDQ A;  4CYN A;  2ZW7 A;  1TKJ A;  3NFZ A;  2G0B A;  3H8F A;  2ZW4 A;  2ARH A;  2PJ1 A;  1YSJ A;  3NE8 A;  2FXF A;  3DR8 A;  4MCS A;  1TKF A;  3EC4 A;  5D8N A;  5HVG A;  3R9E A;  4IHM A;  4UCN A;  3WR7 A;  2XEI A;  4R8F A;  3IU1 A;  4O23 A;  4HKF A;  1QQ9 A;  3LWU A;  4Y49 C;  4U5Y A;  2PVV A;  1H8L A;  2ZEF A;  5ELY A;  4KOV A;  1KUY A;  3IWE A;  1CM0 A;  4GS4 A;  4AVB A;  3D2P A;  4C2Z A;  4QVT A;  4NXY A;  4MMO A;  3FEC A;  4HNY B;  4R3L A;  3SJX A;  5J8C A;  4C7H A;  2QML A;  2FE7 A;  2PJB A;  2D4P A;  4IF5 A;  2HB6 A;  3SXN A;  4UA3 A;  1Z4E A;  2AFU A;  3PBE A;  2NYQ A;  3B2Y A;  1BLL E;  3C26 A;  3I9S A;  3IIB A;  3MGD A;  3SI1 A;  1Z2L A;  3T8W A;  2VQY A;  1XBU A;  1BPM A;  2O28 A;  2B5G B;  4KVM E;  4R3K A;  2PJ4 A;  4J3G A;  2ZEH A;  2R8V A;  4JXQ A;  4MFJ A;  1M4L A;  3CZX A;  5AG7 A;  5D29 A;  5JGF A;  1IOI A;  4B11 A;  1VGY A;  3W6X A;  3D7H A;  1QSM A;  1AYE A;  4M3S A;  3DLJ A;  2BOA A;  3CXP A;  1SQH A;  2OH1 A;  2OZH A;  4A37 A;  3IO1 A;  3TO9 A;  3CDX A;  2GU2 A;  2ZW6 A;  4UBR A;  5LRJ A;  3K9U A;  2PE3 A;  4KUA A;  4NGN A;  4OC2 A;  2B5G A;  2DXQ A;  3LOD A;  3P2F A;  1AUG A;  1ON0 A;  2PRB A;  2Q7S A;  2BSW A;  2REF A;  2X7B A;  2P6E A;  4R76 A;  4PSW A;  4HNW B;  2RB7 A;  2C1C A;  2JDD A;  2VZZ A;  2AFX A;  3V8I A;  4A32 A;  3BJ8 A;  4PPZ A;  2HC9 A;  4M6G A;  4WWV A;  3LMS A;  1RO5 A;  4BIN A;  1LCP A;  2FVG A;  1Z9U A;  4CGP A;  5THW A;  1R57 A;  4UIB A;  3S6G A;  2QIR A;  5LRK A;  3L2N A;  4A95 A;  2V8H A;  2PJ7 A;  5K8O A;  3FVL A;  1HEE A;  4NJR A;  3DGV A;  2C6G A;  3PB4 X;  2DPT A;  2FIW A;  5EMI A;  1NSL A;  5C82 A;  3G8W A;  1YW6 A;  3A9L A;  2Z3K A;  2Z0Z A;  1IOF A;  2QVP A;  1Y9K A;  4ORF A;  1ZLH A;  4OC0 A;  1XOV A;  1IYL A;  2AFO A;  2CNM A;  2QEC A;  1M1D A;  3TC8 A;  2EVN A;  2Q51 A;  4UEZ A;  4ZX9 A;  3KHZ A;  4UCM A;  5J1Q A;  3K9T A;  4KS9 A;  4ZY0 A;  3WC7 A;  7CPA A;  2FL4 A;  2ZEG A;  2CF4 A;  2Q44 A;  4IAV A;  1XJO A;  2B58 A;  3ZZI A;  4C7I A;  3EFA A;  4MY0 A;  1XMB A;  2VL1 A;  3FXT A;  2IQ6 A;  2NMT A;  3GKR A;  4FD4 A;  5IB0 A;  4U9Y A;  4B6Z A;  4BMH A;  4R9M A;  2Y0M A;  4IK2 A;  1XEB