2PCUA

Human carboxypeptidase a4 in complex with a cleaved hexapeptide.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
305
structure length
305
Chain Sequence
NNFNYGAYHSLEAIYHEMDNIAADFPDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGPHANSEVEVKSVVDFIQKHGNFKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELRDTGTYGFLLPANQIIPTAEETWLGLKTIMEHVRDNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Carboxypeptidase A4
publication title Caught after the Act: a human A-type metallocarboxypeptidase in a product complex with a cleaved hexapeptide.
pubmed doi rcsb
source organism Homo sapiens
total genus 115
structure length 305
sequence length 305
ec nomenclature ec 3.4.17.-:
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2pcuA00
3D7GA 1YMEA 4MHNA 4PXEA 1CG2A 2CTCA 1CPSA 3KHXA 3NFZA 2GU2A 2PRQA 1R3NA 1ZG9A 4MCPA 3VH9A 5JGFA 3SJXA 4O23A 5I4MA 2C6PA 1F57A 4ZY1A 1HDQA 4FAIA 2AFXA 1IY7A 2ZEGA 4NFRA 1F2PA 2QVPA 2IMOA 4PXBA 1XMBA 2PVWA 2O53A 3KR5A 2PJ7A 4Q7AA 3FEEA 5HXDA 4IK2A 2JEWA 2AFZA 4EWTA 3H8EA 5LRGA 5LYLA 3IEHA 3IJ3A 3KZWA 2PJ9A 1NSAA 1FT7A 5K8OA 2AFSA 4NGRA 2AFUA 4DYOA 1HEEA 4NGNA 2PJAA 4MRIA 2G9DA 3T8WA 1CP6A 4NGTA 4OIDA 1HDUA 2PJBA 1LAMA 3VATA 5K8NA 3BHXA 4P4EA 4W9YA 2XEIA 3B7IA 3FX6A 3IIBA 5JH9A 3WC7A 3MN8A 3KL9A 2O4HA 3WABA 5HVFA 4UEFA 3SI2A 3K2KA 4X8IA 3SI1A 4P4JA 2F7VA 1TKHA 1FNOA 3IC1A 3KHZA 1VGYA 2ZEDA 1UWYA 1BPMA 4OIWA 3PFOA 2EK8A 1Q7LA 2EWBA 3NA6A 4UEZA 4IHMA 4LQGA 4P4BA 3RAMA 3PBEA 4MCQA 4CPAA 2ZEFA 2AFWA 2PIZA 3PB6X 3JRUA 1RTQA 2GLFA 4FUUA 2QJ8A 2JBKA 2PJCA 4MHYA 2ZOFA 2OR4A 1YW6A 5DS0A 1LFWA 2POKA 3CPAA 4P4IA 4P4DA 1GYTA 1JQGA 3HLPA 5LYIA 2C6GA 2Q43A 2ZELA 2PJ8A 3D4UA 4R7MA 1IGBA 3B35A 3CDXA 3GLJA 2I3CA 3PRTA 4TWEA 4R6TA 4NJRA 4NJQA 1AMPA 1XRYA 4X2TA 3ISXA 3D7DA 3D66A 5K8MA 4MHZA 4P6YA 3DLJA 4MMOA 1BLLE 2ZEMA 3PEIA 4F9UA 3V38A 2Q4ZA 1XBUA 4ZX8A 1F2OA 4KSIA 1DE4C 4TNUA 4K3NA 3ISZA 2V8HA 2ZEPA 7CPAA 2CIJA 4MXUA 4NGSA 4PXCA 1LOKA 3PB8X 2RFHA 4WJBA 1OBRA 2AFOA 5CBMA 2V8DA 3IWWA 1ARLA 5IB9A 2PJ3A 2XEJA 2XEGA 4MCSA 3D67A 3S9LA 1R43A 4X3RA 5LYDA 2DEAA 3FEDA 3FH4A 4B6ZA 1EE3P 4PQAA 2PJ0A 3S9MA 1TKJA 3PB4X 1ZLHA 4UEEA 2J9AA 3WC6A 2CTBA 4MCRA 3I1UA 4G1PA 1ZG8A 3WT4A 3BI1A 3H8GA 4AXVA 4A39A 3D7FA 2OOTA 1LAPA 3H8FA 2NSMA 1Y0YA 4NGQA 4FBEA 2AFMA 1KWMA 1XFOA 4GM5A 5HVGA 1QMUA 1PCAA 3DGVA 4R8FA 3SJEA 1Z2LA 1YLOA 3CPXA 2PJ4A 3HUVA 3BI0A 1Y7EA 2F8HA 4A37A 1TKFA 3BXMA 5LRJA 6CPAA 4OKOA 1LCPA 5LRKA 4ZI6A 2V8VA 4P44A 3KGQA 3GB0A 1LANA 1TXRA 3B3TA 3TX8A 5K8PA 1Z8LA 2ANPA 2PJ2A 2ZEOA 2IQ6A 3KQXA 4ZY2A 3N5FA 3FECA 4EMEA 1ELMP 4IAVA 2ZENA 1Y0RA 4NGMA 4YU9A 1Z5RA 2PJ1A 3B3VA 1TF9A 2RB7A 5JM6A 3RZAA 5J1QA 1H8LA 1PYTB 4Z65A 2PVVA 3LWUA 3B3CA 8CPAA 4EFDA 1VHOA 2V8GA 2VL1A 4OC0A 1AYEA 3QNVA 4P45A 3NH4A 1BPNA 2BCOA 4YWYA 1CBXA 2ZOGA 1CPXA 1ZG7A 4OMEA 4JZ0A 3FF3A 2C6CA 3IO1A 5D8NA 3K9TA 3L2NA 2BOAA 4PXDA 2WZNA 2PJ6A 1VIXA 2FVGA 3SJGA 3PB7X 5D29A 3FMCA 2CF4A 3NH5A 4P4FA 2PCUA 4JYWA 3FVLA 3RBUA 2NYQA 3D68A 4OP4A 4ZY0A 2ZEEA 1ZLIA 3PBBA 3PFEA 2HC9A 4OC5A 3SI0A 2Q51A 1VHEA 2IJZA 4F8ZA 3FJUA 5LYFA 4R76A 3KQZA 4ZYQA 4A38A 4RUHA 1XJOA 3KASA 1QQ9A 2HB6A 4P10A 1ELLP 3SJFA 3GUXA 3WC5A 2PIYA 4F9VA 1DTDA 2EK9A 2QYVA 3MRUA 1BAVA 5ELYA 1M4LA 1TF8A 4A94A 3D7HA 5CPAA 3V7ZA 4DJLA 4OC2A 4WWVA 3TC8A 2XEFA 2C1CA 2JBJA 3IFEA 4DUKA 2PE3A 3VARA 3B2YA 4OC3A 4OC4A 5THWA 4BD9A 3B3SA 3CT9A 4MHPA 3NH8A 2GREA 3B3WA 2ZEHA 3PB9X 2PJ5A 4OC1A 1CP7A 4H2KA 4NGPA 5F09A 3LMSA 1CX8A 4UIAA 4ONWA 3S9NA 4UIBA 1ARMA 1YW4A 4FWUA 2BO9A 1YSJA 4UF4A 2GLJA 3KI9A 5HVHA 2V77A 3KR4A 4ZX9A 2WYRA 4PPZA 2ABZA
chains in the Genus database with same CATH superfamily
