3QAYA

Catalytic domain of cd27l endolysin targeting clostridia difficile
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
180
structure length
180
Chain Sequence
HMKICITVGHSILKSGACTSADGVVNEYQYNKSLAPVLADTFRKEGHKVDVIICPEKQFKTKNEEKSYKIPRVNSGGYDLLIELHLNASNGQGKGSEVLYYSNKGLEYATRICDKLGTVFKNRGAKLDKRLYILNSSKPTAVLIESFFCDNKEDYDKAKKLGHEGIAKLIVEGVLNKNIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Endolysin
publication title Structure-based modification of a Clostridium difficile-targeting endolysin affects activity and host range.
pubmed doi rcsb
source organism Clostridium phage phicd27
total genus 72
structure length 180
sequence length 180
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 3qayA00
4RN7A 4M6IA 4BINA 3NE8A 2ODFA 1XOVA 3QAYA 5EMIA 4LQ6A 4M6HA 2Q7SA 1JWQA 4M6GA 3CZXA
chains in the Genus database with same CATH superfamily
1S7FA 2ARHA 4H89A 1ARMA 4JXRA 2ZW7A 1LOKA 1ZG7A 2Q4YA 2B58A 4JWPA 3MGDA 5G22A 5K8MA 3RNZA 1Y7EA 3GY9A 3DLJA 4BD9A 2Q4ZA 4NEXA 3TT2A 1XFOA 2AFMA 1P0HA 2ATRA 1Z4RA 1YSJA 1Y9WA 2V77A 2DPTA 1TIQA 2REEA 1Y0YA 4NGQA 3PGPA 4PV6A 4R87A 5A27A 1N71A 4UEZA 1S3ZA 2NSMA 2J8NA 2QJ8A 3SJFA 4AB7A 1CJWA 3NFZA 3ZZIA 2R7HA 4LX9A 4MHYA 3V38A 1S5KA 4MFJA 1Z2LA 4Q36A 4X8IA 3D2MA 1BOBA 3KGQA 3P2HA 1ELLP 4AVBA 1OBRA 3PB8X 3PFOA 4HNXB 3PP9A 1GHEA 4M6GA 4A95A 4KOXA 4RN7A 2ZXVA 3NH8A 1V0CA 3BXMA 4CYQA 2GIVA 1F2OA 2Y0MA 3D2PA 4NGRA 2VXKA 4H2KA 4P44A 4ZYQA 2ZW4A 4II9A 4F9VA 2RB7A 4ZY0A 2Z3OA 2G9DA 3IWGA 3FB3A 4B10A 1Y0RA 1DTDA 1QSNA 2EO8A 2ODFA 4YRHA 3GB0A 4PK2A 2JBKA 4CGOA 1NMTA 2JLMA 4MI4A 4WJBA 3IWEA 2GU2A 3GIUA 2Q44A 5H84A 5ISVA 5EC4A 1J4JA 4OC2A 4B12A 4E0AA 4TNUA 4A38A 2REFA 3B3TA 4R6TA 4X3RA 3VATA 4NGSA 2XEJA 3FECA 5AG7A 2IMOA 4CGNA 2GLJA 3FMCA 4CAXA 3S6GA 1IICA 5JGFA 2PE3A 5IB9A 2R98A 4DNCA 1IYKA 1M4GA 4CAEA 4YFJA 4PXCA 1Z8XA 2JDCA 3D7FA 1R3NA 2B4DA 4KUAA 3B35A 4UEFA 2PJ6A 4R7MA 4RS2A 3DR6A 5D8NA 1TKHA 1CP7A 1S60A 2Z3NA 3I9SA 4IUSA 4MHPA 4NF1A 2VQYA 3VWEA 3WC5A 5F46A 4MY3A 2JDDA 1Q2YA 3HLPA 1IYLA 2QYVA 4G1PA 3SXNA 4YWYA 2X7BA 1AMPA 5AG4A 2R8VA 3KI9A 3PB7X 5LRGA 5LYIA 3D68A 4QBJA 1Y7RA 2PR1A 3PZJA 1KWMA 4PK3A 2PIYA 3TO9A 4MCSA 3KKWA 3FVLA 