3B3TA

Crystal structure of the d118n mutant of the aminopeptidase from vibrio proteolyticus
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDNASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Bacterial leucyl aminopeptidase
publication title Zinc coordination geometry and ligand binding affinity: the structural and kinetic analysis of the second-shell serine 228 residue and the methionine 180 residue of the aminopeptidase from Vibrio proteolyticus.
pubmed doi rcsb
source organism Vibrio proteolyticus
total genus 111
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2007-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3b3tA00
4O23A 3B3WA 1IGBA 3TC8A 1Z8LA 2EWBA 3IWWA 2C6PA 2AFMA 1TXRA 4OC3A 1PCAA 3BI1A 5F09A 1F57A 5HXDA 2V8GA 4OMEA 2IMOA 4MHZA 2G9DA 4F9VA 4OIWA 4NGTA 3NH5A 1CPSA 3IFEA 3PB6X 5LRKA 5J1QA 4PXBA 5LRGA 4CPAA 3SJFA 3FJUA 4MHNA 3I1UA 3RZAA 3SI1A 2PVVA 3GUXA 1LAPA 2PJ5A 5LYFA 1LFWA 2IJZA 2QVPA 3N5FA 3TX8A 4ZY2A 2PJAA 1ELLP 2AFUA 3KL9A 2CIJA 5HVFA 4NGMA 4EFDA 2ZEHA 2DEAA 3NA6A 3D7HA 4NGQA 2FVGA 2JEWA 3K9TA 4OIDA 3CDXA 2PCUA 4P4BA 3GLJA 4H2KA 2CTBA 4KSIA 3D7DA 4YWYA 4P10A 3SJGA 1YMEA 2AFOA 3WABA 2GU2A 3WC5A 3CPXA 3FF3A 3FEDA 4NGNA 2I3CA 4OC2A 4OKOA 3IJ3A 4BD9A 3LWUA 4UIBA 4PXCA 1PYTB 3H8GA 2BCOA 4NGPA 1EE3P 1ARMA 4ZY1A 4K3NA 3MRUA 4IK2A 3PB9X 1F2OA 5CBMA 2ZEGA 4UEEA 1CP7A 2WYRA 3K2KA 2ZEOA 2PJBA 2ZOGA 2CTCA 4MMOA 3V7ZA 2GLJA 5THWA 3IO1A 4NGRA 5CPAA 3ISXA 3T8WA 5JGFA 3L2NA 5JM6A 3BXMA 1OBRA 1Y0YA 2AFSA 4PPZA 2RB7A 3NH8A 3D4UA 4JZ0A 3FEEA 2VL1A 4F8ZA 5HVHA 1VHEA 1LANA 2EK9A 4OC5A 4MCRA 4UEZA 4UF4A 2J9AA 2GREA 3H8EA 1TKFA 3PB4X 4F9UA 2NSMA 2PJ1A 4P4FA 1KWMA 1YW4A 4X2TA 3KGQA 1Y7EA 2ZOFA 5K8PA 1Z5RA 4R76A 4ZYQA 1FNOA 2EK8A 3KR4A 4IAVA 3GB0A 3B2YA 3S9NA 2ZEFA 1ZLHA 4R6TA 2O4HA 6CPAA 4DUKA 3PB7X 3PBEA 4FBEA 4MCSA 4OP4A 3CPAA 1R3NA 3VATA 2POKA 1BLLE 4X3RA 3MN8A 2QYVA 5JH9A 1LAMA 5HVGA 4RUHA 4A37A 3D67A 2PRQA 3SJEA 2C6GA 3FVLA 1TKHA 1TF9A 1JQGA 2XEGA 4ZX9A 3D66A 3FECA 4A39A 2XEJA 3FMCA 3KZWA 2ZENA 3KI9A 3FX6A 3KASA 1ARLA 3B3CA 2BOAA 2PIZA 2NYQA 2ZELA 4P4IA 3S9MA 2ZEMA 1YLOA 2ANPA 3JRUA 3PFOA 1Z2LA 4P4DA 2OR4A 5K8NA 4UEFA 2QJ8A 3RBUA 5LYDA 1CPXA 4YU9A 4Z65A 4R7MA 2F8HA 2C1CA 4P4JA 3SJXA 4P44A 1YSJA 5D29A 2Q4ZA 1LCPA 4P45A 1XFOA 3BHXA 3DGVA 2PJ8A 2V8HA 1BPNA 1ELMP 2ABZA 3IEHA 1XJOA 3NFZA 2PJCA 2GLFA 1RTQA 1CBXA 3PFEA 4PQAA 1HDUA 3B7IA 3VH9A 5DS0A 3LMSA 3KHZA 3QNVA 2HC9A 1F2PA 3IIBA 1GYTA 5LYIA 5D8NA 3B3SA 4TNUA 3VARA 4NGSA 2WZNA 2Q51A 8CPAA 4FWUA 4A38A 2AFZA 5I4MA 4FUUA 5K8MA 1Y0RA 4LQGA 3WC6A 4TWEA 3H8FA 3WC7A 3PBBA 2PJ6A 5ELYA 3B3TA 1VIXA 4MHYA 4JYWA 4P6YA 2OOTA 3KQZA 3KR5A 3CT9A 2ZEPA 4ZX8A 2PJ0A 2PIYA 3SI0A 3HLPA 3ISZA 4OC1A 7CPAA 2AFXA 1H8LA 1QQ9A 4OC4A 1CX8A 4NFRA 2PJ2A 4DJLA 1FT7A 1AMPA 3IC1A 1TKJA 1XMBA 3FH4A 4A94A 1HDQA 4B6ZA 2PJ7A 3PRTA 1UWYA 3B3VA 4P4EA 2Q43A 4ONWA 1R43A 2XEFA 2ZEDA 3D68A 4R8FA 5LRJA 4AXVA 1LOKA 2JBKA 3KHXA 4OC0A 4WJBA 4MHPA 4NJRA 2PJ3A 1IY7A 1M4LA 3BI0A 1ZG9A 5IB9A 1CP6A 4Q7AA 3V38A 3RAMA 2IQ6A 2HB6A 2V8VA 1CG2A 1XBUA 4FAIA 2AFWA 2PE3A 3DLJA 3KQXA 2XEIA 4MXUA 1QMUA 1NSAA 4MCPA 3D7GA 3PEIA 4IHMA 1ZG8A 1YW6A 2CF4A 2F7VA 2V77A 1XRYA 2PJ9A 1Q7LA 1ZG7A 4MCQA 3D7FA 2PVWA 4G1PA 1VGYA 3HUVA 1HEEA 2RFHA 1TF8A 4NJQA 4DYOA 4ZI6A 4WWVA 5K8OA 4GM5A 2V8DA 4ZY0A 2PJ4A 4PXDA 1AYEA 3WT4A 4MRIA 4PXEA 1VHOA 4X8IA 5LYLA 2O53A 3PB8X 3SI2A 4EWTA 1DE4C 3NH4A 2JBJA 1BAVA 1DTDA 2C6CA 4UIAA 4W9YA 2BO9A 3B35A 4EMEA 1ZLIA 1BPMA 3S9LA 2ZEEA
chains in the Genus database with same CATH superfamily
