3B3CA

Crystal structure of the m180a mutant of the aminopeptidase from vibrio proteolyticus in complex with leucine phosphonic acid
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDATNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Bacterial leucyl aminopeptidase
publication title Zinc coordination geometry and ligand binding affinity: the structural and kinetic analysis of the second-shell serine 228 residue and the methionine 180 residue of the aminopeptidase from Vibrio proteolyticus.
pubmed doi rcsb
source organism Vibrio proteolyticus
total genus 112
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2007-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3b3cA00
4EFDA 4PXBA 2O4HA 4YU9A 4OIDA 5JM6A 8CPAA 4NGMA 1BPNA 2IMOA 1ARMA 4X3RA 2XEIA 3KHXA 3DGVA 4OP4A 3KGQA 3L2NA 3D66A 2AFXA 3SJEA 2ZENA 3IFEA 4OC1A 1RTQA 3K2KA 4F9UA 4PQAA 2PJ1A 3BI0A 1YW4A 1ZLHA 1LAPA 4ZY2A 4Z65A 3FX6A 3D7FA 3SI2A 5K8NA 2PJ6A 3ISXA 3D4UA 4FUUA 2ZEEA 4NGPA 2JBKA 2RB7A 2QJ8A 3GUXA 3N5FA 4IHMA 4OC3A 2NYQA 4OC5A 3IO1A 4P4IA 4OMEA 2Q4ZA 4AXVA 2ANPA 3FEDA 3FJUA 4NGRA 2ZEDA 2PJ0A 2ZOFA 1R43A 1XBUA 3KQZA 4PPZA 1FNOA 4O23A 4MHZA 4WWVA 3KI9A 3ISZA 1Q7LA 5F09A 3IC1A 2PE3A 1LANA 1TKJA 1DE4C 1QMUA 2F8HA 4ONWA 4H2KA 1YSJA 2BOAA 1Z8LA 1IGBA 1Y0RA 5K8MA 2HB6A 2EK9A 2XEFA 4EMEA 3WC6A 1OBRA 2PRQA 3B2YA 3NFZA 4EWTA 2GLFA 1YMEA 5LYIA 2PJCA 1JQGA 5CBMA 3TC8A 1KWMA 3V38A 4A39A 3NH5A 2V8DA 2C6CA 2POKA 2AFWA 2Q43A 3B3WA 3VH9A 3B35A 2AFUA 5LRJA 4DYOA 2PJ2A 2EK8A 3B7IA 4F8ZA 1ELLP 4P10A 4DUKA 4GM5A 2C1CA 4PXCA 4PXDA 5LYDA 4ZI6A 3K9TA 4R6TA 4R7MA 2IQ6A 4UEZA 3PB7X 5HXDA 5HVFA 1VIXA 1XFOA 4WJBA 2F7VA 3LMSA 2IJZA 4UEFA 1ARLA 1QQ9A 4MRIA 4X8IA 1NSAA 4G1PA 3SJXA 1LAMA 1CBXA 4NGTA 1CG2A 1LOKA 3PBBA 1VHEA 3PRTA 3KZWA 5J1QA 4P4EA 2HC9A 2O53A 1BAVA 1TXRA 1ZG9A 4ZX9A 1R3NA 3D68A 1M4LA 2GLJA 3KHZA 4KSIA 5LRGA 1TKHA 2C6PA 2JBJA 5K8OA 4W9YA 2PJ3A 3D7DA 3IJ3A 3SJFA 5K8PA 3V7ZA 2PJ4A 1BLLE 3FEEA 3WC7A 3D7HA 2V8HA 1TF8A 3WABA 4RUHA 2BO9A 4UF4A 4FAIA 3B3SA 1YW6A 5ELYA 2G9DA 4MCPA 4YWYA 4MHPA 2RFHA 4FWUA 3BI1A 3NH4A 5HVGA 5LYFA 4ZX8A 3IWWA 2OR4A 4X2TA 3PBEA 5LRKA 1EE3P 2GU2A 2WYRA 3KR4A 4JZ0A 4Q7AA 6CPAA 4A37A 3TX8A 2QYVA 2PJAA 1XMBA 3VARA 2ZEFA 3HUVA 5JGFA 3CPXA 3T8WA 4NGSA 3KASA 2ZEPA 1CP6A 2PJ7A 5D8NA 3PB4X 5D29A 2PVVA 3PFEA 1ZLIA 2AFOA 4JYWA 1Y7EA 5THWA 2AFMA 2CTBA 3RAMA 2QVPA 5DS0A 2XEGA 1HDQA 2VL1A 4TNUA 4CPAA 1ZG7A 1AMPA 2J9AA 2FVGA 4R8FA 4TWEA 4MCRA 4OKOA 3HLPA 2Q51A 3I1UA 4MCQA 3B3TA 2PVWA 4F9VA 3FMCA 2ZOGA 3VATA 4NGQA 1Z5RA 2V8GA 3MRUA 4MHNA 3CDXA 3PB9X 2PIYA 1FT7A 3KR5A 4K3NA 4P45A 1XJOA 2GREA 3IEHA 4NGNA 2OOTA 4P4DA 2EWBA 4MXUA 4IK2A 4R76A 5HVHA 3QNVA 5LYLA 4OC2A 1VGYA 2ZEMA 2PCUA 3BXMA 2ABZA 3SI0A 3SI1A 4ZY1A 2PIZA 1HEEA 4DJLA 5CPAA 3SJGA 4UIBA 1AYEA 1ZG8A 3S9MA 4NJQA 3NH8A 4P44A 2CTCA 3B3CA 1F2PA 4LQGA 2DEAA 1CP7A 4A94A 4ZYQA 1LFWA 2C6GA 3FH4A 1PYTB 2ZEHA 1YLOA 2I3CA 3PB6X 2WZNA 3RZAA 3KQXA 4P4FA 4BD9A 2PJ8A 3BHXA 1Y0YA 2PJBA 4MCSA 1F57A 3H8EA 1F2OA 2AFSA 3B3VA 1TKFA 1Z2LA 4NJRA 4UEEA 3NA6A 4OC0A 4A38A 3KL9A 1CX8A 3H8FA 4PXEA 5I4MA 2V8VA 1XRYA 2CIJA 2ZEGA 7CPAA 4OIWA 1HDUA 2PJ9A 4NFRA 3CPAA 4MMOA 4FBEA 1TF9A 1VHOA 3H8GA 4P4BA 3GLJA 3PFOA 4B6ZA 3WC5A 2AFZA 4UIAA 3JRUA 3PEIA 5IB9A 2ZELA 4ZY0A 4OC4A 3DLJA 1H8LA 3D7GA 3S9LA 5JH9A 3IIBA 4MHYA 3FVLA 2PJ5A 3MN8A 1IY7A 3RBUA 3WT4A 1DTDA 3PB8X 3FECA 1LCPA 2XEJA 4IAVA 1GYTA 2CF4A 1UWYA 3LWUA 1CPSA 3FF3A 2BCOA 1BPMA 2NSMA 3GB0A 1PCAA 3CT9A 2JEWA 2V77A 2ZEOA 4P6YA 4P4JA 1ELMP 3S9NA 1CPXA 3D67A
chains in the Genus database with same CATH superfamily