5C82A 3KR4A 4P4FA 3G3SA 1QSRA 1YQEA 4X2TA 2FSRA 4PXBA 4GXHA 1CM0A 4HNYB 4OKOA 4CAVA 1LRZA 2P6FA 1VHOA 4FBEA 5LYLA 4R3KA 2GANA 2RC4A 2AFUA 4MY0A 3S6KA 1FT7A 4EMEA 4B6ZA 4UWJA 4ORFA 2J8RA 5F48A 2Z10A 2PRQA 2D4PA 2Q7BA 1KUXA 2PJ5A 1AYEA 1XBUA 1QSOA 1XOVA 2PJ9A 1CG2A 2I79A 3JVNA 4OC3A 5CPAA 3TCVA 1YLOA 1JWQA 1HDUA 1Z5RA 3D3SA 4E8OA 3H8FA 1TKFA 3LODA 4PQAA 3TOBA 2PJBA 5I4MA 1BO4A 1DE4C 1VKCA 4TWEA 3JUWA 1YK3A 2IJZA 4OLLA 4BINA 2Z11A 1XF8A 1VHSA 4MHZA 4MFKA 4UBRA 1IOIA 4KORA 2P6EA 2Q04A 4R9MA 3QAHA 2BEIA 3RBUA 3FYNA 4UIBA 2PQ8A 2OOTA 2ZOGA 4KLVA 3KHXA 2JBJA 2V8VA 3FEDA 3RAMA 4LQ6A 4UA3A 1X12A 2DPSA 4NGNA 4QVTA 5E96A 3IFEA 2PDOA 1YGHA 2VEZA 4I49A 2G3TA 1S7LA 2PJCA 3LMSA 4MBUA 3CT9A 1IIDA 1Z8WA 3L2NA 1HDQA 3CDXA 3D7DA 4Y49B 4DUKA 2DEAA 2ABZA 2BOAA 1F2PA 2ZEEA 2POKA 4JXQA 4FD5A 6CPAA 3ISZA 1FNOA 1PUAA 1WK4A 2EK9A 1F57A 1MJBA 5D29A 5DS0A 4NXYA 4AG9A 3LD2A 1XIXA 2O53A 2V8HA 1YMEA 5K8PA 1TKJA 2IL4A 3IO1A 4MFPA 3WABA 5BWAB 4K3NA 4DJLA 1LCPA 2OB0A 2XEFA 3FJUA 2H5MA 2ZEMA 1AUGA 3H5ZA 1Q2DA 4A32A 4F0YA 5IB0A 4MHNA 3D8PA 2CY2A 3KR5A 2P6GA 4M85A 3LWUA 3PFEA 2D4OA 4XPDB 4CYNA 8CPAA 1WWZA 2CNMA 5J8CA 2PC1A 3K9TA 5A28A 1M44A 4ONUA 1KUYA 3F8KA 3CXQA 3ISXA 2K5TA 4A2ZA 4KS9A 1Z8TA 2PSWA 4OC4A 1CPSA 3UY5A 1IOFA 3CZXA 1ZG9A 1M4DA 2HQYA 2PR8A 1NE9A 4L8AA 1XRYA 3B3CA 3IGRA 2ZW5A 1CBXA 3IEHA 5EBVA 4ZX8A 3KL9A 4CAFA 4UCNA 4F6AA 2VL1A 4KUBA 4PSXA 2VBQA 5HVHA 2WUUA 2BSWA 4MFQA 1P4NA 3EFAA 2EUIA 1ZLHA 4XNHB 3F5BA 2WPWA 1RTQA 2Q43A 3VH9A 2O28A 3KQZA 4AG7A 1VHEA 4UCMA 4UEEA 5ELYA 3T90A 1R43A 2BO9A 3NE8A 2AFOA 3K9UA 5I0CA 4F9UA 2JEVA 2F7VA 4KSIA 5H86A 3D7GA 2OU2A 2GLFA 3R1KA 4AVAA 4C2ZA 2B3VA 5KTCA 3H8EA 3A9LA 4P4EA 4A39A 2PJ7A 4CAWA 2Z3MA 2ZEHA 3FRMA 3B8GA 3K2KA 4UFVA 4B5PB 4FAIA 1YR0A 1IGBA 3R9GA 3QAYA 3GLJA 4OP4A 4BBHA 4R57A 4C2XA 3PBBA 2YNDA 1UWYA 4E2AA 2HUZA 5F49A 3NE7A 5G1ZA 5KTDA 1VIXA 2O4HA 3B2YA 2DF5A 3TX8A 2YGWA 2ZOFA 4KSFA 5F47A 3R96A 4P4BA 4KSAA 2PJ4A 2YNCA 4PSWA 2DXQA 1TF8A 3WC7A 4OMEA 1QSTA 4KOUA 3S6HA 1OZPA 1M1DA 2AJ6A 1I12A 2XEGA 3IC1A 2ANPA 4BMHA 2J9AA 3T8WA 3D66A 4ZBGA 3NA6A 4PXEA 2CF4A 3SI0A 5LRKA 4IF5A 2C6PA 4MJ8A 1YLEA 4KVME 5LYDA 5C88A 3H4QA 4JYWA 1IB1E 5AG6A 