4XPKA 4O23A 3B3WA 2REFA 3D3SA 1IGBA 2O28A 4A2ZA 2REEA 3TC8A 3CZXA 1Z8LA 2EWBA 4PSXA 4RI1A 3IWWA 4FD4A 4Q36A 1KUVA 2C6PA 3RO0A 2AFMA 2FIWA 1TXRA 1Q2CA 4OC3A 1PCAA 1YGHA 3CXQA 3BI1A 4HPSA 5IB0A 5F09A 1F57A 5HXDA 3R96A 1XE4A 2FIAA 2V8GA 2IMOA 4NEXA 4OMEA 4MHZA 2G9DA 4UCPA 2I79A 2Q04A 2VZYA 4UWJA 4F9VA 4NSQA 1A2ZA 4OIWA 5AG6A 4FD5A 3LD2A 4NGTA 5IV0A 3NH5A 1RO5A 1CPSA 1TIQA 1M44A 2B5GB 3H5ZA 3IFEA 3PB6X 5LRKA 4Y49B 5J1QA 2ZXVA 4LQ6A 1QSMA 4PXBA 3MGDA 3SXOA 2D4PA 2VBQA 3IGRA 2CNMA 5LRGA 4CYQA 4CPAA 5I0CA 2A4NA 3SJFA 2P6GA 2YNCA 3FJUA 4MHNA 4C7HA 3I1UA 3RZAA 3S6HA 3SI1A 2ZW4A 2PVVA 5DWNA 3GUXA 3C26A 4C68A 3VWEA 1IU8A 1LAPA 2CXAA 2P6FA 1MJ9A 2PJ5A 3EY5A 1LFWA 1S3ZA 2IJZA 2PR1A 4R87A 4UFWA 5LYFA 2QVPA 1Q2YA 1U6MA 2G3AA 3FB3A 3N5FA 3TX8A 3BJ7A 4ZY2A 2PJAA 5G21A 2BEIA 2OU2A 1ELLP 2AFUA 2FXFA 1YQEA 3KL9A 2CIJA 5HVFA 3V8IA 2FCKA 4ZBGA 4NGMA 4EFDA 4DNCA 2ZEHA 2DEAA 5F49A 3NA6A 2P0WA 4CGOA 1X10A 3D7HA 3P2FA 4NGQA 2Q44A 4MFLA 1S7FA 2FVGA 4KLVA 4KVOE 2JEWA 3K9TA 4RS2A 3WR7A 2C27A 1IB1E 2PCUA 2RC4A 3CDXA 3GLJA 2CTBA 3N7ZA 4H2KA 4KSIA 3D7DA 4M85A 4MFKA 2QMLA 3S6FA 4KOSA 4YWYA 4MFPA 4P10A 3SJGA 1YMEA 2JLMA 2AFOA 2VI7A 5J8FA 4MY0A 2Z3OA 5A28A 5ISVA 4C7IA 1GHEA 3WABA 3TE4A 2GU2A 3WC5A 2DPTA 1P0HA 3CPXA 3FF3A 3F8KA 3GY9A 5KTDA 3IU2A 2B58A 3FEDA 2DF5A 4NGNA 2I3CA 4OC2A 4MI4A 1YVKA 4OKOA 2Q7BA 3IJ3A 4BD9A 1P4NA 4ORFA 5G20A 3S6KA 3LWUA 4UIBA 2B3VA 3DR6A 4PXCA 1PYTB 3VWDA 3H8GA 2BCOA 2WUUA 4NGPA 1EE3P 4MHDA 1ARMA 4HKFA 4ZY1A 2P6EA 1S7KA 4U5YA 4KS9A 4K3NA 4Q38A 3MRUA 4IK2A 2B5GA 3PB9X 1F2OA 5CBMA 2ZEGA 4UEEA 1CP7A 5G1ZA 4PSWA 2WYRA 4BMHA 3K2KA 2ZEOA 2PJBA 3TT2A 4AVCA 2CTCA 2ZOGA 3R95A 1UFHA 3NE7A 4MMOA 4KOVA 3V7ZA 2GLJA 4MFZA 5THWA 3IO1A 1Y9WA 4NGRA 5FVJA 5CPAA 3ISXA 3S6GA 3TTHA 1XF8A 3T8WA 5JGFA 3L2NA 5JPHA 5JM6A 2HV2A 1XOVA 3BXMA 4CGNA 1OBRA 4A33A 3FNCA 3W6XA 1Y0YA 5AG5A 4FD7A 2AFSA 2R98A 4PPZA 2RB7A 3NH8A 1WK4A 3D4UA 4JZ0A 1QSOA 4AVBA 1KUXA 4F0XA 3FEEA 4E0AA 1IIDA 1MK4A 2VL1A 4ZGYB 4M6HA 4F8ZA 5HVHA 1VHEA 1LANA 2FE7A 2EK9A 3NE8A 4OC5A 4U9ZA 4MCRA 1YREA 2R8VA 4C2XA 2YGWA 4UEZA 4UF4A 3D2PA 2J9AA 4UFXA 2GREA 3H8EA 1TKFA 3PB4X 2IL4A 4KSAA 4F9UA 2OH1A 2BSWA 5EBVA 4K30A 4R9MA 2NSMA 2PJ1A 4P4FA 1KWMA 1YW4A 2ZPAA 4X2TA 3KGQA 1Y7EA 2ZOFA 2B4DA 4A95A 2PQ8A 5K8PA 1M4IA 1Z5RA 4R76A 3EC4A 3R9GA 1FNOA 4ZYQA 2EK8A 3FBUA 3KR4A 4H89A 4IAVA 1Q2DA 4CRZB 2J8RA 4JLYA 4C2YA 3GB0A 3B2YA 3S9NA 3PGPA 3W91A 1Y7RA 3CXSA 2ZEFA 3GKRA 5HH1A 1ZLHA 4R6TA 3T9YA 2BL1A 2FL4A 2O4HA 5A27A 6CPAA 4UFVA 4DUKA 3PB7X 4MFJA 2DXQA 3PBEA 2H5MA 3F5BA 4FBEA 4MCSA 3DSBA 3A9LA 5G22A 4OP4A 1YK3A 1QSRA 1Y9KA 2PRBA 3CPAA 4OAEA 2B4BA 1R3NA 3I3GA 2POKA 3VATA 4MJ8A 3TO7A 1BLLE 4X3RA 3MN8A 4B5PB 1Z8WA 4AG7A 2GIVA 2NMTA 2QYVA 3QAHA 5JH9A 1LAMA 5HVGA 1YLEA 3GIUA 4JXQA 3ZJ0A 4F0YA 4RUHA 2YNCC 4CYOA 2B3UA 4UWIA 1IYLA 5GCNA 3D67A 4A37A 3BJ8A 3G8WA 1JWQA 1S7LA 2PRQA 2FT0A 3SJEA 3LACA 1AUGA 2C6GA 3FVLA 4UBRA 4X5KA 1TKHA 4KOWA 4M6GA 1TF9A 1CM0A 1JQGA 2XEGA 4M3SA 2Z0ZA 4ZX9A 4HNXB 2AJ6A 4LX9A 3D66A 4GXHA 4UCMA 3FECA 4A39A 2XEJA 3FMCA 3KZWA 1QSNA 2ODFA 3SXNA 2ZENA 4KOXA 5J8CA 2JDCA 3R9FA 3KI9A 3FX6A 4KZTA 1MJAA 3KASA 1ARLA 4XPDC 2QIRA 3B3CA 4L8AA 5EC4A 2BOAA 2R1IA 2PIZA 2NYQA 4PK2A 2ZELA 3EFAA 3CXPA 3TOAA 3PP9A 4J3GA 4BINA 3UY5A 4PK3A 4P4IA 4CAXA 2Z11A 3D8PA 1YR0A 3S9MA 3E0KA 2ZEMA 1YLOA 4JWPA 2ANPA 3JRUA 3PFOA 1IOIA 5AG4A 4KVME 4A31A 3DNSA 4A32A 1Z2LA 4P4DA 2Q4VA 2VEZA 2OR4A 4HNWB 5K8NA 1S5KA 4UEFA 1Z8TA 2QJ8A 3RBUA 5LYDA 4XNHC 1CPXA 2JEVA 4YU9A 2J8NA 5HMNA 4B5OA 4Z65A 4R7MA 2Z3KA 2F8HA 4II9A 2C1CA 4CGLA 3D2MA 4PV6A 4P4JA 3SJXA 4KORA 4MFQA 3GYAA 1YSJA 4P44A 5D29A 2Q4ZA 1B6BA 1LCPA 4P45A 1XFOA 1ZO0A 3BHXA 2ZW5A 3DGVA 2HQYA 2PJ8A 2V8HA 4B14A 1BPNA 1BOBA 1L0CA 1ELMP 2CNTA 2ABZA 3IEHA 1KZFA 1XJOA 1YVOA 2G3TA 3NFZA 1IYKA 1NSLA 4C2ZA 3F0AA 1V0CA 1M4DA 5C82A 3FIXA 1WWZA 2GLFA 1LRZA 1XEBA 1XMTA 2PJCA 2PSWA 4B13A 1K4JA 5CNPA 3ZZIA 4B10A 3IWEA 1RTQA 1CBXA 4JJXA 3PFEA 3BLNA 4PQAA 5AG7A 5KTCA 1HDUA 3B7IA 3VH9A 4E8OA 5DS0A 3LMSA 3KHZA 3QNVA 4CGMA 3EXNA 1NE9A 2Z3NA 2HC9A 1IOFA 1F2PA 1GYTA 1IICA 3IIBA 5LYIA 4BBHA 5D8NA 3B3SA 4TNUA 3VARA 4XPDB 4NGSA 2WZNA 2G0BA 2Q7SA 3K9UA 4CS0B 2VZZA 2Q51A 8CPAA 4FWUA 4UA3A 5F48A 1B87A 4A38A 4IF5A 