4EFDA 2P6EA 4PXBA 2BUEA 5H84A 2O4HA 4YU9A 4OIDA 3QAYA 3GY9A 1A2ZA 4MFLA 5J8FA 8CPAA 4MFZA 5JM6A 4AVAA 1IOFA 4RS2A 3DNSA 4NGMA 1BPNA 2IMOA 1ARMA 4X3RA 2XEIA 4CAVA 3KHXA 3D3SA 3DGVA 2ZW6A 4OP4A 3KGQA 2OZGA 2Q0YA 3D66A 3L2NA 2AFXA 4U9ZA 3SJEA 1S3ZA 2ZENA 1AUGA 3IFEA 1RTQA 2B3UA 3CXQA 3K2KA 3DR8A 1LRZA 4OC1A 2Q44A 4F9UA 4KOUA 4PQAA 2PJ1A 3BI0A 1YVKA 1YW4A 2B4DA 2YNDA 1ZLHA 1LAPA 4K30A 4ZY2A 3R9GA 4Z65A 1JWQA 3JVNA 4II9A 3FBUA 3FX6A 3D7FA 3SI2A 3I9SA 4Q36A 3PP9A 5K8NA 4FD6A 3DR6A 4LUAA 1RO5A 2PJ6A 3ISXA 4R3LA 3D4UA 4FUUA 4KOXA 1IU8A 2F5IA 1X10A 2ZEEA 5G1ZA 2J8MA 3V8IA 4NGPA 3EO4A 4B10A 4PSWA 2JBKA 2FXFA 3LD2A 2RB7A 2ARHA 2QJ8A 3GUXA 3N5FA 4CAEA 2Z3NA 5AG4A 2R98A 2PRBA 3W6XA 4CRZB 4IHMA 4OC3A 4HKFA 2NYQA 4OC5A 4PV6A 3IO1A 1XF8A 1Z8WA 4OMEA 4P4IA 2DXQA 2Q4ZA 1Y9KA 1K4JA 4AXVA 2P6GA 2ANPA 2K5TA 3FJUA 3FEDA 1Z8TA 3TTHA 4NGRA 2ZEDA 3IGRA 2Z3PA 2YNCA 2JLMA 2PJ0A 2ZOFA 1R43A 1XBUA 3KQZA 4PPZA 4CGPA 1FNOA 2JEVA 4O23A 4OAEA 5EBVA 4MHZA 3A9LA 3C26A 4MJ8A 4WWVA 1I12A 3KI9A 3ISZA 1Q7LA 5F09A 3RYOA 5KTDA 3NE7A 2DF5A 3IC1A 4B5PA 3WR7A 2PE3A 1LANA 4CRYB 3GKRA 1TKJA 4NSQA 4C7IA 1DE4C 1QMUA 2F8HA 4CGNA 3CXPA 4BINA 4ONWA 4H2KA 1YSJA 2BOAA 5A27A 2HUZA 1Z8LA 1IGBA 1Y0RA 1PUAA 2NMTA 2HB6A 4XNHC 2EK9A 1IYKA 2Q7BA 5K8MA 2XEFA 2Q4YA 4EMEA 1TIQA 5AG6A 3WC6A 1OBRA 4CAXA 5G20A 4FD4A 2R8VA 5EC4A 1XMTA 2PRQA 3B2YA 2B4DB 5ISVA 3NFZA 4EWTA 2GLFA 1YMEA 5F49A 5LYIA 2PJCA 4KLVA 1JQGA 4IUSA 1CM0A 3R95A 5CBMA 3TC8A 2YNCC 2X7BA 2GIVA 4MI4A 3FRMA 1KWMA 3FNCA 3V38A 4AVCA 4MY0A 2WSAA 4A39A 3NH5A 4F0XA 2V8DA 3EC4A 4XNHB 4PSXA 3FB3A 2C6CA 3IWGA 2DPTA 4B5OA 3EXNA 1R57A 3G8WA 2POKA 2AFWA 2Q43A 3K9UA 4C2XA 3F0AA 2B5GA 3B3WA 3VH9A 3R1KA 3H5ZA 4AG7A 3B35A 4DNCA 2AFUA 5LRJA 1P0HA 4DYOA 3TO9A 2JDDA 4L8AA 4CYNA 2PJ2A 2EK8A 3B7IA 5G21A 2QECA 4KSAA 4F8ZA 1ELLP 3N7ZA 3JTKA 1Q2DA 4P10A 3SHPA 1SQHA 3TOBA 2Z0ZA 2EUIA 4DUKA 4UFXA 4GM5A 2C1CA 4HPSA 4PXCA 4PXDA 1Z4RA 1IYLA 2Z3KA 2PDOA 4UFWA 5LYDA 4ZI6A 3K9TA 1YGHA 4R6TA 2IQ6A 4R7MA 4UEZA 4Y49C 2B58A 3MGDA 3PB7X 4B5PB 5JPHA 4M3SA 4CYQA 5HXDA 5HVFA 1VIXA 1XFOA 4KOTA 4WJBA 2F7VA 1XEBA 1WK4A 3LMSA 4KSFA 1B87A 2IJZA 4UEFA 1ARLA 2YGWA 3R96A 1QQ9A 4MRIA 1BO4A 4CS0B 2P6FA 4XPDB 4B11A 4C2ZA 4X8IA 2O28A 1NSAA 3IWEA 1QSOA 2FIWA 4G1PA 4CYOA 3SJXA 1LAMA 2OZUA 1VKCA 1CBXA 4A95A 1QSTA 4NGTA 4QB9A 5DWNA 1CG2A 1LOKA 2OU2A 4XPKA 5I0CA 2QMLA 3PBBA 1Y7RA 2GANA 4B13A 4E8OA 5CNPA 5HH1A 2OB0A 3SXNA 1VHEA 3PRTA 1RXTA 4X5KA 4CAWA 3KZWA 5DWMA 2B3VA 4P4EA 1Y9WA 2HC9A 2O53A 5J1QA 3B8GA 1XE4A 3FIXA 1BAVA 1BOBA 5IV0A 1TXRA 2Z3LA 1ZG9A 4ZX9A 1R3NA 4JJXA 3D68A 1M4LA 1PU9A 2GLJA 2Y0MA 3KHZA 4JWPA 5FVJA 4KSIA 4KVXA 2VXKA 1TKHA 4KOSA 5LRGA 3TO7A 2C6PA 2JBJA 4NEXA 5K8OA 4NXYA 2VZYA 2PJ3A 4QUSA 4W9YA 1IOIA 3D7DA 5F46A 2REEA 3IJ3A 4ZBGA 4B12A 2B5GB 3SJFA 4KLWA 4RN7A 4UWJA 2I00A 5K8PA 2FSRA 4U9YA 3V7ZA 2ZW4A 2PJ4A 2CY2A 4BMHA 1BLLE 1VHSA 3KKWA 2VZZA 3FEEA 2ZW5A 3LACA 4J3GA 4LQ6A 3WC7A 4AG9A 3D7HA 2YNEA 4LX9A 1CJWA 1QSNA 2V8HA 2VEZA 1TF8A 3WABA 5A28A 2ODFA 4MFQA 3IU2A 4RUHA 2Z10A 3I3GA 2ATRA 2BO9A 4KVOE 4UF4A 1B6BA 4FAIA 3H4QA 3E0KA 1YQEA 3B3SA 2ZW7A 1YW6A 2BEIA 5ELYA 1S7LA 2G9DA 4HNXB 4HNYB 1Q2CA 4JXRA 4MCPA 4R9MA 2IL4A 4YWYA 1Z8XA 1X12A 4MHPA 2RFHA 4U5YA 2FCKA 4FWUA 3NE8A 3BI1A 3NH4A 3R9EA 5HVGA 5LYFA 4ZX8A 1KUVA 3IWWA 1L0CA 2OR4A 4MFKA 4X2TA 3PBEA 2R7HA 5LRKA 1EE3P 5J8CA 2AJ6A 2GU2A 2WYRA 3KR4A 4FD7A 2WUUA 4JZ0A 4OLLA 4E0AA 4AVBA 4Q7AA 4JD6A 6CPAA 4MBUA 1M1DA 2R1IA 2WPWA 3TT2A 3TX8A 2AE6A 2QYVA 4A37A 1FY7A 3TCVA 2PC1A 2PJAA 2J8RA 1U6MA 1XMBA 2FL4A 4KOYA 3VARA 2ZEFA 3HUVA 1KUXA 5JGFA 3PZJA 3CPXA 3T8WA 4NGSA 1UFHA 2FS5A 3KASA 4R3KA 1YK3A 2ZEPA 1CP6A 2HV2A 3W6SA 5F48A 5C88A 2PJ7A 1ON0A 5D8NA 3PB4X 4C68A 4JXQA 3DSBA 4PK3A 5D29A 2PVVA 4ORFA 3PFEA 1KUYA 3ZJ0A 1ZLIA 2AFOA 4GS4A 4JYWA 5AG5A 1NSLA 1Y7EA 3R9FA 4GXHA 1KZFA 1Z9UA 1I1DA 2GFQA 3CZXA 5THWA 2AFMA 2CTBA 4YGOA 4CGOA 3RAMA 2QVPA 3VWEA 5DS0A 3S6KA 4OADA 2XEGA 1HDQA 1Q2YA 2VL1A 3DDDA 4TNUA 2G3TA 1M4IA 3S6HA 4CPAA 2CNSA 1S60A 1ZG7A 3PGPA 4QVTA 1AMPA 2J9AA 4UCPA 1MK4A 2FVGA 3TOAA 4R8FA 4TWEA 1I21A 4MCRA 3FYNA 4OKOA 1GHEA 3JUWA 3HLPA 2Q51A 3I1UA 4MCQA 4IF5A 4MFPA 3B3TA 2VBQA 2FE7A 4NCZA 3BLNA 2PVWA 3FXTA 