3QAYA

Catalytic domain of cd27l endolysin targeting clostridia difficile
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
180
structure length
180
Chain Sequence
HMKICITVGHSILKSGACTSADGVVNEYQYNKSLAPVLADTFRKEGHKVDVIICPEKQFKTKNEEKSYKIPRVNSGGYDLLIELHLNASNGQGKGSEVLYYSNKGLEYATRICDKLGTVFKNRGAKLDKRLYILNSSKPTAVLIESFFCDNKEDYDKAKKLGHEGIAKLIVEGVLNKNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endolysin
publication title Structure-based modification of a Clostridium difficile-targeting endolysin affects activity and host range.
pubmed doi rcsb
source organism Clostridium phage phicd27
molecule tags Lyase
total genus 72
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 3qayA00
2Q7SA 1XOVA 1JWQA 4M6GA 5EMIA 4RN7A 4BINA 3NE8A 3CZXA 2ODFA 4M6IA 3QAYA 4M6HA 4LQ6A
chains in the Genus database with same CATH superfamily
2X7BA 3B3SA 3DDDA 3FMCA 3SHPA 3S6HA 1LAPA 2WUUA 8CPAA 3NA6A 3T90A 4YRHA 4EFDA 3JUWA 5AG7A 4QUSA 4MCSA 5F47A 4CYQA 1Z8TA 3BLNA 1B87A 1Y9KA 4F6AA 2YNEA 4DJLA 5G22A 5THWA 2CF4A 2PVWA 3QAYA 3H8FA 4UWJA 3NH5A 3RAMA 1KWMA 2FSRA 2GE3A 3GIUA 4CGLA 2QJ8A 1YQEA 4Z65A 4A95A 2FL4A 2BSWA 3DSBA 2ZEFA 3SI0A 2EVNA 4B5OA 5LRJA 3NE7A 3TOBA 3EC4A 1P4NA 2Z3PA 4YWYA 2QVPA 4OKOA 4MFKA 2PJ1A 1XMTA 2ZEHA 4BMHA 4OC3A 4OC2A 2G3TA 2CNTA 4EMEA 2FS5A 3TOAA 5JM6A 1SQHA 2QECA 2PJ0A 1AUGA 1YW6A 4P4EA 1M4DA 1XEBA 1MJAA 2NMTA 2RB7A 3ISXA 4OC4A 3IIBA 2EWBA 4HNWB 5FVJA 2OOTA 4A38A 4KSFA 3F5BA 3SJEA 1IOFA 4NGNA 4NGQA 4UIBA 3KHXA 4ZBGA 2PDOA 1OZPA 3BI1A 2P6EA 5K8PA 3NH8A 5IB0A 1Y7EA 4ZY1A 3VARA 1KZFA 4KOUA 3IWEA 1YREA 3D7FA 3SI1A 4DUKA 4CRYB 4FD6A 4XPDC 2REFA 4ZY2A 4PXBA 3TO6A 2PQ8A 4UCNA 3BHXA 2ZW4A 4B11A 4MFQA 2CY2A 3HUVA 4KUAA 4MHDA 4CAVA 4QBJA 2CIJA 3KHZA 3PB4X 3G8WA 3TFYA 2WYRA 4L8AA 2IMOA 2ZELA 5EC4A 2DXQA 4BBHA 2V77A 4WJBA 2PRQA 3KKWA 3TE4A 2HQYA 4QVTA 2B3VA 4AG7A 3IU2A 3WR7A 3B35A 4KSAA 2ATRA 2I3CA 2C6CA 2PJ4A 4UCMA 2VZYA 4IAVA 1XIXA 2Q4VA 2IQ6A 2ZEEA 4M3SA 4X8IA 4R6TA 4R3KA 2ZENA 5HXDA 4P45A 4H6UA 4MHYA 5LYIA 2GIVA 2J8RA 3BJ7A 3R1KA 4OC1A 3LACA 4FAIA 4RN7A 3NE8A 2NSMA 1YVOA 1PU9A 4ZX8A 2POKA 4X2TA 4UEEA 1PUAA 4A2ZA 2OZUA 2FE7A 2XEIA 2JDDA 3B7IA 4PXCA 3KQZA 1XFOA 