2V8GA

Crystal structure of beta-alanine synthase from saccharomyces kluyveri in complex with the product beta-alanine
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
432
structure length
432
Chain Sequence
PLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGHQFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Yeast -Alanine Synthase Complexes Reveal the Mode of Substrate Binding and Large Scale Domain Closure Movements.
pubmed doi rcsb
source organism Saccharomyces kluyveri
molecule tags Hydrolase
molecule keywords BETA-ALANINE SYNTHASE
total genus 158
structure length 432
sequence length 432
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v8gA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2v8gA01
4P4BA 2ZELA 3GLJA 4G1PA 4H2KA 1ZLHA 1XRYA 1IGBA 1TKJA 3FECA 2PVWA 2C6GA 4NGMA 3IO1A 1LANA 3H8GA 2V8VA 3MRUA 2J9AA 4K3NA 3B3TA 2ZOGA 2NYQA 1CP7A 2Q4ZA 5HVHA 3T8WA 4UEZA 1Z5RA 3VH9A 4PXBA 2CIJA 4A39A 4DUKA 1LAPA 3N5FA 4P45A 1VHEA 4IHMA 4ZY1A 1YSJA 3KR5A 1CX8A 1TF9A 2EK9A 2ZEHA 2V8DA 2C6CA 3PB8X 2Q43A 2EK8A 3D4UA 2PJ2A 2EWBA 3WC6A 3FMCA 4NJRA 1ZG8A 4IAVA 3V7ZA 3TC8A 4PQAA 2GU2A 3NH5A 4OIWA 4EWTA 1PYTB 4OC0A 3KHXA 4UIAA 3KHZA 4P4EA 3S9MA 1XMBA 2ZEGA 1YMEA 4YWYA 2AFUA 4ZY2A 2OOTA 1LAMA 1F57A 3ISZA 3FX6A 1VHOA 3KR4A 2PJBA 2GLJA 2QVPA 1R43A 3CPXA 4OC5A 5LRKA 3HUVA 1TKFA 2PJ3A 4JZ0A 4MRIA 2AFXA 3GUXA 4P4DA 4MCRA 4UIBA 1YW6A 4R76A 4CPAA 3B2YA 1YLOA 3WC7A 1Z8LA 4PPZA 3PB6X 2BCOA 4ZX8A 4MHYA 4PXCA 1QQ9A 5DS0A 2PJ7A 2XEIA 4R8FA 4EMEA 2O53A 4GM5A 1QMUA 2PIZA 1ELMP 3PBEA 4MMOA 1CG2A 2ZEOA 3CDXA 3RAMA 3H8EA 4WWVA 3PB9X 2C1CA 5LYLA 3I1UA 1BLLE 2ZEDA 1HDUA 5IB9A 1XBUA 1XFOA 1CPSA 2ZEMA 3QNVA 4NGRA 1IY7A 1NSAA 3B3WA 3SI2A 3ISXA 1YW4A 2V8HA 3LWUA 4P10A 4PXEA 4PXDA 1M4LA 3DGVA 2HC9A 3MN8A 1Z2LA 2NSMA 1LOKA 6CPAA 3FF3A 2QJ8A 1TF8A 4WJBA 5ELYA 3KGQA 2XEJA 3D7DA 4ZI6A 3SI0A 4NGTA 2QYVA 4X3RA 1H8LA 1R3NA 2BO9A 4F9UA 2AFMA 2GREA 3D67A 4Z65A 5F09A 2V77A 3PRTA 5JGFA 2PJ8A 2PJCA 4UEEA 1AYEA 5LYFA 3IWWA 2IQ6A 2WYRA 3SI1A 4Q7AA 2JBKA 3NFZA 2BOAA 1BPNA 3KQXA 1Y7EA 2C6PA 1Q7LA 1CP6A 1VIXA 3D7FA 3RBUA 4OC1A 4OIDA 2DEAA 1ELLP 1CPXA 3WABA 4X8IA 3RZAA 2WZNA 4B6ZA 4O23A 2V8GA 3D66A 3IJ3A 4OMEA 3KASA 3PEIA 4KSIA 1RTQA 5LRJA 3VATA 3CT9A 4MCSA 4IK2A 5CPAA 5LRGA 8CPAA 3NH4A 2CF4A 5LYIA 4MHNA 3SJFA 4NJQA 4ONWA 5JM6A 3DLJA 3IIBA 2PJAA 2AFZA 2XEFA 4TWEA 1F2OA 4NGSA 3FH4A 4P44A 2PJ6A 1BAVA 4FUUA 3PB7X 2I3CA 2ZEEA 2PJ4A 3D7HA 2HB6A 1ZG9A 2JEWA 3TX8A 3IEHA 3D7GA 4MCQA 5I4MA 2IJZA 1VGYA 4MXUA 4ZYQA 5LYDA 5HVFA 1LCPA 3IFEA 3IC1A 2ZEFA 1HDQA 4P4FA 3B35A 2PJ9A 4MHZA 4BD9A 1TXRA 4LQGA 4FWUA 4MHPA 4OC4A 3B3CA 2ZENA 1FNOA 3FJUA 4FBEA 3BI1A 1DTDA 4A38A 2GLFA 4P6YA 2PJ1A 5JH9A 5D29A 3S9LA 1ARMA 3PBBA 3H8FA 2XEGA 3B7IA 2PVVA 5THWA 1AMPA 3HLPA 3KQZA 5CBMA 3CPAA 2CTBA 1UWYA 5K8NA 2Q51A 2RB7A 4RUHA 4NGPA 4A94A 4EFDA 4YU9A 4TNUA 2JBJA 4OC2A 4A37A 4DJLA 4DYOA 1LFWA 2ZOFA 3NA6A 3LMSA 3FEEA 4NGQA 3SJEA 1DE4C 2OR4A 3KI9A 1Y0RA 1PCAA 2O4HA 3BHXA 3KZWA 4UF4A 3WC5A 2AFSA 3SJXA 1XJOA 7CPAA 1Y0YA 2ANPA 1JQGA 3FVLA 4P4IA 4UEFA 1BPMA 2POKA 2FVGA 5J1QA 3GB0A 3FEDA 4FAIA 2CTCA 4X2TA 3B3VA 4OKOA 2F7VA 2F8HA 3D68A 4R6TA 4NFRA 2RFHA 3PFOA 2AFWA 1ZG7A 1HEEA 5K8OA 2ZEPA 4ZY0A 1OBRA 1CBXA 5K8MA 4NGNA 1EE3P 3S9NA 4F9VA 5HXDA 1TKHA 2PE3A 3PB4X 3PFEA 4JYWA 4ZX9A 3K9TA 2PJ5A 5HVGA 3K2KA 1FT7A 3VARA 3NH8A 4W9YA 5D8NA 1ZLIA 1F2PA 2AFOA 3B3SA 2PRQA 2VL1A 2G9DA 4R7MA 4AXVA 3SJGA 4OP4A 1ARLA 4MCPA 3KL9A 1GYTA 2ABZA 4P4JA 3WT4A 2IMOA 5K8PA 2PJ0A 3BI0A 2PCUA 3V38A 3JRUA 4OC3A 3L2NA 2PIYA 1KWMA 3BXMA 4F8ZA
chains in the Genus database with same CATH superfamily
4MH8A 4G1PA 5KFKA 4N8OA 1QSMA 4AL7A 5KT7A 2RILA 2NXUA 4H4KA 4DUYJ 4FKYA 5A8KA 4ZVFA 3RBZA 3CCSS 4NPOA 2EFVA 3SXLA 4DR6J 1JLAA 5JPHA 3BSAA 3GE9A 3RJMB 1FEEA 1ZOTA 2CQ0A 4ZIVA 2OU2A 4DFMA 1RTHB 2Z0ZA 3GV8B 5AXMA 2WZ1A 4LSNB 3KDOA 2EK8A 3VAFA 3TUJC 3WX4A 4FYVB 5KFHA 1GXUA 4DUTA 4RW9A 4NASA 1S48A 4P4EA 1VQLS 3DXBA 2V94A 4B3MF 1H2TZ 2CADA 4UA3A 3V6KA 1LAMA 1NXIA 1SJ4P 4DU7A 3TO8A 1FJGF 4I64A 4Q0BB 4A8YA 3PRBA 1XC9A 1LW0B 1UWBA 5CD4A 1WOOA 3TARA 4CPAA 1Z8LA 1NKBA 3PB6X 1QAJA 3OVAA 1HR0F 5F47A 2XEIA 2EG2A 3VGVA 3RB6A 1M4DA 4L73A 1YK3A 5D4PA 4OI6A 4DV5F 1VK8A 3SIPB 4LF9J 5D4LA 2CZ4A 4KS9A 2ZEMA 3KG0A 4WFZA 4JYAJ 4CYUB 4JI4F 3TJAA 2CVIA 3HT3A 4PPDA 1SL0A 2JEIA 1IBKF 2JOQA 3E01B 2EK1A 1FVSA 1YKWA 3GJSB 1D3WA 3P49B 2W1BA 3H4DA 3T6BA 2DVIA 1VFJA 1PSDA 3CXCR 2IM2A 4B17A 5F09A 2REFA 3DR8A 3I31A 2E7XA 3MMAB 4WPAA 2F63A 2AE6A 1RT7A 2AYEA 4NLSA 2UVUA 2CNOB 3ZTPA 1UA1A 1U6ZA 2JLEA 3VF0B 3VAIA 4ZPBA 4QC6A 3LUYA 3PNIA 2EC2A 3HSDA 4WXOA 4RWWA 2GA7A 3D7FA 1KZFA 3RBUA 4BBYA 2PEBA 4F4YA 3HFZB 3MR7A 1YX2A 2V8GA 1SJQA 2PDOA 3IGVA 5AG7A 3KASA 2LEAA 3BKFA 5ADZA 2YQ3A 2QLFB 4UWJA 4CNZA 5DM6Q 5CPAA 2U2FA 4IFYB 3CD6S 1WSVA 5GADI 3DLJA 3IIBA 1FO1A 1QUVA 4Y2CA 5HJXA 2MKSA 4WIQA 2I5JA 3LOUA 4M5IA 3EUNA 3FXTA 1XMOF 4TY8B 4ED0A 1PYSB 3LALA 3PW7A 3IEHA 1QY7A 2YH0A 2R2SA 2G2ZA 2OKQA 3T5LA 2HQYA 5KFZA 4LSZB 4URQU 2AGQA 2ZEFA 1C0TB 5GMDA 4KKOB 3J7Z5 1ZM3A 5KFIA 4NCAA 2ZH2A 4ECVA 1HD1A 1FNOA 3FC9A 