4F9VA 3FMCA 5KTAA 2ZOGA 3S6GA 3VATA 4A33A 4Q38A 2EVNA 1YLEA 3F8KA 5HMNA 1S7NA 3EFAA 5EMIA 5BWAB 5E96A 4CAFA 4F6AA 4E2AA 4NGQA 1Z5RA 2EBJA 2V8GA 1J4JA 3MRUA 4MHNA 3CDXA 3PB9X 2PIYA 1FT7A 3KR5A 4PK2A 4K3NA 3QB8A 4P45A 1XJOA 2H5MA 2GREA 3G3SA 3IEHA 4KOWA 2BL1A 4H6UA 4NGNA 2OOTA 3GIUA 4P4DA 4KUBA 2EWBA 4MXUA 2Q04A 4ONUA 5AG7A 2QIRA 4Y49B 5F47A 2CNTA 3D2MA 4HNWB 4IK2A 2WPXA 3P2HA 2ZXVA 4R76A 5HVHA 3QNVA 5LYLA 1IB1E 4OC2A 1VGYA 1XOVA 2PCUA 2VI7A 2ZEMA 3W91A 2P0WA 2ABZA 3BXMA 4R57A 3SI0A 3SI1A 3BJ8A 4ZY1A 2Z3MA 2PIZA 3UY5A 1HEEA 4DJLA 2DPSA 5CPAA 3SJGA 5KTCA 4M85A 4UFVA 2CXAA 1AYEA 4UIBA 2A4NA 2J8NA 1ZG8A 3S9MA 4A31A 4F0YA 4NJQA 4CYPA 2OZHA 3NH8A 5C82A 4P44A 2CTCA 3BJ7A 3B3CA 1IIDA 1F2PA 1YR0A 4LQGA 2REFA 2DEAA 2Z11A 1CP7A 4UCNA 4A94A 2OH1A 3VWDA 4ZYQA 1LFWA 2C6GA 3FH4A 4UCMA 3SXOA 1PYTB 2ZEHA 2FT0A 1YLOA 2I3CA 3PB6X 2WZNA 3RZAA 3KQXA 4BBHA 4B14A 4P4FA 5GCNA 4BD9A 2PJ8A 3BHXA 4KVME 1Y0YA 3IU1A 4MFJA 4M6HA 4I49A 4YFJA 4JLYA 3RO0A 2PJBA 3T9YA 2GE3A 3GYAA 4MCSA 5IB0A 2JDCA 2G0BA 1F57A 1M4GA 3H8EA 1F2OA 2B4BA 1YX0A 2AFSA 3B3VA 1TKFA 1Z2LA 4NJRA 4UEEA 3NA6A 4M6GA 4C2YA 4CGLA 4OC0A 5AGEA 4H89A 3KL9A 4A38A 1CX8A 2KCWA 3H8FA 4PXEA 5I4MA 1ZO0A 2D4OA 2I79A 4MY3A 3RNZA 2D4PA 2V8VA 4YRHA 1XRYA 5JQ4A 3S6FA 4C7HA 2CIJA 2C27A 3D8PA 2Q7SA 2ZEGA 4UWIA 7CPAA 4OIWA 1HDUA 2PJ9A 4NFRA 3CPAA 2RC4A 4MMOA 1QSRA 2ZPAA 3TE4A 4QBJA 1M44A 4KORA 3LODA 4RI1A 4FBEA 2BSWA 1TF9A 3OWCA 1VHOA 4M6IA 1YVOA 3T90A 2Q4VA 2PR1A 2PSWA 1S7KA 1XIXA 4EVYA 3H8GA 4P4BA 4A32A 5H86A 3GLJA 3PFOA 3P2FA 1MJAA 4B6ZA 1MJ9A 3WC5A 2AFZA 1OZPA 1YREA 2PR8A 4UIAA 4ZGYB 3JRUA 3PEIA 4KUAA 4A30A 5IB9A 2PQ8A 2ZELA 4KOVA 4ZY0A 4AB7A 4NF1A 4OC4A 1P4NA 3DLJA 1H8LA 4R87A 3TFYA 4QC6A 5IX3A 1N71A 3D7GA 3S9LA 1NE9A 1S7FA 2FIAA 5JH9A 4UA3A 2G3AA 2Z3OA 2HQYA 3IIBA 1IICA 3FVLA 4MHYA 2PJ5A 2VQYA 1IY7A 3F5BA 3MN8A 3RBUA 3ZZIA 2EO8A 4A2ZA 1S5KA 3WT4A 1V0CA 1DTDA 3PB8X 4KZTA 3FECA 1LCPA 1MJBA 2XEJA 4IAVA 4KS9A 4MHDA 5G22A 3EY5A 1GYTA 4H6ZA 4L89A 1Z4EA 1WWZA 3CXSA 2CF4A 2CNMA 3D2PA 1UWYA 3LWUA 1NMTA 1CPSA 4UBRA 3FF3A 2BCOA 4XPLA 3TO6A 1BPMA 1QSMA 2NSMA 3GB0A 1PCAA 3CT9A 2JEWA 2V77A 2ZEOA 4P6YA 4P4JA 1ELMP 3S9NA 1M4DA 3QAHA 4FD5A 4XPDC 1CPXA 3D67A 4CGMA
chains in the Genus database with same CATH topology
4EFDA 4PXBA 2O4HA 4YU9A 4OIDA 5JM6A 8CPAA 4NGMA 1BPNA 2IMOA 1ARMA 4X3RA 2XEIA 3KHXA 3DGVA 4OP4A 3KGQA 3L2NA 3D66A 2AFXA 3SJEA 2ZENA 3IFEA 4OC1A 1RTQA 3K2KA 4F9UA 4PQAA 2PJ1A 3BI0A 1YW4A 1ZLHA 1LAPA 4ZY2A 4Z65A 3FX6A 3D7FA 3SI2A 5K8NA 2PJ6A 3ISXA 3D4UA 4FUUA 2ZEEA 4NGPA 2JBKA 2RB7A 2QJ8A 3GUXA 3N5FA 4IHMA 4OC3A 2NYQA 4OC5A 3IO1A 4P4IA 4OMEA 2Q4ZA 4AXVA 2ANPA 3FEDA 3FJUA 4NGRA 2ZEDA 2PJ0A 2ZOFA 1R43A 1XBUA 3KQZA 4PPZA 1FNOA 4O23A 4MHZA 4WWVA 3KI9A 3ISZA 1Q7LA 5F09A 3IC1A 2PE3A 1LANA 1TKJA 1DE4C 1QMUA 2F8HA 4ONWA 4H2KA 1YSJA 2BOAA 1Z8LA 1IGBA 1Y0RA 5K8MA 2HB6A 2EK9A 2XEFA 4EMEA 3WC6A 1OBRA 2PRQA 3B2YA 3NFZA 4EWTA 2GLFA 1YMEA 5LYIA 2PJCA 1JQGA 5CBMA 3TC8A 1KWMA 3V38A 4A39A 3NH5A 2V8DA 2C6CA 2POKA 2AFWA 2Q43A 3B3WA 3VH9A 3B35A 2AFUA 5LRJA 4DYOA 2PJ2A 2EK8A 3B7IA 4F8ZA 1ELLP 4P10A 4DUKA 4GM5A 2C1CA 4PXCA 4PXDA 5LYDA 4ZI6A 3K9TA 4R6TA 4R7MA 2IQ6A 4UEZA 3PB7X 5HXDA 5HVFA 1VIXA 1XFOA 4WJBA 2F7VA 3LMSA 2IJZA 4UEFA 1ARLA 1QQ9A 4MRIA 4X8IA 1NSAA 4G1PA 3SJXA 1LAMA 1CBXA 4NGTA 1CG2A 1LOKA 3PBBA 1VHEA 3PRTA 3KZWA 5J1QA 4P4EA 2HC9A 2O53A 1BAVA 1TXRA 1ZG9A 4ZX9A 1R3NA 3D68A 1M4LA 2GLJA 3KHZA 4KSIA 5LRGA 1TKHA 2C6PA 2JBJA 5K8OA 4W9YA 2PJ3A 3D7DA 3IJ3A 3SJFA 5K8PA 3V7ZA 2PJ4A 1BLLE 3FEEA 3WC7A 3D7HA 2V8HA 1TF8A 3WABA 4RUHA 2BO9A 4UF4A 4FAIA 3B3SA 1YW6A 5ELYA 2G9DA 4MCPA 4YWYA 4MHPA 2RFHA 4FWUA 3BI1A 3NH4A 5HVGA 5LYFA 4ZX8A 3IWWA 2OR4A 4X2TA 3PBEA 5LRKA 1EE3P 2GU2A 2WYRA 3KR4A 4JZ0A 4Q7AA 6CPAA 4A37A 3TX8A 2QYVA 2PJAA 1XMBA 3VARA 2ZEFA 3HUVA 5JGFA 3CPXA 3T8WA 4NGSA 3KASA 2ZEPA 1CP6A 2PJ7A 5D8NA 3PB4X 5D29A 2PVVA 3PFEA 1ZLIA 