2B4BA 3E0KA 1GHEA 4UIAA 2YNCA 1R57A 4UBRA 3D7DA 4E8OA 3MN8A 2BEIA 3PFOA 4K30A 4MCRA 2Z3NA 3JTKA 2RFHA 5JGFA 3BXMA 3EFAA 5K8OA 3JRUA 4M6IA 1CM0A 4MBUA 2Q43A 4MJ8A 2V8DA 1FNOA 3RNZA 4PPZA 2YNCC 4P10A 3DLJA 4M6GA 5EMIA 4KVME 2AFUA 4L89A 4OAEA 3B3WA 3EXNA 1M4IA 3FEDA 3IFEA 1WWZA 1RO5A 1X12A 2BO9A 2VZZA 1IICA 3PB7X 4E2AA 2XEGA 2Q51A 2FT0A 1XJOA 4R57A 4LQ6A 3R95A 4DYOA 1Z4EA 5F46A 1Q2DA 1XOVA 3TX8A 1BPNA 2B4DA 3D8PA 1QQ9A 4F9VA 4EWTA 5KTAA 3GLJA 3HLPA 1JWQA 4KSIA 4OMEA 4XPLA 4RS2A 4CYOA 5LRGA 1TKFA 4ZGYB 2ABZA 3IO1A 4TWEA 1Q2CA 2ZEMA 4P4DA 4ZYQA 1IY7A 3FNCA 4KLWA 4CYNA 2NYQA 1N71A 1S3ZA 1LANA 2A4NA 1VKCA 2B3UA 4PXEA 2R7HA 2Q7BA 1BPMA 2VL1A 1Y9WA 1CPSA 2JBJA 4Y49C 4E0AA 3MGDA 3B8GA 1YX0A 2GREA 4KOWA 1TIQA 2J8MA 3CXPA 1Z4RA 2F7VA 2OU2A 4G1PA 1PCAA 2F8HA 2AFWA 4B5PB 1U6MA 2FIWA 2FCKA 4UWIA 2G3AA 4U9ZA 1TF8A 1BO4A 1LOKA 4MMOA 3F0AA 4KLVA 4F9UA 3H8EA 4PSXA 3IJ3A 2KCWA 4B14A 2FIAA 1L0CA 2VQYA 4MI4A 1VHEA 3NH4A 3P2HA 4AVBA 4FD5A 4NEXA 4P44A 1XMBA 2Q0YA 4P6YA 1RXTA 4PXDA 5D8NA 2OZHA 5AG6A 3CPXA 1CG2A 4JXRA 4KZTA 4MRIA 3KR5A 5J1QA 2D4PA 4CRZB 5F49A 5I0CA 1IU8A 2B5GB 4MHPA 1HDUA 3IC1A 4RI1A 3S9NA 4CGMA 2JLMA 2P6GA 1Y7RA 4A94A 3PGPA 3FF3A 1AYEA 4QB9A 1NSAA 1F57A 3D7HA 3CDXA 3I9SA 5C82A 1I21A 4JXQA 3PP9A 2AE6A 3N5FA 1XRYA 4U5YA 1I1DA 2R8VA 4KS9A 3D3SA 4NFRA 4OC5A 3FVLA 4QC6A 1LFWA 3GB0A 4F0YA 2K5TA 2CTCA 2PJBA 4ONWA 5DWMA 3RYOA 2ANPA 1V0CA 2PE3A 2V8VA 4BINA 4F8ZA 1VHOA 3IGRA 1K4JA 4OADA 2ZXVA 3S6FA 3TO7A 2OR4A 5AG5A 2D4OA 1S5KA 3GUXA 4I49A 4CAEA 5JQ4A 4NGRA 4R9MA 1M4LA 2Q04A 3TTHA 3D2PA 4II9A 4FD7A 4BD9A 3DR8A 4HPSA 4J3GA 4U9YA 2BOAA 1NMTA 2DPTA 2PJ8A 3KGQA 4DNCA 1EE3P 5G1ZA 3PB9X 1IYKA 5CNPA 2PJ3A 1M1DA 4X5KA 3FX6A 5ELYA 2Z3MA 3DGVA 3QAHA 4JLYA 3D2MA 5C88A 2PJAA 3L2NA 1QMUA 3KL9A 4B10A 5F48A 5BWAB 5CBMA 3FIXA 1XF8A 4FWUA 2FXFA 3TC8A 2RC4A 5F09A 3FJUA 4ORFA 4B6ZA 1CP7A 1DTDA 1Z8XA 1B6BA 1CX8A 4KVXA 4MFLA 2R98A 1YVKA 1YW4A 4MHNA 4OLLA 4P4BA 4C2XA 3VH9A 4GS4A 4CS0B 2PJ7A 3IWGA 3B3CA 2BCOA 2VBQA 4LUAA 3V8IA 4HNXB 1M44A 4NGSA 6CPAA 3RO0A 1TKHA 4CGPA 1H8LA 3BJ8A 4NGMA 4JD6A 4FBEA 1HEEA 1KUYA 3CXQA 2ODFA 5HVFA 1I12A 1S7LA 5HMNA 1KUVA 4AXVA 1WK4A 2YGWA 2WPWA 3LD2A 3QB8A 