3QAYA

Catalytic domain of cd27l endolysin targeting clostridia difficile
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
180
structure length
180
Chain Sequence
b'HMKICITVGHSILKSGACTSADGVVNEYQYNKSLAPVLADTFRKEGHKVDVIICPEKQFKTKNEEKSYKIPRVNSGGYDLLIELHLNASNGQGKGSEVLYYSNKGLEYATRICDKLGTVFKNRGAKLDKRLYILNSSKPTAVLIESFFCDNKEDYDKAKKLGHEGIAKLIVEGVLNKNIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endolysin
molecule tags Lyase
source organism Clostridium phage phicd27
publication title Structure-based modification of a Clostridium difficile-targeting endolysin affects activity and host range.
pubmed doi rcsb
total genus 72
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 3qayA00
2Q7SA 4RN7A 4M6HA 1JWQA 2ODFA 3QAYA 3CZXA 5EMIA 4BINA 1XOVA 4M6IA 4M6GA 3NE8A 4LQ6A
chains in the Genus database with same CATH superfamily
1LFWA 4UFXA 4F0YA 3E0KA 4FD7A 5AGEA 2ZEOA 2X7BA 1LOKA 3KR5A 4WWVA 1I12A 4Q7AA 2P6FA 2GLFA 2Z3OA 1YREA 4NGNA 4CGLA 2I00A 3BJ7A 4CAEA 3IWEA 3KHXA 3KGQA 5F49A 5CBMA 4P44A 5THWA 3CPAA 4KOYA 1KUXA 4ZY2A 1ARLA 3V8IA 1Y0YA 3I9SA 2FCKA 2QECA 2ZPAA 1ON0A 4JJXA 4OMEA 4XPDB 4AVAA 5K8MA 3DR8A 1Z2LA 3NFZA 5HVFA 2ZW7A 3DLJA 4NGPA 3V38A 1M44A 2C6CA 4OKOA 2PJ2A 3JUWA 2Q04A 4P10A 4II9A 4EMEA 3SI0A 4FAIA 5ISVA 2Z11A 3RYOA 1IGBA 2J8NA 3B3SA 4KZTA 4XPDC 2REEA 3CPXA 4CGPA 2VZYA 2OOTA 5LRKA 3D3SA 4UBRA 5KTDA 1S7NA 1TF9A 4IHMA 4L89A 1Z4EA 2GLJA 3CZXA 4MCQA 1IU8A 1XMTA 2C1CA 2AJ6A 5HMNA 1QSOA 2IL4A 2OB0A 1CPXA 1R3NA 2REFA 3QAHA 3FH4A 2J8MA 2PRBA 3FEDA 4TNUA 4Y49B 2GANA 5LRJA 4F9VA 3WC6A 4LQGA 1VHOA 1CPSA 3BI0A 1XIXA 4MFPA 4UWIA 4OC4A 1Z8TA 2PJ8A 4JXQA 1SQHA 1ZLHA 2CY2A 5H84A 4RN7A 2VQYA 2C6PA 4UF4A 3I3GA 1P4NA 1Y0RA 1OBRA 1YK3A 4KOXA 5DWNA 2NYQA 4Y49C 4A32A 4F0XA 5J8FA 4AG9A 2HUZA 3PZJA 4MCSA 5I0CA 3NA6A 5EC4A 1YW6A 2BUEA 2PJ0A 2PVWA 4UA3A 4NEXA 1VHEA 2XEGA 3T9YA 3TCVA 2YNCC 1BPNA 1PUAA 3EC4A 4H6UA 4U9YA 4CAXA 4B5OA 3BHXA 4B10A 2JLMA 1YMEA 4MFQA 1P0HA 1BAVA 2ARHA 2JDDA 5F47A 2R98A 1IYLA 2Z3PA 3KL9A 4CAVA 4ORFA 1VGYA 4WJBA 1U6MA 4GXHA 2Q4ZA 2PC1A 1Y9WA 2OZGA 1I1DA 1I21A 1ZO0A 1M4LA 2Q43A 3FBUA 3SXOA 3IIBA 4UEEA 1YR0A 3D8PA 4ZBGA 3B35A 3GB0A 4KVXA 4NSQA 