2V8GA

Crystal structure of beta-alanine synthase from saccharomyces kluyveri in complex with the product beta-alanine
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
432
structure length
432
Chain Sequence
b'PLSIASGRLNQTILETGSQFGGVARWGQESHEFGMRRLAGTALDGAMRDWFTNECESLGCKVKVDKIGNMFAVYPGKNGGKPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNYVPNYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLEEAYGLMSVGEDKPESVYDSLKNIGYIGDTPASYKENEIDAHFELHIEQGPILEDENKAIGIVTGVQAYNWQKVTVHGVGAHAGTTPWRLRKDALLMSSKMIVAASEIAQRHNGLFTCGIIDAKPYSVNIIPGEVSFTLDFRHPSDDVLATMLKEAAAEFDRLIKINDGGALSYESETLQVSPAVNFHEVCIECVSRSAFAQFKKDQVRQIWSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSPEEIENGFKVLLQAIINYDNYRVIRGHQFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-ALANINE SYNTHASE
publication title Crystal Structures of Yeast -Alanine Synthase Complexes Reveal the Mode of Substrate Binding and Large Scale Domain Closure Movements.
pubmed doi rcsb
source organism Saccharomyces kluyveri
molecule tags Hydrolase
total genus 158
structure length 432
sequence length 432
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.6: Beta-ureidopropionase.
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2v8gA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2v8gA01
2PJ0A 5JH9A 4MCPA 4DYOA 3FF3A 3GB0A 3RBUA 4OC0A 3B2YA 3NH4A 3D7FA 4YU9A 4CPAA 1YW4A 4DJLA 2CF4A 3FEDA 2Q43A 3V7ZA 4F9VA 4MCQA 4JZ0A 5LYLA 4A38A 4Q7AA 1M4LA 3I1UA 4YWYA 1ZLIA 2AFXA 3B35A 1ELLP 3B7IA 4MHNA 5LYDA 2ZEMA 1LOKA 1Y0RA 3BXMA 1F2PA 3H8FA 3RAMA 4NJQA 4X8IA 5ELYA 4UEZA 3TX8A 3PB6X 3KHZA 5D29A 2HB6A 2C6CA 1ZG7A 2EK9A 3IC1A 2I3CA 2V8HA 3IFEA 2PJ2A 1VHOA 3PB9X 1H8LA 1TKFA 3B3VA 4F9UA 2ZENA 2XEGA 2IQ6A 2PIZA 4DUKA 3FX6A 2WZNA 2C6GA 3ISZA 3FEEA 3FJUA 3LMSA 4UEFA 1DE4C 1XMBA 2PRQA 4H2KA 3D67A 3H8GA 4NFRA 4G1PA 2NSMA 3WC5A 4NGQA 1ZG8A 4WWVA 5K8MA 5F09A 1BAVA 1EE3P 3KR4A 3FH4A 2O4HA 2C1CA 1GYTA 4OIWA 2ZEGA 2PCUA 4UF4A 4ZY0A 1XJOA 5D8NA 4IAVA 5JGFA 2V8VA 3FMCA 4ZY2A 3B3TA 4NGRA 2IMOA 1QMUA 3IEHA 4FWUA 1IY7A 3K9TA 1Z2LA 1YMEA 7CPAA 4UIAA 4BD9A 3IO1A 2O53A 3PB8X 2AFWA 1ZG9A 3KR5A 2ZEEA 3SJGA 2BOAA 4FUUA 2EK8A 1XRYA 1OBRA 1Y0YA 3N5FA 2AFZA 2ZEFA 3PFEA 4AXVA 3PBBA 3SJXA 2EWBA 4R7MA 4MCSA 3KGQA 4ZYQA 1PCAA 4TWEA 1XFOA 3V38A 4PXCA 2XEJA 4LQGA 4P4FA 5IB9A 3KL9A 3D7GA 4PXDA 4EMEA 4NGSA 2F8HA 5HVFA 4P45A 1LCPA 3WC7A 4X3RA 1IGBA 2F7VA 1CPSA 4R76A 4OC2A 1BPNA 1CG2A 2ABZA 4OC5A 2PJ5A 2CTCA 3MRUA 4ZX9A 2POKA 5HVGA 3IWWA 1YLOA 2JBKA 1KWMA 2PJ8A 1LANA 1TXRA 2C6PA 5K8NA 3KHXA 4UEEA 3PFOA 4NGNA 4MXUA 3PB7X 1ARLA 3D7DA 4OP4A 2QYVA 4NJRA 4MCRA 1JQGA 1TF8A 1ELMP 5HVHA 4NGMA 4OC1A 4EFDA 3BI1A 2RFHA 4IK2A 3IJ3A 1HEEA 2AFSA 6CPAA 2PVVA 3CDXA 4NGPA 3DGVA 4F8ZA 3D4UA 1CX8A 2G9DA 4ZY1A 1FT7A 2FVGA 1PYTB 3FVLA 3L2NA 4OIDA 5HXDA 4MRIA 2ZEHA 2PJ6A 1QQ9A 3PRTA 1Z5RA 1CPXA 3NH8A 1HDUA 1RTQA 2NYQA 4P4BA 2IJZA 2GLJA 1ZLHA 3SJFA 3KQXA 4PXEA 4P4JA 3LWUA 2PJ7A 2PE3A 2PJAA 2QJ8A 4R8FA 3D7HA 3PEIA 4B6ZA 2GU2A 2XEIA 3WC6A 4TNUA 2PVWA 1CBXA 3HLPA 3MN8A 4PQAA 4GM5A 1TKHA 4P4IA 1VGYA 2OR4A 1LFWA 4JYWA 1NSAA 2ZEOA 1BPMA 2QVPA 3SI0A 2GREA 4MMOA 1LAPA 5I4MA 3D68A 3BI0A 4P4DA 4WJBA 2WYRA 1ARMA 2Q51A 4Z65A 4EWTA 3S9NA 3CT9A 5LRJA 2JEWA 2GLFA 3RZAA 2DEAA 3S9MA 4A39A 3FECA 4X2TA 5LYIA 4PXBA 1F57A 3VH9A 5THWA 1AMPA 3HUVA 3WABA 2PJCA 5K8OA 4P6YA 3D66A 4NGTA 4R6TA 3NFZA 4OKOA 1Y7EA 2JBJA 3K2KA 3B3CA 4P10A 5CBMA 3CPAA 3KASA 3GLJA 2Q4ZA 4MHYA 5LRGA 2VL1A 1Z8LA 2PJ9A 5LRKA 3S9LA 2PJBA 2CIJA 3NH5A 2J9AA 3H8EA 4UIBA 3B3WA 3SI2A 5J1QA 4ZI6A 5JM6A 2AFOA 2PJ3A 4PPZA 3KI9A 2V8DA 3WT4A 2BCOA 4O23A 3PBEA 4KSIA 3CPXA 2OOTA 3T8WA 2ANPA 4OC3A 4FBEA 3VARA 2CTBA 3IIBA 4ZX8A 3JRUA 3SJEA 4MHPA 2ZOFA 4A37A 4K3NA 3ISXA 4IHMA 1TKJA 1HDQA 3NA6A 1FNOA 4A94A 3KQZA 1R43A 5LYFA 2PJ1A 2PIYA 1TF9A 8CPAA 1R3NA 1CP6A 2PJ4A 4ONWA 2ZELA 4MHZA 5DS0A 4P4EA 2BO9A 2V77A 2V8GA 4FAIA 1F2OA 4OMEA 3PB4X 2RB7A 5K8PA 3QNVA 4RUHA 1LAMA 1YW6A 1VIXA 1BLLE 2ZEDA 4P44A 4OC4A 3SI1A 2ZEPA 3B3SA 1UWYA 1AYEA 4W9YA 2AFMA 3KZWA 3DLJA 3GUXA 1XBUA 3VATA 1YSJA 2HC9A 2AFUA 5CPAA 1DTDA 1Q7LA 1CP7A 2ZOGA 3BHXA 3TC8A 1VHEA 2XEFA
chains in the Genus database with same CATH superfamily
4EK2A 4BWJA 4DUZF 1FRLA 1GMVA 1Z2ZA 4KS9A 2ZH7A 1URRA 2VZZA 2CF4A 1YVKA 4M5JA 2K2PA 3GZ7A 1KZFA 3QATA 4MCQA 2PFFB 1S9GA 3PRVA 4CYOA 5IQQA 3A3NB 3NS5A 1MJAA 4DPTA 4MKYA 1NNDA 1S79A 5IV3A 4NLVA 2JRSA 2KVIA 2P0WA 3EPIA 3CJQA 5F0UA 2WOMA 3CO9A 1XIQA 1QVGR 3PEHA 1HYSA 4E0AA 1H3DA 3JTPA 3OL8A 1CULA 1GMWD 5BYRA 3EWGA 1HMVB 2ATRA 2N7YA 1M0SA 3PW7A 5H9FK 2GANA 2OPSB 2R7HA 2DO4A 3MR3A 2B5JB 1D9AA 1UVJA 2MB0B 2AMCB 2NR0A 1ZG8A 4ZP7A 1NHVA 3BSAA 5K8MA 1J4JA 1N4LA 4USIA 3HO1A 1WC5A 3HJVA 2O4HA 2BQ3A 1SKRA 2Q7BA 4X66J 4NWBA 4X4QA 3HFKA 3B3TA 2P6EA 3HSZA 2EVNA 4J9OA 5A76A 1U24A 1RHRB 4LUAA 1DJ0A 1YMEA 2JVRA 4CRYB 1VHFA 1TL1B 3HT3A 2AFZA 3PBBA 3SJXA 2MY7A 4LFCJ 2EWBA 1SL0A 3PHEA 5E3RA 5LM7E 2E5JA 1RCXB 1XFOA 1Q0NA 3W5ZA 4H4OA 2J8AA 4O3SA 4NL5A 4PXDA 1S1UA 2UUWA 3IRXA 4ZPVR 5HVFA 5EX3A 2V4QA 4EZ9A 3WC7A 2VOPA 1NZ8A 2KN4A 4C8NA 2F7VA 4LR7A 2JLFA 4DV7J 3B82A 3H42A 1CG2A 2HGLA 2AE6A 1FCAA 4NYOA 3RB4A 2WSFC 4ZJOA 1IN0A 4CTAA 