2AFOA 4JYWA 1Y7EA 5THWA 2AFMA 2CTBA 3RAMA 2QVPA 5DS0A 2XEGA 1HDQA 2VL1A 4TNUA 4CPAA 1ZG7A 1AMPA 2J9AA 2FVGA 4R8FA 4TWEA 4MCRA 4OKOA 3HLPA 2Q51A 3I1UA 4MCQA 3B3TA 2PVWA 4F9VA 3FMCA 2ZOGA 3VATA 4NGQA 1Z5RA 2V8GA 3MRUA 4MHNA 3CDXA 3PB9X 2PIYA 1FT7A 3KR5A 4K3NA 4P45A 1XJOA 2GREA 3IEHA 4NGNA 2OOTA 4P4DA 2EWBA 4MXUA 4IK2A 4R76A 5HVHA 3QNVA 5LYLA 4OC2A 1VGYA 2ZEMA 2PCUA 3BXMA 2ABZA 3SI0A 3SI1A 4ZY1A 2PIZA 1HEEA 4DJLA 5CPAA 3SJGA 4UIBA 1AYEA 1ZG8A 3S9MA 4NJQA 3NH8A 4P44A 2CTCA 3B3CA 1F2PA 4LQGA 2DEAA 1CP7A 4A94A 4ZYQA 1LFWA 2C6GA 3FH4A 1PYTB 2ZEHA 1YLOA 2I3CA 3PB6X 2WZNA 3RZAA 3KQXA 4P4FA 4BD9A 2PJ8A 3BHXA 1Y0YA 2PJBA 4MCSA 1F57A 3H8EA 1F2OA 2AFSA 3B3VA 1TKFA 1Z2LA 4NJRA 4UEEA 3NA6A 4OC0A 4A38A 3KL9A 1CX8A 3H8FA 4PXEA 5I4MA 2V8VA 1XRYA 2CIJA 2ZEGA 7CPAA 4OIWA 1HDUA 2PJ9A 4NFRA 3CPAA 4MMOA 4FBEA 1TF9A 1VHOA 3H8GA 4P4BA 3GLJA 3PFOA 4B6ZA 3WC5A 2AFZA 4UIAA 3JRUA 3PEIA 5IB9A 2ZELA 4ZY0A 4OC4A 3DLJA 1H8LA 3D7GA 3S9LA 5JH9A 3IIBA 4MHYA 3FVLA 2PJ5A 3MN8A 1IY7A 3RBUA 3WT4A 1DTDA 3PB8X 3FECA 1LCPA 2XEJA 4IAVA 1GYTA 2CF4A 1UWYA 3LWUA 1CPSA 3FF3A 2BCOA 1BPMA 2NSMA 3GB0A 1PCAA 3CT9A 2JEWA 2V77A 2ZEOA 4P6YA 4P4JA 1ELMP 3S9NA 1CPXA 3D67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EFD A;  4PXB A;  2O4H A;  4YU9 A;  4OID A;  5JM6 A;  8CPA A;  4NGM A;  1BPN A;  2IMO A;  1ARM A;  4X3R A;  2XEI A;  3KHX A;  3DGV A;  4OP4 A;  3KGQ A;  3L2N A;  3D66 A;  2AFX A;  3SJE A;  2ZEN A;  3IFE A;  4OC1 A;  1RTQ A;  3K2K A;  4F9U A;  4PQA A;  2PJ1 A;  3BI0 A;  1YW4 A;  1ZLH A;  1LAP A;  4ZY2 A;  4Z65 A;  3FX6 A;  3D7F A;  3SI2 A;  5K8N A;  2PJ6 A;  3ISX A;  3D4U A;  4FUU A;  2ZEE A;  4NGP A;  2JBK A;  2RB7 A;  2QJ8 A;  3GUX A;  3N5F A;  4IHM A;  4OC3 A;  2NYQ A;  4OC5 A;  3IO1 A;  4P4I A;  4OME A;  2Q4Z A;  4AXV A;  2ANP A;  3FED A;  3FJU A;  4NGR A;  2ZED A;  2PJ0 A;  2ZOF A;  1R43 A;  1XBU A;  3KQZ A;  4PPZ A;  1FNO A;  4O23 A;  4MHZ A;  4WWV A;  3KI9 A;  3ISZ A;  1Q7L A;  5F09 A;  3IC1 A;  2PE3 A;  1LAN A;  1TKJ A;  1DE4 C;  1QMU A;  2F8H A;  4ONW A;  4H2K A;  1YSJ A;  2BOA A;  1Z8L A;  1IGB A;  1Y0R A;  5K8M A;  2HB6 A;  2EK9 A;  2XEF A;  4EME A;  3WC6 A;  1OBR A;  2PRQ A;  3B2Y A;  3NFZ A;  4EWT A;  2GLF A;  1YME A;  5LYI A;  2PJC A;  1JQG A;  5CBM A;  3TC8 A;  1KWM A;  3V38 A;  4A39 A;  3NH5 A;  2V8D A;  2C6C A;  2POK A;  2AFW A;  2Q43 A;  3B3W A;  3VH9 A;  3B35 A;  2AFU A;  5LRJ A;  4DYO A;  2PJ2 A;  2EK8 A;  3B7I A;  4F8Z A;  1ELL P;  4P10 A;  4DUK A;  4GM5 A;  2C1C A;  4PXC A;  4PXD A;  5LYD A;  4ZI6 A;  3K9T A;  4R6T A;  4R7M A;  2IQ6 A;  4UEZ A;  3PB7 X;  5HXD A;  5HVF A;  1VIX A;  1XFO A;  4WJB A;  2F7V A;  3LMS A;  2IJZ A;  4UEF A;  1ARL A;  1QQ9 A;  4MRI A;  4X8I A;  1NSA A;  4G1P A;  3SJX A;  1LAM A;  1CBX A;  4NGT A;  1CG2 A;  1LOK A;  3PBB A;  1VHE A;  3PRT A;  3KZW A;  5J1Q A;  4P4E A;  2HC9 A;  2O53 A;  1BAV A;  1TXR A;  1ZG9 A;  4ZX9 A;  1R3N A;  3D68 A;  1M4L A;  2GLJ A;  3KHZ A;  4KSI A;  5LRG A;  1TKH A;  2C6P A;  2JBJ A;  5K8O A;  4W9Y A;  2PJ3 A;  3D7D A;  3IJ3 A;  3SJF A;  5K8P A;  3V7Z A;  2PJ4 A;  1BLL E;  3FEE A;  3WC7 A;  3D7H A;  2V8H A;  1TF8 A;  3WAB A;  4RUH A;  2BO9 A;  4UF4 A;  4FAI A;  3B3S A;  1YW6 A;  5ELY A;  2G9D A;  4MCP A;  4YWY A;  4MHP A;  2RFH A;  4FWU A;  3BI1 A;  3NH4 A;  5HVG A;  5LYF A;  4ZX8 A;  3IWW A;  2OR4 A;  4X2T A;  3PBE A;  5LRK A;  1EE3 P;  2GU2 A;  2WYR A;  3KR4 A;  4JZ0 A;  4Q7A A;  6CPA A;  4A37 A;  3TX8 A;  2QYV A;  2PJA A;  1XMB A;  3VAR A;  2ZEF A;  3HUV A;  5JGF A;  3CPX A;  3T8W A;  4NGS A;  3KAS A;  2ZEP A;  1CP6 A;  2PJ7 A;  5D8N A;  3PB4 X;  5D29 A;  2PVV A;  3PFE A;  1ZLI A;  2AFO A;  4JYW A;  1Y7E A;  5THW A;  2AFM A;  2CTB A;  3RAM A;  2QVP A;  5DS0 A;  2XEG A;  1HDQ A;  2VL1 A;  4TNU A;  4CPA A;  1ZG7 A;  1AMP A;  2J9A A;  2FVG A;  4R8F A;  4TWE A;  4MCR A;  4OKO A;  3HLP A;  2Q51 