2OB0A

Human mak3 homolog in complex with acetyl-coa
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
154
structure length
154
Chain Sequence
b'SKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human MAK3 homolog
publication title Structure of Human MAK3 homolog
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 40
structure length 154
sequence length 154
chains with identical sequence B, C
ec nomenclature ec 2.3.1.258: N-terminal methionine N(alpha)-acetyltransferase NatE.
pdb deposition date 2006-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2ob0A00
1NMTA 1NE9A 2OZHA 1S7NA 4K30A 4AB7A 5KTDA 1L0CA 4CAVA 2CNTA 2FCKA 1KZFA 4B5PB 2P6GA 1YK3A 2Z11A 2NMTA 1YLEA 1B6BA 2OZGA 5HH1A 2FIWA 1I12A 1ON0A 2PR8A 2CY2A 1WK4A 2FT0A 4AVCA 3BJ7A 2GE3A 3QAHA 2REFA 4LUAA 4J3GA 2I00A 2PRBA 4Y49C 3S6HA 4IF5A 2ZPAA 3TTHA 2EVNA 2HQYA 3EFAA 1S7KA 3TT2A 1IYLA 4OAEA 3GYAA 4XPLA 1XEBA 3WR7A 5F47A 1VHSA 3R96A 2ZW7A 3FBUA 3MGDA 2EUIA 4E0AA 4KUAA 3VWDA 1M44A 1VKCA 2HUZA 4MBUA 3FRMA 3W6XA 2Y0MA 3DSBA 4QBJA 3CXQA 2Q7BA 3T90A 1Q2CA 1QSOA 2J8RA 3K9UA 4RI1A 4F6AA 2HV2A 5F48A 4R87A 5F49A 2CNSA 2ZW6A 3V8IA 3VWEA 1YR0A 5IX3A 1YREA 2R98A 4JD6A 5J8FA 4JXRA 2O28A 4L8AA 3FIXA 4XPDC 2AE6A 4U5YA 2B3UA 4FD4A 4QUSA 4PSWA 1XE4A 2Q4VA 5HMNA 4QVTA 4DNCA 3DNSA 5FVJA 4JJXA 5GCNA 4GS4A 5E96A 1I1DA 4KOUA 3R95A 2R7HA 3RYOA 4B5PA 3TO9A 2GIVA 1BO4A 1CJWA 2G3TA 2A4NA 3LODA 5DWNA 2OU2A 4R9MA 4HKFA 4JXQA 4PK3A 5KTAA 1K4JA 2Q44A 2ZW5A 3TO6A 4KLWA 3FYNA 2P6FA 4HNXB 2BL1A 4KOXA 3B8GA 4E2AA 2ZW4A 3S6FA 4XNHC 3R9FA 3GKRA 3C26A 2FSRA 1I21A 2D4OA 2WPWA 1CM0A 4PK2A 2QMLA 3TOBA 3R1KA 3PGPA 2VI7A 2PSWA 1IIDA 5H84A 5EC4A 3TCVA 5F46A 1U6MA 2B4BA 4M85A 4CAXA 4KOWA 2B4DA 4U9YA 3IWGA 3W91A 5JPHA 5DWMA 1TIQA 4XPDB 3BJ8A 3CXPA 1MK4A 2GANA 1M4GA 3S6KA 4KORA 4R57A 2JDDA 4JLYA 1MJ9A 1P4NA 3DDDA 2D4PA 1Y9KA 1UFHA 4L89A 1QSRA 4PV6A 1YVOA 4R3KA 2B4DB 3BLNA 3TFYA 3PP9A 4AVAA 2VEZA 4KUBA 4AG9A 3IGRA 3D8PA 3H4QA 3FXTA 5ISVA 2G0BA 1S3ZA 4CRZB 4EVYA 3F8KA 1GHEA 3PZJA 1RXTA 1RO5A 4HNWB 3EO4A 3R9EA 3FB3A 4CRYB 1Z4RA 2G3AA 2P6EA 4XNHB 1KUVA 2PQ8A 4U9ZA 4UBRA 4B5OA 4YFJA 3DR8A 4QC6A 2H5MA 2B3VA 4R3LA 4II9A 4H89A 1KUYA 3N7ZA 4RS2A 1S5KA 4KZTA 2QIRA 2ATRA 2BUEA 1QSTA 3JVNA 3P2HA 4NCZA 1N71A 1XF8A 2OH1A 4UA3A 1FY7A 4AG7A 1B87A 4NXYA 1XMTA 4FD7A 2WPXA 4ORFA 4H6UA 4H6ZA 4HNYB 2QECA 4MY0A 2JLMA 5JQ4A 2R8VA 1S7FA 2OB0A 2VZZA 2X7BA 4KVME 4NEXA 2J8MA 1PUAA 1M4IA 2IL4A 3QB8A 4KOYA 2VQYA 1SQHA 3G3SA 2VBQA 4MY3A 2FE7A 3F5BA 1PU9A 2Z0ZA 2FIAA 4QB9A 4E8OA 5CNPA 3EXNA 2K5TA 3F0AA 2J8NA 2JDCA 1KUXA 5KTCA 3D2MA 3S6GA 2VXKA 2RC4A 4MHDA 1IB1E 2DXQA 2F5IA 1YVKA 2FXFA 2JEVA 1V0CA 4MI4A 4JWPA 2R1IA 4KVXA 2ARHA 3EY5A 3I9SA 4UWIA 1S7LA 1YX0A 1QSNA 4CAWA 2VZYA 4NF1A 1P0HA 5I0CA 4X5KA 4UWJA 3NE7A 3ZZIA 2B5GB 3W6SA 3SXNA 1Y7RA 4YGOA 1Z9UA 4XPKA 5C82A 4LX9A 1Q2DA 3D2PA 1MJAA 2Z10A 3JUWA 3R9GA 4ZBGA 5H86A 2OZUA 3OWCA 3KKWA 1Y9WA 1Z4EA 2Q4YA 2CNMA 2BSWA 2Q0YA 1IICA 2Q04A 1QSMA 2I79A 2REEA 4KOTA 3D3SA 4FD6A 1Q2YA 4IUSA 3DR6A 4AVBA 1R57A 3T9YA 2B58A 4OLLA 4FD5A 4M3SA 4OADA 4MJ8A 1XIXA 3TE4A 1OZPA 1BOBA 5IV0A 2AJ6A 1WWZA 4KOSA 3SXOA 3TO7A 2PR1A 1NSLA 3UY5A 5C88A 4PSXA 3ZJ0A 2FS5A 3E0KA 5IB0A 3SHPA 2FL4A 4NSQA 5J8CA 3FNCA 4ONUA 1M1DA 1LRZA 2PC1A 4KVOE 2PDOA 4F0YA 1YGHA 4KLVA 2BEIA 1M4DA 3GY9A 3G8WA 4Y49B 1S60A 2C27A 3P2FA 1MJBA 3EC4A 4KOVA 4I49A 2P0WA 2KCWA 4CS0B 1IYKA 3I3GA 4BMHA 1J4JA 3LD2A 4YRHA 5EBVA 2ZXVA 2B5GA 3CXSA 3TOAA
chains in the Genus database with same CATH superfamily
