3B3TA

Crystal structure of the d118n mutant of the aminopeptidase from vibrio proteolyticus
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
291
structure length
291
Chain Sequence
MPPITQQATVTAWLPQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYNQKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDNASGIAAVTEVIRVLSENNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFITDYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPRIHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial leucyl aminopeptidase
publication title Zinc coordination geometry and ligand binding affinity: the structural and kinetic analysis of the second-shell serine 228 residue and the methionine 180 residue of the aminopeptidase from Vibrio proteolyticus.
pubmed doi rcsb
source organism Vibrio proteolyticus
molecule tags Hydrolase
total genus 111
structure length 291
sequence length 291
ec nomenclature ec 3.4.11.10: Bacterial leucyl aminopeptidase.
pdb deposition date 2007-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3b3tA00
4NGQA 4ZX9A 4ZI6A 2AFOA 1F2OA 1VHOA 2CIJA 1LFWA 1XBUA 3B7IA 2BOAA 4P6YA 1ZG9A 3BHXA 4X2TA 5LYIA 1KWMA 2CTBA 4UF4A 3IFEA 1PYTB 4FUUA 4A39A 3SI2A 2V8VA 2XEGA 4PXCA 2WZNA 2ZENA 3WC7A 1BLLE 1DTDA 4OIDA 3GUXA 3D7GA 2PJ3A 1UWYA 2ZEOA 4MMOA 1GYTA 1XRYA 4NJRA 1ZLHA 1YW6A 2XEJA 4B6ZA 3D7DA 4NGRA 3FJUA 1AMPA 1CP6A 2ZOGA 5LYFA 1EE3P 2PJAA 1YLOA 4UIBA 1NSAA 3ISZA 5JGFA 5HXDA 1HDQA 6CPAA 2GU2A 1QMUA 3H8FA 3S9LA 8CPAA 2PJ7A 4X8IA 1YW4A 1XMBA 2ZEPA 3B3CA 4MCPA 4IHMA 1ZLIA 3KASA 5K8PA 1JQGA 2PRQA 4OC3A 3PB7X 3NH8A 1DE4C 3I1UA 3IEHA 5LRJA 5LYLA 1F2PA 3FVLA 3FECA 5K8OA 5F09A 3TX8A 2C6GA 2EK9A 4IAVA 1IY7A 4P10A 1CG2A 1TXRA 2NYQA 2PJBA 2OR4A 4MXUA 4RUHA 2JBKA 3K9TA 1ZG8A 2C6PA 3JRUA 3H8EA 1R3NA 3VH9A 5K8NA 4UEZA 5HVGA 2VL1A 3NFZA 2ZELA 3FH4A 2BO9A 1BPNA 4NGPA 1Z8LA 1XFOA 2AFZA 1RTQA 4K3NA 3S9MA 3FEDA 2XEIA 2ABZA 2JEWA 2IJZA 4OIWA 4ZY2A 3IO1A 2GLFA 2PIZA 1ELLP 3PB6X 2PJ6A 5THWA 5ELYA 4AXVA 4OMEA 4H2KA 2ZEMA 3H8GA 3CDXA 4ZY0A 4MRIA 4NGSA 4X3RA 3SJXA 3KGQA 2Q43A 3GB0A 4MHNA 3VARA 2PE3A 3NA6A 2C1CA 3B3WA 3KQZA 3D7HA 3SJEA 3KQXA 3V7ZA 5HVFA 1TF8A 3KHZA 2EK8A 2OOTA 4YWYA 1BPMA 4P4EA 4W9YA 4LQGA 3BXMA 4ONWA 3SJGA 2PVWA 3WC5A 4PXBA 4O23A 3WC6A 4JZ0A 3DLJA 4JYWA 3D4UA 5CBMA 1ELMP 4DJLA 3HUVA 1Q7LA 2IQ6A 3KZWA 4F9UA 1Y7EA 2AFSA 3PRTA 1ZG7A 2PJ4A 4NGMA 2Q51A 3PB8X 4EFDA 3VATA 3FEEA 4YU9A 1TF9A 4BD9A 1TKJA 2ANPA 3DGVA 3KR5A 1CP7A 2ZEEA 3IC1A 4TNUA 4NFRA 2O53A 3TC8A 3IWWA 4R76A 2NSMA 4P44A 2DEAA 2RFHA 4IK2A 1LAMA 3B35A 3B3VA 4P4DA 1LOKA 1OBRA 1LAPA 2G9DA 3ISXA 5CPAA 3V38A 3B2YA 3D66A 3BI0A 4OP4A 4Z65A 3K2KA 3MN8A 4Q7AA 3RBUA 1LANA 3CPXA 3PFOA 1H8LA 2GLJA 4P4IA 1R43A 2CTCA 1ARMA 5LYDA 3MRUA 3QNVA 2CF4A 2V8HA 4WJBA 4PXDA 1CBXA 3B3TA 4ZX8A 3PEIA 1CPSA 3SI0A 2PJCA 2POKA 4MCQA 2XEFA 4FBEA 1FT7A 1M4LA 4MCRA 3RAMA 5LRGA 3CPAA 4MHYA 1TKHA 1TKFA 4F8ZA 2GREA 3N5FA 4PPZA 4UIAA 3RZAA 4FWUA 5IB9A 3HLPA 3LMSA 4OC2A 3CT9A 2AFUA 4R6TA 3PB4X 2WYRA 4MCSA 1Z2LA 4WWVA 4PQAA 1F57A 2PJ1A 4R8FA 5K8MA 3D67A 3D68A 2F7VA 1VIXA 4UEEA 3S9NA 4MHZA 2QVPA 2FVGA 3SJFA 3LWUA 4P4BA 3WT4A 2HB6A 4OC5A 2ZEDA 3IIBA 1FNOA 3PB9X 1Z5RA 3L2NA 1IGBA 4TWEA 5JM6A 1CX8A 3GLJA 3KR4A 1XJOA 1HEEA 3KL9A 2PJ0A 2Q4ZA 5I4MA 2QYVA 1QQ9A 1YMEA 4A37A 1AYEA 4PXEA 3IJ3A 2ZOFA 4ZY1A 4A94A 2J9AA 5D29A 2PJ9A 2V8DA 3FMCA 4EWTA 2PJ5A 2RB7A 4MHPA 1Y0RA 1LCPA 2O4HA 3SI1A 2ZEHA 4A38A 7CPAA 4ZYQA 4OC1A 2AFWA 4P45A 5DS0A 3NH4A 2V8GA 3T8WA 4EMEA 2IMOA 1VGYA 2PVVA 3PBBA 3PFEA 4NJQA 4DUKA 3PBEA 1PCAA 4NGNA 1CPXA 3FF3A 4CPAA 4OKOA 2EWBA 1HDUA 2HC9A 4P4FA 3KI9A 1VHEA 4P4JA 3BI1A 4UEFA 3D7FA 5HVHA 4OC0A 4R7MA 2ZEFA 2BCOA 2F8HA 3FX6A 1ARLA 1YSJA 4G1PA 5LRKA 2JBJA 3B3SA 1BAVA 3KHXA 4F9VA 2AFXA 5J1QA 2V77A 3WABA 2AFMA 2QJ8A 4KSIA 2ZEGA 4GM5A 4DYOA 1Y0YA 2PJ8A 5JH9A 4NGTA 2PCUA 3NH5A 5D8NA 2PJ2A 4FAIA 2C6CA 2PIYA 2I3CA 4OC4A
chains in the Genus database with same CATH superfamily