A;  3I1U A;  4MCQ A;  3B3T A;  2PVW A;  4F9V A;  3FMC A;  2ZOG A;  3VAT A;  4NGQ A;  1Z5R A;  2V8G A;  3MRU A;  4MHN A;  3CDX A;  3PB9 X;  2PIY A;  1FT7 A;  3KR5 A;  4K3N A;  4P45 A;  1XJO A;  2GRE A;  3IEH A;  4NGN A;  2OOT A;  4P4D A;  2EWB A;  4MXU A;  4IK2 A;  4R76 A;  5HVH A;  3QNV A;  5LYL A;  4OC2 A;  1VGY A;  2ZEM A;  2PCU A;  3BXM A;  2ABZ A;  3SI0 A;  3SI1 A;  4ZY1 A;  2PIZ A;  1HEE A;  4DJL A;  5CPA A;  3SJG A;  4UIB A;  1AYE A;  1ZG8 A;  3S9M A;  4NJQ A;  3NH8 A;  4P44 A;  2CTC A;  3B3C A;  1F2P A;  4LQG A;  2DEA A;  1CP7 A;  4A94 A;  4ZYQ A;  1LFW A;  2C6G A;  3FH4 A;  1PYT B;  2ZEH A;  1YLO A;  2I3C A;  3PB6 X;  2WZN A;  3RZA A;  3KQX A;  4P4F A;  4BD9 A;  2PJ8 A;  3BHX A;  1Y0Y A;  2PJB A;  4MCS A;  1F57 A;  3H8E A;  1F2O A;  2AFS A;  3B3V A;  1TKF A;  1Z2L A;  4NJR A;  4UEE A;  3NA6 A;  4OC0 A;  4A38 A;  3KL9 A;  1CX8 A;  3H8F A;  4PXE A;  5I4M A;  2V8V A;  1XRY A;  2CIJ A;  2ZEG A;  7CPA A;  4OIW A;  1HDU A;  2PJ9 A;  4NFR A;  3CPA A;  4MMO A;  4FBE A;  1TF9 A;  1VHO A;  3H8G A;  4P4B A;  3GLJ A;  3PFO A;  4B6Z A;  3WC5 A;  2AFZ A;  4UIA A;  3JRU A;  3PEI A;  5IB9 A;  2ZEL A;  4ZY0 A;  4OC4 A;  3DLJ A;  1H8L A;  3D7G A;  3S9L A;  5JH9 A;  3IIB A;  4MHY A;  3FVL A;  2PJ5 A;  3MN8 A;  1IY7 A;  3RBU A;  3WT4 A;  1DTD A;  3PB8 X;  3FEC A;  1LCP A;  2XEJ A;  4IAV A;  1GYT A;  2CF4 A;  1UWY A;  3LWU A;  1CPS A;  3FF3 A;  2BCO A;  1BPM A;  2NSM A;  3GB0 A;  1PCA A;  3CT9 A;  2JEW A;  2V77 A;  2ZEO A;  4P6Y A;  4P4J A;  1ELM P;  3S9N A;  1CPX A;  3D67 A; 
#chains in the Genus database with same CATH topology
 4EFD A;  2P6E A;  4PXB A;  2BUE A;  5H84 A;  2O4H A;  4YU9 A;  4OID A;  3QAY A;  3GY9 A;  1A2Z A;  4MFL A;  5J8F A;  8CPA A;  4MFZ A;  5JM6 A;  4AVA A;  1IOF A;  4RS2 A;  3DNS A;  4NGM A;  1BPN A;  2IMO A;  1ARM A;  4X3R A;  2XEI A;  4CAV A;  3KHX A;  3D3S A;  3DGV A;  2ZW6 A;  4OP4 A;  3KGQ A;  2OZG A;  2Q0Y A;  3D66 A;  3L2N A;  2AFX A;  4U9Z A;  3SJE A;  1S3Z A;  2ZEN A;  1AUG A;  3IFE A;  1RTQ A;  2B3U A;  3CXQ A;  3K2K A;  3DR8 A;  1LRZ A;  4OC1 A;  2Q44 A;  4F9U A;  4KOU A;  4PQA A;  2PJ1 A;  3BI0 A;  1YVK A;  1YW4 A;  2B4D A;  2YND A;  1ZLH A;  1LAP A;  4K30 A;  4ZY2 A;  3R9G A;  4Z65 A;  1JWQ A;  3JVN A;  4II9 A;  3FBU A;  3FX6 A;  3D7F A;  3SI2 A;  3I9S A;  4Q36 A;  3PP9 A;  5K8N A;  4FD6 A;  3DR6 A;  4LUA A;  1RO5 A;  2PJ6 A;  3ISX A;  4R3L A;  3D4U A;  4FUU A;  4KOX A;  1IU8 A;  2F5I A;  1X10 A;  2ZEE A;  5G1Z A;  2J8M A;  3V8I A;  4NGP A;  3EO4 A;  4B10 A;  4PSW A;  2JBK A;  2FXF A;  3LD2 A;  2RB7 A;  2ARH A;  2QJ8 A;  3GUX A;  3N5F A;  4CAE A;  2Z3N A;  5AG4 A;  2R98 A;  2PRB A;  3W6X A;  4CRZ B;  4IHM A;  4OC3 A;  4HKF A;  2NYQ A;  4OC5 A;  4PV6 A;  3IO1 A;  1XF8 A;  1Z8W A;  4OME A;  4P4I A;  2DXQ A;  2Q4Z A;  1Y9K A;  1K4J A;  4AXV A;  2P6G A;  2ANP A;  2K5T A;  3FJU A;  3FED A;  1Z8T A;  3TTH A;  4NGR A;  2ZED A;  3IGR A;  2Z3P A;  2YNC A;  2JLM A;  2PJ0 A;  2ZOF A;  1R43 A;  1XBU A;  3KQZ A;  4PPZ A;  4CGP A;  1FNO A;  2JEV A;  4O23 A;  4OAE A;  5EBV A;  4MHZ A;  3A9L A;  3C26 A;  4MJ8 A;  4WWV A;  1I12 A;  3KI9 A;  3ISZ A;  1Q7L A;  5F09 A;  3RYO A;  5KTD A;  3NE7 A;  2DF5 A;  3IC1 A;  4B5P A;  3WR7 A;  2PE3 A;  1LAN A;  4CRY B;  3GKR A;  1TKJ A;  4NSQ A;  4C7I A;  1DE4 C;  1QMU A;  2F8H A;  4CGN A;  3CXP A;  4BIN A;  4ONW A;  4H2K A;  1YSJ A;  2BOA A;  5A27 A;  2HUZ A;  1Z8L A;  1IGB A;  1Y0R A;  1PUA A;  2NMT A;  2HB6 A;  4XNH C;  2EK9 A;  1IYK A;  2Q7B A;  5K8M A;  2XEF A;  2Q4Y A;  4EME A;  1TIQ A;  5AG6 A;  3WC6 A;  1OBR A;  4CAX A;  5G20 A;  4FD4 A;  2R8V A;  5EC4 A;  1XMT A;  2PRQ A;  3B2Y A;  2B4D B;  5ISV A;  3NFZ A;  4EWT A;  2GLF A;  1YME A;  5F49 A;  5LYI A;  2PJC A;  4KLV A;  1JQG A;  4IUS A;  1CM0 A;  3R95 A;  5CBM A;  3TC8 A;  2YNC C;  2X7B A;  2GIV A;  4MI4 A;  3FRM A;  1KWM