3B3CA

Crystal structure of the m180a mutant of the aminopeptidase from vibrio proteolyticus in complex with leucine phosphonic acid
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDATNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title Zinc coordination geometry and ligand binding affinity: the structural and kinetic analysis of the second-shell serine 228 residue and the methionine 180 residue of the aminopeptidase from Vibrio proteolyticus.
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase
total genus 112
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3b3cA00
3GUXA 1GYTA 1PYTB 2ABZA 1VIXA 1LAPA 5CPAA 3NFZA 4OIWA 2NSMA 1Z5RA 2JEWA 2PJ8A 2ZOGA 3D4UA 3KL9A 4NGRA 4X3RA 5D29A 3RBUA 5F09A 4ZX9A 4ZY1A 2V77A 5JH9A 2POKA 2PVVA 4ZX8A 2XEGA 3PB8X 1Z2LA 1F57A 5HVHA 2BCOA 3VATA 4P4EA 4OC2A 1NSAA 2AFWA 2Q51A 1M4LA 4FUUA 2IQ6A 4UIAA 3IIBA 3IFEA 4IHMA 2PCUA 1YLOA 1Y0RA 3BI1A 3FF3A 1RTQA 2ZEDA 1H8LA 4K3NA 4WJBA 4NFRA 3KHZA 7CPAA 1CP6A 4OC1A 4P4BA 4ZYQA 3PBEA 4YU9A 2JBKA 2HB6A 5HXDA 2Q4ZA 4ZY2A 3S9MA 4FBEA 3NA6A 4UF4A 3K2KA 3MRUA 4DJLA 2PJ5A 1ARLA 3SI2A 2V8DA 2PJ2A 4R76A 3NH8A 2DEAA 2ZEMA 1QQ9A 3V38A 2QJ8A 3S9NA 3H8EA 4OP4A 3VH9A 1XFOA 3PBBA 1OBRA 1IGBA 3KR4A 2GREA 5CBMA 4YWYA 2ZEEA 5J1QA 2RFHA 5THWA 1FNOA 3V7ZA 1DE4C 3FECA 2PJAA 3DGVA 4B6ZA 3WABA 2AFZA 2C6CA 5I4MA 3D7GA 3IJ3A 3B3CA 4PXBA 5LRGA 3SJGA 2AFSA 5DS0A 2EWBA 2XEJA 2XEFA 2ZEHA 3KQZA 4GM5A 5K8PA 3D66A 2C6PA 4MHYA 1BPNA 2GU2A 3GB0A 2FVGA 3CPAA 2NYQA 2PE3A 3HLPA 2V8VA 4MHPA 4F8ZA 3CDXA 2AFUA 3B3VA 1Y0YA 2ZELA 1AYEA 1BPMA 1HEEA 1LFWA 1PCAA 4TNUA 4X8IA 4A38A 4MCPA 4BD9A 2OR4A 1VHOA 3KR5A 4PPZA 3FJUA 4NGQA 2PJ3A 4IK2A 1JQGA 5LRKA 4PQAA 3NH5A 3SI0A 2PVWA 3WC7A 4RUHA 4NGMA 4P44A 1LANA 3CT9A 4R8FA 5HVGA 3TX8A 4A39A 1CPSA 3I1UA 1LOKA 3B7IA 4DUKA 4A37A 3FEEA 3ISXA 2ZEFA 1YSJA 2Q43A 5IB9A 1R43A 3B3TA 3PB7X 2PJ0A 2G9DA 3PEIA 3WC6A 3KASA 5LRJA 1TF8A 2F7VA 4NGTA 2ANPA 2QYVA 3GLJA 3D68A 3TC8A 4F9UA 2WYRA 4KSIA 1CX8A 4MCSA 2V8GA 2AFMA 5D8NA 5K8NA 2IMOA 3PB6X 2CTBA 2PJCA 4A94A 4P4FA 3KHXA 1R3NA 4WWVA 3IO1A 5JM6A 1HDUA 4JZ0A 1ZG7A 1VHEA 3BXMA 4X2TA 2O53A 2ZEGA 1BLLE 1VGYA 1Z8LA 4P45A 2J9AA 2QVPA 1ELMP 2PIZA 4LQGA 1ZLIA 3KZWA 4NGPA 4P4JA 2PJ1A 5HVFA 1UWYA 2RB7A 4O23A 3SI1A 4MCQA 3PRTA 3N5FA 2ZEPA 4AXVA 2ZEOA 1ZLHA 4MHZA 4G1PA 1ARMA 2C6GA 4MXUA 1YW4A 4P10A 4Q7AA 3B3SA 2I3CA 1AMPA 2V8HA 2PJBA 5LYLA 1CPXA 1QMUA 3D7HA 5K8OA 4CPAA 3NH4A 2EK9A 4NGNA 2HC9A 4FWUA 2PJ4A 3ISZA 4NGSA 3SJEA 4DYOA 2CTCA 3IC1A 1XBUA 1EE3P 4W9YA 2BOAA 4MMOA 3B35A 2ZOFA 1TKJA 1F2OA 2PJ9A 1CG2A 1FT7A 2CIJA 4EFDA 1HDQA 1YMEA 4OIDA 1BAVA 1CBXA 1DTDA 4FAIA 5ELYA 2PIYA 3KGQA 1YW6A 2O4HA 1F2PA 4ZI6A 3WC5A 3IEHA 2F8HA 1KWMA 1TXRA 3BI0A 3D7FA 5LYIA 2PJ6A 1TKFA 3T8WA 4P4IA 1XJOA 3K9TA 4NJRA 6CPAA 2PJ7A 2EK8A 3CPXA 4OC0A 4MCRA 1ZG8A 2ZENA 4EMEA 2IJZA 3B2YA 3JRUA 3WT4A 1CP7A 3SJFA 3DLJA 3FX6A 3H8GA 4UEZA 3HUVA 4OMEA 3LWUA 2CF4A 2C1CA 3SJXA 3RZAA 3FVLA 1ZG9A 3PFOA 3VARA 4H2KA 2PRQA 3IWWA 4IAVA 4OC4A 1Q7LA 1LAMA 3RAMA 3BHXA 4PXDA 4P6YA 4PXEA 4MRIA 3PB4X 2JBJA 2AFXA 2OOTA 3FMCA 1IY7A 3L2NA 2XEIA 1LCPA 3FH4A 1XMBA 4P4DA 2GLFA 3PB9X 1ELLP 4JYWA 1Y7EA 1TF9A 4UIBA 5JGFA 1TKHA 3FEDA 5LYDA 3D67A 4F9VA 3D7DA 4ZY0A 5LYFA 2BO9A 2GLJA 3QNVA 3H8FA 4UEEA 3MN8A 3LMSA 4Z65A 4MHNA 4OC3A 2WZNA 3B3WA 4PXCA 4TWEA 5K8MA 4ONWA 4OC5A 4R6TA 2VL1A 4OKOA 8CPAA 1XRYA 3KQXA 2AFOA 4NJQA 4UEFA 4R7MA 3PFEA 4EWTA 3S9LA 3KI9A
chains in the Genus database with same CATH superfamily