2WZNA 1F2OA 4XNHB 2H5MA 4NJQA 3WT4A 4M85A 4PQAA 4ONUA 1YLEA 2B58A 4KOSA 4PV6A 3KQXA 5AG4A 2ZPAA 4OC0A 3VWEA 3TCVA 5JPHA 2ZOGA 1IIDA 2O28A 5K8NA 3JVNA 2XEJA 1QSTA 4GM5A 4AVAA 1PYTB 2HV2A 3WC7A 1ZLHA 1OBRA 2IL4A 5G20A 4B13A 4NGPA 4NCZA 4JWPA 1ZG8A 1CP6A 4NF1A 4Q36A 4MXUA 2Q4YA 3D67A 2QYVA 2JBKA 3TT2A 1TF9A 3KZWA 3WC5A 1ARLA 3IEHA 3KI9A 1YK3A 1FY7A 4LQGA 2ZEDA 2Q44A 1IGBA 3LWUA 2AFOA 2PIYA 4A32A 1TXRA 4WWVA 4MY3A 1ELMP 4UA3A 1ELLP 4KORA 3RBUA 4KOVA 1GYTA 1QSMA 4UCPA 1Z2LA 2PRBA 4NJRA 1X10A 1BOBA 1BAVA 1UFHA 2XEFA 3NFZA 4CGNA 1QSRA 2ZEOA 2Z10A 4CGOA 1ZO0A 2ZW5A 4F0XA 4O23A 5KTDA 3R9EA 3FEEA 2B4DB 4UEFA 4MFZA 4EVYA 4K3NA 2YNDA 3S9MA 2CTBA 4TNUA 2AFMA 3D66A 3PBEA 5IX3A 4MFJA 2V8HA 4M6HA 1KUXA 2HUZA 3SXNA 4MCQA 4R76A 2J9AA 3LODA 1Y0YA 4X3RA 2EK8A 1CPXA 2B5GA 2P6FA 4KOTA 4P4JA 3SI2A 3K9UA 4Q7AA 1Z9UA 3ZJ0A 1YR0A 4MY0A 2R1IA 3TO9A 4C2YA 5HVGA 2PJ2A 2ARHA 2Z11A 4A30A 2JEWA 5LYLA 4YGOA 4CYPA 5JH9A 2EUIA 3FECA 2IJZA 2PSWA 3PZJA 2Z3KA 2EO8A 1QSOA 1MJ9A 3T9YA 4ZY0A 5DWNA 2C6PA 2FVGA 1YSJA 4H2KA 5EBVA 3SJFA 4NXYA 4OP4A 3EO4A 4MCPA 1J4JA 3FRMA 2CXAA 1YGHA 3B2YA 3SJXA 2CNMA 2VI7A 1VHSA 1HDQA 5K8MA 4NSQA 1S7FA 4IHMA 1NE9A 2EBJA 4KUBA 2Q4ZA 3I1UA 1XE4A 4W9YA 1TKJA 1Z8LA 3GY9A 1Z8WA 3K9TA 1IB1E 2O4HA 2QMLA 2ZW6A 4NGTA 4Q38A 3PFEA 4JZ0A 3FBUA 5HVHA 3P2FA 2VXKA 3FYNA 4MFPA 1RTQA 3PB8X 3QNVA 3GKRA 1AMPA 4H89A 3PB6X 3DNSA 2GLFA 1YMEA 4UEZA 4XPDB 1ZG7A 4PK2A 4C2ZA 3B3VA 3D7GA 3H8GA 3C26A 1Q2YA 2WSAA 1IYLA 2GU2A 2PVVA 3IWWA 4UFVA 3UY5A 2REEA 4R3LA 3CPAA 3ZZIA 3D4UA 2PR8A 1ON0A 1R3NA 1Q7LA 2JDCA 3RZAA 3CXSA 5KTCA 2AJ6A 3S6GA 2CNSA 5AGEA 4A33A 4CAXA 5HH1A 5I4MA 1FT7A 5IB9A 4OIDA 2J8NA 3H4QA 4P4IA 1R43A 3K2KA 1VGYA 4A31A 5IV0A 3S9LA 2Z3OA 5LYFA 2I00A 4JYWA 1LAMA 4UF4A 5CPAA 3D68A 3V38A 4AVCA 3I3GA 4HKFA 4B12A 5ISVA 4YU9A 3CZXA 4CAWA 4PK3A 1UWYA 4A39A 2G9DA 1S7NA 7CPAA 2PCUA 3KR4A 5LRKA 3DR6A 4IUSA 2V8GA 1LRZA 3IU1A 3PRTA 4H6ZA 2QIRA 5LYDA 2PR1A 1IOIA 2DF5A 3LMSA 3WABA 1S60A 2BL1A 2ZEGA 3OWCA 4KVOE 2ZEPA 4ZX9A 3SXOA 2PIZA 3B3TA 2WPXA 1JQGA 3R9FA 3R9GA 4UFWA 3WC6A 2GANA 3CT9A 3MRUA 2Q7SA 2OB0A 2VEZA 4AG9A 4XNHC 2HB6A 4HNYB 1CJWA 1Y0RA 3KASA 4C68A 2Z0ZA 2ZOFA 3FXTA 3PBBA 3ISZA 