A;  3FNC A;  3V38 A;  4AVC A;  4MY0 A;  2WSA A;  4A39 A;  3NH5 A;  4F0X A;  2V8D A;  3EC4 A;  4XNH B;  4PSX A;  3FB3 A;  2C6C A;  3IWG A;  2DPT A;  4B5O A;  3EXN A;  1R57 A;  3G8W A;  2POK A;  2AFW A;  2Q43 A;  3K9U A;  4C2X A;  3F0A A;  2B5G A;  3B3W A;  3VH9 A;  3R1K A;  3H5Z A;  4AG7 A;  3B35 A;  4DNC A;  2AFU A;  5LRJ A;  1P0H A;  4DYO A;  3TO9 A;  2JDD A;  4L8A A;  4CYN A;  2PJ2 A;  2EK8 A;  3B7I A;  5G21 A;  2QEC A;  4KSA A;  4F8Z A;  1ELL P;  3N7Z A;  3JTK A;  1Q2D A;  4P10 A;  3SHP A;  1SQH A;  3TOB A;  2Z0Z A;  2EUI A;  4DUK A;  4UFX A;  4GM5 A;  2C1C A;  4HPS A;  4PXC A;  4PXD A;  1Z4R A;  1IYL A;  2Z3K A;  2PDO A;  4UFW A;  5LYD A;  4ZI6 A;  3K9T A;  1YGH A;  4R6T A;  2IQ6 A;  4R7M A;  4UEZ A;  4Y49 C;  2B58 A;  3MGD A;  3PB7 X;  4B5P B;  5JPH A;  4M3S A;  4CYQ A;  5HXD A;  5HVF A;  1VIX A;  1XFO A;  4KOT A;  4WJB A;  2F7V A;  1XEB A;  1WK4 A;  3LMS A;  4KSF A;  1B87 A;  2IJZ A;  4UEF A;  1ARL A;  2YGW A;  3R96 A;  1QQ9 A;  4MRI A;  1BO4 A;  4CS0 B;  2P6F A;  4XPD B;  4B11 A;  4C2Z A;  4X8I A;  2O28 A;  1NSA A;  3IWE A;  1QSO A;  2FIW A;  4G1P A;  4CYO A;  3SJX A;  1LAM A;  2OZU A;  1VKC A;  1CBX A;  4A95 A;  1QST A;  4NGT A;  4QB9 A;  5DWN A;  1CG2 A;  1LOK A;  2OU2 A;  4XPK A;  5I0C A;  2QML A;  3PBB A;  1Y7R A;  2GAN A;  4B13 A;  4E8O A;  5CNP A;  5HH1 A;  2OB0 A;  3SXN A;  1VHE A;  3PRT A;  1RXT A;  4X5K A;  4CAW A;  3KZW A;  5DWM A;  2B3V A;  4P4E A;  1Y9W A;  2HC9 A;  2O53 A;  5J1Q A;  3B8G A;  1XE4 A;  3FIX A;  1BAV A;  1BOB A;  5IV0 A;  1TXR A;  2Z3L A;  1ZG9 A;  4ZX9 A;  1R3N A;  4JJX A;  3D68 A;  1M4L A;  1PU9 A;  2GLJ A;  2Y0M A;  3KHZ A;  4JWP A;  5FVJ A;  4KSI A;  4KVX A;  2VXK A;  1TKH A;  4KOS A;  5LRG A;  3TO7 A;  2C6P A;  2JBJ A;  4NEX A;  5K8O A;  4NXY A;  2VZY A;  2PJ3 A;  4QUS A;  4W9Y A;  1IOI A;  3D7D A;  5F46 A;  2REE A;  3IJ3 A;  4ZBG A;  4B12 A;  2B5G B;  3SJF A;  4KLW A;  4RN7 A;  4UWJ A;  2I00 A;  5K8P A;  2FSR A;  4U9Y A;  3V7Z A;  2ZW4 A;  2PJ4 A;  2CY2 A;  4BMH A;  1BLL E;  1VHS A;  3KKW A;  2VZZ A;  3FEE A;  2ZW5 A;  3LAC A;  4J3G A;  4LQ6 A;  3WC7 A;  4AG9 A;  3D7H A;  2YNE A;  4LX9 A;  1CJW A;  1QSN A;  2V8H A;  2VEZ A;  1TF8 A;  3WAB A;  5A28 A;  2ODF A;  4MFQ A;  3IU2 A;  4RUH A;  2Z10 A;  3I3G A;  2ATR A;  2BO9 A;  4KVO E;  4UF4 A;  1B6B A;  4FAI A;  3H4Q A;  3E0K A;  1YQE A;  3B3S A;  2ZW7 A;  1YW6 A;  2BEI A;  5ELY A;  1S7L A;  2G9D A;  4HNX B;  4HNY B;  1Q2C A;  4JXR A;  4MCP A;  4R9M A;  2IL4 A;  4YWY A;  1Z8X A;  1X12 A;  4MHP A;  2RFH A;  4U5Y A;  2FCK A;  4FWU A;  3NE8 A;  3BI1 A;  3NH4 A;  3R9E A;  5HVG A;  5LYF A;  4ZX8 A;  1KUV A;  3IWW A;  1L0C A;  2OR4 A;  4MFK A;  4X2T A;  3PBE A;  2R7H A;  5LRK A;  1EE3 P;  5J8C A;  2AJ6 A;  2GU2 A;  2WYR A;  3KR4 A;  4FD7 A;  2WUU A;  4JZ0 A;  4OLL A;  4E0A A;  4AVB A;  4Q7A A;  4JD6 A;  6CPA A;  4MBU A;  1M1D A;  2R1I A;  2WPW A;  3TT2 A;  3TX8 A;  2AE6 A;  2QYV A;  4A37 A;  1FY7 A;  3TCV A;  2PC1 A;  2PJA A;  2J8R A;  1U6M A;  1XMB A;  2FL4 A;  4KOY A;  3VAR A;  2ZEF A;  3HUV A;  1KUX A;  5JGF A;  3PZJ A;  3CPX A;  3T8W A;  4NGS A;  1UFH A;  2FS5 A;  3KAS A;  4R3K A;  1YK3 A;  2ZEP A;  1CP6 A;  2HV2 A;  3W6S A;  5F48 A;  5C88 A;  2PJ7 A;  1ON0 A;  5D8N A;  3PB4 X;  4C68 A;  4JXQ A;  3DSB A;  4PK3 A;  5D29 A;  2PVV A;  4ORF A;  3PFE A;  1KUY A;  3ZJ0 A;  1ZLI A;  2AFO A;  4GS4 A;  4JYW A;  5AG5 A;  1NSL A;  1Y7E A;  3R9F A;  4GXH A;  1KZF A;  1Z9U A;  1I1D A;  2GFQ A;  3CZX A;  5THW A;  2AFM A;  2CTB A;  4YGO A;  4CGO A;  3RAM A;  2QVP A;  3VWE A;  5DS0 A;  3S6K A;  4OAD A;  2XEG A;  1HDQ A;  1Q2Y A;  2VL1 A;  3DDD A;  4TNU A;  2G3T A;  1M4I A;  3S6H A;  4CPA A;  2CNS A;  1S60 A;  1ZG7 A;  3PGP A;  4QVT A;  1AMP A;  2J9A A;  4UCP A;  1MK4 A;  2FVG A;  3TOA A;  4R8F A;  4TWE A;  1I21 A;  4MCR A;  3FYN A;  4OKO A;  1GHE A;  3JUW