5H86A 2FIWA 1CM0A 3S6FA 1OZPA 4GM5A 2YNEA 4OLLA 2GU2A 2HV2A 2AFMA 3CDXA 1IY7A 2FE7A 2B3VA 2OZHA 3KKWA 4MFJA 4C2YA 3ISZA 1HDQA 4CGOA 1S60A 3LMSA 2B5GA 4MHZA 4ZGYB 1F57A 1LANA 3W6XA 5IX3A 4AG7A 2AFSA 1IOIA 3MRUA 4C2XA 2KCWA 2R7HA 2FXFA 4A30A 6CPAA 5HVGA 2NSMA 4I49A 2HQYA 2FL4A 1XF8A 2Q51A 5JM6A 3IJ3A 2JDCA 3UY5A 3N5FA 4ZY0A 4M3SA 4X3RA 3GIUA 4JLYA 4PPZA 4UFWA 5E96A 2IMOA 4OP4A 4NGMA 1TIQA 3P2HA 1Z5RA 3KHZA 4R87A 4L8AA 1S7LA 2CTCA 4MI4A 3P2FA 4F8ZA 3MN8A 3ZZIA 4PV6A 2FS5A 4EFDA 5C88A 2OH1A 3DDDA 4NJRA 5LYIA 4DNCA 3PB4X 4U5YA 5IV0A 1FY7A 4NFRA 3H4QA 1TKFA 3JRUA 5LRGA 5IB0A 4PXEA 1EE3P 1MJAA 3R95A 1DE4C 1YVOA 4KUBA 2DPSA 2V8DA 4BINA 2PRQA 2O28A 4FWUA 1L0CA 3S6KA 4B5PA 3ZJ0A 5D29A 4A33A 4UFVA 2WYRA 2EK9A 2ZEFA 3W6SA 4MCPA 3WR7A 4B12A 1LAMA 1M4IA 5LYDA 4P4DA 2PIYA 4K3NA 3IC1A 1Y9KA 3QNVA 4R3KA 4XPLA 4OIDA 3TFYA 1XJOA 1TKJA 4IUSA 2I79A 1QSTA 4JXRA 1TKHA 4C68A 3SJXA 4A39A 2PJ6A 1Y7RA 1AYEA 3IGRA 3K9UA 1BO4A 3FB3A 3GUXA 2ZEGA 4NGRA 3G3SA 2Q4VA 5J8CA 3PB9X 2Y0MA 3DR6A 1CP6A 3PRTA 1YGHA 4MHDA 2HB6A 4PQAA 4Q36A 3TOAA 3BLNA 4RUHA 1VHSA 2Z3KA 2C6GA 3R96A 4PXBA 2ZW4A 2AFUA 2NMTA 5K8PA 2POKA 3NH5A 3D7GA 2WZNA 3BXMA 1QMUA 2DEAA 3FNCA 3TOBA 5AG4A 3GLJA 3IWWA 3KR4A 3PB8X 3D7DA 1S7KA 3KASA 4AB7A 2ZOFA 4ZY1A 1Y7EA 2AFXA 2ODFA 2OR4A 2FT0A 2ZELA 4HNXB 4RI1A 2Z10A 4HPSA 1AUGA 4R7MA 5ELYA 4OADA 4M85A 2ANPA 2G3AA 5HH1A 3B3VA 4C7IA 5C82A 4LX9A 1CP7A 2A4NA 1XEBA 5G20A 1YQEA 2YNDA 3A9LA 4P45A 4CRYB 3TT2A 1M4GA 3FX6A 2VL1A 2XEJA 3D7FA 4KLVA 4OC3A 2PJ9A 3JTKA 3EXNA 4CYPA 2AFOA 3FIXA 4B13A 2EO8A 3PGPA 4R8FA 3S9MA 2Q4YA 3KZWA 3KI9A 2EWBA 4EWTA 3TO9A 3PFOA 1XMBA 1X12A 2D4OA 1M4DA 3FYNA 2PJ3A 2V77A 3PB7X 4CYOA 3RO0A 2F7VA 1XFOA 3K9TA 5F46A 3NH8A 3ISXA 4ONWA 4OAEA 2GIVA 4KSFA 4X8IA 1IB1E 2Q7SA 4P4JA 1CX8A 4R9MA 2PJBA 4UWJA 1Q2CA 3FEEA 4HNYB 4YU9A 4NF1A 4JYWA 4BMHA 3FRMA 1N71A 1IIDA 1LCPA 2V8GA 2ZW5A 2ZEDA 4KSAA 4C2ZA 3S9LA 4MY3A 2EVNA 3H8GA 4MHYA 2F5IA 3WABA 1KUYA 4KORA 1S3ZA 4A2ZA 3B8GA 4MXUA 4P4EA 5G1ZA 2J8RA 3MGDA 3LODA 3F8KA 1AMPA 4DYOA 1FT7A 5DWMA 4OC0A 1GYTA 1MJBA 5BWAB 2PSWA 5KTCA 5LYLA 3IWGA 1V0CA 2VZZA 3HUVA 4A31A 4DUKA 3TE4A 2XEFA 2CNMA 2ZEHA 4X2TA 5CNPA 1ARMA 3RBUA 3VH9A 2BSWA 