4AYBD 2QC3A 3IWEA 1TXRA 5HQ8A 2NYIA 3OHBA 5ETMA 2BE2B 2JJ4D 4NJRA 3P45B 1U2RA 2P8IA 4DQQA 2RFHA 3A8IA 1IKVA 4OLPA 5DG8A 6CPAA 4UOFA 2PVVA 2FCKA 4IG3A 1ZA1B 5AXKA 5A2QY 1RWKB 3FVLA 4UFXA 4I2PB 1N8RT 4L74A 3P8BB 5D0GA 5I3UB 4MRIA 5LOQA 3DHWC 3ISNC 1G7CB 3W6SA 1HDUA 5CZXA 5HLFA 4ERDA 4ECWA 1WHWA 3CD7A 2QJ8A 4N76A 4LSZB 1FDAA 2IAJB 2HQCA 2XEIA 2VFRA 2D4OA 4ECYA 4PQAA 2Z8QA 2RU3A 2HHUA 1RA7A 2W01A 4ZITA 2DTJA 5I4MA 4MJ8A 2VG5B 1UFKA 5CXTA 4ILRA 3MR7A 3ZTQA 4RN7A 4DR3J 2EFPA 4YQWA 2A4NA 1KN6A 2DNZA 1RAAB 4N7TA 2EW9A 2B4DA 2YKMB 1WHVA 1RAHB 4KPCA 3ZO7A 2B7CB 2C2RA 1WNEA 2Q6BA 3VH9A 4F3MA 4E98A 2LDYA 3LANA 4IR1A 3I32A 3UNGC 3DRSA 2VPZB 3UFCX 1SL2A 4OMFG 4LF2A 4A8QA 2JBJA 3WZ0A 4DR4J 3GLJA 5C5JA 3OR2A 4I49A 2ZH6A 5G20A 1Z8LA 1REVB 3S9LA 2XHCA 1LNQA 4NXMF 4C68A 3SI2A 3JAMU 3X1LB 4GXHA 2B4UA 2VQYA 5J1EA 2W25A 5H1SV 4KOUA 1QSRA 1OPIA 3THVA 2BCOA 2IJRA 2XWXA 3EZ5A 1S1TA 2WZ1A 4ZX8A 4HKQA 3I55S 2DPSA 4PRFA 1FKPA 2KRRA 5K14B 1WOOA 4KKOA 1JKHA 4NXYA 2FXFA 3GIKA 3I5CA 1XNRJ 2DR7A 3MPDA 5LMUJ 2I38A 1TUWA 3BBBA 4PSXA 1BC6A 1KBRA 4GVBA 4ZDNA 1CP6A 1T02A 5L1LA 1M4GA 3V4IB 2Q79A 3F41A 5DS0A 5AE2A 4FAIA 4YR3A 2CJXB 4IFYB 2EBGA 5K8PA 4I68A 1KVKA 2LKZA 3CJ4A 3NGDA 4P44A 2XULA 2GA7A 4F0YA 2GX8A 4Y0FA 1UA1A 4B3RF 2AFMA 3KZWA 1S0NA 3HZEA 4ETXA 5LSOA 4NEYA 1EKSA 3DDKA 3I0RB 1GH8A 2HVIA 2XMKA 1N52B 3TC8A 2R7VA 3KLIB 2W4DA 1CLFA 1MWYA 3C6UA 3IAM9 4ZP9A 3QRRA 5LJ3Y 2DISA 3IP0A 3TRGA 4QC6A 3OL7A 3OSNA 2CJYB 3T5JA 4FXVA 2RQMA 3L7OA 1XR6A 4B12A 3LACA 4KOVA 3NL0A 3ILOA 3B35A 5E0OA 3CC4S 1KD1T 2HVEA 4OJHA 2RNEA 2R2UA 5KFYA 4AQYF 2Q44A 3KHZA 2X7IA 4CGPA 3C16B 3K58A 2Z10A 2YTCA 4UQTA 4YEAA 1Q8KA 2XZWA 2CPIA 4HACA 2CNMA 2GQ2A 2HNDB 4KOSA 4FYYB 4EO6A 3TZWA 3M9NB 3OHAA 5K5MA 3MR2A 5C88A 2RDJA 4LRDA 3NCRA 2BUNA 3DSBA 3THPA 3DYAA 2EG1A 2OMLA 1Y5NB 4PR6A 1RLDA 1QUPA 4NGQA 1IBLF 1BAVA 5IQ6A 2IL4A 3LQVA 3KK3A 4OJ3A 3TX0A 1GYTA 4U67Q 2ZEGA 1Y7RA 3FVYA 2XY7A 3PV8A 3G8SA 1QTNB 2WVFA 4X5KA 2IMOA 3GCWP 4MKBA 4FWUA 1R7IA 1JLCA 3CIMA 3TJ8A 3TAQA 4OYAA 4HPSA 1LXNA 4TU7A 1ZZNA 2L3MA 3D6FB 2ZFHA 4QR1A 3OJUA 2XEXA 2M8DB 2I79A 1TK5A 3HHLA 4ZIVA 1U2CA 3W5YA 3RRHA 1JMTA 3MMBB 1WG1A 2XEJA 3TO7A 4RW7A 1QSNA 1BD6A 2UVUA 4DQPA 1S9EB 1NHUA 2MKIA 2DR6A 3UPFA 4DV3F 5T14A 2GW8A 1FEEA 3D2WA 2IJNA 5G4DA 3CCZA 5C2CA 1J5EJ 3M9MB 1XMTA 4ED8A 1RCOB 1W7WA 3MD3A 4BC9A 1YX0A 5D78A 3W91A 9ATCB 4B9TA 1SL1A 1MLAA 4L76A 4I67A 5B0FA 1NDCA 2R7UA 2HFVA 3G3SA 2EK6A 5HK4A 3QSYB 2GZOA 3FBBA 3H7HB 1N5TA 3GSDA 3OUYB 3KHHA 5KT5A 3DLHA 1RAIB 3W7BA 2OMOA 1SIZA 1YJNS 2ZJPQ 4U8YA 1DQ9A 3MXHP 5ITHA 2CNKB 1PYSB 1XMQJ 3DLKA 3D4UA 4Q36A 2QJ3A 2C2KB 5D4PA 4HT5A 3QT7A 2G2OA 3G86A 2PJ6A 3M8PB 1RWWB 1CPXA 1AUDA 3D3SA 1Q5YA 3MM9A 2C3UA 5E3PA 3MEEB 4RBUA 1GX6A 1HW8A 1NJYA 4F4ZA 1RWUA 3CXSA 4P72A 4C7IA 2LDIA 1EP4A 4OZ3A 2V6AA 4A46A 3TNVA 3OLBA 3PVXA 3C3LA 4TNUA 1X7VA 1WJ9A 4KIAA 3QB8A 3EXCX 3KK1A 4ECTA 4RW4B 5GADI 1DHMA 2YKAA 1NM2A 4NE9C 2GMHA 3OV7A 3KG1A 4CCHA 1ZH5A 5GAEU 8AT1B 1F0XA 4LF6F 1VISA 5JVGQ 3T1HF 2CPXA 4JI7F 1RYRA 2YNFB 3JTNA 1F2HA 7FDRA 1PGZA 4QWDA 3SFGA 5GAGU 1GXLA 4DUYF 5KFAA 4ANEA 3BDPA 3Q2SC 3I56S 5HP1B 3M8QA 2AYGA 4DUZJ 5HI7A 2QE5A 4IFVB 4P6YA 3PR4A 3HHEA 2N3OA 4F4AA 4WFBQ 1HNVB 1U6MA 1ZM4A 3D6HB 5HBMB 1ZS6A 4MHYA 4QR2A 2MKCA 1VK3A 1N5SA 2NZ4A 3U1MA 2LEAA 1TZ0A 4FP9A 1GXUA 4HTJA 2OPPA 4J9NA 3TA1A 3G4SS 2NZCA 5KTQA 4TLRA 2OH2A 2PJ3A 2A0FB 4H54A 2ILZA 3VARA 1KQGB 4J9LA 1FX2A 4BBYA 5AG4A 3VCDA 3PTWA 4KJIA 1S49A 4IHMA 1M90T 1RABB 3E8OA 3W65A 2DVIA 3ZNJ1 2HMIB 2Y0MA 3MURP 4ICLA 1T9XA 3G6XA 2DGVA 4FYXB 3PACA 1XR7A 4MFKA 4MK9A 3O3LA 1BQMB 2QL9B 2XSJA 1REGX 1CC7A 4PEOA 4A8FA 2CQ4A 2P9GA 4OAEA 2XS7A 1VQNS 3C26A 1OY8A 3CD0A 2FY1A 3LP1A 1N33F 2YNIA 1V3ZA 1UWYA 2IHR1 2F5GA 1YWXA 3CCRS 1DRZA 5HMYA 4P7TA 4OYPA 3KMSA 4F3QA 4XPDB 2ZWPA 4YMEA 1WUUA 2P9EA 3C6TA 3LPYA 3CCTA 4CLLA 1QLNA 4JZ0A 1OIAA 3ELHA 1M5OC 4ELUA 2M5YA 5C42B 1F3VA 1U1PA 3L3CA 3OTOF 1Q8IA 4MK7A 4MY0A 4B5PB 3UW1A 5JPHA 2B8QA 3TOAA 4DFJA 3PHTA 2E1RA 4OX6A 2DR8A 4JV2A 4I0WA 2D3UA 3NMAA 1AB8A 1ZTWA 3KDOA 2NPIA 3KUEA 3B3VA 4O44B 4F9UA 1TKXB 3DOMA 3PZPA 1MMDA 1NSQA 4ZJLA 2AJ0A 2QLXA 2GJFA 1ZM3A 3D8PA 1SBRA 5IC6B 3M32B 1S72S 1NK9A 5M2UA 3MM5B 1W25A 1D9DA 4G1PA 2NSMA 4C98A 4FF4A 4EEYA 1CC8A 1IKWB 3B78A 4FNIA 4DL5A 4ZN1A 1XQIA 4OYBA 2ZZNA 1YJ7A 3F56A 3TWZA 1GNKA 1HQEB 3K9TA 3EGWB 3LW5C 4GC6A 5AGEA 4DPOA 1AW0A 2ZEEA 2EK8A 3DOKB 3MMCA 4C3LA 3W64A 1QM9A 3BKFA 3DOLA 4EUVA 3GYNA 1X5SA 2XGQA 2KJVA 4TWEA 3M6UA 3GR0A 2PGCA 1K1QA 1KSPA 5DDPC 4QU7A 2KRBA 4ZVFA 4X3RA 2CJAA 4CT9A 2RQCA 4DPXA 1SJQA 1WC3A 2UU9J 2DXEA 3NGSA 3FFIA 4IG0B 2PI4A 2PC1A 1NPKA 2GIRA 1XNQF 4RS2A 1IUJA 4F2RA 1QSMA 1RWNB 2DNHA 4O0NA 4R5PA 3SZ2A 2C6PA 1H72C 4NGNA 4MXUA 4AL7A 3MUMP 4ZVEA 2BW2A 1A0OB 1F5BA 1FFSB 2HHWA 4DEZA 3KHLA 4IK2A 3R7NB 2UXBF 2RRBA 4MFJA 1ZO0A 4KVXA 4RZRA 2NUHA 1VCTA 2GIFA 2ZC4A 2G9DA 1UVNA 4UA3A 2N7CA 1VJWA 2EI5A 3NXZA 5F8LA 3EY5A 2Z4PA 4L6V3 5E3AA 1JK9B 1EZZB 2HV2A 4B14A 3VHQA 4A2ZA 4P4JA 1WKLA 5D4OA 1HLWA 2PJ7A 2DH7A 1U1MA 1OJ4A 4DU8A 3TR5A 4A8MP 2F4FA 3CJ3A 2PVWA 3R27A 1HWIA 1LWCB 3MECB 3BEGB 3ZNUA 2P6FA 1IBCB 3PO5A 1LFWA 2APOA 1VBXA 2WONA 4MMOA 5KT2A 3HCXA 2FIAA 5I42B 2D1CA 