4KOUA 2EVNA 2AFZA 5I4MA 2K5TA 4FUUA 4LUAA 5K8MA 5H86A 1X12A 1Y0RA 4LQGA 3WC6A 5BWAB 3RYOA 4TWEA 3H8FA 1OZPA 3WC7A 2VQYA 2WPXA 3PBBA 1QSTA 2PJ6A 4NCZA 5ELYA 2Y0MA 4JXRA 3B3TA 4XNHB 3LODA 1XIXA 2HUZA 4CAWA 4YFJA 1VIXA 4MHYA 4JYWA 4P6YA 2OOTA 1J4JA 4FD6A 3I9SA 2Q4YA 3KQZA 3P2HA 3KR5A 3QAYA 3CT9A 4M6IA 2ZEPA 3JUWA 5E96A 2Q0YA 2KCWA 4ZX8A 2PJ0A 1PU9A 2PIYA 4JD6A 1Z4EA 3SI0A 3HLPA 4KOTA 3ISZA 4OC1A 3FYNA 5AGEA 4CRYB 7CPAA 5KTAA 4R57A 3IU1A 2AFXA 1H8LA 2Z10A 1QQ9A 4OC4A 1CX8A 4NFRA 2OZGA 4QUSA 2PJ2A 4F6AA 2PC1A 4MY3A 4DJLA 1FT7A 1AMPA 3DR8A 1TKJA 1XMBA 3FH4A 3IC1A 4A94A 1FY7A 1HDQA 1I21A 4B6ZA 2PJ7A 2BUEA 3PRTA 4CYPA 1S60A 5C88A 1M4GA 1UWYA 1Z8XA 3B3VA 4P4EA 4R3LA 2Q43A 4ONWA 5DWMA 1R43A 4YGOA 2XEFA 2GFQA 2ZEDA 3TFYA 2OZUA 4NXYA 2AE6A 4OIDA 4AVAA 1Z9UA 3D68A 4QB9A 4R8FA 1VHSA 3DDDA 4UCNA 3TO6A 1M1DA 2QECA 3R1KA 4OLLA 1NMTA 5LRJA 4CAEA 3W6SA 2ARHA 4MBUA 2CY2A 3G3SA 3EO4A 5JQ4A 4AXVA 4KUAA 1ON0A 1LOKA 2ATRA 1YX0A 4L89A 2JBKA 4YRHA 1Z4RA 3IWGA 4KOYA 3KHXA 4OC0A 4A30A 3KKWA 4WJBA 1S7NA 4MHPA 4NJRA 2PJ3A 1IY7A 1R57A 1M4LA 4QC6A 4CAFA 4B12A 1N71A 3BI0A 4HNYB 1ZG9A 4QBJA 3QB8A 3JTKA 1I1DA 2FS5A 1CP6A 4Q7AA 2I00A 5IB9A 4AB7A 3V38A 2EO8A 3T90A 4QVTA 3RAMA 2YNDA 4GS4A 2IQ6A 2HB6A 2V8VA 3FXTA 1CG2A 1XBUA 2B4DB 2D4OA 2X7BA 4FAIA 3TO9A 2AFWA 2PE3A 2CNSA 3DLJA 4AG9A 3H4QA 4RN7A 2EUIA 3KQXA 3OWCA 4R3KA 2XEIA 2VXKA 1QMUA 1NSAA 2YNEA 4MCPA 4MXUA 3D7GA 1I12A 4H6ZA 4P4BA 4E2AA 4KVXA 4EVYA 3PEIA 3PZJA 4IHMA 3TCVA 4CGPA 1ZG8A 2J8MA 4KSFA 1YW6A 4I49A 2CF4A 2F7VA 2V77A 1XRYA 2PJ9A 2FSRA 5F46A 2GANA 3R9EA 1BO4A 1Q7LA 2F5IA 2ZW7A 1ZG7A 2Z3PA 4Y49C 4MCQA 3D7FA 2PVWA 2Z3MA 2WSAA 4G1PA 1VGYA 4B5PA 3HUVA 4CAVA 1CJWA 4ONUA 1PUAA 5IX3A 3TOBA 5H84A 1MJBA 4XPLA 1HEEA 3SHPA 2RFHA 1TF8A 4NJQA 4OADA 4DYOA 4WWVA 4ZI6A 5K8OA 4GM5A 2V8DA 4B11A 4ZY0A 2JDDA 2PDOA 2PJ4A 1AYEA 4PXDA 4MRIA 3WT4A 2DPSA 4PXEA 4U9YA 1VHOA 4KUBA 4X8IA 4NF1A 5LYLA 3B8GA 2O53A 4KLWA 3PB8X 2ZW6A 5EMIA 3SI2A 4IUSA 4EWTA 1DE4C 1VKCA 2GE3A 2JBJA 2OZHA 3NH4A 1BAVA 1KUYA 1DTDA 2C6CA 4UIAA 3RNZA 2OB0A 2EBJA 4W9YA 2BO9A 4H6UA 2WPWA 3JVNA 3FRMA 4CYNA 1SQHA 2Z3LA 1RXTA 1BPMA 1ZLIA 3B35A 5F47A 4EMEA 2ZEEA 3S9LA 2PR8A 2R7HA
chains in the Genus database with same CATH topology
4O23A 3B3WA 1IGBA 3TC8A 1Z8LA 2EWBA 3IWWA 2C6PA 2AFMA 1TXRA 4OC3A 1PCAA 3BI1A 5F09A 1F57A 5HXDA 2V8GA 4OMEA 2IMOA 4MHZA 2G9DA 4F9VA 4OIWA 4NGTA 3NH5A 1CPSA 3IFEA 3PB6X 5LRKA 5J1QA 4PXBA 5LRGA 4CPAA 3SJFA 3FJUA 4MHNA 3I1UA 3RZAA 3SI1A 2PVVA 3GUXA 1LAPA 2PJ5A 5LYFA 1LFWA 2IJZA 2QVPA 3N5FA 3TX8A 4ZY2A 2PJAA 1ELLP 2AFUA 3KL9A 2CIJA 5HVFA 4NGMA 4EFDA 2ZEHA 2DEAA 3NA6A 3D7HA 4NGQA 2FVGA 2JEWA 3K9TA 4OIDA 3CDXA 2PCUA 4P4BA 3GLJA 4H2KA 2CTBA 4KSIA 3D7DA 4YWYA 4P10A 3SJGA 1YMEA 2AFOA 3WABA 2GU2A 3WC5A 3CPXA 3FF3A 3FEDA 4NGNA 2I3CA 4OC2A 4OKOA 3IJ3A 4BD9A 3LWUA 4UIBA 4PXCA 1PYTB 3H8GA 2BCOA 4NGPA 1EE3P 1ARMA 4ZY1A 4K3NA 3MRUA 4IK2A 3PB9X 1F2OA 5CBMA 2ZEGA 4UEEA 1CP7A 2WYRA 3K2KA 2ZEOA 2PJBA 2ZOGA 2CTCA 4MMOA 3V7ZA 2GLJA 5THWA 3IO1A 4NGRA 5CPAA 3ISXA 3T8WA 5JGFA 3L2NA 5JM6A 3BXMA 1OBRA 1Y0YA 2AFSA 4PPZA 2RB7A 3NH8A 3D4UA 4JZ0A 3FEEA 2VL1A 4F8ZA 5HVHA 1VHEA 1LANA 2EK9A 4OC5A 4MCRA 4UEZA 4UF4A 2J9AA 2GREA 3H8EA 1TKFA 3PB4X 4F9UA 2NSMA 2PJ1A 4P4FA 1KWMA 1YW4A 4X2TA 3KGQA 1Y7EA 2ZOFA 5K8PA 1Z5RA 4R76A 4ZYQA 1FNOA 2EK8A 3KR4A 4IAVA 3GB0A 3B2YA 3S9NA 2ZEFA 1ZLHA 4R6TA 2O4HA 6CPAA 4DUKA 3PB7X 3PBEA 4FBEA 4MCSA 4OP4A 3CPAA 1R3NA 3VATA 2POKA 1BLLE 4X3RA 3MN8A 2QYVA 5JH9A 1LAMA 5HVGA 4RUHA 4A37A 3D67A 2PRQA 3SJEA 2C6GA 3FVLA 1TKHA 1TF9A 1JQGA 2XEGA 4ZX9A 3D66A 3FECA 4A39A 2XEJA 3FMCA 3KZWA 2ZENA 3KI9A 3FX6A 3KASA 1ARLA 3B3CA 2BOAA 2PIZA 2NYQA 2ZELA 4P4IA 3S9MA 2ZEMA 1YLOA 2ANPA 3JRUA 3PFOA 1Z2LA 4P4DA 2OR4A 5K8NA 4UEFA 2QJ8A 3RBUA 5LYDA 1CPXA 4YU9A 4Z65A 4R7MA 2F8HA 2C1CA 4P4JA 3SJXA 4P44A 1YSJA 5D29A 2Q4ZA 1LCPA 4P45A 1XFOA 3BHXA 3DGVA 2PJ8A 2V8HA 