4NGQA 1NMTA 4ZX9A 4ZI6A 4ONUA 2AFOA 1F2OA 1S3ZA 1VHOA 2ZW5A 3NE7A 1QSMA 4F0XA 2CIJA 2REFA 4JD6A 1LFWA 1R57A 3D8PA 4MHDA 1XBUA 2ODFA 3B7IA 1WK4A 2BOAA 4P6YA 1ZG9A 3BHXA 4QBJA 1MJBA 4X2TA 5LYIA 4B14A 1KWMA 2CTBA 3TO7A 2P6GA 3IFEA 4UF4A 5AG4A 4Y49C 1PYTB 2F5IA 4FUUA 4MBUA 2FCKA 4A39A 2BUEA 3SI2A 1Z8XA 4R87A 2V8VA 2XEGA 3EY5A 3BLNA 2WZNA 4PXCA 2Q0YA 1MJ9A 2ZENA 3WC7A 1DTDA 1BLLE 4OIDA 2ZW4A 3TOBA 3GUXA 2P6FA 3D7GA 2PJ3A 1UWYA 2OZUA 2PRBA 2ZEOA 2B58A 4MMOA 1IICA 1GYTA 4HNXB 1XRYA 1NE9A 2VBQA 2Q4YA 4NJRA 3T90A 4C7HA 1ZLHA 1YW6A 2XEJA 3JUWA 3TO6A 2GIVA 3D7DA 4B6ZA 1X10A 4BMHA 4NGRA 2VZZA 3DR6A 3FJUA 1AMPA 1CP6A 2ZOGA 4JLYA 4Q38A 1EE3P 2PJAA 3RO0A 5LYFA 1S60A 2O28A 2Z3KA 3TTHA 5KTAA 1YLOA 2A4NA 3P2HA 3H5ZA 5G21A 4UIBA 4CS0B 1NSAA 4B5OA 3ISZA 4MFLA 4U9ZA 5JGFA 5HXDA 1HDQA 6CPAA 2GU2A 1QMUA 3H8FA 3JTKA 4R57A 4UFVA 3S9LA 5AG5A 1RXTA 4U9YA 5G22A 8CPAA 2PJ7A 3R9GA 4X8IA 1YW4A 1XMBA 1CJWA 2ZEPA 2Y0MA 3B3CA 4CRZB 4MCPA 4IHMA 4KVOE 4AVBA 3PGPA 1ZLIA 2FE7A 3KASA 5K8PA 2VEZA 1JQGA 4L89A 3TFYA 2PRQA 4OC3A 3PB7X 3NH8A 1DE4C 3I1UA 3S6HA 1Z4RA 3IEHA 2WPXA 5LRJA 3GY9A 5LYLA 2AJ6A 3GIUA 5ISVA 3W6SA 1YGHA 1I12A 1F2PA 2G0BA 3EFAA 3FVLA 3FECA 4CAXA 5F09A 3TX8A 5K8OA 2C6GA 4PK3A 2EK9A 1TIQA 3EC4A 1IY7A 3GKRA 4IAVA 4M3SA 4P10A 1CG2A 2I00A 4UA3A 3DNSA 3OWCA 4R3KA 1TXRA 2NYQA 2PJBA 2OR4A 4MXUA 1SQHA 3TOAA 4M6GA 4RUHA 3A9LA 1YQEA 2JBKA 3K9TA 1ZG8A 2C6PA 2FIAA 4LQ6A 3JRUA 4AG9A 4CYPA 1JWQA 1IU8A 3QAHA 4CAWA 5A27A 5IB0A 1B6BA 1R3NA 3H8EA 2HUZA 3I9SA 5AG6A 3VH9A 4CGMA 4UEZA 4YGOA 2Q44A 5K8NA 1Y9WA 2Q4VA 1Z4EA 4B10A 5HVGA 4MY3A 3P2FA 2VL1A 3D3SA 5F49A 2B3UA 2DF5A 1N71A 2ZELA 2BO9A 3FH4A 3NFZA 1BPNA 4NGPA 1P0HA 1XFOA 1M44A 1RTQA 2AFZA 1Z8LA 1M1DA 2Z3LA 1XEBA 4MFKA 4KSAA 2YGWA 3JVNA 4HPSA 3PZJA 4K3NA 1FY7A 4C2XA 3S9MA 3FEDA 2XEIA 1YLEA 1YREA 2ABZA 3N7ZA 5F48A 1IYKA 3FYNA 2JEWA 2IJZA 4GS4A 4UCPA 4ORFA 5CNPA 2P6EA 2DPSA 5I0CA 3H4QA 4OIWA 4RS2A 4ZY2A 2G3TA 2GLFA 3IO1A 4JJXA 2PIZA 1ELLP 4XNHB 1Z9UA 2AE6A 1X12A 2PJ6A 3PB6X 5THWA 4H89A 5ELYA 5G20A 4OAEA 1J4JA 5EBVA 1AUGA 5FVJA 4AXVA 4OMEA 4H2KA 2ZEMA 3H8GA 1I21A 3CDXA 4H6UA 4B5PB 5HH1A 3WR7A 2G3AA 4A32A 2OB0A 4ZY0A 4MRIA 4ZBGA 4CGNA 2JDDA 4FD4A 1YK3A 5BWAB 4NGSA 4X3RA 3SJXA 2FL4A 3KGQA 4NSQA 4Q36A 4L8AA 1XOVA 2Q43A 3GB0A 2R7HA 4MHNA 3IU1A 3VARA 3CXSA 2ZW6A 2PE3A 3NA6A 3EO4A 4FD6A 1V0CA 2C1CA 3B3WA 3FRMA 3KQZA 3D7HA 4RN7A 3RNZA 3SJEA 3KQXA 4NEXA 3V7ZA 1S7NA 1Q2DA 2PC1A 4PSWA 4FD7A 5HVFA 5F46A 1YVOA 1TF8A 2CNSA 4M85A 4EVYA 4LX9A 2B4DA 3KHZA 2EK8A 1XIXA 2OOTA 4A2ZA 4YWYA 4NXYA 1BPMA 4P4EA 4PV6A 4W9YA 2RC4A 4XPKA 4CGLA 1IOIA 5A28A 4LQGA 1CM0A 3BXMA 2ARHA 5C88A 4UCNA 2B4BA 1KUVA 3VWEA 4KOSA 1IIDA 4ONWA 1YVKA 2D4OA 1U6MA 4AG7A 2OU2A 2X7BA 5KTDA 1ZO0A 3SJGA 4CYQA 2PVWA 3WC5A 2JDCA 4KVXA 4PXBA 4O23A 3NE8A 3TO9A 1L0CA 3WC6A 4JZ0A 2PSWA 2FSRA 3DLJA 1PU9A 2Z3NA 4MY0A 1M4DA 4JYWA 3D4UA 1RO5A 4NF1A 5DWMA 5CBMA 1ELMP 4DJLA 4B5PA 3SXOA 3HUVA 4QUSA 1Q7LA 4JXRA 2IQ6A 1B87A 2Z11A 4UWIA 3R9FA 1QSOA 5C82A 3KZWA 4F9UA 1Y7EA 2AFSA 4CGPA 3PRTA 3R96A 2EUIA 1ZG7A 1S7FA 4A30A 2PJ4A 4NGMA 2Q51A 3PB8X 4EFDA 1XMTA 3S6GA 1ON0A 4XNHC 3VATA 3FB3A 2WSAA 1P4NA 1TF9A 3FEEA 4KORA 4YU9A 4BD9A 2BSWA 2GANA 1TKJA 2CXAA 2ANPA 4QC6A 3DGVA 3KR5A 1CP7A 4KUAA 5AGEA 1QSRA 5KTCA 1KZFA 2ZEEA 3IC1A 2Q7BA 4TNUA 1MK4A 4AVAA 5EC4A 4NFRA 4KSFA 4MFZA 2I79A 3TE4A 2O53A 3TC8A 3IWWA 4QB9A 2J8MA 2K5TA 3S6FA 2EO8A 4R76A 5H86A 4X5KA 4F0YA 2NSMA 2P0WA 4P44A 1XF8A 2DEAA 2RFHA 4IK2A 4IUSA 4MFQA 3W91A 1LAMA 3B35A 4A33A 4PSXA 4A95A 3IGRA 3B3VA 2PQ8A 4P4DA 3F0AA 3CXQA 1LOKA 1OBRA 4HNYB 1LAPA 4KLVA 2G9DA 3ISXA 5CPAA 4IF5A 3V38A 3B2YA 3D66A 3BI0A 4OP4A 4Z65A 3K2KA 3MN8A 3LACA 1I1DA 2FT0A 2Z10A 2YNDA 4CRYB 4Q7AA 1A2ZA 4UBRA 1Q2CA 1MJAA 1QSNA 5E96A 3RBUA 2WUUA 1LANA 3CPXA 3PFOA 3FBUA 1H8LA 3IU2A 2B5GB 4AB7A 4B13A 2GLJA 4P4IA 3ZZIA 4BBHA 1R43A 4DNCA 2CTCA 1ARMA 5LYDA 3LD2A 3I3GA 3MRUA 4C68A 3QNVA 5G1ZA 