2OB0A

Human mak3 homolog in complex with acetyl-coa
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
154
structure length
154
Chain Sequence
SKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Human MAK3 homolog
publication title Structure of Human MAK3 homolog
rcsb
source organism Homo sapiens
total genus 40
structure length 154
sequence length 154
chains with identical sequence B, C
ec nomenclature ec 2.3.1.258: N-terminal methionine N(alpha)-acetyltransferase NatE.
pdb deposition date 2006-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2ob0A00
3UY5A 3TO7A 1YGHA 1CJWA 1QSRA 3T90A 4QUSA 2B5GA 3EC4A 2B58A 4IUSA 2IL4A 5J8CA 1QSTA 1M44A 2Z0ZA 2BEIA 1IB1E 4MHDA 2FXFA 2Q7BA 1U6MA 3DNSA 4F6AA 4HNYB 4AG7A 3RYOA 4XNHB 1YX0A 4YRHA 1Z9UA 2QECA 4OADA 1FY7A 3EY5A 2VZYA 3G8WA 4H6ZA 2ATRA 1LRZA 2G3AA 3KKWA 1YREA 2D4OA 3GY9A 3FYNA 3VWEA 3FXTA 1S7FA 2ZPAA 3SXNA 4YGOA 4XNHC 1B87A 4R3LA 4U5YA 4NF1A 5JQ4A 2PRBA 3ZZIA 2ZW6A 3R96A 5DWMA 5EC4A 1IIDA 3LODA 4FD5A 2I00A 4NXYA 5IV0A 4U9YA 2ARHA 4PK2A 4B5PB 1MJAA 2HV2A 2F5IA 3QAHA 4NEXA 2FSRA 5KTCA 2B5GB 3B8GA 1I21A 2Q04A 4JD6A 1P4NA 1M4IA 2B3VA 2QMLA 5GCNA 2EUIA 3TCVA 3BJ8A 4KVOE 4H6UA 1XIXA 3CXSA 3W91A 2VBQA 1Z4EA 5I0CA 3DR8A 4MBUA 1QSOA 1P0HA 4II9A 2CY2A 4HNXB 1YLEA 2FT0A 5IX3A 2J8RA 2JEVA 2OZHA 2GIVA 3IWGA 3S6HA 4CRZB 4KVME 5H84A 4NSQA 1XE4A 1WWZA 1I12A 3EFAA 4LUAA 1YVOA 2FIWA 2ZW7A 4AG9A 4KORA 1MJBA 1ON0A 4MI4A 2B4BA 2P0WA 4KLVA 3DDDA 4FD7A 5HMNA 5J8FA 2VZZA 1KZFA 1WK4A 2OZGA 4CAVA 3CXQA 1Y7RA 1S7NA 2QIRA 3FRMA 2FL4A 2B4DA 1N71A 3I9SA 4AB7A 2P6FA 1M4GA 2FIAA 3DR6A 4PSXA 5F48A 2NMTA 2X7BA 3R9FA 4B5PA 1XMTA 5FVJA 1Q2YA 4MY0A 4F0YA 3W6SA 4Y49B 3S6GA 4HNWB 4UWJA 2K5TA 4XPKA 4KLWA 1NMTA 2R98A 5KTDA 1BOBA 3TO6A 5F46A 1IYKA 1VHSA 2FCKA 2B3UA 3VWDA 1VKCA 4KOUA 4CRYB 1Y9WA 2PC1A 1L0CA 1BO4A 2G3TA 1YR0A 3TOAA 3C26A 2KCWA 4UBRA 3PGPA 1M1DA 2B4DB 4RI1A 5F47A 3BJ7A 2FE7A 3S6KA 1QSMA 3OWCA 2PDOA 4KOTA 4ORFA 1PUAA 3P2HA 2Q4VA 1RXTA 2P6EA 2DXQA 1NSLA 2PR8A 4U9ZA 3PP9A 3LD2A 2JLMA 4ONUA 4AVAA 4I49A 4L8AA 3R95A 2REFA 4QC6A 2VEZA 4E8OA 4LX9A 2FS5A 1S7KA 3TOBA 4KOWA 4MY3A 3MGDA 3TO9A 5KTAA 2CNMA 3FNCA 5HH1A 2HQYA 3N7ZA 4B5OA 4BMHA 2R8VA 3R1KA 2G0BA 5ISVA 4X5KA 2Q0YA 4MJ8A 5DWNA 3P2FA 2A4NA 4R9MA 4L89A 1K4JA 2PQ8A 3D8PA 2CNTA 2Z10A 2GANA 1UFHA 4AVBA 4KUBA 3TFYA 3K9UA 4FD4A 1M4DA 2VXKA 5CNPA 2VQYA 3GYAA 1I1DA 1XEBA 2R7HA 2JDCA 1OZPA 2BUEA 2OU2A 3JUWA 4H89A 3IGRA 2GE3A 3WR7A 1NE9A 3TE4A 4FD6A 3F8KA 4PK3A 2J8NA 2Y0MA 1PU9A 3DSBA 2Q44A 1S3ZA 4KOXA 1Y9KA 1MJ9A 2Z11A 2WPWA 1Q2DA 5C88A 2O28A 2ZXVA 3ZJ0A 1MK4A 4Y49C 4E2AA 3R9EA 3SXOA 5IB0A 4KUAA 4YFJA 4DNCA 4KOSA 4EVYA 4CS0B 3V8IA 1V0CA 2VI7A 4OLLA 1SQHA 2OB0A 4K30A 4QVTA 4KZTA 3W6XA 3SHPA 2AJ6A 4UA3A 1YVKA 5E96A 4M85A 2C27A 1KUYA 4NCZA 4PSWA 4E0AA 1S7LA 4XPDB 3BLNA 4M3SA 5C82A 1XF8A 4KOVA 1GHEA 3F0AA 3R9GA 2OZUA 4UWIA 1IICA 4IF5A 1IYLA 2REEA 4XPDC 4CAWA 4RS2A 3EXNA 5JPHA 2I79A 3TT2A 5H86A 3JVNA 3D2PA 3GKRA 3QB8A 1CM0A 3D3SA 1YK3A 4JWPA 2OH1A 3FBUA 3T9YA 1S60A 2P6GA 2EVNA 4OAEA 5EBVA 1J4JA 4JJXA 2H5MA 2BL1A 4R87A 3CXPA 1Q2CA 2Q4YA 1KUXA 2RC4A 2PSWA 4QBJA 2ZW5A 4ZBGA 4AVCA 3PZJA 4JXQA 3I3GA 5F49A 2ZW4A 4PV6A 4R57A 2CNSA 2AE6A 4JXRA 1KUVA 1S5KA 3FIXA 1R57A 2J8MA 1B6BA 2R1IA 4CAXA 1Z4RA 1TIQA 3NE7A 3TTHA 4J3GA 4KOYA 3F5BA 4HKFA 3E0KA 2PR1A 4R3KA 3G3SA 4QB9A 1RO5A 1QSNA 2JDDA 4GS4A 2D4PA 2HUZA 4KVXA 4JLYA 3FB3A 3H4QA 2BSWA 3S6FA 3EO4A 4XPLA 3D2MA 2WPXA
chains in the Genus database with same CATH superfamily