A;  2OB0 A;  5FVJ A;  1Y7R A;  3PB8 X;  4PK2 A;  5F48 A;  2B4D B;  1TXR A;  2PJ6 A;  4KOX A;  2HQY A;  2R98 A;  1B87 A;  3KZW A;  1S7K A;  2IMO A;  2Z3O A;  3IEH A;  1Z8X A;  4X8I A;  3R96 A;  4Q38 A;  3TCV A;  1FT7 A;  3NA6 A;  3B35 A;  2YNE A;  3BJ7 A;  4JWP A;  5DWN A;  4AB7 A;  3B3S A;  4CS0 B;  1IYK A;  3IJ3 A;  4CRY B;  5I0C A;  2PVW A;  4MFL A;  3FB3 A;  4AVA A;  4QBJ A;  1MJ9 A;  3W91 A;  2B4D A;  1PU9 A;  4F9V A;  4TWE A;  1ZG9 A;  3TE4 A;  1CBX A;  4B5P B;  1EE3 P;  2NSM A;  4LQG A;  4CPA A;  4B5O A;  4MY3 A;  4OID A;  4M6I A;  2PJ9 A;  3S9M A;  4UFX A;  3S6F A;  4X2T A;  2PDO A;  2GE3 A;  2J8N A;  3FIX A;  4C2X A;  4NFR A;  2XEJ A;  4DJL A;  3N5F A;  3FRM A;  1CX8 A;  4XPD C;  3TOB A;  4MCP A;  1YME A;  4B5P A;  8CPA A;  4UEF A;  2WSA A;  2V8V A;  4OP4 A;  3UY5 A;  4M85 A;  3NH4 A;  3PRT A;  2P6F A;  1S5K A;  2YNC C;  2VZY A;  4QB9 A;  5LRG A;  2FIA A;  1QMU A;  3H8E A;  4HNX B;  4KSI A;  4FD6 A;  4ZI6 A;  4OIW A;  3VAT A;  5HVH A;  4JZ0 A;  2PJ0 A;  3BXM A;  3P2H A;  4A31 A;  1QSN A;  3E0K A;  4EVY A;  3KGQ A;  4JLY A;  5A27 A;  3B7I A;  2Q4Y A;  1DTD A;  2PJ3 A;  2XEG A;  1RTQ A;  2Z3M A;  4ZX8 A;  1I1D A;  2VI7 A;  3D67 A;  5F09 A;  2H5M A;  1A2Z A;  3GYA A;  1YVO A;  4FUU A;  4LUA A;  3CXS A;  1R43 A;  3PFE A;  3SHP A;  1BOB A;  2JBK A;  2WPW A;  3F8K A;  2J9A A;  1YK3 A;  3D4U A;  2FT0 A;  4L8A A;  4R87 A;  4CAE A;  4KLW A;  2PCU A;  4UIA A;  1PCA A;  5EC4 A;  2Q04 A;  5A28 A;  2AFS A;  5HXD A;  2V77 A;  4A2Z A;  3NE7 A;  4B12 A;  4YFJ A;  2C27 A;  3TO7 A;  1ELM P;  2FSR A;  3KAS A;  5IB9 A;  4PXB A;  1LAP A;  4YRH A;  3FBU A;  1JQG A;  4I49 A;  1YW4 A;  2WPX A;  3B8G A;  3QAH A;  4OC1 A;  3CXQ A;  4PV6 A;  2EK9 A;  2J8M A;  4BD9 A;  3PEI A;  2F7V A;  3PFO A;  4CRZ B;  4R6T A;  4NGT A;  3IGR A;  3R9F A;  3W6S A;  5JPH A;  4GM5 A;  3JUW A;  4P4I A;  3D3S A;  2CNS A;  4GXH A;  4A38 A;  2GIV A;  2ZEM A;  3D2M A;  1NSA A;  3G3S A;  4U9Z A;  4Z65 A;  2ABZ A;  2IL4 A;  3PB6 X;  4UWJ A;  5ISV A;  5JH9 A;  4NJQ A;  2HUZ A;  4KSA A;  5HH1 A;  3KQX A;  2DPS A;  2F5I A;  3D7F A;  5HVF A;  5KTA A;  3D8P A;  4QC6 A;  1MJB A;  4NGP A;  