1BPNA 1ELMP 2ABZA 3IEHA 1XJOA 3NFZA 2PJCA 2GLFA 1RTQA 1CBXA 3PFEA 4PQAA 1HDUA 3B7IA 3VH9A 5DS0A 3LMSA 3KHZA 3QNVA 2HC9A 1F2PA 3IIBA 1GYTA 5LYIA 5D8NA 3B3SA 4TNUA 3VARA 4NGSA 2WZNA 2Q51A 8CPAA 4FWUA 4A38A 2AFZA 5I4MA 4FUUA 5K8MA 1Y0RA 4LQGA 3WC6A 4TWEA 3H8FA 3WC7A 3PBBA 2PJ6A 5ELYA 3B3TA 1VIXA 4MHYA 4JYWA 4P6YA 2OOTA 3KQZA 3KR5A 3CT9A 2ZEPA 4ZX8A 2PJ0A 2PIYA 3SI0A 3HLPA 3ISZA 4OC1A 7CPAA 2AFXA 1H8LA 1QQ9A 4OC4A 1CX8A 4NFRA 2PJ2A 4DJLA 1FT7A 1AMPA 3IC1A 1TKJA 1XMBA 3FH4A 4A94A 1HDQA 4B6ZA 2PJ7A 3PRTA 1UWYA 3B3VA 4P4EA 2Q43A 4ONWA 1R43A 2XEFA 2ZEDA 3D68A 4R8FA 5LRJA 4AXVA 1LOKA 2JBKA 3KHXA 4OC0A 4WJBA 4MHPA 4NJRA 2PJ3A 1IY7A 1M4LA 3BI0A 1ZG9A 5IB9A 1CP6A 4Q7AA 3V38A 3RAMA 2IQ6A 2HB6A 2V8VA 1CG2A 1XBUA 4FAIA 2AFWA 2PE3A 3DLJA 3KQXA 2XEIA 4MXUA 1QMUA 1NSAA 4MCPA 3D7GA 3PEIA 4IHMA 1ZG8A 1YW6A 2CF4A 2F7VA 2V77A 1XRYA 2PJ9A 1Q7LA 1ZG7A 4MCQA 3D7FA 2PVWA 4G1PA 1VGYA 3HUVA 1HEEA 2RFHA 1TF8A 4NJQA 4DYOA 4ZI6A 4WWVA 5K8OA 4GM5A 2V8DA 4ZY0A 2PJ4A 4PXDA 1AYEA 3WT4A 4MRIA 4PXEA 1VHOA 4X8IA 5LYLA 2O53A 3PB8X 3SI2A 4EWTA 1DE4C 3NH4A 2JBJA 1BAVA 1DTDA 2C6CA 4UIAA 4W9YA 2BO9A 3B35A 4EMEA 1ZLIA 1BPMA 3S9LA 2ZEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O23 A;  3B3W A;  1IGB A;  3TC8 A;  1Z8L A;  2EWB A;  3IWW A;  2C6P A;  2AFM A;  1TXR A;  4OC3 A;  1PCA A;  3BI1 A;  5F09 A;  1F57 A;  5HXD A;  2V8G A;  4OME A;  2IMO A;  4MHZ A;  2G9D A;  4F9V A;  4OIW A;  4NGT A;  3NH5 A;  1CPS A;  3IFE A;  3PB6 X;  5LRK A;  5J1Q A;  4PXB A;  5LRG A;  4CPA A;  3SJF A;  3FJU A;  4MHN A;  3I1U A;  3RZA A;  3SI1 A;  2PVV A;  3GUX A;  1LAP A;  2PJ5 A;  5LYF A;  1LFW A;  2IJZ A;  2QVP A;  3N5F A;  3TX8 A;  4ZY2 A;  2PJA A;  1ELL P;  2AFU A;  3KL9 A;  2CIJ A;  5HVF A;  4NGM A;  4EFD A;  2ZEH A;  2DEA A;  3NA6 A;  3D7H A;  4NGQ A;  2FVG A;  2JEW A;  3K9T A;  4OID A;  3CDX A;  2PCU A;  4P4B A;  3GLJ A;  4H2K A;  2CTB A;  4KSI A;  3D7D A;  4YWY A;  4P10 A;  3SJG A;  1YME A;  2AFO A;  3WAB A;  2GU2 A;  3WC5 A;  3CPX A;  3FF3 A;  3FED A;  4NGN A;  2I3C A;  4OC2 A;  4OKO A;  3IJ3 A;  4BD9 A;  3LWU A;  4UIB A;  4PXC A;  1PYT B;  3H8G A;  2BCO A;  4NGP A;  1EE3 P;  1ARM A;  4ZY1 A;  4K3N A;  3MRU A;  4IK2 A;  3PB9 X;  1F2O A;  5CBM A;  2ZEG A;  4UEE A;  1CP7 A;  2WYR A;  3K2K A;  2ZEO A;  2PJB A;  2ZOG A;  2CTC A;  4MMO A;  3V7Z A;  2GLJ A;  5THW A;  3IO1 A;  4NGR A;  5CPA A;  3ISX A;  3T8W A;  5JGF A;  3L2N A;  5JM6 A;  3BXM A;  1OBR A;  1Y0Y A;  2AFS A;  4PPZ A;  2RB7 A;  3NH8 A;  3D4U A;  4JZ0 A;  3FEE A;  2VL1 A;  4F8Z A;  5HVH A;  1VHE A;  1LAN A;  2EK9 A;  4OC5 A;  4MCR A;  4UEZ A;  4UF4 A;  2J9A A;  2GRE A;  3H8E A;  1TKF A;  3PB4 X;  4F9U A;  2NSM A;  2PJ1 A;  4P4F A;  1KWM A;  1YW4 A;  4X2T A;  3KGQ A;  1Y7E A;  2ZOF A;  5K8P A;  1Z5R A;  4R76 A;  4ZYQ A;  1FNO A;  2EK8 A;  3KR4 A;  4IAV A;  3GB0 A;  3B2Y A;  3S9N A;  2ZEF A;  1ZLH A;  4R6T A;  2O4H A;  6CPA A;  4DUK A;  3PB7 X;  3PBE A;  4FBE A;  4MCS A;  4OP4 A;  3CPA A;  1R3N A;  3VAT A;  2POK A;  1BLL E;  4X3R A;  3MN8 A;  2QYV A;  5JH9 A;  1LAM A;  5HVG A;  4RUH A;  4A37 A;  3D67 A;  2PRQ A;  3SJE A;  2C6G A;  3FVL A;  1TKH A;  1TF9 A;  1JQG A;  2XEG A;  4ZX9 A;  3D66 A;  3FEC A;  4A39 A;  2XEJ A;  3FMC A;  3KZW A;  2ZEN A;  3KI9 A;  3FX6 A;  3KAS A;  1ARL A;  3B3C A;  2BOA A;  2PIZ A;  2NYQ A;  2ZEL A;  4P4I A;  3S9M A;  2ZEM A;  1YLO A;  2ANP A;  3JRU A;  3PFO A;  1Z2L A;  4P4D A;  2OR4 A;  5K8N A;  4UEF A;  2QJ8 A;  3RBU A;  5LYD A;  1CPX A;  4YU9 A;  4Z65 A;  4R7M A;  2F8H A;  2C1C A;  4P4J A;  3SJX A;  4P44 A;  1YSJ A;  5D29 A;  2Q4Z A;  1LCP A;  4P45 A;  1XFO A;  3BHX A;  3DGV A;  2PJ8 A;  2V8H A;  1BPN A;  1ELM P;  2ABZ A;  3IEH A;  1XJO A;  3NFZ A;  2PJC A;  2GLF A;  1RTQ A;  1CBX A;  3PFE A;  4PQA A;  1HDU A;  3B7I A;  3VH9 A;  5DS0 A;  3LMS A;  3KHZ A;  3QNV A;  2HC9 A;  1F2P A;  3IIB