4M85A

Crystal structure of n-acetyltransferase from staphylococcus aureus mu50
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
185
structure length
185
Chain Sequence
SNAMIRQARPEDRFDIAKLVYMVWDDMELELVKHLPKDMVLDAIEKSCVDATYRTFYQHILVYEVENKVAGCIISYSGENELKYEKAWELLDLPEEIKQYGTPLPVKEAKDDEYYIETIATFAAYRGRGIATKLLTSLLESNTHVKWSLNCDINNEAALKLYKKVGFISDGQIELYKHMYHHLIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression,purification and X-ray crystallography of N-acetyltransferase from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
molecule keywords N-acetyltransferase
total genus 58
structure length 185
sequence length 185
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4m85A00
1YGHA 4HNYB 1S7FA 1TIQA 5KTDA 2B3UA 2CNTA 1YK3A 3JVNA 3DNSA 1IB1E 2G3AA 3WR7A 2F5IA 3FBUA 4AG9A 2EVNA 4CAVA 2D4PA 3FNCA 4E0AA 2B4BA 2J8NA 1QSMA 4PSWA 1IIDA 1IYKA 3TO9A 2BSWA 4R57A 3JUWA 4AG7A 4PSXA 3G8WA 1BO4A 4F6AA 4LUAA 4QUSA 2IL4A 2Q0YA 4L89A 2A4NA 3GYAA 2P6GA 4KZTA 5F48A 2CNSA 4DNCA 5H84A 3LD2A 2JDCA 3I9SA 2HV2A 5GCNA 2GANA 5KTCA 4ZBGA 4MY0A 4KOYA 2AE6A 4UBRA 3R9GA 1V0CA 3SXNA 4AB7A 4BMHA 2VQYA 1Z4EA 5ISVA 4KOVA 4R3LA 2G3TA 4NF1A 1NE9A 1S7KA 4NEXA 2Z11A 4RI1A 3VWEA 3S6KA 3FB3A 3N7ZA 3LODA 1PU9A 4E8OA 1KUXA 4OLLA 4PK2A 5F46A 1SQHA 3EC4A 1IICA 5HH1A 1XE4A 4KOUA 2B5GB 4QBJA 2QMLA 3PP9A 2FIWA 3VWDA 4HNWB 3PGPA 1L0CA 1QSTA 3S6FA 1OZPA 4CS0B 3BJ8A 4NXYA 4KLVA 4PK3A 2Z10A 1R57A 3NE7A 4YRHA 1B6BA 1S60A 4XPDB 4HKFA 3W6SA 2OZGA 3RYOA 3KKWA 1XF8A 2FE7A 3R95A 4NSQA 2X7BA 4GS4A 4JLYA 1RXTA 1WWZA 4I49A 4IF5A 2Q4YA 2HQYA 2P6EA 3H4QA 2BUEA 3TCVA 3T9YA 1S7LA 1MK4A 2EUIA 1UFHA 5H86A 5JQ4A 1KZFA 3DR6A 3BLNA 1YVOA 2C27A 1FY7A 1WK4A 3V8IA 2B5GA 3PZJA 2PDOA 2ZW4A 3EO4A 2NMTA 2Q7BA 2G0BA 4JD6A 1YREA 1S3ZA 2PC1A 3CXQA 3FIXA 4QC6A 4RS2A 2FT0A 1ON0A 4KLWA 2Z0ZA 4R87A 2QECA 2FSRA 2ATRA 5JPHA 3TO6A 5I0CA 4KVXA 4B5OA 3TFYA 2CY2A 1VHSA 1J4JA 2Q4VA 4R9MA 3R9EA 4KUAA 4XPKA 2Y0MA 2J8RA 4JXRA 3SHPA 2CNMA 2OU2A 1GHEA 4KORA 2R8VA 4H6ZA 3ZJ0A 4PV6A 5F47A 2OH1A 2R7HA 2B3VA 2WPXA 3ZZIA 3UY5A 1XEBA 4KUBA 4KVOE 3S6HA 3EY5A 5KTAA 4QVTA 1S5KA 1CM0A 4KVME 4AVAA 4L8AA 2VBQA 1CJWA 5HMNA 3F5BA 3S6GA 4AVBA 3GKRA 1M4GA 2OZUA 4K30A 4II9A 2Q04A 3TOAA 4HNXB 1RO5A 4H6UA 1YVKA 1YX0A 2ZW5A 2ZXVA 4UWIA 4JJXA 2AJ6A 3EXNA 4LX9A 1Q2YA 2GE3A 2REFA 3IGRA 3BJ7A 1XMTA 1M4IA 2QIRA 3P2FA 5FVJA 3W91A 1XIXA 1MJBA 3B8GA 1B87A 4KOXA 1M4DA 4JWPA 2R1IA 4U5YA 2H5MA 3EFAA 1S7NA 4ORFA 3C26A 1IYLA 4H89A 4JXQA 3F8KA 2OZHA 5J8FA 1KUVA 3D2PA 4XPDC 2PR1A 3TE4A 2VEZA 1Y7RA 4J3GA 3CXSA 2WPWA 2P6FA 4MHDA 5IX3A 3TTHA 2ZW6A 3IWGA 3CXPA 5DWNA 2D4OA 4ONUA 2PR8A 1NMTA 2I79A 4OADA 1QSRA 2ZPAA 1M44A 4U9YA 3TOBA 2FS5A 4CRZB 2JDDA 3DDDA 4KOSA 1NSLA 1Y9KA 4CAXA 4FD5A 2B4DA 2FXFA 4XNHB 2ZW7A 3QB8A 5IV0A 2HUZA 4QB9A 3OWCA 3DSBA 1I12A 