3FIXA 4W4MA 4KHMA 5L9NA 2PD1A 3NNAA 2HGMA 4B9NA 4FXDA 5F49A 4ZJQA 3PW4A 1VHSA 4A39A 4PXBA 2ZPAA 2ARHA 2NXNA 1RU1A 2I2YA 5CQGA 3SSRA 2RD5C 4GRSA 2ILYA 1U7LA 3UI3A 3Q8UA 1UP1A 2C2DA 4P10A 3WC0A 1RJJA 1IICA 4UWJA 1SXLA 2CIJA 5A2QU 2MSTA 1FY7A 2UXCJ 2F8EX 1S6QA 3T1YF 1JLGA 4J91A 4RKUC 2O1PA 3BSOA 1FNMA 5A6PA 2G3AA 4G1QB 2AFOA 2AX1A 5BJRA 1SPBP 1D0EA 1KQKA 2KG0A 4DR1F 5H9FJ 3G71S 4DX8H 4CLZA 1T03A 2E29A 1RT3A 3NA6A 3LP0A 3CJSA 1F5AA 2DNKA 4KSEB 3WIUA 4TXSA 1HQ2A 5LYFA 4JP8A 3VV2B 8CPAA 3P49B 2ZW6A 1RT7A 3IM9A 1P27B 2R42A 1XWLA 2C2OB 4P6QA 4ONWA 1IBLJ 1CULB 4KAIA 2BO9A 2UUBF 4C2ZA 4JOUA 4OX9F 2G0BA 2JSXA 3EICA 2RB7A 3MTKA 4TNOA 1DQAA 2J5AA 3S6HA 3DNSA 2YX4A 4ZPCA 3SMZA 3D54A 2ZE2A 4JI2F 3VAGA 1S7NA 4QWAA 2M3DA 1YJRA 2BKPA 4M1KA 3I96A 5BR8J 3CF5Q 1RSCA 2FD2A 4KVOE 1QE1B 4C6AA 4F36A 4DV0F 2B9XA 1Z8XA 3F8KA 4GVLA 2RKIA 1C0TA 2CQBA 4S0MA 1YJWS 1KUYA 4RUCA 4ALZA 3WBZA 5ELYA 3IC1A 2BUEA 4MFBB 4RUBA 4D3GA 3A4TA 5B0GA 2MZRA 2CQPA 2X1AA 3AOCA 4H4OB 2HBZB 2RE1A 2C2EA 2IDLA 5JUMA 1S1UB 4YGOA 2E7WA 4ED6A 2OEKA 2VF3A 4GMKA 2E9RX 2J6SA 3HSGA 1KDNA 1FVSA 2GGPA 1NJWA 2JEVA 3FJUA 4AXIA 1XMBA 1HD1A 2CAJA 1WDDA 2Z2LA 2J7WA 1TAQA 4WWVA 2G9OA 1VQLS 5G22A 3KJFB 1EE3P 2MZQA 1X5PA 5KFEA 4V19X 4JYAF 1NUEA 4ZPDA 3N6LA 1KOOA 3FMCA 3LAKA 4Y3CA 4QYZJ 3JSMA 4B9SA 4K30A 1OPZA 1ZAWA 4FDFA 2Z3KA 4E8UA 2JLMA 3TAMA 2F9DA 3IR5B 5IC4B 4FS2A 4OI0A 2CXEA 5HH1A 4Q2LA 5HQLA 4TLQA 3V6DA 2GAGC 1OQ3A 4FD6A 2B3UA 2H4WB 1MN9A 1FRMA 2A2CA 5HLFB 3KL9A 4MFPA 4A8OA 4CP5A 4C4WA 3T1HJ 3C46A 3V6KA 1R0AB 2Y1JA 3GP9A 4USWA 2V8PA 1G2EA 1Q16B 1DTQB 4H4KC 1S60A 2HURA 2CJKA 2V4RA 5F47A 2DGUA 3E01B 4WXWA 2ZM6F 4X4RA 3BBCA 3QT8A 2E9TA 2JBKA 1RT2A 2B6AA 2O28A 4RW9B 1BXNA 1M44A 2EPIA 2DR5A 3AJ1A 1M5SA 2HQGA 1R8CA 4C3MA 3QMQA 2XO7A 2DIUA 2XCPA 2J8RA 1Q95G 1NZAA 2X1FA 4XPDC 3H8YA 2YWEA 4QOTA 2X7BA 4M5IA 3VALA 4ID8A 5BYQA 2VB6A 1KFSA 3CJ2A 3R5DA 1C1CB 3VQSA 2ASDA 3ZXWA 3KLGA 3VAMA 1IWGA 4KGZB 3G9CA 1X4HA 1JX4A 3MWBA 1ITPA 2IJZA 2M4MA 1IU8A 2WSAA 4JLYA 3UD4P 4I1TA 3G96A 3ONQA 1IKYB 1LRZA 5J1EB 2OPQB 2Q6CA 1CBXA 1PILA 3MCNA 1O51A 1VGYA 2VV5A 3VGUA 1ULRA 2DXDA 2VG7B 5JXSA 1JLEB 2HRYA 2XYPB 1Z4RA 4P4DA 3FZBA 4KORA 4QWBA 3BR9A 1N33J 3UCZP 1OMSA 1ARMA 7AT1B 2ACYA 2Q51A 4EWTA 4QCLA 3MFIA 2LU2A 2DEAA 3QAHA 4LVOP 1TL3A 4X2TA 1J5OB 1F57A 3OLAA 4IOCQ 3GYAA 4U7UD 1LQ9A 2YGWA 4OI4A 2F40A 2PEBA 5DQGA 2N4DA 2PO4A 4M94A 4O3QA 1JNZB 3KLHA 2DGWA 2XS5A 1K1SA 5KG2A 3M2VA 1VOMA 2IFXA 1IJEB 3OVBA 2NS1B 4CM2A 2JDDA 3SV3A 3CO0P 1YLXA 4FN5A 2LXUA 2ZH4A 4NLYA 3RYLA 2BANB 3W8GA 1CQNA 1U25A 4NLOA 5HQMA 2YKOA 1YDLA 3Q0AA 2OGUA 2QGFB 2MEWA 3O44A 3T8WA 4MK8A 2M88A 4ETZA 2FJAB 5B08A 2MKKA 3H59A 1JJHA 2ZOFA 4CAXA 2CQ0A 3BPSP 1X0PA 2OUGA 2JDJA 4DV5J 2W9BB 3BZQA 3UN3A 1SQGA 4B3OB 4B3TJ 4Q43A 4LIWA 4R57A 4PUOA 2D74B 1TK0A 4L3KA 3W63A 4DG1A 2K5TA 3TANA 5CYQA 1TL7A 3QGHA 4LSLA 4PYDA 1IOIA 3EYZA 5KFRA 4WE1B 1JLFA 2B4VA 2GVDB 1TP7A 4UCMA 2JC1A 1VIXA 1CJWA 4CH0S 2BKOA 2YNDA 4OC4A 2H1YA 4I7FB 1NK7A 2PMWA 4X4PA 1VYAA 5J2QB 3DLJA 4G6VB 2AFUA 3NGUA 2XEFA 2OH1A 1T9YA 3CXQA 2BSWA 3PKYA 5I3PA 2FSRA 4RW6B 1DAXA 1WF2A 1GFWB 4NYPA 4M5MA 3UD5A 3KG0A 1ZAVA 1PYTA 2LQ9A 4JV0A 4EO8A 4X62J 2BBEA 1N36J 4DSJA 3J81j 4YWYA 2CWKA 3S1TA 2ZEMA 2DR9A 3Q86A 1F2PA 4ID5B 4CLSA 1FE4A 3TZYA 2C2NA 5DWNA 1CJKA 3UD3P 1MN7A 4CZCA 3CXCR 1AZSA 4KH1B 1XNQJ 3H2UB 1BMQB 3VWSA 1IBKF 1R6VA 2JLEA 1UJ5A 4PV6A 2OD4A 2EC2A 1B70B 4RPFA 2E44A 5IM0A 4R8UA 2BM0A 4C11B 3PDNA 4IH5A 2BE7D 1FWKA 3R9EA 1WC4A 4EYIB 3CJTA 1NH8A 5HSPA 1TKZA 3SI8A 3TVZA 4FBUA 3TO9A 5B0EA 1BUXA 2VKRA 3D3CJ 4ZLLA 2K3KA 4ED0A 3I82A 4FXWA 2IVFB 3UDLA 4C2YA 3UVJB 1HBOB 4J7CA 4Z7CA 2XWYA 2B8PA 1YTYA 1R8BA 3AXMA 4KO0B 4YB7A 3KR4A 1S1XB 2DO0A 3M30B 1RWOB 1WKKA 4CGNA 1GAOA 1HI0P 1B6BA 3EXYA 3U7JA 4DCJB 3R5AA 1FESA 2VKZG 3MEGB 2JLGA 4LF4J 3CDBA 4O3NA 1HNIB 3QNWB 4BWMA 2OIHA 1XE4A 1SV5A 4KV8B 1N5VA 3RNZA 3ZTSA 2G3TA 2FLLA 2DHXA 1KONA 1UCNA 4JI3J 1IJFB 4P75A 2IM3A 2R7RA 5AXLA 3HF5A 1ZBTA 1BPNA 1SJRA 1WTBA 4OC5A 2PJ5A 2CTCA 5DQIA 1B4SA 4R25A 1YLEA 5KG4A 4BDPA 3V6JA 5AE3A 1MW7A 3D0IE 5CYMB 2FLOA 4LQ9A 3UDVA 5T7LB 5F41A 1FE0A 4J37A 4K2JA 1U6BA 1GHEA 1KR4A 3GV8B 1JLQA 4ECSA 3DDNA 1VJQA 3MGJA 4CH1A 4W90B 4PABA 4F8ZA 1FDBA 4ZY1A 1FT7A 1BQNA 3HKZD 1NK8A 3DI6A 3PYGA 3PW0A 1C2PA 3UO0A 2HNZB 3BJ7A 1YJUA 1LWFA 2VFUA 3PRTA 4IOBA 4HNWB 1P4NA 3E2EA 3QLHA 1X60A 1NDKA 2GLJA 4URQU 2FHJA 1CBKA 1S1VA 3DLGA 3JSRA 2V2KA 3TOQA 2BMBA 3VGSA 2XO6A 3QIPA 3KUGA 4USKA 1C4AA 2BJ8A 1QDUB 4UFVA 5KT6A 2B5GA 2OR4A 5JJBA 1TV6A 2PSZA 3BGRB 1TR0A 2CY2A 2XB2D 2UUBJ 3P2FA 3BGOP 4HTIA 2WUUA 5JMNA 1B64A 3BN4A 3OWCA 4WFNQ 1SH0A 2V34A 4ECVA 4KTQA 1GXTA 3S6KA 4NLUA 5LXRA 5HMWA 2HNYB 2J9EA 2L41A 2WPWA 4ICLB 5EWFA 5LRJA 2ZBRA 2D7SA 3H4QA 2G0CA 1VBYA 5KT7A 3D0GE 4LF1A 4JI2J 4OLOA 4ZLNA 3H5ZA 1ZPVA 1SUQB 1KHVA 3DRPA 4J9VA 4KY3A 1JB0C 2V63A 2QMXA 5E2QA 2HHHF 3MEKA 3NFZA 1LWEA 4P52A 1TMMA 2LCWA 5DDQC 2FHOB 4JI0F 2H4YB 2VIHA 2UXDF 3IGRA 3D6TB 3MHYA 3K9UA 3P4UB 4ZK7M 4DV0J 3Q8QB 4MYTA 4GKKF 3LAMA 4ATNA 1D3WA 1Q8LA 3OXGA 1RAJA 5J1QA 1HFEL 3PJWA 3PRBA 4E0DA 2K1RB 1Q8BA 5JM6A 2GE3A 4WP3A 3ITHB 1X4BA 1UZDA 4YN3B 1WSVA 3PBEA 1U1RA 2EBEA 2HLUA 4I2QA 4YS2A 