3S9NA 4UCPA 3T90A 2GE3A 2WPWA 4FD4A 4QVTA 4NGTA 3PFEA 3S6HA 3BI1A 3JVNA 3L2NA 4PSXA 4J3GA 5GCNA 2PCUA 1QQ9A 2Q0YA 4P4IA 2OZUA 4H89A 3PP9A 4PXDA 2PJAA 3SHPA 3RAMA 2EUIA 3QAYA 4NCZA 3SJFA 2J9AA 2PJ7A 5JH9A 2V8HA 2JEVA 3LACA 4M6IA 3H5ZA 4ONUA 4C7HA 4KOTA 4JWPA 3R9GA 2FIAA 1Z4RA 4IK2A 2PQ8A 4MJ8A 5EMIA 4CGMA 1XRYA 4KOSA 2VXKA 4PXCA 5JGFA 4KOVA 5DS0A 2AFWA 3PB6X 4CAWA 1LRZA 2QYVA 4PK2A 5JPHA 5HVHA 1TF8A 2R1IA 1KWMA 2QMLA 2WSAA 3CXQA 3FJUA 2BOAA 3FXTA 2CNTA 4YFJA 1PYTB 4KSIA 4Z65A 2O4HA 3TC8A 3B3WA 2ATRA 2CXAA 4UIAA 5D8NA 4B14A 4LQ6A 1IOFA 4OC1A 5G22A 4NXYA 3BJ8A 2G9DA 4MY0A 2K5TA 1S5KA 2EK8A 3EY5A 2PJ5A 3FECA 2BL1A 3I1UA 2DXQA 5CPAA 2PR8A 1YX0A 2B5GB 2H5MA 4KLWA 4CYNA 1Z9UA 2ABZA 3TX8A 4E0AA 2GREA 1RXTA 3TO7A 3VWEA 1YLOA 4HKFA 3SI1A 4IAVA 2JBKA 4CRZB 2CF4A 4KS9A 2P0WA 3R1KA 3H8EA 3NE7A 4P6YA 4H6ZA 3SI2A 4TWEA 1CJWA 1NE9A 1F2OA 2F8HA 3T8WA 2DF5A 1B6BA 2Z3LA 3WC7A 5K8OA 3SXNA 2ZEEA 3D66A 4MMOA 4AXVA 2BCOA 1ELLP 2EBJA 4ZX9A 2FVGA 2QIRA 4O23A 5A27A 2I3CA 3V7ZA 1DTDA 2PIZA 4F6AA 1CBXA 4UCMA 3VWDA 4NGQA 2HC9A 1PU9A 3IO1A 2PR1A 5F09A 1GHEA 4P4BA 1IICA 2VEZA 1YLEA 4W9YA 4QBJA 2YGWA 4E8OA 3NH4A 1NSLA 1RTQA 4F9UA 2Z3NA 4K30A 1CG2A 3WT4A 4DJLA 5FVJA 7CPAA 4B6ZA 4YRHA 3GYAA 2Q7BA 4CAFA 3NE8A 3EO4A 1S7FA 4NGSA 4U9ZA 2ZOGA 1Z8LA 2B4DB 4B5PB 4OC2A 5K8NA 1Z8XA 1WK4A 2PJ1A 5A28A 3B2YA 2Z3MA 1MJ9A 2PJ4A 2VI7A 4UEFA 5J1QA 4MCRA 4PSWA 1PCAA 1NMTA 2G0BA 5AG7A 1XOVA 3S6GA 3PBBA 4R3LA 1VIXA 3EFAA 3IEHA 4E2AA 3GY9A 5AG6A 3TO6A 2ZEMA 1X10A 2QJ8A 1IYKA 1JWQA 2FSRA 3D4UA 1ZG7A 1F2PA 2PJCA 4X5KA 1YSJA 3W91A 5I4MA 1UFHA 3KQZA 1Q7LA 3PBEA 5EBVA 4PK3A 4M6GA 4A37A 3K2KA 4R76A 4BD9A 3VARA 5IB9A 2O53A 2OU2A 1VKCA 2JEWA 2PE3A 4GS4A 4KOUA 8CPAA 3PEIA 1Z8WA 1BPMA 1KUVA 1QSMA 2AE6A 2B4DA 2WUUA 1QSRA 4H2KA 4KOWA 4LUAA 1BLLE 5F48A 4A38A 5KTAA 4MHNA 3B7IA 3RZAA 2DPTA 3D2PA 2IQ6A 4UIBA 1XE4A 2CIJA 4MHPA 4UCNA 4CYQA 3H8FA 1FNOA 3VATA 4CPAA 1YVKA 4QB9A 2ZXVA 4OC5A 4ZYQA 2P6GA 2JBJA 4YGOA 3LWUA 3IU1A 3D2MA 4FUUA 4AVCA 4MRIA 5JQ4A 3OWCA 5LYFA 3FVLA 4QUSA 4YWYA 4NJQA 2BEIA 4CGNA 1MK4A 4KVME 3DNSA 2QVPA 2AFZA 2P6EA 4HNWB 2V8VA 3CXSA 4FBEA 4M6HA 5G21A 3WC5A 4FD6A 1RO5A 2B4BA 1BOBA 1R57A 3DGVA 5AG5A 