3B3TA

Crystal structure of the d118n mutant of the aminopeptidase from vibrio proteolyticus
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDNASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title Zinc coordination geometry and ligand binding affinity: the structural and kinetic analysis of the second-shell serine 228 residue and the methionine 180 residue of the aminopeptidase from Vibrio proteolyticus.
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase
total genus 111
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2007-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3b3tA00
5K8NA 2JEWA 1TF8A 2C6CA 4NJRA 3B3TA 4Q7AA 3PB9X 4OC1A 4NJQA 4PXBA 5K8MA 1ELLP 3KASA 3TX8A 3B3CA 3RAMA 3SJFA 2EK8A 2ZOFA 4P4DA 4OC2A 4UEZA 2IMOA 1R3NA 1R43A 1HDQA 2PCUA 3RZAA 4OC0A 1IGBA 4R6TA 3KR5A 4MHYA 1NSAA 2AFZA 4NGPA 3IO1A 1Y7EA 1TKHA 4ZY2A 1FT7A 2PJ8A 4P6YA 4UIBA 3WABA 4F8ZA 4Z65A 3CPXA 4P44A 3GLJA 2PJ3A 3B7IA 4ZX9A 4X8IA 2F8HA 3WC5A 1BLLE 4MCSA 3SJEA 1LAPA 4MCPA 5JGFA 2Q4ZA 4FWUA 1JQGA 2PE3A 1F57A 5JM6A 1UWYA 4MHZA 4R8FA 2JBKA 3D7HA 2BOAA 3WC6A 2RB7A 4TNUA 4P4BA 2IQ6A 1XFOA 3LMSA 4AXVA 2PJ2A 1YMEA 5IB9A 3S9MA 2J9AA 2ZEFA 4NGSA 3PRTA 4MMOA 2AFXA 3FVLA 2PIZA 3IJ3A 2XEJA 4P4FA 4ZI6A 4P10A 1YSJA 1VHEA 5LRKA 1Y0YA 3B35A 4P4EA 4DUKA 3H8FA 3RBUA 5K8PA 1XJOA 2C6PA 1GYTA 4MHPA 4DJLA 5CBMA 5LYFA 1CBXA 3BI1A 1AYEA 2VL1A 2WYRA 3NFZA 2ZEHA 3S9LA 2PRQA 3PEIA 3WC7A 4PPZA 1VIXA 3VARA 1Y0RA 1ZG9A 5J1QA 3SI1A 1BAVA 1F2PA 5THWA 4CPAA 4OKOA 1CG2A 3GB0A 3D4UA 2PJBA 2CTBA 4ZYQA 1PYTB 2NSMA 4OC4A 3FECA 3IIBA 1VGYA 2ZEPA 3IFEA 1OBRA 3V38A 2HC9A 1ARMA 3SJXA 2PJ4A 2XEGA 4R76A 2PVVA 4LQGA 3BXMA 1HEEA 3SI2A 3FEDA 2GLFA 2EWBA 2F7VA 4IK2A 3PB6X 3S9NA 3SI0A 4X3RA 3ISXA 3PB4X 4A94A 1ZLIA 1CPXA 2QJ8A 4BD9A 1Z8LA 2G9DA 1Z5RA 4PXEA 2GREA 3SJGA 2WZNA 4OMEA 4OP4A 5ELYA 4ZX8A 4NFRA 1YW6A 2CTCA 3I1UA 5F09A 3D68A 2EK9A 2BO9A 1RTQA 1ARLA 1LANA 1KWMA 3LWUA 1M4LA 3NH5A 2AFMA 2QYVA 3H8GA 4NGRA 2V77A 4GM5A 3QNVA 2DEAA 3T8WA 3CT9A 5D29A 5HVGA 3NH4A 2ABZA 4G1PA 3NA6A 3PFEA 5K8OA 5LYDA 3JRUA 1XMBA 1BPMA 4H2KA 2PJAA 2ZOGA 2PJ9A 2ZENA 3VATA 4WWVA 2AFWA 5LRJA 2O4HA 2V8DA 2PJCA 3IWWA 2HB6A 2V8VA 4A37A 1HDUA 4MRIA 4NGNA 3PBEA 5HVHA 4YU9A 3KZWA 2XEIA 3MRUA 2AFSA 2OOTA 2XEFA 4DYOA 4UF4A 5CPAA 1BPNA 1QMUA 4FBEA 2CIJA 2POKA 1ZG7A 7CPAA 4PXCA 2ZELA 1Q7LA 3BI0A 4ZY0A 1LOKA 3KHZA 2PIYA 5D8NA 4JYWA 2Q51A 3GUXA 5HVFA 2AFUA 5I4MA 3B3VA 4OC3A 3H8EA 2OR4A 2V8GA 1TKFA 4ONWA 4R7MA 2C6GA 3KHXA 1TXRA 4NGTA 3FJUA 2CF4A 1H8LA 3IEHA 4NGMA 2C1CA 2ZEGA 2PVWA 1TKJA 1ZG8A 3PFOA 1CP6A 2JBJA 3FX6A 4UEFA 4OIWA 2Q43A 1Z2LA 4IAVA 3KQZA 1CX8A 3FEEA 4F9VA 1DTDA 3FMCA 3D67A 4W9YA 4OC5A 1LCPA 4O23A 2PJ1A 3B3SA 4JZ0A 5LYLA 4ZY1A 3L2NA 1XRYA 4B6ZA 4P4IA 2RFHA 3KI9A 5JH9A 1VHOA 3CDXA 5LYIA 4NGQA 4P45A 4EMEA 2BCOA 1QQ9A 4TWEA 3D7DA 3HUVA 5HXDA 1PCAA 4PQAA 3IC1A 1F2OA 2PJ0A 4MCQA 1XBUA 1DE4C 4MXUA 3D7GA 1LFWA 1FNOA 3KL9A 3N5FA 3TC8A 3D66A 2PJ7A 3KR4A 4PXDA 3ISZA 3PBBA 4MHNA 3B2YA 1YLOA 4A39A 3CPAA 1AMPA 3BHXA 2O53A 3WT4A 2IJZA 1TF9A 2PJ5A 4FAIA 4IHMA 2AFOA 4WJBA 3VH9A 3K2KA 3FH4A 2QVPA 1ZLHA 4OIDA 3B3WA 4RUHA 2ZEMA 2PJ6A 4EFDA 6CPAA 4YWYA 3D7FA 3KQXA 5LRGA 3PB7X 2I3CA 3KGQA 8CPAA 1CPSA 2GLJA 3MN8A 3K9TA 2ZEOA 4P4JA 1EE3P 3NH8A 3PB8X 4UIAA 2ZEDA 3FF3A 4UEEA 2V8HA 2ZEEA 1ELMP 3DLJA 4A38A 3V7ZA 5DS0A 1YW4A 4X2TA 2ANPA 3DGVA 1LAMA 4K3NA 2NYQA 4KSIA 2GU2A 4MCRA 2FVGA 4EWTA 3HLPA 4F9UA 1IY7A 4FUUA 1CP7A
chains in the Genus database with same CATH superfamily