4CYNA 1UFHA 1Z8TA 2EVNA 4II9A 2ATRA 2CF4A 2V8HA 4OLLA 4WJBA 5EMIA 2Z0ZA 1YR0A 1CBXA 4PXDA 3B3TA 4ZX8A 3PEIA 1CPSA 5F47A 3SI0A 3FXTA 2OZGA 3R9EA 2EBJA 3BJ8A 2QMLA 2ZXVA 2PJCA 4KOYA 2POKA 4MCQA 4ZGYB 2XEFA 4FBEA 1FT7A 5GCNA 1M4LA 4MCRA 4XPDC 3RAMA 2ZW7A 3R95A 2FXFA 5J8FA 4MJ8A 1IOFA 4AVCA 3LODA 5LRGA 4YRHA 4KVME 3CPAA 4MHYA 1TKHA 4KOVA 4QVTA 1TKFA 3G3SA 2GREA 2JLMA 4F8ZA 2PDOA 3IWGA 1GHEA 3N5FA 4PPZA 3DDDA 4UIAA 4KOUA 1Y7RA 3RZAA 4FWUA 4E2AA 3F5BA 5JPHA 4GXHA 2QIRA 5IB9A 4E0AA 2BL1A 3HLPA 3LMSA 4OC2A 3D2MA 4C2YA 4C7IA 5DWNA 3CT9A 2R98A 2AFUA 4R6TA 4KOXA 5J8CA 3PB4X 1Z8WA 3CZXA 4UFXA 2WYRA 4MCSA 4B11A 2B5GA 4KS9A 1Z2LA 1K4JA 4WWVA 4PQAA 1WWZA 3KKWA 1F57A 2Q04A 2OH1A 3RYOA 4PK2A 2R8VA 1M4GA 2PJ1A 5IX3A 2IL4A 3PP9A 1VHSA 4KUBA 2D4PA 4R8FA 5K8MA 2B3VA 3D67A 3D68A 2F7VA 3SXNA 5H84A 4F6AA 1VKCA 2YNCC 2BEIA 4J3GA 1VIXA 2Z3PA 3C26A 3D2PA 4MFPA 2QVPA 4MHZA 4UEEA 3S9NA 2FVGA 3SJFA 4M6IA 5JQ4A 3LWUA 1NSLA 3DR8A 4P4BA 3WT4A 4I49A 2HB6A 3FNCA 4OC5A 1IYLA 2ZEDA 3IIBA 4OADA 1FNOA 3PB9X 1Z5RA 2REEA 3L2NA 4M6HA 3UY5A 3DSBA 2VI7A 3G8WA 3BJ7A 4HKFA 1IGBA 2NMTA 1XE4A 4R9MA 4TWEA 4XPDB 5JM6A 1CX8A 4BINA 3GLJA 3KR4A 1XJOA 3TCVA 2GE3A 2DXQA 1HEEA 3KL9A 4KOTA 2PJ0A 2Q4ZA 2Z3MA 3ZJ0A 2J8NA 5I4MA 1LRZA 2QYVA 2FIWA 1QQ9A 4U5YA 1YMEA 4A37A 3CXPA 4CYOA 4KZTA 4FD5A 3MGDA 3F8KA 1AYEA 4PXEA 2DPTA 3IJ3A 4H6ZA 1Y9KA 2VQYA 2ZOFA 4ZY1A 3EXNA 2HQYA 4A94A 2J9AA 5D29A 2CNMA 2PJ9A 2V8DA 3FMCA 4EWTA 2PJ5A 2RB7A 4CGOA 1S7LA 4MHPA 1Y0RA 2KCWA 4HNWB 1LCPA 2O4HA 3SI1A 1PUAA 2ZEHA 4A38A 7CPAA 2C27A 3GYAA 2PR1A 4UFWA 3SHPA 1YX0A 4ZYQA 4KLWA 4OC1A 2AFWA 4UWJA 1S7KA 4Y49B 4MFJA 3V8IA 2YNEA 4JXQA 4P45A 5DS0A 1BOBA 2WPWA 3K9UA 3TT2A 1BO4A 3NH4A 2FS5A 2V8GA 2J8RA 3T8WA 5IV0A 1M4IA 4A31A 4EMEA 2VXKA 2IMOA 1VGYA 2PVVA 3PBBA 3PFEA 4NJQA 4DUKA 4R3LA 3PBEA 1PCAA 4NGNA 4YFJA 1CPXA 2R1IA 2QECA 3FF3A 4CPAA 2OZHA 4OKOA 2EWBA 1HDUA 2HC9A 4JWPA 3T9YA 2GFQA 4LUAA 2ZPAA 1Q2YA 4P4FA 3KI9A 4E8OA 1OZPA 1VHEA 5AG7A 4P4JA 2PR8A 3BI1A 4UEFA 3D7FA 5HMNA 2CNTA 1KUYA 3S6KA 4OC0A 4R7MA 5HVHA 4CAFA 2ZEFA 3R1KA 2CY2A 2HV2A 3QB8A 2JEVA 2BCOA 2F8HA 3FX6A 1ARLA 3VWDA 1YSJA 2B4DB 3B8GA 4G1PA 2Z3OA 2JBJA 3E0KA 5LRKA 4CAVA 4MI4A 4XPLA 3W6XA 3B3SA 4RI1A 1IB1E 3QAYA 4B12A 1BAVA 3KHXA 4CAEA 4F9VA 2AFXA 1S5KA 4K30A 4NCZA 4UCMA 1KUXA 4C2ZA 5J1QA 2V77A 3WABA 2AFMA 2QJ8A 3IWEA 4KSIA 2ZEGA 2H5MA 4GM5A 4DYOA 4KOWA 1Y0YA 2Q7SA 2PJ8A 5JH9A 4NGTA 2PCUA 1QSTA 2YNCA 3NH5A 5D8NA 2PJ2A 4FAIA 2C6CA 2PIYA 2VZYA 2I3CA 3FIXA 4OC4A
chains in the Genus database with same CATH topology
4NGQA 4ZX9A 4ZI6A 2AFOA 1F2OA 1VHOA 2CIJA 1LFWA 1XBUA 3B7IA 2BOAA 4P6YA 1ZG9A 3BHXA 4X2TA 5LYIA 1KWMA 2CTBA 4UF4A 3IFEA 1PYTB 4FUUA 4A39A 3SI2A 2V8VA 2XEGA 4PXCA 2WZNA 2ZENA 3WC7A 1BLLE 1DTDA 4OIDA 3GUXA 3D7GA 2PJ3A 1UWYA 2ZEOA 4MMOA 1GYTA 1XRYA 4NJRA 1ZLHA 1YW6A 2XEJA 4B6ZA 3D7DA 4NGRA 3FJUA 1AMPA 1CP6A 2ZOGA 5LYFA 1EE3P 2PJAA 1YLOA 4UIBA 1NSAA 3ISZA 5JGFA 5HXDA 1HDQA 6CPAA 2GU2A 1QMUA 3H8FA 3S9LA 8CPAA 2PJ7A 4X8IA 1YW4A 1XMBA 2ZEPA 3B3CA 4MCPA 4IHMA 1ZLIA 3KASA 5K8PA 1JQGA 2PRQA 4OC3A 3PB7X 3NH8A 1DE4C 3I1UA 3IEHA 5LRJA 5LYLA 1F2PA 3FVLA 3FECA 5K8OA 5F09A 3TX8A 2C6GA 2EK9A 4IAVA 1IY7A 4P10A 1CG2A 1TXRA 2NYQA 2PJBA 2OR4A 4MXUA 4RUHA 2JBKA 3K9TA 1ZG8A 2C6PA 3JRUA 3H8EA 1R3NA 3VH9A 5K8NA 4UEZA 5HVGA 2VL1A 3NFZA 2ZELA 3FH4A 2BO9A 1BPNA 4NGPA 1Z8LA 1XFOA 2AFZA 1RTQA 4K3NA 3S9MA 3FEDA 2XEIA 2ABZA 2JEWA 2IJZA 4OIWA 4ZY2A 3IO1A 2GLFA 2PIZA 1ELLP 3PB6X 2PJ6A 5THWA 5ELYA 4AXVA 4OMEA 4H2KA 2ZEMA 3H8GA 3CDXA 4ZY0A 4MRIA 4NGSA 4X3RA 3SJXA 3KGQA 2Q43A 3GB0A 4MHNA 3VARA 2PE3A 3NA6A 2C1CA 3B3WA 3KQZA 3D7HA 3SJEA 3KQXA 3V7ZA 5HVFA 1TF8A 3KHZA 2EK8A 2OOTA 4YWYA 1BPMA 4P4EA 4W9YA 4LQGA 3BXMA 4ONWA 3SJGA 2PVWA 3WC5A 4PXBA 4O23A 3WC6A 4JZ0A 3DLJA 4JYWA 3D4UA 5CBMA 1ELMP 4DJLA 3HUVA 1Q7LA 2IQ6A 3KZWA 4F9UA 1Y7EA 2AFSA 3PRTA 1ZG7A 2PJ4A 4NGMA 2Q51A 3PB8X 4EFDA 3VATA 3FEEA 4YU9A 1TF9A 4BD9A 1TKJA 2ANPA 3DGVA 3KR5A 