2E44A 4C11B 2B4OA 2PJ1A 2N3OA 2AT1B 1VCTA 4DL3A 3JYTB 3H8FA 2XEGA 3GIRA 4MFQA 2OPQA 2UUAJ 4LSLA 2Q51A 4EFDA 2CDRB 2OSQA 2DTJA 3O8WA 4II9A 3BYRA 1NK9A 1HA1A 2OR4A 4DI6A 1PCAA 2DHGA 5KFPA 2AFSA 2QJ3A 5DGBA 1OMSA 1I51B 1Y9KA 1YJWS 2MDAA 2LA4A 4KIAA 4OX8A 1PGZA 1LWEA 2AWZA 2CTCA 1N33J 3HHLD 1KHVA 3AQPA 1TL1A 1IKVA 4NMLA 2E1AA 2C1EB 2JEGA 4NXNJ 3LODA 2CZ9A 3M2VA 1Q2YA 1R27B 3ZTRA 1TKDA 4ED8A 4F50A 3W3SA 4UZBA 4CDIA 3LP0A 1P1LA 4Q36A 5KFNA 1KVIA 4ZX9A 2PI5A 5HVGA 4ATNA 2FLNA 2KM8B 2A2DA 2CPYA 4IOBA 1FT7A 4PG4A 5F8GA 5D8NA 4M5LA 1YX0A 4DZDA 2JH3A 3M8SA 3NLCA 4J3GA 2X7IA 2RE1A 4K5RA 2MMYA 1SC3B 1S1VA 1U26A 1RWVB 4U6PA 4LT6A 4CIOA 1R8PA 4J9LA 1WC3A 4FYXB 4NLRA 4RUAA 3FBCA 3L2NA 4QUSA 4EO6A 1BY9A 4MKVA 2ZELA 3CCTA 1FDDA 1JLQA 3QRQA 1BD6A 1T9WA 2C3OA 4KOUA 1UVIA 2BE2B 4KR0B 4RBVA 1F5AA 3B3TA 4YHHF 1CP7A 4PYAA 2D3ZA 3OFGA 2J8NA 3SQGB 2YNCC 4DQRA 2FD2A 2GJ2A 2CIJA 1OY6A 1S76D 2F8MA 4C2MA 2RS8A 4DV3F 1Y5LB 2BJ1A 4FS1A 1IXKA 4A8QA 4ZY1A 2IAJA 4QIEA 1URNA 2AX0A 3KK2A 5B0GA 1YLXA 2YVSA 4F4ZA 5E7OB 2EWBA 3FMCA 3J7A1 1H38A 1RT4B 2PGCA 4NLQA 3JSBA 4YWYA 2J8MA 2DH9A 3OTBA 3I55S 1FD8A 1FEHA 1X4DA 1Z4UA 2Z58B 4C68A 2CQPA 1TKFA 1G4CA 4MRIA 4X66F 2ZNYA 3D3SA 2Z0GA 4WE1A 2FPHX 4FF3A 4QIWD 1ON0A 4IOCQ 2R7QA 4OYIA 3G71S 3DMJA 3TZXA 3NG8A 4KGZB 2I00A 6FDRA 3EXNA 2SXLA 5KFQA 1RK8A 3PB9X 2DKOB 4DPUA 2BL1A 1CPSA 3MUVP 1N34F 4LVOP 4ZVGA 2J9CA 1YVOA 3PJWA 4KHPF 2K3IA 3DNCA 4F4KA 3D28A 2ZUGA 3B8GA 4F4WA 1V6HA 2BUNA 3O3LA 4JI3J 2Y1RI 5FDLA 1JLFA 3BJ8A 3FQKA 4M95A 1AXQA 1QM9A 3W2WA 3MMJA 4M85A 5IC6B 2F1FA 3ZZIA 3TCVA 2XC9A 5JGFA 3QO9A 2QA2A 1S7FA 2GIVA 2AEFA 4MKAA 2O28A 5KFAA 5KFDA 4Q7AA 1VQ4S 5EWGA 1Q95G 2HIQA 3HF5A 4JI6J 3F44A 4DV1J 3GYNA 4EBCA 1TFYA 1CP6A 4ZVPB 1PG5B 2WAQD 2WZNA 2Z57B 3TI0A 3D0GE 4PUOA 4Q8EA 2ZOMA 4X4OA 5E33A 3PEIA 2H9ZA 1TKXA 1IKVB 1QSTA 4LR8A 4OFZA 1TL1B 1X4BA 1RT2B 4MAKA 3V8IA 2A3JA 4JI4J 1DTTA 4RW7A 3IMQJ 1YDLA 2RKIB 4HHHA 1R31A 2X3GA 4Q44A 4IDKA 4TWEA 4URGA 2QSWA 4B9VA 1CULA 1M1GA 3MEKA 2RU3A 3BKUA 3IN5A 2KG1A 2PJ4A 2HQCA 3QYYA 1ZG9A 2DHXA 2UUBF 2ZW5A 2MKJA 2FJXA 3NGDA 3T1AA 1GXLA 2E5HA 1ZS6A 3W9IA 2KN4A 2NLWA 3T1HJ 2Z8QA 2EBGA 4PYDA 3V6DA 3TVZA 4LSLB 3D2WA 5E3AA 3T90A 1U4BA 1YWXA 4EO8A 4RW8A 4PQUA 3DRYA 4C9DA 4DMZA 3BS9A 3VGTA 1IICA 1CJUA 2CQ2A 3ET6A 2I5JB 8ATCB 1N33F 1NBEB 3NNAA 4K2JA 2C2KB 3KQZA 3T9NA 4IFYA 1I94J 5C24A 3K17A 3BJ7A 4TNUA 4J9KA 1LFWA 3HZGA 3RRKA 2CWKA 3M7VA 2M70A 2JL9A 1A9NB 5KFUA 2V69A 2KVIA 3J80U 2W2MP 3MR2A 3EDQB 2DHHA 4UEFA 1WNEA 2OZUA 5I0CA 4WE1B 2IVYA 2RJZA 3FEDA 1RB0A 3W8GA 3D68A 4R3LA 2HBYB 3M30A 1VQNS 1I1DA 4E0DA 3L7UA 3T9ZA 2J0QD 2XMKA 2Q04A 3ENAA 4OI3A 3CJ3A 2DT9A 3K57A 4UUXA 4DG1A 1OBRA 5K8MA 4FYDA 3GFZA 2R7XA 2FSRA 3DKDA 1Z9UA 3TOBA 4B3MJ 2DR5A 1ZZNA 4FVCA 5L1LA 5KFCA 4AG7A 2VONA 5LXRA 2B8QA 1U09A 2K8GA 4KHPJ 5DRKA 2DR7A 3BKTA 2W4CA 3VR1A 2R8HA 3PZJA 4DPOA 4HLBA 2N3LA 3SQGA 5C25B 5IQ6A 2LKZA 5KFMA 3S6HA 4B5OA 2M8DB 1GYTA 1J4JA 5KFVA 5KFEA 4GS4A 3P5TL 4CGNA 4X65F 2B5GB 3RAXA 3H90A 3RW7A 1U1NA 2KXHA 2VDHA 4WCEQ 3CMQA 4DX5A 4OHWA 4H2KA 2JSXA 1IGBA 4RBUA 4RL1A 4DV5J 2MJNA 1RHUB 2AU0A 3QPIA 3MRUA 4LF2A 2NYQA 2WVEA 2BM1A 2HUZA 5IWAF 5B0FA 3HSZA 2ZITA 1S0VA 2XZWA 5HJYA 2DPTA 4B08A 4IO1A 3GY9A 5D6GA 3NNHA 4BMHA 3V81A 2EK9A 1H74A 1SJ1A 4QPXA 1ACMB 4KO0B 2Q7SA 3BGLA 3M6WA 4DN9A 4IG3A 3G8WA 4TNOA 2RQ4A 5ISVA 3K8VA 1J5EF 3NH5A 4A47A 5B0AA 4W98A 3EVMA 4LSNA 4C3KA 1YMEA 3MPYA 2AFUA 4KOWA 1N5VA 1F57A 3ELHA 1RWMB 1WC4A 2ZHBA 3KR4A 2DNOA 2AJ0A 1R43A 4AT1B 1NK5A 1ZYQA 5KOWA 3BSOA 3TX0A 2I6WA 4H4KC 1YLOA 2YNHA 3SXOA 4YR0A 4C8YA 2LVWA 5LM7E 2AHOB 5ETPA 3K59A 5G22A 1FFGB 5IC4B 4WF9Q 2REEA 4OL8A 2ROEA 1HWLA 1TMMA 2ZEDA 1U1KA 2DGXA 4Y2MA 3M6VA 5D0HA 2RRNA 3DHWC 1S59A 3KTQA 1NZAA 4JWPA 1UA0A 4EBDA 1LEOA 5A8KB 4C11A 2WB4A 4D3GA 2ZC4A 2WSFC 4DR4J 6CPAA 3FF3A 1O51A 2DY9A 4C2YA 4K0KJ 5KG3A 3CJKA 2HFNA 2HRUA 3FRZA 1MWZA 4DL6A 2LU2A 4NEYA 2E5LJ 1NMEB 1IIDA 3T19A 2CPZA 3NEKA 3HSGA 1S57A 3V6JA 3EPIA 3AH6A 4IQXA 2JWNA 1A6LA 2CQ3A 1M4IA 3IWLA 3PDNA 1XMQF 2H4WB 1HNIB 3Q2TC 5IX3A 2ZVIA 1C0TA 2VB6A 1VQPS 4TVAB 3R7SB 2EG1A 3EX7B 2IJNA 4J9VA 3H20A 4I69A 4K4SA 3LH2S 3T9YA 2MLYA 4DU8A 1HYSB 2JJ4D 2B43A 4LF6F 4B6ZA 1KQSR 2ZJQQ 2UXBF 1C1BB 5AJ3F 5F8IA 3S01A 4ZP9A 1DLOA 1AUGA 1RTQA 2G3TA 1FTRA 1N32J 3TR5A 3PYDA 1FKPA 2PIIA 1N34J 1RWUA 2YNGB 1U6BA 2UV8A 1WSRA 1LXJA 1MN7A 2HWTA 4U9RA 2C22A 3OVBA 4JLYA 4ZHRB 4P7TA 4B5PB 2E9ZA 1VR6A 1YJTA 4ZLPA 4CNYA 4AYBD 1X12A 2IJZA 1VGYA 5I42B 2VIHA 3I4PA 3MMBB 4R57A 1S1UB 4CAXA 2A2CA 2UP1A 2HHWA 2H3EB 2C28A 4OV1A 2ROPA 1NEEA 4U8YA 4ZJOA 2QA4G 3KG1A 4P7VA 2RH3A 2QECA 4FYWB 3FSIA 3MEEA 5THWA 4ED4A 1E6YA 5B7WA 2HHSA 4LFCJ 2DO4A 4F2RA 3VAMA 1AB8A 1T8EA 4DJLA 3CTRA 3MM6A 3J7YU 2DR8A 2QL5B 4M6GA 2J8SA 3OL7A 3KZWA 2LFVA 4DR3F 3BN4A 4B5PA 1U1LA 2YQ0A 3EVWA 2Y8YA 4NRUA 4QPTA 4NYZA 3GB0A 1NRKA 2IYGA 2HHTA 1WC1A 1VHIA 3JUWA 3PFOA 2J9DE 4NL5A 4HKQA 3FK4A 3IR7B 3JTNA 3AOBA 3UD5A 3GFXA 1X4FA 2CQHA 2DNPA 3TAQA 4H4MA 2VG7A 2LLZA 4ZP7A 1RAJA 4EGLA 1S0OA 2NMTA 1URRA 1TKHA 3UN5A 3CJSA 1S6QA 2PO4A 2JC0A 1MJ9A 1S97A 2CQGA 4DSKA 2P9CA 2QMWA 2GFFA 4DCPB 3CUNA 