4CPAA 4KOYA 3S6KA 3G3SA 3GYAA 4MHZA 2Y0MA 3EY5A 4IK2A 2PJCA 2EK9A 3FH4A 3SJGA 4C7HA 1XBUA 2GFQA 4P4FA 5A28A 1ZG9A 3FB3A 2C27A 4OIWA 4XPKA 3VATA 2F5IA 2PC1A 2BUEA 1MK4A 1DE4C 1CBXA 1LCPA 1ARMA 2AFXA 4FD4A 4JJXA 1YLOA 4R8FA 1NSLA 3R96A 4YFJA 1S7KA 4AB7A 2AFZA 1MJBA 2PJ6A 3F8KA 2Z3LA 3H5ZA 5A27A 3N7ZA 4IF5A 4ZI6A 4FUUA 2PJ9A 4PSWA 4RUHA 4A37A 4C7IA 3VWDA 4CAFA 4B5PA 1ZLIA 2HC9A 3BI0A 2AFSA 4UFXA 3A9LA 1F2PA 2C6GA 4LX9A 5J8CA 3W6SA 5GCNA 1BLLE 1A2ZA 1P0HA 3W91A 1QSNA 5H86A 3W6XA 2DEAA 2ZW7A 3T8WA 5D29A 4R87A 5H84A 5E96A 2JEVA 5DS0A 4R7MA 2DPSA 1Z5RA 2C1CA 2OZGA 2O53A 3PEIA 4KOXA 5J8FA 4Y49B 2G0BA 2PJ5A 2GLJA 2OH1A 1M4GA 2I79A 2P0WA 5G21A 1VIXA 3V7ZA 4GXHA
chains in the Genus database with same CATH topology
2Q7SA 1XOVA 2HC9A 1JWQA 4M6GA 5EMIA 4RN7A 4BINA 3NE8A 3CZXA 2ODFA 2HB6A 4M6IA 3QAYA 4EFDA 4M6HA 4LQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7S A;  1XOV A;  1JWQ A;  4M6G A;  5EMI A;  4RN7 A;  4BIN A;  3NE8 A;  3CZX A;  2ODF A;  4M6I A;  3QAY A;  4M6H A;  4LQ6 A; 
#chains in the Genus database with same CATH topology
 2X7B A;  3B3S A;  3DDD A;  3FMC A;  3SHP A;  3S6H A;  1LAP A;  2WUU A;  8CPA A;  3NA6 A;  3T90 A;  4YRH A;  4EFD A;  3JUW A;  5AG7 A;  4QUS A;  4MCS A;  5F47 A;  4CYQ A;  1Z8T A;  3BLN A;  1B87 A;  1Y9K A;  4F6A A;  2YNE A;  4DJL A;  5G22 A;  5THW A;  2CF4 A;  2PVW A;  3QAY A;  3H8F A;  4UWJ A;  3NH5 A;  3RAM A;  1KWM A;  2FSR A;  2GE3 A;  3GIU A;  4CGL A;  2QJ8 A;  1YQE A;  4Z65 A;  4A95 A;  2FL4 A;  2BSW A;  3DSB A;  2ZEF A;  3SI0 A;  2EVN A;  4B5O A;  5LRJ A;  3NE7 A;  3TOB A;  3EC4 A;  1P4N A;  2Z3P A;  4YWY A;  2QVP A;  4OKO A;  4MFK A;  2PJ1 A;  1XMT A;  2ZEH A;  4BMH A;  4OC3 A;  4OC2 A;  2G3T A;  2CNT A;  4EME A;  2FS5 A;  3TOA A;  5JM6 A;  1SQH A;  2QEC A;  2PJ0 A;  1AUG A;  1YW6 A;  4P4E A;  1M4D A;  1XEB A;  1MJA A;  2NMT A;  2RB7 A;  3ISX A;  4OC4 A;  3IIB A;  2EWB A;  4HNW B;  5FVJ A;  2OOT A;  4A38 A;  4KSF A;  3F5B A;  3SJE A;  1IOF A;  4NGN A;  4NGQ A;  4UIB A;  3KHX A;  4ZBG A;  2PDO A;  1OZP A;  3BI1 A;  2P6E A;  5K8P A;  3NH8 A;  5IB0 A;  1Y7E A;  4ZY1 A;  3VAR A;  1KZF A;  4KOU A;  3IWE A;  1YRE A;  3D7F