4XPDB 2PDOA 3D7GA 2PC1A 2FXFA 1YMEA 4CAWA 4MHNA 1Y9WA 3TFYA 4ONUA 4U9YA 4PXEA 1CG2A 5AG6A 2CTCA 1CPSA 4XNHB 3KHXA 3H5ZA 3FNCA 1XIXA 3NFZA 4CYQA 1X12A 2GU2A 2PRQA 1R3NA 4GS4A 4OAEA 1ZG9A 4MCPA 3VH9A 5JGFA 3SJXA 4O23A 5I4MA 2FL4A 2C6PA 1F57A 4Q38A 4ZY1A 3CXQA 5G1ZA 1HDQA 2Q04A 4A33A 3DR6A 4FAIA 2AFXA 1IY7A 2BL1A 2ZEGA 1GHEA 4NFRA 1F2PA 2QVPA 2IMOA 2VZZA 4PXBA 1YREA 1XMBA 2PVWA 4F0YA 2O53A 3KR5A 2PJ7A 3CXSA 3OWCA 1CM0A 3S6FA 4Q7AA 4AB7A 3R9GA 1YVOA 2P6EA 3FEEA 5HXDA 4IK2A 4KORA 2RC4A 2JEWA 5H84A 1YVKA 2AFZA 2YNCC 4M85A 4MI4A 4UFXA 1SQHA 4EWTA 4JD6A 3H8EA 4RN7A 4LUAA 1CJWA 1M4GA 5LRGA 2ZW5A 5LYLA 2Q7BA 3IEHA 4XPLA 3BJ7A 3IJ3A 2Z11A 1S7LA 3KZWA 5IV0A 1N71A 2PJ9A 3W6XA 1NSAA 2FE7A 1FT7A 5K8OA 2AFSA 4NGRA 1KZFA 4YFJA 2HUZA 2AFUA 2WPWA 4DYOA 1HEEA 2BSWA 2GIVA 2PJAA 4HNYB 4NGNA 4JLYA 4LQ6A 4A2ZA 4MFPA 2PR1A 4GXHA 4E8OA 4MRIA 2G9DA 2D4OA 4E2AA 4M6HA 4QBJA 4MFQA 4ZGYB 2DF5A 3TO7A 3T8WA 1XEBA 2B5GA 1CP6A 4NGTA 4OIDA 1QSOA 1Z9UA 1HDUA 3I3GA 2P0WA 5C82A 2PJBA 1LAMA 2BEIA 2D4PA 4OLLA 4R57A 3SXOA 3D2MA 3TT2A 2VXKA 4J3GA 3VATA 5K8NA 4A31A 3BHXA 2WUUA 4P4EA 4HNXB 4W9YA 2XEIA 4F0XA 3B7IA 3QAHA 4PSWA 3FX6A 2KCWA 3IIBA 4CGPA 3WC7A 5JH9A 3MN8A 2B5GB 1K4JA 3KL9A 2O4HA 4MFLA 3WABA 3TCVA 5HVFA 2EBJA 2VQYA 3BJ8A 4UEFA 3SI2A 1RO5A 2YNDA 3K2KA 4B11A 2R8VA 2AE6A 2CNMA 4X8IA 3SI1A 1S5KA 4P4JA 1M44A 2F7VA 1LRZA 2Q44A 1TKHA 3LODA 4CYPA 5IB0A 1FNOA 3IC1A 3KHZA 1VGYA 2ZEDA 4PK2A 1NMTA 1UWYA 1BPMA 1YGHA 2Q7SA 4OIWA 3FBUA 2K5TA 3PFOA 4KVOE 3G8WA 2Q0YA 4X5KA 2EK8A 3W6SA 5HMNA 2CY2A 1Q7LA 2EWBA 5AG7A 3NA6A 4UEZA 3JTKA 4IHMA 4LQGA 2GE3A 4CAEA 1MJBA 4P4BA 3RAMA 3PBEA 4MCQA 4A30A 2ODFA 1I12A 4CPAA 2ZEFA 4B5PA 2B3VA 2AFWA 2PIZA 4AVAA 5E96A 3IWGA 3MGDA 3PB6X 3ZZIA 1BOBA 4DNCA 3JRUA 1RTQA 2GLFA 4FUUA 3IGRA 3LACA 2Y0MA 2QJ8A 2O28A 2JBKA 2PJCA 3JUWA 4M6IA 3R96A 4MHYA 4PK3A 2ZOFA 4E0AA 1MK4A 2OR4A 3TO9A 2JLMA 1YW6A 5DS0A 1LFWA 2POKA 2HV2A 3CPAA 4P4IA 4P4DA 1IYLA 1GYTA 5G22A 1JQGA 1YX0A 3HLPA 5LYIA 2C6GA 4NEXA 2Q43A 2ZELA 2PJ8A 4NCZA 2NMTA 1QSRA 3D4UA 4R7MA 4B5PB 3TTHA 1IB1E 1IGBA 4CAVA 3B35A 4NF1A 3F0AA 3QB8A 3TE4A 4UBRA 4NXYA 3CDXA 1MJAA 3EO4A 1XF8A 4CAXA 2OZHA 3GLJA 4KSFA 3V8IA 2I3CA 3PRTA 4FD6A 4TWEA 4R6TA 5A27A 4NJRA 3N7ZA 4KUAA 3TO6A 1M1DA 4NJQA 4CGMA 1AMPA 4F6AA 3EY5A 1Z8WA 4M6GA 1XRYA 2DXQA 4X2TA 4YGOA 3CZXA 3ISXA 4HKFA 3D7DA 3D66A 1YR0A 2GANA 3GIUA 5K8MA 4MHZA 1ON0A 4P6YA 3T90A 4JXRA 2DPTA 4Q36A 3QAYA 4EVYA 1PU9A 3DLJA 4MMOA 1BLLE 2Z10A 2ZEMA 3PEIA 5C88A 3CXPA 3V38A 2Q4ZA 1XBUA 4ZX8A 4F9UA 4JJXA 1U6MA 1F2OA 1VHSA 1DE4C 1Y9KA 2FIAA 4KSIA 3IWEA 4TNUA 2J8MA 4K3NA 3ISZA 2R1IA 2YNCA 2V8HA 2ZEPA 7CPAA 5ISVA 2CIJA 1Q2CA 2FS5A 3B8GA 4MXUA 4NGSA 1S7KA 4PXCA 1LOKA 3PB8X 2RFHA 4WJBA 3EC4A 1OBRA 2AFOA 1WK4A 2GFQA 5CBMA 2V8DA 3IWWA 1ARLA 4CS0B 5IB9A 2PJ3A 2XEJA 1KUVA 2XEGA 2Z3KA 1S7FA 4MCSA 3D67A 3LD2A 4R87A 2P6FA 2G0BA 3W91A 3S9LA 1R43A 4X3RA 5LYDA 3P2FA 2DEAA 2PRBA 2QMLA 4MHDA 3FEDA 3FH4A 2VI7A 4K30A 4B6ZA 1EE3P 4PQAA 1Y7RA 2PJ0A 4M3SA 4AG9A 2ARHA 3SHPA 3S9MA 2B3UA 3SXNA 1S7NA 1TKJA 5DWMA 4XPKA 1M4DA 3I9SA 4MFJA 3PB4X 1ZLHA 1YQEA 4UEEA 2J9AA 3WC6A 4B5OA 2CTBA 4IF5A 4MCRA 2ATRA 3C26A 2PR8A 4A32A 5I0CA 3I1UA 2I79A 2HQYA 3FYNA 1ZG8A 4FD7A 4G1PA 3BI1A 3WT4A 4CRZB 4HNWB 4BINA 2VZYA 3FB3A 3H8GA 4AXVA 1FY7A 4H89A 2G3TA 3RNZA 1S60A 3D7FA 4A39A 1IOFA 4KVME 2OOTA 4Y49B 3S6HA 1IIDA 1B6BA 1LAPA 1ZO0A 3H8FA 2NSMA 4R9MA 5EBVA 3TOBA 1Y0YA 1IOIA 4AVCA 4PSXA 4H6UA 4NGQA 4KOSA 4B12A 2Q4YA 1JWQA 2AFMA 4FBEA 4YRHA 1KWMA 1XFOA 3BLNA 2QIRA 4GM5A 4UFVA 5HVGA 1QMUA 4C2YA 4KOVA 4U5YA 1OZPA 1PCAA 2ZPAA 3DGVA 4UCPA 4R8FA 2JDCA 3SJEA 1Z2LA 2QECA 1YLOA 3CPXA 5J8FA 2PJ4A 5HH1A 3S6GA 2B58A 1I21A 2YGWA 2ZW6A 3HUVA 3BI0A 1Y7EA 1M4IA 1QSTA 1R57A 2F8HA 4RS2A 1TKFA 2CNTA 3VWEA 1IICA 1V0CA 2Z3PA 1P4NA 2F5IA 3BXMA 5LRJA 6CPAA 2A4NA 1I1DA 4OKOA 4ZBGA 3DR8A 3PGPA 1LCPA 5LRKA 2VEZA 4ZI6A 4AG7A 4BBHA 2V8VA 4P44A 4PV6A 4A37A 3KGQA 1YK3A 3GB0A 5H86A 3IU2A 4UWIA 1NSLA 1LANA 1TXRA 3GY9A 3B3TA 1PUAA 5KTDA 3TX8A 1KUXA 3FRMA 5K8PA 1Z8LA 2ANPA 2PJ2A 2ZEOA 1BO4A 1Q2YA 2IQ6A 3KQXA 3PZJA 3DSBA 1UFHA 4UCMA 4ZY2A 3N5FA 2REFA 3FECA 4EMEA 1ELMP 4XPDC 4BMHA 