1N8RT 5CZVA 2KO1A 1F2PA 2AFOA 1HWUA 1CLFA 4DV7J 5AT1B 4ECZA 2HGNA 3T1YJ 4F26A 1YHQS 4K4UA 4CYPA 2E5IA 3MTJA 5EUHA 3MHYA 2ABZA 5H1SV 2ATRA 4L76A 4MFZA 1JKHA 3VZHA 3BI0A 2PCUA 3C15B 3DI6A 4KC5A 1Y5NB 3OJSA 3MTKA 2CDQA 1HHTP 3QT6A 5I3QA 2R1IA 3PCOB 4B02A 2VQEJ 3V4IB 3DRRA 2L9WA 2RVJA 3H8GA 2GVZB 3N9UC 2M3DA 4DV6J 4HVZA 1E6VA 1OJ4A 1WTFA 3QB8A 2XS5A 3KLIA 2P9EA 2C3YA 4CQ1A 1QDUB 2HFVA 4OZ3A 4MK9A 3TNVA 4F3QA 3OTCA 2ZH6A 5LXYA 1WF0A 4NCGA 4TU7A 3DI6B 3D5MA 1CJVB 2AF6A 2VZYA 3PW4A 3DM2B 1JJCB 4OYXA 1M5VC 4R5PB 1AA1B 2IRUA 1SBRA 5IQQA 2FHOB 1RBLA 2KM8C 2OP5A 4ZY2A 2HVZA 2HWIA 3ZTSA 4A8FA 1DTQB 4AD6A 1RO5A 1Q82T 1DURA 4BC9A 4Z37A 1P8GA 2LU1A 3D6HB 1RWOB 4NX9A 1U2FA 1SH3A 5HI7A 5F49A 2W01A 3BB5A 4I2PB 3H40A 1FX2A 4CLLA 4PXCA 3CZXA 4H4MB 4NXMJ 3PYFA 2WUUA 1SH2A 4EMEA 4WKYA 2PIZA 4DR6F 5AG5A 1X5SA 1V3SA 4DV4F 1NDLA 2R8VA 2OPSB 3IBCB 4X4QA 3IG1A 1F3FA 1KD1T 3F56A 4MT1A 3JQMA 4NEXA 3UD3P 3R97A 4ED5A 3DDNA 1S9FA 3ISXA 1JJ2R 4QU6A 4JI1F 3OHAA 3JTOA 2XEXA 3LANA 1LOKA 1S1XB 2HNDB 1J5EJ 2HMIA 1MWQA 2RU9A 4C3MA 2KJWA 2HBQB 4LF6J 2B6AB 2XMAA 4XTTA 4JD6A 4XO0A 1U0SA 3J81Y 2GREA 4X5KA 1YJRA 2R2UA 5LYFA 3PW2A 4MBUA 4MFPA 3KK1B 2ZKUA 4NE9C 5FVJA 4UY8T 4FF2A 4E8UA 1PAEX 5CABA 4LFAF 1FWPA 1HWIA 1RT5B 1NJYA 5LMNF 4RNHA 1R6YA 4F0MA 2QEXS 2ZH3A 3MUMP 3IS9A 4KOSA 2CAJA 2ZH9A 3HK2A 3MXHP 3LAMA 1HFEL 4TQRA 4JOUA 9RUBA 4OJGA 2XMUA 2I1RA 2F4FA 2YNGA 5ETVA 2IJFA 4YFUA 3W5YA 4I6AA 5ETMA 5HH1A 3TQ1A 4LIWA 3OXGA 4UZCA 2I3CA 1UJ4A 1QLNA 2VFTA 2ZC3A 4PG5A 3DGPB 2HB6A 1UEVA 4CO4A 5KTCA 4USVA 3UN3A 4ZIWA 4LIRA 3G6YA 2FVSA 1IKYA 3JB9k 1WG4A 1FF2A 2JFKA 5HVFA 2BJ9A 4HTJA 2ERRA 5AXNA 2QMXA 3IC1A 1N5YA 3GJQB 1R8AA 3UQSA 2YWWA 2DPSA 3H5SA 3B35A 3JQKA 2JVRA 4MHPA 4OQJA 4CLZA 2FVPA 2DEIA 3B3CA 4LFBF 4PWDB 1R8BA 2B5JA 3S7RA 3F8KA 2AQ4A 1WHVA 2R8JA 4Y2KA 3I0RA 5CYMB 2W9AA 3FVYA 4M6HA 1S77D 1EARA 2RB7A 4HNXB 4QVTA 4A94A 4X4PA 4YY3F 3PZPA 5A2QY 5MAOA 4W4MA 3FEEA 3U1LA 3MAQA 1XNRJ 3Q8UA 3QGIA 1WK4A 3JTPA 2M2BA 5L39A 4OLPA 3MM9A 3K89A 4USJC 4CAVA 3ZNUA 1DTTB 4B14A 1GQEA 4OYWA 1H73A 3LW5C 1X4HA 1TK5A 2DRAA 1B70B 4DSLA 1U48A 1JMTA 2DPIA 2CQIA 2HHXA 3EY5A 3KJNB 4B3SJ 4AL6A 2FJAB 3QMQA 3HVWA 4RW4A 1JX4A 4ZP6A 4DLGA 1TR0A 4F9VA 5HXDA 3DRSB 4DV0J 2F4VF 2IRXA 1D9DA 1V9OA 1IJEB 3W9JA 4FYYB 1YLEA 4JI2J 1SC4B 2JEJA 2RSQA 3TYTA 4ID8A 7AT1B 2RRBA 2VFSA 1DQAA 1QTNB 4KOTA 2WB1D 1RT3B 1MU2B 2CJ9A 2GX8A 4JYAF 4RNMA 3SCJE 2QZ8A 3S6KA 3W91A 2PN6A 4KSAA 2PVWA 2DHAA 5LSOA 2VZZA 4I2PA 4HTIA 5G0RB 4GKKJ 1HBOA 1O0PA 1KONA 2YWGA 3HM9A 1FRIA 2FHJA 3N5FA 5I3PA 4AG9A 4DPTA 2JZ5A 1CJWA 5T7LB 1ZA2B 4TQSA 1BUXA 1LK7A 3H2LA 1Z8WA 2QC3A 2HS4A 2G1DA 4KLVA 1RA7A 3BR9A 2BVZA 4O3PA 4EU0A 2ADBA 2D4OA 2PJ2A 3AB2B 4ED6A 3DR6A 2ASYA 1ZG8A 5HMNA 3EE3A 2Q3PA 3UCZP 2XNQA 4P6QA 1FRMA 2WPXA 2VA2A 4I1TA 3A3OB 4TLQA 2X7BA 2BANA 2OMOA 1VHOA 4K4YA 4YB6A 4M5DB 3HFVA 2KKHA 4MCRA 2Z3LA 4QIGA 4XPDB 4B3OB 1NK7A 5DS0A 4USMA 3H98A 3TT2A 2VKZG 1Q7YT 3JSRA 3PBEA 2ALYB 4HH0A 3CJ8A 3DFEA 4NLVA 1B6BA 4OX9F 3M30B 1K0VA 2YNCA 1A0OB 3UNGC 2D4PA 2C1CA 1XNRF 1HDUA 4B13A 3UVJA 4QBJA 1S72S 1NLKL 5CYMA 3NGTA 1FERA 4A8OA 4CO0A 4M5NA 5EX3A 1JLQB 2CG8A 3G8QA 2KTQA 3LWUA 1LQ9A 1FRKA 3IWXA 2YKNA 4WZMA 1EX8A 1XIQA 4OI0A 1OYEA 1N5YB 2FZGB 4ZBGA 5DLGA 5GMKa 4OLLA 2WBRA 1LWFB 1EETA 1Q79A 2LYVA 2PE8A 4PCQA 2VBWA 4YR2A 5HANA 4U7UK 3MMCA 3PM9A 5HROB 1EP4A 2HG4A 3SV4A 3DGPA 4OYPA 1UFHA 4Z65A 2NPIA 3UWTA 3BV8A 5HQLA 3IWNC 1ZM4A 1U25A 3HHLC 3MR5A 4B9TA 2MKKA 3PR5B 2B4PA 3T3FA 3LP0B 1RTJB 3OR1A 1YBTA 5K5MA 2K2PA 2IJRA 5D3GA 2X1BA 3JQJA 3GKRA 4UT4A 1UTAA 2CQDA 2Y0SD 1KRPA 4OIDA 3T1HF 2J76E 3K2YA 4WFXA 1SUQB 4HPSA 5J2MA 2BE9B 2K5TA 1WG5A 4LJMA 3MM6B 4OHYA 2GCFA 1TL7B 3EGZA 1Q7LB 2M52A 3D9BA 8CPAA 3MEEB 3M1VB 3RUBL 1KQGB 3V6HA 4L74A 3NOGA 2NUHA 3TFYA 1HQUB 5DQIA 1N4LA 4A31A 2ACMA 1S7LA 1I94F 2J6TA 2EKNA 4UTGA 2W9BA 2OEKA 1TAUA 1K1SA 1RTZA 3GFYA 1K73T 3FBBA 4XPDC 2LDYA 2RC4A 4HACA 3FYNA 3QJPA 2B7BB 5LSRA 2CVEA 4OZ1A 1BQNA 4K4WA 4NLWA 1VISA 2Z3OA 4DV1F 4LQGA 1R7IA 1QAYA 5E3QA 2ZENA 2HAFA 3Q0AA 4FBEA 3D4JA 4Y2IA 3NWRA 4CGPA 3KK3A 1S10A 2ZM6F 3DDKA 3D1QA 3R3TA 5D0GA 3LP1B 2LQ9A 2DEJA 4XPKA 4JP8A 4H89A 1RTIB 3NXZA 2ILZA 4YU9A 1RWWB 3SYZA 4OC2A 2B4UA 1M5SA 3KWMA 2DGSA 3NA6A 2XGQA 3GIIA 5FDLB 4EMDA 2XWXA 4GVBB 3CXPA 4ZK7M 4USHA 4ZPDA 2UXCF 2HNYB 2BW7A 1RBOB 4F04B 2M0GB 1RT1A 4M5KA 2J9EA 1VLYA 2VG5B 5CHCB 2VPWB 2FHMA 2F7VA 2PFDA 2H4YB 1FTCA 5K9FA 3GIUA 2FCKA 1SC1B 2VFUA 2XZTB 5HMYA 2FHKA 5ETSA 2DIVA 1T7PA 3ZTQA 4K4VA 2UUTA 3R2DJ 2DH8A 2OLWA 5AG6A 3CWJA 1K9MT 3RG6A 4KGVB 1DY3A 1Q8KA 4WYLA 2AW0A 2HZCA 2QLWA 1RT7B 4JV5F 3M32A 5AE2A 2IHR1 2L9DA 1REVB 4V19J 5IB0A 2OPRA 3BQ2A 3RB0A 2ASJA 2C2EA 1ARLA 2WVCA 3OXLA 3PYEA 4ZGYB 1R0AB 2BBEA 3DU5A 2OJ3A 2B8PA 3AXMA 1R0BG 3HSJA 4DV7F 4QYZK 3CC7S 4IO9Q 4OC3A 4DR7J 1K47A 1X8DA 5AGEA 3GJRB 2N82B 5LT5A 4LF9F 2O1PA 4O4RA 4YS2A 1VQYA 3BN7A 2XMJA 2VOPA 2I0XA 4K4TA 5ETQA 3D1HA 2BOPA 5F0UA 3TP2A 1QAXA 5CCMA 4PK3A 4Y49B 3EMTA 1F6TA 1WC6A 3BEGB 2P9GA 1HBNB 2IIHA 4ERDA 4G1QA 4USUA 1NZ8A 2M9KA 4PSWA 5DWMA 5DG9A 2L9NA 1S6QB 2B9EA 2KHDA 4LRAA 2AEJA 4NJRA 2GJFA 2V4JB 2GGPB 