1CP7A 2ZEEA 3IC1A 4TNUA 4NFRA 2O53A 3TC8A 3IWWA 4R76A 2NSMA 4P44A 2DEAA 2RFHA 4IK2A 1LAMA 3B35A 3B3VA 4P4DA 1LOKA 1OBRA 1LAPA 2G9DA 3ISXA 5CPAA 3V38A 3B2YA 3D66A 3BI0A 4OP4A 4Z65A 3K2KA 3MN8A 4Q7AA 3RBUA 1LANA 3CPXA 3PFOA 1H8LA 2GLJA 4P4IA 1R43A 2CTCA 1ARMA 5LYDA 3MRUA 3QNVA 2CF4A 2V8HA 4WJBA 4PXDA 1CBXA 3B3TA 4ZX8A 3PEIA 1CPSA 3SI0A 2PJCA 2POKA 4MCQA 2XEFA 4FBEA 1FT7A 1M4LA 4MCRA 3RAMA 5LRGA 3CPAA 4MHYA 1TKHA 1TKFA 4F8ZA 2GREA 3N5FA 4PPZA 4UIAA 3RZAA 4FWUA 5IB9A 3HLPA 3LMSA 4OC2A 3CT9A 2AFUA 4R6TA 3PB4X 2WYRA 4MCSA 1Z2LA 4WWVA 4PQAA 1F57A 2PJ1A 4R8FA 5K8MA 3D67A 3D68A 2F7VA 1VIXA 4UEEA 3S9NA 4MHZA 2QVPA 2FVGA 3SJFA 3LWUA 4P4BA 3WT4A 2HB6A 4OC5A 2ZEDA 3IIBA 1FNOA 3PB9X 1Z5RA 3L2NA 1IGBA 4TWEA 5JM6A 1CX8A 3GLJA 3KR4A 1XJOA 1HEEA 3KL9A 2PJ0A 2Q4ZA 5I4MA 2QYVA 1QQ9A 1YMEA 4A37A 1AYEA 4PXEA 3IJ3A 2ZOFA 4ZY1A 4A94A 2J9AA 5D29A 2PJ9A 2V8DA 3FMCA 4EWTA 2PJ5A 2RB7A 4MHPA 1Y0RA 1LCPA 2O4HA 3SI1A 2ZEHA 4A38A 7CPAA 4ZYQA 4OC1A 2AFWA 4P45A 5DS0A 3NH4A 2V8GA 3T8WA 4EMEA 2IMOA 1VGYA 2PVVA 3PBBA 3PFEA 4NJQA 4DUKA 3PBEA 1PCAA 4NGNA 1CPXA 3FF3A 4CPAA 4OKOA 2EWBA 1HDUA 2HC9A 4P4FA 3KI9A 1VHEA 4P4JA 3BI1A 4UEFA 3D7FA 5HVHA 4OC0A 4R7MA 2ZEFA 2BCOA 2F8HA 3FX6A 1ARLA 1YSJA 4G1PA 5LRKA 2JBJA 3B3SA 1BAVA 3KHXA 4F9VA 2AFXA 5J1QA 2V77A 3WABA 2AFMA 2QJ8A 4KSIA 2ZEGA 4GM5A 4DYOA 1Y0YA 2PJ8A 5JH9A 4NGTA 2PCUA 3NH5A 5D8NA 2PJ2A 4FAIA 2C6CA 2PIYA 2I3CA 4OC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NGQ A;  4ZX9 A;  4ZI6 A;  2AFO A;  1F2O A;  1VHO A;  2CIJ A;  1LFW A;  1XBU A;  3B7I A;  2BOA A;  4P6Y A;  1ZG9 A;  3BHX A;  4X2T A;  5LYI A;  1KWM A;  2CTB A;  4UF4 A;  3IFE A;  1PYT B;  4FUU A;  4A39 A;  3SI2 A;  2V8V A;  2XEG A;  4PXC A;  2WZN A;  2ZEN A;  3WC7 A;  1BLL E;  1DTD A;  4OID A;  3GUX A;  3D7G A;  2PJ3 A;  1UWY A;  2ZEO A;  4MMO A;  1GYT A;  1XRY A;  4NJR A;  1ZLH A;  1YW6 A;  2XEJ A;  4B6Z A;  3D7D A;  4NGR A;  3FJU A;  1AMP A;  1CP6 A;  2ZOG A;  5LYF A;  1EE3 P;  2PJA A;  1YLO A;  4UIB A;  1NSA A;  3ISZ A;  5JGF A;  5HXD A;  1HDQ A;  6CPA A;  2GU2 A;  1QMU A;  3H8F A;  3S9L A;  8CPA A;  2PJ7 A;  4X8I A;  1YW4 A;  1XMB A;  2ZEP A;  3B3C A;  4MCP A;  4IHM A;  1ZLI A;  3KAS A;  5K8P A;  1JQG A;  2PRQ A;  4OC3 A;  3PB7 X;  3NH8 A;  1DE4 C;  3I1U A;  3IEH A;  5LRJ A;  5LYL A;  1F2P A;  3FVL A;  3FEC A;  5K8O A;  5F09 A;  3TX8 A;  2C6G A;  2EK9 A;  4IAV A;  1IY7 A;  4P10 A;  1CG2 A;  1TXR A;  2NYQ A;  2PJB A;  2OR4 A;  4MXU A;  4RUH A;  2JBK A;  3K9T A;  1ZG8 A;  2C6P A;  3JRU A;  3H8E A;  1R3N A;  3VH9 A;  5K8N A;  4UEZ A;  5HVG A;  2VL1 A;  3NFZ A;  2ZEL A;  3FH4 A;  2BO9 A;  1BPN A;  4NGP A;  1Z8L A;  1XFO A;  2AFZ A;  1RTQ A;  4K3N A;  3S9M A;  3FED A;  2XEI A;  2ABZ A;  2JEW A;  2IJZ A;  4OIW A;  4ZY2 A;  3IO1 A;  2GLF A;  2PIZ A;  1ELL P;  3PB6 X;  2PJ6 A;  5THW A;  5ELY A;  4AXV A;  4OME A;  4H2K A;  2ZEM A;  3H8G A;  3CDX A;  4ZY0 A;  4MRI A;  4NGS A;  4X3R A;  3SJX A;  3KGQ A;  2Q43 A;  3GB0 A;  4MHN A;  3VAR A;  2PE3 A;  3NA6 A;  2C1C A;  3B3W A;  3KQZ A;  3D7H A;  3SJE A;  3KQX A;  3V7Z A;  5HVF A;  1TF8 A;  3KHZ A;  2EK8 A;  2OOT A;  4YWY A;  1BPM A;  4P4E A;  4W9Y A;  4LQG A;  3BXM A;  4ONW A;  3SJG A;  2PVW A;  3WC5 A;  4PXB A;  4O23 A;  3WC6 A;  4JZ0 A;  3DLJ A;  4JYW A;  3D4U A;  5CBM A;  1ELM P;  4DJL A;  3HUV A;  1Q7L A;  2IQ6 A;  3KZW A;  4F9U A;  1Y7E A;  2AFS A;  3PRT A;  1ZG7 A;  2PJ4 A;  4NGM A;  2Q51 A;  3PB8 X;  4EFD A;  3VAT A;  3FEE A;  4YU9 A;  1TF9 A;  4BD9 A;  1TKJ A;  2ANP A;  3DGV A;  3KR5 A;  1CP7 A;  2ZEE A;  3IC1 A;  4TNU A;  4NFR A;  2O53 A;  3TC8 A;  3IWW A;  4R76 A;  2NSM A;  4P44 A;  2DEA A;  2RFH A;  4IK2 A;  1LAM A;  3B35 A;  3B3V A;  4P4D A;  1LOK A;  1OBR A;  1LAP A;  2G9D A;  3ISX A;  5CPA A;  3V38 A;  3B2Y A;  3D66 A;  3BI0 A;  4OP4 A;  4Z65 A;  3K2K A;  3MN8 A;  4Q7A A;  3RBU A;  1LAN A;  3CPX A;  3PFO A;  1H8L A;  2GLJ A;  4P4I A;  