1KZFA 2IJZA 4AVBA 2CTBA 4XPKA 4A94A 4ZX8A 1H8LA 2D4PA 3N7ZA 3LD2A 1JQGA 4MFLA 1LAPA 3F0AA 1B87A 2VBQA 3D68A 4JD6A 1ZG9A 3D7HA 1TXRA 3RNZA 1WWZA 3IFEA 2R8VA 4ZI6A 3R9FA 3DSBA 4JZ0A 3R9EA 1QSNA 2ZEPA 4P4FA 1ZLIA 3SJGA 4KVOE 1K4JA 4FD5A 2B58A 2ZW6A 3FF3A 1HEEA 4XNHB 5HXDA 4RS2A 1HDUA 4B11A 1Q2YA 3D67A 4BBHA 3HLPA 3CT9A 4MFKA 1YW4A 2G3TA 3SJEA 3G8WA 1NSAA 3C26A 1XBUA 3B3TA 2RC4A 2PDOA 4R6TA 3KQXA 1ZG8A 4R57A 2C27A 4XNHC 1UWYA 4KUAA 2Q44A 4CS0B 2RFHA 1ELMP 2RB7A 4OIWA 4UEZA 2XEIA 2Z0ZA 1J4JA 3CXPA 4MBUA 3TTHA 2WPXA 3IU2A 4A95A 4Q38A 3FMCA 1R43A 3F5BA 4QC6A 4EVYA 2PVVA 2B3UA 3B3CA 4G1PA 1A2ZA 2YNCA 2GFQA 3QB8A 1M1DA 3GKRA 2ZENA 4MFZA 2BO9A 4IF5A 1Q2DA 2CNSA
chains in the Genus database with same CATH topology
2HC9A 2Q7SA 4M6HA 4RN7A 1JWQA 2ODFA 3QAYA 4EFDA 3CZXA 5EMIA 4BINA 1XOVA 4M6IA 4M6GA 2HB6A 3NE8A 4LQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7S A;  4RN7 A;  4M6H A;  1JWQ A;  2ODF A;  3QAY A;  3CZX A;  5EMI A;  4BIN A;  1XOV A;  4M6I A;  4M6G A;  3NE8 A;  4LQ6 A; 
#chains in the Genus database with same CATH topology
 1LFW A;  4UFX A;  4F0Y A;  3E0K A;  4FD7 A;  5AGE A;  2ZEO A;  2X7B A;  1LOK A;  3KR5 A;  4WWV A;  1I12 A;  4Q7A A;  2P6F A;  2GLF A;  2Z3O A;  1YRE A;  4NGN A;  4CGL A;  2I00 A;  3BJ7 A;  4CAE A;  3IWE A;  3KHX A;  3KGQ A;  5F49 A;  5CBM A;  4P44 A;  5THW A;  3CPA A;  4KOY A;  1KUX A;  4ZY2 A;  1ARL A;  3V8I A;  1Y0Y A;  3I9S A;  2FCK A;  2QEC A;  2ZPA A;  1ON0 A;  4JJX A;  4OME A;  4XPD B;  4AVA A;  5K8M A;  3DR8 A;  1Z2L A;  3NFZ A;  5HVF A;  2ZW7 A;  3DLJ A;  4NGP A;  3V38 A;  1M44 A;  2C6C A;  4OKO A;  2PJ2 A;  3JUW A;  2Q04 A;  4P10 A;  4II9 A;  4EME A;  3SI0 A;  4FAI A;  5ISV A;  2Z11 A;  3RYO A;  1IGB A;  2J8N A;  3B3S A;  4KZT A;  4XPD C;  2REE A;  3CPX A;  4CGP A;  2VZY A;  2OOT A;  5LRK A;  3D3S A;  4UBR A;  5KTD A;  1S7N A;  1TF9 A;  4IHM A;  4L89 A;  1Z4E A;  2GLJ A;  3CZX A;  4MCQ A;  1IU8 A;  1XMT A;  2C1C A;  2AJ6 A;  5HMN A;  1QSO A;  2IL4 A;  2OB0 A;  1CPX A;  1R3N A;  2REF A;  3QAH A;  3FH4 A;  2J8M A;  2PRB A;  3FED A;  4TNU A;  4Y49 B;  2GAN A;  5LRJ A;  4F9V A;  3WC6 A;  4LQG A;  1VHO A;  1CPS A;  3BI0 