2COLA 4KO0A 4ZVHA 2OMLA 2MZQA 1XBWA 1YZ7A 3CDEA 5DS7A 3BGOP 2CYYA 5KAKA 2OOTA 3R9GA 3O44A 5D15A 4FD5A 3A8EA 2KYZA 1D09B 3J81U 1LFPA 3HX9A 3W7BA 3K0JA 1YBUA 4DLEA 4UIBA 1UEKA 3Q8RB 3ADAC 1WDDA 4A95A 1K44A 3H7HB 3N28A 2MLZA 2E1MC 2DB1A 4C3LA 4XPLA 1H6KX 4JXQA 1T9XA 3SFGA 4IFVA 3PIPQ 4KORA 2B5GA 1NPRA 3EDRB 2OELA 2G4BA 4MKYA 5LYLA 2CPEA 2MYFA 3DHXA 3OPKA 5F8HA 2KB2A 1NJWA 4KV8B 2N7YA 1VOMA 2RDDA 3DYAA 2LQ8A 4PXEA 2UU9J 3OFFA 3ZZOA 4EYHB 3SMZA 3KDNA 3LGHA 4OJ3A 3ILJA 4X2BA 1SL2A 1M5OC 1H7WA 2PSWA 1NKEA 1Y7RA 4KOXA 3SDEA 1RZMA 2BO9A 3PX0A 1S9GB 1REVA 2V77A 5ETKA 2XTJP 4ECYA 3CMES 1VJWA 1T9TA 2QFIA 4I6WA 4P74A 1RHMB 2OAUA 4FXWA 3K5LA 4YGOA 2BOAA 2HFUA 4FS2A 4A32A 3IBWA 3IU1A 1BMQB 4HH1A 4ENOA 2HS3A 1VLOA 1TUWA 3HVTA 1PKUA 3MI7X 3CXQA 4LF4F 3W60A 4DL5A 2EW9A 1IBKJ 2MHNA 2VU5A 2PC6A 4QZVB 4KSIA 1B0PA 2A4NA 5KFRA 1U8SA 3MM8A 3L9ZA 2WVFA 5J2QA 3FEXB 5D77A 1L3KA 4C8NA 4I67A 3Q24A 4F0HA 1UFKA 2DD8S 1OSDA 3R27A 1X5OA 4OYOA 1PJ5A 3PEJA 3M8QB 1T02A 3IR6B 1TMJA 1W26A 5HL7Q 1NB2A 2WVDA 3I9ZA 2W8LA 1S9GA 3TX8A 3PJ9A 2GV1A 3T6JA 1BQNB 4DQIA 4WTOB 1QSLA 3AA9A 5LYDA 4C4WA 2OFHX 3CD5A 2EFGA 4RUCA 4USWA 1LW2B 4FZVA 1DRZA 5HMXA 4GC6A 1KLMB 1TELA 1X4AA 1SPBP 2BJ7A 3R1KA 2RUGA 4DWIA 3KYLA 2V0NA 5I3UA 3MMAA 3IAS9 4LUBA 2IA0A 3S9LA 3JVNA 1CS4B 2VV5A 4KLWA 3BDPA 2KXNB 3QRPA 5CBMA 2Q4VA 2FC9A 2P6SA 4A37A 1REGX 2HZAA 1VRTB 2ACYA 3BF4A 3MFHA 3RR7A 4RLEA 1DE4C 2IC3B 1Y4ZB 4CAWA 4MFBA 1IQZA 4ZLNA 3E01A 2W9BB 4ZOSA 4DPXA 4CCHA 1VDHA 4DS5A 3OW2R 3DOMA 4OV6A 5F3ZA 5J1NA 5C5JA 2Z4PA 5KT4A 5J1QA 2O3DA 3M8RA 4G3IA 4R3KA 1F9HA 2O66A 3KLHA 3KKWA 4FBTA 3CJRA 4ZY0A 1G1XA 2HKEA 5J2MB 5JJBA 3S1TA 4NGNA 1NK8A 1XN9A 3QGGA 4FNHA 3U02A 2ATLA 5D4OA 4MYUA 4ZA1A 1SJFA 2WONA 3OR1B 3ZZYA 1T3NA 2OD4A 5BR8F 4RS2A 4YRHA 5FIIA 1N0UA 4USKA 2YKNB 2R3VA 4ONUA 1NSQA 5CQGA 3H5XA 1AT1B 4GO7X 5E2QA 1EP4B 5IV3A 4W90B 3MMCB 1YQEA 4B3RJ 3DC2A 3HMJG 2NS1B 4ECXA 1RT6A 2N4CA 3K7RA 1IKXA 1VC6A 4CT8A 4B3TJ 3C26A 1VJQA 1RAOA 3TO6A 2ZE2B 3NE8A 3GONA 1HBNA 4P4BA 1ZLHA 4QYZJ 2QE5A 3EZUA 4HHUA 5H86A 1GFWB 2W9CB 4LF4J 2FS5A 2AX1A 3SXNA 3KUEA 5HBMB 3W5ZA 3C19A 2FIWA 1F1BB 4CS0B 2E1RA 4OHVA 2FY8A 5KFXA 1FY7A 1Z5RA 2MSTA 1VQKS 3MECB 4MJ8A 1JLCA 1LAPA 5HMWA 5LL6d 4B9NA 4P45A 3HHKA 1RTDB 3UDLA 3AB4B 4A8WA 3C6TB 1CX8A 2FJEB 3DNSA 1H98A 4ZVSB 1UCNA 4AVBA 4OJHA 5GVQA 3B6BA 3QFHA 2KG0A 3F41A 2HZVA 1FRXA 1NH8A 1JLEA 1YQHA 3L7OA 2IBOA 2CJBA 3PKMA 1RKIA 2P0WA 2WW4A 4ED7A 1T9UA 4NI2B 2PJBA 2QVPA 3HUVA 5JXSA 1SIZA 3DRXA 2HNZA 3GWCA 2R7WA 3T5JA 1YW6A 3OL8A 3C16A 2DNGA 3K5PA 3GV7B 2UUCF 3MM7B 1FCAA 1HNVB 1T3OA 4DV3J 1EB0A 5A6WA 3MFIA 2FE7A 4A48A 2PMHA 4I2QB 3LP2A 3FBFA 4MMOA 2EWHA 2ZEOA 3CDXA 5CYQA 4WKRA 3KLGB 2Y0BB 2FHJD 2HIYA 3C14B 1SJ3P 4DV2F 5JQ4A 3GFHA 3ZZTA 1IYLA 1JXLA 3LF0A 4RZRA 4KUBA 3P45B 1XBUA 3SCIE 2XWYA 4NLYA 1APSA 1IY7A 1NK6A 1FE4A 1OS5A 2WW8A 3QGPA 1ZZFA 1ICEB 3CB4A 5GMEA 4RW8B 1C0UB 2RUSA 3PHTA 1UW4A 3TA2A 2BDPA 2HVEA 2XEJA 3KLEA 2G2OA 4JI0J 3A8JA 3BSCA 2AFMA 2HYIB 3G2XA 2GO9A 4EI2A 3G9CA 1WI8A 2GC8A 5JVHQ 1WG1A 4JB8B 5B08A 4DUZF 2VODA 4DZ6A 1V3ZA 2XMWA 3WIVA 1S6UA 5H84A 4MYTA 2K3KA 2J8RA 3AFGA 1KUYA 2C6PA 3ONQA 3GJTB 2C2DA 1S99A 2KT5A 1TKXB 1JLGB 2V63A 3IBFB 2DEAA 4ZMMA 1ELLP 3WABA 4DFJA 4JI7J 5EMIA 3CXSA 1PJ7A 2HRTA 1OIAA 5LJ3Y 4DL4A 2CJQA 3VWSA 5LJ5Y 3D7SB 2OZGA 3A1YG 4JI3F 1TKTA 2AMCB 3CCVS 2YWEA 3OV7A 2KVQE 3VGSA 3SJFA 1UWAA 1DHMA 3KUHA 1F2OA 3Q2SC 3TWZA 2B5JB 1Y5IB 2LMIA 5HLFA 4ES2A 2R7VA 2RF2B 3HDSA 1Y10A 4ZCIA 4FKXA 1ZTTA 5L8RC 1SI9A 2PD1A 1UVLA 1H72C 4ZYQA 4CAEA 2JVOA 2P8IA 4U7CA 2ZHAA 3W2WB 3LPEA 2HHVA 1UVKA 1OQ6A 4P4FA 3AY0A 3N7ZA 2MQQA 4LF7F 1U2CA 2VICA 2R7OA 3BREA 5A28A 1OO0B 1HQ2A 4UQGA 5E0OA 4PWWA 4P75A 3VALA 1W7WA 4DNCA 4OADA 1JB0C 2UU9F 4WYWA 4F36A 5CZXA 3UVJB 5A76A 4C7HA 4ZPWR 1LWFA 2J9DA 4LBIA 4YQWA 2I9SA 1HW8A 3BPDA 4WBFA 1KR4A 1MROA 1ZAXA 1A2ZA 3CCES 1XJOA 3IXQA 2B4DB 3KHHA 1J2VA 4QWDA 4CGMA 1MW7A 2HRYA 4FAIA 5F46A 2F8HA 5GAHU 5F41A 5LMUJ 1U1MA 1FI4A 2ZVSA 3MGJA 2Z3NA 4Q38A 4OI2A 5H9FJ 3CJQA 1FKOA 4WFYA 2OD6A 1U7LA 1RCOB 1X4GA 3PYGA 3RTVA 3I32A 2OI2A 4RNNA 2YKPA 3OTDA 2GQCA 1IVZA 2I8EA 4WU3A 1N32F 2RRAA 2JLFA 1WHWA 3N5BA 2B9WA 2QL7B 2M7SA 5IFMA 2IFXA 1S3ZA 3QLHA 2LECA 4OI4A 4ZVUB 3ZZRA 1VQ5S 2UV8G 3HULA 1HL6A 2ZH5A 3K5NA 4F0YA 1RAHB 3GTYX 3ETMA 3KL9A 2BE2A 3C3LA 5KT5A 3CJTA 3R5JB 4ETXA 5DM7Q 5HMZA 3OSNA 2GQ2A 4KUAA 3D1OA 4BC7A 2EPIA 2C6GA 1DJ0A 4H6ZA 2R7RA 4Y3CA 2EK6A 4M5JA 4LQ3A 2PA3A 3BDEA 2GFQA 4UOGA 2ZOGA 4NLUA 4KGMA 4MFLA 2G2YA 1FNMA 5F9NA 2JDCA 3M6XA 2DNKA 2W2QP 3FNCA 3PTWA 1VHEA 3R9LA 1SKSA 4LF1A 3UFCX 3M2UB 1TF9A 1YITS 1P9QC 4YDDB 2A1BA 4RW9B 3DLGB 3DLLQ 3TW0A 2X3DA 3V7ZA 3C16B 2R7HA 4Z7CA 1KOHA 4DBQA 4EWTA 2X1AA 4NCGB 4TU9A 3KHXA 4IKAA 2HHHJ 2W2NP 2G9OA 2WOMA 4NLTA 2WBMA 2DNQA 1VRUB 4TU8A 3W5XA 2V2QA 3EICA 1CPZA 5LRKA 2ASLA 1VQMS 2AYGA 5EWFA 2BJEA 1U47A 1SL1A 4LBPA 2ZD1A 3GUXA 1X10A 4R5PA 1HPZB 3MOZA 2VFRA 2N7CA 2AJ1A 1VC0A 2BABA 3GU0A 4HT5A 3V4IA 3G82A 3VCDA 2WK4A 4OZ5A 1N5QA 1UAWA 2CIMA 1FRHA 3MEDB 3O2IA 2ZDPA 4KSEB 1C1CA 5IB9A 1E6VB 2KYXA 4ILLA 2VOOA 1Z2ZA 3JYTA 3M4XA 2P6EA 4Y49C 2G0BA 2VC1A 