4IAVA 5AGEA 2ZENA 5EMIA 1Y0RA 4NGMA 4QB9A 4YU9A 1Z5RA 4QC6A 3WR7A 3D3SA 2B4BA 2PJ1A 3B3VA 3IU1A 4L8AA 3T9YA 4B13A 1TF9A 4AVBA 2RB7A 5JQ4A 4A95A 4XNHC 5JM6A 3RZAA 5J1QA 1H8LA 1PYTB 4Z65A 2PVVA 3LWUA 2OZUA 2H5MA 3D8PA 1J4JA 1RXTA 4NSQA 4KSAA 1IYKA 3B3CA 8CPAA 1B87A 4EFDA 5FVJA 2EVNA 1VHOA 2DPSA 2WPXA 1VKCA 2V8GA 2JDDA 2EUIA 5JPHA 4KOXA 4JXQA 4CAFA 2VL1A 4OC0A 1AYEA 3QNVA 4P45A 3NE8A 3NH4A 1P0HA 1BPNA 3DNSA 4L89A 2BCOA 2PSWA 3GYAA 1CBXA 4YWYA 2ZOGA 3RO0A 1CPXA 1ZG7A 4OMEA 3DDDA 4R3KA 3S6KA 4JZ0A 2EO8A 3H4QA 4HPSA 3PP9A 4MFZA 3FIXA 3FF3A 4KOUA 2C6CA 2G3AA 3IO1A 5D8NA 3K9TA 3L2NA 5F47A 4C7HA 5DWNA 2BOAA 3GKRA 4PXDA 2WZNA 2PJ6A 1VIXA 2FVGA 3K9UA 4C2XA 2Z3LA 2FCKA 3PB7X 1KUYA 3SJGA 2PQ8A 5F46A 5D29A 3R9FA 3FMCA 4KLVA 3TOAA 2CF4A 4KZTA 4C2ZA 2ZW4A 3JVNA 3NH5A 4KLWA 4P4FA 2PCUA 4H6ZA 4JYWA 3FVLA 3P2HA 3RBUA 3G3SA 2NYQA 3D68A 2OH1A 4MY0A 4OP4A 3E0KA 4FD5A 4CYOA 2I00A 2Z0ZA 3ZJ0A 1X10A 2FSRA 2ZEEA 4CYNA 4ZY0A 1NE9A 1ZLIA 3PBBA 4QUSA 2FT0A 3PFEA 4UFWA 4JWPA 1TIQA 2HC9A 4OC5A 1L0CA 1Q2DA 4UCNA 4B14A 1AUGA 3SI0A 2Q51A 1VHEA 4ORFA 2IJZA 4F8ZA 3FJUA 5KTAA 1S3ZA 2X7BA 5LYFA 5F48A 2J8RA 2Z3OA 4R76A 3KQZA 4KOTA 4R3LA 4ZYQA 4A38A 4FD4A 2Z3NA 4LX9A 4RUHA 1XJOA 2OZGA 4UA3A 3KASA 1XE4A 1QQ9A 4Y49C 2HB6A 4P10A 1A2ZA 1ELLP 3SJFA 3NE7A 4B10A 2REEA 3GUXA 1XOVA 5J8CA 3WC5A 1Z4EA 2VBQA 2PIYA 4KS9A 5EC4A 4F9VA 1DTDA 2EK9A 2QYVA 3MRUA 4CGNA 1BAVA 3UY5A 1Z8XA 5ELYA 1M4LA 1TF8A 4I49A 4A94A 1YLEA 4C68A 3D7HA 5CPAA 3V7ZA 4DJLA 1XMTA 4OC2A 4KVXA 4II9A 4WWVA 3TC8A 2AJ6A 2XEFA 3R1KA 2C1CA 4C7IA 2JBJA 3IFEA 3VWDA 1MJ9A 4DUKA 2PE3A 3VARA 3B2YA 4OC3A 4OC4A 5BWAB 5THWA 2J8NA 4IUSA 4BD9A 5AG4A 4MFKA 3B3SA 4MY3A 2YNEA 3CT9A 4MHPA 3NH8A 3R9EA 3RYOA 2GREA 4KOWA 3B3WA 3A9LA 2ZEHA 4QVTA 5CNPA 3PB9X 2PJ5A 4OC1A 1CP7A 2IL4A 2B4DA 4MJ8A 4KOYA 4RI1A 4U9ZA 2Q4VA 5AG5A 5G21A 4H2KA 2WSAA 3KKWA 4NGPA 2Z3MA 5F09A 3LMSA 1CX8A 5GCNA 2ZXVA 4UIAA 4KUBA 4ONWA 3F8KA 3S9NA 4UIBA 3R95A 2CXAA 1ARMA 2FIWA 1YW4A 1Z8TA 3FXTA 2BO9A 2P6GA 4FWUA 1YSJA 4CGLA 3F5BA 4MBUA 4UF4A 5A28A 3EFAA 2OB0A 2ZW7A 5KTCA 1Z4RA 2GLJA 3EXNA 2C27A 5IX3A 2CNSA 3D2PA 3KI9A 5F49A 2OU2A 4OADA 5HVHA 2R98A 2B4DB 2V77A 1QSMA 5G20A 3KR4A 2R7HA 1QSNA 1WWZA 4CRYB 4CGOA 1IU8A 2BUEA 4ZX9A 2JEVA 4UWJA 2WYRA 4PPZA 2ABZA
chains in the Genus database with same CATH topology
3D7GA 1YMEA 4MHNA 4PXEA 1CG2A 2CTCA 1CPSA 3KHXA 3NFZA 2GU2A 2PRQA 1R3NA 1ZG9A 4MCPA 3VH9A 5JGFA 3SJXA 4O23A 5I4MA 2C6PA 1F57A 4ZY1A 1HDQA 4FAIA 2AFXA 1IY7A 2ZEGA 4NFRA 1F2PA 2QVPA 2IMOA 4PXBA 1XMBA 2PVWA 2O53A 3KR5A 2PJ7A 4Q7AA 3FEEA 5HXDA 4IK2A 2JEWA 2AFZA 4EWTA 3H8EA 5LRGA 5LYLA 3IEHA 3IJ3A 3KZWA 2PJ9A 1NSAA 1FT7A 5K8OA 2AFSA 4NGRA 2AFUA 4DYOA 1HEEA 4NGNA 2PJAA 4MRIA 2G9DA 3T8WA 1CP6A 4NGTA 4OIDA 1HDUA 2PJBA 1LAMA 3VATA 5K8NA 3BHXA 4P4EA 4W9YA 2XEIA 3B7IA 3FX6A 3IIBA 5JH9A 3WC7A 3MN8A 3KL9A 2O4HA 3WABA 5HVFA 4UEFA 3SI2A 3K2KA 4X8IA 3SI1A 4P4JA 2F7VA 1TKHA 1FNOA 3IC1A 3KHZA 1VGYA 2ZEDA 1UWYA 1BPMA 4OIWA 3PFOA 2EK8A 1Q7LA 2EWBA 3NA6A 4UEZA 4IHMA 4LQGA 4P4BA 3RAMA 3PBEA 4MCQA 4CPAA 2ZEFA 2AFWA 2PIZA 3PB6X 3JRUA 1RTQA 2GLFA 4FUUA 2QJ8A 2JBKA 2PJCA 4MHYA 2ZOFA 2OR4A 1YW6A 5DS0A 1LFWA 2POKA 3CPAA 4P4IA 4P4DA 1GYTA 1JQGA 3HLPA 5LYIA 2C6GA 2Q43A 2ZELA 2PJ8A 3D4UA 4R7MA 1IGBA 3B35A 3CDXA 3GLJA 2I3CA 3PRTA 4TWEA 4R6TA 4NJRA 4NJQA 1AMPA 1XRYA 4X2TA 3ISXA 3D7DA 3D66A 5K8MA 4MHZA 4P6YA 3DLJA 4MMOA 1BLLE 2ZEMA 3PEIA 4F9UA 3V38A 2Q4ZA 1XBUA 4ZX8A 1F2OA 4KSIA 1DE4C 4TNUA 4K3NA 3ISZA 2V8HA 2ZEPA 7CPAA 2CIJA 4MXUA 4NGSA 4PXCA 1LOKA 3PB8X 2RFHA 4WJBA 1OBRA 2AFOA 5CBMA 2V8DA 3IWWA 1ARLA 5IB9A 2PJ3A 2XEJA 2XEGA 4MCSA 3D67A 3S9LA 1R43A 4X3RA 5LYDA 2DEAA 3FEDA 3FH4A 4B6ZA 1EE3P 4PQAA 2PJ0A 3S9MA 1TKJA 3PB4X 1ZLHA 4UEEA 2J9AA 3WC6A 2CTBA 4MCRA 3I1UA 4G1PA 1ZG8A 3WT4A 3BI1A 3H8GA 4AXVA 4A39A 3D7FA 2OOTA 1LAPA 3H8FA 2NSMA 1Y0YA 4NGQA 4FBEA 2AFMA 1KWMA 1XFOA 4GM5A 5HVGA 1QMUA 1PCAA 3DGVA 4R8FA 