1BOBA 4F0YA 4XPLA 2ARHA 4EVYA 2J8MA 1Q2DA 4NCZA 4X5KA 1P0HA 2B58A 4OAEA 4MJ8A 3MGDA 5EBVA 2PRBA 2FIAA 2I00A 3W6XA 1Q2CA 3R9FA 1U6MA 1PUAA 2P0WA 3FRMA 5DWMA 2KCWA 2PQ8A 4UWJA 1Z9UA 1M1DA 4YGOA 1YLEA 5E96A 4YFJA 4M3SA 1K4JA 1Y9WA 2FCKA 3SXOA 4CAWA 2VZZA 2R98A 1KUYA 2JLMA 2VI7A 3R96A 2BL1A 4KOTA 1I21A 4UA3A 3QAHA 1MJAA 3FXTA 3TT2A 1QSNA 1VKCA 3FYNA 4MBUA 5J8CA 1N71A 5CNPA 3G3SA 3I3GA 5C88A 5F49A 4FD4A 3P2HA 3GY9A 4XNHC 4E2AA 2JEVA 2RC4A 4CRYB 2Q44A 4Y49C 2K5TA 4KOWA 2REEA 1LRZA 4IUSA 4MI4A 2GIVA 4U9ZA 1MJ9A 2BEIA 1YR0A 3D8PA 4AVCA 4FD6A 4R3KA 4B5PA 2O28A 4Y49B 1P4NA 2VXKA 3D3SA 4M85A 1Z4RA 5C82A 1I1DA 5IB0A 3K9UA 4MY3A 2DXQA 3T90A 3D2MA 4B5PB 4FD7A 2OB0A 1QSOA 2PSWA 2FL4A 3TO7A 3DR8A 2B4DB 3E0KA 3R1KA 2VZYA 3F0AA 5EC4A
chains in the Genus database with same CATH superfamily
1CG2A 4NGPA 1ELLP 5G22A 3SJEA 2WUUA 1YGHA 3RAMA 1CPXA 4HNYB 1S7FA 1BLLE 4LQ6A 1CBXA 1TIQA 5KTDA 2B3UA 2CNTA 3KI9A 1YK3A 3BI0A 1LAPA 3JVNA 4C68A 3DNSA 3JTKA 1IB1E 2G3AA 3H8EA 3PFEA 3WR7A 2F5IA 3FBUA 4AG9A 5LYIA 1ZLHA 2O53A 4TNUA 2GLFA 4CPAA 2EVNA 4CAVA 2D4PA 4A2ZA 1PYTB 1XRYA 3FNCA 3VARA 4A32A 5A28A 4CYPA 2Z3MA 3L2NA 5I4MA 4E0AA 2B4BA 4P10A 2J8NA 1QSMA 4KSFA 2YNCA 4PSWA 1IGBA 4C2ZA 4MHNA 1IIDA 2YGWA 2AFUA 1IYKA 3TO9A 2BSWA 3VH9A 4R57A 2Z3NA 3JUWA 2C6GA 4JZ0A 1DTDA 2Z3OA 4AG7A 2CTCA 3KL9A 3G8WA 4M6IA 3KQZA 4PSXA 1BO4A 4F6AA 4LUAA 4QUSA 4C2XA 2IL4A 2Q0YA 2YNDA 1ZO0A 3QAYA 4L89A 2A4NA 2Q51A 2PJAA 2POKA 2P6GA 3GYAA 1AUGA 4KZTA 5F48A 2CNSA 2PVWA 3WABA 4DNCA 5D8NA 4UCNA 1HEEA 5H84A 4MHPA 2QJ8A 2IQ6A 2JDCA 3LD2A 4GXHA 3I9SA 2HV2A 5GCNA 2GANA 1CP6A 2J9AA 5KTCA 3BHXA 4ZBGA 4MY0A 4KOYA 2AE6A 3CT9A 4UBRA 1V0CA 2PJ8A 3R9GA 1TKFA 3SXNA 4AB7A 1CX8A 4BMHA 2VQYA 3FMCA 4MMOA 1KWMA 1Z4EA 3D7GA 4KS9A 2ZEPA 5ISVA 4KOVA 4R3LA 2Z3PA 3IU2A 2G3TA 3N5FA 3B35A 4NF1A 1NE9A 1S7KA 2PJ1A 4FUUA 4NEXA 4CAEA 2JBJA 2Z11A 4EWTA 1IOIA 4NGMA 4RI1A 1QQ9A 3S6KA 3VWEA 4MFKA 2CIJA 2JBKA 1X10A 3FB3A 1M4LA 3N7ZA 3LODA 3IWWA 5K8MA 4CAFA 1PU9A 4E8OA 1KUXA 1Y0RA 1ZG9A 5LRKA 4FBEA 4OLLA 4PK2A 3V7ZA 5F46A 4NJQA 1SQHA 1XBUA 3EC4A 1IICA 5HH1A 1XE4A 4KOUA 2B5GB 4QBJA 2QMLA 2BCOA 3PP9A 2FIWA 3VWDA 4MCQA 4IAVA 1ZG7A 3PGPA 4HNWB 1FT7A 4MCSA 1L0CA 4NGNA 4PXCA 1QSTA 4JYWA 3S6FA 1OZPA 2OR4A 4CS0B 2BOAA 3BJ8A 4NXYA 4KLVA 3PB4X 2Z10A 4PK3A 3ISZA 3HUVA 5F09A 3RNZA 4NGRA 4OKOA 4PXEA 2PJ5A 1R57A 3IU1A 4ZY0A 3NE7A 4CGMA 4NGSA 4YRHA 3CDXA 1VIXA 4EFDA 1B6BA 1S60A 4XPDB 4HKFA 3W6SA 5EMIA 2OZGA 3RYOA 1VHEA 3KKWA 3FX6A 1XF8A 4P4BA 2FE7A 4TWEA 3R95A 4NSQA 3TC8A 3PBBA 1LANA 1YSJA 2DF5A 2X7BA 4K3NA 2ZEGA 4GS4A 1IY7A 3FH4A 4JLYA 1RXTA 4R7MA 1WWZA 1F2OA 2BO9A 4I49A 2DPSA 4IF5A 5THWA 2Q4YA 5IB9A 3H5ZA 2WSAA 3KHXA 2HQYA 4UEZA 2P6EA 3H4QA 2PJBA 2BUEA 3BI1A 3T9YA 1S7LA 3TCVA 5LRJA 4UFXA 3HLPA 1MK4A 2EUIA 4MCRA 1UFHA 5H86A 3IFEA 4F8ZA 