1R43 A;  2CTC A;  1ARM A;  5LYD A;  3MRU A;  3QNV A;  2CF4 A;  2V8H A;  4WJB A;  4PXD A;  1CBX A;  3B3T A;  4ZX8 A;  3PEI A;  1CPS A;  3SI0 A;  2PJC A;  2POK A;  4MCQ A;  2XEF A;  4FBE A;  1FT7 A;  1M4L A;  4MCR A;  3RAM A;  5LRG A;  3CPA A;  4MHY A;  1TKH A;  1TKF A;  4F8Z A;  2GRE A;  3N5F A;  4PPZ A;  4UIA A;  3RZA A;  4FWU A;  5IB9 A;  3HLP A;  3LMS A;  4OC2 A;  3CT9 A;  2AFU A;  4R6T A;  3PB4 X;  2WYR A;  4MCS A;  1Z2L A;  4WWV A;  4PQA A;  1F57 A;  2PJ1 A;  4R8F A;  5K8M A;  3D67 A;  3D68 A;  2F7V A;  1VIX A;  4UEE A;  3S9N A;  4MHZ A;  2QVP A;  2FVG A;  3SJF A;  3LWU A;  4P4B A;  3WT4 A;  2HB6 A;  4OC5 A;  2ZED A;  3IIB A;  1FNO A;  3PB9 X;  1Z5R A;  3L2N A;  1IGB A;  4TWE A;  5JM6 A;  1CX8 A;  3GLJ A;  3KR4 A;  1XJO A;  1HEE A;  3KL9 A;  2PJ0 A;  2Q4Z A;  5I4M A;  2QYV A;  1QQ9 A;  1YME A;  4A37 A;  1AYE A;  4PXE A;  3IJ3 A;  2ZOF A;  4ZY1 A;  4A94 A;  2J9A A;  5D29 A;  2PJ9 A;  2V8D A;  3FMC A;  4EWT A;  2PJ5 A;  2RB7 A;  4MHP A;  1Y0R A;  1LCP A;  2O4H A;  3SI1 A;  2ZEH A;  4A38 A;  7CPA A;  4ZYQ A;  4OC1 A;  2AFW A;  4P45 A;  5DS0 A;  3NH4 A;  2V8G A;  3T8W A;  4EME A;  2IMO A;  1VGY A;  2PVV A;  3PBB A;  3PFE A;  4NJQ A;  4DUK A;  3PBE A;  1PCA A;  4NGN A;  1CPX A;  3FF3 A;  4CPA A;  4OKO A;  2EWB A;  1HDU A;  2HC9 A;  4P4F A;  3KI9 A;  1VHE A;  4P4J A;  3BI1 A;  4UEF A;  3D7F A;  5HVH A;  4OC0 A;  4R7M A;  2ZEF A;  2BCO A;  2F8H A;  3FX6 A;  1ARL A;  1YSJ A;  4G1P A;  5LRK A;  2JBJ A;  3B3S A;  1BAV A;  3KHX A;  4F9V A;  2AFX A;  5J1Q A;  2V77 A;  3WAB A;  2AFM A;  2QJ8 A;  4KSI A;  2ZEG A;  4GM5 A;  4DYO A;  1Y0Y A;  2PJ8 A;  5JH9 A;  4NGT A;  2PCU A;  3NH5 A;  5D8N A;  2PJ2 A;  4FAI A;  2C6C A;  2PIY A;  2I3C A;  4OC4 A; 
#chains in the Genus database with same CATH topology
 4NGQ A;  1NMT A;  4ZX9 A;  4ZI6 A;  4ONU A;  2AFO A;  1F2O A;  1S3Z A;  1VHO A;  2ZW5 A;  3NE7 A;  1QSM A;  4F0X A;  2CIJ A;  2REF A;  4JD6 A;  1LFW A;  1R57 A;  3D8P A;  4MHD A;  1XBU A;  2ODF A;  3B7I A;  1WK4 A;  2BOA A;  4P6Y A;  1ZG9 A;  3BHX A;  4QBJ A;  1MJB A;  4X2T A;  5LYI A;  4B14 A;  1KWM A;  2CTB A;  3TO7 A;  2P6G A;  3IFE A;  4UF4 A;  5AG4 A;  4Y49 C;  1PYT B;  2F5I A;  4FUU A;  4MBU A;  2FCK A;  4A39 A;  2BUE A;  3SI2 A;  1Z8X A;  4R87 A;  2V8V A;  2XEG A;  3EY5 A;  3BLN A;  2WZN A;  4PXC A;  2Q0Y A;  1MJ9 A;  2ZEN A;  3WC7 A;  1DTD A;  1BLL E;  4OID A;  2ZW4 A;  3TOB A;  3GUX A;  2P6F A;  3D7G A;  2PJ3 A;  1UWY A;  2OZU A;  2PRB A;  2ZEO A;  2B58 A;  4MMO A;  1IIC A;  1GYT A;  4HNX B;  1XRY A;  1NE9 A;  2VBQ A;  2Q4Y A;  4NJR A;  3T90 A;  4C7H A;  1ZLH A;  1YW6 A;  2XEJ A;  3JUW A;  3TO6 A;  2GIV A;  3D7D A;  4B6Z A;  1X10 A;  4BMH A;  4NGR A;  2VZZ A;  3DR6 A;  3FJU A;  1AMP A;  1CP6 A;  2ZOG A;  4JLY A;  4Q38 A;  1EE3 P;  2PJA A;  3RO0 A;  5LYF A;  1S60 A;  2O28 A;  2Z3K A;  3TTH A;  5KTA A;  1YLO A;  2A4N A;  3P2H A;  3H5Z A;  5G21 A;  4UIB A;  4CS0 B;  1NSA A;  4B5O A;  3ISZ A;  4MFL A;  4U9Z A;  5JGF A;  5HXD A;  1HDQ A;  6CPA A;  2GU2 A;  1QMU A;  3H8F A;  3JTK A;  4R57 A;  4UFV A;  3S9L A;  5AG5 A;  1RXT A;  4U9Y A;  5G22 A;  8CPA A;  2PJ7 A;  3R9G A;  4X8I A;  1YW4 A;  1XMB A;  1CJW A;  2ZEP A;  2Y0M A;  3B3C A;  4CRZ B;  4MCP A;  4IHM A;  4KVO E;  4AVB A;  3PGP A;  1ZLI A;  2FE7 A;  3KAS A;  5K8P A;  2VEZ A;  1JQG A;  4L89 A;  3TFY A;  2PRQ A;  4OC3 A;  3PB7 X;  3NH8 A;  1DE4 C;  3I1U A;  3S6H A;  1Z4R A;  3IEH A;  2WPX A;  5LRJ A;  3GY9 A;  5LYL A;  2AJ6 A;  3GIU A;  5ISV A;  3W6S A;  1YGH A;  1I12 A;  1F2P A;  2G0B A;  3EFA A;  3FVL A;  3FEC A;  4CAX A;  5F09 A;  3TX8 A;  5K8O A;  2C6G A;  4PK3 A;  2EK9 A;  1TIQ A;  3EC4 A;  1IY7 A;  3GKR A;  4IAV A;  4M3S A;  4P10 A;  1CG2 A;  2I00 A;  4UA3 A;  3DNS A;  3OWC A;  4R3K A;  1TXR A;  2NYQ A;  2PJB A;  2OR4 A;  4MXU A;  1SQH A;  3TOA A;  4M6G A;  4RUH A;  3A9L A;  1YQE A;  2JBK A;  3K9T A;  1ZG8 A;  2C6P A;  