A;  1GYT A;  5LYI A;  5D8N A;  3B3S A;  4TNU A;  3VAR A;  4NGS A;  2WZN A;  2Q51 A;  8CPA A;  4FWU A;  4A38 A;  2AFZ A;  5I4M A;  4FUU A;  5K8M A;  1Y0R A;  4LQG A;  3WC6 A;  4TWE A;  3H8F A;  3WC7 A;  3PBB A;  2PJ6 A;  5ELY A;  3B3T A;  1VIX A;  4MHY A;  4JYW A;  4P6Y A;  2OOT A;  3KQZ A;  3KR5 A;  3CT9 A;  2ZEP A;  4ZX8 A;  2PJ0 A;  2PIY A;  3SI0 A;  3HLP A;  3ISZ A;  4OC1 A;  7CPA A;  2AFX A;  1H8L A;  1QQ9 A;  4OC4 A;  1CX8 A;  4NFR A;  2PJ2 A;  4DJL A;  1FT7 A;  1AMP A;  3IC1 A;  1TKJ A;  1XMB A;  3FH4 A;  4A94 A;  1HDQ A;  4B6Z A;  2PJ7 A;  3PRT A;  1UWY A;  3B3V A;  4P4E A;  2Q43 A;  4ONW A;  1R43 A;  2XEF A;  2ZED A;  3D68 A;  4R8F A;  5LRJ A;  4AXV A;  1LOK A;  2JBK A;  3KHX A;  4OC0 A;  4WJB A;  4MHP A;  4NJR A;  2PJ3 A;  1IY7 A;  1M4L A;  3BI0 A;  1ZG9 A;  5IB9 A;  1CP6 A;  4Q7A A;  3V38 A;  3RAM A;  2IQ6 A;  2HB6 A;  2V8V A;  1CG2 A;  1XBU A;  4FAI A;  2AFW A;  2PE3 A;  3DLJ A;  3KQX A;  2XEI A;  4MXU A;  1QMU A;  1NSA A;  4MCP A;  3D7G A;  3PEI A;  4IHM A;  1ZG8 A;  1YW6 A;  2CF4 A;  2F7V A;  2V77 A;  1XRY A;  2PJ9 A;  1Q7L A;  1ZG7 A;  4MCQ A;  3D7F A;  2PVW A;  4G1P A;  1VGY A;  3HUV A;  1HEE A;  2RFH A;  1TF8 A;  4NJQ A;  4DYO A;  4ZI6 A;  4WWV A;  5K8O A;  4GM5 A;  2V8D A;  4ZY0 A;  2PJ4 A;  4PXD A;  1AYE A;  3WT4 A;  4MRI A;  4PXE A;  1VHO A;  4X8I A;  5LYL A;  2O53 A;  3PB8 X;  3SI2 A;  4EWT A;  1DE4 C;  3NH4 A;  2JBJ A;  1BAV A;  1DTD A;  2C6C A;  4UIA A;  4W9Y A;  2BO9 A;  3B35 A;  4EME A;  1ZLI A;  1BPM A;  3S9L A;  2ZEE A; 
#chains in the Genus database with same CATH topology
 4XPK A;  4O23 A;  3B3W A;  2REF A;  3D3S A;  1IGB A;  2O28 A;  4A2Z A;  2REE A;  3TC8 A;  3CZX A;  1Z8L A;  2EWB A;  4PSX A;  4RI1 A;  3IWW A;  4FD4 A;  4Q36 A;  1KUV A;  2C6P A;  3RO0 A;  2AFM A;  2FIW A;  1TXR A;  1Q2C A;  4OC3 A;  1PCA A;  1YGH A;  3CXQ A;  3BI1 A;  4HPS A;  5IB0 A;  5F09 A;  1F57 A;  5HXD A;  3R96 A;  1XE4 A;  2FIA A;  2V8G A;  2IMO A;  4NEX A;  4OME A;  4MHZ A;  2G9D A;  4UCP A;  2I79 A;  2Q04 A;  2VZY A;  4UWJ A;  4F9V A;  4NSQ A;  1A2Z A;  4OIW A;  5AG6 A;  4FD5 A;  3LD2 A;  4NGT A;  5IV0 A;  3NH5 A;  1RO5 A;  1CPS A;  1TIQ A;  1M44 A;  2B5G B;  3H5Z A;  3IFE A;  3PB6 X;  5LRK A;  4Y49 B;  5J1Q A;  2ZXV A;  4LQ6 A;  1QSM A;  4PXB A;  3MGD A;  3SXO A;  2D4P A;  2VBQ A;  3IGR A;  2CNM A;  5LRG A;  4CYQ A;  4CPA A;  5I0C A;  2A4N A;  3SJF A;  2P6G A;  2YNC A;  3FJU A;  4MHN A;  4C7H A;  3I1U A;  3RZA A;  3S6H A;  3SI1 A;  2ZW4 A;  2PVV A;  5DWN A;  3GUX A;  3C26 A;  4C68 A;  3VWE A;  1IU8 A;  1LAP A;  2CXA A;  2P6F A;  1MJ9 A;  2PJ5 A;  3EY5 A;  1LFW A;  1S3Z A;  2IJZ A;  2PR1 A;  4R87 A;  4UFW A;  5LYF A;  2QVP A;  1Q2Y A;  1U6M A;  2G3A A;  3FB3 A;  3N5F A;  3TX8 A;  3BJ7 A;  4ZY2 A;  2PJA A;  5G21 A;  2BEI A;  2OU2 A;  1ELL P;  2AFU A;  2FXF A;  1YQE A;  3KL9 A;  2CIJ A;  5HVF A;  3V8I A;  2FCK A;  4ZBG A;  4NGM A;  4EFD A;  4DNC A;  2ZEH A;  2DEA A;  5F49 A;  3NA6 A;  2P0W A;  4CGO A;  1X10 A;  3D7H A;  3P2F A;  4NGQ A;  2Q44 A;  4MFL A;  1S7F A;  2FVG A;  4KLV A;  4KVO E;  2JEW A;  3K9T A;  4RS2 A;  3WR7 A;  2C27 A;  1IB1 E;  2PCU A;  2RC4 A;  3CDX A;  3GLJ A;  2CTB A;  3N7Z A;  4H2K A;  4KSI A;  3D7D A;  4M85 A;  4MFK A;  2QML A;  3S6F A;  4KOS A;  4YWY A;  4MFP A;  4P10 A;  3SJG A;  1YME A;  2JLM A;  2AFO A;  2VI7 A;  5J8F A;  4MY0 A;  2Z3O A;  5A28 A;  5ISV A;  4C7I A;  1GHE A;  3WAB A;  3TE4 A;  2GU2 A;  3WC5 A;  2DPT A;  1P0H A;  3CPX A;  3FF3 A;  3F8K A;  3GY9 A;  5KTD A;  3IU2 A;  2B58 A;  3FED A;  2DF5 A;  4NGN A;  2I3C A;  4OC2 A;  4MI4 A;  1YVK A;  4OKO A;  2Q7B A;  3IJ3 A;  4BD9 A;  1P4N A;  4ORF A;  5G20 A;  3S6K A;  3LWU A;  4UIB A;  2B3V A;  3DR6 A;  4PXC A;  1PYT B;  3VWD A;  3H8G A;  2BCO A;  2WUU A;  4NGP A;  1EE3 P;  4MHD A;  1ARM A;  4HKF A;  4ZY1 A;  2P6E A;  1S7K A;  4U5Y A;  