1NMTA 2PVVA 1NE9A 2OZHA 1S7NA 1ELLP 4K30A 2ABZA 5D29A 4AB7A 5KTDA 2AFXA 3D68A 1L0CA 3B3SA 4CAVA 2CNTA 2FCKA 1KZFA 4F9VA 4B5PB 2P6GA 5DS0A 2RB7A 1YK3A 1Z8TA 2EK9A 2Z11A 3FJUA 2NMTA 5F09A 1YLEA 4CGOA 1B6BA 2OZGA 2JBKA 5HH1A 6CPAA 2FIWA 2V8HA 1I12A 4B14A 4FAIA 3SJFA 1ON0A 2PR8A 4Q36A 2CY2A 4AXVA 1WK4A 2FT0A 4AVCA 1CG2A 1CP7A 3BJ7A 3FVLA 2GE3A 2PJ4A 4G1PA 3FF3A 3QAHA 4UF4A 3SI2A 2REFA 4LUAA 4J3GA 2CF4A 3MRUA 2PJ3A 3RBUA 4MCQA 2CTBA 2I00A 4BINA 4NGPA 4Q38A 2PRBA 2ODFA 3SJGA 3PFEA 3I1UA 4Y49C 3S6HA 4IF5A 2ZPAA 4GM5A 3TTHA 2V77A 4B13A 1Z5RA 2EVNA 4P4FA 2HQYA 3EFAA 4UFWA 4YWYA 1S7KA 3KGQA 3TT2A 1IYLA 2AFOA 3GB0A 4H2KA 4MHPA 5AG4A 2AFWA 1TKHA 4OAEA 3GYAA 4XPLA 4FWUA 3ISXA 1XEBA 3WR7A 1BPNA 5F47A 1VHSA 3KQZA 2ZW7A 3R96A 3FBUA 4CYOA 1LANA 3MGDA 1HDUA 1VIXA 2XEJA 3K9TA 2XEFA 5LYLA 2EUIA 4E0AA 2Z3MA 8CPAA 5HVHA 4KUAA 3VWDA 1M44A 1XBUA 1TKJA 2Z3KA 4OMEA 1VKCA 1QQ9A 3CT9A 3ISZA 3KQXA 2PJ8A 2HUZA 4MBUA 4MMOA 4UCNA 3FRMA 3W6XA 2XEGA 4RN7A 2Y0MA 3DSBA 4QBJA 2PJ2A 3CXQA 2Q7BA 4PXCA 1TXRA 3T90A 1Q2CA 1QSOA 2J8RA 2ZEPA 3JTKA 1Z8WA 3K9UA 3LWUA 4RI1A 2HV2A 4F6AA 4C7IA 4P44A 3H8FA 5F48A 3T8WA 1ZG9A 5AG5A 4R87A 5F49A 2CNSA 3RAMA 5K8NA 2AFUA 4A33A 4OC2A 2CTCA 2ZW6A 3V8IA 4A94A 3IC1A 1YQEA 2Z3LA 4OIDA 3VWEA 1YR0A 2YGWA 4EMEA 2F7VA 5IX3A 1YREA 2R98A 4JD6A 5J8FA 3JRUA 3A9LA 5ELYA 4RUHA 1R3NA 5JGFA 4JXRA 3DLJA 4UCPA 2O28A 4L8AA 3FIXA 4CGMA 5K8PA 4XPDC 3B3CA 2AE6A 4U5YA 4Q7AA 2B3UA 3SI1A 1IGBA 4FD4A 2BOAA 4HPSA 4R76A 4QUSA 3KL9A 4F9UA 4PSWA 4W9YA 4A37A 4CAEA 1XE4A 2PJ9A 2Q4VA 5HMNA 4QVTA 4DNCA 1VGYA 4UFVA 3BXMA 4R6TA 5HXDA 4P4IA 3PB8X 3DNSA 5FVJA 4JJXA 5GCNA 4GS4A 1GYTA 5E96A 1I1DA 3S9NA 1ZLIA 4KOUA 3R95A 4CPAA 2R7HA 2J9AA 4A39A 3RYOA 4B5PA 4WWVA 2GIVA 5LYDA 2ZEOA 3TO9A 1BO4A 2GFQA 4C2XA 1CJWA 2ZEDA 2G3TA 3D4UA 2A4NA 3LODA 1XRYA 4B10A 4NGTA 5DWNA 4UEFA 5LRGA 3L2NA 2PJ6A 3H5ZA 2OU2A 4A95A 1Z8XA 4R9MA 4HKFA 4JXQA 4NFRA 1R43A 2G9DA 4PK3A 5KTAA 1K4JA 2Q44A 4ZX8A 5AG6A 2ZW5A 3N5FA 3V7ZA 3TO6A 4KLWA 3FYNA 3RNZA 2YNEA 2P6FA 3H8GA 1X12A 4ONWA 1FNOA 3HLPA 3B3TA 4HNXB 2WUUA 2PRQA 4B12A 5K8OA 1PYTB 2BL1A 4KOXA 5HVFA 1YW6A 3B8GA 4E2AA 2ZW4A 4PPZA 3S6FA 4X3RA 1F2OA 2EK8A 4XNHC 4MFJA 5AG7A 4CAFA 2GU2A 3GKRA 3R9FA 3KHZA 4A31A 3C26A 2FSRA 1I21A 2D4OA 2WPWA 1CM0A 2WYRA 2QMLA 4PK2A 3TOBA 1ZG7A 3PRTA 2ZEHA 2EO8A 4M6GA 1YW4A 3R1KA 3PGPA 1Y0RA 1IOIA 2VI7A 2PSWA 4NGQA 2PJ1A 4A30A 3WT4A 2PJ0A 1XFOA 1Y0YA 4P4JA 3VH9A 4JYWA 1IIDA 5H84A 1TF9A 5EC4A 3TCVA 5F46A 1U6MA 1LCPA 2B4BA 2PJAA 3PFOA 4OC1A 1H8LA 4M85A 4MXUA 4CAXA 4KOWA 2B4DA 4UEZA 3KR4A 4ZY2A 4U9YA 3IWGA 4TWEA 4LQGA 3W91A 2AFSA 4NGMA 5JPHA 5DWMA 1LOKA 1TIQA 4WJBA 3KR5A 3KI9A 4XPDB 3BJ8A 3CXPA 1MK4A 3PB9X 1AUGA 2GANA 4FBEA 1M4GA 1F2PA 3WABA 3S6KA 1EE3P 3IU1A 4KORA 4OIWA 3IIBA 4R57A 1HEEA 2JDDA 1JQGA 2VL1A 1MJ9A 2AFMA 4JLYA 1YMEA 3TX8A 4F0XA 3RZAA 1P4NA 3DDDA 2PJ5A 1PCAA 3FX6A 2D4PA 1IU8A 4MHYA 5D8NA 1Y9KA 1UFHA 4L89A 3GUXA 1QSRA 4PV6A 1YVOA 4R3KA 2B4DB 2OOTA 3BLNA 3TFYA 3SJXA 1KWMA 3PP9A 2PE3A 4MFQA 2OR4A 2VEZA 4AVAA 3RO0A 4KUBA 5LYFA 1A2ZA 4AG9A 1Y7EA 1DE4C 3D8PA 3IGRA 3H4QA 4NGSA 3FXTA 5ISVA 2IJZA 3IO1A 5LRKA 4PXBA 2ZENA 4R8FA 3BI1A 2PJ7A 2G0BA 3GLJA 1S3ZA 4PXDA 4CRZB 2PJCA 4EVYA 3F8KA 1GHEA 3PZJA 1RXTA 3SI0A 4F8ZA 1RO5A 2DPSA 4HNWB 4P45A 3EO4A 3R9EA 3FECA 3FB3A 4CRYB 1Z4RA 2G3AA 4A2ZA 3NE8A 3MN8A 4BBHA 2P6EA 2RFHA 4UIAA 1XJOA 2DF5A 2C6CA 4XNHB 2Z3PA 1KUVA 1ELMP 2PQ8A 4U9ZA 1CPXA 3VARA 4UEEA 2HB6A 4MFZA 2DPTA 4UBRA 4UFXA 4B5OA 1XMBA 2ZOGA 3KZWA 4ZGYB 4GXHA 3DGVA 3NA6A 4YFJA 3DR8A 2GLJA 3BHXA 3FMCA 4QC6A 3NH8A 2H5MA 2B3VA 4R3LA 3B3VA 4II9A 1TKFA 4H89A 1KUYA 2GREA 2QVPA 3N7ZA 4RS2A 1S5KA 2GLFA 3D66A 2QIRA 4KZTA 1OBRA 2ATRA 1X10A 2JEWA 2BUEA 1QSTA 2PVWA 3JVNA 3P2HA 4MHZA 4NCZA 4P4EA 1N71A 1XF8A 1YLOA 2OH1A 2QJ8A 4UA3A 5HVGA 3LMSA 1FY7A 2EWBA 3CPXA 4AG7A 2ZELA 1ZO0A 1B87A 4NXYA 3B3WA 1XMTA 1UWYA 2WPXA 4FD7A 1Q7LA 4MCRA 1LFWA 3FEEA 4H6UA 2V8VA 2ZEGA 4H6ZA 4HNYB 2QECA 4K3NA 4ORFA 5THWA 4MY0A 2JLMA 3NH4A 5JQ4A 2R8VA 3D7DA 1JWQA 1QMUA 1S7FA 4NGNA 3WC6A 2OB0A 4CYNA 5I4MA 2VZZA 2X7BA 4KVME 4P4BA 4NEXA 2J8MA 1PUAA 4P4DA 3K2KA 1M4IA 2IL4A 3QB8A 4KOYA 2VQYA 1SQHA 3G3SA 2CXAA 2VBQA 2POKA 3PB6X 1HDQA 4MY3A 4X8IA 2NYQA 2I3CA 7CPAA 2FE7A 3F5BA 2ZOFA 1PU9A 2C6PA 2Q7SA 3IFEA 2C1CA 2Z0ZA 2FIAA 3QNVA 4KSAA 1FT7A 4A38A 2Q51A 4QB9A 3PBBA 4E8OA 4DYOA 3IWEA 4MRIA 4OC3A 5CNPA 3EXNA 2K5TA 3F0AA 2J8NA 2JDCA 1KUXA 3NFZA 3D2MA 4NGRA 4O23A 3S6GA 5KTCA 2VXKA 4C2ZA 5A27A 4MFPA 4DUKA 4OP4A 1CP6A 2RC4A 4IHMA 4MHDA 4B6ZA 2WSAA 4CGPA 1IB1E 2DXQA 2V8GA 4EWTA 2F5IA 1YVKA 2FXFA 2JEVA 1V0CA 4MI4A 4CGLA 2Q43A 4C2YA 4JWPA 2R1IA 2ZEFA 