A;  3HLP A;  2Q51 A;  3I1U A;  4MCQ A;  4IF5 A;  4MFP A;  3B3T A;  2VBQ A;  2FE7 A;  4NCZ A;  3BLN A;  2PVW A;  3FXT A;  4F9V A;  3FMC A;  5KTA A;  2ZOG A;  3S6G A;  3VAT A;  4A33 A;  4Q38 A;  2EVN A;  1YLE A;  3F8K A;  5HMN A;  1S7N A;  3EFA A;  5EMI A;  5BWA B;  5E96 A;  4CAF A;  4F6A A;  4E2A A;  4NGQ A;  1Z5R A;  2EBJ A;  2V8G A;  1J4J A;  3MRU A;  4MHN A;  3CDX A;  3PB9 X;  2PIY A;  1FT7 A;  3KR5 A;  4PK2 A;  4K3N A;  3QB8 A;  4P45 A;  1XJO A;  2H5M A;  2GRE A;  3G3S A;  3IEH A;  4KOW A;  2BL1 A;  4H6U A;  4NGN A;  2OOT A;  3GIU A;  4P4D A;  4KUB A;  2EWB A;  4MXU A;  2Q04 A;  4ONU A;  5AG7 A;  2QIR A;  4Y49 B;  5F47 A;  2CNT A;  3D2M A;  4HNW B;  4IK2 A;  2WPX A;  3P2H A;  2ZXV A;  4R76 A;  5HVH A;  3QNV A;  5LYL A;  1IB1 E;  4OC2 A;  1VGY A;  1XOV A;  2PCU A;  2VI7 A;  2ZEM A;  3W91 A;  2P0W A;  2ABZ A;  3BXM A;  4R57 A;  3SI0 A;  3SI1 A;  3BJ8 A;  4ZY1 A;  2Z3M A;  2PIZ A;  3UY5 A;  1HEE A;  4DJL A;  2DPS A;  5CPA A;  3SJG A;  5KTC A;  4M85 A;  4UFV A;  2CXA A;  1AYE A;  4UIB A;  2A4N A;  2J8N A;  1ZG8 A;  3S9M A;  4A31 A;  4F0Y A;  4NJQ A;  4CYP A;  2OZH A;  3NH8 A;  5C82 A;  4P44 A;  2CTC A;  3BJ7 A;  3B3C A;  1IID A;  1F2P A;  1YR0 A;  4LQG A;  2REF A;  2DEA A;  2Z11 A;  1CP7 A;  4UCN A;  4A94 A;  2OH1 A;  3VWD A;  4ZYQ A;  1LFW A;  2C6G A;  3FH4 A;  4UCM A;  3SXO A;  1PYT B;  2ZEH A;  2FT0 A;  1YLO A;  2I3C A;  3PB6 X;  2WZN A;  3RZA A;  3KQX A;  4BBH A;  4B14 A;  4P4F A;  5GCN A;  4BD9 A;  2PJ8 A;  3BHX A;  4KVM E;  1Y0Y A;  3IU1 A;  4MFJ A;  4M6H A;  4I49 A;  4YFJ A;  4JLY A;  3RO0 A;  2PJB A;  3T9Y A;  2GE3 A;  3GYA A;  4MCS A;  5IB0 A;  2JDC A;  2G0B A;  1F57 A;  1M4G A;  3H8E A;  1F2O A;  2B4B A;  1YX0 A;  2AFS A;  3B3V A;  1TKF A;  1Z2L A;  4NJR A;  4UEE A;  3NA6 A;  4M6G A;  4C2Y A;  4CGL A;  4OC0 A;  5AGE A;  4H89 A;  3KL9 A;  4A38 A;  1CX8 A;  2KCW A;  3H8F A;  4PXE A;  5I4M A;  1ZO0 A;  2D4O A;  2I79 A;  4MY3 A;  3RNZ A;  2D4P A;  2V8V A;  4YRH A;  1XRY A;  5JQ4 A;  3S6F A;  4C7H A;  2CIJ A;  2C27 A;  3D8P A;  2Q7S A;  2ZEG A;  4UWI A;  7CPA A;  4OIW A;  1HDU A;  2PJ9 A;  4NFR A;  3CPA A;  2RC4 A;  4MMO A;  1QSR A;  2ZPA A;  3TE4 A;  4QBJ A;  1M44 A;  4KOR A;  3LOD A;  4RI1 A;  4FBE A;  2BSW A;  1TF9 A;  3OWC A;  1VHO A;  4M6I A;  1YVO A;  3T90 A;  2Q4V A;  2PR1 A;  2PSW A;  1S7K A;  1XIX A;  4EVY A;  3H8G A;  4P4B A;  4A32 A;  5H86 A;  3GLJ A;  3PFO A;  3P2F A;  1MJA A;  4B6Z A;  1MJ9 A;  3WC5 A;  2AFZ A;  1OZP A;  1YRE A;  2PR8 A;  4UIA A;  4ZGY B;  3JRU A;  3PEI A;  4KUA A;  4A30 A;  5IB9 A;  2PQ8 A;  2ZEL A;  4KOV A;  4ZY0 A;  4AB7 A;  4NF1 A;  4OC4 A;  1P4N A;  3DLJ A;  1H8L A;  4R87 A;  3TFY A;  4QC6 A;  5IX3 A;  1N71 A;  3D7G A;  3S9L A;  1NE9 A;  1S7F A;  2FIA A;  5JH9 A;  4UA3 A;  2G3A A;  2Z3O A;  2HQY A;  3IIB A;  1IIC A;  3FVL A;  4MHY A;  2PJ5 A;  2VQY A;  1IY7 A;  3F5B A;  3MN8 A;  3RBU A;  3ZZI A;  2EO8 A;  4A2Z A;  1S5K A;  3WT4 A;  1V0C A;  1DTD A;  3PB8 X;  4KZT A;  3FEC A;  1LCP A;  1MJB A;  2XEJ A;  4IAV A;  4KS9 A;  4MHD A;  5G22 A;  3EY5 A;  1GYT A;  4H6Z A;  4L89 A;  1Z4E A;  1WWZ A;  3CXS A;  2CF4 A;  2CNM A;  3D2P A;  1UWY A;  3LWU A;  1NMT A;  1CPS A;  4UBR A;  3FF3 A;  2BCO A;  4XPL A;  3TO6 A;  1BPM A;  1QSM A;  2NSM A;  3GB0 A;  1PCA A;  3CT9 A;  2JEW A;  2V77 A;  2ZEO A;  4P6Y A;  4P4J A;  1ELM P;  3S9N A;  1M4D A;  3QAH A;  4FD5 A;  4XPD C;  1CPX A;  3D67 A;  4CGM A; 
#chains in the Genus database with same CATH homology