5JQ4A 1AMPA 1KZFA 3S9NA 3DR6A 7CPAA 3BLNA 1LOKA 1YVOA 4ZX9A 3CZXA 3B7IA 5AG7A 4B13A 4C7IA 3FEDA 2C27A 1FY7A 1WK4A 2DEAA 3V8IA 4HPSA 3PFOA 2B5GA 3PZJA 2PDOA 2ZW4A 3IJ3A 3LWUA 4PQAA 3EO4A 4Q36A 4R76A 2NMTA 3D7DA 2Q7BA 2Q43A 2G0BA 2NSMA 2Z3KA 4JD6A 1YREA 1S3ZA 2V8DA 1UWYA 3B2YA 4A30A 2PC1A 3CXQA 3KASA 5K8PA 5LRGA 3FIXA 4B14A 5HVFA 4QC6A 4RS2A 4ZX8A 4IHMA 2FT0A 5G20A 4MFJA 3QNVA 1ON0A 5LYDA 4KLWA 2Z0ZA 4P4DA 4R87A 2QECA 4UEEA 2C1CA 3KQXA 2FSRA 2ATRA 4NGTA 5JPHA 3NH5A 2PJ3A 3TO6A 5I0CA 2ZOFA 4MFZA 4KVXA 4B5OA 1ELMP 3TFYA 2CY2A 4BBHA 1VHSA 2AFMA 5G21A 1J4JA 2Q4VA 4R9MA 3R9EA 4RUHA 4F9VA 2RB7A 2AFWA 4NJRA 4KUAA 4XPKA 2Y0MA 3D7FA 4B11A 2ZEEA 3PB6X 2J8RA 1YW6A 2RFHA 4JXRA 3SHPA 4CYQA 2CNMA 2ZEDA 2OU2A 2ZOGA 4W9YA 1GHEA 3GIUA 4KORA 1LCPA 4UEFA 3MRUA 4CYOA 2R8VA 4H6ZA 3ZJ0A 3SJFA 4PV6A 1ZG8A 5F47A 5LYLA 2OH1A 2PIYA 3SI0A 2R7HA 4YU9A 4DUKA 2CXAA 5CBMA 5K8OA 4X2TA 2B3VA 2ABZA 1TKHA 2EO8A 3WC6A 4CGLA 1Q7LA 4OC4A 1ARLA 5JH9A 2WPXA 3ZZIA 4A95A 3UY5A 1XEBA 1HDUA 2YNCC 4KUBA 4CYNA 4KVOE 3S6HA 3EY5A 4OC1A 4PXBA 1YMEA 4QVTA 5KTAA 1S5KA 1JWQA 2G9DA 1CM0A 4KVME 3ISXA 4AVAA 4L8AA 4WWVA 2VBQA 1CJWA 2PJ7A 2FVGA 2XEIA 4Q7AA 3BXMA 4UIBA 5HMNA 3F5BA 3KZWA 3S6GA 3IEHA 4AVBA 3GKRA 1M4GA 2OZUA 4OP4A 4P4EA 5AG5A 3K2KA 3FJUA 3PRTA 4K30A 4O23A 1JQGA 2Q04A 4X8IA 4HNXB 4GM5A 3TOAA 5AG4A 1RO5A 2ANPA 3S9MA 3KHZA 5HXDA 3S9LA 4H6UA 3D67A 3B3TA 4OC2A 3SI2A 1LAMA 2PRQA 1YVKA 1YX0A 2ZEOA 4OIWA 2ZW5A 3A9LA 3IO1A 4A31A 5AGEA 1Z8WA 2ZXVA 4JJXA 4UWIA 2AJ6A 3EXNA 4LX9A 4OC5A 2AFXA 1BAVA 1Q2YA 2F8HA 2GE3A 2REFA 3IGRA 4CGNA 4MHZA 3BJ7A 1XMTA 1M4IA 2QIRA 3P2FA 5FVJA 3W91A 4B6ZA 1XIXA 1MJBA 3B8GA 3VATA 3I1UA 1B87A 4KOXA 3DGVA 3DLJA 1GYTA 3TX8A 4P4IA 1M4DA 4JWPA 2R1IA 4U5YA 3KGQA 4A39A 2H5MA 3EFAA 4NFRA 1S7NA 4ORFA 2PJ9A 3MN8A 3C26A 1IYLA 4H89A 2QVPA 1TKJA 2XEFA 2OZHA 3F8KA 1BPMA 4JXQA 5J8FA 3NFZA 4UFVA 3JRUA 1KUVA 3D2PA 3NH4A 2IJZA 3H8FA 4XPDC 2PR1A 3TE4A 1LFWA 1OBRA 2GREA 2VEZA 4C2YA 1Y0YA 1Y7RA 4J3GA 3CXSA 4R8FA 1VHOA 5CPAA 2Z3LA 2WPWA 4UF4A 4A33A 2P6FA 4MHDA 4EMEA 1QMUA 5IX3A 1NSAA 3TTHA 4LQGA 2ZW6A 4OMEA 4DJLA 3WC5A 1Z8TA 4F0XA 3IWGA 2GFQA 4KSAA 1DE4C 5K8NA 3CXPA 5JM6A 5DWNA 4FAIA 1F2PA 3SJGA 2D4OA 2WZNA 4ONUA 4G1PA 2V8HA 2PR8A 2ZENA 3IC1A 1NMTA 3PBEA 4UCPA 2I79A 1Y7EA 4OADA 1ARMA 4UIAA 1QSRA 2ZPAA 1M44A 4U9YA 2YNEA 3TOBA 2V8VA 1IU8A 2FS5A 1PCAA 2ODFA 4CRZB 2JDDA 3DDDA 1ZLIA 2EK8A 2PCUA 4KOSA 1Y9KA 1XOVA 1NSLA 4B10A 4CAXA 4FD5A 3V38A 2EK9A 3FECA 4A94A 1AYEA 2B4DA 2FXFA 2HB6A 4XNHB 2I3CA 2ZW7A 2WYRA 3QB8A 5IV0A 4P44A 2HUZA 2JEWA 4MRIA 4QB9A 4X3RA 4UFWA 6CPAA 2EBJA 1Z5RA 4Z65A 4MXUA 2ZEMA 2NYQA 3OWCA 4P6YA 3DSBA 5HVHA 2ZEFA 3B3VA 4BD9A 2OOTA 1I12A 1BOBA 4F0YA 4XPLA 2ARHA 4EVYA 3FF3A 4ZGYB 1TF8A 5A27A 5JGFA 2J8MA 1Q2DA 4P45A 5LYFA 4NCZA 4X5KA 1P0HA 2B58A 2QYVA 4MJ8A 4OAEA 