2QFIA 1WOPA 1H38A 3CJ5A 3P6YC 1U0HA 2W2QP 1IBMF 3ISXA 3AD8C 3OVSA 2LYVA 3C19A 4IO1A 3M6WA 1N71A 1DBDA 3ENQA 1FNOA 2B3VA 4II9A 4C9DA 3FUYA 3BLNA 2OPRA 4NCGA 4FKYA 3H40A 3Q8RB 3JYTB 5KFBA 1R31A 1DLOA 2H54B 3ULHA 2HS3A 4UT4A 2B3TB 3HD1A 4CM0A 4JYAJ 1PUAA 4WK3A 5CNPA 4X4VA 3WR7A 3M1VB 4LMZA 4UCPA 1RGVA 4CDIA 4NLXA 2AKWB 3FBUA 2V9WA 2MJNA 1VRUB 4NLPA 4YB1P 1APSA 3FQKA 4UUWA 2E9ZA 4LQ3A 1K9MT 1X0FA 2VC0A 3CCWA 1RTDA 3QIDA 3OFGA 1HWJA 3BJYA 4DL6A 1PG5B 1S6PA 1R8HA 3EE3A 3D7FA 1OSDA 1VQ4S 1YX2A 3V81B 4UBRA 1TUVA 3OFHA 2CNSA 4P2FA 4CLPA 4DV4F 2XHWA 3OW2R 4JJXA 5LYDA 5RUBA 2RSQA 2KFZA 5L39A 4USTA 2FVRA 1RU2A 3QGPA 3DR8A 4MKVA 2HYIB 1S7KA 4KFBB 3BSCA 4DV6J 2ZM6J 1VHOA 3DLEA 3NWGA 1J27A 3G6ES 4DFKA 2KVQE 2HBRB 1UPPA 1RT4B 1S99A 2NCKL 1SJ4P 2BJ7A 4JBCA 3ISZA 2QLWA 3DU5A 3CIZA 1FDDA 2FDNA 3K89A 2B4PA 5KFPA 2HQFA 1LV5A 3MPUB 2IA6A 2ZW4A 2ZITA 4JXQA 3T1AA 3LGMA 3FBCA 2W2MP 2IM1A 4X66F 4UF4A 2LA6A 2VG6A 3MCMA 2OEJA 4IAVA 5FIIA 1YRXA 3CJKA 4OZJA 1Z2LA 4MY3A 2D3O1 2EFNA 1VRTB 3LH2S 1WI6A 2AFWA 4HKFA 2AGOA 5K9FA 4NCAA 3SFUA 2CXAA 4R7MA 3T3FA 3PX0A 2VD3A 4DL4A 4ZHRB 3KLEA 3AD7C 4FYVB 2MTLA 1U1KA 5ETOA 3HT0A 2KTQA 2MXYA 3D7GA 5LXYA 3L95X 1UL3A 3P3DA 5U47A 2ZDPA 4DV7F 2W2OP 5KFDA 4ZPTR 4ED3A 4TU9A 3PNIA 1HHQA 1S1WB 1OSCA 2JVOA 3CJ0A 1WG4A 3DR6A 3ZTRA 2XMVA 2ABZA 1RT6B 1KVIA 5GAEI 1Y5LB 4G1IA 4ED2A 2DHGA 3I6PA 3GPAA 4HLBA 4FF2A 2W9CA 3OBIA 2ASYA 4KHPF 3ADAC 2DNPA 1L3UA 2CJ9A 5LSLA 3VVUA 6FD1A 3AA8A 2BVZA 4ZBGA 5GAGI 2M52A 3CDUA 1TF8A 2H5JB 4E2FB 2ROEA 2K3IA 4ES1A 2DITA 3MMAA 3IJ3A 3FRYA 1PC4A 1S5KA 4RW8B 4GKJJ 2VPYB 2N4CA 3DGVA 2IDEA 4QVTA 4KB7A 2F5IA 1ON0A 3KXDA 3TEGA 2NXUA 3ZZZA 1MSWD 4J9SA 4NI2B 4P4BA 4KE5A 1C0UA 1FDNA 4I64A 4OZ5A 2CDQA 1Q2YA 2WBMA 3OFEA 2ERRA 2CA9A 3M8RA 1RWPB 2HGNA 4EI2A 3NAHA 2VONA 3TARA 1IVZA 5D6GA 1QAJA 4XPCA 1VQSA 4DQRA 2UUCF 1WD6A 1NSAA 2Y1LB 2PT0A 2ODFA 4K4YA 3NBPA 2ZHOA 1FWPA 4Q0BB 1IYLA 3G82A 5J2MB 2ASJA 3AJDA 1GQEA 4CH7A 3RGIA 4FD5A 1T03B 1WKJA 4AVBA 3FEZA 3DKDA 4IDKB 4KSAA 4USVA 5EBVA 2L08A 4HEA9 2ZD1A 4F4WA 2PI5A 3AAWB 4TY9A 2E7XA 4CYQA 2A1BA 1TVRA 2RF2A 4J5OA 1CJUA 1UETA 1F1BB 2H9ZA 2F4VJ 5IXUA 1X31C 2OTLS 2W2NP 4DR4F 3NCPA 1Q7YT 3C15A 5CYJA 1NE9A 1UPMB 3B3CA 3PW5A 3Q2TC 1N5QA 2G2YA 4DWIA 4MIBA 5B0CA 3V4MA 3NGTA 3CSKA 3LOUA 3KLFA 4CO2A 4ONUA 5I3QA 3EC4A 2DK2A 1N48A 2EC0A 2FJWA 4KUAA 3T9NA 3OT9A 3DMJA 1DURA 5KTDA 2J6TA 4NA2A 4OYXA 4DR5F 2DT9A 1IBKJ 3R5GA 2AX0A 3JRUA 2GC8A 3CDEA 1V3SA 2C2MB 3IMQJ 2LLZA 1QSLA 1RT1B 2EKNA 1SJ3P 1PJ5A 2ACMA 2GV1A 3N4WA 1FFGB 1Y9OA 3UCGA 2FIUA 1QSSA 2BJ1A 4LSNA 2KT2A 2NQPA 3M2UA 5IT0A 2ROPA 4PWDB 3G8WA 4K0KF 4KZTA 3R9LA 2UUAJ 3AQOA 4M5DB 1U1QA 2J7KA 3D2MA 5LSRA 3H90A 1SC6A 3U02A 4AVCA 1KFDA 2ALZA 5DO2A 5D3GB 2QL7B 3SBMA 1DTTA 4LVNP 5BXIA 4W9YA 1TU0B 1YZ7A 4NX9A 1Y10A 2BRLA 3Q8YA 2O3DA 3IGNA 4PKDB 3POTA 2XMWA 1CEZA 3W1YC 1A9NB 5EHHA 3HFVA 3NAIA 1Q2CA 3FMWA 1V5IB 2W8LA 1O8BA 4KGVB 2Z58B 2W8KA 4J3GA 1NAQA 2P9CA 2R8VA 2AW0A 3QSIA 4R3LA 1I21A 1I1GA 1HBMA 2Y0SD 5LYLA 2GHPA 1UFHA 1M4LA 1CS4A 1UTAA 3JSMB 2VUGA 3IAS9 2L48A 3SQGB 4O4GA 4PG5A 1NLKL 2VEZA 2CQCA 5HAOA 3IBWA 2AEJA 3MAAB 2C6CA 4KLVA 4NASA 4ES3A 1PJ7A 2PR8A 1RTZA 2KO1A 3NNHA 5E96A 1AXQA 3ZZTA 4Y00A 2CNNB 1L3SA 1FD8A 3QZ7A 4LRCA 3ET6B 3RBXA 5DLGA 2RU9A 3VGVA 4CT8A 2FT0A 4K50A 2BJEA 4OYOA 4L72B 3ENWA 3LUYA 2QMUB 3OJSA 2ZH8A 4MIWA 2AP6A 2QTWA 4P9SA 3GV5B 2HQIA 5SUHA 1RTHA 4UZBA 4XPKA 2MGZB 2IVYA 3QFHA 4FNHA 3W2WB 2VZYA 1OYEA 5DQHA 2LECA 3PYFA 5D77A 5AJ3F 4BD9A 2ZNZA 1SCJB 3KR5A 2QLFB 4QR0A 4RWWA 3KFWX 2JFKA 1UJ4A 1NK6A 4X64F 3NE8A 1K47A 4DSIA 3Q83A 1Q53A 4NEXA 3IXQA 2KDOA 4PG7A 4OZNA 2MZJA 3AXKA 8RUCA 1SQEA 1IGBA 4UFWA 3KJNB 2EXUA 4E2AA 3KJVA 3UCUP 2AJ2A 3IRWP 1I5OB 1WC1A 5E3QA 4X65F 2PJ8A 1F6TA 2AGPA 2CJBA 2XLJA 4AT1B 4OYZA 3KHXA 2VZ9A 2UXDJ 3R1KA 1WG5A 3ETMA 4FD4A 1CJTA 2QYVA 4C2MA 4MCRA 4F4YA 1PBUA 5IS2A 4EFDA 1VQKS 1HBNA 2YPZA 1XMQF 4HH1A 2R1IA 2DNYA 3VTIA 1KLMB 1UVKA 4L3NA 4RUAA 2XNRA 1JJ2R 4M6IA 4QBJA 1CX8A 2YWGA 5IV4A 2ZBCA 1M4DA 2CQHA 2PA8D 1T0TV 4WFZA 2QV6A 2WB1D 3TQEA 4CAWA 1K73T 3D6MB 3T19A 1RTQA 1IBMJ 3FKBA 3K5PA 1BLUA 1X4EA 2XI2A 3JUWA 3F5BA 4PXEA 3HSDA 1U09A 2W4PA 3PX4A 2J0WA 2DKOB 1FD2A 4PAAA 3N01A 4XNHC 2AEMA 4JI5J 2ZEOA 1IWAA 4FPRA 2HWIA 5KFCA 3I87A 4C0BA 3BI0A 3DFEA 1YIJS 3SXLA 2QYGA 4Q8EA 1HMVA 1WTFA 4Z65A 1JXVA 1UKUA 1BO4A 2LQ8A 2JEWA 3B8GA 2VFVA 1LXJA 3NEKA 3IU1A 1HKAA 3P5BP 1G3OA 3T5LA 2OPSA 3EGZA 5CCLA 2MPUA 4OADA 4J9MA 4IYQA 1NH7A 2B5JA 4B13A 2R2TA 4R6TA 1T94A 4ILLA 1N5YB 4HI2A 3P96A 4WWSA 1YRTA 1Q2DA 3MEDB 2XG8A 1IQTA 2XYHB 1UW4A 3VVTA 5ETVA 4DV4J 2PC6A 3HHLD 2PDOA 1S59A 5A8WB 5HJYA 3QBCA 2MZSA 3R8YA 3GG1A 2NUUG 3MCSA 5HROB 3OQ2A 1BOBA 2VI7A 3LO3A 3U27A 1W26A 1TUGB 3K8WA 5A8KB 4P2MA 4PPZA 2AEFA 2WCXA 3WT4A 4USJC 1NMTA 2OOTA 3QAYA 3THTA 4IF5A 3BN7A 2YNEA 5KFFA 4MHPA 3GILA 2YKPA 4H89A 4WF9Q 4KPYA 2J8MA 4IH7A 2VQFF 1TKJA 3HFZB 3DM2B 4W92B 4CNYA 2OJ3A 3W2VB 3D9BA 3HVAA 4JI4J 4M5KA 2CPFA 2Y0BB 4MBUA 3M2RB 2MQ8A 1RTJB 3N9UC 3CMAS 3BGFA 3H4BA 3J7A1 1HNZF 2KXNB 4LF8F 4Y49B 3PX6A 4OMEA 4G3IA 1F9HA 4KOYA 2C27A 2FC9A 2B9YA 1TKZB 2AJ4A 3RAQA 2V4JB 1EETB 2BE2A 2AGQA 4WP8A 1DTDA 4MH8A 3SDEB 2MLXA 5CPAA 1X4FA 1EJ7L 