A;  1XIX A;  4MFP A;  4UWI A;  4OC4 A;  1Z8T A;  2PJ8 A;  4JXQ A;  1SQH A;  1ZLH A;  2CY2 A;  5H84 A;  4RN7 A;  2VQY A;  2C6P A;  4UF4 A;  3I3G A;  1P4N A;  1Y0R A;  1OBR A;  1YK3 A;  4KOX A;  5DWN A;  2NYQ A;  4Y49 C;  4A32 A;  4F0X A;  5J8F A;  4AG9 A;  2HUZ A;  3PZJ A;  4MCS A;  5I0C A;  3NA6 A;  5EC4 A;  1YW6 A;  2BUE A;  2PJ0 A;  2PVW A;  4UA3 A;  4NEX A;  1VHE A;  2XEG A;  3T9Y A;  3TCV A;  2YNC C;  1BPN A;  1PUA A;  3EC4 A;  4H6U A;  4U9Y A;  4CAX A;  4B5O A;  3BHX A;  4B10 A;  2JLM A;  1YME A;  4MFQ A;  1P0H A;  1BAV A;  2ARH A;  2JDD A;  5F47 A;  2R98 A;  1IYL A;  2Z3P A;  3KL9 A;  4CAV A;  4ORF A;  1VGY A;  4WJB A;  1U6M A;  4GXH A;  2Q4Z A;  2PC1 A;  1Y9W A;  2OZG A;  1I1D A;  1I21 A;  1ZO0 A;  1M4L A;  2Q43 A;  3FBU A;  3SXO A;  3IIB A;  4UEE A;  1YR0 A;  3D8P A;  4ZBG A;  3B35 A;  3GB0 A;  4KVX A;  4NSQ A;  5H86 A;  2FIW A;  1CM0 A;  3S6F A;  1OZP A;  4GM5 A;  2YNE A;  4OLL A;  2GU2 A;  2HV2 A;  2AFM A;  3CDX A;  1IY7 A;  2FE7 A;  2B3V A;  2OZH A;  3KKW A;  4MFJ A;  4C2Y A;  3ISZ A;  1HDQ A;  4CGO A;  1S60 A;  3LMS A;  2B5G A;  4MHZ A;  4ZGY B;  1F57 A;  1LAN A;  3W6X A;  5IX3 A;  4AG7 A;  2AFS A;  1IOI A;  3MRU A;  4C2X A;  2KCW A;  2R7H A;  2FXF A;  4A30 A;  6CPA A;  5HVG A;  2NSM A;  4I49 A;  2HQY A;  2FL4 A;  1XF8 A;  2Q51 A;  5JM6 A;  3IJ3 A;  2JDC A;  3UY5 A;  3N5F A;  4ZY0 A;  4M3S A;  4X3R A;  3GIU A;  4JLY A;  4PPZ A;  4UFW A;  5E96 A;  2IMO A;  4OP4 A;  4NGM A;  1TIQ A;  3P2H A;  1Z5R A;  3KHZ A;  4R87 A;  4L8A A;  1S7L A;  2CTC A;  4MI4 A;  3P2F A;  4F8Z A;  3MN8 A;  3ZZI A;  4PV6 A;  2FS5 A;  4EFD A;  5C88 A;  2OH1 A;  3DDD A;  4NJR A;  5LYI A;  4DNC A;  3PB4 X;  4U5Y A;  5IV0 A;  1FY7 A;  4NFR A;  3H4Q A;  1TKF A;  3JRU A;  5LRG A;  5IB0 A;  4PXE A;  1EE3 P;  1MJA A;  3R95 A;  1DE4 C;  1YVO A;  4KUB A;  2DPS A;  2V8D A;  4BIN A;  2PRQ A;  2O28 A;  4FWU A;  1L0C A;  3S6K A;  4B5P A;  3ZJ0 A;  5D29 A;  4A33 A;  4UFV A;  2WYR A;  2EK9 A;  2ZEF A;  3W6S A;  4MCP A;  3WR7 A;  4B12 A;  1LAM A;  1M4I A;  5LYD A;  4P4D A;  2PIY A;  4K3N A;  3IC1 A;  1Y9K A;  3QNV A;  4R3K A;  4XPL A;  4OID A;  3TFY A;  1XJO A;  1TKJ A;  4IUS A;  