2Z3NA 5K8NA 2JEWA 1TF8A 4MBUA 1JWQA 4M85A 2C6CA 2DPTA 1QSRA 4NJRA 3B3TA 2AE6A 4R87A 5AG4A 4Q7AA 4IUSA 3PB9X 3OWCA 4GXHA 4NJQA 4OC1A 2B5GA 4PXBA 2P6GA 1IOIA 1YQEA 5K8MA 2P6EA 4A2ZA 1ELLP 3C26A 3KASA 3TX8A 3B3CA 1I1DA 3RAMA 3SJFA 2EK8A 2ZOFA 4P4DA 1B87A 4OC2A 4UEZA 1X12A 4MFJA 2QMLA 2Z11A 2EBJA 4NSQA 2IMOA 3VWDA 1I12A 1R3NA 1R43A 1HDQA 2PCUA 3RZAA 4OC0A 3ZJ0A 1RXTA 1IGBA 4B12A 4PSXA 5E96A 5A28A 2VXKA 4I49A 4R6TA 2Z3LA 4U5YA 3FBUA 3KR5A 3QAHA 4UA3A 4LUAA 4MHYA 1NSAA 2R1IA 4C2ZA 2AFZA 4NGPA 4C7HA 2BSWA 1L0CA 3PGPA 3TO7A 3IO1A 3DNSA 1Y7EA 1S5KA 1TKHA 5KTDA 4ZY2A 1XEBA 1FT7A 1YGHA 3R95A 2PJ8A 4P6YA 5AGEA 5F46A 4UIBA 3FNCA 3WABA 3I9SA 4BMHA 2OZUA 4F8ZA 4Z65A 5I0CA 1XE4A 4MY0A 3CPXA 1K4JA 3R1KA 4P44A 1MJAA 3GLJA 1Y9WA 5DWNA 3MGDA 4OADA 2PJ3A 3B7IA 4ZX9A 4X8IA 4FD7A 1YR0A 2G3AA 4MY3A 2CNTA 2F8HA 2Q44A 3WC5A 3CXSA 4QVTA 3BLNA 5EC4A 2EVNA 2B58A 1BLLE 5J8CA 4MCSA 5JPHA 3SJEA 4AB7A 2FIAA 1LAPA 4KOVA 4MFZA 1MJ9A 1S7NA 5AG7A 3GKRA 4MCPA 4KOXA 4L8AA 3GY9A 2Q4ZA 5JGFA 3EC4A 4KOYA 4KLVA 3P2HA 3W91A 4FWUA 4UFVA 1JQGA 2PE3A 4CGNA 1Z8XA 1F57A 5JM6A 1UWYA 4MHZA 4R8FA 1J4JA 2JBKA 1OZPA 4NEXA 3D7HA 2BOAA 3WC6A 2PR8A 2RB7A 4MFQA 4KVME 4TNUA 4P4BA 2HQYA 2I79A 5F47A 3F8KA 2FCKA 1S60A 5EBVA 2Q7BA 4RN7A 2IQ6A 1XFOA 3FB3A 2HV2A 4A30A 3IWEA 4B5PA 3LMSA 4AXVA 2PDOA 4OLLA 4FD5A 2PJ2A 1YMEA 5IB9A 4UCMA 4FD6A 3S9MA 3EY5A 4GS4A 1IYLA 2J9AA 3NE7A 3G8WA 2ZEFA 1QSOA 3PRTA 3G3SA 2AFXA 3FVLA 2PIZA 4MMOA 3IJ3A 4NGSA 3CZXA 4BBHA 4HPSA 2XEJA 4P4FA 3FIXA 4P10A 4ZI6A 4HKFA 1YSJA 4E8OA 3B8GA 2GE3A 1VHEA 2PR1A 3D2PA 5LRKA 2KCWA 1Y0YA 2GFQA 4XPKA 3B35A 2A4NA 4P4EA 1WWZA 3H8FA 3RBUA 3TO9A 4DUKA 5K8PA 1XJOA 2Q4YA 1QSNA 2C6PA 1GYTA 4HNWB 4MHPA 2OU2A 4DJLA 5CBMA 5LYFA 1CBXA 1M4IA 3BI1A 2Z3KA 3PZJA 1AYEA 4A33A 2R7HA 2VL1A 2WYRA 3NFZA 2ZEHA 4KSFA 2PRQA 3PEIA 3S9LA 1NSLA 4DNCA 1Z8WA 2J8MA 3WC7A 4CRYB 2YNEA 4PPZA 1VIXA 4AG9A 1NMTA 4R3LA 3VARA 1Y0RA 4ONUA 4JWPA 4CAWA 1ZG9A 4AVAA 3SI1A 5J1QA 3N7ZA 1BAVA 1F2PA 2IL4A 2EO8A 4K30A 1X10A 5THWA 5AG6A 3TO6A 4CPAA 5G1ZA 4OKOA 3VWEA 2R8VA 4A32A 1CG2A 5C88A 3GB0A 2FXFA 2PJBA 3D4UA 2CTBA 2DPSA 4ZYQA 2Q04A 4H6ZA 5HH1A 4KZTA 5G22A 2FE7A 1PYTB 2B3UA 3W6SA 2NSMA 2FSRA 4OC4A 3FECA 4HNYB 3IIBA 3FXTA 1VGYA 2ZEPA 3IFEA 1OBRA 2Q4VA 3V38A 3TTHA 2HC9A 2NMTA 4KOSA 1P4NA 3V8IA 1ARMA 4MFLA 3SJXA 5F48A 1QSTA 2PJ4A 5KTCA 3JVNA 1Z4EA 4NF1A 2XEGA 4R76A 2PVVA 4LQGA 3BXMA 3IGRA 2WPXA 3A9LA 1M4GA 1HEEA 3SI2A 1KUXA 2BL1A 4C68A 1YLEA 3FEDA 2GLFA 2EWBA 5G20A 1S7LA 3H4QA 4MFKA 2F7VA 2ODFA 4IK2A 3PB6X 5KTAA 3SI0A 3S9NA 4F0XA 4PV6A 4X3RA 2J8RA 1N71A 3ISXA 3BJ8A 3PB4X 4A95A 3TOAA 3LODA 4XPDC 5A27A 1YVKA 4UWJA 1ZLIA 2EUIA 1CPXA 5H84A 4A94A 2K5TA 2JLMA 2QJ8A 4UFXA 4BD9A 1Z8LA 2G9DA 1Z5RA 4PXEA 4XPLA 2GREA 3S6GA 3SJGA 2WZNA 4OMEA 4OP4A 5ELYA 1IB1E 1YX0A 2F5IA 2YNCA 3BJ7A 1YW6A 2CTCA 4NFRA 2Z3OA 3I1UA 1B6BA 3JUWA 5F09A 3TT2A 3D68A 2FIWA 3LACA 2EK9A 2BO9A 3EXNA 2G3TA 4Y49C 1FY7A 4KVOE 4Q36A 4R9MA 4A31A 1Q2CA 1RTQA 2CXAA 1ARLA 3JTKA 1LANA 1BOBA 1QSMA 2JDDA 1YK3A 3W6XA 1KWMA 4ZX8A 3LWUA 4R3KA 5J8FA 4XNHB 1M4LA 4CAVA 2WSAA 3NH5A 2AFMA 1XMTA 2QYVA 1S7FA 3H8GA 4NGRA 1IIDA 2JDCA 3SXOA 2GIVA 3WR7A 2Q7SA 2ZPAA 2B4BA 4KOUA 4LQ6A 2WPWA 2V77A 2Z0ZA 4BINA 4GM5A 3QNVA 1Q2DA 2DEAA 4JJXA 2B4DB 3CT9A 5D29A 3T8WA 1IOFA 5HVGA 4KUBA 5FVJA 2Z3MA 1M44A 3NH4A 5H86A 1R57A 2ABZA 4G1PA 3FRMA 3NA6A 3PFEA 4YFJA 5LYDA 5K8OA 3SXNA 3JRUA 1XMBA 1BPMA 5IX3A 4H2KA 4C2XA 2PJAA 2VEZA 3F0AA 1A2ZA 3I3GA 4J3GA 2ZOGA 2C27A 4H6UA 2JEVA 4KSAA 2PJ9A 1Y9KA 2ZENA 3VATA 2FT0A 2VI7A 4M6HA 2AFWA 4WWVA 4ZBGA 5LRJA 2O4HA 2V8DA 3ZZIA 5AG5A 2QECA 3FYNA 2VBQA 2PJCA 2X7BA 3IWWA 4E2AA 2HB6A 1S7KA 2I00A 2V8VA 2Y0MA 4A37A 1HDUA 1VHSA 2WUUA 3R9EA 1WK4A 3LD2A 4MRIA 4XNHC 4NGNA 1NE9A 3PBEA 3S6KA 4AVBA 5HVHA 2B5GB 1YVOA 4YU9A 1IICA 2XEIA 3KZWA 2QIRA 4U9ZA 3MRUA 4UBRA 2AFSA 4F0YA 2OOTA 2XEFA 4DYOA 2BEIA 4UF4A 5IB0A 4UCPA 5CPAA 1BPNA 3DDDA 1QMUA 4PSWA 2P0WA 3IWGA 4KLWA 2CIJA 4FBEA 2POKA 5IV0A 4B5OA 1Z8TA 1TIQA 3D2MA 2ZXVA 3EFAA 1ZG7A 2G0BA 7CPAA 4PXCA 2ZELA 4RS2A 1Q7LA 3BI0A 4ORFA 4ZY0A 3CXPA 4CS0B 3D3SA 1LOKA 3KHZA 1P0HA 2CNSA 2PIYA 2P6FA 5D8NA 4M6IA 4PK2A 4JYWA 2Q51A 3GUXA 5HVFA 5BWAB 2AFUA 4CYQA 5I4MA 4C2YA 4XPDB 1LRZA 3B3VA 4OC3A 2OZGA 3H8EA 2OR4A 2V8GA 1IYKA 1TKFA 