3OWCA 4M6IA 1Y9KA 4PXDA 3SI1A 3BHXA 2F5IA 1LFWA 1M4IA 3W6SA 4IK2A 2AFXA 5K8OA 1Z4EA 2BUEA 1S7NA 3PB9X 3PEIA 2BL1A 1NSLA 3FIXA 1A2ZA 5J8FA 3BJ7A 5DWMA 3F0AA 4OC1A 5THWA 3R95A 1PYTB 4KOVA 4ZY1A 4KLWA 4PPZA 4FUUA 3EO4A 5HVGA 5GCNA 3WR7A 3IU2A 2ZEOA 3KASA 4U9YA 2Z0ZA 4NCZA 5HH1A 4AXVA 1I1DA 3D7HA 4M3SA 3WT4A 1QSMA 4M6HA 4B5OA 3R9FA 5AG5A 2V8DA 1CX8A 2RFHA 1X10A 1EE3P 2PVWA 4IAVA 4NGMA 4U9ZA 5CNPA 4EVYA 2ZPAA 1ZG8A 4YU9A 5JM6A 5G20A 1LAPA 3IWWA 4HKFA 3V8IA 3BJ8A 2C27A 4P45A 2EK8A 7CPAA 3MN8A 3N5FA 2KCWA 3KZWA 5KTAA 3BI0A 4OADA 3TO6A 4NJQA 4DYOA 4LUAA 2OZGA 1PU9A 1TF9A 1ON0A 2GE3A 3SI2A 4A31A 2Q0YA 5JQ4A 1YW4A 2QVPA 3E0KA 5FVJA 3SJGA 4CRYB 3I1UA 1CPXA 1VGYA 2B5GB 1ZO0A 2B4BA 2NYQA 2VI7A 1B6BA 3BI1A 3IIBA 5EMIA 5CBMA 4P4IA 4CYPA 4W9YA 2FXFA 3G8WA 4FWUA 1MJ9A 2HC9A 3SJEA 3ZJ0A 2ZELA 2QMLA 3HUVA 1SQHA 2CNTA 2HV2A 2ZEFA 4MCRA 3B3WA 2P0WA 2WSAA 3EXNA 4FD4A 2G3AA 3TO7A 2PJ2A 2FT0A 5F09A 1ARLA 2F8HA 4MXUA 1GYTA 1MK4A 4RI1A 4J3GA 2CXAA 1UFHA 4CRZB 2VZYA 5J1QA 2NMTA 2OR4A 4GS4A 3CPAA 4UFWA 1RXTA 4MCQA 4KVXA 4OC0A 4YGOA 2GREA 2QIRA 4P6YA 3WC6A 4A94A 3GUXA 3IJ3A 3GYAA 2PJ3A 3R9EA 5IV0A 4MFLA 3PB4X 4Q7AA 4OIDA 2ZEGA 4MCPA 4QB9A 2Z3LA 4CGLA 4CPAA 1Q7LA 4QUSA 2AFWA 4B13A 2WPXA 4K30A 3MRUA 3VARA 4CGMA 3W6XA 4KZTA 1BLLE 1Q2CA 2PJ8A 3CPXA 4FD6A 1HEEA 4C68A 3B3SA 4JLYA 4R76A 4B5PA 4C7IA 4NSQA 3QB8A 4KOWA 3FBUA 3RO0A 1TXRA 2B3UA 2CIJA 2J8MA 4NFRA 4UF4A 2FIWA 1M4LA 2PIZA 4NGTA 4B14A 2IQ6A 3D4UA 4P10A 2Q7SA 1S7KA 2YNCC 4UWIA 2Q51A 4IHMA 2EVNA 3DR8A 4H6UA 1BPNA 3FNCA 4MRIA 3C26A 1YREA 1QQ9A 2I00A 3FH4A 3RZAA 3W91A 4EWTA 3LACA 4O23A 2YNEA 2GFQA 3DGVA 1CP6A 2XEIA 4H6ZA 4JD6A 4MFZA 4XPKA 1Z9UA 2I3CA 4A37A 3DNSA 2C6CA 5AGEA 4JJXA 2PRBA 1B87A 2PJ0A 4L89A 4C7HA 3TC8A 5LYFA 2FE7A 3T9YA 4GM5A 4CS0B 1L0CA 2C6GA 4P4DA 1KZFA 3CXPA 4ZI6A 2R1IA 4ZX9A 1XMBA 3KHZA 1QMUA 4EFDA 4F8ZA 2CNSA 3TE4A 4UIAA 1LAMA 3DDDA 1IU8A 2HB6A 4KOSA 3TTHA 1U6MA 3FXTA 4P4JA 4Z65A 2C1CA 2G0BA 4OIWA 1Z8LA 2Z3PA 2FCKA 3D67A 2JEWA 1BPMA 1LANA 2B4DB 2FL4A 3SXOA 5K8NA 4MMOA 3PBEA 5IX3A 5JH9A 4A33A 4KOTA 4Y49C 4ZY2A 3VWDA 3GKRA 4A30A 4ONWA 3EY5A 2Z3KA 1R57A 4WWVA 3S6FA 4NGPA 4C2YA 4QC6A 1ELMP 1YX0A 4AVCA 2CTCA 4CYOA 3EC4A 