A;  3SI1 A;  4DUK A;  4CRY B;  4FD6 A;  4XPD C;  2REF A;  4ZY2 A;  4PXB A;  3TO6 A;  2PQ8 A;  4UCN A;  3BHX A;  2ZW4 A;  4B11 A;  4MFQ A;  2CY2 A;  3HUV A;  4KUA A;  4MHD A;  4CAV A;  4QBJ A;  2CIJ A;  3KHZ A;  3PB4 X;  3G8W A;  3TFY A;  2WYR A;  4L8A A;  2IMO A;  2ZEL A;  5EC4 A;  2DXQ A;  4BBH A;  2V77 A;  4WJB A;  2PRQ A;  3KKW A;  3TE4 A;  2HQY A;  4QVT A;  2B3V A;  4AG7 A;  3IU2 A;  3WR7 A;  3B35 A;  4KSA A;  2ATR A;  2I3C A;  2C6C A;  2PJ4 A;  4UCM A;  2VZY A;  4IAV A;  1XIX A;  2Q4V A;  2IQ6 A;  2ZEE A;  4M3S A;  4X8I A;  4R6T A;  4R3K A;  2ZEN A;  5HXD A;  4P45 A;  4H6U A;  4MHY A;  5LYI A;  2GIV A;  2J8R A;  3BJ7 A;  3R1K A;  4OC1 A;  3LAC A;  4FAI A;  4RN7 A;  3NE8 A;  2NSM A;  1YVO A;  1PU9 A;  4ZX8 A;  2POK A;  4X2T A;  4UEE A;  1PUA A;  4A2Z A;  2OZU A;  2FE7 A;  2XEI A;  2JDD A;  3B7I A;  4PXC A;  3KQZ A;  1XFO A;  2B4B A;  3E0K A;  1GHE A;  4UIA A;  2YNC A;  1R57 A;  4UBR A;  3D7D A;  4E8O A;  3MN8 A;  2BEI A;  3PFO A;  4K30 A;  4MCR A;  2Z3N A;  3JTK A;  2RFH A;  5JGF A;  3BXM A;  3EFA A;  5K8O A;  3JRU A;  4M6I A;  1CM0 A;  4MBU A;  2Q43 A;  4MJ8 A;  2V8D A;  1FNO A;  3RNZ A;  4PPZ A;  2YNC C;  4P10 A;  3DLJ A;  4M6G A;  5EMI A;  4KVM E;  2AFU A;  4L89 A;  4OAE A;  3B3W A;  3EXN A;  1M4I A;  3FED A;  3IFE A;  1WWZ A;  1RO5 A;  1X12 A;  2BO9 A;  2VZZ A;  1IIC A;  3PB7 X;  4E2A A;  2XEG A;  2Q51 A;  2FT0 A;  1XJO A;  4R57 A;  4LQ6 A;  3R95 A;  4DYO A;  1Z4E A;  5F46 A;  1Q2D A;  1XOV A;  3TX8 A;  1BPN A;  2B4D A;  3D8P A;  1QQ9 A;  4F9V A;  4EWT A;  5KTA A;  3GLJ A;  3HLP A;  1JWQ A;  4KSI A;  4OME A;  4XPL A;  4RS2 A;  4CYO A;  5LRG A;  1TKF A;  4ZGY B;  2ABZ A;  3IO1 A;  4TWE A;  1Q2C A;  2ZEM A;  4P4D A;  4ZYQ A;  1IY7 A;  3FNC A;  4KLW A;  4CYN A;  2NYQ A;  1N71 A;  1S3Z A;  1LAN A;  2A4N A;  1VKC A;  2B3U A;  4PXE A;  2R7H A;  2Q7B A;  1BPM A;  2VL1 A;  1Y9W A;  1CPS A;  2JBJ A;  4Y49 C;  4E0A A;  3MGD A;  3B8G A;  1YX0 A;  2GRE A;  4KOW A;  1TIQ A;  2J8M A;  3CXP A;  1Z4R A;  2F7V A;  2OU2 A;  4G1P A;  1PCA A;  2F8H A;  2AFW A;  4B5P B;  1U6M A;  2FIW A;  2FCK A;  4UWI A;  2G3A A;  4U9Z A;  1TF8 A;  1BO4 A;  1LOK A;  4MMO A;  