2WZNA 4MCPA 2RB7A 4MFLA 3UY5A 4B6ZA 4A95A 1LANA 3TO7A 1YGHA 4F9VA 1CJWA 2PJ5A 1QSRA 3T90A 4QUSA 2B5GA 1H8LA 3EC4A 2B58A 4IUSA 5JH9A 2AFXA 2IL4A 5J8CA 2V8DA 1QSTA 2RFHA 1M44A 2YNCA 2Z0ZA 4JZ0A 2BEIA 3B7IA 1IB1E 4MHDA 2FXFA 4H2KA 1FNOA 2Q7BA 3GLJA 1PCAA 2ANPA 1U6MA 3DNSA 4OC5A 4F6AA 4HNYB 4C2YA 7CPAA 4AG7A 4B14A 1IY7A 4OC3A 2PE3A 3RYOA 4XNHB 2DPTA 1YX0A 2O53A 4YRHA 1Z9UA 4M6IA 2QECA 2V8GA 1FY7A 4OADA 2NYQA 3EY5A 3RO0A 2VZYA 2HB6A 1PYTB 2WYRA 3G8WA 4H6ZA 2ATRA 1LRZA 2G3AA 3KKWA 1YREA 2D4OA 3GIUA 3GY9A 2YNEA 3FYNA 3VWEA 3FXTA 3PB6X 1NSAA 1S7FA 4UEZA 4PXBA 2AFUA 2ZPAA 1BPMA 3CT9A 4OC4A 4YGOA 3SXNA 4XNHC 4CGMA 1B87A 2PJ4A 3B3VA 4K3NA 3WC5A 4P44A 3QNVA 4R3LA 4IK2A 4U5YA 3D7HA 5D8NA 4NF1A 5HVGA 5AG4A 4DYOA 5JQ4A 1TKFA 4C2XA 4NGSA 2PRBA 3D7FA 2PJ3A 1YW4A 4M6GA 3ZZIA 1ZLHA 1X12A 2ZW6A 3NH4A 5DWMA 3R96A 3HLPA 2PJ0A 5EC4A 2PIYA 1IIDA 3LODA 4FD5A 2I00A 1LFWA 4NXYA 5IV0A 4FWUA 4U9YA 2ARHA 4PK2A 3B3CA 4B5PB 1CPSA 2J9AA 3NE8A 1MJAA 2HV2A 2F5IA 3QAHA 5D29A 3VATA 4NEXA 5I4MA 5CBMA 2OOTA 2FSRA 2PJ6A 3RBUA 5KTCA 2B5GB 3K9TA 3B8GA 5AG6A 5LRJA 1I21A 3KHXA 1IOFA 3TX8A 2Q04A 4JD6A 1HDUA 1P4NA 1M4IA 2B3VA 2QMLA 1ELMP 2ZEPA 4KSFA 5GCNA 2EUIA 2Z3NA 3B3WA 3BJ8A 4KVOE 3TCVA 3PB7X 4H6UA 4PXEA 1XIXA 2NSMA 4F8ZA 4CGNA 3CXSA 3W91A 2VBQA 1Z4EA 5I0CA 3DR8A 3FH4A 2AFSA 3PBBA 4MBUA 1TXRA 1QSOA 3CZXA 3NH5A 8CPAA 1P0HA 4NGPA 4II9A 1BAVA 3RNZA 2CY2A 3NA6A 2YNCC 4HNXB 1YLEA 2AFMA 2PJAA 2ZEHA 2FT0A 5IX3A 1IGBA 3IO1A 2J8RA 1HDQA 2JEVA 2GIVA 2OZHA 3IWGA 3S6HA 4CRZB 4C7IA 4KVME 4OC1A 5H84A 4NSQA 1XE4A 1BPNA 1WWZA 4O23A 2F8HA 4UEFA 1I12A 3EFAA 1DE4C 3D68A 4LUAA 3VH9A 1YVOA 4P6YA 2FIWA 2ZW7A 1LCPA 4AG9A 3FF3A 3BHXA 4KORA 1XFOA 3TC8A 1XMBA 1GYTA 2Q51A 5LYDA 1MJBA 2JBJA 3KR5A 2EBJA 1ON0A 3T8WA 1Y7EA 4MI4A 3N5FA 4KS9A 2B4BA 2P0WA 4KLVA 1Y0YA 1YQEA 2BCOA 3DGVA 3DDDA 3IJ3A 3KHZA 4FD7A 3B3SA 1TF8A 4PPZA 1RTQA 2ZEOA 5HMNA 5J8FA 4W9YA 2VZZA 1KZFA 5LYLA 4CYQA 1WK4A 2OZGA 4CAVA 3CXQA 4LQ6A 1Y7RA 1S7NA 2QIRA 2QVPA 3FRMA 2C6CA 2B4DA 2FL4A 3KQXA 1N71A 3I9SA 2DEAA 4MFZA 4AB7A 4FBEA 4RUHA 2P6FA 1M4GA 2FIAA 5LRGA 2ABZA 3DR6A 4Q36A 4PSXA 2Z3KA 2DF5A 1YW6A 4EWTA 1BLLE 5F48A 2NMTA 4MFJA 3JTKA 2X7BA 3R9FA 5LYIA 1XMTA 4B5PA 4IHMA 4X2TA 5FVJA 1Q2YA 3FEEA 4MY0A 3IC1A 2PJ2A 4MCRA 4A32A 4F0YA 4UFXA 1M4LA 1F57A 1ZG9A 2IJZA 2AFZA 4ONWA 4GM5A 4R6TA 4Y49B 3W6SA 2GLFA 4FUUA 3S6GA 4HNWB 4F9UA 4UWJA 4R76A 1TKJA 2K5TA 3V38A 2PJ9A 4KLWA 1NMTA 4XPKA 2R98A 5KTDA 2F7VA 1BOBA 3TO6A 5F46A 1IYKA 2FCKA 1CX8A 1VHSA 1XBUA 2FVGA 2PRQA 5K8MA 4ZGYB 2PJ1A 2B3UA 4UIAA 3ISXA 3KZWA 3VWDA 2HC9A 1VKCA 4KOUA 2IQ6A 5IB9A 3KGQA 4CRYB 1IOIA 1Y9WA 2PC1A 3IU2A 4MMOA 1L0CA 2XEIA 1AUGA 4WWVA 4UCNA 3WABA 4CGOA 1BO4A 2ZENA 1R3NA 3PFEA 4JYWA 1CBXA 2G3TA 2ZELA 1A2ZA 1YR0A 2ZEEA 5EMIA 5G21A 1VHEA 1F2OA 3NH8A 4KSAA 4ZY1A 3H8EA 1LAMA 5ELYA 3TOAA 3C26A 2KCWA 4UBRA 5G20A 2IMOA 3LWUA 3S9MA 4C68A 1TF9A 3PGPA 1HEEA 4DUKA 3QAYA 5AGEA 2ZEMA 1M1DA 2B4DB 4M6HA 4RI1A 4UFVA 5DS0A 1Z2LA 1VHOA 4UFWA 5F47A 4AXVA 4ZI6A 3BJ7A 3I1UA 2FE7A 2Q43A 2QJ8A 1QSMA 3S6KA 4B10A 3HUVA 4PXCA 3PB4X 3OWCA 2PDOA 4MCQA 4KOTA 4ORFA 1PUAA 2PJ8A 3P2HA 4MFQA 2Q4VA 4ZX8A 1RXTA 2P6EA 4RN7A 1YSJA 3D4UA 2DXQA 3PRTA 2V8HA 1NSLA 4NGTA 4P4BA 2PR8A 1XJOA 1Z8XA 4U9ZA 3K2KA 3PP9A 3KASA 3LD2A 4A30A 2JLMA 4ONUA 3IEHA 4AVAA 2XEFA 1UWYA 4MHYA 4A39A 4UIBA 4CGPA 3S9LA 4I49A 4L8AA 3R95A 1OBRA 2REFA 3FMCA 4P4FA 4ZY2A 3B2YA 4HPSA 3ISZA 5G1ZA 4A94A 3H8FA 4LQGA 4WJBA 4GXHA 3B3TA 4NJQA 2BO9A 3H8GA 4QC6A 1ELLP 2VEZA 4MXUA 4TWEA 4YWYA 4CYNA 4E8OA 5LYFA 3LMSA 4LX9A 4OMEA 2FS5A 1S7KA 3TOBA 3IWWA 4KOWA 2XEJA 3MGDA 4MY3A 3TO9A 4A37A 2CNMA 5JGFA 5KTAA 1EE3P 5AG7A 3SJEA 5K8OA 4TNUA 3FNCA 5J1QA 4CAFA 5HH1A 3A9LA 3SJXA 2HQYA 3N7ZA 4P4JA 3IIBA 5G22A 3FX6A 4B5OA 4BMHA 2Q7SA 2R8VA 3SI0A 4EMEA 3D7GA 3R1KA 1JWQA 4BBHA 3SJGA 4R8FA 2G0BA 3RAMA 5ISVA 4X5KA 2Q0YA 1Z5RA 4MJ8A 5DWNA 3BI0A 3FVLA 3P2FA 2A4NA 1VGYA 2DPSA 4R9MA 1Z8LA 4EFDA 2PVVA 4L89A 1K4JA 5K8NA 3MRUA 2PQ8A 3GB0A 1CG2A 2CNTA 3D8PA 3NFZA 1QMUA 2Z10A 2GANA 1AMPA 1UFHA 4AVBA 5JM6A 4PXDA 4KUBA 3TFYA 1VIXA 3K9UA 4MHPA 1DTDA 1M4DA 2VXKA 3FECA 1ARLA 2VQYA 3GYAA 3KL9A 4FD4A 5CNPA 2Q4ZA 2GU2A 1I1DA 1XEBA 2R7HA 2JDCA 4R7MA 1OZPA 2VL1A 2BUEA 1Q7LA 1Y0RA 2OU2A 3JUWA 4H89A 3WC7A 3IGRA 1XRYA 5LRKA 3KQZA 1YLOA 2GE3A 2Z3LA 1LOKA 4B12A 4P4EA 5HVHA 3WR7A 1CPXA 1F2PA 1NE9A 1XOVA 3F8KA 4FD6A 4PK3A 2J8NA 2Y0MA 2ZOGA 1PU9A 2O4HA 2ZOFA 3DSBA 2Q44A 1S3ZA 1YMEA 4P10A 2EWBA 2PJBA 2GFQA 4KOXA 2BOAA 1Y9KA 1MJ9A 3CPXA 3D67A 1CP6A 2Z11A 2WPWA 3IFEA 4P45A 1Q2DA 4NFRA 4UF4A 5C88A 2O28A 2C6PA 2GLJA 2ZXVA 2EK9A 4B13A 3CDXA 3ZJ0A 2AFOA 1MK4A 3PB8X 4Y49C 4E2AA 3R9EA 