3TJAA 1T05B 3BKTA 4F3OA 2HS4A 2GNKA 2ZDOA 1FKAF 5GMKa 2CWXA 4B9UA 2W2PP 2XYGB 4YU9A 1YW4A 2DHAA 1EARA 4I2PA 2Q43A 5I3UA 1U1NA 4ES2A 4Z37A 1NDPA 2IJFA 4QPTA 2B43A 9RUBA 2ZHAA 2RQ4A 2X1GA 5B0BA 4JWPA 4MHNA 3M9OB 2FZGB 3RAMA 4DV1J 2PIIA 1VI7A 3G8TA 3PM9A 2WVBA 2REEA 3PB6X 3GTYX 1YJTA 4JI6F 3TZXA 1YHQS 2GIVA 4DLEA 1S48A 1RQ0A 2IAJA 4I56A 2PDAA 4URGA 4BS2A 4A8KA 4K4VA 4KHPJ 4PQUB 2PJ2A 5H9EK 1P9QC 4C8ZA 2Z2MA 3L4BC 4OX7A 2AJ6A 2RVJA 2E66A 4K59A 2DXQA 3PGPA 4NZ6A 2ZENA 3HVTB 2E5GA 4DL2A 2CIMA 4BBHA 2UV8A 3N28A 1JWWA 5G0RB 3SIPB 2C6GA 3N7ZA 4B9VA 3W62A 2LU1A 2ZW7A 1N34J 1DE4C 2DGSA 3W5XA 5C25B 4KHRA 2Z57B 3RR7A 4H2KA 1I3OB 1FERA 5F8HA 2YKMA 3MZIA 1SB6A 5IT9Y 3GKRA 1UA0A 1VC5A 1WI8A 2J0XA 1I94F 2UUTA 1BWEA 2C1CA 2PCUA 5D8NA 4QIEA 3UR0A 2VDIA 1HL6A 1FTRA 2HPUA 1REVA 5J8CA 3QRPA 2R4FA 4QYZK 2BZ2A 3IO1A 2O53A 4LF5J 2BQUA 3TA2A 3SJGA 1XRYA 3RRKA 3N5FA 2OSQA 4KQZA 2DD8S 1X9SA 2CDRB 1BY9A 2UUCJ 2PR1A 3TT2A 3FB3A 1WF1A 4F0KA 1PCAA 3VAHA 2N3LA 3AFGA 4HDGA 3TQ1A 1IR0A 2R8IA 4EU0A 2F8HA 1CQMA 3HMJG 3J7Z5 1S1VB 3PJ9A 5L1IA 2EWHA 3GONA 2GS8A 3FNNA 1K44A 5F8MA 5KFGA 2UU9F 4KRWA 1GX5A 2VFTA 5K14A 5FDLB 5KFOA 4WU2A 1IR1A 2VH7A 4R9MA 3A12A 3MRUA 2R8HA 1HR0F 1UEKA 2U2FA 1RTIB 2GQQA 3V4IA 2MKYA 2ADBA 1ZPWX 4IRDA 2Z3OA 3AOBA 2CFXA 1LW2B 1FRKA 3DRYA 2P2CB 2I6WA 4IFYA 3EX7B 3CB4A 1PJ6A 2DH8A 2I1RA 1Q7LB 2KJWA 4NLQA 5L8RC 3GIJA 1QSOA 5KFXA 1XF8A 2ATLA 1XMOF 3QYYA 1R6YA 2GFQA 1FT8A 4BMHA 2Y3YA 2V69A 3I0RA 2ZH9A 1WC6A 4DR5J 3NG8A 2KT3A 3GQCA 3KLIA 2B7BB 4M6HA 5M2PA 4WP9A 4RNFA 1N0VC 3KQXA 4ZMMA 3UQSA 3T9YA 3HSJA 5CHCB 3D7HA 4B6ZA 3VAIA 3GIIA 5KFNA 1AFIA 2O67A 1R8AA 5C24B 2OHDA 5DM6Q 1ZA2B 4K0KJ 3MM6B 3NOGA 4HDHA 2QVPA 2V9KA 3C16A 5AG7A 2CPJA 2AJQA 1R89A 1S7IA 2DB1A 4ANDA 2IBOA 2WYRA 3UE2A 1KS2A 4LR8A 2HNDA 4ZVRB 1IQZA 3T6BA 3GFHA 2C42A 1CM0A 4Y6IA 5KFVA 1J2VA 3ZZIA 1WEXA 1VRQC 5ETSA 1XJWB 2OLWA 2C28A 3R2CJ 3NS6A 5THWA 3BKUA 2DGQA 2XZDB 4I6WA 4Q45A 3I0SB 4DN9A 3TVKA 3I5AA 2UP1A 3ZZ0A 1NKEA 5CBMA 4P71A 5ETQA 2UXCF 5LRGA 2Z3MA 3KHRA 4DR7F 4OYWA 2PJBA 2OZGA 3ENVA 3NH5A 3WDOA 3KOAA 1D09B 3I9ZA 2CJQA 3DGPB 1N6QB 1S57A 4LFBF 4USUA 4DPUA 2AZ1A 4OL8A 2ZUGA 1E6YB 1TL5A 4WBFA 2I00A 1IKXB 5HMNA 3TZZA 3CPXA 2L9DA 3M05A 1H2UX 3DNCA 1R27B 5DJBA 3MMBA 4DSEA 1FRJA 3EGVA 4ED4A 2GMLA 3IR7B 1S9EA 1Y7PA 2PIYA 3NY0A 2Y9HA 1M5VC 4QQBA 3H0PA 3NWRA 5KOXA 4FZVA 2DF5A 2DBBA 4ED5A 2ZELA 2J76E 2FGOA 2HFUA 2DNRA 2IA0A 2WK4A 3H20A 1F5CA 2KI2A 1LAMA 3BO2A 2HSEB 1LFPA 5DZ7A 4NF1A 5F8IA 3A13A 1Y5IB 2B9EA 2FE7A 3H4DA 1H74A 3JSYA 2H5IB 3SSSA 3W3SA 3KK2A 5AJ3J 2HC9A 3DXSX 3IS9B 1RKJA 3OUYA 5J2PB 2OD6A 2RRAA 1NK5A 5MAOA 2WVEA 3O6QA 4ZVHA 2ZBPA 5BR8F 4X64J 3RBUA 5KFUA 3VR1A 2EUIA 5KG3A 3VAKA 3AH6A 1ROFA 1NDLA 3R6GB 6AT1B 4TY8B 3FEDA 3K0JA 2ZH5A 3B4DA 1QAXA 1XK8A 3M8PA 4Q5VA 2BX6A 2W7OA 4L75A 3WIVA 3SXOA 2R8KA 5FLXY 4FYWB 4D3HA 2MJUA 2NSCA 4RO0A 5A6WA 1H0HB 3RYOA 1YRUA 2Q0YA 3IWXA 4KH0B 4X65J 3K5MA 1XEBA 4RW4A 1H8LA 1D8YA 1R0BG 3PRDA 2KKHA 1I6JA 2XEGA 3W9HA 2CZ9A 2MKSA 3PEJA 1I51B 4ZKAA 2XSFA 2LQJA 4DPWA 4V19J 1X12A 2YNFA 4C3KA 4UEFA 3O8WA 1MMNA 1FRHA 2YNGB 2M9KA 4ZVPB 4CGMA 2HIQA 1FHTA 1RUSA 3FEYB 1L3KA 4MJKA 5F09A 1U26A 5HP1A 3PKMA 1WELA 4IFVA 3C14B 1RACB 1XR5A 1HNVA 2M8HA 3LWMA 5HBMA 1VS3A 2VA3A 1OO0B 4J9PA 3D28A 4ZY2A 3DRRB 4KGKA 5EWGA 4DL0C 7CPAA 2GJ2A 1VQPS 3JQJA 3EVOA 3GIRA 2Q1LA 2ZEFA 3HHDA 4HNYB 5KFTA 3UR3C 2QIRA 2JZ5A 2G4BA 5T41A 1K0VA 1TKTB 2HRTA 4N5SA 4LBIA 1SKWA 1O6XA 3VWEA 4P45A 4U9YA 3ZZOA 1UVIA 4IUSA 2K06A 5CCMA 1L3VA 1S12A 2YNHA 2HMIA 5M2RA 5A0YB 3JB9k 2RH3A 2MDAA 3MTJA 4Y49C 2HG4A 4H4KA 2QMWA 1YLOA 1BQMA 1E6VB 4CAVA 5F48A 3PFOA 4RNHA 1ARLA 1Y9KA 4JI8J 4C8KA 4R87A 2DPIA 4WK1A 4LF7F 2R7WA 2C3OA 2R9LA 1YBTA 1RI7A 3UDEA 4OZ0A 2ASLA 2P6GA 4NZ7A 1XOVA 1A2ZA 3JQMA 1KP6A 3NH8A 2YKNB 4DX5A 3H5UA 4HVZA 4X4UA 2VQFJ 3SJFA 1PIEA 2PJAA 3E3XA 2ZWOA 4H6UA 2NSBA 2X3DA 1YQEA 5C42A 1BHNA 2QZ8A 3G6VA 3IBFB 4AL5A 4B5PA 1HNZJ 2ABYA 4OJGA 4LF8J 4WZMA 1RO5A 4EBEA 2IMWP 3CCJS 3E0KA 2VU5A 4ZVQB 2LQ5A 4CQ1A 2AV5A 5CH7B 3MR6A 5KTCA 4O44A 1JWQA 1VQ7S 4U95A 1TKXA 3F0AA 3W61A 4ZA1A 4U5YA 3M2UB 4NRUA 3BM7A 2HZVA 1AMPA 1EIYB 2I5JB 3WABA 3QT6A 5EUHA 3MM5A 1LOUA 2BKNA 3OSPA 3D66A 3GFYA 3V6HA 2GCFA 1YREA 1PBAA 2AIRB 1IKWA 3FC9A 4LF9J 4DQSA 3MM8B 4L73A 1MK4A 3H8EA 1U02A 4X4NA 2BQRA 5IFMA 1HQEA 3POTB 4ZI6A 3GFXA 2J0SD 4CO3A 4JI6J 2RIJA 4K7QA 2Y8YA 2MHEA 3OXLA 3PY8A 4CGOA 3KI9A 2CG8A 1JIHA 1XERA 3DOKA 4CLYA 1PAUB 5H86A 4OC3A 5CZVA 4F8RA 2MZ1A 5DLFA 2FUG9 3OR1B 4DV5F 1W2IA 4UWIA 5A27A 4K3NA 1BWVA 3B54A 3FGVA 3WQPA 4LFAF 4B3TF 1GTHA 3LP2B 1NO8A 2W4CA 2K7JA 3KQZA 2OB0A 3EM1A 1KOHA 4A4JA 1VLOA 4PG8A 5KFJA 2UVRA 1UWBB 5J2NB 1HW9A 4PZVA 4OZ2A 4B11A 1UAWA 4QBUA 1TKDA 5LJ5Y 4IG0A 1I94J 5ETLA 1FEHA 1JXLA 2HEKA 4RUHA 1BLLE 3OPKA 4CRJA 3UNYA 2D41A 3FBFA 3CVKA 1XBUA 3N6NA 2YPYA 4NOHA 4M5GA 3RB3A 4DX6A 1VHEA 3A3OB 3LWLA 3BF4A 2BJ3A 4IRCA 2OELA 4OHWA 1WSRA 4X62F 4LBPA 1N88A 2AF6A 1EQ0A 5I0CA 3MDFA 1N36F 4F9VA 3CZXA 2D9PA 3RRGA 1IM6A 4WZQA 4C8MA 1EAYC 3PG9A 2D9OA 4WTOB 3TTHA 2Q7SA 3LGHA 2M7SA 1VKCA 4X8IA 5A8RB 2BL1A 4U9RA 3R6LB 3TX8A 2HB6A 2BA9A 4AB7A 1S0VA 4DFPA 1HR0J 2I3CA 2Q04A 3MECA 2RQKA 2FZCB 4C8OA 1YZ6A 2ZJRQ 