4ONWA 4R57A 3EO4A 4R7MA 4CGLA 4CYPA 3DR6A 5HMNA 2C6GA 3KHXA 1TXRA 4NGTA 2FL4A 3FJUA 4IF5A 4PK3A 2CF4A 1H8LA 3IEHA 4NGMA 4E0AA 1M1DA 2H5MA 2C1CA 3TOBA 2ZEGA 2D4PA 2PVWA 1ON0A 1TKJA 2HUZA 1YREA 1ZG8A 4JXQA 4KOTA 4L89A 3PFOA 1CP6A 4YRHA 2JBJA 4Y49B 3FX6A 2YNDA 4UEFA 4OIWA 2Q43A 1Z2LA 3QAYA 4IAVA 3KQZA 1CX8A 3FEEA 5CNPA 4F9VA 2J8NA 1S3ZA 1MK4A 3P2FA 1DTDA 3FMCA 2CNMA 3D67A 1U6MA 4W9YA 3GIUA 2FS5A 4OC5A 4KS9A 1LCPA 4O23A 4Q38A 3R9GA 4QUSA 2PJ1A 4UFWA 3B3SA 4JLYA 3T9YA 4JZ0A 4CRZB 3KKWA 4KORA 5LYLA 3UY5A 5F49A 5EMIA 2ARHA 4ZY1A 3L2NA 3SHPA 1CJWA 3RYOA 4QB9A 1XOVA 1XRYA 4B6ZA 4P4IA 4CAFA 2RC4A 3S6HA 2RFHA 3KI9A 1KUYA 5JH9A 1VHOA 2PQ8A 3CDXA 4JD6A 4NGQA 4P45A 4YGOA 5LYIA 2BCOA 2CY2A 1QQ9A 4EMEA 5C82A 4TWEA 4II9A 1XF8A 3D7DA 2VZYA 3HUVA 3NE8A 1PCAA 4M6GA 4PQAA 4AG7A 4C7IA 5HXDA 4CGPA 4B14A 2OZHA 3IC1A 4UCNA 2ZW7A 1F2OA 2PJ0A 1DE4C 1XBUA 1Q2YA 2PRBA 4MCQA 4X5KA 3T90A 4MXUA 3D7GA 1LFWA 1FNOA 3DR8A 3KL9A 1SQHA 3N5FA 4B5PB 1M4DA 3TC8A 4CAXA 4ZGYB 2Z10A 3D66A 4UWIA 2PJ7A 1RO5A 3KR4A 3R96A 5GCNA 4PXDA 3ISZA 4NCZA 4KOWA 3PBBA 1PU9A 4MHNA 2YGWA 4QBJA 3B2YA 1YLOA 4KUAA 3CPAA 1I21A 4A39A 3CXQA 1ZO0A 1AMPA 3BHXA 4CYOA 4CYNA 5ISVA 2O53A 4CAEA 4KVXA 3WT4A 2IJZA 1TF9A 1XIXA 2PSWA 4U9YA 2PJ5A 2YNCC 3TFYA 3GYAA 4FAIA 4IHMA 2AFOA 4WJBA 3RNZA 4CGOA 2B3VA 3VH9A 3K2KA 1GHEA 3FH4A 4F6AA 2QVPA 3DSBA 3TCVA 1ZLHA 4H89A 4OIDA 3B3WA 3PP9A 4RUHA 2D4OA 2ZW4A 2ZEMA 3RO0A 2DF5A 1Y7RA 2PJ6A 4M3SA 4B10A 4EFDA 6CPAA 1IU8A 4YWYA 3D7FA 3KQXA 2OH1A 5LRGA 1UFHA 1Z4RA 3PB7X 2I3CA 3KGQA 4AVCA 8CPAA 1CPSA 2GLJA 2VQYA 3MN8A 4MHDA 3IU2A 3D8PA 4MFPA 4JXRA 1KUVA 3K9TA 4HNXB 4LX9A 1MJBA 1PUAA 2ZEOA 5G21A 2AJ6A 3R9FA 2O28A 4P4JA 4B11A 1EE3P 1CM0A 3NH8A 1VKCA 3IU1A 3PB8X 4B13A 4UIAA 2ZEDA 3FF3A 4UEEA 2REEA 2OB0A 2V8HA 3E0KA 2ZEEA 1ELMP 3DLJA 4A38A 4EVYA 2R98A 4RI1A 3V7ZA 3H5ZA 1BO4A 1YW4A 2ZW5A 5DS0A 4MJ8A 4X2TA 2ZW6A 4OAEA 4CGMA 2B4DA 2ANPA 3DGVA 1LAMA 2DXQA 2NYQA 2Z3PA 1V0CA 2GU2A 3F5BA 3K9UA 3QB8A 4K3NA 4KSIA 2PC1A 2VZZA 2REFA 5DWMA 1KZFA 4MCRA 4QC6A 2FVGA 4EWTA 2BUEA 1Z9UA 3HLPA 4F9UA 4NXYA 2Q0YA 1AUGA 1IY7A 2ATRA 4FD4A 4FUUA 3S6FA 2GANA 3TE4A 1CP7A 4MI4A 5JQ4A
chains in the Genus database with same CATH topology
5K8NA 2JEWA 1TF8A 2C6CA 4NJRA 3B3TA 4Q7AA 3PB9X 4OC1A 4NJQA 4PXBA 5K8MA 1ELLP 3KASA 3TX8A 3B3CA 3RAMA 3SJFA 2EK8A 2ZOFA 4P4DA 4OC2A 4UEZA 2IMOA 1R3NA 1R43A 1HDQA 2PCUA 3RZAA 4OC0A 1IGBA 4R6TA 3KR5A 4MHYA 1NSAA 2AFZA 4NGPA 3IO1A 1Y7EA 1TKHA 4ZY2A 1FT7A 2PJ8A 4P6YA 4UIBA 3WABA 4F8ZA 4Z65A 3CPXA 4P44A 3GLJA 2PJ3A 3B7IA 4ZX9A 4X8IA 2F8HA 3WC5A 1BLLE 4MCSA 3SJEA 1LAPA 4MCPA 5JGFA 2Q4ZA 4FWUA 1JQGA 2PE3A 1F57A 5JM6A 1UWYA 4MHZA 4R8FA 2JBKA 3D7HA 2BOAA 3WC6A 2RB7A 4TNUA 4P4BA 2IQ6A 1XFOA 3LMSA 4AXVA 2PJ2A 1YMEA 5IB9A 3S9MA 2J9AA 2ZEFA 4NGSA 3PRTA 4MMOA 2AFXA 3FVLA 2PIZA 3IJ3A 2XEJA 4P4FA 4ZI6A 4P10A 1YSJA 1VHEA 5LRKA 1Y0YA 3B35A 4P4EA 4DUKA 3H8FA 3RBUA 5K8PA 1XJOA 2C6PA 1GYTA 4MHPA 4DJLA 5CBMA 5LYFA 1CBXA 3BI1A 1AYEA 2VL1A 2WYRA 3NFZA 2ZEHA 3S9LA 2PRQA 3PEIA 3WC7A 4PPZA 1VIXA 3VARA 1Y0RA 1ZG9A 5J1QA 3SI1A 1BAVA 1F2PA 5THWA 4CPAA 4OKOA 1CG2A 3GB0A 3D4UA 2PJBA 2CTBA 4ZYQA 1PYTB 2NSMA 4OC4A 3FECA 3IIBA 1VGYA 2ZEPA 3IFEA 1OBRA 3V38A 2HC9A 1ARMA 3SJXA 2PJ4A 2XEGA 4R76A 2PVVA 4LQGA 3BXMA 1HEEA 3SI2A 3FEDA 2GLFA 2EWBA 2F7VA 4IK2A 3PB6X 3S9NA 3SI0A 4X3RA 3ISXA 3PB4X 4A94A 1ZLIA 1CPXA 2QJ8A 4BD9A 1Z8LA 2G9DA 1Z5RA 4PXEA 2GREA 3SJGA 2WZNA 4OMEA 4OP4A 5ELYA 4ZX8A 4NFRA 1YW6A 2CTCA 3I1UA 5F09A 3D68A 2EK9A 2BO9A 1RTQA 1ARLA 1LANA 1KWMA 3LWUA 1M4LA 3NH5A 2AFMA 2QYVA 3H8GA 4NGRA 2V77A 4GM5A 3QNVA 2DEAA 3T8WA 3CT9A 5D29A 5HVGA 3NH4A 2ABZA 4G1PA 3NA6A 3PFEA 5K8OA 5LYDA 3JRUA 1XMBA 1BPMA 4H2KA 2PJAA 2ZOGA 2PJ9A 2ZENA 3VATA 4WWVA 2AFWA 5LRJA 2O4HA 2V8DA 2PJCA 3IWWA 2HB6A 2V8VA 4A37A 1HDUA 4MRIA 4NGNA 3PBEA 5HVHA 4YU9A 3KZWA 2XEIA 3MRUA 2AFSA 2OOTA 2XEFA 4DYOA 4UF4A 5CPAA 1BPNA 