4YU9A 2NSMA 4KVXA 3QAYA 5EMIA 2QYVA 2ARHA 1M4LA 1NSAA 3D7FA 3EY5A 3I9SA 4UWIA 1S7LA 1YX0A 1QSNA 4UIBA 2HC9A 1AMPA 4CAWA 4C7HA 2VZYA 4FUUA 4CYQA 4R7MA 4P6YA 1YSJA 4NF1A 1Z2LA 1P0HA 5I0CA 4X5KA 4UWJA 3NE7A 5K8MA 3S9MA 3ZZIA 1ARMA 2B5GB 4C68A 5AGEA 3W6SA 3SXNA 1Y7RA 1LAMA 1Z9UA 3PB4X 4XPKA 4LQ6A 4LX9A 1Q2DA 4YGOA 3KASA 4ZY0A 5C82A 3IWWA 4OKOA 3WC5A 3D2PA 1MJAA 2Z10A 5IB9A 2YNCC 1CX8A 3JUWA 3R9GA 4ZBGA 2CIJA 4ZYQA 2IQ6A 4KS9A 3IU2A 5H86A 3CDXA 2OZUA 2EBJA 4IK2A 3OWCA 3H8EA 4EFDA 2PJBA 3KKWA 1Y9WA 1Z4EA 2Q4YA 4M6IA 1IY7A 5G1ZA 2CNMA 2BSWA 2Q0YA 2PIYA 1IICA 5LRJA 3SJEA 1BPMA 1TF8A 4X2TA 2IMOA 2PCUA 4OC5A 4M6HA 1CPSA 2Q04A 1ZLHA 3FEDA 3VATA 3GIUA 1QSMA 3FH4A 2BCOA 1Z8LA 2I79A 2JBJA 2REEA 5CPAA 4KOTA 1ZG8A 3NH5A 2V8DA 5G20A 3D3SA 4FD6A 1Q2YA 3IEHA 2O53A 3B2YA 4IUSA 4OC4A 3DR6A 3S9LA 4AVBA 1R57A 1DTDA 4KSIA 4CGNA 2ANPA 2FVGA 3T9YA 1VHOA 2B58A 4OLLA 5G22A 4FD5A 4M3SA 4MCSA 4OADA 3BI0A 4MJ8A 4PXEA 1XIXA 3TE4A 4Z65A 4BD9A 1OZPA 1BOBA 5IV0A 2AJ6A 3V38A 1IOFA 5BWAB 4KSFA 1WWZA 4B11A 3D7GA 4KOSA 4NJRA 5G21A 2YNCA 4MFLA 4P10A 3SXOA 3TO7A 4DJLA 1F57A 2PR1A 2WZNA 3D67A 3B35A 1NSLA 3PBEA 4UCMA 3UY5A 5C88A 4MHNA 4PSXA 3ZJ0A 2C6GA 2Z3NA 2FS5A 4PQAA 3KHXA 3E0KA 5IB0A 4NJQA 3SHPA 2FL4A 2O4HA 4IAVA 4NSQA 3D7HA 4OC0A 3PEIA 5J8CA 1BAVA 4CYPA 3FNCA 4ONUA 5A28A 1M1DA 2F8HA 1LRZA 2PC1A 4KVOE 2PDOA 3WC7A 4F0YA 1YGHA 4KLVA 1AYEA 3CZXA 2BEIA 1CBXA 1M4DA 4ZX9A 2Q4ZA 3GY9A 2PIZA 4ZI6A 3TC8A 3G8WA 3PB7X 3HUVA 1S60A 2C27A 3P2FA 4Y49B 5JM6A 3LACA 3B7IA 1MJBA 3EC4A 4KOVA 4I49A 1ARLA 2DEAA 1VHEA 3IJ3A 2Z3OA 2ZEEA 2P0WA 2KCWA 5JH9A 4TNUA 4CS0B 1IYKA 3I3GA 4BMHA 5CBMA 1LAPA 1J4JA 4JZ0A 1RTQA 2BO9A 3LD2A 5LYIA 2YNDA 4MFKA 4YRHA 5EBVA 4ZY1A 1XOVA 1BLLE 2ZXVA 3CPAA 2B5GA 4MCPA 2AFZA 3CXSA 4A32A 3TOAA 5J1QA 2ZEMA 2XEIA
chains in the Genus database with same CATH topology
1NMTA 1NE9A 2OZHA 1S7NA 4K30A 4AB7A 5KTDA 1L0CA 4CAVA 2CNTA 2FCKA 1KZFA 4B5PB 2P6GA 1YK3A 2Z11A 2NMTA 1YLEA 4CGOA 1B6BA 2OZGA 5HH1A 2FIWA 1I12A 4B14A 1ON0A 2PR8A 4Q36A 2CY2A 1WK4A 2FT0A 4AVCA 3BJ7A 2GE3A 3QAHA 2REFA 4LUAA 4J3GA 2I00A 4Q38A 2PRBA 4Y49C 3S6HA 4IF5A 2ZPAA 4B13A 3TTHA 2EVNA 2HQYA 3EFAA 4UFWA 1S7KA 3TT2A 1IYLA 5AG4A 4OAEA 3GYAA 4XPLA 1XEBA 3WR7A 5F47A 1VHSA 3R96A 2ZW7A 3FBUA 4CYOA 3MGDA 2EUIA 4E0AA 2Z3MA 4KUAA 3VWDA 1M44A 2Z3KA 1VKCA 4UCNA 2HUZA 4MBUA 3FRMA 3W6XA 2Y0MA 3DSBA 4QBJA 3CXQA 2Q7BA 3T90A 1Q2CA 1QSOA 2J8RA 3JTKA 3K9UA 4RI1A 4F6AA 2HV2A 4C7IA 5F48A 5AG5A 4R87A 5F49A 2CNSA 4A33A 2ZW6A 3V8IA 2Z3LA 3VWEA 1YR0A 2YGWA 5IX3A 1YREA 2R98A 4JD6A 5J8FA 3A9LA 4JXRA 4UCPA 2O28A 4L8AA 3FIXA 4CGMA 4XPDC 2AE6A 4U5YA 2B3UA 4FD4A 4QUSA 4PSWA 4CAEA 1XE4A 2Q4VA 5HMNA 4QVTA 4DNCA 4UFVA 3DNSA 5FVJA 4JJXA 5GCNA 4GS4A 5E96A 1I1DA 4KOUA 3R95A 2R7HA 3RYOA 4B5PA 3TO9A 2GIVA 1BO4A 4C2XA 1CJWA 2G3TA 2A4NA 3LODA 4B10A 5DWNA 3H5ZA 2OU2A 4A95A 4R9MA 4HKFA 4JXQA 4PK3A 5KTAA 1K4JA 2Q44A 5AG6A 2ZW5A 3TO6A 4KLWA 3FYNA 2YNEA 2P6FA 4B12A 4HNXB 2WUUA 2BL1A 4KOXA 3B8GA 4E2AA 2ZW4A 3S6FA 4XNHC 4MFJA 5AG7A 4CAFA 3R9FA 3GKRA 4A31A 3C26A 2FSRA 1I21A 2D4OA 2WPWA 1CM0A 4PK2A 2QMLA 3TOBA 3R1KA 3PGPA 2VI7A 2PSWA 4A30A 1IIDA 5H84A 5EC4A 3TCVA 5F46A 1U6MA 2B4BA 4M85A 4CAXA 4KOWA 2B4DA 4U9YA 3IWGA 3W91A 5JPHA 5DWMA 1TIQA 4XPDB 3BJ8A 3CXPA 1MK4A 2GANA 1M4GA 3S6KA 3IU1A 4KORA 4R57A 2JDDA 4JLYA 1MJ9A 4F0XA 1P4NA 3DDDA 2D4PA 1Y9KA 1UFHA 4L89A 1QSRA 4PV6A 1YVOA 4R3KA 2B4DB 3BLNA 3TFYA 3PP9A 4MFQA 4AVAA 2VEZA 4KUBA 4AG9A 3IGRA 3D8PA 3H4QA 3FXTA 5ISVA 2G0BA 1S3ZA 4CRZB 4EVYA 3F8KA 1GHEA 3PZJA 1RXTA 1RO5A 2DPSA 4HNWB 3EO4A 3R9EA 3FB3A 4CRYB 1Z4RA 2G3AA 4A2ZA 4BBHA 2P6EA 4XNHB 2Z3PA 1KUVA 2PQ8A 4U9ZA 4MFZA 2DPTA 4UBRA 4UFXA 4B5OA 4ZGYB 4YFJA 3DR8A 4QC6A 2H5MA 2B3VA 4R3LA 4II9A 4H89A 1KUYA 3N7ZA 4RS2A 1S5KA 4KZTA 2QIRA 2ATRA 2BUEA 1QSTA 3JVNA 3P2HA 4NCZA 1N71A 1XF8A 2OH1A 4UA3A 1FY7A 4AG7A 1ZO0A 1B87A 4NXYA 1XMTA 4FD7A 2WPXA 4ORFA 4H6UA 4H6ZA 4HNYB 2QECA 4MY0A 2JLMA 5JQ4A 2R8VA 1S7FA 2OB0A 4CYNA 2VZZA 2X7BA 4KVME 4NEXA 2J8MA 1PUAA 1M4IA 2IL4A 3QB8A 4KOYA 2VQYA 1SQHA 3G3SA 2CXAA 2VBQA 4MY3A 2FE7A 3F5BA 1PU9A 