3Q24A 3EGNA 2DNLA 3OTEA 1RBLA 1C1BB 4LT6A 4KBIA 4M3SA 2QA1A 4OHVA 5I42A 4HHUA 1JLBB 1XMOJ 3GYGA 3DC2A 1OS5A 4YFJA 4RNMA 1UW9A 1DY3A 3CD6S 2A6OA 3SV4A 1RHKB 1HI1A 3FH4A 1KHWA 2ZNYA 5KFQA 3FQLA 4K8RA 3UDCA 1EHWA 3T6JA 4Q38A 1RHQB 4ZY0A 3M7VA 1XJOA 1NK0A 3HP6A 1S4FA 1S76D 3IR6B 3W66A 5ETNA 4TQSA 1HBNB 3QO9B 3IEHA 4LF4F 2B58A 2VOOA 3AODA 4YDDB 2G1DA 4LUBA 2GVZB 2VBYA 4ER8A 4JB8B 4AXVA 1FKOB 4X84A 4H4MA 2XC9A 1AUSL 4G1QA 1NCLA 4PXCA 4A33A 1DARA 4JI3F 4P4FA 2Z3PA 3JXOA 3V8IA 1G6BA 2VDHA 2CQGA 1OY9A 3NGKA 1C4CA 3ILLA 1B87A 2ROGA 3HPOA 4F0HA 3I9V9 4AVAA 4RU9A 3QWUA 5F0WA 3SYZA 4QYRA 4ZP6A 5SZTA 4Z2XA 3MCOA 2HHTA 4UEEA 4C48A 1TELA 2RJZA 2HHXA 1FJEB 4R3KA 1NJZA 4KOTA 4OP4A 4CS0B 4DR7J 2X3GA 4ANCA 4C97A 2OTJS 2OZHA 5IT9U 3BI1A 4LFBJ 1EKRA 1S5ZA 2LQBA 4DCPB 3DRXA 3GJRB 1T9TA 4QPXA 3L2NA 3MAQA 3US5A 1Q5VA 1KEKA 2NYHA 4U9ZA 1ELOA 4C0OC 1S9GB 1IR2A 4LREA 3BSNA 3K2YA 2C3PA 3KTQA 2HW3A 1TQLA 4G65A 5IV0A 3AJ2A 2RT3A 1LKZA 1QE1A 2WOMB 1U49A 2LXIA 3IM8A 2Z3NA 4Y28C 3SCJE 1HYSB 4FBTA 4B08A 1T9WA 1HWKA 2DY9A 2JL9A 4CWBA 4BINA 4CYPA 2BYCA 2Z0ZA 4MHDA 3S8SA 1UMJA 1WK4A 2GMJA 4MFBA 1H7WA 2E5LF 2AYEA 4L8AA 5L46A 2JDCA 1HNXF 3QJLA 4CO0A 5DGBA 2AJ1A 3BB5A 2GJIA 4NMXA 1NSKL 4UOGA 2JOQA 2O01C 5DDRC 1S6UA 3SCIE 2CPHA 2FVQA 4F2SA 4LJMA 3B8HA 3MPVA 2CQ1A 3QAEA 3CPWR 2PRBA 2Q4ZA 3AHPA 1HBUA 2J9AA 5G21A 4DN0A 2V94A 4YR2A 2EBJA 5L1KA 1NHKL 3F0NA 4DPYA 1RLCL 3WX4A 4DR6F 5H9EJ 5DM7Q 3T5KA 1VHIA 3S7RA 1AA1B 2FJVA 2ADCA 3Q8VA 4I69A 4PK3A 4LRBA 3IRXB 2CTBA 1NSLA 3OL6A 1RWXB 4A37A 1SI9A 3GIUA 2OEMA 4X4SA 2CVEA 3T41A 3DCAA 5B09A 2E5HA 4ECXA 3GJQB 4A94A 1F3FA 4W98A 4U6PA 1R0AA 4ZLJA 2CNLB 4Q44A 4O0IA 1R3NA 5E41A 1DTQA 4CTAB 2R2RA 1RWVB 3R1LA 1PAEX 4YY3J 2HBYB 4NA3A 3ZJ0A 2DNMA 4DJBA 2IBKA 1NKBA 4R0EA 3E01A 1FXRA 2LXFA 3CGIA 5DRKA 3SI1A 1IKVB 5HO4A 4ZGYB 1F9EB 4X2BA 5CA5A 4O3RA 4RW9A 2R2SA 4OV1A 1NBEB 2FIWA 4IG3B 2HAIA 1IB1E 2QLJB 3BHXA 3Q22A 2XMMA 2IC3A 5K20B 3QT5A 1LEOA 2FHJD 2NXCA 4ZPAA 1Q78A 4CPAA 1GTEA 1VIOA 3OD2A 2JWNA 1C1CA 5KAKA 4OHZA 3GMGA 3A1YG 2WW8A 4ZCKA 1ELLP 4QWCA 1GK8A 2MY8A 2FL4A 1LOKA 1R0CB 3BXMA 4ECQA 1ZTTA 2IYGA 5IT4A 2I0XA 4UOCA 1IKYA 3TVYA 4DV6F 4UY8T 2OPQA 4F6AA 1NEEA 1FJ7A 4Y2AA 2COLA 4HR2A 4F25A 2VG7A 4FS1A 4TU8A 1JLEA 2GAHC 5AT1B 2B4DB 1QD1A 4KUBA 3FCVA 5C2GA 1RK8A 4LF7J 4NXNF 2FLPA 3FEEA 2Z2YB 1CPZA 1X4GA 1L0CA 2RRNA 3CWJA 3DRSB 2P6SA 1PO6A 2PRQA 2QL5B 1MU2A 2B0GA 3H8GA 4NFRA 2YWFA 2B56A 1KUXA 4ZVGA 3WC5A 2ZZMA 2ZH1A 1AFJA 4A47A 3CXPA 1J5OA 3OR2B 1N56A 3TFYA 4F04B 1U2FA 1SJFA 3Q89A 2F65A 4KGXB 5GMDA 4FF1A 1VK8A 3VWDA 2BEIA 1NK4A 2AQ4A 1NJXA 1CJVA 2K7KA 2GIQA 1U45A 2KHCA 1OZPA 3JVNA 1G1XA 2MKHA 2BANA 1RA6A 4ECZA 1S1TB 5F8JA 4DSFA 4RX6A 2CUYA 3HM9A 1T9VA 2VODA 2EVZA 2R7XA 2QFJA 1FKPB 3JQKA 5FLXU 5GCNA 5IB9A 4KKOB 1JKHB 3L7UA 1FJGJ 2WBRA 3HLUA 3NOCA 2VC1A 3C66A 2XLKA 1V0CA 1FXDA 4GVBB 3K57A 2OKQA 1CPSA 3FDSA 4B3MJ 4FD7A 4OC2A 2W9BA 4B3OA 3P5TL 4YP3A 2VQEF 4DMZA 1YG0A 4CYUA 5D0HA 2YQ1A 4NLRA 4NCZA 4L89A 4Q8FA 3PB7X 4WE1A 5HMZA 2GVDA 1U8WA 1P8GA 4WPAA 3EXNA 4GKJF 4DNCA 2DEIA 4TKTA 2VJVA 3W9IA 4I7FA 3C6UB 1HEEA 3R9GA 2KZMA 4CRZB 4KR0B 5J2QA 1RB0A 4CYNA 3RUBL 2RUSA 2AZ3A 1V5VA 2DYAA 4GC7A 1Y00A 3FJ2A 2PFDA 4RR5A 1KQSR 4RW6A 5HATA 5KG5A 2A18A 2XY6A 4PK2A 3ILIA 1FVQA 4UY85 1H98A 2FJDB 4LFAJ 2WSCC 1ZLHA 4J9KA 4X4TA 3KLVA 4A48A 4RNOA 1A6LA 2EFGA 2KH9A 2LMIA 2OZUA 2ZXVA 2O5DA 5DWMA 1YK9A 4KOWA 4ID5A 1IYKA 4HACB 4JYWA 2PEHA 4CLWA 4PCQA 4NA1A 1BPMA 5HL7Q 4PG4A 4MAKA 2DGXA 1CVJA 2HVHA 3DYAB 3VGTA 3MUVP 4WIQA 5DG7A 3GR1A 3HI9A 1GMWA 3M8WA 3RZAA 3BQ2A 2XY5A 4C11A 3QQCD 2KB2A 4P7VA 3HDSA 4RLEA 2F4VF 3KK3B 2QX0A 5KT3A 2XM3A 2VXKA 4A95A 4NGTA 1Y7EA 3UVJA 1HBOA 4DS4A 2EFQA 4KO0A 2H3EB 1JLCB 1S1XA 2VL1A 5B0DA 2ATCB 3M30A 2EO8A 1WORA 1P1LA 2XQCA 3KK2B 3M6XA 2W1BA 1H2VZ 2EG2A 2HWHA 2V0NA 1QTMA 4U7UK 5IX3A 4AUKA 2Q4VA 5KG1A 3HHLB 4DF8A 3MEGA 3FYNA 3D1OA 4F0XA 3VZHA 2ZUAA 4O23A 3CJRA 4RW7B 1HNIA 1RAOA 4K5SA 1FRIA 1NMEB 5LL6d 4KV8A 4MTPA 2VHGA 2DJWA 4ZCLA 2YNCC 2ZZTA 1KTVA 1RAFB 4KVME 4IO9Q 3EVMA 4Q2MA 2PSWA 1RP5A 3IWNC 2PJ1A 2AJFE 4ZS6A 1TF9A 1VDHA 3KJQB 2HK2A 2UUAF 3BR8A 5AG5A 3J7YU 4FF3A 3TUIC 2I9SA 5EMIA 4F02A 3PB4X 3R96A 3QWPA 1RAGB 4JV5J 2FLNA 2EFOA 3FXTA 2MSSA 3CEDA 5CAAA 5JVHQ 3CMQA 3DLKB 2YWKA 5CYMA 3VATA 1YSJA 2U1AA 3CDWA 3VAFA 3HK2A 5T7LA 4UOHA 5GAHU 4CO4A 3L9ZA 1NB7A 4DYOA 1Q86T 2RHSB 3MM9B 3ISND 3FZ2A 3JTOA 2KXFA 3QFWA 4J9RA 2HNZA 4Q7AA 1EP4B 2JEFA 3E51A 2AFXA 2RS8A 4K5RA 1RKIA 4NLGA 3TO6A 4YFUA 3KK1B 2DHSA 5DG9A 2FJXA 1U8SA 4ITSA 1NU4A 3AA9A 2CQIA 1FJCA 2V8HA 1V6HA 2CPZA 4I4BA 4DXLA 3BGRA 2W24A 1BGXT 2PE8A 4IH6A 3RB0A 1DQ8A 2IQ6A 4WU3A 2EEYA 2PIZA 2BJDA 3O2IA 2Z56B 3FX6A 3CCVS 2WZNA 4RU2A 1EB0A 4MYUA 3M8QB 5L38A 4WFAQ 4M95A 2YNHB 1LK5A 1YVFA 3I3GA 2HNYA 5L1JA 4P2SA 1MNEA 1Y3KA 2F9JA 5BWAB 2ZBQA 2FYXA 4NLSA 1SUQA 5AXNA 2QIFA 3AD9C 1TFWA 3EFAA 4DF4A 3TAPA 2OPPB 3BBFA 1TK8A 5JGFA 2V8VA 4DQIA 2HBQB 3DDIA 1URNA 1Z4EA 2V2ZA 3TJ9A 4UIAA 4RI1A 2KZZA 1Z8WA 4DZDA 5KTAA 2C3YA 4FUUA 1OBRA 3BYPA 1RZMA 2FJBB 1QSTA 4YB6A 3MD1A 4MI4A 1H7XA 2K1RA 4XIUA 3KGQA 4ZYQA 2V2QA 2D4PA 1MROA 3ILJA 1KC8T 3ITHA 3BDEA 3U1LA 2E5LJ 4O3OA 2CQ3A 2DNGA 1O0PA 4A8WA 4LR9A 1HNXJ 