3SJEA 1Z2LA 1YLOA 3CPXA 2PJ4A 3HUVA 3BI0A 1Y7EA 2F8HA 4A37A 1TKFA 3BXMA 5LRJA 6CPAA 4OKOA 1LCPA 5LRKA 4ZI6A 2V8VA 4P44A 3KGQA 3GB0A 1LANA 1TXRA 3B3TA 3TX8A 5K8PA 1Z8LA 2ANPA 2PJ2A 2ZEOA 2IQ6A 3KQXA 4ZY2A 3N5FA 3FECA 4EMEA 1ELMP 4IAVA 2ZENA 1Y0RA 4NGMA 4YU9A 1Z5RA 2PJ1A 3B3VA 1TF9A 2RB7A 5JM6A 3RZAA 5J1QA 1H8LA 1PYTB 4Z65A 2PVVA 3LWUA 3B3CA 8CPAA 4EFDA 1VHOA 2V8GA 2VL1A 4OC0A 1AYEA 3QNVA 4P45A 3NH4A 1BPNA 2BCOA 4YWYA 1CBXA 2ZOGA 1CPXA 1ZG7A 4OMEA 4JZ0A 3FF3A 2C6CA 3IO1A 5D8NA 3K9TA 3L2NA 2BOAA 4PXDA 2WZNA 2PJ6A 1VIXA 2FVGA 3SJGA 3PB7X 5D29A 3FMCA 2CF4A 3NH5A 4P4FA 2PCUA 4JYWA 3FVLA 3RBUA 2NYQA 3D68A 4OP4A 4ZY0A 2ZEEA 1ZLIA 3PBBA 3PFEA 2HC9A 4OC5A 3SI0A 2Q51A 1VHEA 2IJZA 4F8ZA 3FJUA 5LYFA 4R76A 3KQZA 4ZYQA 4A38A 4RUHA 1XJOA 3KASA 1QQ9A 2HB6A 4P10A 1ELLP 3SJFA 3GUXA 3WC5A 2PIYA 4F9VA 1DTDA 2EK9A 2QYVA 3MRUA 1BAVA 5ELYA 1M4LA 1TF8A 4A94A 3D7HA 5CPAA 3V7ZA 4DJLA 4OC2A 4WWVA 3TC8A 2XEFA 2C1CA 2JBJA 3IFEA 4DUKA 2PE3A 3VARA 3B2YA 4OC3A 4OC4A 5THWA 4BD9A 3B3SA 3CT9A 4MHPA 3NH8A 2GREA 3B3WA 2ZEHA 3PB9X 2PJ5A 4OC1A 1CP7A 4H2KA 4NGPA 5F09A 3LMSA 1CX8A 4UIAA 4ONWA 3S9NA 4UIBA 1ARMA 1YW4A 4FWUA 2BO9A 1YSJA 4UF4A 2GLJA 3KI9A 5HVHA 2V77A 3KR4A 4ZX9A 2WYRA 4PPZA 2ABZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D7G A;  1YME A;  4MHN A;  4PXE A;  1CG2 A;  2CTC A;  1CPS A;  3KHX A;  3NFZ A;  2GU2 A;  2PRQ A;  1R3N A;  1ZG9 A;  4MCP A;  3VH9 A;  5JGF A;  3SJX A;  4O23 A;  5I4M A;  2C6P A;  1F57 A;  4ZY1 A;  1HDQ A;  4FAI A;  2AFX A;  1IY7 A;  2ZEG A;  4NFR A;  1F2P A;  2QVP A;  2IMO A;  4PXB A;  1XMB A;  2PVW A;  2O53 A;  3KR5 A;  2PJ7 A;  4Q7A A;  3FEE A;  5HXD A;  4IK2 A;  2JEW A;  2AFZ A;  4EWT A;  3H8E A;  5LRG A;  5LYL A;  3IEH A;  3IJ3 A;  3KZW A;  2PJ9 A;  1NSA A;  1FT7 A;  5K8O A;  2AFS A;  4NGR A;  2AFU A;  4DYO A;  1HEE A;  4NGN A;  2PJA A;  4MRI A;  2G9D A;  3T8W A;  1CP6 A;  4NGT A;  4OID A;  1HDU A;  2PJB A;  1LAM A;  3VAT A;  5K8N A;  3BHX A;  4P4E A;  4W9Y A;  2XEI A;  3B7I A;  3FX6 A;  3IIB A;  5JH9 A;  3WC7 A;  3MN8 A;  3KL9 A;  2O4H A;  3WAB A;  5HVF A;  4UEF A;  3SI2 A;  3K2K A;  4X8I A;  3SI1 A;  4P4J A;  2F7V A;  1TKH A;  1FNO A;  3IC1 A;  3KHZ A;  1VGY A;  2ZED A;  1UWY A;  1BPM A;  4OIW A;  3PFO A;  2EK8 A;  1Q7L A;  2EWB A;  3NA6 A;  4UEZ A;  4IHM A;  4LQG A;  4P4B A;  3RAM A;  3PBE A;  4MCQ A;  4CPA A;  2ZEF A;  2AFW A;  2PIZ A;  3PB6 X;  3JRU A;  1RTQ A;  2GLF A;  4FUU A;  2QJ8 A;  2JBK A;  2PJC A;  4MHY A;  2ZOF A;  2OR4 A;  1YW6 A;  5DS0 A;  1LFW A;  2POK A;  3CPA A;  4P4I A;  4P4D A;  1GYT A;  1JQG A;  3HLP A;  5LYI A;  2C6G A;  2Q43 A;  2ZEL A;  2PJ8 A;  3D4U A;  4R7M A;  1IGB A;  3B35 A;  3CDX A;  3GLJ A;  2I3C A;  3PRT A;  4TWE A;  4R6T A;  4NJR A;  4NJQ A;  1AMP A;  1XRY A;  4X2T A;  3ISX A;  3D7D A;  3D66 A;  5K8M A;  4MHZ A;  4P6Y A;  3DLJ A;  4MMO A;  1BLL E;  2ZEM A;  3PEI A;  4F9U A;  3V38 A;  2Q4Z A;  1XBU A;  4ZX8 A;  1F2O A;  4KSI A;  1DE4 C;  4TNU A;  4K3N A;  3ISZ A;  2V8H A;  2ZEP A;  7CPA A;  2CIJ A;  4MXU A;  4NGS A;  4PXC A;  1LOK A;  3PB8 X;  2RFH A;  4WJB A;  1OBR A;  2AFO A;  5CBM A;  2V8D A;  3IWW A;  1ARL A;  5IB9 A;  2PJ3 A;  2XEJ A;  2XEG A;  4MCS A;  3D67 A;  3S9L A;  1R43 A;  4X3R A;  5LYD A;  2DEA A;  3FED A;  3FH4 A;  4B6Z A;  1EE3 P;  4PQA A;  2PJ0 A;  3S9M A;  1TKJ A;  3PB4 X;  1ZLH A;  4UEE A;  2J9A A;  3WC6 A;  2CTB A;  4MCR A;  3I1U A;  4G1P A;  1ZG8 A;  3WT4 A;  3BI1 A;  3H8G A;  4AXV A;  4A39 A;  3D7F A;  2OOT A;  1LAP A;  3H8F A;  2NSM A;  1Y0Y A;  4NGQ A;  4FBE A;  2AFM A;  1KWM A;  1XFO A;  4GM5 A;  5HVG A;  1QMU A;  1PCA A;  3DGV A;  4R8F A;  3SJE A;  1Z2L A;  1YLO A;  3CPX A;  2PJ4 A;  3HUV A;  3BI0 A;  1Y7E A;  2F8H A;  4A37 A;  1TKF A;  3BXM A;  5LRJ A;  6CPA A;  4OKO A;  1LCP A;  5LRK A;  4ZI6 A;  2V8V A;  4P44 A;  3KGQ A;  3GB0 A;  1LAN A;  1TXR A;  3B3T A;  3TX8 A;  