1RXTA 2Z3PA 3GUXA 1GYTA 1PYTB 2ABZA 1VIXA 3V8IA 1LAPA 5CPAA 3NFZA 4OIWA 2OU2A 2NSMA 3KKWA 1NE9A 2WPXA 1FY7A 4QC6A 1Z5RA 2JEWA 2PJ8A 2ZOGA 3CXPA 3D4UA 1YVOA 3KL9A 4NGRA 3TO6A 4AVAA 4HNWB 4X3RA 4XNHB 5D29A 1VHSA 3RBUA 5F09A 4ZX9A 4F6AA 3F5BA 1X12A 4ZY1A 2V77A 4M85A 5JH9A 2CXAA 2POKA 2FL4A 5KTCA 3CZXA 4Y49B 4CGPA 2PVVA 4ZX8A 2XEGA 3PB8X 1Z2LA 1F57A 5HVHA 2BCOA 4KOVA 3TTHA 3BJ7A 4R3KA 4B5PB 3RO0A 3VATA 1QSTA 4KVOE 2Y0MA 4P4EA 2VXKA 4KUAA 4OC2A 2DPTA 1NSAA 2AFWA 2OZHA 2Q51A 4B11A 1M4LA 2HUZA 4FUUA 4J3GA 4L8AA 2IQ6A 4C2YA 4UIAA 2YNDA 3IIBA 5C82A 3IFEA 4IHMA 4NCZA 3BJ8A 2PCUA 1YLOA 3R1KA 4PK2A 3TE4A 3D2MA 1Y0RA 3BI1A 3FF3A 4HNYB 4L89A 1RTQA 2ZEDA 2RC4A 2ZW5A 1H8LA 1QSNA 4K3NA 4WJBA 4I49A 1M1DA 2GFQA 2Z3KA 3LACA 4NFRA 3KHZA 1R57A 7CPAA 3JTKA 2KCWA 1CP6A 3NE7A 2BL1A 4OC1A 4P4BA 4XPDB 4ZYQA 4QBJA 4CGNA 3PBEA 2G3TA 4U9YA 4YU9A 2DPSA 1QSOA 3S6GA 4AG9A 3IU2A 2G0BA 2JBKA 2HB6A 3TCVA 4CYPA 1A2ZA 5HXDA 2Q4ZA 1ON0A 4ZY2A 4II9A 3A9LA 3S9MA 4FBEA 1WWZA 2FCKA 2Z3MA 3NA6A 4KOTA 4UF4A 3K2KA 4MBUA 3MRUA 4DJLA 1KUYA 2PJ5A 3MGDA 2BEIA 4FD7A 3H5ZA 1ARLA 1IYLA 2QECA 3R9GA 3SI2A 1ZO0A 2V8DA 2FE7A 2PJ2A 1KUXA 2YNCC 4R76A 1I1DA 3F0AA 3NH8A 2DEAA 1CM0A 1XMTA 1Z8TA 4MHDA 2ZEMA 1QQ9A 4CYOA 3V38A 2QJ8A 4LUAA 5F47A 3RYOA 5J8FA 3S9NA 3H8EA 4OP4A 3VH9A 4A38A 5AG7A 1XFOA 3PBBA 2B4DA 3EO4A 1OBRA 4CAVA 4ZBGA 1IGBA 2ZW4A 3KR4A 2GREA 1L0CA 4CYNA 5CBMA 2BUEA 4YWYA 2ZEEA 5J1QA 2PR8A 2RFHA 1P0HA 5THWA 2DXQA 2YGWA 1FNOA 1NSLA 2ZXVA 3V7ZA 5A28A 4RS2A 4KOSA 1Q2DA 2Q7SA 5H84A 1DE4C 3FECA 4AG7A 1Z4EA 2Z3LA 3R96A 2PJAA 4C7HA 3DGVA 4B6ZA 3WABA 5F46A 2AFZA 4KSFA 2C6CA 1BOBA 5I4MA 2EVNA 1JWQA 5HH1A 3S6KA 4DNCA 5IX3A 2FIAA 3D7GA 3S6HA 4M3SA 2ZW7A 3IJ3A 3TFYA 4UCNA 2Q44A 3B3CA 2B4DB 4PXBA 5IV0A 4KZTA 5LRGA 1I12A 3SJGA 4FD6A 2AFSA 2BSWA 1YQEA 2EWBA 4KLWA 4MY3A 4RN7A 5DS0A 2XEJA 4PK3A 5EBVA 4F0YA 3SXNA 2XEFA 2ZEHA 3KQZA 4AVBA 3P2FA 4E8OA 1IIDA 3B8GA 4U5YA 2Z3NA 4B12A 4GM5A 1IYKA 2B3VA 2P6EA 2OZUA 5K8PA 2EBJA 2WSAA 3D66A 2C6PA 4MHYA 3WR7A 2ARHA 4UFXA 1BPNA 2GU2A 2D4OA 3GB0A 1YR0A 2FVGA 3CPAA 2NYQA 2PE3A 3HLPA 2V8VA 4JD6A 4KUBA 4MHPA 3LD2A 4F8ZA 4GS4A 2GIVA 3CDXA 4C7IA 2AFUA 3B3VA 1Y0YA 3CXSA 4M6IA 4JXQA 2FIWA 1YREA 2ZELA 1AYEA 1BPMA 1HEEA 1LFWA 1PCAA 1XOVA 4TNUA 4X8IA 3GIUA 5EC4A 3K9UA 4MCPA 4BD9A 1M4DA 2OR4A 1VHOA 3NE8A 4UA3A 4CAXA 2B4BA 3KR5A 1MJ9A 4PPZA 4XPKA 3FJUA 4NGQA 3VWEA 4AVCA 2PJ3A 4IF5A 4IK2A 4BINA 2OZGA 1JQGA 5LRKA 4PQAA 2CY2A 3NH5A 5AG4A 3SI0A 2PVWA 1NMTA 3WC7A 2ZW6A 4RUHA 4NGMA 1LRZA 4LX9A 5KTAA 4P44A 1GHEA 1LANA 3CT9A 5CNPA 3DNSA 5IB0A 3W91A 4R8FA 5HVGA 4K30A 4MI4A 3TX8A 1CPSA 4A39A 2PQ8A 3I1UA 4YRHA 1LOKA 4UWJA 3B7IA 4DUKA 4A37A 1Z4RA 2FXFA 4A31A 3FEEA 1S60A 2PC1A 3ISXA 4B13A 2ZEFA 1KUVA 1YSJA 1AUGA 2ZPAA 3ZJ0A 2Q43A 5IB9A 1R43A 3B3TA 1S7NA 3PB7X 4JJXA 4Y49C 4MY0A 2PJ0A 4ORFA 4UFVA 2G9DA 3PEIA 3WC6A 3KASA 5LRJA 1TF8A 2F7VA 4NGTA 2ANPA 2QYVA 5G22A 3GLJA 3D68A 3G8WA 3TC8A 4F9UA 2WYRA 3T9YA 4KSIA 2D4PA 1CX8A 4MCSA 2VZZA 2V8GA 2AFMA 2A4NA 4C2XA 3EC4A 4A95A 4CGMA 5D8NA 1PU9A 4XPLA 5K8NA 2IMOA 3PB6X 2CTBA 3FRMA 1OZPA 4OLLA 2IL4A 2PJCA 4UCPA 4A94A 2PSWA 3TOBA 4P4FA 3IU1A 3KHXA 1R3NA 2QIRA 3IO1A 4WWVA 5JM6A 1HDUA 4MFQA 1XIXA 4JZ0A 2R1IA 1X10A 1ZG7A 3D8PA 1P4NA 4MFZA 1VHEA 3BXMA 4X2TA 4R57A 4PV6A 2O53A 3FYNA 1MJAA 4XPDC 2ZEGA 2X7BA 3OWCA 1BLLE 1VGYA 1Z8LA 3H4QA 4P45A 1Y9WA 2JEVA 3PZJA 2Q04A 5G1ZA 3GKRA 2J9AA 1YVKA 4HKFA 4YGOA 4ZGYB 2QVPA 2CNTA 2FS5A 2EUIA 1ELMP 2AJ6A 2EO8A 2PIZA 4LQGA 1ZLIA 3KZWA 4UWIA 2QMLA 4NGPA 2PJ1A 4P4JA 5HVFA 4CGOA 1UWYA 2RB7A 4O23A 3SI1A 4MCQA 2R98A 4CAEA 4E2AA 3PRTA 3N5FA 1RO5A 2ZEPA 4BBHA 3G3SA 5AGEA 1WK4A 2WPWA 3QB8A 4AXVA 2JDDA 2ZEOA 5DWNA 3R9FA 1ZLHA 1YX0A 4QVTA 3P2HA 2Q4VA 3EFAA 4IUSA 4MHZA 4G1PA 1IB1E 1ARMA 3R95A 5JPHA 2C6GA 2VBQA 4MXUA 4QB9A 3D3SA 4KOWA 1YW4A 4P10A 4H6ZA 1Y7RA 4Q7AA 4A32A 4JLYA 2VI7A 3B3SA 2I3CA 1AMPA 2V8HA 4ONUA 1Q2YA 2PJBA 2C27A 5LYLA 1S7LA 1CPXA 1QMUA 2JDCA 5JQ4A 3D7HA 5K8OA 4CPAA 4B5PA 3LODA 4F0XA 4LQ6A 5J8CA 3NH4A 1S7KA 2Q7BA 2EK9A 4NGNA 1VKCA 2HC9A 4MFKA 3GYAA 2GE3A 3N7ZA 4UBRA 4FWUA 1M44A 4B14A 1S7FA 2PJ4A 3ISZA 4NXYA 2K5TA 4NGSA 3SHPA 3SJEA 3F8KA 4NSQA 2VEZA 4DYOA 2CTCA 2FT0A 3IC1A 1XBUA 1S3ZA 4PSXA 4KOYA 1EE3P 1J4JA 2REEA 3FBUA 4KVXA 4W9YA 2BOAA 3W6SA 4MMOA 4R9MA 