2Z0ZA 2FIAA 4KSAA 4QB9A 4E8OA 3IWEA 5CNPA 3EXNA 2K5TA 3F0AA 2J8NA 2JDCA 1KUXA 5KTCA 3D2MA 3S6GA 2VXKA 4C2ZA 5A27A 4MFPA 2RC4A 4MHDA 2WSAA 4CGPA 1IB1E 2DXQA 2F5IA 1YVKA 2FXFA 2JEVA 1V0CA 4MI4A 4CGLA 4C2YA 4JWPA 2R1IA 4KVXA 2ARHA 3EY5A 3I9SA 4UWIA 1S7LA 1YX0A 1QSNA 4CAWA 4C7HA 2VZYA 4CYQA 4NF1A 1P0HA 5I0CA 4X5KA 4UWJA 3NE7A 3ZZIA 2B5GB 4C68A 5AGEA 3W6SA 3SXNA 1Y7RA 4YGOA 1Z9UA 4XPKA 5C82A 4LX9A 1Q2DA 3D2PA 1MJAA 2Z10A 2YNCC 3JUWA 3R9GA 4ZBGA 4KS9A 3IU2A 5H86A 2OZUA 3OWCA 3KKWA 1Y9WA 1Z4EA 2Q4YA 5G1ZA 2CNMA 2BSWA 2Q0YA 1IICA 2Q04A 1QSMA 2I79A 2REEA 4KOTA 5G20A 3D3SA 4FD6A 1Q2YA 4IUSA 3DR6A 4AVBA 1R57A 4CGNA 3T9YA 2B58A 4OLLA 5G22A 4FD5A 4M3SA 4OADA 4MJ8A 1XIXA 3TE4A 1OZPA 1BOBA 5IV0A 2AJ6A 5BWAB 4KSFA 1WWZA 4B11A 4KOSA 5G21A 2YNCA 4MFLA 3SXOA 3TO7A 2PR1A 1NSLA 4UCMA 3UY5A 5C88A 4PSXA 3ZJ0A 2Z3NA 2FS5A 3E0KA 5IB0A 3SHPA 2FL4A 4NSQA 5J8CA 4CYPA 3FNCA 4ONUA 5A28A 1M1DA 1LRZA 2PC1A 4KVOE 2PDOA 4F0YA 1YGHA 4KLVA 2BEIA 1M4DA 3GY9A 3G8WA 4Y49B 1S60A 2C27A 3P2FA 1MJBA 3EC4A 4KOVA 4I49A 2Z3OA 2P0WA 2KCWA 4CS0B 1IYKA 3I3GA 4BMHA 1J4JA 3LD2A 2YNDA 4MFKA 4YRHA 5EBVA 2ZXVA 2B5GA 3CXSA 4A32A 3TOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NMT A;  1NE9 A;  2OZH A;  1S7N A;  4K30 A;  4AB7 A;  5KTD A;  1L0C A;  4CAV A;  2CNT A;  2FCK A;  1KZF A;  4B5P B;  2P6G A;  1YK3 A;  2Z11 A;  2NMT A;  1YLE A;  1B6B A;  2OZG A;  5HH1 A;  2FIW A;  1I12 A;  1ON0 A;  2PR8 A;  2CY2 A;  1WK4 A;  2FT0 A;  4AVC A;  3BJ7 A;  2GE3 A;  3QAH A;  2REF A;  4LUA A;  4J3G A;  2I00 A;  2PRB A;  4Y49 C;  3S6H A;  4IF5 A;  2ZPA A;  3TTH A;  2EVN A;  2HQY A;  3EFA A;  1S7K A;  3TT2 A;  1IYL A;  4OAE A;  3GYA A;  4XPL A;  1XEB A;  3WR7 A;  5F47 A;  1VHS A;  3R96 A;  2ZW7 A;  3FBU A;  3MGD A;  2EUI A;  4E0A A;  4KUA A;  3VWD A;  1M44 A;  1VKC A;  2HUZ A;  4MBU A;  3FRM A;  3W6X A;  2Y0M A;  3DSB A;  4QBJ A;  3CXQ A;  2Q7B A;  3T90 A;  1Q2C A;  1QSO A;  2J8R A;  3K9U A;  4RI1 A;  4F6A A;  2HV2 A;  5F48 A;  4R87 A;  5F49 A;  2CNS A;  2ZW6 A;  3V8I A;  3VWE A;  1YR0 A;  5IX3 A;  1YRE A;  2R98 A;  4JD6 A;  5J8F A;  4JXR A;  2O28 A;  4L8A A;  3FIX A;  4XPD C;  2AE6 A;  4U5Y A;  2B3U A;  4FD4 A;  4QUS A;  4PSW A;  1XE4 A;  2Q4V A;  5HMN A;  4QVT A;  4DNC A;  3DNS A;  5FVJ A;  4JJX A;  5GCN A;  4GS4 A;  5E96 A;  1I1D A;  4KOU A;  3R95 A;  2R7H A;  3RYO A;  4B5P A;  3TO9 A;  2GIV A;  1BO4 A;  1CJW A;  2G3T A;  2A4N A;  3LOD A;  5DWN A;  2OU2 A;  4R9M A;  4HKF A;  4JXQ A;  4PK3 A;  5KTA A;  1K4J A;  2Q44 A;  2ZW5 A;  3TO6 A;  4KLW A;  3FYN A;  2P6F A;  4HNX B;  2BL1 A;  4KOX A;  3B8G A;  4E2A A;  2ZW4 A;  3S6F A;  4XNH C;  3R9F A;  3GKR A;  3C26 A;  2FSR A;  1I21 A;  2D4O A;  2WPW A;  1CM0 A;  4PK2 A;  2QML A;  3TOB A;  3R1K A;  3PGP A;  2VI7 A;  2PSW A;  1IID A;  5H84 A;  5EC4 A;  3TCV A;  5F46 A;  1U6M A;  2B4B A;  4M85 A;  4CAX A;  4KOW A;  2B4D A;  4U9Y A;  3IWG A;  3W91 A;  5JPH A;  5DWM A;  1TIQ A;  4XPD B;  3BJ8 A;  3CXP A;  1MK4 A;  2GAN A;  1M4G A;  3S6K A;  4KOR A;  4R57 A;  2JDD A;  4JLY A;  1MJ9 A;  1P4N A;  3DDD A;  2D4P A;  1Y9K A;  1UFH A;  4L89 A;  1QSR A;  4PV6 A;  1YVO A;  4R3K A;  2B4D B;  3BLN A;  3TFY A;  3PP9 A;  4AVA A;  2VEZ A;  4KUB A;  4AG9 A;  3IGR A;  3D8P A;  3H4Q A;  3FXT A;  5ISV A;  2G0B A;  1S3Z A;  4CRZ B;  4EVY A;  3F8K A;  1GHE A;  3PZJ A;  1RXT A;  1RO5 A;  4HNW B;  3EO4 A;  3R9E A;  3FB3 A;  4CRY B;  1Z4R A;  2G3A A;  2P6E A;  4XNH B;  1KUV A;  2PQ8 A;  4U9Z A;  4UBR A;  4B5O A;  4YFJ A;  3DR8 A;  4QC6 A;  2H5M A;  2B3V A;  4R3L A;  4II9 A;  4H89 A;  1KUY A;  3N7Z A;  4RS2 A;  1S5K A;  4KZT A;  2QIR A;  2ATR A;  2BUE A;  1QST A;  3JVN A;  3P2H A;  4NCZ A;  1N71 A;  1XF8 A;  2OH1 A;  4UA3 A;  1FY7 A;  4AG7 A;  1B87 A;  4NXY A;  1XMT A;  4FD7 A;  2WPX A;  4ORF A;  4H6U A;  4H6Z A;  4HNY B;  2QEC A;  4MY0 A;  2JLM A;  5JQ4 A;  2R8V A;  1S7F A;  2OB0 A;  2VZZ A;  2X7B A;  4KVM E;  4NEX A;  2J8M A;  1PUA A;  1M4I A;  2IL4 A;  3QB8 A;  4KOY A;  2VQY A;  1SQH A;  3G3S A;  2VBQ A;  4MY3 A;  2FE7 A;  3F5B A;  