3MGDA 3PB8X 2ZELA 3D7HA 3SI1A 5EBVA 2PRBA 4MFLA 1XFOA 2FIAA 2I00A 4PXDA 3W6XA 4C7HA 3NH8A 3SJXA 1Q2CA 3R9FA 1U6MA 1PUAA 4MHYA 2P0WA 4RN7A 3FRMA 4ZY2A 5DWMA 2GU2A 2KCWA 3K9TA 1F57A 2PQ8A 4UWJA 2PJCA 3NA6A 1Z9UA 1M1DA 2CTBA 3FVLA 3H8GA 3LMSA 1BPNA 4YGOA 3KR4A 1YLEA 2O4HA 4M6HA 3LACA 5E96A 4YFJA 3D4UA 1R43A 8CPAA 4M3SA 3PB9X 4NGQA 5J1QA 3B3SA 3IIBA 1K4JA 1Y9WA 2FCKA 2Q7SA 4UCMA 5G1ZA 1R3NA 4BINA 5AG6A 3SXOA 4CAWA 2VZZA 2R98A 4OC3A 1KUYA 3RZAA 2VL1A 2JLMA 3D68A 2VI7A 3R96A 1X12A 5ELYA 2BL1A 5BWAB 2PJ0A 2PVVA 4KOTA 4KSIA 3IWEA 1I21A 4A38A 4MFQA 3T8WA 1YQEA 2AFSA 1Z8LA 2PIZA 4UA3A 4H2KA 3QAHA 3GB0A 4DYOA 4ZY1A 1TXRA 1MJAA 4ZI6A 3FXTA 4Q38A 2PJ2A 4M6GA 2XEJA 3CPAA 3TT2A 4MCPA 1QSNA 1YW4A 5HVGA 1VKCA 1Z2LA 1FNOA 2HC9A 3FYNA 3CPXA 2AFZA 4IK2A 4MBUA 5J8CA 4A37A 1N71A 2DPTA 2AFOA 1VGYA 3B3CA 3G3SA 1XJOA 3PB7X 2CF4A 3NE8A 5CNPA 3KR5A 3I3GA 5C88A 1EE3P 5F49A 4FD4A 1IOFA 3P2HA 2C6PA 4MFPA 3B3WA 3GY9A 4XNHC 4E2AA 2JEVA 3PEIA 2RC4A 1A2ZA 4CRYB 3D66A 2C6CA 2ZEHA 3GUXA 4YWYA 2Q44A 4Y49C 2K5TA 4KOWA 4AXVA 2REEA 1LRZA 3FEEA 4IUSA 2V8GA 2GIVA 4MI4A 3RBUA 3WT4A 4U9ZA 1MJ9A 5D29A 2BEIA 1YLOA 4F9UA 1YR0A 3D8PA 1HDQA 2IMOA 4AVCA 4FD6A 3WC7A 2PE3A 4R3KA 4B5PA 1TF9A 4P4FA 3RO0A 2O28A 1CP7A 4Y49B 3GLJA 1P4NA 2VXKA 3D3SA 4WJBA 1Z8XA 4M85A 1Z4RA 1CPSA 5C82A 2V77A 4FWUA 1I1DA 5IB0A 5DS0A 3K9UA 4CGPA 2PJ6A 4ONWA 4PPZA 4OC0A 4CGOA 4MY3A 2DXQA 4P4JA 2EWBA 3T90A 3D2MA 4B5PB 4FD7A 2OB0A 4R6TA 2XEGA 4B12A 1H8LA 2PSWA 1QSOA 2FL4A 2GLJA 3DR8A 2B4DB 3TO7A 4II9A 3E0KA 3R1KA 4OIDA 1RTQA 2F7VA 2Q4ZA 2PJ4A 2VZYA 3F0AA 1XMBA 4ZYQA 5EC4A
chains in the Genus database with same CATH topology
5G22A 2WUUA 1YGHA 4HNYB 1S7FA 1TIQA 5KTDA 2B3UA 2CNTA 1YK3A 4C68A 3JVNA 3DNSA 3JTKA 1IB1E 2G3AA 3WR7A 2F5IA 3FBUA 4AG9A 2EVNA 4CAVA 2D4PA 4A2ZA 3FNCA 4A32A 5A28A 4CYPA 2Z3MA 4E0AA 2B4BA 2J8NA 1QSMA 4KSFA 2YNCA 4PSWA 4C2ZA 1IIDA 2YGWA 1IYKA 3TO9A 2BSWA 4R57A 2Z3NA 3JUWA 2Z3OA 4AG7A 4PSXA 3G8WA 1BO4A 4F6AA 4LUAA 4QUSA 4C2XA 2IL4A 2Q0YA 2YNDA 1ZO0A 4L89A 2A4NA 3GYAA 2P6GA 4KZTA 5F48A 2CNSA 4DNCA 4UCNA 5H84A 3LD2A 2JDCA 3I9SA 2HV2A 5GCNA 2GANA 5KTCA 4ZBGA 4MY0A 4KOYA 2AE6A 4UBRA 3R9GA 1V0CA 3SXNA 4AB7A 4BMHA 2VQYA 1Z4EA 5ISVA 4KS9A 4KOVA 4R3LA 2Z3PA 3IU2A 2G3TA 4NF1A 1NE9A 1S7KA 4NEXA 4CAEA 2Z11A 4RI1A 3VWEA 3S6KA 4MFKA 3FB3A 3N7ZA 3LODA 4CAFA 1PU9A 4E8OA 1KUXA 4OLLA 4PK2A 5F46A 1SQHA 3EC4A 1IICA 5HH1A 1XE4A 4KOUA 2B5GB 4QBJA 2QMLA 3PP9A 2FIWA 3VWDA 4HNWB 3PGPA 1L0CA 1QSTA 3S6FA 1OZPA 4CS0B 3BJ8A 4NXYA 4KLVA 4PK3A 2Z10A 1R57A 3IU1A 3NE7A 4CGMA 4YRHA 1B6BA 1S60A 4XPDB 4HKFA 3W6SA 2OZGA 3RYOA 3KKWA 1XF8A 2FE7A 3R95A 4NSQA 2X7BA 4GS4A 4JLYA 1RXTA 1WWZA 4I49A 2DPSA 4IF5A 2Q4YA 3H5ZA 2WSAA 2HQYA 2P6EA 3H4QA 2BUEA 3TCVA 3T9YA 1S7LA 4UFXA 1MK4A 2EUIA 1UFHA 5H86A 5JQ4A 1KZFA 3DR6A 3BLNA 1YVOA 4B13A 