4IR1A 3ZNJ1 2VPXB 3DRRB 3I0SB 3ULHA 4M63A 3NAHA 1M4LA 3FGVA 2GNKA 1WC5A 2HC9A 2NSMA 1ZPVA 2XLIA 2QJ8A 2ZJRQ 3WDOA 4ORFA 1KP6A 4C2XA 3MPWA 2MPUA 2NZ4A 2ZH8A 2E66A 4X3RA 1SKWA 2NR0A 5K14A 4C0BA 1ZAVA 2UVWA 1S1TA 3PRTA 1B4SA 2HURA 2J7KA 3NS6A 4DV0F 1G2EA 1RLDA 1X9WA 2MZJA 2ADCA 2RDJA 3BPSP 3S8SA 3JAMU 3MZIA 1XOVA 2IM1A 2PR1A 2CJKA 1VIXA 1R8HA 2CUYA 2J7UA 4CLTA 4C0HA 4NCBA 1CPXA 4IRCA 3BBBA 1WEYA 4X65J 3OWCA 3F0NA 4K30A 2ZH1A 1EJ7L 4O4GB 1M5HA 4YUDA 5B0DA 4YB5A 5E3PA 4O0NA 4Z7YA 4O44B 4JUZA 2LCWA 2EFOA 3GIKA 3CPWR 2LQBA 1HNXJ 3DSBA 4HNWB 1M1HA 3DOLA 2KCWA 3WR7A 2H48B 1U0HA 4KFBB 3FH4A 4P44A 3HHEA 4Q2LA 1BAVA 4DF8A 2H51B 2X1FA 1S1UA 1U02A 5F3TA 2DRDA 2B6AA 4A30A 2ZZTA 2DNLA 3O6QA 4YB7A 1LCPA 2FJBB 3LGMA 1QAIA 4BD9A 3I5BA 2DGTA 4PZVA 3C6UA 2PMZD 2HHUA 2FJDB 2CXAA 1UMJA 1PBAA 3JTKA 2P6FA 2WSAA 3A9LA 4OZNA 2PVVA 3VGUA 3TUIC 2R7UA 4B3RF 3HKWA 2V50A 1FKPB 4DSIA 2VXKA 1P0HA 2MLXA 1JWQA 2OPSA 2FQQB 4N77A 3LMSA 4W92B 4O4GA 5GCNA 2VUGA 1C1BA 3VHQA 1C0UA 4EK2A 2BSWA 2OIHA 4MIBA 4MFJA 2BX6A 3B78A 1UJ5A 1UL3A 1OPIA 1ULRA 2EKYA 1GX5A 3CJ2A 1ITPA 4XDDA 2W7OA 3CIMA 4R6TA 4NFRA 1NMTA 4ECQA 3IG1B 5C2GA 4IRDA 3N0VA 2YNIA 2CPFA 2QLBB 2DNRA 5KT2A 2GS8A 3EPGA 4OX6A 4AFFA 3AAWB 1KFDA 3H5ZA 4DR7F 1FFSB 1RADB 2LA6A 4NOHA 3CDWA 3PFEA 2GQQA 3PG9A 4JYWA 4FPIA 1IBMF 4FD6A 7FDRA 1FA0A 3AD9C 3DN9A 4NI2A 1YJNS 2CNKB 3VARA 2E5LF 3L3CA 4DR2J 3KLIB 4JI2F 1F5BA 3H4QA 4CO1A 2PRQA 2ZZNA 2MQLA 4I68A 4MCPA 4KYZA 3OTEA 4DV4J 4FD7A 3BH6B 9ATCB 3R5AA 2F9DA 4O0IA 3JRUA 2DCUB 1CVJA 2HLUA 4Q2MA 1KWMA 3US5A 3TVYA 2B4BA 1X5TA 3G82B 4XPEA 4JI8F 2AGOA 2PT0A 3CD7A 1VQOS 1UVMA 3JSYA 2C2OB 2XYPB 4IF5A 1N0VC 4WWSA 1LK5A 4B3TF 3FCVA 2GVZA 3N4WA 3WZ0A 1L0CA 3G8TA 2IPOB 5J1EB 1V5VA 3SSRA 2BR0A 4ZS6A 3AOAA 1CC8A 2RS2A 1WKKA 1YSJA 3LAKA 1YK9A 1TV6A 3ETOA 2IVFB 3QWUA 2V67A 3TO7A 2YNHB 3CC4S 3OVSA 4DSEA 3TC8A 2QRRA 2Y3YA 4M5GA 3R5CA 1CJTB 1AUDA 2B9YA 3SFUA 2D41A 4ECWA 3D3BJ 2CPIA 3PKYA 3LO3A 3EC4A 2W2OP 3E0KA 5DETA 1C2PA 3BGFA 3RW6A 4P4DA 1FDBA 3LQVA 2V4JA 3G6VA 3WC7A 3SCKE 4PPZA 2HEKA 2VG7B 3PX6A 1KNZA 4J9QA 3HJVA 5E3CA 2HSEB 2HV2A 3UCGA 1ZAWA 3OLAA 1MNEA 3E8OA 4KVOE 3GPAA 4TYBA 1S7HA 4L89A 2X51A 3DDDA 3PGPA 1BGXT 4J9NA 4IYQA 1Q1KA 3CJ5A 4NGRA 4CRJA 3QAYA 2V8PA 5HSPA 1FDNA 1D9AA 5GAGI 3EWGA 3P8BB 1TK8A 1GMWA 4RW6B 4Q43A 4J9RA 1VRTA 1H0HB 3KMSA 1Z8TA 3NBPB 1I6JA 3CDUA 1VS3A 1KBRA 1R3NA 3LPYA 3THPA 3OHBA 1D1UA 4J9MA 4DPWA 1Q16B 1WOPA 4DOZA 2CQ4A 3KJFB 2OH2A 4UEEA 1ZO0A 3P2FA 2PMWA 3DXSX 4NEZA 2AYBA 2BJ8A 3KQXA 2XBPA 1A7GE 1BQMB 5F8JA 2MY8A 3A8KA 4ZCLA 3T1YF 2B4DA 1YVKA 3T41A 2XCPA 2DY1A 2O67A 1CQMA 4QR2A 5C42B 3MOJB 4NCZA 3MCOA 4X4VA 4O23A 5F0WA 2HBZB 4G1IA 4WFAQ 3PEHA 1MROB 4J9PA 3TZZA 2LQJA 4LQ9A 4RNFA 2CNNB 5C24B 4NYPA 4IG0A 4F4AA 3DRPB 4ELUA 2NUUG 2DGVA 1U1RA 2NYHA 5JM6A 4Y0FA 2Q6CA 4NSQA 2EI5A 4RJVA 1JK9B 3F0AA 2XEFA 2HNYA 2EO8A 4OIXA 4CLSA 3S6EA 4TYAA 1VQ7S 5ETRA 3CIZA 2OEJA 1WI6A 1KFSA 4XNHC 1IQTA 5I4MA 1RQ0A 2KZZA 4X62F 2EBJA 3CNQP 2FIUA 2MGZB 3QIPA 3TAMB 1NPPA 3BH7B 1YJ9S 1HDQA 5L1KA 2H54B 2UXCJ 2RHQB 2GANA 2ZH7A 4UFWA 1EQ0A 4ECTA 1DTDA 3I0SA 2RKIA 3MAHA 3NRBA 5DDPC 1S0NA 3FBUA 4LRFA 3B7IA 3M8WA 1UWYA 1C1CB 1DZ5A 2EFQA 2QFJA 2Q44A 1TKTB 2QSFA 2MXYA 4FF4A 4DYOA 2ZOFA 2HHQA 1RBAA 4P52A 2A10A 4DEZA 1SQHA 1IBCB 3SJXA 4F3OA 2XMMA 3FQLA 4UWIA 2ANPA 2WPWA 5U47A 3DCAA 2HQDA 3OT9A 2MSSA 2E9RX 4DHVA 1TQLA 2ABYA 2NQPA 4X2TA 2MKYA 1RT2A 3UDCA 2V68A 1NJXA 3KMQA 2V9WA 4QU7A 2AFWA 1M4GA 1V0CA 3DOKB 1NO8A 2XG8A 2CRLA 2KI2A 3HCXA 4NRTA 1SUQA 4PUOB 2IRYA 3WQPA 2R7SA 1WJ9A 4GO5X 1D0EA 2K1RB 2ZDOA 3FRYA 2F8EX 1EE3P 3VAGA 2CNSA 3POTB 4JJXA 3NAIA 4J37A 4OZJA 1JLFB 3K9TA 2FJWA 3HHLA 3IGRA 1X4CA 3AD8C 2MKIA 2CJXB 5DDQC 1ELOA 2QX0A 4NLXA 2Q7BA 2I2YA 2FYXA 4DSJA 3BO4A 2KXFA 4LFCF 1FJ7A 3FIXA 3OTOF 4ED1A 4DQQA 4JV5J 3LTOA 2YWHA 1RWNB 4OZLA 2B7CB 2D1CA 2NSCA 3PV8A 4GC7A 1VQSA 2A6OA 1HWKA 2EUIA 3C14A 5KFSA 1G6BA 1FXDA 1QSOA 3LP2B 2L41A 3V81B 2Z2ZA 5A0YA 4GVLA 2MKCA 1WF2A 2VQEF 2CPHA 3IR5B 1FD2A 4ED2A 4UEZA 1RLCL 2A18A 4UCPA 2FLOA 2LXUA 1S0MA 2V9KA 3FRMA 2C3PA 3WC2A 2ZEHA 1W25A 1OWXA 2C6CA 4MFKA 4JI0F 1KQKA 3HO1A 5E41A 5MLCV 3IWGA 2QN6B 4FP9A 4HHJA 5A8RA 2BRLA 1FWKA 4RX6A 2VBYA 1HARA 1KLNA 1SQGA 2RQCA 2QTWA 3QRRA 3OTOJ 3UN2A 2D3UA 3ZXWA 3N79A 2BANB 3EZOA 5BJRA 3Q8PB 1YI2S 1JLCB 1IR1A 1RYSA 2CG4A 4MHDA 5F8LA 4YEAA 3OBIA 1NJIT 1JIHA 5A8RB 3R1LA 1FXRA 2AEMA 3B2YA 2V5HG 2RD5C 2BEFA 1I12A 1RXOB 1NDKA 5DO2A 4MHYA 3SV3A 5KFJA 1EKRA 4E0AA 4DSFA 4KJIA 4R87A 1LNQA 3MCNA 2UZAA 3Q89A 3RAMA 4QW9A 1IKXB 2HK2A 3CCLS 2CPDA 3PO5A 1XFOA 3UCUP 1HBOB 2W7PA 1XR6A 5H9EK 2VKRA 1YW4A 4LF8J 2JEFA 4E8OA 5D0EA 4DR4F 1L3VA 3DGVA 2CNMA 2ZH4A 4PQUB 1Z2LA 2D69A 2ALZA 2O5DA 3DLKB 1TP7A 2E5JA 1C4CA 3HVAA 4ZI6A 5J2NB 3R9FA 3SI0A 2ZBIA 3L7PA 2K1RA 2FY1A 1X7VA 1MLAA 3F5BA 5HK4A 4PSXA 1PIEA 1L3SA 1YJUA 4TY9A 5D78A 5EN1A 3LWLA 1CULB 4A46A 2OSRA 4IH7A 1U45A 4RW7B 3HHLB 1CEZA 1Y7EA 3PRDA 2UUCJ 3DRSA 3JSMB 3TANA 3P6YC 4YR3A 4MIWA 4K50A 2MQ8A 5KG0A 5J2PA 1RHJB 2VPZB 2XY6A 3KG4A 1BE4A 2G1HA 2L08A 4ZCMA 5LRJA 4USIA 3VATA 3GIJA 4JI1J 1HI0P 2KFNA 3W6SA 5CH7B 4JV0A 3JSMA 2X1GA 