3F0A A;  4KLV A;  4F9U A;  3H8E A;  4PSX A;  3IJ3 A;  2KCW A;  4B14 A;  2FIA A;  1L0C A;  2VQY A;  4MI4 A;  1VHE A;  3NH4 A;  3P2H A;  4AVB A;  4FD5 A;  4NEX A;  4P44 A;  1XMB A;  2Q0Y A;  4P6Y A;  1RXT A;  4PXD A;  5D8N A;  2OZH A;  5AG6 A;  3CPX A;  1CG2 A;  4JXR A;  4KZT A;  4MRI A;  3KR5 A;  5J1Q A;  2D4P A;  4CRZ B;  5F49 A;  5I0C A;  1IU8 A;  2B5G B;  4MHP A;  1HDU A;  3IC1 A;  4RI1 A;  3S9N A;  4CGM A;  2JLM A;  2P6G A;  1Y7R A;  4A94 A;  3PGP A;  3FF3 A;  1AYE A;  4QB9 A;  1NSA A;  1F57 A;  3D7H A;  3CDX A;  3I9S A;  5C82 A;  1I21 A;  4JXQ A;  3PP9 A;  2AE6 A;  3N5F A;  1XRY A;  4U5Y A;  1I1D A;  2R8V A;  4KS9 A;  3D3S A;  4NFR A;  4OC5 A;  3FVL A;  4QC6 A;  1LFW A;  3GB0 A;  4F0Y A;  2K5T A;  2CTC A;  2PJB A;  4ONW A;  5DWM A;  3RYO A;  2ANP A;  1V0C A;  2PE3 A;  2V8V A;  4BIN A;  4F8Z A;  1VHO A;  3IGR A;  1K4J A;  4OAD A;  2ZXV A;  3S6F A;  3TO7 A;  2OR4 A;  5AG5 A;  2D4O A;  1S5K A;  3GUX A;  4I49 A;  4CAE A;  5JQ4 A;  4NGR A;  4R9M A;  1M4L A;  2Q04 A;  3TTH A;  3D2P A;  4II9 A;  4FD7 A;  4BD9 A;  3DR8 A;  4HPS A;  4J3G A;  4U9Y A;  2BOA A;  1NMT A;  2DPT A;  2PJ8 A;  3KGQ A;  4DNC A;  1EE3 P;  5G1Z A;  3PB9 X;  1IYK A;  5CNP A;  2PJ3 A;  1M1D A;  4X5K A;  3FX6 A;  5ELY A;  2Z3M A;  3DGV A;  3QAH A;  4JLY A;  3D2M A;  5C88 A;  2PJA A;  3L2N A;  1QMU A;  3KL9 A;  4B10 A;  5F48 A;  5BWA B;  5CBM A;  3FIX A;  1XF8 A;  4FWU A;  2FXF A;  3TC8 A;  2RC4 A;  5F09 A;  3FJU A;  4ORF A;  4B6Z A;  1CP7 A;  1DTD A;  1Z8X A;  1B6B A;  1CX8 A;  4KVX A;  4MFL A;  2R98 A;  1YVK A;  1YW4 A;  4MHN A;  4OLL A;  4P4B A;  4C2X A;  3VH9 A;  4GS4 A;  4CS0 B;  2PJ7 A;  3IWG A;  3B3C A;  2BCO A;  2VBQ A;  4LUA A;  3V8I A;  4HNX B;  1M44 A;  4NGS A;  6CPA A;  3RO0 A;  1TKH A;  4CGP A;  1H8L A;  3BJ8 A;  4NGM A;  4JD6 A;  4FBE A;  1HEE A;  1KUY A;  3CXQ A;  2ODF A;  5HVF A;  1I12 A;  1S7L A;  5HMN A;  1KUV A;  4AXV A;  1WK4 A;  2YGW A;  2WPW A;  3LD2 A;  3QB8 A;  2WZN A;  1F2O A;  4XNH B;  2H5M A;  4NJQ A;  3WT4 A;  4M85 A;  4PQA A;  4ONU A;  1YLE A;  2B58 A;  4KOS A;  4PV6 A;  3KQX A;  5AG4 A;  2ZPA A;  4OC0 A;  3VWE A;  3TCV A;  5JPH A;  2ZOG A;  1IID A;  2O28 