5AG7A 4C7IA 2C27A 1FY7A 1WK4A 3V8IA 2B5GA 3PZJA 2PDOA 2ZW4A 3EO4A 4Q36A 2NMTA 2Q7BA 2G0BA 4JD6A 2Z3KA 1YREA 1S3ZA 4A30A 2PC1A 3CXQA 4B14A 3FIXA 4QC6A 4RS2A 2FT0A 5G20A 4MFJA 1ON0A 4KLWA 2Z0ZA 4R87A 2QECA 2FSRA 2ATRA 5JPHA 3TO6A 5I0CA 4MFZA 4KVXA 4B5OA 3TFYA 2CY2A 4BBHA 1VHSA 5G21A 1J4JA 2Q4VA 4R9MA 3R9EA 4KUAA 4XPKA 2Y0MA 4B11A 2J8RA 4JXRA 3SHPA 4CYQA 2CNMA 2OU2A 1GHEA 4KORA 4CYOA 2R8VA 4H6ZA 3ZJ0A 4PV6A 5F47A 2OH1A 2R7HA 2CXAA 2B3VA 4CGLA 2WPXA 3ZZIA 4A95A 3UY5A 1XEBA 2YNCC 4KUBA 4CYNA 4KVOE 3S6HA 3EY5A 5KTAA 4QVTA 1S5KA 1CM0A 4KVME 4AVAA 4L8AA 2VBQA 1CJWA 5HMNA 3F5BA 3S6GA 4AVBA 3GKRA 1M4GA 2OZUA 5AG5A 4K30A 4II9A 2Q04A 3TOAA 4HNXB 5AG4A 1RO5A 4H6UA 1YVKA 1YX0A 2ZW5A 3A9LA 4A31A 5AGEA 2ZXVA 4UWIA 4JJXA 2AJ6A 3EXNA 4LX9A 1Q2YA 2GE3A 2REFA 3IGRA 4CGNA 3BJ7A 1XMTA 1M4IA 2QIRA 3P2FA 5FVJA 3W91A 1XIXA 1MJBA 3B8GA 1B87A 4KOXA 1M4DA 4JWPA 2R1IA 4U5YA 2H5MA 3EFAA 1S7NA 4ORFA 3C26A 1IYLA 4H89A 4JXQA 3F8KA 2OZHA 5J8FA 4UFVA 1KUVA 3D2PA 4XPDC 2PR1A 3TE4A 2VEZA 4C2YA 1Y7RA 4J3GA 3CXSA 2Z3LA 2WPWA 4A33A 2P6FA 4MHDA 5IX3A 3TTHA 2ZW6A 4F0XA 3IWGA 4KSAA 3CXPA 5DWNA 2D4OA 4ONUA 2PR8A 4UCPA 1NMTA 2I79A 4OADA 1QSRA 2ZPAA 1M44A 4U9YA 2YNEA 3TOBA 2FS5A 4CRZB 2JDDA 3DDDA 4B10A 4KOSA 1NSLA 1Y9KA 4CAXA 4FD5A 2B4DA 2FXFA 4XNHB 2ZW7A 3QB8A 5IV0A 2HUZA 4QB9A 4UFWA 3OWCA 3DSBA 1I12A 1BOBA 4F0YA 4XPLA 2ARHA 4EVYA 4ZGYB 5A27A 2J8MA 1Q2DA 4NCZA 4X5KA 1P0HA 2B58A 4OAEA 4MJ8A 3MGDA 5EBVA 2PRBA 4MFLA 2FIAA 2I00A 3W6XA 4C7HA 1Q2CA 3R9FA 1U6MA 1PUAA 2P0WA 3FRMA 5DWMA 2KCWA 2PQ8A 4UWJA 1Z9UA 1M1DA 4YGOA 1YLEA 5E96A 4YFJA 4M3SA 1K4JA 1Y9WA 2FCKA 4UCMA 5G1ZA 5AG6A 3SXOA 4CAWA 2VZZA 2R98A 1KUYA 2JLMA 2VI7A 3R96A 5BWAB 2BL1A 4KOTA 3IWEA 1I21A 4MFQA 4UA3A 3QAHA 1MJAA 3FXTA 4Q38A 3TT2A 1QSNA 1VKCA 3FYNA 4MBUA 5J8CA 1N71A 2DPTA 5CNPA 3G3SA 3I3GA 5C88A 5F49A 4FD4A 3P2HA 4MFPA 3GY9A 4XNHC 4E2AA 2JEVA 2RC4A 4CRYB 2Q44A 4Y49C 2K5TA 4KOWA 2REEA 1LRZA 4IUSA 4MI4A 2GIVA 4U9ZA 1MJ9A 2BEIA 1YR0A 3D8PA 4AVCA 4FD6A 4R3KA 4B5PA 2O28A 4Y49B 1P4NA 2VXKA 3D3SA 4M85A 1Z4RA 5C82A 1I1DA 5IB0A 3K9UA 4CGPA 4CGOA 4MY3A 2DXQA 3T90A 3D2MA 4B5PB 4FD7A 2OB0A 4B12A 1QSOA 2PSWA 2FL4A 3TO7A 3DR8A 2B4DB 3E0KA 3R1KA 2VZYA 3F0AA 5EC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YGH A;  4HNY B;  1S7F A;  1TIQ A;  5KTD A;  2B3U A;  2CNT A;  1YK3 A;  3JVN A;  3DNS A;  1IB1 E;  2G3A A;  3WR7 A;  2F5I A;  3FBU A;  4AG9 A;  2EVN A;  4CAV A;  2D4P A;  3FNC A;  4E0A A;  2B4B A;  2J8N A;  1QSM A;  4PSW A;  1IID A;  1IYK A;  3TO9 A;  2BSW A;  4R57 A;  3JUW A;  4AG7 A;  4PSX A;  3G8W A;  1BO4 A;  4F6A A;  4LUA A;  4QUS A;  2IL4 A;  2Q0Y A;  4L89 A;  2A4N A;  3GYA A;  2P6G A;  4KZT A;  5F48 A;  2CNS A;  4DNC A;  5H84 A;  3LD2 A;  2JDC A;  3I9S A;  2HV2 A;  5GCN A;  2GAN A;  5KTC A;  4ZBG A;  4MY0 A;  