1QMUA 4FBEA 2CIJA 2POKA 1ZG7A 7CPAA 4PXCA 2ZELA 1Q7LA 3BI0A 4ZY0A 1LOKA 3KHZA 2PIYA 5D8NA 4JYWA 2Q51A 3GUXA 5HVFA 2AFUA 5I4MA 3B3VA 4OC3A 3H8EA 2OR4A 2V8GA 1TKFA 4ONWA 4R7MA 2C6GA 3KHXA 1TXRA 4NGTA 3FJUA 2CF4A 1H8LA 3IEHA 4NGMA 2C1CA 2ZEGA 2PVWA 1TKJA 1ZG8A 3PFOA 1CP6A 2JBJA 3FX6A 4UEFA 4OIWA 2Q43A 1Z2LA 4IAVA 3KQZA 1CX8A 3FEEA 4F9VA 1DTDA 3FMCA 3D67A 4W9YA 4OC5A 1LCPA 4O23A 2PJ1A 3B3SA 4JZ0A 5LYLA 4ZY1A 3L2NA 1XRYA 4B6ZA 4P4IA 2RFHA 3KI9A 5JH9A 1VHOA 3CDXA 5LYIA 4NGQA 4P45A 4EMEA 2BCOA 1QQ9A 4TWEA 3D7DA 3HUVA 5HXDA 1PCAA 4PQAA 3IC1A 1F2OA 2PJ0A 4MCQA 1XBUA 1DE4C 4MXUA 3D7GA 1LFWA 1FNOA 3KL9A 3N5FA 3TC8A 3D66A 2PJ7A 3KR4A 4PXDA 3ISZA 3PBBA 4MHNA 3B2YA 1YLOA 4A39A 3CPAA 1AMPA 3BHXA 2O53A 3WT4A 2IJZA 1TF9A 2PJ5A 4FAIA 4IHMA 2AFOA 4WJBA 3VH9A 3K2KA 3FH4A 2QVPA 1ZLHA 4OIDA 3B3WA 4RUHA 2ZEMA 2PJ6A 4EFDA 6CPAA 4YWYA 3D7FA 3KQXA 5LRGA 3PB7X 2I3CA 3KGQA 8CPAA 1CPSA 2GLJA 3MN8A 3K9TA 2ZEOA 4P4JA 1EE3P 3NH8A 3PB8X 4UIAA 2ZEDA 3FF3A 4UEEA 2V8HA 2ZEEA 1ELMP 3DLJA 4A38A 3V7ZA 5DS0A 1YW4A 4X2TA 2ANPA 3DGVA 1LAMA 4K3NA 2NYQA 4KSIA 2GU2A 4MCRA 2FVGA 4EWTA 3HLPA 4F9UA 1IY7A 4FUUA 1CP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K8N A;  2JEW A;  1TF8 A;  2C6C A;  4NJR A;  3B3T A;  4Q7A A;  3PB9 X;  4OC1 A;  4NJQ A;  4PXB A;  5K8M A;  1ELL P;  3KAS A;  3TX8 A;  3B3C A;  3RAM A;  3SJF A;  2EK8 A;  2ZOF A;  4P4D A;  4OC2 A;  4UEZ A;  2IMO A;  1R3N A;  1R43 A;  1HDQ A;  2PCU A;  3RZA A;  4OC0 A;  1IGB A;  4R6T A;  3KR5 A;  4MHY A;  1NSA A;  2AFZ A;  4NGP A;  3IO1 A;  1Y7E A;  1TKH A;  4ZY2 A;  1FT7 A;  2PJ8 A;  4P6Y A;  4UIB A;  3WAB A;  4F8Z A;  4Z65 A;  3CPX A;  4P44 A;  3GLJ A;  2PJ3 A;  3B7I A;  4ZX9 A;  4X8I A;  2F8H A;  3WC5 A;  1BLL E;  4MCS A;  3SJE A;  1LAP A;  4MCP A;  5JGF A;  2Q4Z A;  4FWU A;  1JQG A;  2PE3 A;  1F57 A;  5JM6 A;  1UWY A;  4MHZ A;  4R8F A;  2JBK A;  3D7H A;  2BOA A;  3WC6 A;  2RB7 A;  4TNU A;  4P4B A;  2IQ6 A;  1XFO A;  3LMS A;  4AXV A;  2PJ2 A;  1YME A;  5IB9 A;  3S9M A;  2J9A A;  2ZEF A;  4NGS A;  3PRT A;  4MMO A;  2AFX A;  3FVL A;  2PIZ A;  3IJ3 A;  2XEJ A;  4P4F A;  4ZI6 A;  4P10 A;  1YSJ A;  1VHE A;  5LRK A;  1Y0Y A;  3B35 A;  4P4E A;  4DUK A;  3H8F A;  3RBU A;  5K8P A;  1XJO A;  2C6P A;  1GYT A;  4MHP A;  4DJL A;  5CBM A;  5LYF A;  1CBX A;  3BI1 A;  1AYE A;  2VL1 A;  2WYR A;  3NFZ A;  2ZEH A;  3S9L A;  2PRQ A;  3PEI A;  3WC7 A;  4PPZ A;  1VIX A;  3VAR A;  1Y0R A;  1ZG9 A;  5J1Q A;  3SI1 A;  1BAV A;  1F2P A;  5THW A;  4CPA A;  4OKO A;  1CG2 A;  3GB0 A;  3D4U A;  2PJB A;  2CTB A;  4ZYQ A;  1PYT B;  2NSM A;  4OC4 A;  3FEC A;  3IIB A;  1VGY A;  2ZEP A;  3IFE A;  1OBR A;  3V38 A;  2HC9 A;  1ARM A;  3SJX A;  2PJ4 A;  2XEG A;  4R76 A;  2PVV A;  4LQG A;  3BXM A;  1HEE A;  3SI2 A;  3FED A;  2GLF A;  2EWB A;  2F7V A;  4IK2 A;  3PB6 X;  3S9N A;  3SI0 A;  4X3R A;  3ISX A;  3PB4 X;  4A94 A;  1ZLI A;  1CPX A;  2QJ8 A;  4BD9 A;  1Z8L A;  2G9D A;  1Z5R A;  4PXE A;  2GRE A;  3SJG A;  2WZN A;  4OME A;  4OP4 A;  5ELY A;  4ZX8 A;  4NFR A;  1YW6 A;  2CTC A;  3I1U A;  5F09 A;  3D68 A;  2EK9 A;  2BO9 A;  1RTQ A;  1ARL A;  1LAN A;  1KWM A;  3LWU A;  1M4L A;  3NH5 A;  2AFM A;  2QYV A;  3H8G A;  4NGR A;  2V77 A;  4GM5 A;  3QNV A;  2DEA A;  3T8W A;  3CT9 A;  5D29 A;  5HVG A;  3NH4 A;  2ABZ A;  4G1P A;  3NA6 A;  3PFE A;  5K8O A;  5LYD A;  3JRU A;  1XMB A;  1BPM A;  4H2K A;  2PJA A;  2ZOG A;  2PJ9 A;  2ZEN A;  3VAT A;  4WWV A;  2AFW A;  5LRJ A;  2O4H A;  2V8D A;  2PJC A;  3IWW A;  2HB6 A;  2V8V A;  4A37 A;  1HDU A;  4MRI A;  4NGN A;  3PBE A;  5HVH A;  4YU9 A;  3KZW A;  2XEI A;  3MRU A;  2AFS A;  2OOT A;  2XEF A;  4DYO A;  4UF4 A;  5CPA A;  1BPN A;  1QMU A;  4FBE A;  2CIJ A;  2POK A;  1ZG7 A;  7CPA A;  4PXC A;  2ZEL A;  1Q7L A;  3BI0 A;  4ZY0 A;  1LOK A;  3KHZ A;  2PIY A;  5D8N A;  4JYW A;  2Q51 A;  3GUX A;  5HVF A;  2AFU A;  