2FIA A;  4LQ6 A;  3JRU A;  4AG9 A;  4CYP A;  1JWQ A;  1IU8 A;  3QAH A;  4CAW A;  5A27 A;  5IB0 A;  1B6B A;  1R3N A;  3H8E A;  2HUZ A;  3I9S A;  5AG6 A;  3VH9 A;  4CGM A;  4UEZ A;  4YGO A;  2Q44 A;  5K8N A;  1Y9W A;  2Q4V A;  1Z4E A;  4B10 A;  5HVG A;  4MY3 A;  3P2F A;  2VL1 A;  3D3S A;  5F49 A;  2B3U A;  2DF5 A;  1N71 A;  2ZEL A;  2BO9 A;  3FH4 A;  3NFZ A;  1BPN A;  4NGP A;  1P0H A;  1XFO A;  1M44 A;  1RTQ A;  2AFZ A;  1Z8L A;  1M1D A;  2Z3L A;  1XEB A;  4MFK A;  4KSA A;  2YGW A;  3JVN A;  4HPS A;  3PZJ A;  4K3N A;  1FY7 A;  4C2X A;  3S9M A;  3FED A;  2XEI A;  1YLE A;  1YRE A;  2ABZ A;  3N7Z A;  5F48 A;  1IYK A;  3FYN A;  2JEW A;  2IJZ A;  4GS4 A;  4UCP A;  4ORF A;  5CNP A;  2P6E A;  2DPS A;  5I0C A;  3H4Q A;  4OIW A;  4RS2 A;  4ZY2 A;  2G3T A;  2GLF A;  3IO1 A;  4JJX A;  2PIZ A;  1ELL P;  4XNH B;  1Z9U A;  2AE6 A;  1X12 A;  2PJ6 A;  3PB6 X;  5THW A;  4H89 A;  5ELY A;  5G20 A;  4OAE A;  1J4J A;  5EBV A;  1AUG A;  5FVJ A;  4AXV A;  4OME A;  4H2K A;  2ZEM A;  3H8G A;  1I21 A;  3CDX A;  4H6U A;  4B5P B;  5HH1 A;  3WR7 A;  2G3A A;  4A32 A;  2OB0 A;  4ZY0 A;  4MRI A;  4ZBG A;  4CGN A;  2JDD A;  4FD4 A;  1YK3 A;  5BWA B;  4NGS A;  4X3R A;  3SJX A;  2FL4 A;  3KGQ A;  4NSQ A;  4Q36 A;  4L8A A;  1XOV A;  2Q43 A;  3GB0 A;  2R7H A;  4MHN A;  3IU1 A;  3VAR A;  3CXS A;  2ZW6 A;  2PE3 A;  3NA6 A;  3EO4 A;  4FD6 A;  1V0C A;  2C1C A;  3B3W A;  3FRM A;  3KQZ A;  3D7H A;  4RN7 A;  3RNZ A;  3SJE A;  3KQX A;  4NEX A;  3V7Z A;  1S7N A;  1Q2D A;  2PC1 A;  4PSW A;  4FD7 A;  5HVF A;  5F46 A;  1YVO A;  1TF8 A;  2CNS A;  4M85 A;  4EVY A;  4LX9 A;  2B4D A;  3KHZ A;  2EK8 A;  1XIX A;  2OOT A;  4A2Z A;  4YWY A;  4NXY A;  1BPM A;  4P4E A;  4PV6 A;  4W9Y A;  2RC4 A;  4XPK A;  4CGL A;  1IOI A;  5A28 A;  4LQG A;  1CM0 A;  3BXM A;  2ARH A;  5C88 A;  4UCN A;  2B4B A;  1KUV A;  3VWE A;  4KOS A;  1IID A;  4ONW A;  1YVK A;  2D4O A;  1U6M A;  4AG7 A;  2OU2 A;  2X7B A;  5KTD A;  1ZO0 A;  3SJG A;  4CYQ A;  2PVW A;  3WC5 A;  2JDC A;  4KVX A;  4PXB A;  4O23 A;  3NE8 A;  3TO9 A;  1L0C A;  3WC6 A;  4JZ0 A;  2PSW A;  2FSR A;  3DLJ A;  1PU9 A;  2Z3N A;  4MY0 A;  1M4D A;  4JYW A;  3D4U A;  1RO5 A;  4NF1 A;  5DWM A;  5CBM A;  1ELM P;  4DJL A;  4B5P A;  3SXO A;  3HUV A;  4QUS A;  1Q7L A;  4JXR A;  2IQ6 A;  1B87 A;  2Z11 A;  4UWI A;  3R9F A;  1QSO A;  5C82 A;  3KZW A;  4F9U A;  1Y7E A;  2AFS A;  4CGP A;  3PRT A;  3R96 A;  2EUI A;  1ZG7 A;  1S7F A;  4A30 A;  2PJ4 A;  4NGM A;  2Q51 A;  3PB8 X;  4EFD A;  1XMT A;  3S6G A;  1ON0 A;  4XNH C;  3VAT A;  3FB3 A;  2WSA A;  1P4N A;  1TF9 A;  3FEE A;  4KOR A;  4YU9 A;  4BD9 A;  2BSW A;  2GAN A;  1TKJ A;  2CXA A;  2ANP A;  4QC6 A;  3DGV A;  3KR5 A;  1CP7 A;  4KUA A;  5AGE A;  1QSR A;  5KTC A;  1KZF A;  2ZEE A;  3IC1 A;  2Q7B A;  4TNU A;  1MK4 A;  4AVA A;  5EC4 A;  4NFR A;  4KSF A;  4MFZ A;  2I79 A;  3TE4 A;  2O53 A;  3TC8 A;  3IWW A;  4QB9 A;  2J8M A;  2K5T A;  3S6F A;  2EO8 A;  4R76 A;  5H86 A;  4X5K A;  4F0Y A;  2NSM A;  2P0W A;  4P44 A;  1XF8 A;  2DEA A;  2RFH A;  4IK2 A;  4IUS A;  4MFQ A;  3W91 A;  1LAM A;  3B35 A;  4A33 A;  4PSX A;  4A95 A;  3IGR A;  3B3V A;  2PQ8 A;  4P4D A;  3F0A A;  3CXQ A;  1LOK A;  1OBR A;  4HNY B;  1LAP A;  4KLV A;  2G9D A;  3ISX A;  5CPA A;  4IF5 A;  3V38 A;  3B2Y A;  3D66 A;  3BI0 A;  4OP4 A;  4Z65 A;  3K2K A;  3MN8 A;  3LAC A;  1I1D A;  2FT0 A;  2Z10 A;  2YND A;  4CRY B;  4Q7A A;  1A2Z A;  4UBR A;  1Q2C A;  1MJA A;  1QSN A;  5E96 A;  3RBU A;  2WUU A;  1LAN A;  3CPX A;  3PFO A;  3FBU A;  1H8L A;  3IU2 A;  2B5G B;  4AB7 A;  4B13 A;  2GLJ A;  4P4I A;  3ZZI A;  4BBH A;  1R43 A;  4DNC A;  2CTC A;  1ARM A;  5LYD A;  3LD2 A;  3I3G A;  3MRU A;  4C68 A;  3QNV A;  5G1Z A;  4CYN A;  1UFH A;  1Z8T A;  2EVN A;  4II9 A;  2ATR A;  2CF4 A;  2V8H A;  4OLL A;  4WJB A;  5EMI A;  2Z0Z A;  1YR0 A;  1CBX A;  4PXD A;  3B3T A;  4ZX8 A;  3PEI A;  1CPS A;  5F47 A;  3SI0 A;  