4KOY A;  2AE6 A;  4UBR A;  3R9G A;  1V0C A;  3SXN A;  4AB7 A;  4BMH A;  2VQY A;  1Z4E A;  5ISV A;  4KOV A;  4R3L A;  2G3T A;  4NF1 A;  1NE9 A;  1S7K A;  4NEX A;  2Z11 A;  4RI1 A;  3VWE A;  3S6K A;  3FB3 A;  3N7Z A;  3LOD A;  1PU9 A;  4E8O A;  1KUX A;  4OLL A;  4PK2 A;  5F46 A;  1SQH A;  3EC4 A;  1IIC A;  5HH1 A;  1XE4 A;  4KOU A;  2B5G B;  4QBJ A;  2QML A;  3PP9 A;  2FIW A;  3VWD A;  4HNW B;  3PGP A;  1L0C A;  1QST A;  3S6F A;  1OZP A;  4CS0 B;  3BJ8 A;  4NXY A;  4KLV A;  4PK3 A;  2Z10 A;  1R57 A;  3NE7 A;  4YRH A;  1B6B A;  1S60 A;  4XPD B;  4HKF A;  3W6S A;  2OZG A;  3RYO A;  3KKW A;  1XF8 A;  2FE7 A;  3R95 A;  4NSQ A;  2X7B A;  4GS4 A;  4JLY A;  1RXT A;  1WWZ A;  4I49 A;  4IF5 A;  2Q4Y A;  2HQY A;  2P6E A;  3H4Q A;  2BUE A;  3TCV A;  3T9Y A;  1S7L A;  1MK4 A;  2EUI A;  1UFH A;  5H86 A;  5JQ4 A;  1KZF A;  3DR6 A;  3BLN A;  1YVO A;  2C27 A;  1FY7 A;  1WK4 A;  3V8I A;  2B5G A;  3PZJ A;  2PDO A;  2ZW4 A;  3EO4 A;  2NMT A;  2Q7B A;  2G0B A;  4JD6 A;  1YRE A;  1S3Z A;  2PC1 A;  3CXQ A;  3FIX A;  4QC6 A;  4RS2 A;  2FT0 A;  1ON0 A;  4KLW A;  2Z0Z A;  4R87 A;  2QEC A;  2FSR A;  2ATR A;  5JPH A;  3TO6 A;  5I0C A;  4KVX A;  4B5O A;  3TFY A;  2CY2 A;  1VHS A;  1J4J A;  2Q4V A;  4R9M A;  3R9E A;  4KUA A;  4XPK A;  2Y0M A;  2J8R A;  4JXR A;  3SHP A;  2CNM A;  2OU2 A;  1GHE A;  4KOR A;  2R8V A;  4H6Z A;  3ZJ0 A;  4PV6 A;  5F47 A;  2OH1 A;  2R7H A;  2B3V A;  2WPX A;  3ZZI A;  3UY5 A;  1XEB A;  4KUB A;  4KVO E;  3S6H A;  3EY5 A;  5KTA A;  4QVT A;  1S5K A;  1CM0 A;  4KVM E;  4AVA A;  4L8A A;  2VBQ A;  1CJW A;  5HMN A;  3F5B A;  3S6G A;  4AVB A;  3GKR A;  1M4G A;  2OZU A;  4K30 A;  4II9 A;  2Q04 A;  3TOA A;  4HNX B;  1RO5 A;  4H6U A;  1YVK A;  1YX0 A;  2ZW5 A;  2ZXV A;  4UWI A;  4JJX A;  2AJ6 A;  3EXN A;  4LX9 A;  1Q2Y A;  2GE3 A;  2REF A;  3IGR A;  3BJ7 A;  1XMT A;  1M4I A;  2QIR A;  3P2F A;  5FVJ A;  3W91 A;  1XIX A;  1MJB A;  3B8G A;  1B87 A;  4KOX A;  1M4D A;  4JWP A;  2R1I A;  4U5Y A;  2H5M A;  3EFA A;  1S7N A;  4ORF A;  3C26 A;  1IYL A;  4H89 A;  4JXQ A;  3F8K A;  2OZH A;  5J8F A;  1KUV A;  3D2P A;  4XPD C;  2PR1 A;  3TE4 A;  2VEZ A;  1Y7R A;  4J3G A;  3CXS A;  2WPW A;  2P6F A;  4MHD A;  5IX3 A;  3TTH A;  2ZW6 A;  3IWG A;  3CXP A;  5DWN A;  2D4O A;  4ONU A;  2PR8 A;  1NMT A;  2I79 A;  4OAD A;  1QSR A;  2ZPA A;  1M44 A;  4U9Y A;  3TOB A;  2FS5 A;  4CRZ B;  2JDD A;  3DDD A;  4KOS A;  1NSL A;  1Y9K A;  4CAX A;  4FD5 A;  2B4D A;  2FXF A;  4XNH B;  2ZW7 A;  3QB8 A;  5IV0 A;  2HUZ A;  4QB9 A;  3OWC A;  3DSB A;  1I12 A;  1BOB A;  4F0Y A;  4XPL A;  2ARH A;  4EVY A;  2J8M A;  1Q2D A;  4NCZ A;  4X5K A;  1P0H A;  2B58 A;  4OAE A;  4MJ8 A;  3MGD A;  5EBV A;  2PRB A;  2FIA A;  2I00 A;  3W6X A;  1Q2C A;  3R9F A;  1U6M A;  1PUA A;  2P0W A;  3FRM A;  