5I4M A;  3B3V A;  4OC3 A;  3H8E A;  2OR4 A;  2V8G A;  1TKF A;  4ONW A;  4R7M A;  2C6G A;  3KHX A;  1TXR A;  4NGT A;  3FJU A;  2CF4 A;  1H8L A;  3IEH A;  4NGM A;  2C1C A;  2ZEG A;  2PVW A;  1TKJ A;  1ZG8 A;  3PFO A;  1CP6 A;  2JBJ A;  3FX6 A;  4UEF A;  4OIW A;  2Q43 A;  1Z2L A;  4IAV A;  3KQZ A;  1CX8 A;  3FEE A;  4F9V A;  1DTD A;  3FMC A;  3D67 A;  4W9Y A;  4OC5 A;  1LCP A;  4O23 A;  2PJ1 A;  3B3S A;  4JZ0 A;  5LYL A;  4ZY1 A;  3L2N A;  1XRY A;  4B6Z A;  4P4I A;  2RFH A;  3KI9 A;  5JH9 A;  1VHO A;  3CDX A;  5LYI A;  4NGQ A;  4P45 A;  4EME A;  2BCO A;  1QQ9 A;  4TWE A;  3D7D A;  3HUV A;  5HXD A;  1PCA A;  4PQA A;  3IC1 A;  1F2O A;  2PJ0 A;  4MCQ A;  1XBU A;  1DE4 C;  4MXU A;  3D7G A;  1LFW A;  1FNO A;  3KL9 A;  3N5F A;  3TC8 A;  3D66 A;  2PJ7 A;  3KR4 A;  4PXD A;  3ISZ A;  3PBB A;  4MHN A;  3B2Y A;  1YLO A;  4A39 A;  3CPA A;  1AMP A;  3BHX A;  2O53 A;  3WT4 A;  2IJZ A;  1TF9 A;  2PJ5 A;  4FAI A;  4IHM A;  2AFO A;  4WJB A;  3VH9 A;  3K2K A;  3FH4 A;  2QVP A;  1ZLH A;  4OID A;  3B3W A;  4RUH A;  2ZEM A;  2PJ6 A;  4EFD A;  6CPA A;  4YWY A;  3D7F A;  3KQX A;  5LRG A;  3PB7 X;  2I3C A;  3KGQ A;  8CPA A;  1CPS A;  2GLJ A;  3MN8 A;  3K9T A;  2ZEO A;  4P4J A;  1EE3 P;  3NH8 A;  3PB8 X;  4UIA A;  2ZED A;  3FF3 A;  4UEE A;  2V8H A;  2ZEE A;  1ELM P;  3DLJ A;  4A38 A;  3V7Z A;  5DS0 A;  1YW4 A;  4X2T A;  2ANP A;  3DGV A;  1LAM A;  4K3N A;  2NYQ A;  4KSI A;  2GU2 A;  4MCR A;  2FVG A;  4EWT A;  3HLP A;  4F9U A;  1IY7 A;  4FUU A;  1CP7 A; 
#chains in the Genus database with same CATH topology
 2Z3N A;  5K8N A;  2JEW A;  1TF8 A;  4MBU A;  1JWQ A;  4M85 A;  2C6C A;  2DPT A;  1QSR A;  4NJR A;  3B3T A;  2AE6 A;  4R87 A;  5AG4 A;  4Q7A A;  4IUS A;  3PB9 X;  3OWC A;  4GXH A;  4NJQ A;  4OC1 A;  2B5G A;  4PXB A;  2P6G A;  1IOI A;  1YQE A;  5K8M A;  2P6E A;  4A2Z A;  1ELL P;  3C26 A;  3KAS A;  3TX8 A;  3B3C A;  1I1D A;  3RAM A;  3SJF A;  2EK8 A;  2ZOF A;  4P4D A;  1B87 A;  4OC2 A;  4UEZ A;  1X12 A;  4MFJ A;  2QML A;  2Z11 A;  2EBJ A;  4NSQ A;  2IMO A;  3VWD A;  1I12 A;  1R3N A;  1R43 A;  1HDQ A;  2PCU A;  3RZA A;  4OC0 A;  3ZJ0 A;  1RXT A;  1IGB A;  4B12 A;  4PSX A;  5E96 A;  5A28 A;  2VXK A;  4I49 A;  4R6T A;  2Z3L A;  4U5Y A;  3FBU A;  3KR5 A;  3QAH A;  4UA3 A;  4LUA A;  4MHY A;  1NSA A;  2R1I A;  4C2Z A;  2AFZ A;  4NGP A;  4C7H A;  2BSW A;  1L0C A;  3PGP A;  3TO7 A;  3IO1 A;  3DNS A;  1Y7E A;  1S5K A;  1TKH A;  5KTD A;  4ZY2 A;  1XEB A;  1FT7 A;  1YGH A;  3R95 A;  2PJ8 A;  4P6Y A;  5AGE A;  5F46 A;  4UIB A;  3FNC A;  3WAB A;  3I9S A;  4BMH A;  2OZU A;  4F8Z A;  4Z65 A;  5I0C A;  1XE4 A;  4MY0 A;  3CPX A;  1K4J A;  3R1K A;  4P44 A;  1MJA A;  3GLJ A;  1Y9W A;  5DWN A;  3MGD A;  4OAD A;  2PJ3 A;  3B7I A;  4ZX9 A;  4X8I A;  4FD7 A;  1YR0 A;  2G3A A;  4MY3 A;  2CNT A;  2F8H A;  2Q44 A;  3WC5 A;  3CXS A;  4QVT A;  3BLN A;  5EC4 A;  2EVN A;  2B58 A;  1BLL E;  5J8C A;  4MCS A;  5JPH A;  3SJE A;  4AB7 A;  2FIA A;  1LAP A;  4KOV A;  4MFZ A;  1MJ9 A;  1S7N A;  5AG7 A;  3GKR A;  4MCP A;  4KOX A;  4L8A A;  3GY9 A;  2Q4Z A;  5JGF A;  3EC4 A;  4KOY A;  4KLV A;  3P2H A;  3W91 A;  4FWU A;  4UFV A;  1JQG A;  2PE3 A;  4CGN A;  1Z8X A;  1F57 A;  5JM6 A;  1UWY A;  4MHZ A;  4R8F A;  1J4J A;  2JBK A;  1OZP A;  4NEX A;  3D7H A;  2BOA A;  3WC6 A;  2PR8 A;  2RB7 A;  4MFQ A;  4KVM E;  4TNU A;  4P4B A;  2HQY A;  2I79 A;  5F47 A;  3F8K A;  2FCK A;  1S60 A;  5EBV A;  2Q7B A;  4RN7 A;  2IQ6 A;  1XFO A;  3FB3 A;  2HV2 A;  4A30 A;  3IWE A;  4B5P A;  3LMS A;  4AXV A;  2PDO A;  4OLL A;  4FD5 A;  2PJ2 A;  1YME A;  5IB9 A;  4UCM A;  4FD6 A;  3S9M A;  3EY5 A;  4GS4 A;  1IYL A;  2J9A A;  3NE7 A;  3G8W A;  2ZEF A;  1QSO A;  3PRT A;  3G3S A;  2AFX A;  3FVL A;  2PIZ A;  4MMO A;  3IJ3 A;  4NGS A;  3CZX A;  4BBH A;  4HPS A;  2XEJ A;  4P4F A;  3FIX A;  4P10 A;  4ZI6 A;  4HKF A;  