3SXOA 5IB0A 1Z8WA 4KUAA 4YFJA 4ZYQA 4F0XA 4DNCA 1JQGA 4KOSA 5HXDA 4EVYA 4CS0B 4NGMA 3V8IA 5THWA 4UEEA 1V0CA 2C1CA 2VI7A 2ODFA 4OLLA 1SQHA 3KR4A 2OB0A 4X8IA 1QQ9A 4K30A 4KZTA 4QVTA 3JRUA 1CP7A 4OIWA 3W6XA 2CTBA 3B35A 3SHPA 2AJ6A 2QYVA 1X10A 4UA3A 1YVKA 4A38A 5E96A 4M85A 2C27A 1KUYA 2YGWA 3PEIA 4CAEA 3H5ZA 4NCZA 4PSWA 2PIZA 4MRIA 4NGQA 4E0AA 5A27A 2JBKA 1S7LA 4XPDB 3BLNA 4M3SA 4YU9A 5C82A 1XF8A 4P4DA 3CPAA 4KOVA 3D66A 1GHEA 6CPAA 3F0AA 1Z8TA 3R9GA 2V77A 4NGNA 4MFPA 3V7ZA 2OZUA 2PJCA 4UWIA 1IICA 4IF5A 1IU8A 4C7HA 3DLJA 1IYLA 3BI1A 2REEA 4OIDA 4OC0A 3IWEA 1FT7A 4XPDC 2POKA 3VARA 2Z3PA 4CPAA 4CAWA 4RS2A 3PFOA 2AFWA 3EXNA 5JPHA 3RZAA 3BXMA 2I79A 3TT2A 5HVFA 5H86A 3D7DA 3JVNA 4A33A 3GUXA 3D2PA 3GKRA 4MCSA 3QB8A 3WT4A 1CM0A 3TE4A 2ZEFA 3D3SA 2YNDA 2Z3MA 4DJLA 1YK3A 1TKHA 4JWPA 4UCPA 2OH1A 4NJRA 3FBUA 1AYEA 3T9YA 1S60A 4Q7AA 2P6GA 4ZY0A 4NGRA 2EVNA 5AG5A 4OAEA 5EBVA 4A31A 1J4JA 4JJXA 2H5MA 3FEDA 2I3CA 2BL1A 4G1PA 3CXPA 4R87A 1KWMA 1Q2CA 2Q4YA 2V8VA 1KUXA 2RC4A 2PSWA 3SI2A 4PQAA 4BINA 4CYPA 4QBJA 2CTCA 2ZW5A 2WUUA 4ZBGA 4AVCA 2Z3OA 4KSIA 4Z65A 3PZJA 2C6GA 4ZX9A 4IAVA 2GREA 4OC2A 3S9NA 1ARMA 1R43A 2ZEDA 4UCMA 4OP4A 4MFKA 4JXQA 3I3GA 2G9DA 5F49A 2ZW4A 4PV6A 3MN8A 3WC6A 3L2NA 4P4IA 4R57A 2CNSA 5A28A 3LACA 2CIJA 5CPAA 3IU1A 2ZEGA 2AE6A 4JXRA 1LAPA 1KUVA 1S5KA 3FIXA 3PBEA 2PVWA 1R57A 2J8MA 1B6BA 2OR4A 4MHZA 2CF4A 2PCUA 2R1IA 4CAXA 1Z4RA 1ZO0A 4CGLA 2EK8A 1TIQA 1ZG8A 3NE7A 4MHNA 3TTHA 4J3GA 2PJ7A 4KOYA 4Q38A 3F5BA 4HKFA 5F09A 2WSAA 2XEGA 2JEWA 3E0KA 3SI1A 4C2ZA 3SJFA 4A2ZA 5BWAB 2PR1A 1ZLIA 3KI9A 3G3SA 4QB9A 1RO5A 1QSNA 4R3KA 4X3RA 4B11A 2JDDA 4GS4A 4OKOA 2EO8A 4CYOA 2D4PA 3FJUA 2HUZA 4KVXA 3PB9X 1ZG7A 3FB3A 4JLYA 3H4QA 4FAIA 4BD9A 2BSWA 3S6FA 3EO4A 4XPLA 2CXAA 3D2MA 2WPXA 5K8PA
chains in the Genus database with same CATH topology
4MFLA 3UY5A 4A95A 3TO7A 1YGHA 1CJWA 1QSRA 3T90A 4QUSA 2B5GA 3EC4A 2B58A 4IUSA 2IL4A 5J8CA 1QSTA 1M44A 2YNCA 2Z0ZA 2BEIA 1IB1E 4MHDA 2FXFA 2Q7BA 1U6MA 3DNSA 4F6AA 4HNYB 4C2YA 4AG7A 4B14A 3RYOA 4XNHB 2DPTA 1YX0A 4YRHA 1Z9UA 2QECA 4OADA 1FY7A 3EY5A 2VZYA 3G8WA 4H6ZA 2ATRA 1LRZA 2G3AA 3KKWA 1YREA 2D4OA 3GY9A 2YNEA 3FYNA 3VWEA 3FXTA 1S7FA 2ZPAA 3SXNA 4CGMA 4YGOA 4XNHC 1B87A 4R3LA 4U5YA 4NF1A 5JQ4A 5AG4A 4C2XA 2PRBA 3ZZIA 2ZW6A 3R96A 5DWMA 5EC4A 1IIDA 3LODA 4FD5A 2I00A 4NXYA 5IV0A 4U9YA 2ARHA 4PK2A 4B5PB 1MJAA 2HV2A 2F5IA 3QAHA 4NEXA 2FSRA 5KTCA 2B5GB 3B8GA 5AG6A 1I21A 2Q04A 4JD6A 1P4NA 1M4IA 2B3VA 2QMLA 4KSFA 5GCNA 2EUIA 2Z3NA 3TCVA 3BJ8A 4KVOE 4H6UA 1XIXA 4CGNA 3CXSA 3W91A 2VBQA 1Z4EA 5I0CA 3DR8A 4MBUA 1QSOA 1P0HA 4II9A 2CY2A 2YNCC 4HNXB 1YLEA 2FT0A 5IX3A 2J8RA 2JEVA 2OZHA 2GIVA 3IWGA 3S6HA 4CRZB 4C7IA 4KVME 5H84A 4NSQA 1XE4A 1WWZA 1I12A 3EFAA 4LUAA 1YVOA 2FIWA 2ZW7A 4AG9A 4KORA 1MJBA 1ON0A 4MI4A 4KS9A 2B4BA 2P0WA 4KLVA 3DDDA 4FD7A 5HMNA 5J8FA 2VZZA 1KZFA 4CYQA 1WK4A 2OZGA 4CAVA 3CXQA 1Y7RA 1S7NA 2QIRA 3FRMA 2FL4A 2B4DA 4MFZA 1N71A 3I9SA 4AB7A 2P6FA 1M4GA 2FIAA 3DR6A 4Q36A 4PSXA 2Z3KA 5F48A 2NMTA 4MFJA 3JTKA 2X7BA 3R9FA 4B5PA 1XMTA 5FVJA 1Q2YA 4MY0A 4A32A 4F0YA 4UFXA 3W6SA 4Y49B 3S6GA 4HNWB 4UWJA 2K5TA 4XPKA 4KLWA 1NMTA 2R98A 5KTDA 1BOBA 3TO6A 5F46A 1IYKA 1VHSA 2FCKA 4ZGYB 2B3UA 3VWDA 1VKCA 4KOUA 4CRYB 3IU2A 1Y9WA 2PC1A 1L0CA 4UCNA 4CGOA 1BO4A 2G3TA 1YR0A 5G21A 4KSAA 3TOAA 3C26A 2KCWA 4UBRA 5G20A 4C68A 3PGPA 5AGEA 1M1DA 2B4DB 4RI1A 4UFVA 4UFWA 5F47A 3BJ7A 2FE7A 3S6KA 1QSMA 4B10A 3OWCA 2PDOA 4KOTA 4ORFA 1PUAA 3P2HA 4MFQA 2Q4VA 1RXTA 2P6EA 2DXQA 1NSLA 2PR8A 4U9ZA 3PP9A 3LD2A 4A30A 2JLMA 4ONUA 4AVAA 4CGPA 4I49A 4L8AA 3R95A 2REFA 5G1ZA 4QC6A 4CYNA 2VEZA 4E8OA 4LX9A 2FS5A 1S7KA 3TOBA 4KOWA 4MY3A 3MGDA 3TO9A 5KTAA 2CNMA 5AG7A 3FNCA 4CAFA 5HH1A 3A9LA 2HQYA 3N7ZA 5G22A 4B5OA 4BMHA 2R8VA 3R1KA 4BBHA 2G0BA 5ISVA 4X5KA 2Q0YA 4MJ8A 5DWNA 3P2FA 2A4NA 2DPSA 4R9MA 4L89A 1K4JA 2PQ8A 3D8PA 2CNTA 2Z10A 2GANA 1UFHA 4AVBA 4KUBA 3TFYA 3K9UA 4FD4A 1M4DA 2VXKA 5CNPA 2VQYA 3GYAA 1I1DA 1XEBA 2R7HA 2JDCA 1OZPA 2BUEA 2OU2A 3JUWA 4H89A 3IGRA 2GE3A 2Z3LA 4B12A 3WR7A 1NE9A 3TE4A 4FD6A 3F8KA 4PK3A 2J8NA 2Y0MA 