2I79 A;  1QST A;  4JXR A;  1TKH A;  4C68 A;  3SJX A;  4A39 A;  2PJ6 A;  1Y7R A;  1AYE A;  3IGR A;  3K9U A;  1BO4 A;  3FB3 A;  3GUX A;  2ZEG A;  4NGR A;  3G3S A;  2Q4V A;  5J8C A;  3PB9 X;  2Y0M A;  3DR6 A;  1CP6 A;  3PRT A;  1YGH A;  4MHD A;  2HB6 A;  4PQA A;  4Q36 A;  3TOA A;  3BLN A;  4RUH A;  1VHS A;  2Z3K A;  2C6G A;  3R96 A;  4PXB A;  2ZW4 A;  2AFU A;  2NMT A;  5K8P A;  2POK A;  3NH5 A;  3D7G A;  2WZN A;  3BXM A;  1QMU A;  2DEA A;  3FNC A;  3TOB A;  5AG4 A;  3GLJ A;  3IWW A;  3KR4 A;  3PB8 X;  3D7D A;  1S7K A;  3KAS A;  4AB7 A;  2ZOF A;  4ZY1 A;  1Y7E A;  2AFX A;  2ODF A;  2OR4 A;  2FT0 A;  2ZEL A;  4HNX B;  4RI1 A;  2Z10 A;  4HPS A;  1AUG A;  4R7M A;  5ELY A;  4OAD A;  4M85 A;  2ANP A;  2G3A A;  5HH1 A;  3B3V A;  4C7I A;  5C82 A;  4LX9 A;  1CP7 A;  2A4N A;  1XEB A;  5G20 A;  1YQE A;  2YND A;  3A9L A;  4P45 A;  4CRY B;  3TT2 A;  1M4G A;  3FX6 A;  2VL1 A;  2XEJ A;  3D7F A;  4KLV A;  4OC3 A;  2PJ9 A;  3JTK A;  3EXN A;  4CYP A;  2AFO A;  3FIX A;  4B13 A;  2EO8 A;  3PGP A;  4R8F A;  3S9M A;  2Q4Y A;  3KZW A;  3KI9 A;  2EWB A;  4EWT A;  3TO9 A;  3PFO A;  1XMB A;  1X12 A;  2D4O A;  1M4D A;  3FYN A;  2PJ3 A;  2V77 A;  3PB7 X;  4CYO A;  3RO0 A;  2F7V A;  1XFO A;  3K9T A;  5F46 A;  3NH8 A;  3ISX A;  4ONW A;  4OAE A;  2GIV A;  4KSF A;  4X8I A;  1IB1 E;  2Q7S A;  4P4J A;  1CX8 A;  4R9M A;  2PJB A;  4UWJ A;  1Q2C A;  3FEE A;  4HNY B;  4YU9 A;  4NF1 A;  4JYW A;  4BMH A;  3FRM A;  1N71 A;  1IID A;  1LCP A;  2V8G A;  2ZW5 A;  2ZED A;  4KSA A;  4C2Z A;  3S9L A;  4MY3 A;  2EVN A;  3H8G A;  4MHY A;  2F5I A;  3WAB A;  1KUY A;  4KOR A;  1S3Z A;  4A2Z A;  3B8G A;  4MXU A;  4P4E A;  5G1Z A;  2J8R A;  3MGD A;  3LOD A;  3F8K A;  1AMP A;  4DYO A;  1FT7 A;  5DWM A;  4OC0 A;  1GYT A;  1MJB A;  5BWA B;  2PSW A;  5KTC A;  5LYL A;  3IWG A;  1V0C A;  2VZZ A;  3HUV A;  4A31 A;  4DUK A;  3TE4 A;  2XEF A;  2CNM A;  2ZEH A;  4X2T A;  5CNP A;  1ARM A;  3RBU A;  3VH9 A;  2BSW A;  3S9N A;  4UCP A;  3T90 A;  2GE3 A;  2WPW A;  4FD4 A;  4QVT A;  4NGT A;  3PFE A;  3S6H A;  3BI1 A;  3JVN A;  3L2N A;  4PSX A;  4J3G A;  5GCN A;  2PCU A;  1QQ9 A;  2Q0Y A;  4P4I A;  2OZU A;  4H89 A;  3PP9 