3B35A 3DSBA 2J8RA 3DR8A 2ATRA 4A2ZA 2ZOFA 5A27A 1I21A 1TKJA 1XE4A 2G3AA 1IOIA 1Z8WA 4M6GA 4X5KA 1F2OA 4R87A 1MJBA 2PJ9A 3R9EA 1CG2A 1FT7A 2CIJA 4EFDA 1HDQA 1YMEA 2WUUA 1CJWA 2VQYA 1Z9UA 4NF1A 4OIDA 2Q0YA 4H89A 3BLNA 1BAVA 1CBXA 2R7HA 1B87A 1DTDA 1TIQA 3EXNA 2B5GA 5GCNA 4FAIA 5ELYA 2PIYA 4NEXA 5FVJA 3DR6A 3KGQA 1M4IA 1YW6A 2PRBA 2O4HA 2J8NA 2CNSA 4MFJA 1M4GA 5I0CA 1F2PA 4ZI6A 3E0KA 3WC5A 3SXOA 3IEHA 4XNHC 2F8HA 2P0WA 1KWMA 2PR1A 1TXRA 3BI0A 1YK3A 3D7FA 4KOUA 5LYIA 2PJ6A 5C88A 1TKFA 5F49A 3T8WA 3QAHA 4P4IA 4KLVA 1XJOA 4BMHA 4Q36A 4H6UA 1QSMA 3K9TA 4NJRA 2YNCA 6CPAA 1PUAA 2PJ7A 2EK8A 4MFLA 3JVNA 5G20A 3CPXA 4OC0A 4MCRA 1ZG8A 2ZENA 4EMEA 2IJZA 3B2YA 3JRUA 3WT4A 2B5GB 1CP7A 4CS0B 1MK4A 1Y9KA 4A30A 4C2ZA 3SJFA 5BWAB 2B58A 3DLJA 3PP9A 3FX6A 3H8GA 4UEZA 3W6XA 3HUVA 5ISVA 3IWGA 4OMEA 1U6MA 3LWUA 2CF4A 4E0AA 3C26A 4HPSA 2J8MA 1XEBA 2C1CA 2HV2A 3RNZA 4FD5A 3RZAA 3FVLA 4JWPA 3SJXA 3I3GA 1S5KA 1YGHA 1ZG9A 1YLEA 3PFOA 3VARA 4H2KA 2PRQA 3ZZIA 3IWWA 2R8VA 4IAVA 5E96A 1IU8A 2JLMA 4OC4A 3UY5A 2CNMA 2PDOA 3DDDA 1Q7LA 2O28A 1LAMA 2YNEA 3RAMA 3BHXA 4JXRA 4PXDA 1Q2CA 2GANA 4RI1A 4P6YA 4PXEA 4MRIA 2Z0ZA 2REFA 3FXTA 2VZYA 3PB4X 2JBJA 2ODFA 1N71A 3FB3A 2Z11A 2AFXA 2OOTA 1SQHA 3FMCA 1IY7A 3L2NA 2Z10A 1UFHA 2XEIA 4MJ8A 3TOAA 1LCPA 3FH4A 1XMBA 2Z3OA 3CXQA 1KZFA 2NMTA 4P4DA 4Q38A 2GLFA 3PB9X 4QUSA 4B10A 1ELLP 1QSRA 3FNCA 1Y7EA 4JYWA 4CRYB 1TF9A 3T90A 3D2PA 4MFPA 5DWMA 4AB7A 4UIBA 4A33A 4HNXB 5JGFA 1TKHA 3FEDA 3IWEA 1BO4A 5EMIA 5LYDA 3D67A 4OADA 4F9VA 4CRZB 3TT2A 3D7DA 4CYQA 1K4JA 4EVYA 4ZY0A 2I79A 3S6FA 1XF8A 3QAYA 3EY5A 5LYFA 4GXHA 4PSWA 4R3LA 2BO9A 4C68A 2P6GA 5H86A 2GLJA 1V0CA 3JUWA 3QNVA 4CGLA 4CAWA 3H8FA 4UEEA 3TO9A 3MN8A 3LMSA 4Z65A 4KS9A 3PGPA 2HQYA 4MHNA 4KVME 5G21A 4OC3A 2WZNA 3B3WA 4PXCA 4OAEA 4UCMA 4TWEA 5K8MA 3I9SA 2DF5A 5HMNA 3VWDA 4ONWA 2F5IA 2OH1A 2P6FA 4OC5A 5F48A 1B6BA 2FSRA 2B3UA 4R6TA 5AG5A 3IGRA 4FD4A 4U9ZA 5AG6A 3FIXA 2H5MA 2VL1A 4OKOA 8CPAA 3GY9A 1IOFA 1XRYA 1Z8XA 3KQXA 2AFOA 2OB0A 3TO7A 4NJQA 4UFWA 4KOXA 4M6HA 4CAFA 4KORA 4UEFA 4R7MA 3PFEA 5KTDA 4KSAA 4B5OA 4EWTA 3S9LA 2I00A 1IICA 4YFJA 2AE6A 2Q4YA 3KI9A
chains in the Genus database with same CATH topology
3GUXA 1GYTA 1PYTB 2ABZA 1VIXA 1LAPA 5CPAA 3NFZA 4OIWA 2NSMA 1Z5RA 2JEWA 2PJ8A 2ZOGA 3D4UA 3KL9A 4NGRA 4X3RA 5D29A 3RBUA 5F09A 4ZX9A 4ZY1A 2V77A 5JH9A 2POKA 2PVVA 4ZX8A 2XEGA 3PB8X 1Z2LA 1F57A 5HVHA 2BCOA 3VATA 4P4EA 4OC2A 1NSAA 2AFWA 2Q51A 1M4LA 4FUUA 2IQ6A 4UIAA 3IIBA 3IFEA 4IHMA 2PCUA 1YLOA 1Y0RA 3BI1A 3FF3A 1RTQA 2ZEDA 1H8LA 4K3NA 4WJBA 4NFRA 3KHZA 7CPAA 1CP6A 4OC1A 4P4BA 4ZYQA 3PBEA 4YU9A 2JBKA 2HB6A 5HXDA 2Q4ZA 4ZY2A 3S9MA 4FBEA 3NA6A 4UF4A 3K2KA 3MRUA 4DJLA 2PJ5A 1ARLA 3SI2A 2V8DA 2PJ2A 4R76A 3NH8A 2DEAA 2ZEMA 1QQ9A 3V38A 2QJ8A 3S9NA 3H8EA 4OP4A 3VH9A 1XFOA 3PBBA 1OBRA 1IGBA 3KR4A 2GREA 5CBMA 4YWYA 2ZEEA 5J1QA 2RFHA 5THWA 1FNOA 3V7ZA 1DE4C 3FECA 2PJAA 3DGVA 4B6ZA 3WABA 2AFZA 2C6CA 5I4MA 3D7GA 3IJ3A 3B3CA 4PXBA 5LRGA 3SJGA 2AFSA 5DS0A 2EWBA 2XEJA 2XEFA 2ZEHA 3KQZA 4GM5A 5K8PA 3D66A 2C6PA 4MHYA 1BPNA 2GU2A 3GB0A 2FVGA 3CPAA 2NYQA 2PE3A 3HLPA 2V8VA 4MHPA 4F8ZA 3CDXA 2AFUA 3B3VA 1Y0YA 2ZELA 1AYEA 1BPMA 1HEEA 1LFWA 1PCAA 4TNUA 4X8IA 4A38A 4MCPA 4BD9A 2OR4A 1VHOA 3KR5A 4PPZA 3FJUA 4NGQA 2PJ3A 4IK2A 1JQGA 5LRKA 4PQAA 3NH5A 3SI0A 2PVWA 3WC7A 4RUHA 4NGMA 4P44A 1LANA 3CT9A 4R8FA 5HVGA 3TX8A 4A39A 1CPSA 3I1UA 1LOKA 3B7IA 4DUKA 4A37A 3FEEA 3ISXA 2ZEFA 1YSJA 2Q43A 5IB9A 1R43A 3B3TA 3PB7X 2PJ0A 2G9DA 3PEIA 3WC6A 3KASA 5LRJA 1TF8A 2F7VA 4NGTA 2ANPA 2QYVA 3GLJA 3D68A 3TC8A 4F9UA 2WYRA 4KSIA 1CX8A 4MCSA 2V8GA 2AFMA 5D8NA 5K8NA 2IMOA 3PB6X 2CTBA 2PJCA 4A94A 4P4FA 3KHXA 1R3NA 4WWVA 3IO1A 5JM6A 1HDUA 4JZ0A 1ZG7A 1VHEA 3BXMA 4X2TA 2O53A 2ZEGA 1BLLE 1VGYA 1Z8LA 4P45A 2J9AA 2QVPA 1ELMP 2PIZA 4LQGA 1ZLIA 3KZWA 4NGPA 4P4JA 2PJ1A 5HVFA 1UWYA 2RB7A 4O23A 3SI1A 4MCQA 3PRTA 3N5FA 2ZEPA 