2A4N A;  4H6Z A;  4F0X A;  3D7D A;  3TOA A;  2WYR A;  2K5T A;  3ISX A;  1Z8W A;  3S6H A;  3GB0 A;  3VWE A;  5E96 A;  4G1P A;  4MHD A;  4C2Y A;  4ZY1 A;  4EWT A;  1JWQ A;  2ZEP A;  1ZG8 A;  1Q2Y A;  2P6G A;  3PZJ A;  4A30 A;  4AG7 A;  2OR4 A;  4HPS A;  3CT9 A;  5DWM A;  4A39 A;  5LYD A;  5G22 A;  4KOU A;  2JDC A;  3IFE A;  4KVO E;  4CYO A;  5H84 A;  3T90 A;  3B3W A;  4JXR A;  1NE9 A;  1S3Z A;  2POK A;  2V8G A;  4CGO A;  3BI0 A;  4P4B A;  2CXA A;  5AG4 A;  1N71 A;  1TIQ A;  1AMP A;  2BUE A;  2G3A A;  2DEA A;  4KOY A;  4MRI A;  4JYW A;  2I00 A;  3WC5 A;  1VIX A;  2EBJ A;  2VXK A;  3NH8 A;  3KL9 A;  2Z10 A;  2DF5 A;  3IWG A;  3QB8 A;  2O4H A;  3PBB A;  4NSQ A;  2VBQ A;  1F2O A;  4UFW A;  2RFH A;  2REE A;  3D7G A;  4KUB A;  5LYI A;  5BWA B;  5K8P A;  1GHE A;  1XRY A;  5EBV A;  3S9N A;  2ANP A;  2Z11 A;  2OOT A;  3SJF A;  1ZLI A;  2PR8 A;  4NCZ A;  3TT2 A;  2BCO A;  3PB9 X;  1QSO A;  3ISZ A;  4RS2 A;  4LQ6 A;  5F47 A;  3H8G A;  1RXT A;  4NGR A;  1XF8 A;  4H6U A;  5HMN A;  2HV2 A;  3GLJ A;  4K3N A;  1I21 A;  1Q2C A;  4B14 A;  4XPL A;  5J8F A;  4JJX A;  1P0H A;  4RUH A;  4Q7A A;  4MCR A;  2CY2 A;  4E8O A;  3KR5 A;  1TF8 A;  4L89 A;  4UWI A;  3TX8 A;  2YNC A;  4YGO A;  4FD5 A;  5JQ4 A;  1XE4 A;  4YWY A;  3JRU A;  1KUV A;  1LFW A;  3MRU A;  5DS0 A;  2P0W A;  1VHE A;  4KLV A;  4F8Z A;  4PXD A;  1LAN A;  2CTC A;  3IWW A;  1FNO A;  2YGW A;  1YLO A;  4P4E A;  3KHX A;  4Y49 B;  1PYT B;  1QST A;  1X12 A;  2CTB A;  1KUX A;  2Q0Y A;  1S7L A;  1CG2 A;  2KCW A;  1ARL A;  4PK3 A;  2FCK A;  3GY9 A;  5IX3 A;  4NGQ A;  4MHP A;  4XNH C;  4CYQ A;  1WWZ A;  5AGE A;  3TTH A;  2ZEO A;  3OWC A;  1LOK A;  2EK8 A;  3KR4 A;  4P6Y A;  3RZA A;  1ZG7 A;  4BBH A;  4FAI A;  2PC1 A;  4MFP A;  1BO4 A;  1ELL P;  1HDU A;  2B4B A;  1BPN A;  5G1Z A;  4AVC A;  4EME A;  1CPS A;  3JTK A;  3HUV A;  2PQ8 A;  2RC4 A;  2GAN A;  2EUI A;  3FJU A;  1M4G A;  1S7F A;  1DE4 C;  2J8R A;  4P4F A;  2I3C A;  5LYF A;  1Y0Y A;  2AJ6 A;  3V38 A;  4JD6 A;  3WC6 A;  4MI4 A;  1MJA A;  3QNV A;  3QAY A;  1I12 A;  2C6C A;  2Z3N A;  2Z3P A;  1L0C A;  1OBR A;  3RAM A;  5CPA A;  4ZY2 A;  1VKC A;  1Q2D A;  5AG5 A;  4MHY A;  5JM6 A;  2ODF A;  2GLF A;  3F0A A; 