1YSJ A;  4E8O A;  3B8G A;  2GE3 A;  1VHE A;  2PR1 A;  3D2P A;  5LRK A;  2KCW A;  1Y0Y A;  2GFQ A;  4XPK A;  3B35 A;  2A4N A;  4P4E A;  1WWZ A;  3H8F A;  3RBU A;  3TO9 A;  4DUK A;  5K8P A;  1XJO A;  2Q4Y A;  1QSN A;  2C6P A;  1GYT A;  4HNW B;  4MHP A;  2OU2 A;  4DJL A;  5CBM A;  5LYF A;  1CBX A;  1M4I A;  3BI1 A;  2Z3K A;  3PZJ A;  1AYE A;  4A33 A;  2R7H A;  2VL1 A;  2WYR A;  3NFZ A;  2ZEH A;  4KSF A;  2PRQ A;  3PEI A;  3S9L A;  1NSL A;  4DNC A;  1Z8W A;  2J8M A;  3WC7 A;  4CRY B;  2YNE A;  4PPZ A;  1VIX A;  4AG9 A;  1NMT A;  4R3L A;  3VAR A;  1Y0R A;  4ONU A;  4JWP A;  4CAW A;  1ZG9 A;  4AVA A;  3SI1 A;  5J1Q A;  3N7Z A;  1BAV A;  1F2P A;  2IL4 A;  2EO8 A;  4K30 A;  1X10 A;  5THW A;  5AG6 A;  3TO6 A;  4CPA A;  5G1Z A;  4OKO A;  3VWE A;  2R8V A;  4A32 A;  1CG2 A;  5C88 A;  3GB0 A;  2FXF A;  2PJB A;  3D4U A;  2CTB A;  2DPS A;  4ZYQ A;  2Q04 A;  4H6Z A;  5HH1 A;  4KZT A;  5G22 A;  2FE7 A;  1PYT B;  2B3U A;  3W6S A;  2NSM A;  2FSR A;  4OC4 A;  3FEC A;  4HNY B;  3IIB A;  3FXT A;  1VGY A;  2ZEP A;  3IFE A;  1OBR A;  2Q4V A;  3V38 A;  3TTH A;  2HC9 A;  2NMT A;  4KOS A;  1P4N A;  3V8I A;  1ARM A;  4MFL A;  3SJX A;  5F48 A;  1QST A;  2PJ4 A;  5KTC A;  3JVN A;  1Z4E A;  4NF1 A;  2XEG A;  4R76 A;  2PVV A;  4LQG A;  3BXM A;  3IGR A;  2WPX A;  3A9L A;  1M4G A;  1HEE A;  3SI2 A;  1KUX A;  2BL1 A;  4C68 A;  1YLE A;  3FED A;  2GLF A;  2EWB A;  5G20 A;  1S7L A;  3H4Q A;  4MFK A;  2F7V A;  2ODF A;  4IK2 A;  3PB6 X;  5KTA A;  3SI0 A;  3S9N A;  4F0X A;  4PV6 A;  4X3R A;  2J8R A;  1N71 A;  3ISX A;  3BJ8 A;  3PB4 X;  4A95 A;  3TOA A;  3LOD A;  4XPD C;  5A27 A;  1YVK A;  4UWJ A;  1ZLI A;  2EUI A;  1CPX A;  5H84 A;  4A94 A;  2K5T A;  2JLM A;  2QJ8 A;  4UFX A;  4BD9 A;  1Z8L A;  2G9D A;  1Z5R A;  4PXE A;  4XPL A;  2GRE A;  3S6G A;  3SJG A;  2WZN A;  4OME A;  4OP4 A;  5ELY A;  1IB1 E;  1YX0 A;  2F5I A;  2YNC A;  3BJ7 A;  1YW6 A;  2CTC A;  4NFR A;  2Z3O A;  3I1U A;  1B6B A;  3JUW A;  5F09 A;  3TT2 A;  3D68 A;  2FIW A;  3LAC A;  2EK9 A;  2BO9 A;  3EXN A;  2G3T A;  4Y49 C;  1FY7 A;  4KVO E;  4Q36 A;  4R9M A;  4A31 A;  1Q2C A;  1RTQ A;  2CXA A;  1ARL A;  3JTK A;  1LAN A;  1BOB A;  1QSM A;  2JDD A;  1YK3 A;  3W6X A;  1KWM A;  4ZX8 A;  3LWU A;  4R3K A;  5J8F A;  4XNH B;  1M4L A;  4CAV A;  2WSA A;  3NH5 A;  2AFM A;  1XMT A;  2QYV A;  1S7F A;  3H8G A;  4NGR A;  1IID A;  2JDC A;  3SXO A;  2GIV A;  3WR7 A;  2Q7S A;  2ZPA A;  2B4B A;  4KOU A;  4LQ6 A;  2WPW A;  2V77 A;  2Z0Z A;  4BIN A;  4GM5 A;  3QNV A;  1Q2D A;  2DEA A;  4JJX A;  2B4D B;  3CT9 A;  5D29 A;  3T8W A;  1IOF A;  5HVG A;  4KUB A;  5FVJ A;  2Z3M A;  1M44 A;  3NH4 A;  5H86 A;  1R57 A;  2ABZ A;  4G1P A;  3FRM A;  3NA6 A;  3PFE A;  4YFJ A;  5LYD A;  5K8O A;  3SXN A;  3JRU A;  1XMB A;  1BPM A;  5IX3 A;  4H2K A;  4C2X A;  2PJA A;  2VEZ A;  3F0A A;  1A2Z A;  3I3G A;  4J3G A;  2ZOG A;  2C27 A;  4H6U A;  2JEV A;  4KSA A;  2PJ9 A;  1Y9K A;  2ZEN A;  3VAT A;  2FT0 A;  2VI7 A;  4M6H A;  2AFW A;  4WWV A;  4ZBG A;  5LRJ A;  2O4H A;  2V8D A;  3ZZI A;  5AG5 A;  2QEC A;  3FYN A;  2VBQ A;  2PJC A;  2X7B A;  3IWW A;  4E2A A;  2HB6 A;  1S7K A;  2I00 A;  2V8V A;  2Y0M A;  4A37 A;  1HDU A;  1VHS A;  2WUU A;  3R9E A;  1WK4 A;  3LD2 A;  4MRI A;  4XNH C;  4NGN A;  1NE9 A;  3PBE A;  3S6K A;  4AVB A;  5HVH A;  2B5G B;  1YVO A;  4YU9 A;  1IIC A;  2XEI A;  3KZW A;  2QIR A;  4U9Z A;  3MRU A;  4UBR A;  2AFS A;  4F0Y A;  2OOT A;  2XEF A;  4DYO A;  2BEI A;  4UF4 A;  5IB0 A;  4UCP A;  5CPA A;  1BPN A;  3DDD A;  1QMU A;  4PSW A;  2P0W A;  3IWG A;  4KLW A;  2CIJ A;  4FBE A;  2POK A;  5IV0 A;  4B5O A;  1Z8T A;  1TIQ A;  3D2M A;  2ZXV A;  3EFA A;  1ZG7 A;  2G0B A;  7CPA A;  4PXC A;  2ZEL A;  4RS2 A;  1Q7L A;  3BI0 A;  4ORF A;  4ZY0 A;  3CXP A;  4CS0 B;  3D3S A;  1LOK A;  3KHZ A;  1P0H A;  2CNS A;  2PIY A;  2P6F A;  5D8N