3FXT A;  2OZG A;  3R9E A;  2EBJ A;  3BJ8 A;  2QML A;  2ZXV A;  2PJC A;  4KOY A;  2POK A;  4MCQ A;  4ZGY B;  2XEF A;  4FBE A;  1FT7 A;  5GCN A;  1M4L A;  4MCR A;  4XPD C;  3RAM A;  2ZW7 A;  3R95 A;  2FXF A;  5J8F A;  4MJ8 A;  1IOF A;  4AVC A;  3LOD A;  5LRG A;  4YRH A;  4KVM E;  3CPA A;  4MHY A;  1TKH A;  4KOV A;  4QVT A;  1TKF A;  3G3S A;  2GRE A;  2JLM A;  4F8Z A;  2PDO A;  3IWG A;  1GHE A;  3N5F A;  4PPZ A;  3DDD A;  4UIA A;  4KOU A;  1Y7R A;  3RZA A;  4FWU A;  4E2A A;  3F5B A;  5JPH A;  4GXH A;  2QIR A;  5IB9 A;  4E0A A;  2BL1 A;  3HLP A;  3LMS A;  4OC2 A;  3D2M A;  4C2Y A;  4C7I A;  5DWN A;  3CT9 A;  2R98 A;  2AFU A;  4R6T A;  4KOX A;  5J8C A;  3PB4 X;  1Z8W A;  3CZX A;  4UFX A;  2WYR A;  4MCS A;  4B11 A;  2B5G A;  4KS9 A;  1Z2L A;  1K4J A;  4WWV A;  4PQA A;  1WWZ A;  3KKW A;  1F57 A;  2Q04 A;  2OH1 A;  3RYO A;  4PK2 A;  2R8V A;  1M4G A;  2PJ1 A;  5IX3 A;  2IL4 A;  3PP9 A;  1VHS A;  4KUB A;  2D4P A;  4R8F A;  5K8M A;  2B3V A;  3D67 A;  3D68 A;  2F7V A;  3SXN A;  5H84 A;  4F6A A;  1VKC A;  2YNC C;  2BEI A;  4J3G A;  1VIX A;  2Z3P A;  3C26 A;  3D2P A;  4MFP A;  2QVP A;  4MHZ A;  4UEE A;  3S9N A;  2FVG A;  3SJF A;  4M6I A;  5JQ4 A;  3LWU A;  1NSL A;  3DR8 A;  4P4B A;  3WT4 A;  4I49 A;  2HB6 A;  3FNC A;  4OC5 A;  1IYL A;  2ZED A;  3IIB A;  4OAD A;  1FNO A;  3PB9 X;  1Z5R A;  2REE A;  3L2N A;  4M6H A;  3UY5 A;  3DSB A;  2VI7 A;  3G8W A;  3BJ7 A;  4HKF A;  1IGB A;  2NMT A;  1XE4 A;  4R9M A;  4TWE A;  4XPD B;  5JM6 A;  1CX8 A;  4BIN A;  3GLJ A;  3KR4 A;  1XJO A;  3TCV A;  2GE3 A;  2DXQ A;  1HEE A;  3KL9 A;  4KOT A;  2PJ0 A;  2Q4Z A;  2Z3M A;  3ZJ0 A;  2J8N A;  5I4M A;  1LRZ A;  2QYV A;  2FIW A;  1QQ9 A;  4U5Y A;  1YME A;  4A37 A;  3CXP A;  4CYO A;  4KZT A;  4FD5 A;  3MGD A;  3F8K A;  1AYE A;  4PXE A;  2DPT A;  3IJ3 A;  4H6Z A;  1Y9K A;  2VQY A;  2ZOF A;  4ZY1 A;  3EXN A;  2HQY A;  4A94 A;  2J9A A;  5D29 A;  2CNM A;  2PJ9 A;  2V8D A;  3FMC A;  4EWT A;  2PJ5 A;  2RB7 A;  4CGO A;  1S7L A;  4MHP A;  1Y0R A;  2KCW A;  4HNW B;  1LCP A;  2O4H A;  3SI1 A;  1PUA A;  2ZEH A;  4A38 A;  7CPA A;  2C27 A;  3GYA A;  2PR1 A;  4UFW A;  3SHP A;  1YX0 A;  4ZYQ A;  4KLW A;  4OC1 A;  2AFW A;  4UWJ A;  1S7K A;  4Y49 B;  4MFJ A;  3V8I A;  2YNE A;  4JXQ A;  4P45 A;  5DS0 A;  1BOB A;  2WPW A;  3K9U A;  3TT2 A;  1BO4 A;  3NH4 A;  2FS5 A;  2V8G A;  2J8R A;  3T8W A;  5IV0 A;  1M4I A;  4A31 A;  4EME A;  2VXK A;  2IMO A;  1VGY A;  2PVV A;  3PBB A;  3PFE A;  4NJQ A;  4DUK A;  4R3L A;  3PBE A;  1PCA A;  4NGN A;  4YFJ A;  1CPX A;  2R1I A;  2QEC A;  3FF3 A;  4CPA A;  2OZH A;  4OKO A;  2EWB A;  1HDU A;  2HC9 A;  4JWP A;  3T9Y A;  2GFQ A;  4LUA A;  2ZPA A;  1Q2Y A;  4P4F A;  3KI9 A;  4E8O A;  1OZP A;  1VHE A;  5AG7 A;  4P4J A;  2PR8 A;  3BI1 A;  4UEF A;  3D7F A;  5HMN A;  2CNT A;  1KUY A;  3S6K A;  4OC0 A;  4R7M A;  5HVH A;  4CAF A;  2ZEF A;  3R1K A;  2CY2 A;  2HV2 A;  3QB8 A;  2JEV A;  2BCO A;  2F8H A;  3FX6 A;  1ARL A;  3VWD A;  1YSJ A;  2B4D B;  3B8G A;  4G1P A;  2Z3O A;  2JBJ A;  3E0K A;  5LRK A;  4CAV A;  4MI4 A;  4XPL A;  3W6X A;  3B3S A;  4RI1 A;  1IB1 E;  3QAY A;  4B12 A;  1BAV A;  3KHX A;  4CAE A;  4F9V A;  2AFX A;  1S5K A;  4K30 A;  4NCZ A;  4UCM A;  1KUX A;  4C2Z A;  5J1Q A;  2V77 A;  3WAB A;  2AFM A;  2QJ8 A;  3IWE A;  4KSI A;  2ZEG A;  2H5M A;  4GM5 A;  4DYO A;  4KOW A;  1Y0Y A;  2Q7S A;  2PJ8 A;  5JH9 A;  4NGT A;  2PCU A;  1QST A;  2YNC A;  3NH5 A;  5D8N A;  2PJ2 A;  4FAI A;  2C6C A;  2PIY A;  2VZY A;  2I3C A;  3FIX A;  4OC4 A; 
#chains in the Genus database with same CATH homology