4AXVA 2ZEOA 1ZLHA 4MHZA 4G1PA 1ARMA 2C6GA 4MXUA 1YW4A 4P10A 4Q7AA 3B3SA 2I3CA 1AMPA 2V8HA 2PJBA 5LYLA 1CPXA 1QMUA 3D7HA 5K8OA 4CPAA 3NH4A 2EK9A 4NGNA 2HC9A 4FWUA 2PJ4A 3ISZA 4NGSA 3SJEA 4DYOA 2CTCA 3IC1A 1XBUA 1EE3P 4W9YA 2BOAA 4MMOA 3B35A 2ZOFA 1TKJA 1F2OA 2PJ9A 1CG2A 1FT7A 2CIJA 4EFDA 1HDQA 1YMEA 4OIDA 1BAVA 1CBXA 1DTDA 4FAIA 5ELYA 2PIYA 3KGQA 1YW6A 2O4HA 1F2PA 4ZI6A 3WC5A 3IEHA 2F8HA 1KWMA 1TXRA 3BI0A 3D7FA 5LYIA 2PJ6A 1TKFA 3T8WA 4P4IA 1XJOA 3K9TA 4NJRA 6CPAA 2PJ7A 2EK8A 3CPXA 4OC0A 4MCRA 1ZG8A 2ZENA 4EMEA 2IJZA 3B2YA 3JRUA 3WT4A 1CP7A 3SJFA 3DLJA 3FX6A 3H8GA 4UEZA 3HUVA 4OMEA 3LWUA 2CF4A 2C1CA 3SJXA 3RZAA 3FVLA 1ZG9A 3PFOA 3VARA 4H2KA 2PRQA 3IWWA 4IAVA 4OC4A 1Q7LA 1LAMA 3RAMA 3BHXA 4PXDA 4P6YA 4PXEA 4MRIA 3PB4X 2JBJA 2AFXA 2OOTA 3FMCA 1IY7A 3L2NA 2XEIA 1LCPA 3FH4A 1XMBA 4P4DA 2GLFA 3PB9X 1ELLP 4JYWA 1Y7EA 1TF9A 4UIBA 5JGFA 1TKHA 3FEDA 5LYDA 3D67A 4F9VA 3D7DA 4ZY0A 5LYFA 2BO9A 2GLJA 3QNVA 3H8FA 4UEEA 3MN8A 3LMSA 4Z65A 4MHNA 4OC3A 2WZNA 3B3WA 4PXCA 4TWEA 5K8MA 4ONWA 4OC5A 4R6TA 2VL1A 4OKOA 8CPAA 1XRYA 3KQXA 2AFOA 4NJQA 4UEFA 4R7MA 3PFEA 4EWTA 3S9LA 3KI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GUX A;  1GYT A;  1PYT B;  2ABZ A;  1VIX A;  1LAP A;  5CPA A;  3NFZ A;  4OIW A;  2NSM A;  1Z5R A;  2JEW A;  2PJ8 A;  2ZOG A;  3D4U A;  3KL9 A;  4NGR A;  4X3R A;  5D29 A;  3RBU A;  5F09 A;  4ZX9 A;  4ZY1 A;  2V77 A;  5JH9 A;  2POK A;  2PVV A;  4ZX8 A;  2XEG A;  3PB8 X;  1Z2L A;  1F57 A;  5HVH A;  2BCO A;  3VAT A;  4P4E A;  4OC2 A;  1NSA A;  2AFW A;  2Q51 A;  1M4L A;  4FUU A;  2IQ6 A;  4UIA A;  3IIB A;  3IFE A;  4IHM A;  2PCU A;  1YLO A;  1Y0R A;  3BI1 A;  3FF3 A;  1RTQ A;  2ZED A;  1H8L A;  4K3N A;  4WJB A;  4NFR A;  3KHZ A;  7CPA A;  1CP6 A;  4OC1 A;  4P4B A;  4ZYQ A;  3PBE A;  4YU9 A;  2JBK A;  2HB6 A;  5HXD A;  2Q4Z A;  4ZY2 A;  3S9M A;  4FBE A;  3NA6 A;  4UF4 A;  3K2K A;  3MRU A;  4DJL A;  2PJ5 A;  1ARL A;  3SI2 A;  2V8D A;  2PJ2 A;  4R76 A;  3NH8 A;  2DEA A;  2ZEM A;  1QQ9 A;  3V38 A;  2QJ8 A;  3S9N A;  3H8E A;  4OP4 A;  3VH9 A;  1XFO A;  3PBB A;  1OBR A;  1IGB A;  3KR4 A;  2GRE A;  5CBM A;  4YWY A;  2ZEE A;  5J1Q A;  2RFH A;  5THW A;  1FNO A;  3V7Z A;  1DE4 C;  3FEC A;  2PJA A;  3DGV A;  4B6Z A;  3WAB A;  2AFZ A;  2C6C A;  5I4M A;  3D7G A;  3IJ3 A;  3B3C A;  4PXB A;  5LRG A;  3SJG A;  2AFS A;  5DS0 A;  2EWB A;  2XEJ A;  2XEF A;  2ZEH A;  3KQZ A;  4GM5 A;  5K8P A;  3D66 A;  2C6P A;  4MHY A;  1BPN A;  2GU2 A;  3GB0 A;  2FVG A;  3CPA A;  2NYQ A;  2PE3 A;  3HLP A;  2V8V A;  4MHP A;  4F8Z A;  3CDX A;  2AFU A;  3B3V A;  1Y0Y A;  2ZEL A;  1AYE A;  1BPM A;  1HEE A;  1LFW A;  1PCA A;  4TNU A;  4X8I A;  4A38 A;  4MCP A;  4BD9 A;  2OR4 A;  1VHO A;  3KR5 A;  4PPZ A;  3FJU A;  4NGQ A;  2PJ3 A;  4IK2 A;  1JQG A;  5LRK A;  4PQA A;  3NH5 A;  3SI0 A;  2PVW A;  3WC7 A;  4RUH A;  4NGM A;  4P44 A;  1LAN A;  3CT9 A;  4R8F A;  5HVG A;  3TX8 A;  4A39 A;  1CPS A;  3I1U A;  1LOK A;  3B7I A;  4DUK A;  4A37 A;  3FEE A;  3ISX A;  2ZEF A;  1YSJ A;  2Q43 A;  5IB9 A;  1R43 A;  3B3T A;  3PB7 X;  2PJ0 A;  2G9D A;  3PEI A;  3WC6 A;  3KAS A;  5LRJ A;  1TF8 A;  2F7V A;  4NGT A;  2ANP A;  2QYV A;  3GLJ A;  3D68 A;  3TC8 A;  4F9U A;  2WYR A;  4KSI A;  1CX8 A;  4MCS A;  2V8G A;  2AFM A;  5D8N A;  5K8N A;  2IMO A;  3PB6 X;  2CTB A;  2PJC A;  4A94 A;  4P4F A;  3KHX A;  1R3N A;  4WWV A;  3IO1 A;  5JM6 A;  1HDU A;  4JZ0 A;  1ZG7 A;  1VHE A;  3BXM A;  4X2T A;  2O53 A;  2ZEG A;  1BLL E;  1VGY A;  1Z8L A;  4P45 A;  2J9A A;  2QVP A;  1ELM P;  2PIZ A;  4LQG A;  1ZLI A;  3KZW A;  4NGP A;  4P4J A;  2PJ1 A;  5HVF A;  1UWY A;  2RB7 A;  4O23 A;  3SI1 A;  4MCQ A;  3PRT A;  3N5F A;  2ZEP A;  4AXV A;  2ZEO A;  1ZLH A;  4MHZ A;  4G1P A;  1ARM A;  2C6G A;  4MXU A;  1YW4 A;  4P10 A;  4Q7A A;  3B3S A;  2I3C A;  1AMP A;  2V8H A;  2PJB A;  5LYL A;  1CPX A;  1QMU A;  