4KS9 A;  4K3N A;  4Q38 A;  3MRU A;  4IK2 A;  2B5G A;  3PB9 X;  1F2O A;  5CBM A;  2ZEG A;  4UEE A;  1CP7 A;  5G1Z A;  4PSW A;  2WYR A;  4BMH A;  3K2K A;  2ZEO A;  2PJB A;  3TT2 A;  4AVC A;  2CTC A;  2ZOG A;  3R95 A;  1UFH A;  3NE7 A;  4MMO A;  4KOV A;  3V7Z A;  2GLJ A;  4MFZ A;  5THW A;  3IO1 A;  1Y9W A;  4NGR A;  5FVJ A;  5CPA A;  3ISX A;  3S6G A;  3TTH A;  1XF8 A;  3T8W A;  5JGF A;  3L2N A;  5JPH A;  5JM6 A;  2HV2 A;  1XOV A;  3BXM A;  4CGN A;  1OBR A;  4A33 A;  3FNC A;  3W6X A;  1Y0Y A;  5AG5 A;  4FD7 A;  2AFS A;  2R98 A;  4PPZ A;  2RB7 A;  3NH8 A;  1WK4 A;  3D4U A;  4JZ0 A;  1QSO A;  4AVB A;  1KUX A;  4F0X A;  3FEE A;  4E0A A;  1IID A;  1MK4 A;  2VL1 A;  4ZGY B;  4M6H A;  4F8Z A;  5HVH A;  1VHE A;  1LAN A;  2FE7 A;  2EK9 A;  3NE8 A;  4OC5 A;  4U9Z A;  4MCR A;  1YRE A;  2R8V A;  4C2X A;  2YGW A;  4UEZ A;  4UF4 A;  3D2P A;  2J9A A;  4UFX A;  2GRE A;  3H8E A;  1TKF A;  3PB4 X;  2IL4 A;  4KSA A;  4F9U A;  2OH1 A;  2BSW A;  5EBV A;  4K30 A;  4R9M A;  2NSM A;  2PJ1 A;  4P4F A;  1KWM A;  1YW4 A;  2ZPA A;  4X2T A;  3KGQ A;  1Y7E A;  2ZOF A;  2B4D A;  4A95 A;  2PQ8 A;  5K8P A;  1M4I A;  1Z5R A;  4R76 A;  3EC4 A;  3R9G A;  1FNO A;  4ZYQ A;  2EK8 A;  3FBU A;  3KR4 A;  4H89 A;  4IAV A;  1Q2D A;  4CRZ B;  2J8R A;  4JLY A;  4C2Y A;  3GB0 A;  3B2Y A;  3S9N A;  3PGP A;  3W91 A;  1Y7R A;  3CXS A;  2ZEF A;  3GKR A;  5HH1 A;  1ZLH A;  4R6T A;  3T9Y A;  2BL1 A;  2FL4 A;  2O4H A;  5A27 A;  6CPA A;  4UFV A;  4DUK A;  3PB7 X;  4MFJ A;  2DXQ A;  3PBE A;  2H5M A;  3F5B A;  4FBE A;  4MCS A;  3DSB A;  3A9L A;  5G22 A;  4OP4 A;  1YK3 A;  1QSR A;  1Y9K A;  2PRB A;  3CPA A;  4OAE A;  2B4B A;  1R3N A;  3I3G A;  2POK A;  3VAT A;  4MJ8 A;  3TO7 A;  1BLL E;  4X3R A;  3MN8 A;  4B5P B;  1Z8W A;  4AG7 A;  2GIV A;  2NMT A;  2QYV A;  3QAH A;  5JH9 A;  1LAM A;  5HVG A;  1YLE A;  3GIU A;  4JXQ A;  3ZJ0 A;  4F0Y A;  4RUH A;  2YNC C;  4CYO A;  2B3U A;  4UWI A;  1IYL A;  5GCN A;  3D67 A;  4A37 A;  3BJ8 A;  3G8W A;  1JWQ A;  1S7L A;  2PRQ A;  2FT0 A;  3SJE A;  3LAC A;  1AUG A;  2C6G A;  3FVL A;  4UBR A;  4X5K A;  1TKH A;  4KOW A;  4M6G A;  1TF9 A;  1CM0 A;  1JQG A;  2XEG A;  4M3S A;  2Z0Z A;  4ZX9 A;  4HNX B;  2AJ6 A;  4LX9 A;  3D66 A;  4GXH A;  4UCM A;  3FEC A;  4A39 A;  2XEJ A;  3FMC A;  3KZW A;  1QSN A;  2ODF A;  3SXN A;  2ZEN A;  4KOX A;  5J8C A;  2JDC A;  3R9F A;  3KI9 A;  3FX6 A;  4KZT A;  1MJA A;  3KAS A;  1ARL A;  4XPD C;  2QIR A;  3B3C A;  4L8A A;  5EC4 A;  2BOA A;  2R1I A;  2PIZ A;  2NYQ A;  4PK2 A;  2ZEL A;  3EFA A;  3CXP A;  3TOA A;  3PP9 A;  4J3G A;  4BIN A;  3UY5 A;  4PK3 A;  4P4I A;  4CAX A;  2Z11 A;  3D8P A;  1YR0 A;  3S9M A;  3E0K A;  2ZEM A;  1YLO A;  4JWP A;  2ANP A;  3JRU A;  3PFO A;  1IOI A;  5AG4 A;  4KVM E;  4A31 A;  3DNS A;  4A32 A;  1Z2L A;  4P4D A;  2Q4V A;  2VEZ A;  2OR4 A;  4HNW B;  5K8N A;  1S5K A;  4UEF A;  1Z8T A;  2QJ8 A;  3RBU A;  5LYD A;  4XNH C;  1CPX A;  2JEV A;  4YU9 A;  2J8N A;  5HMN A;  4B5O A;  4Z65 A;  4R7M A;  2Z3K A;  2F8H A;  4II9 A;  2C1C A;  4CGL A;  3D2M A;  4PV6 A;  4P4J A;  3SJX A;  4KOR A;  4MFQ A;  3GYA A;  1YSJ A;  4P44 A;  5D29 A;  2Q4Z A;  1B6B A;  1LCP A;  4P45 A;  1XFO A;  1ZO0 A;  3BHX A;  2ZW5 A;  3DGV A;  2HQY A;  2PJ8 A;  2V8H A;  4B14 A;  1BPN A;  1BOB A;  1L0C A;  1ELM P;  2CNT A;  2ABZ A;  3IEH A;  1KZF A;  1XJO A;  1YVO A;  2G3T A;  3NFZ A;  1IYK A;  1NSL A;  4C2Z A;  3F0A A;  1V0C A;  1M4D A;  5C82 A;  3FIX A;  1WWZ A;  2GLF A;  1LRZ A;  1XEB A;  1XMT A;  2PJC A;  2PSW A;  4B13 A;  1K4J A;  5CNP A;  3ZZI A;  4B10 A;  3IWE A;  1RTQ A;  1CBX A;  4JJX A;  3PFE A;  3BLN A;  4PQA A;  5AG7 A;  5KTC A;  1HDU A;  3B7I A;  3VH9 A;  4E8O A;  5DS0 A;  3LMS A;  3KHZ A;  3QNV A;  4CGM A;  3EXN A;  1NE9 A;  2Z3N A;  2HC9 A;  1IOF A;  1F2P A;  1GYT A;  1IIC A;  3IIB A;  5LYI A;  4BBH A;  5D8N A;  3B3S A;  4TNU