1PU9A 3DSBA 2Q44A 1S3ZA 4KOXA 1Y9KA 1MJ9A 2Z11A 2WPWA 1Q2DA 5C88A 2O28A 2ZXVA 4B13A 3ZJ0A 1MK4A 4Y49C 4E2AA 3R9EA 3SXOA 5IB0A 4KUAA 4YFJA 4F0XA 4DNCA 4KOSA 4EVYA 4CS0B 3V8IA 1V0CA 2VI7A 4OLLA 1SQHA 2OB0A 4K30A 4QVTA 4KZTA 3W6XA 3SHPA 2AJ6A 4UA3A 1YVKA 5E96A 4M85A 2C27A 1KUYA 2YGWA 4CAEA 3H5ZA 4NCZA 4PSWA 5A27A 4E0AA 1S7LA 4XPDB 3BLNA 4M3SA 5C82A 1XF8A 4KOVA 1GHEA 3F0AA 3R9GA 4MFPA 2OZUA 4UWIA 1IICA 4IF5A 4C7HA 1IYLA 2REEA 3IWEA 4XPDC 2Z3PA 4CAWA 4RS2A 3EXNA 5JPHA 2I79A 3TT2A 5H86A 3JVNA 4A33A 3D2PA 3GKRA 3QB8A 1CM0A 3D3SA 2YNDA 2Z3MA 1YK3A 4JWPA 4UCPA 2OH1A 3FBUA 3T9YA 1S60A 2P6GA 5AG5A 2EVNA 4OAEA 5EBVA 4A31A 1J4JA 4JJXA 2H5MA 2BL1A 4R87A 3CXPA 1Q2CA 2Q4YA 1KUXA 2RC4A 2PSWA 4CYPA 4QBJA 2ZW5A 2WUUA 4ZBGA 4AVCA 2Z3OA 3PZJA 4UCMA 4MFKA 4JXQA 3I3GA 5F49A 2ZW4A 4PV6A 4R57A 2CNSA 5A28A 3IU1A 2AE6A 4JXRA 1KUVA 1S5KA 3FIXA 1R57A 2J8MA 1B6BA 2R1IA 4CAXA 1Z4RA 1ZO0A 4CGLA 1TIQA 3NE7A 3TTHA 4J3GA 4KOYA 4Q38A 3F5BA 4HKFA 2WSAA 3E0KA 4C2ZA 4A2ZA 5BWAB 2PR1A 4R3KA 3G3SA 4QB9A 1RO5A 1QSNA 4B11A 2JDDA 4GS4A 4CYOA 2D4PA 2HUZA 4KVXA 4JLYA 3FB3A 3H4QA 2BSWA 3S6FA 3EO4A 4XPLA 2CXAA 3D2MA 2WPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UY5 A;  3TO7 A;  1YGH A;  1CJW A;  1QSR A;  3T90 A;  4QUS A;  2B5G A;  3EC4 A;  2B58 A;  4IUS A;  2IL4 A;  5J8C A;  1QST A;  1M44 A;  2Z0Z A;  2BEI A;  1IB1 E;  4MHD A;  2FXF A;  2Q7B A;  1U6M A;  3DNS A;  4F6A A;  4HNY B;  4AG7 A;  3RYO A;  4XNH B;  1YX0 A;  4YRH A;  1Z9U A;  2QEC A;  4OAD A;  1FY7 A;  3EY5 A;  2VZY A;  3G8W A;  4H6Z A;  2ATR A;  1LRZ A;  2G3A A;  3KKW A;  1YRE A;  2D4O A;  3GY9 A;  3FYN A;  3VWE A;  3FXT A;  1S7F A;  2ZPA A;  3SXN A;  4YGO A;  4XNH C;  1B87 A;  4R3L A;  4U5Y A;  4NF1 A;  5JQ4 A;  2PRB A;  3ZZI A;  2ZW6 A;  3R96 A;  5DWM A;  5EC4 A;  1IID A;  3LOD A;  4FD5 A;  2I00 A;  4NXY A;  5IV0 A;  4U9Y A;  2ARH A;  4PK2 A;  4B5P B;  1MJA A;  2HV2 A;  2F5I A;  3QAH A;  4NEX A;  2FSR A;  5KTC A;  2B5G B;  3B8G A;  1I21 A;  2Q04 A;  4JD6 A;  1P4N A;  1M4I A;  2B3V A;  2QML A;  5GCN A;  2EUI A;  3TCV A;  3BJ8 A;  4KVO E;  4H6U A;  1XIX A;  3CXS A;  3W91 A;  2VBQ A;  1Z4E A;  5I0C A;  3DR8 A;  4MBU A;  1QSO A;  1P0H A;  4II9 A;  2CY2 A;  4HNX B;  1YLE A;  2FT0 A;  5IX3 A;  2J8R A;  2JEV A;  2OZH A;  2GIV A;  3IWG A;  3S6H A;  4CRZ B;  4KVM E;  5H84 A;  4NSQ A;  1XE4 A;  1WWZ A;  1I12 A;  3EFA A;  4LUA A;  1YVO A;  2FIW A;  2ZW7 A;  4AG9 A;  4KOR A;  1MJB A;  1ON0 A;  4MI4 A;  2B4B A;  2P0W A;  4KLV A;  3DDD A;  4FD7 A;  5HMN A;  5J8F A;  2VZZ A;  1KZF A;  1WK4 A;  2OZG A;  4CAV A;  3CXQ A;  1Y7R A;  1S7N A;  2QIR A;  3FRM A;  2FL4 A;  2B4D A;  1N71 A;  3I9S A;  4AB7 A;  2P6F A;  1M4G A;  2FIA A;  3DR6 A;  4PSX A;  5F48 A;  2NMT A;  2X7B A;  3R9F A;  4B5P A;  1XMT A;  5FVJ A;  1Q2Y A;  4MY0 A;  4F0Y A;  3W6S A;  4Y49 B;  3S6G A;  4HNW B;  4UWJ A;  2K5T A;  4XPK A;  4KLW A;  1NMT A;  2R98 A;  5KTD A;  1BOB A;  3TO6 A;  5F46 A;  1IYK A;  1VHS A;  2FCK A;  2B3U A;  3VWD A;  1VKC A;  4KOU A;  4CRY B;  1Y9W A;  2PC1 A;  1L0C A;  1BO4 A;  2G3T A;  1YR0 A;  3TOA A;  3C26 A;  2KCW A;  4UBR A;  3PGP A;  1M1D A;  2B4D B;  4RI1 A;  5F47 A;  3BJ7 A;  2FE7 A;  3S6K A;  1QSM A;  3OWC A;  2PDO A;  4KOT A;  4ORF A;  1PUA A;  3P2H A;  2Q4V A;  1RXT A;  2P6E A;  2DXQ A;  1NSL A;  2PR8 A;  4U9Z A;  3PP9 A;  3LD2 A;  2JLM A;  4ONU A;  4AVA A;  4I49 A;  4L8A A;  3R95 A;  2REF A;  4QC6 A;  2VEZ A;  4E8O A;  4LX9 A;  2FS5 A;  1S7K A;  3TOB A;  4KOW A;  4MY3 A;  3MGD A;  3TO9 A;  5KTA A;  2CNM A;  3FNC A;  5HH1 A;  2HQY A;  3N7Z A;  4B5O A;  4BMH A;  2R8V A;  3R1K A;  2G0B A;  5ISV A;  4X5K A;  2Q0Y A;  4MJ8 A;  5DWN A;  3P2F A;  2A4N A;  4R9M A;  4L89 A;  1K4J A;  2PQ8 A;  3D8P A;  2CNT A;  2Z10 A;  2GAN A;  1UFH A;  4AVB A;  4KUB A;  3TFY A;  3K9U A;  4FD4 A;  1M4D A;  2VXK A;  5CNP A;  2VQY A;  3GYA A;  1I1D A;  1XEB A;  2R7H A;  2JDC A;  1OZP A;  2BUE A;  2OU2 A;  3JUW A;  4H89 A;  3IGR A;  2GE3 A;  3WR7 A;  1NE9 A;  3TE4 A;  4FD6 A;  3F8K A;  4PK3 A;  2J8N A;  2Y0M