2OZUA 4KOYA 4MHDA 3BLNA 4R3LA 2PVVA 3P2FA 2FS5A 3PB6X 1K4JA 2ZW6A 2PJAA 2FVGA 2Q4VA 4UFXA 2VZZA 1YVKA 3V7ZA 3DSBA 2FIAA 3PRTA 3QNVA 4R8FA 1XJOA 1YW6A 2V8GA 4Q38A 1MJAA 3S9NA 2CTBA 2QECA 4U5YA 3B7IA 2ZENA 2BCOA 3I3GA 4HPSA 4JZ0A 4OC5A 5HXDA 4B11A 1FY7A 2AE6A 5HVFA 1NSAA 4NJRA 1PCAA 4FD7A 4X5KA 1XE4A 4XPDC 2PCUA 1ZLIA 3S9LA 2WYRA 1H8LA 4UCPA 3IU1A 1I21A 3FEEA 3JTKA 4LQGA 4ZGYB 2WZNA 2ZEDA 3CXSA 4CGPA 4OAEA 3NH4A 3TFYA 3H8GA 2EWBA 2OH1A 3KQXA 4F0XA 1KUVA 3FX6A 5LRJA 3SHPA 4RUHA 2B5GA 5JPHA 5DWNA 2OZHA 3FF3A 3S9MA 3N7ZA 2A4NA 4XPLA 3RYOA 2PJ1A 5HMNA 2AFZA 1XEBA 2AFSA 2ZEPA 4KVOE 5G21A 1RO5A 1XMTA 3B3VA 1IY7A 3NH5A 1BAVA 4HNWB 3TOAA 2EBJA 1JQGA 3JRUA 3SJXA 1YVOA 4XNHC
chains in the Genus database with same CATH topology
4RN7A 2HB6A 4M6IA 4BINA 2HC9A 3NE8A 2ODFA 1XOVA 3QAYA 5EMIA 4LQ6A 4M6HA 2Q7SA 4EFDA 1JWQA 4M6GA 3CZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RN7 A;  4M6I A;  4BIN A;  3NE8 A;  2ODF A;  1XOV A;  3QAY A;  5EMI A;  4LQ6 A;  4M6H A;  2Q7S A;  1JWQ A;  4M6G A;  3CZX A; 
#chains in the Genus database with same CATH topology
 1S7F A;  2ARH A;  4H89 A;  1ARM A;  4JXR A;  2ZW7 A;  1LOK A;  1ZG7 A;  2Q4Y A;  2B58 A;  4JWP A;  3MGD A;  5G22 A;  5K8M A;  3RNZ A;  1Y7E A;  3GY9 A;  3DLJ A;  4BD9 A;  2Q4Z A;  4NEX A;  3TT2 A;  1XFO A;  2AFM A;  1P0H A;  2ATR A;  1Z4R A;  1YSJ A;  1Y9W A;  2V77 A;  2DPT A;  1TIQ A;  2REE A;  1Y0Y A;  4NGQ A;  3PGP A;  4PV6 A;  4R87 A;  5A27 A;  1N71 A;  4UEZ A;  1S3Z A;  2NSM A;  2J8N A;  2QJ8 A;  3SJF A;  4AB7 A;  1CJW A;  3NFZ A;  3ZZI A;  2R7H A;  4LX9 A;  4MHY A;  3V38 A;  1S5K A;  4MFJ A;  1Z2L A;  4Q36 A;  4X8I A;  3D2M A;  1BOB A;  3KGQ A;  3P2H A;  1ELL P;  4AVB A;  1OBR A;  3PB8 X;  3PFO A;  4HNX B;  3PP9 A;  1GHE A;  4M6G A;  4A95 A;  4KOX A;  4RN7 A;  2ZXV A;  3NH8 A;  1V0C A;  3BXM A;  4CYQ A;  2GIV A;  1F2O A;  2Y0M A;  3D2P A;  4NGR A;  2VXK A;  4H2K A;  4P44 A;  4ZYQ A;  2ZW4 A;  4II9 A;  4F9V A;  2RB7 A;  4ZY0 A;  2Z3O A;  2G9D A;  3IWG A;  3FB3 A;  4B10 A;  1Y0R A;  1DTD A;  1QSN A;  2EO8 A;  2ODF A;  4YRH A;  3GB0 A;  4PK2 A;  2JBK A;  4CGO A;  1NMT A;  2JLM A;  4MI4 A;  4WJB A;  3IWE A;  2GU2 