4Y65A 1SQFA 4ELTA 4YRHA 4CO5A 4CAFA 4CLFA 1R57A 2XSJB 4R76A 4C8YA 1KTQA 3M8SA 1S6OA 3TUZC 2VBXA 4UUXA 2P6TA 3GV7B 2CQDA 3J7AN 4XTTA 1ZM9A 2V68A 4ZVTB 3JYTA 4K2XA 4JUZA 4B3SF 3LP1B 3EMTA 2YNIB 2YH0A 1M1GA 4QIWD 3OTDA 3NMRA 4NMLA 2F63A 4DCOB 2BR0A 2X51A 4N41A 1KUVA 4OC1A 1MG7A 3M1VA 1ACMB 3U1NA 5CD4H 2ZH3A 4HH0A 2JEGA 4ECUA 4Y2KA 3MI7X 1JLAA 5HJXA 4DR6J 3ZZUA 3S6EA 1VRUA 1RT5A 5F3TA 4DDFA 3WC2A 3C6TB 4MFZA 3LD2A 1WDTA 2ZEHA 4MFQA 1B7FA 3MOJB 3I31A 4EFAC 2E1MC 4YUDA 2CZVC 2ZHBA 2R7QA 3V81A 1FK9A 2UVVA 3PEIA 2XMAA 2G0JA 3WC6A 1HPZA 4JI5F 4M6GA 4ZOSA 4RL1A 4BCAA 4GM5A 3Q23A 3Q8PB 4IRKA 4P4IA 2C3MA 2AYMA 2BV3A 3DHXA 3DOMB 4KFBA 1LAPA 3SQOP 3BV8A 1H73A 2ZVIA 4WYWA 2Y1IA 2NXEA 2OP5A 2Q66A 1RT4A 3H2LA 3S9MA 4B9MA 2WAQD 3UN5A 3RG6A 4WXOA 4CLTA 3H5SA 5C82A 3D0HE 4ED1A 2Z30B 4UZCA 1ZETA 1YKWA 2XMTA 2BXJA 1YQHA 1Z8TA 1S9FA 1Q82T 5E5NA 1WHYA 1XC9A 3S6GA 2J8SA 5ETTA 2HQ3A 4I6YA 1RE1B 4DL7A 2H5MA 5DS7A 1X5OA 1QUVA 3MMCB 4NXMJ 3K5OA 4QZVB 4DR2F 3RR8A 3DOLB 3RBEA 2I8EA 3CTRA 3CD5A 1VRTA 4USHA 3LALA 3UY5A 4QW8A 1YJ9S 1T7PA 3R7SB 3F44A 4CLKA 2JC0A 3FNCA 3P2HA 1IM4A 4ZHRA 3AB4B 5C7PA 1Q4RA 3BH7B 4C7HA 2JNJA 3O5TB 3HHKA 4NXNJ 3IU2A 3DU6A 3FFIB 1HHTP 1YI2S 5KFWA 4JI4F 3LF0A 3VZIA 2REFA 2G1HA 4N56A 4A30A 1S1WA 1MJBA 4U7CA 4R5PB 1NB2A 2RAQA 4P4EA 2V77A 1RT6A 4HT7A 2C2ZB 4K4XA 1WWHA 3QNVA 2RDIA 4U8VA 4KC5A 3R97A 2AWZA 2DNQA 1AYEA 3RU0A 4BLGA 1KRPA 2AHOB 4MKAA 1VQ9S 2A10A 3UN2A 4DSKA 4B3RJ 3KHGA 2GQCA 4ZCIA 2ZOGA 3EUNA 2G2ZA 4IR9A 1O5JA 1FRXA 4RW8A 4MCPA 1QAIA 1WEYA 4NZ0A 3FF3A 3GB0A 1EX8A 3KG4A 3NH4A 2KM8B 1LW0A 4DV2F 3LPEA 1AT1B 2DY1A 2FC8A 3V7ZA 2OFHX 3EDRB 5D4NA 4NI2A 3B7IA 4DI6A 4DV1F 3CCQS 2FHMA 3G6YA 4UEZA 5J1PA 5D29A 4H4MB 1ZG7A 2WONB 1VBZA 2GHWA 2VQEJ 4ZCMA 4AQYJ 4ZPBA 2QA2A 3PB9X 2IY5B 1M1DA 1TKFA 1Q79A 1VQ6S 1SC4B 4Z7YA 1P0HA 3RJMB 3FEXB 4Q0BA 1IOFA 3AOAA 2VASA 4DBQA 5A28A 1N34F 5J2MA 3TOBA 2FPHX 4F7VA 4HHJA 4OJ1A 4OIXA 4IDKA 3D67A 3MFHA 1XIXA 4XK8C 2Z2ZA 3JTKA 2JHEA 1N32F 1FNXH 3SCLE 4UTGA 4TYBA 1RHMB 2MQPA 1SH2A 2CADA 2XZTB 1P6TA 3QJPA 5EX0A 1S6QB 2Z3LA 4OI6A 3CCES 1JLGB 1WHXA 4ZVOB 4ORFA 4HNXB 3IA0A 1UWAA 2DXFA 4NGRA 4A8XA 4KYZA 3ZFVA 4LF5F 2CZ4A 2AT1B 3HHLC 3BJ8A 2H48B 2BOAA 2KU7A 4OI1A 3PFEA 1Y11A 1X9WA 1T95A 1VQYA 2CPDA 4OV6A 1QVFR 2W7AA 3V38A 1R8PA 4EVYA 4AE5A 1RT3B 3J81Y 2OO4A 1KLNA 3LP0B 3QGGA 3GY9A 3K7RA 5FJ4A 2M0GB 4ECRA 3WHIA 2YQ3A 1RADB 4IQXA 1RT7B 2QMLA 4DV3J 1RT1A 4A8SA 1VLYA 2DEJA 4N47A 4KGMA 2POKA 3ENAA 1RYSA 4B10A 2JH3A 1SH3A 2DH9A 4PWDA 4NLTA 2JEIA 4EMDA 1YVOA 4CLUA 3D2PA 4M5DA 2CG4A 3IBCB 3KUHA 3FSXA 2FB0A 3T5HA 2ZE2B 2RILA 5D3GA 1F60B 4UQGA 1SC1B 5BYSA 2L9NA 4I6AA 2LEPA 2H5EA 3H5XA 4BHQA 3TUJC 4WYLA 3R5CA 3OTCA 3AT1B 1S7HA 4OIDA 1OYDA 5HXDA 2ZKTA 3T9ZA 2HQYA 1VQMS 2FS5A 2EFVA 2RKIB 1C0TB 2WB4A 2NYQA 1HBUB 2AD9A 2W7PA 2A6MA 1U48A 5KFLA 3CULA 2PE3A 3NCQA 3SQGA 3HLPA 1RISA 1TKHA 3MOZA 4EBDA 2V67A 1ZM2A 1JXEA 3TUPA 3MAAA 3SI0A 2GREA 2FGCA 4WJBA 2KG1A 2GGPB 1N54B 2UV8G 4LF6J 2QRRA 1ZAXA 2WSEC 3ET6A 4JI7J 1B0VA 3R95A 1XBWA 2XBPA 2JEJA 3FECA 2PMHA 4YR0A 4DUYJ 2BE9B 4KLWA 4ZVSB 3FRMA 2NLWA 5EGYA 4OKOA 4E8OA 5GVQA 3F73A 1NXIA 3D3BJ 1L5UA 2NMTA 1S0OA 3PXGa 2CRLA 1NPPA 3GG0A 2QEXS 2MGZA 3HVRA 3TAMB 4QWEA 2P5VA 3W2WA 3LA0A 4AXJA 4TN2A 4NLWA 2DGTA 2LVWA 2MYFA 2IC3B 2CPEA 3V6DB 1Z1ZA 1HQUA 1U6ZA 2LFVA 3I4HX 4KSIA 3PO4A 5KOWA 1FI4A 3IIBA 4ZP8A 3CW2C 3SJEA 2HFSA 4JI1F 2QN6B 2FHKA 2YBVA 2MLZA 4TQRA 2A2DA 3MM7A 3S6FA 1D9FA 5ETKA 3TW0A 4HHHA 4Y34A 3K59A 1VR6A 1RT2B 2B6AB 4HL9A 7FD1A 4PG6A 3EDQB 4M8LA 2UZAA 1K4JA 2HHSA 1F2OA 5EWEA 2D3ZA 3MF5A 3N6MA 5D15A 3H25A 4HYKA 2EK1A 1YW6A 1X4CA 2DRBA 3M4XA 4OYIA 3GU0A 1YGYA 1M5PC 4XPLA 3CCSS 5GMEA 2CPYA 2XMUA 4ED7A 1MU2B 5KG6A 1CP7A 3FBEA 2A3JA 2F8MA 5ETRA 4N77A 1KLMA 4GS4A 2KHDA 3KLGB 3BQ0A 3B2YA 2DGOA 1HIYA 3HVWA 2YX7A 1X4AA 5JQ4A 4XO0A 3GE9A 3IG1A 2BW7A 2JX2A 1Q1KA 4A38A 2HRUA 4RBVA 1UEVA 2QG9B 1SKUB 1CJVB 4ENOA 4H6ZA 4Y2IA 3B6BA 2J9DA 4OHYA 4C2XA 3ZTPA 2DIVA 2BOPA 3DLLQ 4UCNA 5LMNF 3OTOJ 2DCUB 2HAFA 1FXLA 1T9UA 3K17A 3FCWA 3RBZA 4B3SJ 2NREA 1ZZFA 3PZJA 4TVAB 1Y9WA 3K8VA 4M85A 3PCOB 4UW2A 4DUKA 2HK3A 4IQMA 3RO0A 2GFFA 1TL3B 4J9UE 2Z0GA 1ZYQA 4B17A 3LMSA 2SXLA 1QSYA 3HX9A 4CNZA 2WHOA 2ZOMA 5F9NA 3V2UC 3NE7A 3AQPA 1JJCB 1VBKA 3BREA 3DLBA 4CYUB 3KLHB 5DETA 4FYDA 3M2VB 3N0VA 4NEZA 2ZBIA 1N5YA 2ZW5A 2OSRA 3T90A 1YBAA 2Q3PA 1SJ1A 3MEDA 1S4EA 5KG7A 1XN9A 3PB8X 1HHSA 5A8WA 2YWWA 5B0AA 3KYLA 3DXBA 3IGVA 5HROA 2YKQA 2CQ2A 3QJJA 2R8GA 5A8KA 1EQMA 4OHXA 3D5MA 2F3JA 4M5LA 4N8NA 5D0RA 2LEBA 4PUOB 1IXKA 4USMA 2F1FA 2WRMA 4DFMA 3PYDA 3IWLA 3J80Y 4QIFA 4DG1B 5CYQB 2DRDA 1TL7B 2PN6A 3DM2A 4LSLB 3RBDA 1JLFB 4DU7A 3G2XA 3W2VA 3RW7A 5HVGA 2CNTA 4O3PA 3IWWA 2OI2A 4A32A 2OFGX 3M2RA 1RTJA 1KWMA 4R0JA 5IB0A 3HHNB 2BEFA 4JI8F 4OYMA 4K4ZA 2MLYA 4F26A 1VC0A 4KOXA 3RAXA 2HLTA 2HVDA 1ELMP 4HI1A 5F8NA 1GT8A 3PR5B 4WFYA 2QLBB 3GFZA 3FK4A 4DR2J 3CDXA 5G1ZA 2V4JA 1FFWB 1EETA 2UXBJ 4AG9A 2YVSA 2KM8C 2RS2A 1D8ZA 3SDEA 1TL1A 2FVGA 3KKWA 4F50A 3GYXB 1PYTB 3PW2A 1T05A 2MQNA 4F0MA 3KWMA 2H65B 1Z5RA 3M8YA 1NKCA 1A7GE 1B0PA 1P9YA 1V3RA 2HWTA 3KKFA 3MR5A 4OLLA 3BO4A 3MGDA 2W9AA 2BABA 3ZZPA 3AB2B 4DX7A 3OFFA 5D8HB 3LWUA 3X3UA 