2ZXVA 1NAQA 2OPQB 5AXKA 2PQ8A 5L9NA 3VV2B 4ALZA 3GMGA 2AFZA 1BLUA 2VASA 3EVOA 3RRGA 4JI6F 4LR7A 1VK3A 2CKWA 3D7GA 1YGHA 3TAMA 4ICLA 2DRBA 3CVKA 3PX4A 3OJUA 2NREA 1HKAA 2RMLA 3IFEA 2GW8A 3RRHA 5GAHI 1SKRA 1XMTA 4LX9A 4DX7A 3TVKA 1IN0A 4MHZA 2FDNA 1T03A 1YVFA 3H25A 4QIVA 2DNMA 1F5CA 2DGOA 4A38A 4PWDA 1HMVA 1Z4EA 4ZVQB 5KG5A 2GIQA 2GVDA 4CLWA 5L38A 2P2CB 4NGPA 5J2NA 4JBCA 5KG4A 3MD3A 2ZWPA 3MM8B 2WRMA 1SV5B 1DQ9A 4RO0A 3MWBA 2OFGX 4DR1F 5B0BA 2BUEA 2MJUA 3MM7A 2B3TB 2F4VJ 1OSCA 4CGOA 2R2TA 1D8YA 1UW9A 2YXLA 4F8RA 4ILRA 2EVZA 3Q8YA 2L3MA 3B3VA 4OKOA 1T9YA 1TL5A 3K5OA 2CJYB 2F5GA 2KT2A 3OFHA 4CAFA 1ZG7A 2DNZA 2OH1A 5B0CA 4PG8A 1UKUA 2DK2A 3UDEA 4ITSA 4ZVRB 4URSA 4C98A 1SC6A 1PJ6A 4X62J 1U1QA 2C2NA 3HD1A 4RUBA 3C66A 5E3RA 1LXNA 4DDFA 1T0TV 1XR5A 2PSZA 3AOCA 2QA4S 5IS2A 3DYAB 3AHPA 3CCQS 3MAAA 1GHEA 4CRYB 1GT8A 4UOCA 5DZ6A 4R7MA 3VAKA 4CYQA 1XQIA 1HW9A 2OEMA 2C27A 2ROGA 3TZYA 2DXEA 4J91A 4B12A 3V38A 2IA6A 2W9CA 4LBHA 1NUEA 4KGXB 3EYZA 2PIYA 3MF5A 4AXJA 4F8ZA 1N56A 4YHHJ 3HHNB 3MCSA 3R2CJ 3NGKA 3QFWA 4TN2A 4QJVA 5EDWA 4NGMA 1RJJA 2LEPA 3CCJS 4CYUA 2OTJS 4NXYA 2J9AA 2QIRA 1FWLA 3HP6A 2XHCA 4K4ZA 4I56A 5HO4A 2O01C 4TXSA 3GP9A 1KEKA 2B58A 1I1GA 2FVRA 2VQFJ 4PXBA 4RPFA 3R5GA 3VZIA 1RAIB 2EBEA 3KNGA 2VF3A 4PAAA 5A0YB 5DQGA 4BBHA 4HDHA 2VFVA 4Z2XA 1U2RA 3RAQA 4ZN1A 1CJTA 3H2VE 3M8ZA 2BXJA 3M6UA 3GR1A 1X9MA 2BACA 3WC6A 2BJDA 1PILA 3QSYB 2OB0A 1QSNA 3NL0A 1KKHA 5ETTA 3SSSA 1J5OA 2NXJA 3AJ2A 1F3VA 5HN0A 5HQMA 1ZBTA 4NMXA 4PKDB 3IM8A 4J9SA 3CDBA 2AGPA 4RR5A 3N6NA 3LD2A 3FKBA 4WFBQ 2JLMA 1N88A 1HNZF 4RNOA 4M5MA 4L8AA 1TVRA 5M2RA 3C2PA 1QQ9A 1TV6B 3GYXB 5KFFA 3LA0A 2O53A 1IR2A 3TUZC 3V2UC 1F0XA 3QJJA 2CWXA 1H2VZ 5DJBA 3FCHA 2JRSA 3VQSA 1FJGJ 3VTIA 1W2IA 1XWLA 1FT8A 3SI2A 1L3TA 1T05A 4PEOA 3M32B 1P4NA 4LF8F 1XE4A 2IY5B 1VBYA 4KKOA 2K7KA 1LW2A 3C15A 4CH1A 2EC0A 3W6XA 3TOAA 1VMBA 1YZ6A 4LF7J 1EIYB 1O6XA 4EUVA 3VAJA 3TZWA 4KBIA 1GEHA 4YY3J 1YGYA 3ZZ0A 2J0SD 2VPYB 1CQNA 2DGWA 4AXIA 3MUTP 3IWWA 4P2SA 2HFSA 4Y2AA 2G0IA 4CLUA 3M8QA 4C8OA 3NFZA 1DQ8A 2DISA 1WACA 5RUBA 4HL9A 4NZ7A 3KJQB 4YOEA 2ODFA 3OQ2A 2FZCB 2YNFB 1IKYB 1IU8A 4FPRA 2B0GA 2H5IB 3CSKA 3QAHA 2V6AA 1EQMA 3RZAA 2PA8D 3D66A 5EX0A 4OMFG 1YRUA 4I7FB 2M8HA 2YNIB 3FJ2A 2ILYA 2KDOA 4HNYB 3SI8A 4UCMA 3G87A 3CT9A 3FFIA 5LRGA 1WUUA 3SBMA 5FD1A 5LYIA 1Y3JA 1RWKB 1WWZA 1GMWD 3KLFB 4PV6A 4KAIA 1UZDA 4KZTA 4OHZA 1RA6A 2YWKA 4PRFA 2AYMA 2ZEEA 4K7QA 4CLYA 1WEXA 1F2GA 2Z10A 5G21A 2XS7A 4S0MA 5C42A 2RIJA 1IOIA 2V4QA 1NB7A 5KG1A 3JXOA 1RISA 4KVXA 4NF1A 3NBPA 1Y3KA 3CDAA 3WBZA 1JXEA 4I6YA 4FWUA 1QSSA 3MR3A 2F40A 1HQEA 3GSDA 2BQUA 1MMNA 2WSEC 4ZVTB 2DNHA 4QQBA 3U1MA 4ER8A 4KFBA 3D0HE 1HQUA 2GLFA 4P6YA 5JH9A 1OQ3A 1TKZB 3KXDA 5AE3A 1FESA 3M1VA 3CF5Q 2J7WA 3NS5A 1GTEA 3ZJ0A 4OYMA 1KUVA 1Q53A 4RUHA 4A2ZA 4O44A 3L4BC 2AV5A 4KQZA 2VZ9A 4N76A 2IVMA 1HBUB 1HD0A 4RN7A 1Y0RA 1HNXF 4UY85 1UP1A 1S5ZA 4MY3A 1Y0YA 1LKZA 2DXDA 1B7FA 3W64A 2KL8A 2K06A 3P3DA 1VC5A 4IR9A 3DOLB 3TQEA 1AW0A 1ZETA 2H5EA 2M4MA 1FFWB 5DG8A 3ILIA 2QMUB 4Q0BA 3FUYA 2MQPA 3Q8QB 5K8OA 1N36J 3UPFA 3NOCA 4A4JA 1B99A 3IGNA 2Y0MA 1NDCA 2IYIA 4CM2A 4O3OA 3BR8A 2HPUA 4MJKA 1TU0B 5J8FA 3FMWA 5BYQA 2CQ1A 3J7ZT 2KFZA 5IOLA 1JJ4A 2FLLA 1PC5A 4LF5J 2FL4A 3DLBA 4L6V3 3GG0A 3D3CJ 1XEBA 1GK8A 3K2KA 4X4RA 3NH8A 4RBTA 3J81j 4OI1A 2KRRA 4IOAQ 1GAOA 1N48A 4LMZA 1PUAA 4FXDA 2P5VA 4NLOA 2CPXA 1WHXA 2ATCB 2BQ3A 3WT4A 2IMOA 1YIJS 1U1PA 3DLEA 2EVNA 1DAXA 1EHWA 1Q4RA 3HHDA 2IL4A 3FNNA 4GXHA 3RYOA 2ZUAA 1XNQF 3BXMA 3R6LB 5F48A 3P4UB 1F9FA 1XRYA 1JNRB 1BWVA 4FNIA 3B8HA 2NSBA 4B3OA 2V8VA 2CQCA 2GJIA 1JLAB 2H5JB 2JEVA 4K3NA 2XHWA 3FBEA 2Q79A 2GO8A 5DWNA 4ID5A 2ZD1B 2L48A 4R25A 3M8YA 2OPRB 3VH9A 1CJKA 2MTLA 1S9EB 4DUKA 1Q2DA 2M88A 5F8NA 2MZTA 3UNYA 4R0JA 1MSWD 2FT0A 2KT3A 3KR5A 1RUSA 2QA1A 2CY2A 3RBXA 3PVXA 4OAEA 3RYLA 5DG7A 1HHSA 3DLEB 1DFDA 3MURP 1NHKL 4C2ZA 1XK8A 4ANEA 4IH6A 4OIWA 5KT3A 2W25A 5SZTA 1PYTB 1VYAA 4LRCA 1SXLA 2IM0A 5A2QU 3OSPA 2WOMB 3ISZA 5B0EA 4ES3A 2GLJA 4EZ6A 4F3MA 4E2AA 1NNDA 3TOQA 2B9XA 1PBUA 3WX8A 4WTYA 2BE7D 1N52B 3AQOA 2HVHA 5KFWA 3T5KA 4JI8J 1RDRA 1NH7A 5KFBA 4K2XA 1L5UA 4I49A 3M2UA 3QSIA 3ICLA 2Z3PA 1CG2A 4M8LA 4X4TA 3EGVA 3OR2A 4B11A 4KE5A 3UI3A 1TL4A 2VHGA 1QSYA 3LP1A 3QNVA 2HQFA 1B0VA 4X64F 1HNWJ 4TLRA 4DF4A 4F2SA 4UFXA 2HBRB 3KK3B 2Z56B 1YRXA 1R89A 5A8WB 1JLBA 2DXFA 3BGRB 5KG6A 2E7VA 4PK2A 2XI2A 1FRLA 3MM5B 1VQ6S 4C97A 4C48A 4ZJLA 1H8LA 5HP1A 1O5JA 3GIMA 2AJ2A 1RI7A 1EKSA 5C25A 1HBMB 1N71A 1VBXA 2NYIA 1YG0A 1U0HB 3R5BA 1U8WA 4ZPTR 1HQEB 2DGQA 1RAGB 4X4SA 3Q86A 3R7BB 1P6TA 3Q8SB 4U9YA 1SQFA 4DUZJ 4ZVEA 1SCJB 1N6QA 1ZH5A 4CYNA 4WZQA 5G20A 2FC8A 3MMBA 1Q7LA 1U24A 3MM9B 1LWXA 4O3SA 3V4MA 2JNJA 2HGMA 4DL0C 3Q23A 4A8KA 5CYJA 4X8IA 3B54A 1FRJA 1KC8T 2ZWOA 4ZPVR 2OPPB 4HI1A 1BQXA 1UVNA 2ZFHA 1FNXH 4MCSA 2C2RA 2KH9A 2ZJPQ 4B9UA 3FFIB 2PJAA 3KJVA 3EZ5A 2XM3A 3FMBA 2ZHOA 2PC1A 3PIOQ 3H0PA 3I5CA 1IBMJ 2J0XA 3D54A 5K14B 4WP3A 4DFKA 5KFGA 1SV5A 2BA9A 4H54A 2CJAA 3PJXA 2EFPA 2GVDB 3CCZA 5K20B 1M1DA 1VKCA 4PR6A 5IT0A 1AZSA 2E9TA 2RF2A 4U95A 3CCWA 2MZ1A 1X5PA 2E5GA 3V5RA 4O3QA 1M5PC 