1PU9 A;  2Z0Z A;  2FIA A;  4QB9 A;  4E8O A;  5CNP A;  3EXN A;  2K5T A;  3F0A A;  2J8N A;  2JDC A;  1KUX A;  5KTC A;  3D2M A;  3S6G A;  2VXK A;  2RC4 A;  4MHD A;  1IB1 E;  2DXQ A;  2F5I A;  1YVK A;  2FXF A;  2JEV A;  1V0C A;  4MI4 A;  4JWP A;  2R1I A;  4KVX A;  2ARH A;  3EY5 A;  3I9S A;  4UWI A;  1S7L A;  1YX0 A;  1QSN A;  4CAW A;  2VZY A;  4NF1 A;  1P0H A;  5I0C A;  4X5K A;  4UWJ A;  3NE7 A;  3ZZI A;  2B5G B;  3W6S A;  3SXN A;  1Y7R A;  4YGO A;  1Z9U A;  4XPK A;  5C82 A;  4LX9 A;  1Q2D A;  3D2P A;  1MJA A;  2Z10 A;  3JUW A;  3R9G A;  4ZBG A;  5H86 A;  2OZU A;  3OWC A;  3KKW A;  1Y9W A;  1Z4E A;  2Q4Y A;  2CNM A;  2BSW A;  2Q0Y A;  1IIC A;  2Q04 A;  1QSM A;  2I79 A;  2REE A;  4KOT A;  3D3S A;  4FD6 A;  1Q2Y A;  4IUS A;  3DR6 A;  4AVB A;  1R57 A;  3T9Y A;  2B58 A;  4OLL A;  4FD5 A;  4M3S A;  4OAD A;  4MJ8 A;  1XIX A;  3TE4 A;  1OZP A;  1BOB A;  5IV0 A;  2AJ6 A;  1WWZ A;  4KOS A;  3SXO A;  3TO7 A;  2PR1 A;  1NSL A;  3UY5 A;  5C88 A;  4PSX A;  3ZJ0 A;  2FS5 A;  3E0K A;  5IB0 A;  3SHP A;  2FL4 A;  4NSQ A;  5J8C A;  3FNC A;  4ONU A;  1M1D A;  1LRZ A;  2PC1 A;  4KVO E;  2PDO A;  4F0Y A;  1YGH A;  4KLV A;  2BEI A;  1M4D A;  3GY9 A;  3G8W A;  4Y49 B;  1S60 A;  2C27 A;  3P2F A;  1MJB A;  3EC4 A;  4KOV A;  4I49 A;  2P0W A;  2KCW A;  4CS0 B;  1IYK A;  3I3G A;  4BMH A;  1J4J A;  3LD2 A;  4YRH A;  5EBV A;  2ZXV A;  2B5G A;  3CXS A;  3TOA A; 
#chains in the Genus database with same CATH topology
 1NMT A;  2PVV A;  1NE9 A;  2OZH A;  1S7N A;  1ELL P;  4K30 A;  2ABZ A;  5D29 A;  4AB7 A;  5KTD A;  2AFX A;  3D68 A;  1L0C A;  3B3S A;  4CAV A;  2CNT A;  2FCK A;  1KZF A;  4F9V A;  4B5P B;  2P6G A;  5DS0 A;  2RB7 A;  1YK3 A;  1Z8T A;  2EK9 A;  2Z11 A;  3FJU A;  2NMT A;  5F09 A;  1YLE A;  4CGO A;  1B6B A;  2OZG A;  2JBK A;  5HH1 A;  6CPA A;  2FIW A;  2V8H A;  1I12 A;  4B14 A;  4FAI A;  3SJF A;  1ON0 A;  2PR8 A;  4Q36 A;  2CY2 A;  4AXV A;  1WK4 A;  2FT0 A;  4AVC A;  1CG2 A;  1CP7 A;  3BJ7 A;  3FVL A;  2GE3 A;  2PJ4 A;  4G1P A;  3FF3 A;  3QAH A;  4UF4 A;  3SI2 A;  2REF A;  4LUA A;  4J3G A;  2CF4 A;  3MRU A;  2PJ3 A;  3RBU A;  4MCQ A;  2CTB A;  2I00 A;  4BIN A;  4NGP A;  4Q38 A;  2PRB A;  2ODF A;  3SJG A;  3PFE A;  3I1U A;  4Y49 C;  3S6H A;  4IF5 A;  2ZPA A;  4GM5 A;  3TTH A;  2V77 A;  4B13 A;  1Z5R A;  2EVN A;  4P4F A;  2HQY A;  3EFA A;  4UFW A;  4YWY A;  1S7K A;  3KGQ A;  3TT2 A;  1IYL A;  2AFO A;  3GB0 A;  4H2K A;  4MHP A;  5AG4 A;  2AFW A;  1TKH A;  4OAE A;  3GYA A;  4XPL A;  4FWU A;  3ISX A;  1XEB A;  3WR7 A;  1BPN A;  5F47 A;  1VHS A;  3KQZ A;  2ZW7 A;  3R96 A;  3FBU A;  4CYO A;  1LAN A;  3MGD A;  1HDU A;  1VIX A;  2XEJ A;  3K9T A;  2XEF A;  5LYL A;  2EUI A;  4E0A A;  2Z3M A;  8CPA A;  5HVH A;  4KUA A;  3VWD A;  1M44 A;  1XBU A;  1TKJ A;  2Z3K A;  4OME A;  1VKC A;  1QQ9 A;  3CT9 A;  3ISZ A;  3KQX A;  2PJ8 A;  2HUZ A;  4MBU A;  4MMO A;  4UCN A;  3FRM A;  3W6X A;  2XEG A;  4RN7 A;  2Y0M A;  3DSB A;  4QBJ A;  2PJ2 A;  3CXQ A;  2Q7B A;  4PXC A;  1TXR A;  3T90 A;  1Q2C A;  1QSO A;  2J8R A;  2ZEP A;  3JTK A;  1Z8W A;  3K9U A;  3LWU A;  4RI1 A;  2HV2 A;  4F6A A;  4C7I A;  4P44 A;  3H8F A;  5F48 A;  3T8W A;  1ZG9 A;  5AG5 A;  4R87 A;  5F49 A;  2CNS A;  3RAM A;  5K8N A;  2AFU A;  4A33 A;  4OC2 A;  2CTC A;  2ZW6 A;  3V8I A;  4A94 A;  3IC1 A;  1YQE A;  2Z3L A;  4OID A;  3VWE A;  1YR0 A;  2YGW A;  4EME A;  2F7V A;  5IX3 A;  1YRE A;  2R98 A;  4JD6 A;  5J8F A;  3JRU A;  3A9L A;  5ELY A;  4RUH A;  1R3N A;  5JGF A;  4JXR A;  3DLJ A;  4UCP A;  2O28 A;  4L8A A;  3FIX A;  4CGM A;  5K8P A;  4XPD C;  3B3C A;  2AE6 A;  4U5Y A;  4Q7A A;  2B3U A;  3SI1 A;  1IGB A;  4FD4 A;  2BOA A;  4HPS A;  4R76 A;  4QUS A;  3KL9 A;  4F9U A;  4PSW A;  4W9Y A;  4A37 A;  4CAE A;  1XE4 A;  2PJ9 A;  2Q4V A;  5HMN A;  4QVT A;  4DNC A;  1VGY A;  4UFV A;  3BXM A;  4R6T A;  5HXD A;  4P4I A;  3PB8 X;  3DNS A;  5FVJ A;  4JJX A;  5GCN A;  4GS4 A;  1GYT A;  5E96 A;  1I1D A;  3S9N A;  1ZLI A;  4KOU A;  3R95 A;  4CPA A;  2R7H A;  2J9A A;  4A39 A;  3RYO A;  4B5P A;  4WWV A;  2GIV A;  5LYD A;  2ZEO A;  3TO9 A;  1BO4 A;  2GFQ A;  4C2X A;  1CJW A;  2ZED A;  2G3T A;  3D4U A;  2A4N A;  3LOD A;  1XRY A;  4B10 A;  4NGT A;  5DWN A;  4UEF A;  5LRG A;  3L2N A;  2PJ6 A;  3H5Z A;  2OU2 A;  4A95 A;  1Z8X A;  4R9M A;  4HKF A;  4JXQ A;  4NFR A;  1R43 A;  2G9D A;  4PK3 A;  5KTA A;  1K4J A;  2Q44 A;  4ZX8 A;  5AG6 A;  2ZW5 A;  3N5F A;  3V7Z A;  3TO6 A;  4KLW A;  3FYN A;  3RNZ A;  2YNE A;  2P6F A;  3H8G A;  1X12 A;  4ONW A;  1FNO A;  3HLP A;  3B3T A;  4HNX B;  2WUU A;  2PRQ A;  4B12 A;  5K8O A;  1PYT B;  2BL1 A;  4KOX A;  5HVF A;  1YW6 A;  3B8G A;  4E2A A;  2ZW4 A;  4PPZ A;  3S6F A;  4X3R A;  1F2O A;  2EK8 A;  4XNH C;  4MFJ A;  5AG7 A;  4CAF A;  2GU2 A;  3GKR A;  3R9F A;  3KHZ A;  4A31 A;  3C26 A;  2FSR A;  1I21 A;  2D4O A;  2WPW A;  1CM0 A;  2WYR A;  2QML A;  4PK2 A;  3TOB A;  1ZG7 A;  3PRT A;  2ZEH A;  2EO8 A;  4M6G A;  1YW4 A;  3R1K A;  3PGP A;  1Y0R A;  1IOI A;  2VI7 A;  2PSW A;  4NGQ A;  2PJ1 A;  4A30 A;  3WT4 A;  2PJ0 A;  1XFO A;  1Y0Y A;  4P4J A;  3VH9 A;  4JYW A;  1IID A;  5H84 A;  1TF9 A;  5EC4 A;  3TCV A;  5F46 A;  1U6M A;  1LCP A;  2B4B A;  2PJA A;  3PFO A;  4OC1 A;  1H8L A;  4M85 A;  4MXU A;  4CAX A;  4KOW A;  2B4D A;  4UEZ A;  3KR4 A;  4ZY2 A;  4U9Y A;  3IWG A;  4TWE A;  4LQG A;  3W91 A;  2AFS A;  4NGM A;  5JPH A;  5DWM A;  1LOK A;  1TIQ A;  4WJB A;  3KR5 A;  3KI9 A;  4XPD B;  3BJ8 A;  3CXP A;  1MK4 A;  3PB9 X;  1AUG A;  2GAN A;  4FBE A;  1M4G A;  1F2P A;  3WAB A;  3S6K A;  1EE3 P;  3IU1 A;  4KOR A;  4OIW A;  3IIB A;  4R57 A;  1HEE A;  2JDD A;  1JQG A;  2VL1 A;  1MJ9 A;  2AFM A;  4JLY A;  1YME A;  3TX8 A;  4F0X A;  3RZA A;  1P4N A;  3DDD A;  2PJ5 A;  1PCA A;  3FX6 A;  2D4P A;  1IU8 A;  4MHY A;  5D8N A;  1Y9K A;  1UFH A;  4L89 A;  3GUX A;  1QSR A;  4PV6 A;  1YVO A;  4R3K A;  2B4D B;  2OOT A;  3BLN A;  3TFY A;  3SJX A;  1KWM A;  3PP9 A;  2PE3 A;  4MFQ A;  2OR4 A;  2VEZ A;  4AVA A;  3RO0 A;  4KUB A;  5LYF A;  1A2Z A;  4AG9 A;  1Y7E A;  1DE4 C;  3D8P A;  3IGR A;  3H4Q A;  4NGS A;  3FXT A;  5ISV A;  2IJZ A;  3IO1 A;  5LRK A;  4PXB A;  2ZEN A;  4R8F A;  3BI1 A;  2PJ7 A;  2G0B A;  3GLJ A;  1S3Z A;  4PXD A;  4CRZ B;  2PJC A;  4EVY A;  3F8K A;  1GHE A;  3PZJ A;  1RXT A;  3SI0 A;  4F8Z A;  1RO5 A;  2DPS A;  4HNW B;  4P45 A;  3EO4 A;  3R9E A;  3FEC A;  3FB3 A;  4CRY B;  1Z4R A;  2G3A A;  4A2Z A;  3NE8 A;  3MN8 A;  4BBH A;  2P6E A;  2RFH A;  4UIA A;  1XJO A;  2DF5 A;  2C6C A;  4XNH B;  2Z3P A;  1KUV A;  1ELM P;  2PQ8 A;  4U9Z A;  1CPX A;  3VAR A;  4UEE A;  2HB6 A;  4MFZ A;  2DPT A;  4UBR A;  4UFX A;  4B5O A;  1XMB A;  2ZOG A;  3KZW A;  4ZGY B;  4GXH A;  3DGV A;  3NA6 A;  4YFJ A;  3DR8 A;  2GLJ A;  3BHX A;  3FMC A;  4QC6 A;  3NH8 A;  2H5M A;  2B3V A;  4R3L A;  3B3V A;  4II9 A;  1TKF A;  4H89 A;  1KUY A;  2GRE A;  2QVP A;  3N7Z A;  4RS2 A;  1S5K A;  2GLF A;  3D66 A;  2QIR A;  4KZT A;  1OBR A;  2ATR A;  1X10 A;  2JEW A;  2BUE A;  1QST A;  2PVW A;  3JVN A;  3P2H A;  4MHZ A;  4NCZ A;  4P4E A;  1N71 A;  1XF8 A;  1YLO A;  2OH1 A;  2QJ8 A;  4UA3 A;  5HVG A;  3LMS A;  1FY7 A;  2EWB A;  3CPX A;  4AG7 A;  2ZEL A;  1ZO0 A;  1B87 A;  4NXY A;  3B3W A;  1XMT A;  1UWY A;  2WPX A;  4FD7 A;  1Q7L A;  4MCR A;  1LFW A;  3FEE A;  4H6U A;  2V8V A;  2ZEG A;  4H6Z A;  4HNY B;  2QEC A;  4K3N A;  4ORF A;  5THW A;  4MY0 A;  2JLM A;  3NH4 A;  5JQ4 A;  2R8V A;  3D7D A;  1JWQ A;  1QMU A;  1S7F A;  4NGN A;  3WC6 A;  2OB0 A;  4CYN A;  5I4M A;  2VZZ A;  2X7B A;  4KVM E;  4P4B A;  4NEX A;  2J8M A;  1PUA A;  4P4D A;  3K2K A;  1M4I A;  2IL4 A;  3QB8 A;  4KOY A;  2VQY A;  1SQH A;  3G3S A;  2CXA A;  2VBQ A;  2POK A;  3PB6 X;  1HDQ A;  4MY3 A;  4X8I A;  2NYQ A;  2I3C A;  7CPA A;  2FE7 A;  3F5B A;  2ZOF A;  1PU9 A;  2C6P A;  2Q7S A;  3IFE A;  2C1C A;  2Z0Z A;  2FIA A;  3QNV A;  4KSA A;  1FT7 A;  4A38 A;  2Q51 A;  4QB9 A;  3PBB A;  4E8O A;  4DYO A;  3IWE A;  4MRI A;  4OC3 A;  5CNP A;  3EXN A;  2K5T A;  3F0A A;  2J8N A;  2JDC A;  1KUX A;  3NFZ A;  3D2M A;  4NGR A;  4O23 A;  3S6G A;  5KTC A;  2VXK A;  