 4NGQ A;  4ZX9 A;  4ZI6 A;  2AFO A;  1F2O A;  1VHO A;  2CIJ A;  1LFW A;  1XBU A;  3B7I A;  2BOA A;  4P6Y A;  1ZG9 A;  3BHX A;  4X2T A;  5LYI A;  1KWM A;  2CTB A;  4UF4 A;  3IFE A;  1PYT B;  4FUU A;  4A39 A;  3SI2 A;  2V8V A;  2XEG A;  4PXC A;  2WZN A;  2ZEN A;  3WC7 A;  1BLL E;  1DTD A;  4OID A;  3GUX A;  3D7G A;  2PJ3 A;  1UWY A;  2ZEO A;  4MMO A;  1GYT A;  1XRY A;  4NJR A;  1ZLH A;  1YW6 A;  2XEJ A;  4B6Z A;  3D7D A;  4NGR A;  3FJU A;  1AMP A;  1CP6 A;  2ZOG A;  5LYF A;  1EE3 P;  2PJA A;  1YLO A;  4UIB A;  1NSA A;  3ISZ A;  5JGF A;  5HXD A;  1HDQ A;  6CPA A;  2GU2 A;  1QMU A;  3H8F A;  3S9L A;  8CPA A;  2PJ7 A;  4X8I A;  1YW4 A;  1XMB A;  2ZEP A;  3B3C A;  4MCP A;  4IHM A;  1ZLI A;  3KAS A;  5K8P A;  1JQG A;  2PRQ A;  4OC3 A;  3PB7 X;  3NH8 A;  1DE4 C;  3I1U A;  3IEH A;  5LRJ A;  5LYL A;  1F2P A;  3FVL A;  3FEC A;  5K8O A;  5F09 A;  3TX8 A;  2C6G A;  2EK9 A;  4IAV A;  1IY7 A;  4P10 A;  1CG2 A;  1TXR A;  2NYQ A;  2PJB A;  2OR4 A;  4MXU A;  4RUH A;  2JBK A;  3K9T A;  1ZG8 A;  2C6P A;  3JRU A;  3H8E A;  1R3N A;  3VH9 A;  5K8N A;  4UEZ A;  5HVG A;  2VL1 A;  3NFZ A;  2ZEL A;  3FH4 A;  2BO9 A;  1BPN A;  4NGP A;  1Z8L A;  1XFO A;  2AFZ A;  1RTQ A;  4K3N A;  3S9M A;  3FED A;  2XEI A;  2ABZ A;  2JEW A;  2IJZ A;  4OIW A;  4ZY2 A;  3IO1 A;  2GLF A;  2PIZ A;  1ELL P;  3PB6 X;  2PJ6 A;  5THW A;  5ELY A;  4AXV A;  4OME A;  4H2K A;  2ZEM A;  3H8G A;  3CDX A;  4ZY0 A;  4MRI A;  4NGS A;  4X3R A;  3SJX A;  3KGQ A;  2Q43 A;  3GB0 A;  4MHN A;  3VAR A;  2PE3 A;  3NA6 A;  2C1C A;  3B3W A;  3KQZ A;  3D7H A;  3SJE A;  3KQX A;  3V7Z A;  5HVF A;  1TF8 A;  3KHZ A;  2EK8 A;  2OOT A;  4YWY A;  1BPM A;  4P4E A;  4W9Y A;  4LQG A;  3BXM A;  4ONW A;  3SJG A;  2PVW A;  3WC5 A;  4PXB A;  4O23 A;  3WC6 A;  4JZ0 A;  3DLJ A;  4JYW A;  3D4U A;  5CBM A;  1ELM P;  4DJL A;  3HUV A;  1Q7L A;  2IQ6 A;  3KZW A;  4F9U A;  1Y7E A;  2AFS A;  3PRT A;  1ZG7 A;  2PJ4 A;  4NGM A;  2Q51 A;  3PB8 X;  4EFD A;  3VAT A;  3FEE A;  4YU9 A;  1TF9 A;  4BD9 A;  1TKJ A;  2ANP A;  3DGV A;  3KR5 A;  1CP7 A;  2ZEE A;  3IC1 A;  4TNU A;  4NFR A;  2O53 A;  3TC8 A;  3IWW A;  4R76 A;  2NSM A;  4P44 A;  2DEA A;  2RFH A;  4IK2 A;  1LAM A;  3B35 A;  3B3V A;  4P4D A;  1LOK A;  1OBR A;  1LAP A;  2G9D A;  3ISX A;  5CPA A;  3V38 A;  3B2Y A;  3D66 A;  3BI0 A;  4OP4 A;  4Z65 A;  3K2K A;  3MN8 A;  4Q7A A;  3RBU A;  1LAN A;  3CPX A;  3PFO A;  1H8L A;  2GLJ A;  4P4I A;  1R43 A;  2CTC A;  1ARM A;  5LYD A;  3MRU A;  3QNV A;  2CF4 A;  2V8H A;  4WJB A;  4PXD A;  1CBX A;  3B3T A;  4ZX8 A;  3PEI A;  1CPS A;  3SI0 A;  2PJC A;  2POK A;  4MCQ A;  2XEF A;  4FBE A;  1FT7 A;  1M4L A;  4MCR A;  3RAM A;  5LRG A;  3CPA A;  4MHY A;  1TKH A;  1TKF A;  4F8Z A;  2GRE A;  3N5F A;  4PPZ A;  4UIA A;  3RZA A;  4FWU A;  5IB9 A;  3HLP A;  3LMS A;  4OC2 A;  3CT9 A;  2AFU A;  4R6T A;  3PB4 X;  2WYR A;  4MCS A;  1Z2L A;  4WWV A;  4PQA A;  1F57 A;  2PJ1 A;  4R8F A;  5K8M A;  3D67 A;  3D68 A;  2F7V A;  1VIX A;  4UEE A;  3S9N A;  4MHZ A;  2QVP A;  2FVG A;  3SJF A;  3LWU A;  4P4B A;  3WT4 A;  2HB6 A;  4OC5 A;  2ZED A;  3IIB A;  1FNO A;  3PB9 X;  1Z5R A;  3L2N A;  1IGB A;  4TWE A;  5JM6 A;  1CX8 A;  3GLJ A;  3KR4 A;  1XJO A;  1HEE A;  3KL9 A;  2PJ0 A;  2Q4Z A;  5I4M A;  2QYV A;  1QQ9 A;  1YME A;  4A37 A;  1AYE A;  4PXE A;  3IJ3 A;  2ZOF A;  4ZY1 A;  4A94 A;  2J9A A;  5D29 A;  2PJ9 A;  2V8D A;  3FMC A;  4EWT A;  2PJ5 A;  2RB7 A;  4MHP A;  1Y0R A;  1LCP A;  2O4H A;  3SI1 A;  2ZEH A;  4A38 A;  7CPA A;  4ZYQ A;  4OC1 A;  2AFW A;  4P45 A;  5DS0 A;  3NH4 A;  2V8G A;  3T8W A;  4EME A;  2IMO A;  1VGY A;  2PVV A;  3PBB A;  3PFE A;  4NJQ A;  4DUK A;  3PBE A;  1PCA A;  4NGN A;  1CPX A;  3FF3 A;  4CPA A;  4OKO A;  2EWB A;  1HDU A;  2HC9 A;  4P4F A;  3KI9 A;  1VHE A;  4P4J A;  3BI1 A;  4UEF A;  3D7F A;  5HVH A;  4OC0 A;  4R7M A;  2ZEF A;  2BCO A;  2F8H A;  3FX6 A;  1ARL A;  1YSJ A;  4G1P A;  5LRK A;  2JBJ A;  3B3S A;  1BAV A;  3KHX A;  4F9V A;  2AFX A;  5J1Q A;  2V77 A;  3WAB A;  2AFM A;  2QJ8 A;  4KSI A;  2ZEG A;  4GM5 A;  4DYO A;  1Y0Y A;  2PJ8 A;  5JH9 A;  4NGT A;  2PCU A;  3NH5 A;  5D8N A;  2PJ2 A;  4FAI A;  2C6C A;  2PIY A;  2I3C A;  4OC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...