A;  1PU9 A;  3DSB A;  2Q44 A;  1S3Z A;  4KOX A;  1Y9K A;  1MJ9 A;  2Z11 A;  2WPW A;  1Q2D A;  5C88 A;  2O28 A;  2ZXV A;  3ZJ0 A;  1MK4 A;  4Y49 C;  4E2A A;  3R9E A;  3SXO A;  5IB0 A;  4KUA A;  4YFJ A;  4DNC A;  4KOS A;  4EVY A;  4CS0 B;  3V8I A;  1V0C A;  2VI7 A;  4OLL A;  1SQH A;  2OB0 A;  4K30 A;  4QVT A;  4KZT A;  3W6X A;  3SHP A;  2AJ6 A;  4UA3 A;  1YVK A;  5E96 A;  4M85 A;  2C27 A;  1KUY A;  4NCZ A;  4PSW A;  4E0A A;  1S7L A;  4XPD B;  3BLN A;  4M3S A;  5C82 A;  1XF8 A;  4KOV A;  1GHE A;  3F0A A;  3R9G A;  2OZU A;  4UWI A;  1IIC A;  4IF5 A;  1IYL A;  2REE A;  4XPD C;  4CAW A;  4RS2 A;  3EXN A;  5JPH A;  2I79 A;  3TT2 A;  5H86 A;  3JVN A;  3D2P A;  3GKR A;  3QB8 A;  1CM0 A;  3D3S A;  1YK3 A;  4JWP A;  2OH1 A;  3FBU A;  3T9Y A;  1S60 A;  2P6G A;  2EVN A;  4OAE A;  5EBV A;  1J4J A;  4JJX A;  2H5M A;  2BL1 A;  4R87 A;  3CXP A;  1Q2C A;  2Q4Y A;  1KUX A;  2RC4 A;  2PSW A;  4QBJ A;  2ZW5 A;  4ZBG A;  4AVC A;  3PZJ A;  4JXQ A;  3I3G A;  5F49 A;  2ZW4 A;  4PV6 A;  4R57 A;  2CNS A;  2AE6 A;  4JXR A;  1KUV A;  1S5K A;  3FIX A;  1R57 A;  2J8M A;  1B6B A;  2R1I A;  4CAX A;  1Z4R A;  1TIQ A;  3NE7 A;  3TTH A;  4J3G A;  4KOY A;  3F5B A;  4HKF A;  3E0K A;  2PR1 A;  4R3K A;  3G3S A;  4QB9 A;  1RO5 A;  1QSN A;  2JDD A;  4GS4 A;  2D4P A;  2HUZ A;  4KVX A;  4JLY A;  3FB3 A;  3H4Q A;  2BSW A;  3S6F A;  3EO4 A;  4XPL A;  3D2M A;  2WPX A; 
#chains in the Genus database with same CATH topology
 2WZN A;  4MCP A;  2RB7 A;  4MFL A;  3UY5 A;  4B6Z A;  4A95 A;  1LAN A;  3TO7 A;  1YGH A;  4F9V A;  1CJW A;  2PJ5 A;  1QSR A;  3T90 A;  4QUS A;  2B5G A;  1H8L A;  3EC4 A;  2B58 A;  4IUS A;  5JH9 A;  2AFX A;  2IL4 A;  5J8C A;  2V8D A;  1QST A;  2RFH A;  1M44 A;  2YNC A;  2Z0Z A;  4JZ0 A;  2BEI A;  3B7I A;  1IB1 E;  4MHD A;  2FXF A;  4H2K A;  1FNO A;  2Q7B A;  3GLJ A;  1PCA A;  2ANP A;  1U6M A;  3DNS A;  4OC5 A;  4F6A A;  4HNY B;  4C2Y A;  7CPA A;  4AG7 A;  4B14 A;  1IY7 A;  4OC3 A;  2PE3 A;  3RYO A;  4XNH B;  2DPT A;  1YX0 A;  2O53 A;  4YRH A;  1Z9U A;  4M6I A;  2QEC A;  2V8G A;  1FY7 A;  4OAD A;  2NYQ A;  3EY5 A;  3RO0 A;  2VZY A;  2HB6 A;  1PYT B;  2WYR A;  3G8W A;  4H6Z A;  2ATR A;  1LRZ A;  2G3A A;  3KKW A;  1YRE A;  2D4O A;  3GIU A;  3GY9 A;  2YNE A;  3FYN A;  3VWE A;  3FXT A;  3PB6 X;  1NSA A;  1S7F A;  4UEZ A;  4PXB A;  2AFU A;  2ZPA A;  1BPM A;  3CT9 A;  4OC4 A;  4YGO A;  3SXN A;  4XNH C;  4CGM A;  1B87 A;  2PJ4 A;  3B3V A;  4K3N A;  3WC5 A;  4P44 A;  3QNV A;  4R3L A;  4IK2 A;  4U5Y A;  3D7H A;  5D8N A;  4NF1 A;  5HVG A;  5AG4 A;  4DYO A;  5JQ4 A;  1TKF A;  4C2X A;  4NGS A;  2PRB A;  3D7F A;  2PJ3 A;  1YW4 A;  4M6G A;  3ZZI A;  1ZLH A;  1X12 A;  2ZW6 A;  3NH4 A;  5DWM A;  3R96 A;  3HLP A;  2PJ0 A;  5EC4 A;  2PIY A;  1IID A;  3LOD A;  4FD5 A;  2I00 A;  1LFW A;  4NXY A;  5IV0 A;  4FWU A;  4U9Y A;  2ARH A;  4PK2 A;  3B3C A;  4B5P B;  1CPS A;  2J9A A;  3NE8 A;  1MJA A;  2HV2 A;  2F5I A;  3QAH A;  5D29 A;  3VAT A;  4NEX A;  5I4M A;  5CBM A;  2OOT A;  2FSR A;  2PJ6 A;  3RBU A;  5KTC A;  2B5G B;  3K9T A;  3B8G A;  5AG6 A;  5LRJ A;  1I21 A;  3KHX A;  1IOF A;  3TX8 A;  2Q04 A;  4JD6 A;  1HDU A;  1P4N A;  1M4I A;  2B3V A;  2QML A;  1ELM P;  2ZEP A;  4KSF A;  5GCN A;  2EUI A;  2Z3N A;  3B3W A;  3BJ8 A;  4KVO E;  3TCV A;  3PB7 X;  4H6U A;  4PXE A;  1XIX A;  2NSM A;  4F8Z A;  4CGN A;  3CXS A;  3W91 A;  2VBQ A;  1Z4E A;  5I0C A;  3DR8 A;  3FH4 A;  2AFS A;  3PBB A;  4MBU A;  1TXR A;  1QSO A;  3CZX A;  3NH5 A;  8CPA A;  1P0H A;  4NGP A;  4II9 A;  1BAV A;  3RNZ A;  2CY2 A;  3NA6 A;  2YNC C;  4HNX B;  1YLE A;  2AFM A;  2PJA A;  2ZEH A;  2FT0 A;  5IX3 A;  1IGB A;  3IO1 A;  2J8R A;  1HDQ A;  2JEV A;  2GIV A;  2OZH A;  3IWG A;  3S6H A;  4CRZ B;  4C7I A;  4KVM E;  4OC1 A;  5H84 A;  4NSQ A;  1XE4 A;  1BPN A;  1WWZ A;  4O23 A;  2F8H A;  4UEF A;  1I12 A;  3EFA A;  1DE4 C;  3D68 A;  4LUA A;  3VH9 A;  1YVO A;  4P6Y A;  2FIW A;  2ZW7 A;  1LCP A;  4AG9 A;  3FF3 A;  3BHX A;  4KOR A;  1XFO A;  3TC8 A;  1XMB A;  1GYT A;  2Q51 A;  5LYD A;  