A;  4PXD A;  2PJA A;  3SHP A;  3RAM A;  2EUI A;  3QAY A;  4NCZ A;  3SJF A;  2J9A A;  2PJ7 A;  5JH9 A;  2V8H A;  2JEV A;  3LAC A;  4M6I A;  3H5Z A;  4ONU A;  4C7H A;  4KOT A;  4JWP A;  3R9G A;  2FIA A;  1Z4R A;  4IK2 A;  2PQ8 A;  4MJ8 A;  5EMI A;  4CGM A;  1XRY A;  4KOS A;  2VXK A;  4PXC A;  5JGF A;  4KOV A;  5DS0 A;  2AFW A;  3PB6 X;  4CAW A;  1LRZ A;  2QYV A;  4PK2 A;  5JPH A;  5HVH A;  1TF8 A;  2R1I A;  1KWM A;  2QML A;  2WSA A;  3CXQ A;  3FJU A;  2BOA A;  3FXT A;  2CNT A;  4YFJ A;  1PYT B;  4KSI A;  4Z65 A;  2O4H A;  3TC8 A;  3B3W A;  2ATR A;  2CXA A;  4UIA A;  5D8N A;  4B14 A;  4LQ6 A;  1IOF A;  4OC1 A;  5G22 A;  4NXY A;  3BJ8 A;  2G9D A;  4MY0 A;  2K5T A;  1S5K A;  2EK8 A;  3EY5 A;  2PJ5 A;  3FEC A;  2BL1 A;  3I1U A;  2DXQ A;  5CPA A;  2PR8 A;  1YX0 A;  2B5G B;  2H5M A;  4KLW A;  4CYN A;  1Z9U A;  2ABZ A;  3TX8 A;  4E0A A;  2GRE A;  1RXT A;  3TO7 A;  3VWE A;  1YLO A;  4HKF A;  3SI1 A;  4IAV A;  2JBK A;  4CRZ B;  2CF4 A;  4KS9 A;  2P0W A;  3R1K A;  3H8E A;  3NE7 A;  4P6Y A;  4H6Z A;  3SI2 A;  4TWE A;  1CJW A;  1NE9 A;  1F2O A;  2F8H A;  3T8W A;  2DF5 A;  1B6B A;  2Z3L A;  3WC7 A;  5K8O A;  3SXN A;  2ZEE A;  3D66 A;  4MMO A;  4AXV A;  2BCO A;  1ELL P;  2EBJ A;  4ZX9 A;  2FVG A;  2QIR A;  4O23 A;  5A27 A;  2I3C A;  3V7Z A;  1DTD A;  2PIZ A;  4F6A A;  1CBX A;  4UCM A;  3VWD A;  4NGQ A;  2HC9 A;  1PU9 A;  3IO1 A;  2PR1 A;  5F09 A;  1GHE A;  4P4B A;  1IIC A;  2VEZ A;  1YLE A;  4W9Y A;  4QBJ A;  2YGW A;  4E8O A;  3NH4 A;  1NSL A;  1RTQ A;  4F9U A;  2Z3N A;  4K30 A;  1CG2 A;  3WT4 A;  4DJL A;  5FVJ A;  7CPA A;  4B6Z A;  4YRH A;  3GYA A;  2Q7B A;  4CAF A;  3NE8 A;  3EO4 A;  1S7F A;  4NGS A;  4U9Z A;  2ZOG A;  1Z8L A;  2B4D B;  4B5P B;  4OC2 A;  5K8N A;  1Z8X A;  1WK4 A;  2PJ1 A;  5A28 A;  3B2Y A;  2Z3M A;  1MJ9 A;  2PJ4 A;  2VI7 A;  4UEF A;  5J1Q A;  4MCR A;  4PSW A;  1PCA A;  1NMT A;  2G0B A;  5AG7 A;  1XOV A;  3S6G A;  3PBB A;  4R3L A;  1VIX A;  3EFA A;  3IEH A;  4E2A A;  3GY9 A;  5AG6 A;  3TO6 A;  2ZEM A;  1X10 A;  2QJ8 A;  1IYK A;  1JWQ A;  2FSR A;  3D4U A;  1ZG7 A;  1F2P A;  2PJC A;  4X5K A;  1YSJ A;  3W91 A;  5I4M A;  1UFH A;  3KQZ A;  1Q7L A;  