5K8P A;  1Z8L A;  2ANP A;  2PJ2 A;  2ZEO A;  2IQ6 A;  3KQX A;  4ZY2 A;  3N5F A;  3FEC A;  4EME A;  1ELM P;  4IAV A;  2ZEN A;  1Y0R A;  4NGM A;  4YU9 A;  1Z5R A;  2PJ1 A;  3B3V A;  1TF9 A;  2RB7 A;  5JM6 A;  3RZA A;  5J1Q A;  1H8L A;  1PYT B;  4Z65 A;  2PVV A;  3LWU A;  3B3C A;  8CPA A;  4EFD A;  1VHO A;  2V8G A;  2VL1 A;  4OC0 A;  1AYE A;  3QNV A;  4P45 A;  3NH4 A;  1BPN A;  2BCO A;  4YWY A;  1CBX A;  2ZOG A;  1CPX A;  1ZG7 A;  4OME A;  4JZ0 A;  3FF3 A;  2C6C A;  3IO1 A;  5D8N A;  3K9T A;  3L2N A;  2BOA A;  4PXD A;  2WZN A;  2PJ6 A;  1VIX A;  2FVG A;  3SJG A;  3PB7 X;  5D29 A;  3FMC A;  2CF4 A;  3NH5 A;  4P4F A;  2PCU A;  4JYW A;  3FVL A;  3RBU A;  2NYQ A;  3D68 A;  4OP4 A;  4ZY0 A;  2ZEE A;  1ZLI A;  3PBB A;  3PFE A;  2HC9 A;  4OC5 A;  3SI0 A;  2Q51 A;  1VHE A;  2IJZ A;  4F8Z A;  3FJU A;  5LYF A;  4R76 A;  3KQZ A;  4ZYQ A;  4A38 A;  4RUH A;  1XJO A;  3KAS A;  1QQ9 A;  2HB6 A;  4P10 A;  1ELL P;  3SJF A;  3GUX A;  3WC5 A;  2PIY A;  4F9V A;  1DTD A;  2EK9 A;  2QYV A;  3MRU A;  1BAV A;  5ELY A;  1M4L A;  1TF8 A;  4A94 A;  3D7H A;  5CPA A;  3V7Z A;  4DJL A;  4OC2 A;  4WWV A;  3TC8 A;  2XEF A;  2C1C A;  2JBJ A;  3IFE A;  4DUK A;  2PE3 A;  3VAR A;  3B2Y A;  4OC3 A;  4OC4 A;  5THW A;  4BD9 A;  3B3S A;  3CT9 A;  4MHP A;  3NH8 A;  2GRE A;  3B3W A;  2ZEH A;  3PB9 X;  2PJ5 A;  4OC1 A;  1CP7 A;  4H2K A;  4NGP A;  5F09 A;  3LMS A;  1CX8 A;  4UIA A;  4ONW A;  3S9N A;  4UIB A;  1ARM A;  1YW4 A;  4FWU A;  2BO9 A;  1YSJ A;  4UF4 A;  2GLJ A;  3KI9 A;  5HVH A;  2V77 A;  3KR4 A;  4ZX9 A;  2WYR A;  4PPZ A;  2ABZ A; 
#chains in the Genus database with same CATH topology
 4XPD B;  2PDO A;  3D7G A;  2PC1 A;  2FXF A;  1YME A;  4CAW A;  4MHN A;  1Y9W A;  3TFY A;  4ONU A;  4U9Y A;  4PXE A;  1CG2 A;  5AG6 A;  2CTC A;  1CPS A;  4XNH B;  3KHX A;  3H5Z A;  3FNC A;  1XIX A;  3NFZ A;  4CYQ A;  1X12 A;  2GU2 A;  2PRQ A;  1R3N A;  4GS4 A;  4OAE A;  1ZG9 A;  4MCP A;  3VH9 A;  5JGF A;  3SJX A;  4O23 A;  5I4M A;  2FL4 A;  2C6P A;  1F57 A;  4Q38 A;  4ZY1 A;  3CXQ A;  5G1Z A;  1HDQ A;  2Q04 A;  4A33 A;  3DR6 A;  4FAI A;  2AFX A;  1IY7 A;  2BL1 A;  2ZEG A;  1GHE A;  4NFR A;  1F2P A;  2QVP A;  2IMO A;  2VZZ A;  4PXB A;  1YRE A;  1XMB A;  2PVW A;  4F0Y A;  2O53 A;  3KR5 A;  2PJ7 A;  3CXS A;  3OWC A;  1CM0 A;  3S6F A;  4Q7A A;  4AB7 A;  3R9G A;  1YVO A;  2P6E A;  3FEE A;  5HXD A;  4IK2 A;  4KOR A;  2RC4 A;  2JEW A;  5H84 A;  1YVK A;  2AFZ A;  2YNC C;  4M85 A;  4MI4 A;  4UFX A;  1SQH A;  4EWT A;  4JD6 A;  3H8E A;  4RN7 A;  4LUA A;  1CJW A;  1M4G A;  5LRG A;  2ZW5 A;  5LYL A;  2Q7B A;  3IEH A;  4XPL A;  3BJ7 A;  3IJ3 A;  2Z11 A;  1S7L A;  3KZW A;  5IV0 A;  1N71 A;  2PJ9 A;  3W6X A;  1NSA A;  2FE7 A;  1FT7 A;  5K8O A;  2AFS A;  4NGR A;  1KZF A;  4YFJ A;  2HUZ A;  2AFU A;  2WPW A;  4DYO A;  1HEE A;  2BSW A;  2GIV A;  2PJA A;  4HNY B;  4NGN A;  4JLY A;  4LQ6 A;  4A2Z A;  4MFP A;  2PR1 A;  4GXH A;  4E8O A;  4MRI A;  2G9D A;  2D4O A;  4E2A A;  4M6H A;  4QBJ A;  4MFQ A;  4ZGY B;  2DF5 A;  3TO7 A;  3T8W A;  1XEB A;  2B5G A;  1CP6 A;  4NGT A;  4OID A;  1QSO A;  1Z9U A;  1HDU A;  3I3G A;  2P0W A;  5C82 A;  2PJB A;  1LAM A;  2BEI A;  2D4P A;  4OLL A;  4R57 A;  3SXO A;  3D2M A;  3TT2 A;  2VXK A;  4J3G A;  3VAT A;  5K8N A;  4A31 A;  3BHX A;  2WUU A;  4P4E A;  4HNX B;  4W9Y A;  2XEI A;  4F0X A;  3B7I A;  3QAH A;  4PSW A;  3FX6 A;  2KCW A;  3IIB A;  4CGP A;  3WC7 A;  5JH9 A;  3MN8 A;  2B5G B;  1K4J A;  3KL9 A;  2O4H A;  4MFL A;  3WAB A;  3TCV A;  5HVF A;  2EBJ A;  2VQY A;  3BJ8 A;  4UEF A;  3SI2 A;  1RO5 A;  2YND A;  3K2K A;  4B11 A;  2R8V A;  2AE6 A;  2CNM A;  4X8I A;  3SI1 A;  1S5K A;  4P4J A;  1M44 A;  2F7V A;  1LRZ A;  2Q44 A;  1TKH A;  3LOD A;  4CYP A;  5IB0 A;  1FNO A;  3IC1 A;  3KHZ A;  1VGY A;  2ZED A;  4PK2 A;  1NMT A;  1UWY A;  1BPM A;  1YGH A;  2Q7S A;  4OIW A;  3FBU A;  2K5T A;  