A;  5K8N A;  3JVN A;  2XEJ A;  1QST A;  4GM5 A;  4AVA A;  1PYT B;  2HV2 A;  3WC7 A;  1ZLH A;  1OBR A;  2IL4 A;  5G20 A;  4B13 A;  4NGP A;  4NCZ A;  4JWP A;  1ZG8 A;  1CP6 A;  4NF1 A;  4Q36 A;  4MXU A;  2Q4Y A;  3D67 A;  2QYV A;  2JBK A;  3TT2 A;  1TF9 A;  3KZW A;  3WC5 A;  1ARL A;  3IEH A;  3KI9 A;  1YK3 A;  1FY7 A;  4LQG A;  2ZED A;  2Q44 A;  1IGB A;  3LWU A;  2AFO A;  2PIY A;  4A32 A;  1TXR A;  4WWV A;  4MY3 A;  1ELM P;  4UA3 A;  1ELL P;  4KOR A;  3RBU A;  4KOV A;  1GYT A;  1QSM A;  4UCP A;  1Z2L A;  2PRB A;  4NJR A;  1X10 A;  1BOB A;  1BAV A;  1UFH A;  2XEF A;  3NFZ A;  4CGN A;  1QSR A;  2ZEO A;  2Z10 A;  4CGO A;  1ZO0 A;  2ZW5 A;  4F0X A;  4O23 A;  5KTD A;  3R9E A;  3FEE A;  2B4D B;  4UEF A;  4MFZ A;  4EVY A;  4K3N A;  2YND A;  3S9M A;  2CTB A;  4TNU A;  2AFM A;  3D66 A;  3PBE A;  5IX3 A;  4MFJ A;  2V8H A;  4M6H A;  1KUX A;  2HUZ A;  3SXN A;  4MCQ A;  4R76 A;  2J9A A;  3LOD A;  1Y0Y A;  4X3R A;  2EK8 A;  1CPX A;  2B5G A;  2P6F A;  4KOT A;  4P4J A;  3SI2 A;  3K9U A;  4Q7A A;  1Z9U A;  3ZJ0 A;  1YR0 A;  4MY0 A;  2R1I A;  3TO9 A;  4C2Y A;  5HVG A;  2PJ2 A;  2ARH A;  2Z11 A;  4A30 A;  2JEW A;  5LYL A;  4YGO A;  4CYP A;  5JH9 A;  2EUI A;  3FEC A;  2IJZ A;  2PSW A;  3PZJ A;  2Z3K A;  2EO8 A;  1QSO A;  1MJ9 A;  3T9Y A;  4ZY0 A;  5DWN A;  2C6P A;  2FVG A;  1YSJ A;  4H2K A;  5EBV A;  3SJF A;  4NXY A;  4OP4 A;  3EO4 A;  4MCP A;  1J4J A;  3FRM A;  2CXA A;  1YGH A;  3B2Y A;  3SJX A;  2CNM A;  2VI7 A;  1VHS A;  1HDQ A;  5K8M A;  4NSQ A;  1S7F A;  4IHM A;  1NE9 A;  2EBJ A;  4KUB A;  2Q4Z A;  3I1U A;  1XE4 A;  4W9Y A;  1TKJ A;  1Z8L A;  3GY9 A;  1Z8W A;  3K9T A;  1IB1 E;  2O4H A;  2QML A;  2ZW6 A;  4NGT A;  4Q38 A;  3PFE A;  4JZ0 A;  3FBU A;  5HVH A;  3P2F A;  2VXK A;  3FYN A;  4MFP A;  1RTQ A;  3PB8 X;  3QNV A;  3GKR A;  1AMP A;  4H89 A;  3PB6 X;  3DNS A;  2GLF A;  1YME A;  4UEZ A;  4XPD B;  1ZG7 A;  4PK2 A;  4C2Z A;  3B3V A;  3D7G A;  3H8G A;  3C26 A;  1Q2Y A;  2WSA A;  1IYL A;  2GU2 A;  2PVV A;  3IWW A;  4UFV A;  3UY5 A;  2REE A;  4R3L A;  3CPA A;  3ZZI A;  3D4U A;  2PR8 A;  1ON0 A;  1R3N A;  1Q7L A;  2JDC A;  3RZA A;  3CXS A;  5KTC A;  2AJ6 A;  3S6G A;  