3D7H A;  5K8O A;  4CPA A;  3NH4 A;  2EK9 A;  4NGN A;  2HC9 A;  4FWU A;  2PJ4 A;  3ISZ A;  4NGS A;  3SJE A;  4DYO A;  2CTC A;  3IC1 A;  1XBU A;  1EE3 P;  4W9Y A;  2BOA A;  4MMO A;  3B35 A;  2ZOF A;  1TKJ A;  1F2O A;  2PJ9 A;  1CG2 A;  1FT7 A;  2CIJ A;  4EFD A;  1HDQ A;  1YME A;  4OID A;  1BAV A;  1CBX A;  1DTD A;  4FAI A;  5ELY A;  2PIY A;  3KGQ A;  1YW6 A;  2O4H A;  1F2P A;  4ZI6 A;  3WC5 A;  3IEH A;  2F8H A;  1KWM A;  1TXR A;  3BI0 A;  3D7F A;  5LYI A;  2PJ6 A;  1TKF A;  3T8W A;  4P4I A;  1XJO A;  3K9T A;  4NJR A;  6CPA A;  2PJ7 A;  2EK8 A;  3CPX A;  4OC0 A;  4MCR A;  1ZG8 A;  2ZEN A;  4EME A;  2IJZ A;  3B2Y A;  3JRU A;  3WT4 A;  1CP7 A;  3SJF A;  3DLJ A;  3FX6 A;  3H8G A;  4UEZ A;  3HUV A;  4OME A;  3LWU A;  2CF4 A;  2C1C A;  3SJX A;  3RZA A;  3FVL A;  1ZG9 A;  3PFO A;  3VAR A;  4H2K A;  2PRQ A;  3IWW A;  4IAV A;  4OC4 A;  1Q7L A;  1LAM A;  3RAM A;  3BHX A;  4PXD A;  4P6Y A;  4PXE A;  4MRI A;  3PB4 X;  2JBJ A;  2AFX A;  2OOT A;  3FMC A;  1IY7 A;  3L2N A;  2XEI A;  1LCP A;  3FH4 A;  1XMB A;  4P4D A;  2GLF A;  3PB9 X;  1ELL P;  4JYW A;  1Y7E A;  1TF9 A;  4UIB A;  5JGF A;  1TKH A;  3FED A;  5LYD A;  3D67 A;  4F9V A;  3D7D A;  4ZY0 A;  5LYF A;  2BO9 A;  2GLJ A;  3QNV A;  3H8F A;  4UEE A;  3MN8 A;  3LMS A;  4Z65 A;  4MHN A;  4OC3 A;  2WZN A;  3B3W A;  4PXC A;  4TWE A;  5K8M A;  4ONW A;  4OC5 A;  4R6T A;  2VL1 A;  4OKO A;  8CPA A;  1XRY A;  3KQX A;  2AFO A;  4NJQ A;  4UEF A;  4R7M A;  3PFE A;  4EWT A;  3S9L A;  3KI9 A; 
#chains in the Genus database with same CATH topology
 1RXT A;  2Z3P A;  3GUX A;  1GYT A;  1PYT B;  2ABZ A;  1VIX A;  3V8I A;  1LAP A;  5CPA A;  3NFZ A;  4OIW A;  2OU2 A;  2NSM A;  3KKW A;  1NE9 A;  2WPX A;  1FY7 A;  4QC6 A;  1Z5R A;  2JEW A;  2PJ8 A;  2ZOG A;  3CXP A;  3D4U A;  1YVO A;  3KL9 A;  4NGR A;  3TO6 A;  4AVA A;  4HNW B;  4X3R A;  4XNH B;  5D29 A;  1VHS A;  3RBU A;  5F09 A;  4ZX9 A;  4F6A A;  3F5B A;  1X12 A;  4ZY1 A;  2V77 A;  4M85 A;  5JH9 A;  2CXA A;  2POK A;  2FL4 A;  5KTC A;  3CZX A;  4Y49 B;  4CGP A;  2PVV A;  4ZX8 A;  2XEG A;  3PB8 X;  1Z2L A;  1F57 A;  5HVH A;  2BCO A;  4KOV A;  3TTH A;  3BJ7 A;  4R3K A;  4B5P B;  3RO0 A;  3VAT A;  1QST A;  4KVO E;  2Y0M A;  4P4E A;  2VXK A;  4KUA A;  4OC2 A;  2DPT A;  1NSA A;  2AFW A;  2OZH A;  2Q51 A;  4B11 A;  1M4L A;  2HUZ A;  4FUU A;  4J3G A;  4L8A A;  2IQ6 A;  4C2Y A;  4UIA A;  2YND A;  3IIB A;  5C82 A;  3IFE A;  4IHM A;  4NCZ A;  3BJ8 A;  2PCU A;  1YLO A;  3R1K A;  4PK2 A;  3TE4 A;  3D2M A;  1Y0R A;  3BI1 A;  3FF3 A;  4HNY B;  4L89 A;  1RTQ A;  2ZED A;  2RC4 A;  2ZW5 A;  1H8L A;  1QSN A;  4K3N A;  4WJB A;  4I49 A;  1M1D A;  2GFQ A;  2Z3K A;  3LAC A;  4NFR A;  3KHZ A;  1R57 A;  7CPA A;  3JTK A;  2KCW A;  1CP6 A;  3NE7 A;  2BL1 A;  4OC1 A;  4P4B A;  4XPD B;  4ZYQ A;  4QBJ A;  4CGN A;  3PBE A;  2G3T A;  4U9Y A;  4YU9 A;  2DPS A;  1QSO A;  3S6G A;  4AG9 A;  3IU2 A;  2G0B A;  2JBK A;  2HB6 A;  3TCV A;  4CYP A;  1A2Z A;  5HXD A;  2Q4Z A;  1ON0 A;  4ZY2 A;  4II9 A;  3A9L A;  3S9M A;  4FBE A;  1WWZ A;  2FCK A;  2Z3M A;  3NA6 A;  4KOT A;  4UF4 A;  3K2K A;  4MBU A;  3MRU A;  4DJL A;  1KUY A;  2PJ5 A;  3MGD A;  2BEI A;  4FD7 A;  3H5Z A;  1ARL A;  1IYL A;  2QEC A;  3R9G A;  3SI2 A;  1ZO0 A;  2V8D A;  2FE7 A;  2PJ2 A;  1KUX A;  2YNC C;  4R76 A;  1I1D A;  3F0A A;  3NH8 A;  2DEA A;  1CM0 A;  1XMT A;  1Z8T A;  4MHD A;  2ZEM A;  1QQ9 A;  4CYO A;  3V38 A;  2QJ8 A;  4LUA A;  5F47 A;  3RYO A;  5J8F A;  3S9N A;  3H8E A;  4OP4 A;  3VH9 A;  4A38 A;  5AG7 A;  1XFO A;  3PBB A;  2B4D A;  3EO4 A;  1OBR A;  4CAV A;  4ZBG A;  1IGB A;  2ZW4 A;  3KR4 A;  2GRE A;  1L0C A;  4CYN A;  5CBM A;  2BUE A;  4YWY A;  2ZEE A;  5J1Q A;  2PR8 A;  2RFH A;  1P0H A;  5THW A;  2DXQ A;  2YGW A;  1FNO A;  1NSL A;  2ZXV A;  3V7Z A;  5A28 A;  4RS2 A;  4KOS A;  1Q2D A;  2Q7S A;  5H84 A;  1DE4 