1MJB A;  2JBJ A;  3KR5 A;  2EBJ A;  1ON0 A;  3T8W A;  1Y7E A;  4MI4 A;  3N5F A;  4KS9 A;  2B4B A;  2P0W A;  4KLV A;  1Y0Y A;  1YQE A;  2BCO A;  3DGV A;  3DDD A;  3IJ3 A;  3KHZ A;  4FD7 A;  3B3S A;  1TF8 A;  4PPZ A;  1RTQ A;  2ZEO A;  5HMN A;  5J8F A;  4W9Y A;  2VZZ A;  1KZF A;  5LYL A;  4CYQ A;  1WK4 A;  2OZG A;  4CAV A;  3CXQ A;  4LQ6 A;  1Y7R A;  1S7N A;  2QIR A;  2QVP A;  3FRM A;  2C6C A;  2B4D A;  2FL4 A;  3KQX A;  1N71 A;  3I9S A;  2DEA A;  4MFZ A;  4AB7 A;  4FBE A;  4RUH A;  2P6F A;  1M4G A;  2FIA A;  5LRG A;  2ABZ A;  3DR6 A;  4Q36 A;  4PSX A;  2Z3K A;  2DF5 A;  1YW6 A;  4EWT A;  1BLL E;  5F48 A;  2NMT A;  4MFJ A;  3JTK A;  2X7B A;  3R9F A;  5LYI A;  1XMT A;  4B5P A;  4IHM A;  4X2T A;  5FVJ A;  1Q2Y A;  3FEE A;  4MY0 A;  3IC1 A;  2PJ2 A;  4MCR A;  4A32 A;  4F0Y A;  4UFX A;  1M4L A;  1F57 A;  1ZG9 A;  2IJZ A;  2AFZ A;  4ONW A;  4GM5 A;  4R6T A;  4Y49 B;  3W6S A;  2GLF A;  4FUU A;  3S6G A;  4HNW B;  4F9U A;  4UWJ A;  4R76 A;  1TKJ A;  2K5T A;  3V38 A;  2PJ9 A;  4KLW A;  1NMT A;  4XPK A;  2R98 A;  5KTD A;  2F7V A;  1BOB A;  3TO6 A;  5F46 A;  1IYK A;  2FCK A;  1CX8 A;  1VHS A;  1XBU A;  2FVG A;  2PRQ A;  5K8M A;  4ZGY B;  2PJ1 A;  2B3U A;  4UIA A;  3ISX A;  3KZW A;  3VWD A;  2HC9 A;  1VKC A;  4KOU A;  2IQ6 A;  5IB9 A;  3KGQ A;  4CRY B;  1IOI A;  1Y9W A;  2PC1 A;  3IU2 A;  4MMO A;  1L0C A;  2XEI A;  1AUG A;  4WWV A;  4UCN A;  3WAB A;  4CGO A;  1BO4 A;  2ZEN A;  1R3N A;  3PFE A;  4JYW A;  1CBX A;  2G3T A;  2ZEL A;  1A2Z A;  1YR0 A;  2ZEE A;  5EMI A;  5G21 A;  1VHE A;  1F2O A;  3NH8 A;  4KSA A;  4ZY1 A;  3H8E A;  1LAM A;  5ELY A;  3TOA A;  3C26 A;  2KCW A;  4UBR A;  5G20 A;  2IMO A;  3LWU A;  3S9M A;  4C68 A;  1TF9 A;  3PGP A;  1HEE A;  4DUK A;  3QAY A;  5AGE A;  2ZEM A;  1M1D A;  2B4D B;  4M6H A;  4RI1 A;  4UFV A;  5DS0 A;  1Z2L A;  1VHO A;  4UFW A;  5F47 A;  4AXV A;  4ZI6 A;  3BJ7 A;  3I1U A;  2FE7 A;  2Q43 A;  2QJ8 A;  1QSM A;  3S6K A;  4B10 A;  3HUV A;  4PXC A;  3PB4 X;  3OWC A;  2PDO A;  4MCQ A;  4KOT A;  4ORF A;  1PUA A;  2PJ8 A;  3P2H A;  4MFQ A;  2Q4V A;  4ZX8 A;  1RXT A;  2P6E A;  4RN7 A;  1YSJ A;  3D4U A;  2DXQ A;  3PRT A;  2V8H A;  1NSL A;  4NGT A;  4P4B A;  2PR8 A;  1XJO A;  1Z8X A;  4U9Z A;  3K2K A;  3PP9 A;  3KAS A;  3LD2 A;  4A30 A;  2JLM A;  4ONU A;  3IEH A;  4AVA A;  2XEF A;  1UWY A;  4MHY A;  4A39 A;  4UIB A;  4CGP A;  3S9L A;  4I49 A;  4L8A A;  3R95 A;  1OBR A;  2REF A;  3FMC A;  4P4F A;  4ZY2 A;  3B2Y A;  4HPS A;  3ISZ A;  5G1Z A;  4A94 A;  3H8F A;  4LQG A;  4WJB A;  4GXH A;  3B3T A;  4NJQ A;  2BO9 A;  3H8G A;  4QC6 A;  1ELL P;  2VEZ A;  4MXU A;  4TWE A;  4YWY A;  4CYN A;  4E8O A;  5LYF A;  3LMS A;  4LX9 A;  4OME A;  2FS5 A;  1S7K A;  3TOB A;  3IWW A;  4KOW A;  2XEJ A;  3MGD A;  4MY3 A;  3TO9 A;  4A37 A;  2CNM A;  5JGF A;  5KTA A;  1EE3 P;  5AG7 A;  3SJE A;  5K8O A;  4TNU A;  3FNC A;  5J1Q A;  4CAF A;  5HH1 A;  3A9L A;  3SJX A;  2HQY A;  3N7Z A;  4P4J A;  3IIB A;  5G22 A;  3FX6 A;  4B5O A;  4BMH A;  2Q7S A;  2R8V A;  3SI0 A;  4EME A;  3D7G A;  3R1K A;  1JWQ A;  4BBH A;  3SJG A;  4R8F A;  2G0B A;  3RAM A;  5ISV A;  4X5K A;  2Q0Y A;  1Z5R A;  4MJ8 A;  5DWN A;  3BI0 A;  3FVL A;  3P2F A;  2A4N A;  1VGY A;  2DPS A;  4R9M A;  1Z8L A;  4EFD A;  2PVV A;  4L89 A;  1K4J A;  5K8N A;  3MRU A;  2PQ8 A;  3GB0 A;  1CG2 A;  2CNT A;  3D8P A;  3NFZ A;  1QMU A;  2Z10 A;  2GAN A;  1AMP A;  1UFH A;  4AVB A;  5JM6 A;  4PXD A;  4KUB A;  3TFY A;  1VIX A;  3K9U A;  4MHP A;  1DTD A;  1M4D A;  2VXK A;  3FEC A;  1ARL A;  2VQY A;  3GYA A;  3KL9 A;  4FD4 A;  5CNP A;  2Q4Z A;  2GU2 A;  1I1D A;  1XEB A;  2R7H A;  2JDC A;  4R7M A;  1OZP A;  2VL1 A;  2BUE A;  1Q7L A;  1Y0R A;  2OU2 A;  3JUW A;  4H89 A;  3WC7 A;  3IGR A;  1XRY A;  5LRK A;  3KQZ A;  1YLO A;  2GE3 A;  2Z3L A;  1LOK A;  4B12 A;  4P4E A;  5HVH A;  3WR7 A;  1CPX A;  1F2P A;  1NE9 A;  1XOV A;  3F8K A;  4FD6 A;  4PK3 A;  2J8N A;  2Y0M A;  2ZOG A;  1PU9 A;  2O4H A;  2ZOF A;  3DSB A;  2Q44 A;  1S3Z A;  1YME A;  4P10 A;  2EWB A;  2PJB A;  2GFQ A;  4KOX A;  2BOA A;  1Y9K A;  1MJ9 A;  3CPX A;  3D67 A;  1CP6 A;  2Z11 A;  2WPW A;  3IFE A;  4P45 A;  1Q2D A;  4NFR A;  4UF4 A;  5C88 A;  2O28 A;  2C6P A;  2GLJ A;  2ZXV A;  2EK9 A;  4B13 A;  3CDX A;  3ZJ0 A;  2AFO A;  1MK4 A;  3PB8 X;  4Y49 C;  4E2A A;  3R9E A;  3SXO A;  5IB0 A;  1Z8W A;  4KUA A;  4YFJ A;  4ZYQ A;  4F0X A;  4DNC A;  1JQG A;  4KOS A;  5HXD A;  4EVY A;  4CS0 B;  4NGM A;  3V8I A;  5THW A;  4UEE A;  1V0C A;  2C1C A;  2VI7 A;  2ODF A;  4OLL A;  1SQH A;  3KR4 A;  2OB0 A;  4X8I A;  1QQ9 A;  4K30 A;  4KZT A;  4QVT A;  3JRU A;  1CP7 A;  4OIW A;  3W6X A;  2CTB A;  3B35 A;  3SHP A;  2AJ6 A;  2QYV A;  1X10 A;  4UA3 A;  1YVK A;  4A38 A;  5E96 A;  4M85 A;  2C27 A;  1KUY A;  2YGW A;  3PEI A;  4CAE A;  3H5Z A;  4NCZ A;  4PSW A;  2PIZ A;  4MRI A;  4NGQ A;  4E0A A;  5A27 A;  2JBK A;  1S7L A;  4XPD B;  3BLN A;  4M3S A;  4YU9 A;  5C82 A;  1XF8 A;  4P4D A;  3CPA A;  4KOV A;  3D66 A;  1GHE A;  6CPA A;  3F0A A;  1Z8T A;  3R9G A;  2V77 A;  4NGN A;  4MFP A;  3V7Z A;  2OZU A;  2PJC A;  4UWI A;  1IIC A;  4IF5 A;  1IU8 A;  4C7H A;  3DLJ A;  1IYL A;  3BI1 A;  2REE A;  4OID A;  4OC0 A;  3IWE A;  1FT7 A;  4XPD C;  2POK A;  3VAR A;  2Z3P A;  4CPA A;  4CAW A;  4RS2 A;  3PFO A;  2AFW A;  3EXN A;  5JPH A;  3RZA A;  3BXM A;  2I79 A;  3TT2 A;  5HVF A;  5H86 A;  3D7D A;  3JVN A;  4A33 A;  3GUX A;  3D2P A;  3GKR A;  4MCS A;  3QB8 A;  3WT4 A;  1CM0 A;  3TE4 A;  2ZEF A;  3D3S A;  2YND A;  2Z3M A;  4DJL A;  1YK3 A;  1TKH A;  4JWP A;  4UCP A;  2OH1 A;  4NJR A;  3FBU A;  1AYE A;  3T9Y A;  1S60 A;  4Q7A A;  2P6G A;  4ZY0 A;  4NGR A;  2EVN A;  5AG5 A;  4OAE A;  5EBV A;  4A31 A;  1J4J A;  4JJX A;  2H5M A;  3FED A;  2I3C A;  2BL1 A;  4G1P A;  3CXP A;  4R87 A;  1KWM A;  1Q2C A;  2Q4Y A;  2V8V A;  1KUX A;  2RC4 A;  2PSW A;  3SI2 A;  4PQA A;  4BIN A;  4CYP A;  4QBJ A;  2CTC A;  2ZW5 A;  2WUU A;  4ZBG A;  4AVC A;  2Z3O A;  4KSI A;  4Z65 A;  3PZJ A;  2C6G A;  4ZX9 A;  4IAV A;  2GRE A;  4OC2 A;  3S9N A;  1ARM A;  1R43 A;  2ZED A;  4UCM A;  4OP4 A;  4MFK A;  4JXQ A;  3I3G A;  2G9D A;  5F49 A;  2ZW4 A;  4PV6 A;  3MN8 A;  3WC6 A;  3L2N A;  4P4I A;  4R57 A;  2CNS A;  5A28 A;  3LAC A;  2CIJ A;  5CPA A;  3IU1 A;  2ZEG A;  2AE6 A;  4JXR A;  1LAP A;  1KUV A;  1S5K A;  3FIX A;  3PBE A;  2PVW A;  1R57 A;  2J8M A;  1B6B A;  2OR4 A;  4MHZ A;  2CF4 A;  2PCU A;  2R1I A;  4CAX A;  1Z4R A;  1ZO0 A;  4CGL A;  2EK8 A;  1TIQ A;  1ZG8 A;  3NE7 A;  4MHN A;  3TTH A;  4J3G A;  2PJ7 A;  4KOY A;  4Q38 A;  3F5B A;  4HKF A;  5F09 A;  2WSA A;  2XEG A;  2JEW A;  3E0K A;  3SI1 A;  4C2Z A;  3SJF A;  4A2Z A;  5BWA B;  2PR1 A;  1ZLI A;  3KI9 A;  3G3S A;  4QB9 A;  1RO5 A;  1QSN A;  4R3K A;  4X3R A;  4B11 A;  2JDD A;  4GS4 A;  4OKO A;  2EO8 A;  4CYO A;  2D4P A;  3FJU A;  2HUZ A;  4KVX A;  3PB9 X;  1ZG7 A;  3FB3 A;  4JLY A;  3H4Q A;  4FAI A;  4BD9 A;  2BSW A;  3S6F A;  3EO4 A;  4XPL A;  2CXA A;  3D2M A;  2WPX A;  5K8P A; 
#chains in the Genus database with same CATH homology
 4MFL A;  3UY5 A;  4A95 A;  3TO7 A;  1YGH A;  1CJW A;  1QSR A;  3T90 A;  4QUS A;  2B5G A;  3EC4 A;  2B58 A;  4IUS A;  2IL4 A;  5J8C A;  1QST A;  1M44 A;  2YNC A;  2Z0Z A;  2BEI A;  1IB1 E;  4MHD A;  2FXF A;  2Q7B A;  1U6M A;  3DNS A;  4F6A A;  4HNY B;  4C2Y A;  4AG7 A;  4B14 A;  3RYO A;  4XNH B;  2DPT A;  1YX0 A;  4YRH A;  1Z9U A;  2QEC A;  4OAD A;  1FY7 A;  3EY5 A;  2VZY A;  3G8W A;  4H6Z A;  2ATR A;  1LRZ A;  2G3A A;  3KKW A;  1YRE A;  2D4O A;  3GY9 A;  2YNE A;  3FYN A;  3VWE A;  3FXT A;  1S7F A;  2ZPA A;  3SXN A;  4CGM A;  4YGO A;  4XNH C;  1B87 A;  4R3L A;  4U5Y A;  4NF1 A;  5JQ4 A;  5AG4 A;  4C2X A;  2PRB A;  3ZZI A;  2ZW6 A;  3R96 A;  5DWM A;  5EC4 A;  1IID A;  3LOD A;  4FD5 A;  2I00 A;  4NXY A;  5IV0 A;  4U9Y A;  2ARH A;  4PK2 A;  4B5P B;  1MJA A;  2HV2 A;  2F5I A;  3QAH A;  4NEX A;  2FSR A;  5KTC A;  2B5G B;  3B8G A;  5AG6 A;  1I21 A;  2Q04 A;  4JD6 A;  1P4N A;  1M4I A;  2B3V A;  2QML A;  4KSF A;  5GCN A;  2EUI A;  2Z3N A;  3TCV A;  3BJ8 A;  4KVO E;  4H6U A;  1XIX A;  4CGN A;  