4C2Z A;  5A27 A;  4MFP A;  4DUK A;  4OP4 A;  1CP6 A;  2RC4 A;  4IHM A;  4MHD A;  4B6Z A;  2WSA A;  4CGP A;  1IB1 E;  2DXQ A;  2V8G A;  4EWT A;  2F5I A;  1YVK A;  2FXF A;  2JEV A;  1V0C A;  4MI4 A;  4CGL A;  2Q43 A;  4C2Y A;  4JWP A;  2R1I A;  2ZEF A;  4YU9 A;  2NSM A;  4KVX A;  3QAY A;  5EMI A;  2QYV A;  2ARH A;  1M4L A;  1NSA A;  3D7F A;  3EY5 A;  3I9S A;  4UWI A;  1S7L A;  1YX0 A;  1QSN A;  4UIB A;  2HC9 A;  1AMP A;  4CAW A;  4C7H A;  2VZY A;  4FUU A;  4CYQ A;  4R7M A;  4P6Y A;  1YSJ A;  4NF1 A;  1Z2L A;  1P0H A;  5I0C A;  4X5K A;  4UWJ A;  3NE7 A;  5K8M A;  3S9M A;  3ZZI A;  1ARM A;  2B5G B;  4C68 A;  5AGE A;  3W6S A;  3SXN A;  1Y7R A;  1LAM A;  1Z9U A;  3PB4 X;  4XPK A;  4LQ6 A;  4LX9 A;  1Q2D A;  4YGO A;  3KAS A;  4ZY0 A;  5C82 A;  3IWW A;  4OKO A;  3WC5 A;  3D2P A;  1MJA A;  2Z10 A;  5IB9 A;  2YNC C;  1CX8 A;  3JUW A;  3R9G A;  4ZBG A;  2CIJ A;  4ZYQ A;  2IQ6 A;  4KS9 A;  3IU2 A;  5H86 A;  3CDX A;  2OZU A;  2EBJ A;  4IK2 A;  3OWC A;  3H8E A;  4EFD A;  2PJB A;  3KKW A;  1Y9W A;  1Z4E A;  2Q4Y A;  4M6I A;  1IY7 A;  5G1Z A;  2CNM A;  2BSW A;  2Q0Y A;  2PIY A;  1IIC A;  5LRJ A;  3SJE A;  1BPM A;  1TF8 A;  4X2T A;  2IMO A;  2PCU A;  4OC5 A;  4M6H A;  1CPS A;  2Q04 A;  1ZLH A;  3FED A;  3VAT A;  3GIU A;  1QSM A;  3FH4 A;  2BCO A;  1Z8L A;  2I79 A;  2JBJ A;  2REE A;  5CPA A;  4KOT A;  1ZG8 A;  3NH5 A;  2V8D A;  5G20 A;  3D3S A;  4FD6 A;  1Q2Y A;  3IEH A;  2O53 A;  3B2Y A;  4IUS A;  4OC4 A;  3DR6 A;  3S9L A;  4AVB A;  1R57 A;  1DTD A;  4KSI A;  4CGN A;  2ANP A;  2FVG A;  3T9Y A;  1VHO A;  2B58 A;  4OLL A;  5G22 A;  4FD5 A;  4M3S A;  4MCS A;  4OAD A;  3BI0 A;  4MJ8 A;  4PXE A;  1XIX A;  3TE4 A;  4Z65 A;  4BD9 A;  1OZP A;  1BOB A;  5IV0 A;  2AJ6 A;  3V38 A;  1IOF A;  5BWA B;  4KSF A;  1WWZ A;  4B11 A;  3D7G A;  4KOS A;  4NJR A;  5G21 A;  2YNC A;  4MFL A;  4P10 A;  3SXO A;  3TO7 A;  4DJL A;  1F57 A;  2PR1 A;  2WZN A;  3D67 A;  3B35 A;  1NSL A;  3PBE A;  4UCM A;  3UY5 A;  5C88 A;  4MHN A;  4PSX A;  3ZJ0 A;  2C6G A;  2Z3N A;  2FS5 A;  4PQA A;  3KHX A;  3E0K A;  5IB0 A;  4NJQ A;  3SHP A;  2FL4 A;  2O4H A;  4IAV A;  4NSQ A;  3D7H A;  4OC0 A;  3PEI A;  5J8C A;  1BAV A;  4CYP A;  3FNC A;  4ONU A;  5A28 A;  1M1D A;  2F8H A;  1LRZ A;  2PC1 A;  4KVO E;  2PDO A;  3WC7 A;  4F0Y A;  1YGH A;  4KLV A;  1AYE A;  3CZX A;  2BEI A;  1CBX A;  1M4D A;  4ZX9 A;  2Q4Z A;  3GY9 A;  2PIZ A;  4ZI6 A;  3TC8 A;  3G8W A;  3PB7 X;  3HUV A;  1S60 A;  2C27 A;  3P2F A;  4Y49 B;  5JM6 A;  3LAC A;  3B7I A;  1MJB A;  3EC4 A;  4KOV A;  4I49 A;  1ARL A;  2DEA A;  1VHE A;  3IJ3 A;  2Z3O A;  2ZEE A;  2P0W A;  2KCW A;  5JH9 A;  4TNU A;  4CS0 B;  1IYK A;  3I3G A;  4BMH A;  5CBM A;  1LAP A;  1J4J A;  4JZ0 A;  1RTQ A;  2BO9 A;  3LD2 A;  5LYI A;  2YND A;  4MFK A;  4YRH A;  5EBV A;  4ZY1 A;  1XOV A;  1BLL E;  2ZXV A;  3CPA A;  2B5G A;  4MCP A;  2AFZ A;  3CXS A;  4A32 A;  3TOA A;  5J1Q A;  2ZEM A;  2XEI A; 
#chains in the Genus database with same CATH homology
 1NMT A;  1NE9 A;  2OZH A;  1S7N A;  4K30 A;  4AB7 A;  5KTD A;  1L0C A;  4CAV A;  2CNT A;  2FCK A;  1KZF A;  4B5P B;  2P6G A;  1YK3 A;  2Z11 A;  2NMT A;  1YLE A;  4CGO A;  1B6B A;  2OZG A;  5HH1 A;  2FIW A;  1I12 A;  4B14 A;  1ON0 A;  2PR8 A;  4Q36 A;  2CY2 A;  1WK4 A;  2FT0 A;  4AVC A;  3BJ7 A;  2GE3 A;  3QAH A;  2REF A;  4LUA A;  4J3G A;  2I00 A;  4Q38 A;  2PRB A;  4Y49 C;  3S6H A;  4IF5 A;  2ZPA A;  4B13 A;  3TTH A;  2EVN A;  2HQY A;  3EFA A;  4UFW A;  1S7K A;  3TT2 A;  1IYL A;  5AG4 A;  4OAE A;  3GYA A;  4XPL A;  1XEB A;  3WR7 A;  5F47 A;  1VHS A;  3R96 A;  2ZW7 A;  3FBU A;  4CYO A;  3MGD A;  2EUI A;  4E0A A;  2Z3M A;  4KUA A;  3VWD A;  1M44 A;  2Z3K A;  1VKC A;  4UCN A;  2HUZ A;  4MBU A;  3FRM A;  3W6X A;  2Y0M A;  3DSB A;  4QBJ A;  3CXQ A;  2Q7B A;  3T90 A;  1Q2C A;  1QSO A;  2J8R A;  3JTK A;  3K9U A;  4RI1 A;  4F6A A;  2HV2 A;  4C7I A;  5F48 A;  5AG5 A;  4R87 A;  5F49 A;  2CNS A;  4A33 A;  2ZW6 A;  3V8I A;  2Z3L A;  3VWE A;  1YR0 A;  2YGW A;  5IX3 A;  1YRE A;  2R98 A;  4JD6 A;  