1Q5YA 1K0TA 1AMPA 3T5HA 5K8NA 2Y9HA 1Q86T 4KOVA 4H4OB 4DR3J 2AD9A 2JBJA 4F25A 4K5SA 4ICLB 5KFYA 5M2UA 1I3OB 2YX7A 3PRVA 1UPPA 1WKLA 1TFWA 3KI9A 5C82A 2B3UA 3BHXA 4P9SA 4A8XA 3KNAA 4R8UB 4OYAA 7CPAA 3IS9B 2NXNA 4FN5A 3TTHA 2R42A 1HPZA 2VBXA 1HI8A 3ITHA 5KTDA 3C46A 2UXBJ 3TJ8A 2GAGC 3DLHA 4F4XA 1ZA1B 4AVCA 2YGWA 3QNWB 3TA1A 1UZHA 3UR0A 1I21A 4WK1A 2BQRA 4O3RA 3NWGA 1FE0A 4WP9A 4YP3A 4DR5J 5J2PB 2DJWA 2XMTA 2OZHA 1TVRB 3AJDA 3M8PA 2PE3A 4J90A 1RGVA 1RSCA 1S7IA 1WF1A 4OLOA 1XMOJ 1O8BA 3GZ7A 4HR2A 2FVQA 1VRUA 1UFLA 1J27A 1ZLIA 3B3SA 3TO9A 2G9DA 2YKMB 1BC6A 4ELVA 3E51A 1S6PA 1OY9A 4KVME 2JHEA 4P4JA 3O5TB 4IG3B 2A0FB 1S1WB 4YFJA 2OUGA 4NA2A 3PY8A 3LGNA 3MPDA 2YQ1A 4HDGA 3RR8A 2KFYA 2VH7A 3W61A 5LMNJ 2XGPA 4F7VA 3U27A 1HNVA 4AUKA 1S4FA 1S1WA 2XMVA 1V3RA 2DH7A 4ES1A 3H5YA 5CCLA 4M6IA 3CO0P 5EC4A 4WXWA 1KUXA 1GXTA 1YR0A 3U7JA 5BYRA 3IWEA 2YX1A 4A39A 2JDJA 4ED3A 5IZHA 4UOHA 1HI1A 4JV1A 4R0EA 3RB3A 1M1KT 4I2QA 4WU2A 3QIDA 4Y28C 3GCXP 3MDFA 4QWEA 2YKOA 2PRBA 4C8ZA 1IOFA 4QBUA 1C4AA 1AROP 4KTQA 2Z3KA 5FLXU 1K1QA 2HNZB 1T94A 3GYAA 4F0XA 3IRXB 3QT5A 3S9MA 3KOAA 3W1YC 4HI2A 2XULA 2ZW7A 4KOYA 4AQYJ 1QVFR 2XQCA 4DXLA 1S9EA 3VVUA 4JZ0A 1AUSL 5KTQA 1OZPA 1UPMB 8AT1B 1RT4A 2OGUA 3P96A 1RAEB 4L3NA 5DQHA 4R76A 2BYCA 1RU1A 1TAQA 3CCMS 2Y1JA 3RBEA 2R7TA 3C6TA 1QMUA 1Q5VA 5C2CA 2ZE2A 2MB0B 3S6FA 2R8KA 4NLPA 1XERA 2CXEA 1WDTA 2NPFA 3J7YI 1FK9B 1IWGA 5IV0A 4UQTA 4KB7A 1D9FA 4C7QA 3UR3C 3NGUA 3WC0A 1ROFA 2RNEA 3QJLA 2V2ZA 2W7AA 4EVYA 1MJAA 2V2VA 1GH8A 4PXDA 4M5HA 1Q2CA 1SKUB 5ETLA 2F3JA 4HT7A 2HWHA 4WJBA 3G8SA 1XR7A 1S60A 4DV6F 4J7CA 3G96A 4KHRA 2IM3A 3RO0A 2FZKB 3D67A 1RHRB 1KVJA 4DJBA 2PJCA 1N5SA 3M2RB 3MEGB 4IUFA 4C8MA 1IWAA 3SI1A 4DS4A 1RAFB 3TAPA 4U9ZA 1YJ7A 2PEHA 1WD6A 5C88A 1N54B 2WCXA 1KTVA 4P2MA 4TKTA 2ZW4A 3H59A 5A6PA 2FJVA 3DOMB 4K59A 1RU2A 4QR1A 1RABB 1DARA 3Q83A 2AIRB 4OMEA 2IBKA 4N7TA 5HLFB 3HFKA 3TEHB 2XSJB 1Y9OA 2HS0A 2DR6A 4YN3B 4XDCA 3I96A 4KGKA 4DL7A 4ZPAA 2LXIA 1RT5A 2W4DA 4PABA 1NHVA 1G7CB 4MHNA 4NJQA 4LR9A 1NKCA 1YREA 1R8CA 3IAM9 2HVIA 1S49A 1TKZA 3UO0A 4DCOB 2AJFE 2LXFA 3JS9A 4FUUA 3RGIA 2G0CA 3D7HA 3GCWP 4DL2A 2Z2YB 4MKBA 1JLGA 3S6GA 4MXUA 1MN9A 2F9JA 2AJQA 1Z4RA 4DFPA 5IT4A 2YH1A 4LVNP 3HPOA 2UUWA 2VJUA 1CS4A 5DLFA 1TTHB 4LREA 1Y0HA 3A8IA 3QT7A 4A8SA 4AL5A 3FJUA 3BI1A 3QO9B 4ZHRA 5IT9Y 2CNLB 2D7SA 3PBBA 5LMUF 3ZZUA 2KZMA 3ISNC 2NZCA 2VQYA 3CPAA 4JI5J 3QIPB 5KTAA 3PW5A 1GNKA 3KLEB 1GMUA 1XTZA 3FZ2A 1H3DA 2E1PA 1I5OB 4MK7A 1KS2A 2D9PA 2VG6B 4UF4A 1LWCA 4I0WA 5D8HB 3P2HA 1RP5A 5H9FK 4P4IA 4N41A 4DQSA 2YNFA 2MZRA 1IKWB 5BYSA 4OX7A 2C3MA 3OUYB 3DRPA 1X4EA 2XO6A 2DPJA 4Y00A 1RXTA 4FXVA 3KLGA 4U8VA 2RQMA 2YBVA 4KPCA 2WVBA 5KFLA 2YY3A 2CPJA 3BBCA 1TUGB 3NP5A 2BM0A 3R6GB 1BQMA 2HGLA 4YDXA 4RKUC 2JC1A 2H65B 5ETNA 1D8ZA 1FKAF 4OYZA 3Q22A 1Q8BA 1SVDA 1PU9A 3R9EA 1Z8XA 3ILOA 2YWFA 1JXVA 5BWAB 3NCQA 4DV2J 4PG6A 4F67A 2RHSB 5BR8J 3D2PA 1IR0A 2LEBA 5K8PA 4WK3A 2PJ0A 2XZDB 4ZLJA 4IFVB 3KK2B 2KJVA 3JAMY 2W8KA 2AP6A 2IAJB 2E29A 3GLJA 2Y1IA 2ZBPA 5CNPA 1TKJA 5G1ZA 4DPYA 5B09A 3NGRA 4FBUA 1LANA 1CBKA 3MECA 4KV8A 2DO0A 4J9UE 1NHUA 1XF8A 3ENWA 3E3XA 3K9UA 3T8WA 1MWYA 4OZ0A 2V34A 2RDIA 1ZTWA 3SCLE 3NGSA 3NNCA 3NMAA 4IHMA 3X1LB 4CTAA 5CD4H 3C8YA 3P5BP 3GQCA 2V8DA 3PB8X 2Q43A 2D9OA 3D4UA 2WONB 3AODA 3QBCA 1VBKA 1ZM9A 1LW0A 4PQAA 1RT6B 2ARHA 5EHHA 2Q66A 2B51A 1KDNA 2XYGB 1WHYA 4UIAA 1MMLA 5H9EJ 3KHZA 4YMEA 2ZEGA 1EZZB 3BLNA 2LDIA 1LV5A 2HFZA 4OZ2A 4P71A 4R9MA 5KFTA 4X4NA 3IM9A 5DGAA 2RAQA 3W2VA 3FX6A 1NK0A 3GSIA 2VI7A 2V2KA 2WSCC 3W62A 1TIQA 2AFXA 3W65A 2LQ5A 1K4JA 2GIRA 3KUGA 5M2PA 3F73A 3UDVA 2GGPA 4QOTA 3POTA 2OO4A 4NA1A 3HD2A 3I9SA 3IP0A 2EXUA 2HQ3A 3A12A 2ZM6J 2Y1LB 1FHTA 1T95A 1KTQA 4R8FA 5GAEU 2C2MB 2VJVA 4G1QB 4GM5A 1VHSA 1LOUA 4JXRA 2IC3A 2XSFA 1B0TA 2U1AA 1RYRA 3M2VB 1HBUA 4D3HA 5J1EA 3KLHB 3DOKA 1Y11A 3H8EA 4WWVA 1U1OA 4BHQA 4YB1P 1QVGR 1BLLE 2GHPA 1OPZA 3LWMA 4AB7A 5EWEA 1NSAA 4MK8A 1U49A 3EO4A 4KT0C 2OTLS 4MI4A 2BV3A 1PYOB 4JI5F 4LUAA 4GKJJ 4P10A 2PFFB 3RB4A 4CLKA 1S4EA 1NSKL 3I87A 1KLMA 1IB1E 1TF8A 5ELYA 2QYCA 3KGQA 4N8NA 1R0AA 3N6MA 3HT0A 5I42A 2QYVA 4BCAA 4BDPA 4CO2A 4CLPA 2YNEA 2YX4A 2G13A 8RUCA 1N5TA 3WIUA 4DCJB 3UE2A 3QZ8A 5AG4A 4P2XA 1GX6A 5I3UB 3D6TB 4ZCKA 4B9LA 4QCLA 4P72A 4Q45A 2JBKA 4E98A 4U67Q 1Q0NA 1NPKA 2DITA 3GYGA 1BPNA 3CO9A 3U1NA 2PR8A 3I3GA 1MJBA 1UFWA 5J2QB 2MGZA 1RT1B 1FVQA 2J6SA 4O3NA 1IM6A 4N5SA 5DDOC 5A27A 2VG6A 4X4UA 1HYSA 3A3NB 3HVTB 4CWBA 4E2FB 3G4SS 3RU0A 3PO4A 4NZ0A 2CF4A 4ONWA 2Q6BA 2E1CA 3PP9A 2BZ2A 4Q8FA 1IKWA 2GHWA 3EXYA 2DR9A 2VEZA 1CJUB 1HMVB 1RHKB 3ET6B 4NGSA 2I38A 4ZKAA 3OL6A 4B9MA 5AXLA 2G3AA 4GVBA 2QG9B 2VQFF 1P27B 4MCQA 4ZPCA 1WELA 2EFNA 3H5UA 1HHQA 1ZM2A 4B3SF 3J7AN 1BXNA 2NXEA 4DUYF 2HK3A 3CJKB 4BWMA 2WTFA 4ECUA 2Y8WA 4LFBJ 3KHRA 2VD3A 3TE4A 3TRGA 1OYDA 3G3SA 5KG7A 4F02A 3VWEA 4IDKB 3HZEA 3N6LA 2IDLA 1S12A 4A8MP 1TK0A 3R7NB 3SDEB 1B64A 3OFEA 3BJYA 2CTBA 3PR4A 5EGYA 2VBQA 3W63A 4M94A 4ZLLA 1K8AT 3AT1B 2ZBCA 4RW6A 1X60A 1BO4A 4DR1J 1WC0A 2HVDA 2R8GA 2AZ1A 1FX4A 3W8PA 2UXDF 1Y7PA 4FVMA 3A3PB 5CAAA 6FD1A 2EEYA 4EZ9A 2BKPA 1Y9WA 