A;  4M6I A;  4PK2 A;  4JYW A;  2Q51 A;  3GUX A;  5HVF A;  5BWA B;  2AFU A;  4CYQ A;  5I4M A;  4C2Y A;  4XPD B;  1LRZ A;  3B3V A;  4OC3 A;  2OZG A;  3H8E A;  2OR4 A;  2V8G A;  1IYK A;  1TKF A;  4ONW A;  4R57 A;  3EO4 A;  4R7M A;  4CGL A;  4CYP A;  3DR6 A;  5HMN A;  2C6G A;  3KHX A;  1TXR A;  4NGT A;  2FL4 A;  3FJU A;  4IF5 A;  4PK3 A;  2CF4 A;  1H8L A;  3IEH A;  4NGM A;  4E0A A;  1M1D A;  2H5M A;  2C1C A;  3TOB A;  2ZEG A;  2D4P A;  2PVW A;  1ON0 A;  1TKJ A;  2HUZ A;  1YRE A;  1ZG8 A;  4JXQ A;  4KOT A;  4L89 A;  3PFO A;  1CP6 A;  4YRH A;  2JBJ A;  4Y49 B;  3FX6 A;  2YND A;  4UEF A;  4OIW A;  2Q43 A;  1Z2L A;  3QAY A;  4IAV A;  3KQZ A;  1CX8 A;  3FEE A;  5CNP A;  4F9V A;  2J8N A;  1S3Z A;  1MK4 A;  3P2F A;  1DTD A;  3FMC A;  2CNM A;  3D67 A;  1U6M A;  4W9Y A;  3GIU A;  2FS5 A;  4OC5 A;  4KS9 A;  1LCP A;  4O23 A;  4Q38 A;  3R9G A;  4QUS A;  2PJ1 A;  4UFW A;  3B3S A;  4JLY A;  3T9Y A;  4JZ0 A;  4CRZ B;  3KKW A;  4KOR A;  5LYL A;  3UY5 A;  5F49 A;  5EMI A;  2ARH A;  4ZY1 A;  3L2N A;  3SHP A;  1CJW A;  3RYO A;  4QB9 A;  1XOV A;  1XRY A;  4B6Z A;  4P4I A;  4CAF A;  2RC4 A;  3S6H A;  2RFH A;  3KI9 A;  1KUY A;  5JH9 A;  1VHO A;  2PQ8 A;  3CDX A;  4JD6 A;  4NGQ A;  4P45 A;  4YGO A;  5LYI A;  2BCO A;  2CY2 A;  1QQ9 A;  4EME A;  5C82 A;  4TWE A;  4II9 A;  1XF8 A;  3D7D A;  2VZY A;  3HUV A;  3NE8 A;  1PCA A;  4M6G A;  4PQA A;  4AG7 A;  4C7I A;  5HXD A;  4CGP A;  4B14 A;  2OZH A;  3IC1 A;  4UCN A;  2ZW7 A;  1F2O A;  2PJ0 A;  1DE4 C;  1XBU A;  1Q2Y A;  2PRB A;  4MCQ A;  4X5K A;  3T90 A;  4MXU A;  3D7G A;  1LFW A;  1FNO A;  3DR8 A;  3KL9 A;  1SQH A;  3N5F A;  4B5P B;  1M4D A;  3TC8 A;  4CAX A;  4ZGY B;  2Z10 A;  3D66 A;  4UWI A;  2PJ7 A;  1RO5 A;  3KR4 A;  3R96 A;  5GCN A;  4PXD A;  3ISZ A;  4NCZ A;  4KOW A;  3PBB A;  1PU9 A;  4MHN A;  2YGW A;  4QBJ A;  3B2Y A;  1YLO A;  4KUA A;  3CPA A;  1I21 A;  4A39 A;  3CXQ A;  1ZO0 A;  1AMP A;  3BHX A;  4CYO A;  4CYN A;  5ISV A;  2O53 A;  4CAE A;  4KVX A;  3WT4 A;  2IJZ A;  1TF9 A;  1XIX A;  2PSW A;  4U9Y A;  2PJ5 A;  2YNC C;  3TFY A;  3GYA A;  4FAI A;  4IHM A;  2AFO A;  4WJB A;  3RNZ A;  4CGO A;  2B3V A;  3VH9 A;  3K2K A;  1GHE A;  3FH4 A;  4F6A A;  2QVP A;  3DSB A;  3TCV A;  1ZLH A;  4H89 A;  4OID A;  3B3W A;  3PP9 A;  4RUH A;  2D4O A;  2ZW4 A;  2ZEM A;  3RO0 A;  2DF5 A;  1Y7R A;  2PJ6 A;  4M3S A;  4B10 A;  4EFD A;  6CPA A;  1IU8 A;  4YWY A;  3D7F A;  3KQX A;  2OH1 A;  5LRG A;  1UFH A;  1Z4R A;  3PB7 X;  2I3C A;  3KGQ A;  4AVC A;  8CPA A;  1CPS A;  2GLJ A;  2VQY A;  3MN8 A;  4MHD A;  3IU2 A;  3D8P A;  4MFP A;  4JXR A;  1KUV A;  3K9T A;  4HNX B;  4LX9 A;  1MJB A;  1PUA A;  2ZEO A;  5G21 A;  2AJ6 A;  3R9F A;  2O28 A;  4P4J A;  4B11 A;  1EE3 P;  1CM0 A;  3NH8 A;  1VKC A;  3IU1 A;  3PB8 X;  4B13 A;  4UIA A;  2ZED A;  3FF3 A;  4UEE A;  2REE A;  2OB0 A;  2V8H A;  3E0K A;  2ZEE A;  1ELM P;  3DLJ A;  4A38 A;  4EVY A;  2R98 A;  4RI1 A;  3V7Z A;  3H5Z A;  1BO4 A;  1YW4 A;  2ZW5 A;  5DS0 A;  4MJ8 A;  4X2T A;  2ZW6 A;  4OAE A;  4CGM A;  2B4D A;  2ANP A;  3DGV A;  1LAM A;  2DXQ A;  2NYQ A;  2Z3P A;  1V0C A;  2GU2 A;  3F5B A;  3K9U A;  3QB8 A;  4K3N A;  4KSI A;  2PC1 A;  2VZZ A;  2REF A;  5DWM A;  1KZF A;  4MCR A;  4QC6 A;  2FVG A;  4EWT A;  2BUE A;  1Z9U A;  3HLP A;  4F9U A;  4NXY A;  2Q0Y A;  1AUG A;  1IY7 A;  2ATR A;  4FD4 A;  4FUU A;  3S6F A;  2GAN A;  3TE4 A;  1CP7 A;  4MI4 A;  5JQ4 A; 
#chains in the Genus database with same CATH homology