3PFO A;  4KVO E;  3G8W A;  2Q0Y A;  4X5K A;  2EK8 A;  3W6S A;  5HMN A;  2CY2 A;  1Q7L A;  2EWB A;  5AG7 A;  3NA6 A;  4UEZ A;  3JTK A;  4IHM A;  4LQG A;  2GE3 A;  4CAE A;  1MJB A;  4P4B A;  3RAM A;  3PBE A;  4MCQ A;  4A30 A;  2ODF A;  1I12 A;  4CPA A;  2ZEF A;  4B5P A;  2B3V A;  2AFW A;  2PIZ A;  4AVA A;  5E96 A;  3IWG A;  3MGD A;  3PB6 X;  3ZZI A;  1BOB A;  4DNC A;  3JRU A;  1RTQ A;  2GLF A;  4FUU A;  3IGR A;  3LAC A;  2Y0M A;  2QJ8 A;  2O28 A;  2JBK A;  2PJC A;  3JUW A;  4M6I A;  3R96 A;  4MHY A;  4PK3 A;  2ZOF A;  4E0A A;  1MK4 A;  2OR4 A;  3TO9 A;  2JLM A;  1YW6 A;  5DS0 A;  1LFW A;  2POK A;  2HV2 A;  3CPA A;  4P4I A;  4P4D A;  1IYL A;  1GYT A;  5G22 A;  1JQG A;  1YX0 A;  3HLP A;  5LYI A;  2C6G A;  4NEX A;  2Q43 A;  2ZEL A;  2PJ8 A;  4NCZ A;  2NMT A;  1QSR A;  3D4U A;  4R7M A;  4B5P B;  3TTH A;  1IB1 E;  1IGB A;  4CAV A;  3B35 A;  4NF1 A;  3F0A A;  3QB8 A;  3TE4 A;  4UBR A;  4NXY A;  3CDX A;  1MJA A;  3EO4 A;  1XF8 A;  4CAX A;  2OZH A;  3GLJ A;  4KSF A;  3V8I A;  2I3C A;  3PRT A;  4FD6 A;  4TWE A;  4R6T A;  5A27 A;  4NJR A;  3N7Z A;  4KUA A;  3TO6 A;  1M1D A;  4NJQ A;  4CGM A;  1AMP A;  4F6A A;  3EY5 A;  1Z8W A;  4M6G A;  1XRY A;  2DXQ A;  4X2T A;  4YGO A;  3CZX A;  3ISX A;  4HKF A;  3D7D A;  3D66 A;  1YR0 A;  2GAN A;  3GIU A;  5K8M A;  4MHZ A;  1ON0 A;  4P6Y A;  3T90 A;  4JXR A;  2DPT A;  4Q36 A;  3QAY A;  4EVY A;  1PU9 A;  3DLJ A;  4MMO A;  1BLL E;  2Z10 A;  2ZEM A;  3PEI A;  5C88 A;  3CXP A;  3V38 A;  2Q4Z A;  1XBU A;  4ZX8 A;  4F9U A;  4JJX A;  1U6M A;  1F2O A;  1VHS A;  1DE4 C;  1Y9K A;  2FIA A;  4KSI A;  3IWE A;  4TNU A;  2J8M A;  4K3N A;  3ISZ A;  2R1I A;  2YNC A;  2V8H A;  2ZEP A;  7CPA A;  5ISV A;  2CIJ A;  1Q2C A;  2FS5 A;  3B8G A;  4MXU A;  4NGS A;  1S7K A;  4PXC A;  1LOK A;  3PB8 X;  2RFH A;  4WJB A;  3EC4 A;  1OBR A;  2AFO A;  1WK4 A;  2GFQ A;  5CBM A;  2V8D A;  3IWW A;  1ARL A;  4CS0 B;  5IB9 A;  2PJ3 A;  2XEJ A;  1KUV A;  2XEG A;  2Z3K A;  1S7F A;  4MCS A;  3D67 A;  3LD2 A;  4R87 A;  2P6F A;  2G0B A;  3W91 A;  3S9L A;  1R43 A;  4X3R A;  5LYD A;  3P2F A;  2DEA A;  2PRB A;  2QML A;  4MHD A;  3FED A;  3FH4 A;  2VI7 A;  4K30 A;  4B6Z A;  1EE3 P;  4PQA A;  1Y7R A;  2PJ0 A;  4M3S A;  4AG9 A;  2ARH A;  3SHP A;  3S9M A;  2B3U A;  3SXN A;  1S7N A;  1TKJ A;  5DWM A;  4XPK A;  1M4D A;  3I9S A;  4MFJ A;  3PB4 X;  1ZLH A;  1YQE A;  4UEE A;  2J9A A;  3WC6 A;  4B5O A;  2CTB A;  4IF5 A;  4MCR A;  2ATR A;  3C26 A;  2PR8 A;  4A32 A;  5I0C A;  3I1U A;  2I79 A;  2HQY A;  3FYN A;  1ZG8 A;  4FD7 A;  4G1P A;  3BI1 A;  3WT4 A;  4CRZ B;  4HNW B;  4BIN A;  2VZY A;  3FB3 A;  3H8G A;  4AXV A;  1FY7 A;  4H89 A;  2G3T A;  3RNZ A;  1S60 A;  3D7F A;  4A39 A;  1IOF A;  4KVM E;  2OOT A;  4Y49 B;  3S6H A;  1IID A;  1B6B A;  1LAP A;  1ZO0 A;  3H8F A;  2NSM A;  4R9M A;  5EBV A;  3TOB A;  1Y0Y A;  1IOI A;  4AVC A;  4PSX A;  4H6U A;  4NGQ A;  4KOS A;  4B12 A;  2Q4Y A;  1JWQ A;  2AFM A;  4FBE A;  4YRH A;  1KWM A;  1XFO A;  3BLN A;  2QIR A;  4GM5 A;  4UFV A;  5HVG A;  1QMU A;  4C2Y A;  4KOV A;  4U5Y A;  1OZP A;  1PCA A;  2ZPA A;  3DGV A;  4UCP A;  4R8F A;  2JDC A;  3SJE A;  1Z2L A;  2QEC A;  1YLO A;  3CPX A;  5J8F A;  2PJ4 A;  5HH1 A;  3S6G A;  2B58 A;  1I21 A;  2YGW A;  2ZW6 A;  3HUV A;  3BI0 A;  1Y7E A;  1M4I A;  1QST A;  1R57 A;  2F8H A;  4RS2 A;  1TKF A;  2CNT A;  3VWE A;  1IIC A;  1V0C A;  2Z3P A;  1P4N A;  2F5I A;  3BXM A;  5LRJ A;  6CPA A;  2A4N A;  1I1D A;  4OKO A;  4ZBG A;  3DR8 A;  3PGP A;  1LCP A;  5LRK A;  2VEZ A;  4ZI6 A;  4AG7 A;  4BBH A;  2V8V A;  4P44 A;  4PV6 A;  4A37 A;  3KGQ A;  1YK3 A;  3GB0 A;  5H86 A;  3IU2 A;  4UWI A;  1NSL A;  1LAN A;  1TXR A;  3GY9 A;  3B3T A;  1PUA A;  5KTD A;  3TX8 A;  1KUX A;  3FRM A;  5K8P A;  1Z8L A;  2ANP A;  2PJ2 A;  2ZEO A;  1BO4 A;  1Q2Y A;  2IQ6 A;  3KQX A;  3PZJ A;  3DSB A;  1UFH A;  4UCM A;  4ZY2 A;  