A;  3VAR A;  4XPD B;  4NGS A;  2WZN A;  2G0B A;  2Q7S A;  3K9U A;  4CS0 B;  2VZZ A;  2Q51 A;  8CPA A;  4FWU A;  4UA3 A;  5F48 A;  1B87 A;  4A38 A;  4IF5 A;  4KOU A;  2EVN A;  2AFZ A;  5I4M A;  2K5T A;  4FUU A;  4LUA A;  5K8M A;  5H86 A;  1X12 A;  1Y0R A;  4LQG A;  3WC6 A;  5BWA B;  3RYO A;  4TWE A;  3H8F A;  1OZP A;  3WC7 A;  2VQY A;  2WPX A;  3PBB A;  1QST A;  2PJ6 A;  4NCZ A;  5ELY A;  2Y0M A;  4JXR A;  3B3T A;  4XNH B;  3LOD A;  1XIX A;  2HUZ A;  4CAW A;  4YFJ A;  1VIX A;  4MHY A;  4JYW A;  4P6Y A;  2OOT A;  1J4J A;  4FD6 A;  3I9S A;  2Q4Y A;  3KQZ A;  3P2H A;  3KR5 A;  3QAY A;  3CT9 A;  4M6I A;  2ZEP A;  3JUW A;  5E96 A;  2Q0Y A;  2KCW A;  4ZX8 A;  2PJ0 A;  1PU9 A;  2PIY A;  4JD6 A;  1Z4E A;  3SI0 A;  3HLP A;  4KOT A;  3ISZ A;  4OC1 A;  3FYN A;  5AGE A;  4CRY B;  7CPA A;  5KTA A;  4R57 A;  3IU1 A;  2AFX A;  1H8L A;  2Z10 A;  1QQ9 A;  4OC4 A;  1CX8 A;  4NFR A;  2OZG A;  4QUS A;  2PJ2 A;  4F6A A;  2PC1 A;  4MY3 A;  4DJL A;  1FT7 A;  1AMP A;  3DR8 A;  1TKJ A;  1XMB A;  3FH4 A;  3IC1 A;  4A94 A;  1FY7 A;  1HDQ A;  1I21 A;  4B6Z A;  2PJ7 A;  2BUE A;  3PRT A;  4CYP A;  1S60 A;  5C88 A;  1M4G A;  1UWY A;  1Z8X A;  3B3V A;  4P4E A;  4R3L A;  2Q43 A;  4ONW A;  5DWM A;  1R43 A;  4YGO A;  2XEF A;  2GFQ A;  2ZED A;  3TFY A;  2OZU A;  4NXY A;  2AE6 A;  4OID A;  4AVA A;  1Z9U A;  3D68 A;  4QB9 A;  4R8F A;  1VHS A;  3DDD A;  4UCN A;  3TO6 A;  1M1D A;  2QEC A;  3R1K A;  4OLL A;  1NMT A;  5LRJ A;  4CAE A;  3W6S A;  2ARH A;  4MBU A;  2CY2 A;  3G3S A;  3EO4 A;  5JQ4 A;  4AXV A;  4KUA A;  1ON0 A;  1LOK A;  2ATR A;  1YX0 A;  4L89 A;  2JBK A;  4YRH A;  1Z4R A;  3IWG A;  4KOY A;  3KHX A;  4OC0 A;  4A30 A;  3KKW A;  4WJB A;  1S7N A;  4MHP A;  4NJR A;  2PJ3 A;  1IY7 A;  1R57 A;  1M4L A;  4QC6 A;  4CAF A;  4B12 A;  1N71 A;  3BI0 A;  4HNY B;  1ZG9 A;  4QBJ A;  3QB8 A;  3JTK A;  1I1D A;  2FS5 A;  1CP6 A;  4Q7A A;  2I00 A;  5IB9 A;  4AB7 A;  3V38 A;  2EO8 A;  3T90 A;  4QVT A;  3RAM A;  2YND A;  4GS4 A;  2IQ6 A;  2HB6 A;  2V8V A;  3FXT A;  1CG2 A;  1XBU A;  2B4D B;  2D4O A;  2X7B A;  4FAI A;  3TO9 A;  2AFW A;  2PE3 A;  2CNS A;  3DLJ A;  4AG9 A;  3H4Q A;  4RN7 A;  2EUI A;  3KQX A;  3OWC A;  4R3K A;  2XEI A;  2VXK A;  1QMU A;  1NSA A;  2YNE A;  4MCP A;  4MXU A;  3D7G A;  1I12 A;  4H6Z A;  4P4B A;  4E2A A;  4KVX A;  4EVY A;  3PEI A;  3PZJ A;  4IHM A;  3TCV A;  4CGP A;  1ZG8 A;  2J8M A;  4KSF A;  1YW6 A;  4I49 A;  2CF4 A;  2F7V A;  2V77 A;  1XRY A;  2PJ9 A;  2FSR A;  5F46 A;  2GAN A;  3R9E A;  1BO4 A;  1Q7L A;  2F5I A;  2ZW7 A;  1ZG7 A;  2Z3P A;  4Y49 C;  4MCQ A;  3D7F A;  2PVW A;  2Z3M A;  2WSA A;  4G1P A;  1VGY A;  4B5P A;  3HUV A;  4CAV A;  1CJW A;  4ONU A;  1PUA A;  5IX3 A;  3TOB A;  5H84 A;  1MJB A;  4XPL A;  1HEE A;  3SHP A;  2RFH A;  1TF8 A;  4NJQ A;  4OAD A;  4DYO A;  4WWV A;  4ZI6 A;  5K8O A;  4GM5 A;  2V8D A;  4B11 A;  4ZY0 A;  2JDD A;  2PDO A;  2PJ4 A;  1AYE A;  4PXD A;  4MRI A;  3WT4 A;  2DPS A;  4PXE A;  4U9Y A;  1VHO A;  4KUB A;  4X8I A;  4NF1 A;  5LYL A;  3B8G A;  2O53 A;  4KLW A;  3PB8 X;  2ZW6 A;  5EMI A;  3SI2 A;  4IUS A;  4EWT A;  1DE4 C;  1VKC A;  2GE3 A;  2JBJ A;  2OZH A;  3NH4 A;  1BAV A;  1KUY A;  1DTD A;  2C6C A;  4UIA A;  3RNZ A;  2OB0 A;  2EBJ A;  4W9Y A;  2BO9 A;  4H6U A;  2WPW A;  3JVN A;  3FRM A;  4CYN A;  1SQH A;  2Z3L A;  1RXT A;  1BPM A;  1ZLI A;  3B35 A;  5F47 A;  4EME A;  2ZEE A;  3S9L A;  2PR8 A;  2R7H A; 
#chains in the Genus database with same CATH homology