2DIUA 2RFHA 3BBFA 1FJCA 2CA9A 4XIUA 4P73A 1HEEA 1M0SA 2XSJA 1UVJA 2AKWB 1CBXA 3I56S 5SUHA 1J5OB 3MGDA 4AQYF 3S9NA 2C3UA 3MPUB 1L3UA 2DHSA 1EETB 4B10A 2J8AA 1R6VA 4ZN3A 3W9HA 5GAGU 1RTJA 3GV5B 5T41A 1OY8A 2PJ5A 1GMVA 4UOFA 5T14A 4CTAB 2FVCA 3W2VB 4W9YA 3KFWX 3M2RA 4QWAA 3PHEA 4KPYA 4ZP8A 2VL1A 1TL3A 3L95X 5HROA 4AXVA 4U96A 2D74B 2ZEJA 1WKJA 3EFAA 2ZKTA 3EGNA 2DF5A 1RCXB 4LFAJ 2J6UA 3CCRS 4Y65A 5JMNA 1ZPWX 1H7XA 4V19X 5CXTA 3MD1A 4UUWA 4CO5A 1F9EB 3MR6A 3IO1A 4BINA 1S6OA 2R4FA 2XI3A 2Q4ZA 5HVHA 1XMQJ 4HEA9 1M44A 5CA5A 2C42A 1HR0J 3SZ2A 3MEDA 4NXMF 1FDAA 3D6MB 3MAAB 1UETA 4DQPA 2K7JA 4QW8A 4I4BA 3NY0A 1MK4A 2AJ6A 1S7KA 4CI0B 3IRXA 2MHEA 2BEIA 4U7UD 4IAVA 2GU2A 4UW2A 2XS2A 1NJZA 1IJFB 4PWUA 4KH0B 2UUAF 2XNRA 3AA8A 1XMBA 3HKZD 3M9OB 3OXFA 4DG1B 4CM0A 5JUMA 4CT9A 4NA3A 1AFJA 2B3VA 1RHQB 4RU2A 1HNWF 4ZITA 2D3O1 1WORA 2R98A 1NDPA 2YKAA 4WP8A 3OUYA 1QSRA 2RT3A 1H2UX 2VG5A 4ECRA 2HHPA 3BGUA 4ZJQA 3OL9A 3ZO7A 3K5MA 2BCOA 4ZX8A 3DLGA 2QLXA 1VHFA 2PJ7A 2VDIA 3X3UA 1LWCB 5HATA 2ZBQA 2OHDA 4DR5F 4RI1A 2FLPA 1FXLA 1ELMP 4F0KA 4NLGA 1RAAB 4QWCA 4CGLA 1B3TA 2YKQA 1Y00A 1VBZA 2MQMA 3R5DA 4C6AA 3FCWA 1RTIA 3BO2A 3CJ4A 3SHPA 3FEZA 2YPZA 1S6PB 4AE5A 3ZC4A 3B3WA 5G0RA 2V8HA 3ZFVA 5HQ8A 1X31C 1W2BR 3E2EA 4NYOA 4IRKA 3MN8A 1T03B 3W66A 3KLVA 2NCKL 3WHIA 1YBAA 2DCLA 1QD1A 3V6DB 3KKFA 3D7DA 4HACB 3QGHA 2FXFA 4NGTA 1RT3A 2UVRA 1B7YB 4G65A 3TA0A 4F9UA 3UD4P 1KOOA 2YNDA 2YKMA 2GAHC 2FIAA 1IYKA 2NXCA 1AYEA 1S79A 3NCRA 1XEZA 2DGUA 2GMJA 2IQ6A 4KRWA 1RACB 2GIFA 2AJ4A 3LACA 5L1JA 3H42A 3I9V9 3M05A 3ITHB 2DNYA 3M8PB 6AT1B 1LRZA 1PO6A 4XK8C 2M5YA 5IT9U 4OJ1A 2BKOA 4OC1A 5JVGQ 1HIYA 3RBDA 3EM1A 2GMLA 3I5AA 4R8UA 3PXGa 2XY7A 2KHCA 1FKOB 2MY7A 3CCUS 4IUSA 2R8IA 3DDIA 5D3GB 3VQTA 2F5IA 4ECSA 1QE1B 4IK2A 2G0JA 4XAKA 1T9VA 3BQ1A 3NH4A 3GILA 3B82A 2AZ3A 2PI4A 1TL7A 4WIIA 3MEGA 2PJ6A 3Q8VA 3IRWP 4M3SA 2GZOA 1IBLF 1YTYA 2CZVC 4MIAA 4A33A 4ANDA 5IXUA 4EFAC 3IU2A 1BHNA 4H4OA 2ZBRA 4Q5VA 1KN6A 3DLKA 2PJ9A 2ZPAA 1NK4A 2MEWA 4TY8A 4DN0A 1XNQJ 2DYAA 4X66J 5G4DA 3NCPA 2HHHF 2P6TA 3A13A 1S1TB 1U6MA 4OHXA 1KQFB 2D3OR 4K8RA 2HLTA 1JWWA 3HLPA 3R96A 2ZW6A 3CMAS 4UFVA 4WFNQ 4K4XA 1Q8IA 1IBLJ 2HFOA 2I79A 1NSLA 2H1YA 3ZTOA 3SJEA 2ASDA 2OPPA 3CJ0A 3DMJB 3ENQA 2O4HA 1V5IB 2C2ZB 3FVLA 1RWXB 2QLJB 3AD7C 1BPMA 5DZ7A 2QIFA 2UVVA 2LP4A 1CC7A 3KJVB 2POKA 2FVGA 4Y34A 1N6QB 2IMWP 4M5DA 1KVKA 3IA0A 1QE1A 1FK9A 2XY5A 2QT7A 1NM2A 4XPCA 1X0FA 3D8PA 1QJHA 3BZQA 1NCLA 4QB9A 1U6FA 4L3KA 3CW2C 1N36F 2F65A 4CP5A 2Z2LA 2XYHB 3EXCX 5HP1B 1XIXA 4C7IA 4CYOA 5E96A 1R57A 4CO3A 4HYKA 4GMKA 3PB4X 1S1XA 3H4BA 3D2MA 3TEGA 3MCMA 1JLBB 2APOA 4NLDA 5T7LA 1F60B 3OD2A 3TUPA 5J1PA 3BSNA 4ELTA 3HVRA 3RNZA 2HAIA 4X84A 3MPVA 4CH0S 5LOQA 4OP4A 2HQGA 5FLXY 1WOSA 3J80Y 5L9XA 1NE9A 2W2PP 1WWHA 5AJ3J 2ZZMA 3NE7A 2Q0YA 4LRDA 2R2RA 5KG2A 4IH5A 4JI7F 4LQ6A 3CEDA 4GRSA 4X64J 4QYRA 3CGIA 2E7WA 1PC4A 1B87A 3BGRA 4ANCA 1AFIA 5A8WA 3FECA 1WEZA 1IUJA 4UBRA 1KSPA 2GE3A 3QWPA 4BS2A 2MQNA 4RWXA 1S1VB 4USTA 2JDDA 3SQOP 3D6FB 2DXQA 3R95A 2IDEA 4F6AA 1G3OA 5CYQB 2XLJA 4CLFA 1MMDA 2KRBA 3R1HA 4L72B 1FJEB 4NXNF 1CM0A 4FF1A 1SQEA 2GHVC 2ZNZA 3QAUA 5J8CA 2Z2MA 1IM4A 1PYTA 1Q81T 5LSLA 1MG7A 1MU2A 2HQIA 4UCNA 3D0IE 3BM7A 2Z30B 4Y6IA 3FZBA 4HKFA 4RW4B 1SH0A 4OC0A 2FTRA 5HAOA 2JLGA 3N01A 1SIWB 1RTHA 1QUPA 3EGWB 3QLHB 3G6ES 3FDSA 1Q78A 1DTQA 1VQ9S 1RKJA 5IWAJ 1CJKB 1P9YA 3CPXA 4OC5A 4ZDNA 2BKNA 2PJ3A 4OX9J 2BW2A 1JLEB 1LWEB 1BOBA 1F2HA 4EBEA 4J9OA 1BWEA 1JJHA 5KT6A 3DM2A 3UW1A 4KHMA 5D0RA 2XO7A 2MKHA 5GADU 3HJFA 4RU9A 1VQ8S 2YTCA 2H5MA 1P1TA 1RTDA 2Z3MA 3CULA 1JKHB 4DX8H 2Z11A 1NU4A 3ZZZA 3I1UA 5E5NA 2DNNA 2YPYA 4MTPA 3HI9A 5BXIA 4EYIB 4ID5B 3I0RB 2HW3A 1R0CB 5HBMA 3NKYA 2DBBA 5GAEI 3BYPA 2CFXA 1RWPB 2CNTA 2MQOA 3VVTA 4FD4A 3SEOA 5KOXA 4NWBA 2PDAA 2P6GA 5FJ4A 1XJWB 1DBDA 2B56A 2QYGA 1GTHA 4J5OA 3QZ7A 3OLBA 5KFOA 3M9NB 3SSQA 3ENVA 4FDFA 4DR2F 2QV6A 3ISND 1TL3B 3B4DA 4KSFA 1KHWA 2PJ8A 4H6UA 5F9LA 4AVAA 2B4VA 2WYRA 4QIFA 1AZSB 2Q1LA 4B9SA 2MZSA 3QATA 3AJ1A 4PG7A 3BQ0A 4XNHB 2VC0A 4IG0B 3GR0A 5C7PA 2A6MA 2XLKA 4K0KF 5IM0B 4V1Ak 2Q4YA 5L46A 2FGCA 3KHLA 3HLUA 3IJ3A 2QMLA 3H8YA 1S5KA 4MY0A 4CRZB 2QGFB 1TZ0A 3THVA 3FEYB 2UXDJ 3NMRA 3HXMA 4IQMA 3TJ9A 1X0PA 4ZVOB 4CZCA 1YJVA 2W24A 2WHOA 5AE1A 3PACA 2XCAA 1CSJA 3KK1A 3CC2S 3C6UB 1M90T 3PB7X 3QT8A 4MFBB 1HBMA 3BO3A 2JEWA 2VBZA 2JX2A 3I82A 4G6VB 4NZ6A 2JFDA 4M1KA 3MM5A 4QR0A 2HMIB 2HNDA 1E6YB 4QWBA 3G6XA 4N47A 5D4NA 4GKKF 1TXRA 1RE1B 2N4DA 4OC4A 3DU6A 5ITHA 2CQBA 3KHGA 1PAUB 1NSPA 1HLWA 2W4PA 3FSXA 4KY3A 1JNZB 4CH7A 5D29A 4C0OC 1M5KC 1ARMA 2BRKA 2BMBA 2J5AA 1S7NA 3OR2B 4GKJF 3CD0A 3I4HX 4OYBA 1UEUA 2R9LA 1HNZJ 2XB2D 1T11A 1VI7A 1Z1ZA 3VWDA 4NGQA 1Q8LA 1HWJA 4I7FA 3H2UB 3WC5A 5EBVA 1VIOA 4L75A 5IM0A 4ILMA 2QL9B 1JQGA 3GG1A 3K8WA 3L09A 3UY5A 3I6PA 2KU7A 3A4TA 1UWBB 2J0WA 4N56A 2QO3A 3KLFA 3O1LA 3AXKA 1QTMA 4JV2A 4C8KA 3M9MB 1SJRA 2FGOA 3QAEA 1TUVA 1DLOB 4EEYA 2ZEPA 3FB3A 3PW0A 2GMHA 5ETOA 5L1IA 2RQKA 3ILLA 3QQCD 3FSYA 5F8MA 3EJMA 1SB6A 2BJ3A 4KH1B 1X9SA 2UUBJ 2V4RA 4U5YA 4P2FA 1CJVA 3B4MA 2FUG9 3NS7B 4DX6A 3VAHA 4BLGA 1HNIA 1UJ6A 3CE8A