3CXS A;  3W91 A;  2VBQ A;  1Z4E A;  5I0C A;  3DR8 A;  4MBU A;  1QSO A;  1P0H A;  4II9 A;  2CY2 A;  2YNC C;  4HNX B;  1YLE A;  2FT0 A;  5IX3 A;  2J8R A;  2JEV A;  2OZH A;  2GIV A;  3IWG A;  3S6H A;  4CRZ B;  4C7I A;  4KVM E;  5H84 A;  4NSQ A;  1XE4 A;  1WWZ A;  1I12 A;  3EFA A;  4LUA A;  1YVO A;  2FIW A;  2ZW7 A;  4AG9 A;  4KOR A;  1MJB A;  1ON0 A;  4MI4 A;  4KS9 A;  2B4B A;  2P0W A;  4KLV A;  3DDD A;  4FD7 A;  5HMN A;  5J8F A;  2VZZ A;  1KZF A;  4CYQ A;  1WK4 A;  2OZG A;  4CAV A;  3CXQ A;  1Y7R A;  1S7N A;  2QIR A;  3FRM A;  2FL4 A;  2B4D A;  4MFZ A;  1N71 A;  3I9S A;  4AB7 A;  2P6F A;  1M4G A;  2FIA A;  3DR6 A;  4Q36 A;  4PSX A;  2Z3K A;  5F48 A;  2NMT A;  4MFJ A;  3JTK A;  2X7B A;  3R9F A;  4B5P A;  1XMT A;  5FVJ A;  1Q2Y A;  4MY0 A;  4A32 A;  4F0Y A;  4UFX A;  3W6S A;  4Y49 B;  3S6G A;  4HNW B;  4UWJ A;  2K5T A;  4XPK A;  4KLW A;  1NMT A;  2R98 A;  5KTD A;  1BOB A;  3TO6 A;  5F46 A;  1IYK A;  1VHS A;  2FCK A;  4ZGY B;  2B3U A;  3VWD A;  1VKC A;  4KOU A;  4CRY B;  3IU2 A;  1Y9W A;  2PC1 A;  1L0C A;  4UCN A;  4CGO A;  1BO4 A;  2G3T A;  1YR0 A;  5G21 A;  4KSA A;  3TOA A;  3C26 A;  2KCW A;  4UBR A;  5G20 A;  4C68 A;  3PGP A;  5AGE A;  1M1D A;  2B4D B;  4RI1 A;  4UFV A;  4UFW A;  5F47 A;  3BJ7 A;  2FE7 A;  3S6K A;  1QSM A;  4B10 A;  3OWC A;  2PDO A;  4KOT A;  4ORF A;  1PUA A;  3P2H A;  4MFQ A;  2Q4V A;  1RXT A;  2P6E A;  2DXQ A;  1NSL A;  2PR8 A;  4U9Z A;  3PP9 A;  3LD2 A;  4A30 A;  2JLM A;  4ONU A;  4AVA A;  4CGP A;  4I49 A;  4L8A A;  3R95 A;  2REF A;  5G1Z A;  4QC6 A;  4CYN A;  2VEZ A;  4E8O A;  4LX9 A;  2FS5 A;  1S7K A;  3TOB A;  4KOW A;  4MY3 A;  3MGD A;  3TO9 A;  5KTA A;  2CNM A;  5AG7 A;  3FNC A;  4CAF A;  5HH1 A;  3A9L A;  2HQY A;  3N7Z A;  5G22 A;  4B5O A;  4BMH A;  2R8V A;  3R1K A;  4BBH A;  2G0B A;  5ISV A;  4X5K A;  2Q0Y A;  4MJ8 A;  5DWN A;  3P2F A;  2A4N A;  2DPS A;  4R9M A;  4L89 A;  1K4J A;  2PQ8 A;  3D8P A;  2CNT A;  2Z10 A;  2GAN A;  1UFH A;  4AVB A;  4KUB A;  3TFY A;  3K9U A;  4FD4 A;  1M4D A;  2VXK A;  5CNP A;  2VQY A;  3GYA A;  1I1D A;  1XEB A;  2R7H A;  2JDC A;  1OZP A;  2BUE A;  2OU2 A;  3JUW A;  4H89 A;  3IGR A;  2GE3 A;  2Z3L A;  4B12 A;  3WR7 A;  1NE9 A;  3TE4 A;  4FD6 A;  3F8K A;  4PK3 A;  2J8N A;  2Y0M A;  1PU9 A;  3DSB A;  2Q44 A;  1S3Z A;  4KOX A;  1Y9K A;  1MJ9 A;  2Z11 A;  2WPW A;  1Q2D A;  5C88 A;  2O28 A;  2ZXV A;  4B13 A;  3ZJ0 A;  1MK4 A;  4Y49 C;  4E2A A;  3R9E A;  3SXO A;  5IB0 A;  4KUA A;  4YFJ A;  4F0X A;  4DNC A;  4KOS A;  4EVY A;  4CS0 B;  3V8I A;  1V0C A;  2VI7 A;  4OLL A;  1SQH A;  2OB0 A;  4K30 A;  4QVT A;  4KZT A;  3W6X A;  3SHP A;  2AJ6 A;  4UA3 A;  1YVK A;  5E96 A;  4M85 A;  2C27 A;  1KUY A;  2YGW A;  4CAE A;  3H5Z A;  4NCZ A;  4PSW A;  5A27 A;  4E0A A;  1S7L A;  4XPD B;  3BLN A;  4M3S A;  5C82 A;  1XF8 A;  4KOV A;  1GHE A;  3F0A A;  3R9G A;  4MFP A;  2OZU A;  4UWI A;  1IIC A;  4IF5 A;  4C7H A;  1IYL A;  2REE A;  3IWE A;  4XPD C;  2Z3P A;  4CAW A;  4RS2 A;  3EXN A;  5JPH A;  2I79 A;  3TT2 A;  5H86 A;  3JVN A;  4A33 A;  3D2P A;  3GKR A;  3QB8 A;  1CM0 A;  3D3S A;  2YND A;  2Z3M A;  1YK3 A;  4JWP A;  4UCP A;  2OH1 A;  3FBU A;  3T9Y A;  1S60 A;  2P6G A;  5AG5 A;  2EVN A;  4OAE A;  5EBV A;  4A31 A;  1J4J A;  4JJX A;  2H5M A;  2BL1 A;  4R87 A;  3CXP A;  1Q2C A;  2Q4Y A;  1KUX A;  2RC4 A;  2PSW A;  4CYP A;  4QBJ A;  2ZW5 A;  2WUU A;  4ZBG A;  4AVC A;  2Z3O A;  3PZJ A;  4UCM A;  4MFK A;  4JXQ A;  3I3G A;  5F49 A;  2ZW4 A;  4PV6 A;  4R57 A;  2CNS A;  5A28 A;  3IU1 A;  2AE6 A;  4JXR A;  1KUV A;  1S5K A;  3FIX A;  1R57 A;  2J8M A;  1B6B A;  2R1I A;  4CAX A;  1Z4R A;  1ZO0 A;  4CGL A;  1TIQ A;  3NE7 A;  3TTH A;  4J3G A;  4KOY A;  4Q38 A;  3F5B A;  4HKF A;  2WSA A;  3E0K A;  4C2Z A;  4A2Z A;  5BWA B;  2PR1 A;  4R3K A;  3G3S A;  4QB9 A;  1RO5 A;  1QSN A;  4B11 A;  2JDD A;  4GS4 A;  4CYO A;  2D4P A;  2HUZ A;  4KVX A;  4JLY A;  3FB3 A;  3H4Q A;  2BSW A;  3S6F A;  3EO4 A;  4XPL A;  2CXA A;  3D2M A;  2WPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...