 4O23 A;  3B3W A;  1IGB A;  3TC8 A;  1Z8L A;  2EWB A;  3IWW A;  2C6P A;  2AFM A;  1TXR A;  4OC3 A;  1PCA A;  3BI1 A;  5F09 A;  1F57 A;  5HXD A;  2V8G A;  4OME A;  2IMO A;  4MHZ A;  2G9D A;  4F9V A;  4OIW A;  4NGT A;  3NH5 A;  1CPS A;  3IFE A;  3PB6 X;  5LRK A;  5J1Q A;  4PXB A;  5LRG A;  4CPA A;  3SJF A;  3FJU A;  4MHN A;  3I1U A;  3RZA A;  3SI1 A;  2PVV A;  3GUX A;  1LAP A;  2PJ5 A;  5LYF A;  1LFW A;  2IJZ A;  2QVP A;  3N5F A;  3TX8 A;  4ZY2 A;  2PJA A;  1ELL P;  2AFU A;  3KL9 A;  2CIJ A;  5HVF A;  4NGM A;  4EFD A;  2ZEH A;  2DEA A;  3NA6 A;  3D7H A;  4NGQ A;  2FVG A;  2JEW A;  3K9T A;  4OID A;  3CDX A;  2PCU A;  4P4B A;  3GLJ A;  4H2K A;  2CTB A;  4KSI A;  3D7D A;  4YWY A;  4P10 A;  3SJG A;  1YME A;  2AFO A;  3WAB A;  2GU2 A;  3WC5 A;  3CPX A;  3FF3 A;  3FED A;  4NGN A;  2I3C A;  4OC2 A;  4OKO A;  3IJ3 A;  4BD9 A;  3LWU A;  4UIB A;  4PXC A;  1PYT B;  3H8G A;  2BCO A;  4NGP A;  1EE3 P;  1ARM A;  4ZY1 A;  4K3N A;  3MRU A;  4IK2 A;  3PB9 X;  1F2O A;  5CBM A;  2ZEG A;  4UEE A;  1CP7 A;  2WYR A;  3K2K A;  2ZEO A;  2PJB A;  2ZOG A;  2CTC A;  4MMO A;  3V7Z A;  2GLJ A;  5THW A;  3IO1 A;  4NGR A;  5CPA A;  3ISX A;  3T8W A;  5JGF A;  3L2N A;  5JM6 A;  3BXM A;  1OBR A;  1Y0Y A;  2AFS A;  4PPZ A;  2RB7 A;  3NH8 A;  3D4U A;  4JZ0 A;  3FEE A;  2VL1 A;  4F8Z A;  5HVH A;  1VHE A;  1LAN A;  2EK9 A;  4OC5 A;  4MCR A;  4UEZ A;  4UF4 A;  2J9A A;  2GRE A;  3H8E A;  1TKF A;  3PB4 X;  4F9U A;  2NSM A;  2PJ1 A;  4P4F A;  1KWM A;  1YW4 A;  4X2T A;  3KGQ A;  1Y7E A;  2ZOF A;  5K8P A;  1Z5R A;  4R76 A;  4ZYQ A;  1FNO A;  2EK8 A;  3KR4 A;  4IAV A;  3GB0 A;  3B2Y A;  3S9N A;  2ZEF A;  1ZLH A;  4R6T A;  2O4H A;  6CPA A;  4DUK A;  3PB7 X;  3PBE A;  4FBE A;  4MCS A;  4OP4 A;  3CPA A;  1R3N A;  3VAT A;  2POK A;  1BLL E;  4X3R A;  3MN8 A;  2QYV A;  5JH9 A;  1LAM A;  5HVG A;  4RUH A;  4A37 A;  3D67 A;  2PRQ A;  3SJE A;  2C6G A;  3FVL A;  1TKH A;  1TF9 A;  1JQG A;  2XEG A;  4ZX9 A;  3D66 A;  3FEC A;  4A39 A;  2XEJ A;  3FMC A;  3KZW A;  2ZEN A;  3KI9 A;  3FX6 A;  3KAS A;  1ARL A;  3B3C A;  2BOA A;  2PIZ A;  2NYQ A;  2ZEL A;  4P4I A;  3S9M A;  2ZEM A;  1YLO A;  2ANP A;  3JRU A;  3PFO A;  1Z2L A;  4P4D A;  2OR4 A;  5K8N A;  4UEF A;  2QJ8 A;  3RBU A;  5LYD A;  1CPX A;  4YU9 A;  4Z65 A;  4R7M A;  2F8H A;  2C1C A;  4P4J A;  3SJX A;  4P44 A;  1YSJ A;  5D29 A;  2Q4Z A;  1LCP A;  4P45 A;  1XFO A;  3BHX A;  3DGV A;  2PJ8 A;  2V8H A;  1BPN A;  1ELM P;  2ABZ A;  3IEH A;  1XJO A;  3NFZ A;  2PJC A;  2GLF A;  1RTQ A;  1CBX A;  3PFE A;  4PQA A;  1HDU A;  3B7I A;  3VH9 A;  5DS0 A;  3LMS A;  3KHZ A;  3QNV A;  2HC9 A;  1F2P A;  3IIB A;  1GYT A;  5LYI A;  5D8N A;  3B3S A;  4TNU A;  3VAR A;  4NGS A;  2WZN A;  2Q51 A;  8CPA A;  4FWU A;  4A38 A;  2AFZ A;  5I4M A;  4FUU A;  5K8M A;  1Y0R A;  4LQG A;  3WC6 A;  4TWE A;  3H8F A;  3WC7 A;  3PBB A;  2PJ6 A;  5ELY A;  3B3T A;  1VIX A;  4MHY A;  4JYW A;  4P6Y A;  2OOT A;  3KQZ A;  3KR5 A;  3CT9 A;  2ZEP A;  4ZX8 A;  2PJ0 A;  2PIY A;  3SI0 A;  3HLP A;  3ISZ A;  4OC1 A;  7CPA A;  2AFX A;  1H8L A;  1QQ9 A;  4OC4 A;  1CX8 A;  4NFR A;  2PJ2 A;  4DJL A;  1FT7 A;  1AMP A;  3IC1 A;  1TKJ A;  1XMB A;  3FH4 A;  4A94 A;  1HDQ A;  4B6Z A;  2PJ7 A;  3PRT A;  1UWY A;  3B3V A;  4P4E A;  2Q43 A;  4ONW A;  1R43 A;  2XEF A;  2ZED A;  3D68 A;  4R8F A;  5LRJ A;  4AXV A;  1LOK A;  2JBK A;  3KHX A;  4OC0 A;  4WJB A;  4MHP A;  4NJR A;  2PJ3 A;  1IY7 A;  1M4L A;  3BI0 A;  1ZG9 A;  5IB9 A;  1CP6 A;  4Q7A A;  3V38 A;  3RAM A;  2IQ6 A;  2HB6 A;  2V8V A;  1CG2 A;  1XBU A;  4FAI A;  2AFW A;  2PE3 A;  3DLJ A;  3KQX A;  2XEI A;  4MXU A;  1QMU A;  1NSA A;  4MCP A;  3D7G A;  3PEI A;  4IHM A;  1ZG8 A;  1YW6 A;  2CF4 A;  2F7V A;  2V77 A;  1XRY A;  2PJ9 A;  1Q7L A;  1ZG7 A;  4MCQ A;  3D7F A;  2PVW A;  4G1P A;  1VGY A;  3HUV A;  1HEE A;  2RFH A;  1TF8 A;  4NJQ A;  4DYO A;  4ZI6 A;  4WWV A;  5K8O A;  4GM5 A;  2V8D A;  4ZY0 A;  2PJ4 A;  4PXD A;  1AYE A;  3WT4 A;  4MRI A;  4PXE A;  1VHO A;  4X8I A;  5LYL A;  2O53 A;  3PB8 X;  3SI2 A;  4EWT A;  1DE4 C;  3NH4 A;  2JBJ A;  1BAV A;  1DTD A;  2C6C A;  4UIA A;  4W9Y A;  2BO9 A;  3B35 A;  4EME A;  1ZLI A;  1BPM A;  3S9L A;  2ZEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...