A;  3GIU A;  2Q44 A;  5H84 A;  5ISV A;  5EC4 A;  1J4J A;  4OC2 A;  4B12 A;  4E0A A;  4TNU A;  4A38 A;  2REF A;  3B3T A;  4R6T A;  4X3R A;  3VAT A;  4NGS A;  2XEJ A;  3FEC A;  5AG7 A;  2IMO A;  4CGN A;  2GLJ A;  3FMC A;  4CAX A;  3S6G A;  1IIC A;  5JGF A;  2PE3 A;  5IB9 A;  2R98 A;  4DNC A;  1IYK A;  1M4G A;  4CAE A;  4YFJ A;  4PXC A;  1Z8X A;  2JDC A;  3D7F A;  1R3N A;  2B4D A;  4KUA A;  3B35 A;  4UEF A;  2PJ6 A;  4R7M A;  4RS2 A;  3DR6 A;  5D8N A;  1TKH A;  1CP7 A;  1S60 A;  2Z3N A;  3I9S A;  4IUS A;  4MHP A;  4NF1 A;  2VQY A;  3VWE A;  3WC5 A;  5F46 A;  4MY3 A;  2JDD A;  1Q2Y A;  3HLP A;  1IYL A;  2QYV A;  4G1P A;  3SXN A;  4YWY A;  2X7B A;  1AMP A;  5AG4 A;  2R8V A;  3KI9 A;  3PB7 X;  5LRG A;  5LYI A;  3D68 A;  4QBJ A;  1Y7R A;  2PR1 A;  3PZJ A;  1KWM A;  4PK3 A;  2PIY A;  3TO9 A;  4MCS A;  3KKW A;  3FVL A;  5C82 A;  3KR4 A;  4P4F A;  3G3S A;  1QSR A;  1YQE A;  4X2T A;  2FSR A;  4PXB A;  4GXH A;  1CM0 A;  4HNY B;  4OKO A;  4CAV A;  1LRZ A;  2P6F A;  1VHO A;  4FBE A;  5LYL A;  4R3K A;  2GAN A;  2RC4 A;  2AFU A;  4MY0 A;  3S6K A;  1FT7 A;  4EME A;  4B6Z A;  4UWJ A;  4ORF A;  2J8R A;  5F48 A;  2Z10 A;  2PRQ A;  2D4P A;  2Q7B A;  1KUX A;  2PJ5 A;  1AYE A;  1XBU A;  1QSO A;  1XOV A;  2PJ9 A;  1CG2 A;  2I79 A;  3JVN A;  4OC3 A;  5CPA A;  3TCV A;  1YLO A;  1JWQ A;  1HDU A;  1Z5R A;  3D3S A;  4E8O A;  3H8F A;  1TKF A;  3LOD A;  4PQA A;  3TOB A;  2PJB A;  5I4M A;  1BO4 A;  1DE4 C;  1VKC A;  4TWE A;  3JUW A;  1YK3 A;  2IJZ A;  4OLL A;  4BIN A;  2Z11 A;  1XF8 A;  1VHS A;  4MHZ A;  4MFK A;  4UBR A;  1IOI A;  4KOR A;  2P6E A;  2Q04 A;  4R9M A;  3QAH A;  2BEI A;  3RBU A;  3FYN A;  4UIB A;  2PQ8 A;  2OOT A;  2ZOG A;  4KLV A;  3KHX A;  2JBJ A;  2V8V A;  3FED A;  3RAM A;  4LQ6 A;  4UA3 A;  1X12 A;  2DPS A;  4NGN A;  4QVT A;  5E96 A;  3IFE A;  2PDO A;  1YGH A;  2VEZ A;  4I49 A;  2G3T A;  1S7L A;  2PJC A;  3LMS A;  4MBU A;  3CT9 A;  1IID A;  1Z8W A;  3L2N A;  1HDQ A;  3CDX A;  3D7D A;  4Y49 B;  4DUK A;  2DEA A;  2ABZ A;  2BOA A;  1F2P A;  2ZEE A;  2POK A;  4JXQ A;  4FD5 A;  6CPA A;  3ISZ A;  1FNO A;  1PUA A;  1WK4 A;  2EK9 A;  1F57 A;  1MJB A;  5D29 A;  5DS0 A;  