C;  3FEC A;  4AG7 A;  1Z4E A;  2Z3L A;  3R96 A;  2PJA A;  4C7H A;  3DGV A;  4B6Z A;  3WAB A;  5F46 A;  2AFZ A;  4KSF A;  2C6C A;  1BOB A;  5I4M A;  2EVN A;  1JWQ A;  5HH1 A;  3S6K A;  4DNC A;  5IX3 A;  2FIA A;  3D7G A;  3S6H A;  4M3S A;  2ZW7 A;  3IJ3 A;  3TFY A;  4UCN A;  2Q44 A;  3B3C A;  2B4D B;  4PXB A;  5IV0 A;  4KZT A;  5LRG A;  1I12 A;  3SJG A;  4FD6 A;  2AFS A;  2BSW A;  1YQE A;  2EWB A;  4KLW A;  4MY3 A;  4RN7 A;  5DS0 A;  2XEJ A;  4PK3 A;  5EBV A;  4F0Y A;  3SXN A;  2XEF A;  2ZEH A;  3KQZ A;  4AVB A;  3P2F A;  4E8O A;  1IID A;  3B8G A;  4U5Y A;  2Z3N A;  4B12 A;  4GM5 A;  1IYK A;  2B3V A;  2P6E A;  2OZU A;  5K8P A;  2EBJ A;  2WSA A;  3D66 A;  2C6P A;  4MHY A;  3WR7 A;  2ARH A;  4UFX A;  1BPN A;  2GU2 A;  2D4O A;  3GB0 A;  1YR0 A;  2FVG A;  3CPA A;  2NYQ A;  2PE3 A;  3HLP A;  2V8V A;  4JD6 A;  4KUB A;  4MHP A;  3LD2 A;  4F8Z A;  4GS4 A;  2GIV A;  3CDX A;  4C7I A;  2AFU A;  3B3V A;  1Y0Y A;  3CXS A;  4M6I A;  4JXQ A;  2FIW A;  1YRE A;  2ZEL A;  1AYE A;  1BPM A;  1HEE A;  1LFW A;  1PCA A;  1XOV A;  4TNU A;  4X8I A;  3GIU A;  5EC4 A;  3K9U A;  4MCP A;  4BD9 A;  1M4D A;  2OR4 A;  1VHO A;  3NE8 A;  4UA3 A;  4CAX A;  2B4B A;  3KR5 A;  1MJ9 A;  4PPZ A;  4XPK A;  3FJU A;  4NGQ A;  3VWE A;  4AVC A;  2PJ3 A;  4IF5 A;  4IK2 A;  4BIN A;  2OZG A;  1JQG A;  5LRK A;  4PQA A;  2CY2 A;  3NH5 A;  5AG4 A;  3SI0 A;  2PVW A;  1NMT A;  3WC7 A;  2ZW6 A;  4RUH A;  4NGM A;  1LRZ A;  4LX9 A;  5KTA A;  4P44 A;  1GHE A;  1LAN A;  3CT9 A;  5CNP A;  3DNS A;  5IB0 A;  3W91 A;  4R8F A;  5HVG A;  4K30 A;  4MI4 A;  3TX8 A;  1CPS A;  4A39 A;  2PQ8 A;  3I1U A;  4YRH A;  1LOK A;  4UWJ A;  3B7I A;  4DUK A;  4A37 A;  1Z4R A;  2FXF A;  4A31 A;  3FEE A;  1S60 A;  2PC1 A;  3ISX A;  4B13 A;  2ZEF A;  1KUV A;  1YSJ A;  1AUG A;  2ZPA A;  3ZJ0 A;  2Q43 A;  5IB9 A;  1R43 A;  3B3T A;  1S7N A;  3PB7 X;  4JJX A;  4Y49 C;  4MY0 A;  2PJ0 A;  4ORF A;  4UFV A;  2G9D A;  3PEI A;  3WC6 A;  3KAS A;  5LRJ A;  1TF8 A;  2F7V A;  4NGT A;  2ANP A;  2QYV A;  5G22 A;  3GLJ A;  3D68 A;  3G8W A;  3TC8 A;  4F9U A;  2WYR A;  3T9Y A;  4KSI A;  2D4P A;  1CX8 A;  4MCS A;  2VZZ A;  2V8G A;  2AFM A;  2A4N A;  4C2X A;  3EC4 A;  4A95 A;  4CGM A;  5D8N A;  1PU9 A;  4XPL A;  5K8N A;  2IMO A;  3PB6 X;  2CTB A;  3FRM A;  1OZP A;  4OLL A;  2IL4 A;  2PJC A;  4UCP A;  4A94 A;  2PSW A;  3TOB A;  4P4F A;  3IU1 A;  3KHX A;  1R3N A;  2QIR A;  3IO1 A;  4WWV A;  5JM6 A;  1HDU A;  4MFQ A;  1XIX A;  4JZ0 A;  2R1I A;  1X10 A;  1ZG7 A;  3D8P A;  1P4N A;  4MFZ A;  1VHE A;  3BXM A;  4X2T A;  4R57 A;  4PV6 A;  2O53 A;  3FYN A;  1MJA A;  4XPD C;  2ZEG A;  2X7B A;  3OWC A;  1BLL E;  1VGY A;  1Z8L A;  3H4Q A;  4P45 A;  1Y9W A;  2JEV A;  3PZJ A;  2Q04 A;  5G1Z A;  3GKR A;  2J9A A;  1YVK A;  4HKF A;  4YGO A;  4ZGY B;  2QVP A;  2CNT A;  2FS5 A;  2EUI A;  1ELM P;  2AJ6 A;  2EO8 A;  2PIZ A;  4LQG A;  1ZLI A;  3KZW A;  4UWI A;  2QML A;  4NGP A;  2PJ1 A;  4P4J A;  5HVF A;  4CGO A;  1UWY A;  2RB7 A;  4O23 A;  3SI1 A;  4MCQ A;  2R98 A;  4CAE A;  4E2A A;  3PRT A;  3N5F A;  1RO5 A;  2ZEP A;  4BBH A;  3G3S A;  5AGE A;  1WK4 A;  2WPW A;  3QB8 A;  4AXV A;  2JDD A;  2ZEO A;  5DWN A;  3R9F A;  1ZLH A;  1YX0 A;  4QVT A;  3P2H A;  2Q4V A;  3EFA A;  4IUS A;  4MHZ A;  4G1P A;  1IB1 E;  1ARM A;  3R95 A;  5JPH A;  2C6G A;  2VBQ A;  4MXU A;  4QB9 A;  3D3S A;  4KOW A;  1YW4 A;  4P10 A;  4H6Z A;  1Y7R A;  4Q7A A;  4A32 A;  4JLY A;  2VI7 A;  3B3S A;  2I3C A;  1AMP A;  2V8H A;  4ONU A;  1Q2Y A;  2PJB A;  2C27 A;  5LYL A;  1S7L A;  1CPX A;  1QMU A;  2JDC A;  5JQ4 A;  3D7H A;  5K8O A;  4CPA A;  4B5P A;  3LOD A;  4F0X A;  4LQ6 A;  5J8C A;  3NH4 A;  1S7K A;  2Q7B A;  2EK9 A;  4NGN A;  1VKC A;  2HC9 A;  4MFK A;  3GYA A;  2GE3 A;  3N7Z A;  4UBR A;  4FWU A;  1M44 A;  4B14 A;  1S7F A;  2PJ4 A;  3ISZ A;  4NXY A;  2K5T A;  4NGS A;  