3N5F A;  2REF A;  3FEC A;  4EME A;  1ELM P;  4XPD C;  4BMH A;  4IAV A;  5AGE A;  2ZEN A;  5EMI A;  1Y0R A;  4NGM A;  4QB9 A;  4YU9 A;  1Z5R A;  4QC6 A;  3WR7 A;  3D3S A;  2B4B A;  2PJ1 A;  3B3V A;  3IU1 A;  4L8A A;  3T9Y A;  4B13 A;  1TF9 A;  4AVB A;  2RB7 A;  5JQ4 A;  4A95 A;  4XNH C;  5JM6 A;  3RZA A;  5J1Q A;  1H8L A;  1PYT B;  4Z65 A;  2PVV A;  3LWU A;  2OZU A;  2H5M A;  3D8P A;  1J4J A;  1RXT A;  4NSQ A;  4KSA A;  1IYK A;  3B3C A;  8CPA A;  1B87 A;  4EFD A;  5FVJ A;  2EVN A;  1VHO A;  2DPS A;  2WPX A;  1VKC A;  2V8G A;  2JDD A;  2EUI A;  5JPH A;  4KOX A;  4JXQ A;  4CAF A;  2VL1 A;  4OC0 A;  1AYE A;  3QNV A;  4P45 A;  3NE8 A;  3NH4 A;  1P0H A;  1BPN A;  3DNS A;  4L89 A;  2BCO A;  2PSW A;  3GYA A;  1CBX A;  4YWY A;  2ZOG A;  3RO0 A;  1CPX A;  1ZG7 A;  4OME A;  3DDD A;  4R3K A;  3S6K A;  4JZ0 A;  2EO8 A;  3H4Q A;  4HPS A;  3PP9 A;  4MFZ A;  3FIX A;  3FF3 A;  4KOU A;  2C6C A;  2G3A A;  3IO1 A;  5D8N A;  3K9T A;  3L2N A;  5F47 A;  4C7H A;  5DWN A;  2BOA A;  3GKR A;  4PXD A;  2WZN A;  2PJ6 A;  1VIX A;  2FVG A;  3K9U A;  4C2X A;  2Z3L A;  2FCK A;  3PB7 X;  1KUY A;  3SJG A;  2PQ8 A;  5F46 A;  5D29 A;  3R9F A;  3FMC A;  4KLV A;  3TOA A;  2CF4 A;  4KZT A;  4C2Z A;  2ZW4 A;  3JVN A;  3NH5 A;  4KLW A;  4P4F A;  2PCU A;  4H6Z A;  4JYW A;  3FVL A;  3P2H A;  3RBU A;  3G3S A;  2NYQ A;  3D68 A;  2OH1 A;  4MY0 A;  4OP4 A;  3E0K A;  4FD5 A;  4CYO A;  2I00 A;  2Z0Z A;  3ZJ0 A;  1X10 A;  2FSR A;  2ZEE A;  4CYN A;  4ZY0 A;  1NE9 A;  1ZLI A;  3PBB A;  4QUS A;  2FT0 A;  3PFE A;  4UFW A;  4JWP A;  1TIQ A;  2HC9 A;  4OC5 A;  1L0C A;  1Q2D A;  4UCN A;  4B14 A;  1AUG A;  3SI0 A;  2Q51 A;  1VHE A;  4ORF A;  2IJZ A;  4F8Z A;  3FJU A;  5KTA A;  1S3Z A;  2X7B A;  5LYF A;  5F48 A;  2J8R A;  2Z3O A;  4R76 A;  3KQZ A;  4KOT A;  4R3L A;  4ZYQ A;  4A38 A;  4FD4 A;  2Z3N A;  4LX9 A;  4RUH A;  1XJO A;  2OZG A;  4UA3 A;  3KAS A;  1XE4 A;  1QQ9 A;  4Y49 C;  2HB6 A;  4P10 A;  1A2Z A;  1ELL P;  3SJF A;  3NE7 A;  4B10 A;  2REE A;  3GUX A;  1XOV A;  5J8C A;  3WC5 A;  1Z4E A;  2VBQ A;  2PIY A;  4KS9 A;  5EC4 A;  4F9V A;  1DTD A;  2EK9 A;  2QYV A;  3MRU A;  4CGN A;  1BAV A;  3UY5 A;  1Z8X A;  5ELY A;  1M4L A;  1TF8 A;  4I49 A;  4A94 A;  1YLE A;  4C68 A;  3D7H A;  5CPA A;  3V7Z A;  4DJL A;  1XMT A;  4OC2 A;  4KVX A;  4II9 A;  4WWV A;  3TC8 A;  2AJ6 A;  2XEF A;  3R1K A;  2C1C A;  4C7I A;  2JBJ A;  3IFE A;  3VWD A;  1MJ9 A;  4DUK A;  2PE3 A;  3VAR A;  3B2Y A;  4OC3 A;  4OC4 A;  5BWA B;  5THW A;  2J8N A;  4IUS A;  4BD9 A;  5AG4 A;  4MFK A;  3B3S A;  4MY3 A;  2YNE A;  3CT9 A;  4MHP A;  3NH8 A;  3R9E A;  3RYO A;  2GRE A;  4KOW A;  3B3W A;  3A9L A;  2ZEH A;  4QVT A;  5CNP A;  3PB9 X;  2PJ5 A;  4OC1 A;  1CP7 A;  2IL4 A;  2B4D A;  4MJ8 A;  4KOY A;  4RI1 A;  4U9Z A;  2Q4V A;  5AG5 A;  5G21 A;  4H2K A;  2WSA A;  3KKW A;  4NGP A;  2Z3M A;  5F09 A;  3LMS A;  1CX8 A;  5GCN A;  2ZXV A;  4UIA A;  4KUB A;  4ONW A;  3F8K A;  3S9N A;  4UIB A;  3R95 A;  2CXA A;  1ARM A;  2FIW A;  1YW4 A;  1Z8T A;  3FXT A;  2BO9 A;  2P6G A;  4FWU A;  1YSJ A;  4CGL A;  3F5B A;  4MBU A;  4UF4 A;  5A28 A;  3EFA A;  2OB0 A;  2ZW7 A;  5KTC A;  1Z4R A;  2GLJ A;  3EXN A;  2C27 A;  5IX3 A;  2CNS A;  3D2P A;  3KI9 A;  5F49 A;  2OU2 A;  4OAD A;  5HVH A;  2R98 A;  2B4D B;  2V77 A;  1QSM A;  5G20 A;  3KR4 A;  2R7H A;  1QSN A;  1WWZ A;  4CRY B;  4CGO A;  1IU8 A;  2BUE A;  4ZX9 A;  2JEV A;  4UWJ A;  2WYR A;  4PPZ A;  2ABZ A; 
#chains in the Genus database with same CATH homology