4NXY A;  4AG9 A;  3LD2 A;  1XIX A;  2O53 A;  2V8H A;  1YME A;  5K8P A;  1TKJ A;  2IL4 A;  3IO1 A;  4MFP A;  3WAB A;  5BWA B;  4K3N A;  4DJL A;  1LCP A;  2OB0 A;  2XEF A;  3FJU A;  2H5M A;  2ZEM A;  1AUG A;  3H5Z A;  1Q2D A;  4A32 A;  4F0Y A;  5IB0 A;  4MHN A;  3D8P A;  2CY2 A;  3KR5 A;  2P6G A;  4M85 A;  3LWU A;  3PFE A;  2D4O A;  4XPD B;  4CYN A;  8CPA A;  1WWZ A;  2CNM A;  5J8C A;  2PC1 A;  3K9T A;  5A28 A;  1M44 A;  4ONU A;  1KUY A;  3F8K A;  3CXQ A;  3ISX A;  2K5T A;  4A2Z A;  4KS9 A;  1Z8T A;  2PSW A;  4OC4 A;  1CPS A;  3UY5 A;  1IOF A;  3CZX A;  1ZG9 A;  1M4D A;  2HQY A;  2PR8 A;  1NE9 A;  4L8A A;  1XRY A;  3B3C A;  3IGR A;  2ZW5 A;  1CBX A;  3IEH A;  5EBV A;  4ZX8 A;  3KL9 A;  4CAF A;  4UCN A;  4F6A A;  2VL1 A;  4KUB A;  4PSX A;  2VBQ A;  5HVH A;  2WUU A;  2BSW A;  4MFQ A;  1P4N A;  3EFA A;  2EUI A;  1ZLH A;  4XNH B;  3F5B A;  2WPW A;  1RTQ A;  2Q43 A;  3VH9 A;  2O28 A;  3KQZ A;  4AG7 A;  1VHE A;  4UCM A;  4UEE A;  5ELY A;  3T90 A;  1R43 A;  2BO9 A;  3NE8 A;  2AFO A;  3K9U A;  5I0C A;  4F9U A;  2JEV A;  2F7V A;  4KSI A;  5H86 A;  3D7G A;  2OU2 A;  2GLF A;  3R1K A;  4AVA A;  4C2Z A;  2B3V A;  5KTC A;  3H8E A;  3A9L A;  4P4E A;  4A39 A;  2PJ7 A;  4CAW A;  2Z3M A;  2ZEH A;  3FRM A;  3B8G A;  3K2K A;  4UFV A;  4B5P B;  4FAI A;  1YR0 A;  1IGB A;  3R9G A;  3QAY A;  3GLJ A;  4OP4 A;  4BBH A;  4R57 A;  4C2X A;  3PBB A;  2YND A;  1UWY A;  4E2A A;  2HUZ A;  5F49 A;  3NE7 A;  5G1Z A;  5KTD A;  1VIX A;  2O4H A;  3B2Y A;  2DF5 A;  3TX8 A;  2YGW A;  2ZOF A;  4KSF A;  5F47 A;  3R96 A;  4P4B A;  4KSA A;  2PJ4 A;  2YNC A;  4PSW A;  2DXQ A;  1TF8 A;  3WC7 A;  4OME A;  1QST A;  4KOU A;  3S6H A;  1OZP A;  1M1D A;  2AJ6 A;  1I12 A;  2XEG A;  3IC1 A;  2ANP A;  4BMH A;  2J9A A;  3T8W A;  3D66 A;  4ZBG A;  3NA6 A;  4PXE A;  2CF4 A;  3SI0 A;  5LRK A;  4IF5 A;  2C6P A;  4MJ8 A;  1YLE A;  4KVM E;  5LYD A;  5C88 A;  3H4Q A;  4JYW A;  1IB1 E;  5AG6 A;  3OWC A;  4M6I A;  1Y9K A;  4PXD A;  3SI1 A;  3BHX A;  2F5I A;  1LFW A;  1M4I A;  3W6S A;  4IK2 A;  2AFX A;  5K8O A;  1Z4E A;  2BUE A;  1S7N A;  3PB9 X;  3PEI A;  2BL1 A;  1NSL A;  3FIX A;  1A2Z A;  5J8F A;  3BJ7 A;  5DWM A;  