5DWM A;  2KCW A;  2PQ8 A;  4UWJ A;  1Z9U A;  1M1D A;  4YGO A;  1YLE A;  5E96 A;  4YFJ A;  4M3S A;  1K4J A;  1Y9W A;  2FCK A;  3SXO A;  4CAW A;  2VZZ A;  2R98 A;  1KUY A;  2JLM A;  2VI7 A;  3R96 A;  2BL1 A;  4KOT A;  1I21 A;  4UA3 A;  3QAH A;  1MJA A;  3FXT A;  3TT2 A;  1QSN A;  1VKC A;  3FYN A;  4MBU A;  5J8C A;  1N71 A;  5CNP A;  3G3S A;  3I3G A;  5C88 A;  5F49 A;  4FD4 A;  3P2H A;  3GY9 A;  4XNH C;  4E2A A;  2JEV A;  2RC4 A;  4CRY B;  2Q44 A;  4Y49 C;  2K5T A;  4KOW A;  2REE A;  1LRZ A;  4IUS A;  4MI4 A;  2GIV A;  4U9Z A;  1MJ9 A;  2BEI A;  1YR0 A;  3D8P A;  4AVC A;  4FD6 A;  4R3K A;  4B5P A;  2O28 A;  4Y49 B;  1P4N A;  2VXK A;  3D3S A;  4M85 A;  1Z4R A;  5C82 A;  1I1D A;  5IB0 A;  3K9U A;  4MY3 A;  2DXQ A;  3T90 A;  3D2M A;  4B5P B;  4FD7 A;  2OB0 A;  1QSO A;  2PSW A;  2FL4 A;  3TO7 A;  3DR8 A;  2B4D B;  3E0K A;  3R1K A;  2VZY A;  3F0A A;  5EC4 A; 
#chains in the Genus database with same CATH topology
 1CG2 A;  4NGP A;  1ELL P;  5G22 A;  3SJE A;  2WUU A;  1YGH A;  3RAM A;  1CPX A;  4HNY B;  1S7F A;  1BLL E;  4LQ6 A;  1CBX A;  1TIQ A;  5KTD A;  2B3U A;  2CNT A;  3KI9 A;  1YK3 A;  3BI0 A;  1LAP A;  3JVN A;  4C68 A;  3DNS A;  3JTK A;  1IB1 E;  2G3A A;  3H8E A;  3PFE A;  3WR7 A;  2F5I A;  3FBU A;  4AG9 A;  5LYI A;  1ZLH A;  2O53 A;  4TNU A;  2GLF A;  4CPA A;  2EVN A;  4CAV A;  2D4P A;  4A2Z A;  1PYT B;  1XRY A;  3FNC A;  3VAR A;  4A32 A;  5A28 A;  4CYP A;  2Z3M A;  3L2N A;  5I4M A;  4E0A A;  2B4B A;  4P10 A;  2J8N A;  1QSM A;  4KSF A;  2YNC A;  4PSW A;  1IGB A;  4C2Z A;  4MHN A;  1IID A;  2YGW A;  2AFU A;  1IYK A;  3TO9 A;  2BSW A;  3VH9 A;  4R57 A;  2Z3N A;  3JUW A;  2C6G A;  4JZ0 A;  1DTD A;  2Z3O A;  4AG7 A;  2CTC A;  3KL9 A;  3G8W A;  4M6I A;  3KQZ A;  4PSX A;  1BO4 A;  4F6A A;  4LUA A;  4QUS A;  4C2X A;  2IL4 A;  2Q0Y A;  2YND A;  1ZO0 A;  3QAY A;  4L89 A;  2A4N A;  2Q51 A;  2PJA A;  2POK A;  2P6G A;  3GYA A;  1AUG A;  4KZT A;  5F48 A;  2CNS A;  2PVW A;  3WAB A;  4DNC A;  5D8N A;  4UCN A;  1HEE A;  5H84 A;  4MHP A;  2QJ8 A;  2IQ6 A;  2JDC A;  3LD2 A;  4GXH A;  3I9S A;  2HV2 A;  5GCN A;  2GAN A;  1CP6 A;  2J9A A;  5KTC A;  3BHX A;  4ZBG A;  4MY0 A;  4KOY A;  2AE6 A;  3CT9 A;  4UBR A;  1V0C A;  2PJ8 A;  3R9G A;  1TKF A;  3SXN A;  4AB7 A;  1CX8 A;  4BMH A;  2VQY A;  3FMC A;  4MMO A;  1KWM A;  1Z4E A;  3D7G A;  4KS9 A;  2ZEP A;  5ISV A;  4KOV A;  4R3L A;  2Z3P A;  3IU2 A;  2G3T A;  3N5F A;  3B35 A;  4NF1 A;  1NE9 A;  1S7K A;  2PJ1 A;  4FUU A;  4NEX A;  4CAE A;  2JBJ A;  2Z11 A;  4EWT A;  1IOI A;  4NGM A;  4RI1 A;  1QQ9 A;  3S6K A;  3VWE A;  4MFK A;  2CIJ A;  2JBK A;  1X10 A;  3FB3 A;  1M4L A;  3N7Z A;  3LOD A;  3IWW A;  5K8M A;  4CAF A;  1PU9 A;  4E8O A;  1KUX A;  1Y0R A;  1ZG9 A;  5LRK A;  4FBE A;  4OLL A;  4PK2 A;  3V7Z A;  