3PBE A;  5EBV A;  4PK3 A;  4M6G A;  4A37 A;  3K2K A;  4R76 A;  4BD9 A;  3VAR A;  5IB9 A;  2O53 A;  2OU2 A;  1VKC A;  2JEW A;  2PE3 A;  4GS4 A;  4KOU A;  8CPA A;  3PEI A;  1Z8W A;  1BPM A;  1KUV A;  1QSM A;  2AE6 A;  2B4D A;  2WUU A;  1QSR A;  4H2K A;  4KOW A;  4LUA A;  1BLL E;  5F48 A;  4A38 A;  5KTA A;  4MHN A;  3B7I A;  3RZA A;  2DPT A;  3D2P A;  2IQ6 A;  4UIB A;  1XE4 A;  2CIJ A;  4MHP A;  4UCN A;  4CYQ A;  3H8F A;  1FNO A;  3VAT A;  4CPA A;  1YVK A;  4QB9 A;  2ZXV A;  4OC5 A;  4ZYQ A;  2P6G A;  2JBJ A;  4YGO A;  3LWU A;  3IU1 A;  3D2M A;  4FUU A;  4AVC A;  4MRI A;  5JQ4 A;  3OWC A;  5LYF A;  3FVL A;  4QUS A;  4YWY A;  4NJQ A;  2BEI A;  4CGN A;  1MK4 A;  4KVM E;  3DNS A;  2QVP A;  2AFZ A;  2P6E A;  4HNW B;  2V8V A;  3CXS A;  4FBE A;  4M6H A;  5G21 A;  3WC5 A;  4FD6 A;  1RO5 A;  2B4B A;  1BOB A;  1R57 A;  3DGV A;  5AG5 A;  1KZF A;  2IJZ A;  4AVB A;  2CTB A;  4XPK A;  4A94 A;  4ZX8 A;  1H8L A;  2D4P A;  3N7Z A;  3LD2 A;  1JQG A;  4MFL A;  1LAP A;  3F0A A;  1B87 A;  2VBQ A;  3D68 A;  4JD6 A;  1ZG9 A;  3D7H A;  1TXR A;  3RNZ A;  1WWZ A;  3IFE A;  2R8V A;  4ZI6 A;  3R9F A;  3DSB A;  4JZ0 A;  3R9E A;  1QSN A;  2ZEP A;  4P4F A;  1ZLI A;  3SJG A;  4KVO E;  1K4J A;  4FD5 A;  2B58 A;  2ZW6 A;  3FF3 A;  1HEE A;  4XNH B;  5HXD A;  4RS2 A;  1HDU A;  4B11 A;  1Q2Y A;  3D67 A;  4BBH A;  3HLP A;  3CT9 A;  4MFK A;  1YW4 A;  2G3T A;  3SJE A;  3G8W A;  1NSA A;  3C26 A;  1XBU A;  3B3T A;  2RC4 A;  2PDO A;  4R6T A;  3KQX A;  1ZG8 A;  4R57 A;  2C27 A;  4XNH C;  1UWY A;  4KUA A;  2Q44 A;  4CS0 B;  2RFH A;  1ELM P;  2RB7 A;  4OIW A;  4UEZ A;  2XEI A;  2Z0Z A;  1J4J A;  3CXP A;  4MBU A;  3TTH A;  2WPX A;  3IU2 A;  4A95 A;  4Q38 A;  3FMC A;  1R43 A;  3F5B A;  4QC6 A;  4EVY A;  2PVV A;  2B3U A;  3B3C A;  4G1P A;  1A2Z A;  2YNC A;  2GFQ A;  3QB8 A;  1M1D A;  3GKR A;  2ZEN A;  4MFZ A;  2BO9 A;  4IF5 A;  1Q2D A;  2CNS A; 
#chains in the Genus database with same CATH homology
 2HC9 A;  2Q7S A;  4M6H A;  4RN7 A;  1JWQ A;  2ODF A;  3QAY A;  4EFD A;  3CZX A;  5EMI A;  4BIN A;  1XOV A;  4M6I A;  4M6G A;  2HB6 A;  3NE8 A;  4LQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...