3F0A A;  4OC1 A;  5THW A;  3R95 A;  1PYT B;  4KOV A;  4ZY1 A;  4KLW A;  4PPZ A;  4FUU A;  3EO4 A;  5HVG A;  5GCN A;  3WR7 A;  3IU2 A;  2ZEO A;  3KAS A;  4U9Y A;  2Z0Z A;  4NCZ A;  5HH1 A;  4AXV A;  1I1D A;  3D7H A;  4M3S A;  3WT4 A;  1QSM A;  4M6H A;  4B5O A;  3R9F A;  5AG5 A;  2V8D A;  1CX8 A;  2RFH A;  1X10 A;  1EE3 P;  2PVW A;  4IAV A;  4NGM A;  4U9Z A;  5CNP A;  4EVY A;  2ZPA A;  1ZG8 A;  4YU9 A;  5JM6 A;  5G20 A;  1LAP A;  3IWW A;  4HKF A;  3V8I A;  3BJ8 A;  2C27 A;  4P45 A;  2EK8 A;  7CPA A;  3MN8 A;  3N5F A;  2KCW A;  3KZW A;  5KTA A;  3BI0 A;  4OAD A;  3TO6 A;  4NJQ A;  4DYO A;  4LUA A;  2OZG A;  1PU9 A;  1TF9 A;  1ON0 A;  2GE3 A;  3SI2 A;  4A31 A;  2Q0Y A;  5JQ4 A;  1YW4 A;  2QVP A;  3E0K A;  5FVJ A;  3SJG A;  4CRY B;  3I1U A;  1CPX A;  1VGY A;  2B5G B;  1ZO0 A;  2B4B A;  2NYQ A;  2VI7 A;  1B6B A;  3BI1 A;  3IIB A;  5EMI A;  5CBM A;  4P4I A;  4CYP A;  4W9Y A;  2FXF A;  3G8W A;  4FWU A;  1MJ9 A;  2HC9 A;  3SJE A;  3ZJ0 A;  2ZEL A;  2QML A;  3HUV A;  1SQH A;  2CNT A;  2HV2 A;  2ZEF A;  4MCR A;  3B3W A;  2P0W A;  2WSA A;  3EXN A;  4FD4 A;  2G3A A;  3TO7 A;  2PJ2 A;  2FT0 A;  5F09 A;  1ARL A;  2F8H A;  4MXU A;  1GYT A;  1MK4 A;  4RI1 A;  4J3G A;  2CXA A;  1UFH A;  4CRZ B;  2VZY A;  5J1Q A;  2NMT A;  2OR4 A;  4GS4 A;  3CPA A;  4UFW A;  1RXT A;  4MCQ A;  4KVX A;  4OC0 A;  4YGO A;  2GRE A;  2QIR A;  4P6Y A;  3WC6 A;  4A94 A;  3GUX A;  3IJ3 A;  3GYA A;  2PJ3 A;  3R9E A;  5IV0 A;  4MFL A;  3PB4 X;  4Q7A A;  4OID A;  2ZEG A;  4MCP A;  4QB9 A;  2Z3L A;  4CGL A;  4CPA A;  1Q7L A;  4QUS A;  2AFW A;  4B13 A;  2WPX A;  4K30 A;  3MRU A;  3VAR A;  4CGM A;  3W6X A;  4KZT A;  1BLL E;  1Q2C A;  2PJ8 A;  3CPX A;  4FD6 A;  1HEE A;  4C68 A;  3B3S A;  4JLY A;  4R76 A;  4B5P A;  4C7I A;  4NSQ A;  3QB8 A;  4KOW A;  3FBU A;  3RO0 A;  1TXR A;  2B3U A;  2CIJ A;  2J8M A;  4NFR A;  4UF4 A;  2FIW A;  1M4L A;  2PIZ A;  4NGT A;  4B14 A;  2IQ6 A;  3D4U A;  4P10 A;  2Q7S A;  1S7K A;  2YNC C;  4UWI A;  2Q51 A;  4IHM A;  2EVN A;  3DR8 A;  4H6U A;  1BPN A;  3FNC A;  4MRI A;  3C26 A;  1YRE A;  1QQ9 A;  2I00 A;  3FH4 A;  3RZA A;  3W91 A;  4EWT A;  3LAC A;  4O23 A;  2YNE A;  2GFQ A;  