#chains in the Genus database with same CATH homology
 1LAM A;  2V8D A;  2CIJ A;  4X3R A;  3CPX A;  4ZYQ A;  4UF4 A;  3B3V A;  1KWM A;  2WZN A;  4YU9 A;  3FH4 A;  1Z8L A;  4H2K A;  3VH9 A;  3KQZ A;  4MXU A;  4NGS A;  4PXC A;  3GUX A;  4MCQ A;  5K8N A;  1ARM A;  3KI9 A;  2ZED A;  3WAB A;  3I1U A;  5I4M A;  1Z5R A;  1F57 A;  2JBJ A;  4MHZ A;  3VAR A;  2Q4Z A;  1UWY A;  3PB7 X;  4PXE A;  3BHX A;  4UEE A;  3FX6 A;  4WJB A;  4OC4 A;  3SJE A;  3S9L A;  2ZOG A;  3IC1 A;  3D66 A;  1Q7L A;  3CPA A;  6CPA A;  4DUK A;  4P4J A;  3NH5 A;  2F8H A;  4NGM A;  1GYT A;  2AFW A;  4W9Y A;  2PIZ A;  3K2K A;  3SJG A;  4FBE A;  1IGB A;  2EWB A;  2ZOF A;  1CP6 A;  2ZEN A;  4EFD A;  5K8M A;  3MN8 A;  2AFM A;  4R7M A;  1CPX A;  4P44 A;  2QJ8 A;  4P45 A;  4MHN A;  3RBU A;  2PJ8 A;  2BO9 A;  4OKO A;  1F2P A;  3SI2 A;  2GRE A;  3B3T A;  4TNU A;  2PJ5 A;  4F9U A;  2PJ2 A;  2O53 A;  4AXV A;  2IJZ A;  2GLJ A;  3V7Z A;  2ZEL A;  4PQA A;  2XEF A;  3B3C A;  2C6P A;  2PJC A;  1TF9 A;  3FMC A;  4P10 A;  5CBM A;  4FWU A;  2PIY A;  1IY7 A;  1VHO A;  5LYL A;  1R3N A;  1Y0R A;  3HLP A;  2ZEE A;  3FF3 A;  1TKH A;  1BAV A;  4ONW A;  4A94 A;  4OC3 A;  3WT4 A;  4P4D A;  2G9D A;  4OME A;  3BI1 A;  2Q43 A;  2AFZ A;  2QYV A;  2PJA A;  3D68 A;  1XFO A;  4DYO A;  1CP7 A;  1Y7E A;  3FEE A;  3SI0 A;  2PRQ A;  2JEW A;  4OC5 A;  3FED A;  1HDQ A;  3NFZ A;  1TKJ A;  3H8F A;  2PJ1 A;  1YSJ A;  4MCS A;  1TKF A;  5HVG A;  4IHM A;  2XEI A;  4R8F A;  4O23 A;  1QQ9 A;  3LWU A;  2PVV A;  1H8L A;  2ZEF A;  5ELY A;  4MMO A;  3FEC A;  3SJX A;  2PJB A;  2HB6 A;  2AFU A;  3PBE A;  2NYQ A;  3B2Y A;  1BLL E;  3IIB A;  3SI1 A;  4ZI6 A;  3T8W A;  1Z2L A;  1XBU A;  1BPM A;  2PJ4 A;  2ZEH A;  5D29 A;  1M4L A;  5JGF A;  1VGY A;  3D7H A;  1AYE A;  3DLJ A;  2BOA A;  4A37 A;  3IO1 A;  3CDX A;  2GU2 A;  5LRJ A;  2PE3 A;  4NGN A;  4OC2 A;  4R76 A;  2RB7 A;  2C1C A;  2AFX A;  4PPZ A;  2HC9 A;  4WWV A;  3LMS A;  1LCP A;  2FVG A;  5THW A;  4UIB A;  5LRK A;  3L2N A;  2V8H A;  2PJ7 A;  5K8O A;  3FVL A;  1HEE A;  4NJR A;  3DGV A;  2C6G A;  3PB4 X;  1YW6 A;  2QVP A;  1ZLH A;  