 5K8N A;  2JEW A;  1TF8 A;  2C6C A;  4NJR A;  3B3T A;  4Q7A A;  3PB9 X;  4OC1 A;  4NJQ A;  4PXB A;  5K8M A;  1ELL P;  3KAS A;  3TX8 A;  3B3C A;  3RAM A;  3SJF A;  2EK8 A;  2ZOF A;  4P4D A;  4OC2 A;  4UEZ A;  2IMO A;  1R3N A;  1R43 A;  1HDQ A;  2PCU A;  3RZA A;  4OC0 A;  1IGB A;  4R6T A;  3KR5 A;  4MHY A;  1NSA A;  2AFZ A;  4NGP A;  3IO1 A;  1Y7E A;  1TKH A;  4ZY2 A;  1FT7 A;  2PJ8 A;  4P6Y A;  4UIB A;  3WAB A;  4F8Z A;  4Z65 A;  3CPX A;  4P44 A;  3GLJ A;  2PJ3 A;  3B7I A;  4ZX9 A;  4X8I A;  2F8H A;  3WC5 A;  1BLL E;  4MCS A;  3SJE A;  1LAP A;  4MCP A;  5JGF A;  2Q4Z A;  4FWU A;  1JQG A;  2PE3 A;  1F57 A;  5JM6 A;  1UWY A;  4MHZ A;  4R8F A;  2JBK A;  3D7H A;  2BOA A;  3WC6 A;  2RB7 A;  4TNU A;  4P4B A;  2IQ6 A;  1XFO A;  3LMS A;  4AXV A;  2PJ2 A;  1YME A;  5IB9 A;  3S9M A;  2J9A A;  2ZEF A;  4NGS A;  3PRT A;  4MMO A;  2AFX A;  3FVL A;  2PIZ A;  3IJ3 A;  2XEJ A;  4P4F A;  4ZI6 A;  4P10 A;  1YSJ A;  1VHE A;  5LRK A;  1Y0Y A;  3B35 A;  4P4E A;  4DUK A;  3H8F A;  3RBU A;  5K8P A;  1XJO A;  2C6P A;  1GYT A;  4MHP A;  4DJL A;  5CBM A;  5LYF A;  1CBX A;  3BI1 A;  1AYE A;  2VL1 A;  2WYR A;  3NFZ A;  2ZEH A;  3S9L A;  2PRQ A;  3PEI A;  3WC7 A;  4PPZ A;  1VIX A;  3VAR A;  1Y0R A;  1ZG9 A;  5J1Q A;  3SI1 A;  1BAV A;  1F2P A;  5THW A;  4CPA A;  4OKO A;  1CG2 A;  3GB0 A;  3D4U A;  2PJB A;  2CTB A;  4ZYQ A;  1PYT B;  2NSM A;  4OC4 A;  3FEC A;  3IIB A;  1VGY A;  2ZEP A;  3IFE A;  1OBR A;  3V38 A;  2HC9 A;  1ARM A;  3SJX A;  2PJ4 A;  2XEG A;  4R76 A;  2PVV A;  4LQG A;  3BXM A;  1HEE A;  3SI2 A;  3FED A;  2GLF A;  2EWB A;  2F7V A;  4IK2 A;  3PB6 X;  3S9N A;  3SI0 A;  4X3R A;  3ISX A;  3PB4 X;  4A94 A;  1ZLI A;  1CPX A;  2QJ8 A;  4BD9 A;  1Z8L A;  2G9D A;  1Z5R A;  4PXE A;  2GRE A;  3SJG A;  2WZN A;  4OME A;  4OP4 A;  5ELY A;  4ZX8 A;  4NFR A;  1YW6 A;  2CTC A;  3I1U A;  5F09 A;  3D68 A;  2EK9 A;  2BO9 A;  1RTQ A;  1ARL A;  1LAN A;  1KWM A;  3LWU A;  1M4L A;  3NH5 A;  2AFM A;  2QYV A;  3H8G A;  4NGR A;  2V77 A;  4GM5 A;  3QNV A;  2DEA A;  3T8W A;  3CT9 A;  5D29 A;  5HVG A;  3NH4 A;  2ABZ A;  4G1P A;  3NA6 A;  3PFE A;  5K8O A;  5LYD A;  3JRU A;  1XMB A;  1BPM A;  4H2K A;  2PJA A;  2ZOG A;  2PJ9 A;  2ZEN A;  3VAT A;  4WWV A;  2AFW A;  5LRJ A;  2O4H A;  2V8D A;  2PJC A;  3IWW A;  2HB6 A;  2V8V A;  4A37 A;  1HDU A;  4MRI A;  4NGN A;  3PBE A;  5HVH A;  4YU9 A;  3KZW A;  2XEI A;  3MRU A;  2AFS A;  2OOT A;  2XEF A;  4DYO A;  4UF4 A;  5CPA A;  1BPN A;  1QMU A;  4FBE A;  2CIJ A;  2POK A;  1ZG7 A;  7CPA A;  4PXC A;  2ZEL A;  1Q7L A;  3BI0 A;  4ZY0 A;  1LOK A;  3KHZ A;  2PIY A;  5D8N A;  4JYW A;  2Q51 A;  3GUX A;  5HVF A;  2AFU A;  5I4M A;  3B3V A;  4OC3 A;  3H8E A;  2OR4 A;  2V8G A;  1TKF A;  4ONW A;  4R7M A;  2C6G A;  3KHX A;  1TXR A;  4NGT A;  3FJU A;  2CF4 A;  1H8L A;  3IEH A;  4NGM A;  2C1C A;  2ZEG A;  2PVW A;  1TKJ A;  1ZG8 A;  3PFO A;  1CP6 A;  2JBJ A;  3FX6 A;  4UEF A;  4OIW A;  2Q43 A;  1Z2L A;  4IAV A;  3KQZ A;  1CX8 A;  3FEE A;  4F9V A;  1DTD A;  3FMC A;  3D67 A;  4W9Y A;  4OC5 A;  1LCP A;  4O23 A;  2PJ1 A;  3B3S A;  4JZ0 A;  5LYL A;  4ZY1 A;  3L2N A;  1XRY A;  4B6Z A;  4P4I A;  2RFH A;  3KI9 A;  5JH9 A;  1VHO A;  3CDX A;  5LYI A;  4NGQ A;  4P45 A;  4EME A;  2BCO A;  1QQ9 A;  4TWE A;  3D7D A;  3HUV A;  5HXD A;  1PCA A;  4PQA A;  3IC1 A;  1F2O A;  2PJ0 A;  4MCQ A;  1XBU A;  1DE4 C;  4MXU A;  3D7G A;  1LFW A;  1FNO A;  3KL9 A;  3N5F A;  3TC8 A;  3D66 A;  2PJ7 A;  3KR4 A;  4PXD A;  3ISZ A;  3PBB A;  4MHN A;  3B2Y A;  1YLO A;  4A39 A;  3CPA A;  1AMP A;  3BHX A;  2O53 A;  3WT4 A;  2IJZ A;  1TF9 A;  2PJ5 A;  4FAI A;  4IHM A;  2AFO A;  4WJB A;  3VH9 A;  3K2K A;  3FH4 A;  2QVP A;  1ZLH A;  4OID A;  3B3W A;  4RUH A;  2ZEM A;  2PJ6 A;  4EFD A;  6CPA A;  4YWY A;  3D7F A;  3KQX A;  5LRG A;  3PB7 X;  2I3C A;  3KGQ A;  8CPA A;  1CPS A;  2GLJ A;  3MN8 A;  3K9T A;  2ZEO A;  4P4J A;  1EE3 P;  3NH8 A;  3PB8 X;  4UIA A;  2ZED A;  3FF3 A;  4UEE A;  2V8H A;  2ZEE A;  1ELM P;  3DLJ A;  4A38 A;  3V7Z A;  5DS0 A;  1YW4 A;  4X2T A;  2ANP A;  3DGV A;  1LAM A;  4K3N A;  2NYQ A;  4KSI A;  2GU2 A;  4MCR A;  2FVG A;  4EWT A;  3HLP A;  4F9U A;  1IY7 A;  4FUU A;  1CP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...