3DGV A;  1CP6 A;  2XEI A;  4H6Z A;  4JD6 A;  4MFZ A;  4XPK A;  1Z9U A;  2I3C A;  4A37 A;  3DNS A;  2C6C A;  5AGE A;  4JJX A;  2PRB A;  1B87 A;  2PJ0 A;  4L89 A;  4C7H A;  3TC8 A;  5LYF A;  2FE7 A;  3T9Y A;  4GM5 A;  4CS0 B;  1L0C A;  2C6G A;  4P4D A;  1KZF A;  3CXP A;  4ZI6 A;  2R1I A;  4ZX9 A;  1XMB A;  3KHZ A;  1QMU A;  4EFD A;  4F8Z A;  2CNS A;  3TE4 A;  4UIA A;  1LAM A;  3DDD A;  1IU8 A;  2HB6 A;  4KOS A;  3TTH A;  1U6M A;  3FXT A;  4P4J A;  4Z65 A;  2C1C A;  2G0B A;  4OIW A;  1Z8L A;  2Z3P A;  2FCK A;  3D67 A;  2JEW A;  1BPM A;  1LAN A;  2B4D B;  2FL4 A;  3SXO A;  5K8N A;  4MMO A;  3PBE A;  5IX3 A;  5JH9 A;  4A33 A;  4KOT A;  4Y49 C;  4ZY2 A;  3VWD A;  3GKR A;  4A30 A;  4ONW A;  3EY5 A;  2Z3K A;  1R57 A;  4WWV A;  3S6F A;  4NGP A;  4C2Y A;  4QC6 A;  1ELM P;  1YX0 A;  4AVC A;  2CTC A;  4CYO A;  3EC4 A;  2OZU A;  4KOY A;  4MHD A;  3BLN A;  4R3L A;  2PVV A;  3P2F A;  2FS5 A;  3PB6 X;  1K4J A;  2ZW6 A;  2PJA A;  2FVG A;  2Q4V A;  4UFX A;  2VZZ A;  1YVK A;  3V7Z A;  3DSB A;  2FIA A;  3PRT A;  3QNV A;  4R8F A;  1XJO A;  1YW6 A;  2V8G A;  4Q38 A;  1MJA A;  3S9N A;  2CTB A;  2QEC A;  4U5Y A;  3B7I A;  2ZEN A;  2BCO A;  3I3G A;  4HPS A;  4JZ0 A;  4OC5 A;  5HXD A;  4B11 A;  1FY7 A;  2AE6 A;  5HVF A;  1NSA A;  4NJR A;  1PCA A;  4FD7 A;  4X5K A;  1XE4 A;  4XPD C;  2PCU A;  1ZLI A;  3S9L A;  2WYR A;  1H8L A;  4UCP A;  3IU1 A;  1I21 A;  3FEE A;  3JTK A;  4LQG A;  4ZGY B;  2WZN A;  2ZED A;  3CXS A;  4CGP A;  4OAE A;  3NH4 A;  3TFY A;  3H8G A;  2EWB A;  2OH1 A;  3KQX A;  4F0X A;  1KUV A;  3FX6 A;  5LRJ A;  3SHP A;  4RUH A;  2B5G A;  5JPH A;  5DWN A;  2OZH A;  3FF3 A;  3S9M A;  3N7Z A;  2A4N A;  4XPL A;  3RYO A;  2PJ1 A;  5HMN A;  2AFZ A;  1XEB A;  2AFS A;  2ZEP A;  4KVO E;  5G21 A;  1RO5 A;  1XMT A;  3B3V A;  1IY7 A;  3NH5 A;  1BAV A;  4HNW B;  3TOA A;  2EBJ A;  1JQG A;  3JRU A;  3SJX A;  1YVO A;  4XNH C; 
#chains in the Genus database with same CATH homology
 4RN7 A;  2HB6 A;  4M6I A;  4BIN A;  2HC9 A;  3NE8 A;  2ODF A;  1XOV A;  3QAY A;  5EMI A;  4LQ6 A;  4M6H A;  2Q7S A;  4EFD A;  1JWQ A;  4M6G A;  3CZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...