4OC0 A;  2AFO A;  3TC8 A;  2Q51 A;  4UEZ A;  4ZX9 A;  5J1Q A;  3KHZ A;  3K9T A;  4ZY0 A;  3WC7 A;  7CPA A;  2ZEG A;  2CF4 A;  4IAV A;  1XJO A;  1XMB A;  2VL1 A;  2IQ6 A;  4B6Z A;  4IK2 A;  3PB8 X;  1TXR A;  2PJ6 A;  3KZW A;  2IMO A;  3IEH A;  4X8I A;  1FT7 A;  3NA6 A;  3B35 A;  3B3S A;  3IJ3 A;  2PVW A;  4F9V A;  4TWE A;  1ZG9 A;  1CBX A;  1EE3 P;  2NSM A;  4LQG A;  4CPA A;  4OID A;  2PJ9 A;  3S9M A;  4X2T A;  4DJL A;  4NFR A;  2XEJ A;  3N5F A;  1CX8 A;  4MCP A;  1YME A;  8CPA A;  4UEF A;  2V8V A;  4OP4 A;  3NH4 A;  3PRT A;  5LRG A;  3H8E A;  1QMU A;  4KSI A;  4OIW A;  3VAT A;  5HVH A;  4JZ0 A;  2PJ0 A;  3BXM A;  3KGQ A;  3B7I A;  1DTD A;  2PJ3 A;  2XEG A;  1RTQ A;  4ZX8 A;  5F09 A;  3D67 A;  4FUU A;  1R43 A;  3PFE A;  2JBK A;  2J9A A;  3D4U A;  2PCU A;  4UIA A;  1PCA A;  2AFS A;  5HXD A;  2V77 A;  1ELM P;  3KAS A;  5IB9 A;  4PXB A;  1LAP A;  1JQG A;  1YW4 A;  4OC1 A;  2EK9 A;  4BD9 A;  3PEI A;  2F7V A;  3PFO A;  4R6T A;  4NGT A;  4GM5 A;  4P4I A;  4A38 A;  2ZEM A;  4Z65 A;  1NSA A;  2ABZ A;  3PB6 X;  5JH9 A;  4NJQ A;  3KQX A;  3D7F A;  5HVF A;  4NGP A;  3D7D A;  2WYR A;  3ISX A;  3GB0 A;  4G1P A;  4ZY1 A;  4EWT A;  2ZEP A;  1ZG8 A;  2OR4 A;  3CT9 A;  4A39 A;  5LYD A;  3IFE A;  3B3W A;  2POK A;  2V8G A;  3BI0 A;  4P4B A;  1AMP A;  2DEA A;  4MRI A;  4JYW A;  3WC5 A;  1VIX A;  3NH8 A;  3KL9 A;  2O4H A;  3PBB A;  1F2O A;  2RFH A;  5K8P A;  3D7G A;  5LYI A;  1XRY A;  3S9N A;  2ANP A;  2OOT A;  3SJF A;  1ZLI A;  2BCO A;  3PB9 X;  3ISZ A;  3H8G A;  4NGR A;  3GLJ A;  4K3N A;  4RUH A;  4Q7A A;  4MCR A;  3KR5 A;  1TF8 A;  3TX8 A;  4YWY A;  3JRU A;  1LFW A;  3MRU A;  5DS0 A;  1VHE A;  4F8Z A;  4PXD A;  1LAN A;  2CTC A;  3IWW A;  1FNO A;  1YLO A;  4P4E A;  3KHX A;  1PYT B;  2CTB A;  1CG2 A;  1ARL A;  4NGQ A;  4MHP A;  2ZEO A;  1LOK A;  2EK8 A;  3KR4 A;  4P6Y A;  3RZA A;  1ZG7 A;  4FAI A;  1ELL P;  1HDU A;  4EME A;  1BPN A;  1CPS A;  3HUV A;  3FJU A;  5D8N A;  5LYF A;  4P4F A;  1DE4 C;  2I3C A;  1Y0Y A;  3V38 A;  3WC6 A;  3QNV A;  2C6C A;  1OBR A;  3RAM A;  5CPA A;  4ZY2 A;  4MHY A;  5JM6 A;  2GLF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...