 3D7G A;  1YME A;  4MHN A;  4PXE A;  1CG2 A;  2CTC A;  1CPS A;  3KHX A;  3NFZ A;  2GU2 A;  2PRQ A;  1R3N A;  1ZG9 A;  4MCP A;  3VH9 A;  5JGF A;  3SJX A;  4O23 A;  5I4M A;  2C6P A;  1F57 A;  4ZY1 A;  1HDQ A;  4FAI A;  2AFX A;  1IY7 A;  2ZEG A;  4NFR A;  1F2P A;  2QVP A;  2IMO A;  4PXB A;  1XMB A;  2PVW A;  2O53 A;  3KR5 A;  2PJ7 A;  4Q7A A;  3FEE A;  5HXD A;  4IK2 A;  2JEW A;  2AFZ A;  4EWT A;  3H8E A;  5LRG A;  5LYL A;  3IEH A;  3IJ3 A;  3KZW A;  2PJ9 A;  1NSA A;  1FT7 A;  5K8O A;  2AFS A;  4NGR A;  2AFU A;  4DYO A;  1HEE A;  4NGN A;  2PJA A;  4MRI A;  2G9D A;  3T8W A;  1CP6 A;  4NGT A;  4OID A;  1HDU A;  2PJB A;  1LAM A;  3VAT A;  5K8N A;  3BHX A;  4P4E A;  4W9Y A;  2XEI A;  3B7I A;  3FX6 A;  3IIB A;  5JH9 A;  3WC7 A;  3MN8 A;  3KL9 A;  2O4H A;  3WAB A;  5HVF A;  4UEF A;  3SI2 A;  3K2K A;  4X8I A;  3SI1 A;  4P4J A;  2F7V A;  1TKH A;  1FNO A;  3IC1 A;  3KHZ A;  1VGY A;  2ZED A;  1UWY A;  1BPM A;  4OIW A;  3PFO A;  2EK8 A;  1Q7L A;  2EWB A;  3NA6 A;  4UEZ A;  4IHM A;  4LQG A;  4P4B A;  3RAM A;  3PBE A;  4MCQ A;  4CPA A;  2ZEF A;  2AFW A;  2PIZ A;  3PB6 X;  3JRU A;  1RTQ A;  2GLF A;  4FUU A;  2QJ8 A;  2JBK A;  2PJC A;  4MHY A;  2ZOF A;  2OR4 A;  1YW6 A;  5DS0 A;  1LFW A;  2POK A;  3CPA A;  4P4I A;  4P4D A;  1GYT A;  1JQG A;  3HLP A;  5LYI A;  2C6G A;  2Q43 A;  2ZEL A;  2PJ8 A;  3D4U A;  4R7M A;  1IGB A;  3B35 A;  3CDX A;  3GLJ A;  2I3C A;  3PRT A;  4TWE A;  4R6T A;  4NJR A;  4NJQ A;  1AMP A;  1XRY A;  4X2T A;  3ISX A;  3D7D A;  3D66 A;  5K8M A;  4MHZ A;  4P6Y A;  3DLJ A;  4MMO A;  1BLL E;  2ZEM A;  3PEI A;  4F9U A;  3V38 A;  2Q4Z A;  1XBU A;  4ZX8 A;  1F2O A;  4KSI A;  1DE4 C;  4TNU A;  4K3N A;  3ISZ A;  2V8H A;  2ZEP A;  7CPA A;  2CIJ A;  4MXU A;  4NGS A;  4PXC A;  1LOK A;  3PB8 X;  2RFH A;  4WJB A;  1OBR A;  2AFO A;  5CBM A;  2V8D A;  3IWW A;  1ARL A;  5IB9 A;  2PJ3 A;  2XEJ A;  2XEG A;  4MCS A;  3D67 A;  3S9L A;  1R43 A;  4X3R A;  5LYD A;  2DEA A;  3FED A;  3FH4 A;  4B6Z A;  1EE3 P;  4PQA A;  2PJ0 A;  3S9M A;  1TKJ A;  3PB4 X;  1ZLH A;  4UEE A;  2J9A A;  3WC6 A;  2CTB A;  4MCR A;  3I1U A;  4G1P A;  1ZG8 A;  3WT4 A;  3BI1 A;  3H8G A;  4AXV A;  4A39 A;  3D7F A;  2OOT A;  1LAP A;  3H8F A;  2NSM A;  1Y0Y A;  4NGQ A;  4FBE A;  2AFM A;  1KWM A;  1XFO A;  4GM5 A;  5HVG A;  1QMU A;  1PCA A;  3DGV A;  4R8F A;  3SJE A;  1Z2L A;  1YLO A;  3CPX A;  2PJ4 A;  3HUV A;  3BI0 A;  1Y7E A;  2F8H A;  4A37 A;  1TKF A;  3BXM A;  5LRJ A;  6CPA A;  4OKO A;  1LCP A;  5LRK A;  4ZI6 A;  2V8V A;  4P44 A;  3KGQ A;  3GB0 A;  1LAN A;  1TXR A;  3B3T A;  3TX8 A;  5K8P A;  1Z8L A;  2ANP A;  2PJ2 A;  2ZEO A;  2IQ6 A;  3KQX A;  4ZY2 A;  3N5F A;  3FEC A;  4EME A;  1ELM P;  4IAV A;  2ZEN A;  1Y0R A;  4NGM A;  4YU9 A;  1Z5R A;  2PJ1 A;  3B3V A;  1TF9 A;  2RB7 A;  5JM6 A;  3RZA A;  5J1Q A;  1H8L A;  1PYT B;  4Z65 A;  2PVV A;  3LWU A;  3B3C A;  8CPA A;  4EFD A;  1VHO A;  2V8G A;  2VL1 A;  4OC0 A;  1AYE A;  3QNV A;  4P45 A;  3NH4 A;  1BPN A;  2BCO A;  4YWY A;  1CBX A;  2ZOG A;  1CPX A;  1ZG7 A;  4OME A;  4JZ0 A;  3FF3 A;  2C6C A;  3IO1 A;  5D8N A;  3K9T A;  3L2N A;  2BOA A;  4PXD A;  2WZN A;  2PJ6 A;  1VIX A;  2FVG A;  3SJG A;  3PB7 X;  5D29 A;  3FMC A;  2CF4 A;  3NH5 A;  4P4F A;  2PCU A;  4JYW A;  3FVL A;  3RBU A;  2NYQ A;  3D68 A;  4OP4 A;  4ZY0 A;  2ZEE A;  1ZLI A;  3PBB A;  3PFE A;  2HC9 A;  4OC5 A;  3SI0 A;  2Q51 A;  1VHE A;  2IJZ A;  4F8Z A;  3FJU A;  5LYF A;  4R76 A;  3KQZ A;  4ZYQ A;  4A38 A;  4RUH A;  1XJO A;  3KAS A;  1QQ9 A;  2HB6 A;  4P10 A;  1ELL P;  3SJF A;  3GUX A;  3WC5 A;  2PIY A;  4F9V A;  1DTD A;  2EK9 A;  2QYV A;  3MRU A;  1BAV A;  5ELY A;  1M4L A;  1TF8 A;  4A94 A;  3D7H A;  5CPA A;  3V7Z A;  4DJL A;  4OC2 A;  4WWV A;  3TC8 A;  2XEF A;  2C1C A;  2JBJ A;  3IFE A;  4DUK A;  2PE3 A;  3VAR A;  3B2Y A;  4OC3 A;  4OC4 A;  5THW A;  4BD9 A;  3B3S A;  3CT9 A;  4MHP A;  3NH8 A;  2GRE A;  3B3W A;  2ZEH A;  3PB9 X;  2PJ5 A;  4OC1 A;  1CP7 A;  4H2K A;  4NGP A;  5F09 A;  3LMS A;  1CX8 A;  4UIA A;  4ONW A;  3S9N A;  4UIB A;  1ARM A;  1YW4 A;  4FWU A;  2BO9 A;  1YSJ A;  4UF4 A;  2GLJ A;  3KI9 A;  5HVH A;  2V77 A;  3KR4 A;  4ZX9 A;  2WYR A;  4PPZ A;  2ABZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...