4R8FA 1CJKB 2B51A 2PA3A 4DOZA 4YDXA 4A8YA 3VAJA 1AZSB 1RBOB 1K8AT 3MN8A 3UWTA 3J7ZT 2RMLA 3SEOA 2XS2A 3CC2S 5IM0B 4R8UB 1F2GA 3D68A 3L09A 4LQ6A 2E5IA 4PQUA 2IIHA 3Q8SB 4NCBA 1TFYA 1GMUA 2ZC3A 5IZHA 1UJ6A 4CIOA 3TO8A 1VMBA 1JNRB 3HVTA 2KCWA 2QA4S 4PWUA 5G0RA 4DLGA 2RDDA 5LYIA 5C25A 2FZKB 5FD1A 4ELVA 5K8OA 2HFZA 1X5TA 3TA0A 4LF9F 4JV1A 2YQ0A 2HZAA 4DV2J 3CC7S 2J9CA 4FPIA 2NPFA 3KASA 4C0HA 2DPTA 1U6FA 3RB6A 1T3NA 1W2BR 4B9LA 2J7UA 3R7BB 3FMBA 2FJEB 1U4BA 3CDAA 3T1YJ 2PQ8A 3OL9A 3DN9A 1RHJB 1SV5B 1WWZA 5KFMA 3O1LA 2V8DA 4MT1A 2FVSA 3BS9A 2IYIA 1HWUA 3ZTOA 3NLCA 2ANPA 2WVDA 3VQTA 1VQ8S 3MUTP 4ZIWA 1S10A 5GADU 2VG5A 3LTOA 3LODA 4K4WA 4DR1J 2O66A 1BE4A 3PP9A 1NRKA 2QYCA 4YHHF 3R5BA 3H5YA 3BQ1A 1NPRA 3PIOQ 1H2TZ 1N32J 2PJ4A 4URSA 4X4OA 5FDLA 1FA0A 4CAEA 1FF2A 2WW4A 4OX9J 1RTIA 2KXHA 4EZ6A 1D1UA 3L7PA 3B3SA 3TEHB 1JLQB 1TMJA 1LW2A 2BDPA 4EGLA 1Q7LA 1BQNB 3BGLA 3DI6B 4K4SA 2XMJA 2CYYA 2PJ0A 1SQHA 5JH9A 4FKXA 1LWFB 1HNWF 3CJ8A 3QLHB 2OAUA 2E1AA 2MQLA 3CNQP 4OI3A 2XLIA 5IWAF 1TAUA 4DJLA 3D4JA 1IIDA 1X10A 5KT4A 3DLGB 1VFJA 2VA2A 4F4KA 1ZLIA 1OQ6A 3QIPB 1I1DA 4O4RA 3VF0B 1X4DA 3H8FA 2B5GB 4NJQA 1TV6B 4M5HA 5D0EA 1M5HA 1MROB 3IFEA 5C24A 2HVZA 3A3PB 3MM6A 1KKHA 1Y4ZB 4JXRA 4WFXA 2D3OR 3TE4A 1U1OA 4FVCA 2KT5A 3IN5A 3DRPB 5CD4A 3RTVA 1LWEB 1RHUB 2G13A 4A31A 2FTRA 4C8LA 2G0IA 1LWXA 2OU2A 4QIVA 5ETPA 4OIWA 3I0SA 4F4XA 3CCMS 2Q4YA 1U47A 1BQXA 3R3TA 3B4MA 2HZCA 2KYZA 1HWLA 1IY7A 1LK7A 5HMXA 1JLAB 1WC0A 2RUGA 2GO9A 2QSWA 1RXOB 2PMZD 2DRAA 1ZG9A 2L9WA 1RT5B 3DGPA 1N6QA 3KMQA 4I2QB 1E6YA 1CSJA 1MJ9A 4MCSA 3D7SB 1U0HB 1Y0HA 3LGNA 1PKUA 1Z4UA 1IKXA 4NGSA 5IOLA 2GO8A 5L9XA 1FK9B 2B4OA 2OPRB 4NCGB 4NRTA 4PYAA 1LCPA 1Z9UA 4LIRA 1KQFB 4QW9A 3SSQA 3TI0A 4RNNA 1HPZB 1DLOB 1UEUA 1AUGA 2VFSA 4LRFA 4ZX9A 4B5OA 4NPOA 1VQOS 2MMYA 1B3TA 2NXJA 1YGHA 2J9DE 1LANA 2DCLA 2ZJQQ 4XNHB 1YJVA 1TTHB 4AG7A 1WACA 2EKYA 4WKRA 1HI8A 5E33A 1JQGA 1U1LA 5F9LA 5HVHA 4DZ6A 4MFLA 1B99A 2ZH2A 3QZ8A 1RTDB 1DFDA 4QJVA 1S6PB 4NGPA 3MPYA 4WKYA 2CNOB 2KYXA 3IS9A 5KFKA 2KFYA 2RC4A 4ILMA 3JAMY 5EDWA 5J2PA 2DHHA 1QQ9A 4LRAA 3CUNA 3PJXA 4JI1J 3RW6A 2ZVSA 3SCKE 4TY8A 3M6VA 2CVIA 3GIMA 2WVCA 2GU2A 1QY7A 3J81U 2C1EB 3DLEB 3G8QA 4K4TA 1KVJA 3H98A 4LFCF 2M2BA 5FVJA 1XEZA 1QJHA 2VBWA 4TYAA 3W6XA 3ZZRA 4K4UA 1Y3JA 3H2VE 3OXFA 5ADZA 5E7OB 4OZLA 5MLCV 1UVMA 3MPWA 3CT9A 4OFZA 3JS9A 2GLFA 3J7YI 2XGPA 1S7LA 2B4BA 2HKEA 2YXLA 4OX8A 2XI3A 4ZLPA 1S3ZA 2HIYA 2HQDA 3HUVA 4QUSA 2YNGA 5DZ6A 5F46A 2VG6B 3D1QA 2VPXB 3K2KA 1T11A 3CJKB 3AY0A 3KNAA 1HD0A 5LRKA 5J8FA 3MEEA 2XCAA 3C14A 4ZPWR 5GAHI 2J0QD 3B3WA 4P73A 2DNNA 1SVDA 3BGUA 4J90A 4M5NA 3DRRA 2KFNA 2VICA 5LMNJ 3KLEB 4RJVA 2E1CA 1SIWB 1LW0B 1WOSA 3CCLS 4PWWA 5D4LA 4FBEA 1HA1A 2DPJA 2ALYB 2MQMA 1M4IA 4JD6A 2E1PA 2RHQB 1YK3A 1TKTA 3R1HA 2ZEJA 1NJIT 2IRUA 1HDQA 1B7YB 3C2PA 3ETOA 3EVWA 4DS5A 1ZOTA 2E7VA 1PSDA 1S97A 3CE8A 4DSLA 1M1KT 2W9CB 4YY3F 2HFOA 3GWCA 3V5RA 2FY8A 5KFZA 2QSFA 3N79A 1S77D 4WIIA 5A0YA 5H84A 1RWMB 2Y8WA 1P1TA 4P74A 2V5HG 3PYEA 4B02A 3MMAB 4WCEQ 3IWGA 2IPOB 1E6VA 2ZEPA 4DR3F 2KL8A 3SHPA 4LBHA 3S01A 4J9QA 3K5LA 4EBCA 3GUXA 4OZ1A 3HJFA 2LP4A 1U0SA 2JFDA 2R7OA 2IM0A 3NS7B 1KNZA 2BM1A 1I12A 4OC0A 1FX4A 5F3ZA 3DDDA 1XTZA 1C0UB 4XAKA 4IUFA 2HFNA 2YH1A 2BACA 2FQQB 3I1UA 2IRYA 1SKSA 3I4PA 3KDNA 3SXNA 2YY3A 2YKNA 6FDRA 2Z11A 3W8PA 3PIPQ 1Y0RA 4OI2A 3FRZA 1SC3B 3NBPB 2EK9A 3G82B 5DDOC 4V1Ak 1AROP 2YX1A 4AFFA 3W9JA 1X9MA 3CMES 3NNCA 5KG0A 2FVPA 3HZGA 3NP5A 3KNGA 2ZD1B 2HHVA 4M63A 3FCHA 1XNRF 1TVRB 2RF2B 5LMUF 1CJUB 4F67A 5F8GA 1VQ5S 1X8DA 3R2DJ 2FVCA 1UZHA 4NYZA 3BYRA 3C15B 1G4CA 3GJSB 5AG6A 4PSWA 2Y1RI 2I5JA 4KT0C 3BO3A 4IKAA 1TL4A 3JSBA 4RBTA 3KLFB 1OWXA 4OQJA 2ZKUA 2AU0A 2N82B 1QMUA 3A8JA 1L3TA 3MM8A 3DMJB 5EC4A 3QPIA 2J8NA 2R3VA 3EZOA 1RXTA 1T3OA 3R9FA 2QA4G 1Y0YA 1WF0A 4FVMA 3HD2A 2WTFA 1F9FA 2VBZA 3I9SA 1RBAA 3ICLA 1MWQA 2VBQA 1FJGF 4LQGA 3HXMA 4LX9A 4EMEA 2C22A 2DNOA 3OR1A 1UFWA 4LSNB 4B3MF 5KFIA 1K0TA 2MQOA 2XTJP 3K5NA 3EPGA 4AL6A 2WPXA 2LA4A 3LP2A 1UVLA 3M32A 4Y2MA 1ICEB 1UWBA 1RAEB 5J2NA 3EO4A 3GSIA 2HS0A 1DTTB 4NSQA 5K8NA 1WEZA 3EJMA 2YWHA 3D7DA 3A9LA 4WTYA 4NGMA 4RWXA 2D69A 4GO7X 2BRKA 4QB9A 3WX8A 2AFSA 2M70A 2V50A 3OTBA 2IVMA 1PU9A 5LT5A 1S7FA 3CCUS 1MMLA 4GO5X 3EZUA 2J6UA 3TP2A 1HBMB 3MMJA 3TYTA 4EYHB 1CS4B 2HHPA 3GJTB 4CI0B 4O4GB 3ZC4A 4QU6A 1M5KC 4AD6A 5KFHA 2B9WA 5EN1A 1UFLA 2IM2A 1YR0A 4YHHJ 1OY6A 2R98A 2AYBA 2H51B 1HQUB 4YOEA 5A8RA 2IRXA 3W60A 5DGAA 1VC6A 3OVAA 2VJUA 1YBUA 1N0UA 3QGIA 3J80U 1FWLA 3C8YA 3A8EA 1M1HA 2R8JA 4XPEA 4DHVA 1FTCA 3MAHA 5AE1A 3S9NA 3MM7B 1C1BA 1J5EF 1PYOB 1RDRA 3NKYA 1V9OA 3D1HA 1JLBA 1RTHB 4BC7A 3BH6B 2MZTA 4N8OA 2PJCA 4NLDA 1HNWJ 2QO3A 5E3CA 4C7QA 5IWAJ 3CPAA 2HHHJ 2XNQA 3N5BA 4ZVUB 2UVWA 2HUZA 4JI0J 4CGLA 3GCXP 1B0TA 2PJ9A 3ZZYA 1JJ4A 5J1NA 3NGRA 3TCVA 5B7WA 4UIBA 3I5BA 4GKKJ 4XDDA 1Q81T 3QO9A 3NRBA 4CO1A 8ATCB 1DZ5A 1GEHA 4Y2CA 1LWCA 1MWZA 2GVZA 4KSFA 3A8KA 1T8EA 1FO1A 3M8ZA 2V2VA 2BJ9A 2GHVC 3QAUA 1YITS 1FKOA 2QECA 3IG1B 2MKJA 5HANA 1TIQA 4DUTA 2VPWB 3R5JB 2QT7A 2R7SA 4MIAA 2HHQA 1NSPA 1HARA 4PPDA 4DL3A 4XDCA 3KJVB 2CKWA 2MHNA 1R43A 2K8GA 2YNCA 1S0MA 5ISVA 1H6KX 4QIGA 4MHZA 1QAYA 2V8GA 2R7TA 1CJT