5J8F A;  3A9L A;  4JXR A;  4UCP A;  2O28 A;  4L8A A;  3FIX A;  4CGM A;  4XPD C;  2AE6 A;  4U5Y A;  2B3U A;  4FD4 A;  4QUS A;  4PSW A;  4CAE A;  1XE4 A;  2Q4V A;  5HMN A;  4QVT A;  4DNC A;  4UFV A;  3DNS A;  5FVJ A;  4JJX A;  5GCN A;  4GS4 A;  5E96 A;  1I1D A;  4KOU A;  3R95 A;  2R7H A;  3RYO A;  4B5P A;  3TO9 A;  2GIV A;  1BO4 A;  4C2X A;  1CJW A;  2G3T A;  2A4N A;  3LOD A;  4B10 A;  5DWN A;  3H5Z A;  2OU2 A;  4A95 A;  4R9M A;  4HKF A;  4JXQ A;  4PK3 A;  5KTA A;  1K4J A;  2Q44 A;  5AG6 A;  2ZW5 A;  3TO6 A;  4KLW A;  3FYN A;  2YNE A;  2P6F A;  4B12 A;  4HNX B;  2WUU A;  2BL1 A;  4KOX A;  3B8G A;  4E2A A;  2ZW4 A;  3S6F A;  4XNH C;  4MFJ A;  5AG7 A;  4CAF A;  3R9F A;  3GKR A;  4A31 A;  3C26 A;  2FSR A;  1I21 A;  2D4O A;  2WPW A;  1CM0 A;  4PK2 A;  2QML A;  3TOB A;  3R1K A;  3PGP A;  2VI7 A;  2PSW A;  4A30 A;  1IID A;  5H84 A;  5EC4 A;  3TCV A;  5F46 A;  1U6M A;  2B4B A;  4M85 A;  4CAX A;  4KOW A;  2B4D A;  4U9Y A;  3IWG A;  3W91 A;  5JPH A;  5DWM A;  1TIQ A;  4XPD B;  3BJ8 A;  3CXP A;  1MK4 A;  2GAN A;  1M4G A;  3S6K A;  3IU1 A;  4KOR A;  4R57 A;  2JDD A;  4JLY A;  1MJ9 A;  4F0X A;  1P4N A;  3DDD A;  2D4P A;  1Y9K A;  1UFH A;  4L89 A;  1QSR A;  4PV6 A;  1YVO A;  4R3K A;  2B4D B;  3BLN A;  3TFY A;  3PP9 A;  4MFQ A;  4AVA A;  2VEZ A;  4KUB A;  4AG9 A;  3IGR A;  3D8P A;  3H4Q A;  3FXT A;  5ISV A;  2G0B A;  1S3Z A;  4CRZ B;  4EVY A;  3F8K A;  1GHE A;  3PZJ A;  1RXT A;  1RO5 A;  2DPS A;  4HNW B;  3EO4 A;  3R9E A;  3FB3 A;  4CRY B;  1Z4R A;  2G3A A;  4A2Z A;  4BBH A;  2P6E A;  4XNH B;  2Z3P A;  1KUV A;  2PQ8 A;  4U9Z A;  4MFZ A;  2DPT A;  4UBR A;  4UFX A;  4B5O A;  4ZGY B;  4YFJ A;  3DR8 A;  4QC6 A;  2H5M A;  2B3V A;  4R3L A;  4II9 A;  4H89 A;  1KUY A;  3N7Z A;  4RS2 A;  1S5K A;  4KZT A;  2QIR A;  2ATR A;  2BUE A;  1QST A;  3JVN A;  3P2H A;  4NCZ A;  1N71 A;  1XF8 A;  2OH1 A;  4UA3 A;  1FY7 A;  4AG7 A;  1ZO0 A;  1B87 A;  4NXY A;  1XMT A;  4FD7 A;  2WPX A;  4ORF A;  4H6U A;  4H6Z A;  4HNY B;  2QEC A;  4MY0 A;  2JLM A;  5JQ4 A;  2R8V A;  1S7F A;  2OB0 A;  4CYN A;  2VZZ A;  2X7B A;  4KVM E;  4NEX A;  2J8M A;  1PUA A;  1M4I A;  2IL4 A;  3QB8 A;  4KOY A;  2VQY A;  1SQH A;  3G3S A;  2CXA A;  2VBQ A;  4MY3 A;  2FE7 A;  3F5B A;  1PU9 A;  2Z0Z A;  2FIA A;  4KSA A;  4QB9 A;  4E8O A;  3IWE A;  5CNP A;  3EXN A;  2K5T A;  3F0A A;  2J8N A;  2JDC A;  1KUX A;  5KTC A;  3D2M A;  3S6G A;  2VXK A;  4C2Z A;  5A27 A;  4MFP A;  2RC4 A;  4MHD A;  2WSA A;  4CGP A;  1IB1 E;  2DXQ A;  2F5I A;  1YVK A;  2FXF A;  2JEV A;  1V0C A;  4MI4 A;  4CGL A;  4C2Y A;  4JWP A;  2R1I A;  4KVX A;  2ARH A;  3EY5 A;  3I9S A;  4UWI A;  1S7L A;  1YX0 A;  1QSN A;  4CAW A;  4C7H A;  2VZY A;  4CYQ A;  4NF1 A;  1P0H A;  5I0C A;  4X5K A;  4UWJ A;  3NE7 A;  3ZZI A;  2B5G B;  4C68 A;  5AGE A;  3W6S A;  3SXN A;  1Y7R A;  4YGO A;  1Z9U A;  4XPK A;  5C82 A;  4LX9 A;  1Q2D A;  3D2P A;  1MJA A;  2Z10 A;  2YNC C;  3JUW A;  3R9G A;  4ZBG A;  4KS9 A;  3IU2 A;  5H86 A;  2OZU A;  3OWC A;  3KKW A;  1Y9W A;  1Z4E A;  2Q4Y A;  5G1Z A;  2CNM A;  2BSW A;  2Q0Y A;  1IIC A;  2Q04 A;  1QSM A;  2I79 A;  2REE A;  4KOT A;  5G20 A;  3D3S A;  4FD6 A;  1Q2Y A;  4IUS A;  3DR6 A;  4AVB A;  1R57 A;  4CGN A;  3T9Y A;  2B58 A;  4OLL A;  5G22 A;  4FD5 A;  4M3S A;  4OAD A;  4MJ8 A;  1XIX A;  3TE4 A;  1OZP A;  1BOB A;  5IV0 A;  2AJ6 A;  5BWA B;  4KSF A;  1WWZ A;  4B11 A;  4KOS A;  5G21 A;  2YNC A;  4MFL A;  3SXO A;  3TO7 A;  2PR1 A;  1NSL A;  4UCM A;  3UY5 A;  5C88 A;  4PSX A;  3ZJ0 A;  2Z3N A;  2FS5 A;  3E0K A;  5IB0 A;  3SHP A;  2FL4 A;  4NSQ A;  5J8C A;  4CYP A;  3FNC A;  4ONU A;  5A28 A;  1M1D A;  1LRZ A;  2PC1 A;  4KVO E;  2PDO A;  4F0Y A;  1YGH A;  4KLV A;  2BEI A;  1M4D A;  3GY9 A;  3G8W A;  4Y49 B;  1S60 A;  2C27 A;  3P2F A;  1MJB A;  3EC4 A;  4KOV A;  4I49 A;  2Z3O A;  2P0W A;  2KCW A;  4CS0 B;  1IYK A;  3I3G A;  4BMH A;  1J4J A;  3LD2 A;  2YND A;  4MFK A;  4YRH A;  5EBV A;  2ZXV A;  2B5G A;  3CXS A;  4A32 A;  3TOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...