3SHP A;  3SJE A;  3F8K A;  4NSQ A;  2VEZ A;  4DYO A;  2CTC A;  2FT0 A;  3IC1 A;  1XBU A;  1S3Z A;  4PSX A;  4KOY A;  1EE3 P;  1J4J A;  2REE A;  3FBU A;  4KVX A;  4W9Y A;  2BOA A;  3W6S A;  4MMO A;  4R9M A;  3B35 A;  3DSB A;  2J8R A;  3DR8 A;  2ATR A;  4A2Z A;  2ZOF A;  5A27 A;  1I21 A;  1TKJ A;  1XE4 A;  2G3A A;  1IOI A;  1Z8W A;  4M6G A;  4X5K A;  1F2O A;  4R87 A;  1MJB A;  2PJ9 A;  3R9E A;  1CG2 A;  1FT7 A;  2CIJ A;  4EFD A;  1HDQ A;  1YME A;  2WUU A;  1CJW A;  2VQY A;  1Z9U A;  4NF1 A;  4OID A;  2Q0Y A;  4H89 A;  3BLN A;  1BAV A;  1CBX A;  2R7H A;  1B87 A;  1DTD A;  1TIQ A;  3EXN A;  2B5G A;  5GCN A;  4FAI A;  5ELY A;  2PIY A;  4NEX A;  5FVJ A;  3DR6 A;  3KGQ A;  1M4I A;  1YW6 A;  2PRB A;  2O4H A;  2J8N A;  2CNS A;  4MFJ A;  1M4G A;  5I0C A;  1F2P A;  4ZI6 A;  3E0K A;  3WC5 A;  3SXO A;  3IEH A;  4XNH C;  2F8H A;  2P0W A;  1KWM A;  2PR1 A;  1TXR A;  3BI0 A;  1YK3 A;  3D7F A;  4KOU A;  5LYI A;  2PJ6 A;  5C88 A;  1TKF A;  5F49 A;  3T8W A;  3QAH A;  4P4I A;  4KLV A;  1XJO A;  4BMH A;  4Q36 A;  4H6U A;  1QSM A;  3K9T A;  4NJR A;  2YNC A;  6CPA A;  1PUA A;  2PJ7 A;  2EK8 A;  4MFL A;  3JVN A;  5G20 A;  3CPX A;  4OC0 A;  4MCR A;  1ZG8 A;  2ZEN A;  4EME A;  2IJZ A;  3B2Y A;  3JRU A;  3WT4 A;  2B5G B;  1CP7 A;  4CS0 B;  1MK4 A;  1Y9K A;  4A30 A;  4C2Z A;  3SJF A;  5BWA B;  2B58 A;  3DLJ A;  3PP9 A;  3FX6 A;  3H8G A;  4UEZ A;  3W6X A;  3HUV A;  5ISV A;  3IWG A;  4OME A;  1U6M A;  3LWU A;  2CF4 A;  4E0A A;  3C26 A;  4HPS A;  2J8M A;  1XEB A;  2C1C A;  2HV2 A;  3RNZ A;  4FD5 A;  3RZA A;  3FVL A;  4JWP A;  3SJX A;  3I3G A;  1S5K A;  1YGH A;  1ZG9 A;  1YLE A;  3PFO A;  3VAR A;  4H2K A;  2PRQ A;  3ZZI A;  3IWW A;  2R8V A;  4IAV A;  5E96 A;  1IU8 A;  2JLM A;  4OC4 A;  3UY5 A;  2CNM A;  2PDO A;  3DDD A;  1Q7L A;  2O28 A;  1LAM A;  2YNE A;  3RAM A;  3BHX A;  4JXR A;  4PXD A;  1Q2C A;  2GAN A;  4RI1 A;  4P6Y A;  4PXE A;  4MRI A;  2Z0Z A;  2REF A;  3FXT A;  2VZY A;  3PB4 X;  2JBJ A;  2ODF A;  1N71 A;  3FB3 A;  2Z11 A;  2AFX A;  2OOT A;  1SQH A;  3FMC A;  1IY7 A;  3L2N A;  2Z10 A;  1UFH A;  2XEI A;  4MJ8 A;  3TOA A;  1LCP A;  3FH4 A;  1XMB A;  2Z3O A;  3CXQ A;  1KZF A;  2NMT A;  4P4D A;  4Q38 A;  2GLF A;  3PB9 X;  4QUS A;  4B10 A;  1ELL P;  1QSR A;  3FNC A;  1Y7E A;  4JYW A;  4CRY B;  1TF9 A;  3T90 A;  3D2P A;  4MFP A;  5DWM A;  4AB7 A;  4UIB A;  4A33 A;  4HNX B;  5JGF A;  1TKH A;  3FED A;  3IWE A;  1BO4 A;  5EMI A;  5LYD A;  3D67 A;  4OAD A;  4F9V A;  4CRZ B;  3TT2 A;  3D7D A;  4CYQ A;  1K4J A;  4EVY A;  4ZY0 A;  2I79 A;  3S6F A;  1XF8 A;  3QAY A;  3EY5 A;  5LYF A;  4GXH A;  4PSW A;  4R3L A;  2BO9 A;  4C68 A;  2P6G A;  5H86 A;  2GLJ A;  1V0C A;  3JUW A;  3QNV A;  4CGL A;  4CAW A;  3H8F A;  4UEE A;  3TO9 A;  3MN8 A;  3LMS A;  4Z65 A;  4KS9 A;  3PGP A;  2HQY A;  4MHN A;  4KVM E;  5G21 A;  4OC3 A;  2WZN A;  3B3W A;  4PXC A;  4OAE A;  4UCM A;  4TWE A;  5K8M A;  3I9S A;  2DF5 A;  5HMN A;  3VWD A;  4ONW A;  2F5I A;  2OH1 A;  2P6F A;  4OC5 A;  5F48 A;  1B6B A;  2FSR A;  2B3U A;  4R6T A;  5AG5 A;  3IGR A;  4FD4 A;  4U9Z A;  5AG6 A;  3FIX A;  2H5M A;  2VL1 A;  4OKO A;  8CPA A;  3GY9 A;  1IOF A;  1XRY A;  1Z8X A;  3KQX A;  2AFO A;  2OB0 A;  3TO7 A;  4NJQ A;  4UFW A;  4KOX A;  4M6H A;  4CAF A;  4KOR A;  4UEF A;  4R7M A;  3PFE A;  5KTD A;  4KSA A;  4B5O A;  4EWT A;  3S9L A;  2I00 A;  1IIC A;  4YFJ A;  2AE6 A;  2Q4Y A;  3KI9 A; 
#chains in the Genus database with same CATH homology