2CNS A;  5AGE A;  4A33 A;  4CAX A;  5HH1 A;  5I4M A;  1FT7 A;  5IB9 A;  4OID A;  2J8N A;  3H4Q A;  4P4I A;  1R43 A;  3K2K A;  1VGY A;  4A31 A;  5IV0 A;  3S9L A;  2Z3O A;  5LYF A;  2I00 A;  4JYW A;  1LAM A;  4UF4 A;  5CPA A;  3D68 A;  3V38 A;  4AVC A;  3I3G A;  4HKF A;  4B12 A;  5ISV A;  4YU9 A;  3CZX A;  4CAW A;  4PK3 A;  1UWY A;  4A39 A;  2G9D A;  1S7N A;  7CPA A;  2PCU A;  3KR4 A;  5LRK A;  3DR6 A;  4IUS A;  2V8G A;  1LRZ A;  3IU1 A;  3PRT A;  4H6Z A;  2QIR A;  5LYD A;  2PR1 A;  1IOI A;  2DF5 A;  3LMS A;  3WAB A;  1S60 A;  2BL1 A;  2ZEG A;  3OWC A;  4KVO E;  2ZEP A;  4ZX9 A;  3SXO A;  2PIZ A;  3B3T A;  2WPX A;  1JQG A;  3R9F A;  3R9G A;  4UFW A;  3WC6 A;  2GAN A;  3CT9 A;  3MRU A;  2Q7S A;  2OB0 A;  2VEZ A;  4AG9 A;  4XNH C;  2HB6 A;  4HNY B;  1CJW A;  1Y0R A;  3KAS A;  4C68 A;  2Z0Z A;  2ZOF A;  3FXT A;  3PBB A;  3ISZ A;  4CPA A;  4KOY A;  3S6K A;  3G3S A;  3GYA A;  4MHZ A;  2Y0M A;  3EY5 A;  4IK2 A;  2PJC A;  2EK9 A;  3FH4 A;  3SJG A;  4C7H A;  1XBU A;  2GFQ A;  4P4F A;  5A28 A;  1ZG9 A;  3FB3 A;  2C27 A;  4OIW A;  4XPK A;  3VAT A;  2F5I A;  2PC1 A;  2BUE A;  1MK4 A;  1DE4 C;  1CBX A;  1LCP A;  1ARM A;  2AFX A;  4FD4 A;  4JJX A;  1YLO A;  4R8F A;  1NSL A;  3R96 A;  4YFJ A;  1S7K A;  4AB7 A;  2AFZ A;  1MJB A;  2PJ6 A;  3F8K A;  2Z3L A;  3H5Z A;  5A27 A;  3N7Z A;  4IF5 A;  4ZI6 A;  4FUU A;  2PJ9 A;  4PSW A;  4RUH A;  4A37 A;  4C7I A;  3VWD A;  4CAF A;  4B5P A;  1ZLI A;  2HC9 A;  3BI0 A;  2AFS A;  4UFX A;  3A9L A;  1F2P A;  2C6G A;  4LX9 A;  5J8C A;  3W6S A;  5GCN A;  1BLL E;  1A2Z A;  1P0H A;  3W91 A;  1QSN A;  5H86 A;  3W6X A;  2DEA A;  2ZW7 A;  3T8W A;  5D29 A;  4R87 A;  5H84 A;  5E96 A;  2JEV A;  5DS0 A;  4R7M A;  2DPS A;  1Z5R A;  2C1C A;  2OZG A;  2O53 A;  3PEI A;  4KOX A;  5J8F A;  4Y49 B;  2G0B A;  2PJ5 A;  2GLJ A;  2OH1 A;  1M4G A;  2I79 A;  2P0W A;  5G21 A;  1VIX A;  3V7Z A;  4GXH A; 
#chains in the Genus database with same CATH homology
 2Q7S A;  1XOV A;  2HC9 A;  1JWQ A;  4M6G A;  5EMI A;  4RN7 A;  4BIN A;  3NE8 A;  3CZX A;  2ODF A;  2HB6 A;  4M6I A;  3QAY A;  4EFD A;  4M6H A;  4LQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...