 4EFD A;  4PXB A;  2O4H A;  4YU9 A;  4OID A;  5JM6 A;  8CPA A;  4NGM A;  1BPN A;  2IMO A;  1ARM A;  4X3R A;  2XEI A;  3KHX A;  3DGV A;  4OP4 A;  3KGQ A;  3L2N A;  3D66 A;  2AFX A;  3SJE A;  2ZEN A;  3IFE A;  4OC1 A;  1RTQ A;  3K2K A;  4F9U A;  4PQA A;  2PJ1 A;  3BI0 A;  1YW4 A;  1ZLH A;  1LAP A;  4ZY2 A;  4Z65 A;  3FX6 A;  3D7F A;  3SI2 A;  5K8N A;  2PJ6 A;  3ISX A;  3D4U A;  4FUU A;  2ZEE A;  4NGP A;  2JBK A;  2RB7 A;  2QJ8 A;  3GUX A;  3N5F A;  4IHM A;  4OC3 A;  2NYQ A;  4OC5 A;  3IO1 A;  4P4I A;  4OME A;  2Q4Z A;  4AXV A;  2ANP A;  3FED A;  3FJU A;  4NGR A;  2ZED A;  2PJ0 A;  2ZOF A;  1R43 A;  1XBU A;  3KQZ A;  4PPZ A;  1FNO A;  4O23 A;  4MHZ A;  4WWV A;  3KI9 A;  3ISZ A;  1Q7L A;  5F09 A;  3IC1 A;  2PE3 A;  1LAN A;  1TKJ A;  1DE4 C;  1QMU A;  2F8H A;  4ONW A;  4H2K A;  1YSJ A;  2BOA A;  1Z8L A;  1IGB A;  1Y0R A;  5K8M A;  2HB6 A;  2EK9 A;  2XEF A;  4EME A;  3WC6 A;  1OBR A;  2PRQ A;  3B2Y A;  3NFZ A;  4EWT A;  2GLF A;  1YME A;  5LYI A;  2PJC A;  1JQG A;  5CBM A;  3TC8 A;  1KWM A;  3V38 A;  4A39 A;  3NH5 A;  2V8D A;  2C6C A;  2POK A;  2AFW A;  2Q43 A;  3B3W A;  3VH9 A;  3B35 A;  2AFU A;  5LRJ A;  4DYO A;  2PJ2 A;  2EK8 A;  3B7I A;  4F8Z A;  1ELL P;  4P10 A;  4DUK A;  4GM5 A;  2C1C A;  4PXC A;  4PXD A;  5LYD A;  4ZI6 A;  3K9T A;  4R6T A;  4R7M A;  2IQ6 A;  4UEZ A;  3PB7 X;  5HXD A;  5HVF A;  1VIX A;  1XFO A;  4WJB A;  2F7V A;  3LMS A;  2IJZ A;  4UEF A;  1ARL A;  1QQ9 A;  4MRI A;  4X8I A;  1NSA A;  4G1P A;  3SJX A;  1LAM A;  1CBX A;  4NGT A;  1CG2 A;  1LOK A;  3PBB A;  1VHE A;  3PRT A;  3KZW A;  5J1Q A;  4P4E A;  2HC9 A;  2O53 A;  1BAV A;  1TXR A;  1ZG9 A;  4ZX9 A;  1R3N A;  3D68 A;  1M4L A;  2GLJ A;  3KHZ A;  4KSI A;  5LRG A;  1TKH A;  2C6P A;  2JBJ A;  5K8O A;  4W9Y A;  2PJ3 A;  3D7D A;  3IJ3 A;  3SJF A;  5K8P A;  3V7Z A;  2PJ4 A;  1BLL E;  3FEE A;  3WC7 A;  3D7H A;  2V8H A;  1TF8 A;  3WAB A;  4RUH A;  2BO9 A;  4UF4 A;  4FAI A;  3B3S A;  1YW6 A;  5ELY A;  2G9D A;  4MCP A;  4YWY A;  4MHP A;  2RFH A;  4FWU A;  3BI1 A;  3NH4 A;  5HVG A;  5LYF A;  4ZX8 A;  3IWW A;  2OR4 A;  4X2T A;  3PBE A;  5LRK A;  1EE3 P;  2GU2 A;  2WYR A;  3KR4 A;  4JZ0 A;  4Q7A A;  6CPA A;  4A37 A;  3TX8 A;  2QYV A;  2PJA A;  1XMB A;  3VAR A;  2ZEF A;  3HUV A;  5JGF A;  3CPX A;  3T8W A;  4NGS A;  3KAS A;  2ZEP A;  1CP6 A;  2PJ7 A;  5D8N A;  3PB4 X;  5D29 A;  2PVV A;  3PFE A;  1ZLI A;  2AFO A;  4JYW A;  1Y7E A;  5THW A;  2AFM A;  2CTB A;  3RAM A;  2QVP A;  5DS0 A;  2XEG A;  1HDQ A;  2VL1 A;  4TNU A;  4CPA A;  1ZG7 A;  1AMP A;  2J9A A;  2FVG A;  4R8F A;  4TWE A;  4MCR A;  4OKO A;  3HLP A;  2Q51 A;  3I1U A;  4MCQ A;  3B3T A;  2PVW A;  4F9V A;  3FMC A;  2ZOG A;  3VAT A;  4NGQ A;  1Z5R A;  2V8G A;  3MRU A;  4MHN A;  3CDX A;  3PB9 X;  2PIY A;  1FT7 A;  3KR5 A;  4K3N A;  4P45 A;  1XJO A;  2GRE A;  3IEH A;  4NGN A;  2OOT A;  4P4D A;  2EWB A;  4MXU A;  4IK2 A;  4R76 A;  5HVH A;  3QNV A;  5LYL A;  4OC2 A;  1VGY A;  2ZEM A;  2PCU A;  3BXM A;  2ABZ A;  3SI0 A;  3SI1 A;  4ZY1 A;  2PIZ A;  1HEE A;  4DJL A;  5CPA A;  3SJG A;  4UIB A;  1AYE A;  1ZG8 A;  3S9M A;  4NJQ A;  3NH8 A;  4P44 A;  2CTC A;  3B3C A;  1F2P A;  4LQG A;  2DEA A;  1CP7 A;  4A94 A;  4ZYQ A;  1LFW A;  2C6G A;  3FH4 A;  1PYT B;  2ZEH A;  1YLO A;  2I3C A;  3PB6 X;  2WZN A;  3RZA A;  3KQX A;  4P4F A;  4BD9 A;  2PJ8 A;  3BHX A;  1Y0Y A;  2PJB A;  4MCS A;  1F57 A;  3H8E A;  1F2O A;  2AFS A;  3B3V A;  1TKF A;  1Z2L A;  4NJR A;  4UEE A;  3NA6 A;  4OC0 A;  4A38 A;  3KL9 A;  1CX8 A;  3H8F A;  4PXE A;  5I4M A;  2V8V A;  1XRY A;  2CIJ A;  2ZEG A;  7CPA A;  4OIW A;  1HDU A;  2PJ9 A;  4NFR A;  3CPA A;  4MMO A;  4FBE A;  1TF9 A;  1VHO A;  3H8G A;  4P4B A;  3GLJ A;  3PFO A;  4B6Z A;  3WC5 A;  2AFZ A;  4UIA A;  3JRU A;  3PEI A;  5IB9 A;  2ZEL A;  4ZY0 A;  4OC4 A;  3DLJ A;  1H8L A;  3D7G A;  3S9L A;  5JH9 A;  3IIB A;  4MHY A;  3FVL A;  2PJ5 A;  3MN8 A;  1IY7 A;  3RBU A;  3WT4 A;  1DTD A;  3PB8 X;  3FEC A;  1LCP A;  2XEJ A;  4IAV A;  1GYT A;  2CF4 A;  1UWY A;  3LWU A;  1CPS A;  3FF3 A;  2BCO A;  1BPM A;  2NSM A;  3GB0 A;  1PCA A;  3CT9 A;  2JEW A;  2V77 A;  2ZEO A;  4P6Y A;  4P4J A;  1ELM P;  3S9N A;  1CPX A;  3D67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...