 3GUX A;  1GYT A;  1PYT B;  2ABZ A;  1VIX A;  1LAP A;  5CPA A;  3NFZ A;  4OIW A;  2NSM A;  1Z5R A;  2JEW A;  2PJ8 A;  2ZOG A;  3D4U A;  3KL9 A;  4NGR A;  4X3R A;  5D29 A;  3RBU A;  5F09 A;  4ZX9 A;  4ZY1 A;  2V77 A;  5JH9 A;  2POK A;  2PVV A;  4ZX8 A;  2XEG A;  3PB8 X;  1Z2L A;  1F57 A;  5HVH A;  2BCO A;  3VAT A;  4P4E A;  4OC2 A;  1NSA A;  2AFW A;  2Q51 A;  1M4L A;  4FUU A;  2IQ6 A;  4UIA A;  3IIB A;  3IFE A;  4IHM A;  2PCU A;  1YLO A;  1Y0R A;  3BI1 A;  3FF3 A;  1RTQ A;  2ZED A;  1H8L A;  4K3N A;  4WJB A;  4NFR A;  3KHZ A;  7CPA A;  1CP6 A;  4OC1 A;  4P4B A;  4ZYQ A;  3PBE A;  4YU9 A;  2JBK A;  2HB6 A;  5HXD A;  2Q4Z A;  4ZY2 A;  3S9M A;  4FBE A;  3NA6 A;  4UF4 A;  3K2K A;  3MRU A;  4DJL A;  2PJ5 A;  1ARL A;  3SI2 A;  2V8D A;  2PJ2 A;  4R76 A;  3NH8 A;  2DEA A;  2ZEM A;  1QQ9 A;  3V38 A;  2QJ8 A;  3S9N A;  3H8E A;  4OP4 A;  3VH9 A;  1XFO A;  3PBB A;  1OBR A;  1IGB A;  3KR4 A;  2GRE A;  5CBM A;  4YWY A;  2ZEE A;  5J1Q A;  2RFH A;  5THW A;  1FNO A;  3V7Z A;  1DE4 C;  3FEC A;  2PJA A;  3DGV A;  4B6Z A;  3WAB A;  2AFZ A;  2C6C A;  5I4M A;  3D7G A;  3IJ3 A;  3B3C A;  4PXB A;  5LRG A;  3SJG A;  2AFS A;  5DS0 A;  2EWB A;  2XEJ A;  2XEF A;  2ZEH A;  3KQZ A;  4GM5 A;  5K8P A;  3D66 A;  2C6P A;  4MHY A;  1BPN A;  2GU2 A;  3GB0 A;  2FVG A;  3CPA A;  2NYQ A;  2PE3 A;  3HLP A;  2V8V A;  4MHP A;  4F8Z A;  3CDX A;  2AFU A;  3B3V A;  1Y0Y A;  2ZEL A;  1AYE A;  1BPM A;  1HEE A;  1LFW A;  1PCA A;  4TNU A;  4X8I A;  4A38 A;  4MCP A;  4BD9 A;  2OR4 A;  1VHO A;  3KR5 A;  4PPZ A;  3FJU A;  4NGQ A;  2PJ3 A;  4IK2 A;  1JQG A;  5LRK A;  4PQA A;  3NH5 A;  3SI0 A;  2PVW A;  3WC7 A;  4RUH A;  4NGM A;  4P44 A;  1LAN A;  3CT9 A;  4R8F A;  5HVG A;  3TX8 A;  4A39 A;  1CPS A;  3I1U A;  1LOK A;  3B7I A;  4DUK A;  4A37 A;  3FEE A;  3ISX A;  2ZEF A;  1YSJ A;  2Q43 A;  5IB9 A;  1R43 A;  3B3T A;  3PB7 X;  2PJ0 A;  2G9D A;  3PEI A;  3WC6 A;  3KAS A;  5LRJ A;  1TF8 A;  2F7V A;  4NGT A;  2ANP A;  2QYV A;  3GLJ A;  3D68 A;  3TC8 A;  4F9U A;  2WYR A;  4KSI A;  1CX8 A;  4MCS A;  2V8G A;  2AFM A;  5D8N A;  5K8N A;  2IMO A;  3PB6 X;  2CTB A;  2PJC A;  4A94 A;  4P4F A;  3KHX A;  1R3N A;  4WWV A;  3IO1 A;  5JM6 A;  1HDU A;  4JZ0 A;  1ZG7 A;  1VHE A;  3BXM A;  4X2T A;  2O53 A;  2ZEG A;  1BLL E;  1VGY A;  1Z8L A;  4P45 A;  2J9A A;  2QVP A;  1ELM P;  2PIZ A;  4LQG A;  1ZLI A;  3KZW A;  4NGP A;  4P4J A;  2PJ1 A;  5HVF A;  1UWY A;  2RB7 A;  4O23 A;  3SI1 A;  4MCQ A;  3PRT A;  3N5F A;  2ZEP A;  4AXV A;  2ZEO A;  1ZLH A;  4MHZ A;  4G1P A;  1ARM A;  2C6G A;  4MXU A;  1YW4 A;  4P10 A;  4Q7A A;  3B3S A;  2I3C A;  1AMP A;  2V8H A;  2PJB A;  5LYL A;  1CPX A;  1QMU A;  3D7H A;  5K8O A;  4CPA A;  3NH4 A;  2EK9 A;  4NGN A;  2HC9 A;  4FWU A;  2PJ4 A;  3ISZ A;  4NGS A;  3SJE A;  4DYO A;  2CTC A;  3IC1 A;  1XBU A;  1EE3 P;  4W9Y A;  2BOA A;  4MMO A;  3B35 A;  2ZOF A;  1TKJ A;  1F2O A;  2PJ9 A;  1CG2 A;  1FT7 A;  2CIJ A;  4EFD A;  1HDQ A;  1YME A;  4OID A;  1BAV A;  1CBX A;  1DTD A;  4FAI A;  5ELY A;  2PIY A;  3KGQ A;  1YW6 A;  2O4H A;  1F2P A;  4ZI6 A;  3WC5 A;  3IEH A;  2F8H A;  1KWM A;  1TXR A;  3BI0 A;  3D7F A;  5LYI A;  2PJ6 A;  1TKF A;  3T8W A;  4P4I A;  1XJO A;  3K9T A;  4NJR A;  6CPA A;  2PJ7 A;  2EK8 A;  3CPX A;  4OC0 A;  4MCR A;  1ZG8 A;  2ZEN A;  4EME A;  2IJZ A;  3B2Y A;  3JRU A;  3WT4 A;  1CP7 A;  3SJF A;  3DLJ A;  3FX6 A;  3H8G A;  4UEZ A;  3HUV A;  4OME A;  3LWU A;  2CF4 A;  2C1C A;  3SJX A;  3RZA A;  3FVL A;  1ZG9 A;  3PFO A;  3VAR A;  4H2K A;  2PRQ A;  3IWW A;  4IAV A;  4OC4 A;  1Q7L A;  1LAM A;  3RAM A;  3BHX A;  4PXD A;  4P6Y A;  4PXE A;  4MRI A;  3PB4 X;  2JBJ A;  2AFX A;  2OOT A;  3FMC A;  1IY7 A;  3L2N A;  2XEI A;  1LCP A;  3FH4 A;  1XMB A;  4P4D A;  2GLF A;  3PB9 X;  1ELL P;  4JYW A;  1Y7E A;  1TF9 A;  4UIB A;  5JGF A;  1TKH A;  3FED A;  5LYD A;  3D67 A;  4F9V A;  3D7D A;  4ZY0 A;  5LYF A;  2BO9 A;  2GLJ A;  3QNV A;  3H8F A;  4UEE A;  3MN8 A;  3LMS A;  4Z65 A;  4MHN A;  4OC3 A;  2WZN A;  3B3W A;  4PXC A;  4TWE A;  5K8M A;  4ONW A;  4OC5 A;  4R6T A;  2VL1 A;  4OKO A;  8CPA A;  1XRY A;  3KQX A;  2AFO A;  4NJQ A;  4UEF A;  4R7M A;  3PFE A;  4EWT A;  3S9L A;  3KI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...