5F46 A;  4NJQ A;  1SQH A;  1XBU A;  3EC4 A;  1IIC A;  5HH1 A;  1XE4 A;  4KOU A;  2B5G B;  4QBJ A;  2QML A;  2BCO A;  3PP9 A;  2FIW A;  3VWD A;  4MCQ A;  4IAV A;  1ZG7 A;  3PGP A;  4HNW B;  1FT7 A;  4MCS A;  1L0C A;  4NGN A;  4PXC A;  1QST A;  4JYW A;  3S6F A;  1OZP A;  2OR4 A;  4CS0 B;  2BOA A;  3BJ8 A;  4NXY A;  4KLV A;  3PB4 X;  2Z10 A;  4PK3 A;  3ISZ A;  3HUV A;  5F09 A;  3RNZ A;  4NGR A;  4OKO A;  4PXE A;  2PJ5 A;  1R57 A;  3IU1 A;  4ZY0 A;  3NE7 A;  4CGM A;  4NGS A;  4YRH A;  3CDX A;  1VIX A;  4EFD A;  1B6B A;  1S60 A;  4XPD B;  4HKF A;  3W6S A;  5EMI A;  2OZG A;  3RYO A;  1VHE A;  3KKW A;  3FX6 A;  1XF8 A;  4P4B A;  2FE7 A;  4TWE A;  3R95 A;  4NSQ A;  3TC8 A;  3PBB A;  1LAN A;  1YSJ A;  2DF5 A;  2X7B A;  4K3N A;  2ZEG A;  4GS4 A;  1IY7 A;  3FH4 A;  4JLY A;  1RXT A;  4R7M A;  1WWZ A;  1F2O A;  2BO9 A;  4I49 A;  2DPS A;  4IF5 A;  5THW A;  2Q4Y A;  5IB9 A;  3H5Z A;  2WSA A;  3KHX A;  2HQY A;  4UEZ A;  2P6E A;  3H4Q A;  2PJB A;  2BUE A;  3BI1 A;  3T9Y A;  1S7L A;  3TCV A;  5LRJ A;  4UFX A;  3HLP A;  1MK4 A;  2EUI A;  4MCR A;  1UFH A;  5H86 A;  3IFE A;  4F8Z A;  5JQ4 A;  1AMP A;  1KZF A;  3S9N A;  3DR6 A;  7CPA A;  3BLN A;  1LOK A;  1YVO A;  4ZX9 A;  3CZX A;  3B7I A;  5AG7 A;  4B13 A;  4C7I A;  3FED A;  2C27 A;  1FY7 A;  1WK4 A;  2DEA A;  3V8I A;  4HPS A;  3PFO A;  2B5G A;  3PZJ A;  2PDO A;  2ZW4 A;  3IJ3 A;  3LWU A;  4PQA A;  3EO4 A;  4Q36 A;  4R76 A;  2NMT A;  3D7D A;  2Q7B A;  2Q43 A;  2G0B A;  2NSM A;  2Z3K A;  4JD6 A;  1YRE A;  1S3Z A;  2V8D A;  1UWY A;  3B2Y A;  4A30 A;  2PC1 A;  3CXQ A;  3KAS A;  5K8P A;  5LRG A;  3FIX A;  4B14 A;  5HVF A;  4QC6 A;  4RS2 A;  4ZX8 A;  4IHM A;  2FT0 A;  5G20 A;  4MFJ A;  3QNV A;  1ON0 A;  5LYD A;  4KLW A;  2Z0Z A;  4P4D A;  4R87 A;  2QEC A;  4UEE A;  2C1C A;  3KQX A;  2FSR A;  2ATR A;  4NGT A;  5JPH A;  3NH5 A;  2PJ3 A;  3TO6 A;  5I0C A;  2ZOF A;  4MFZ A;  4KVX A;  4B5O A;  1ELM P;  3TFY A;  2CY2 A;  4BBH A;  1VHS A;  2AFM A;  5G21 A;  1J4J A;  2Q4V A;  4R9M A;  3R9E A;  4RUH A;  4F9V A;  2RB7 A;  2AFW A;  4NJR A;  4KUA A;  4XPK A;  2Y0M A;  3D7F A;  4B11 A;  2ZEE A;  3PB6 X;  2J8R A;  1YW6 A;  2RFH A;  4JXR A;  3SHP A;  4CYQ A;  2CNM A;  2ZED A;  2OU2 A;  2ZOG A;  4W9Y A;  1GHE A;  3GIU A;  4KOR A;  1LCP A;  4UEF A;  3MRU A;  4CYO A;  2R8V A;  4H6Z A;  3ZJ0 A;  3SJF A;  4PV6 A;  1ZG8 A;  5F47 A;  5LYL A;  2OH1 A;  2PIY A;  3SI0 A;  2R7H A;  4YU9 A;  4DUK A;  2CXA A;  5CBM A;  5K8O A;  4X2T A;  2B3V A;  2ABZ A;  1TKH A;  2EO8 A;  3WC6 A;  4CGL A;  1Q7L A;  4OC4 A;  1ARL A;  5JH9 A;  2WPX A;  3ZZI A;  4A95 A;  3UY5 A;  1XEB A;  1HDU A;  2YNC C;  4KUB A;  4CYN A;  4KVO E;  3S6H A;  3EY5 A;  4OC1 A;  4PXB A;  1YME A;  4QVT A;  5KTA A;  1S5K A;  1JWQ A;  2G9D A;  1CM0 A;  4KVM E;  3ISX A;  4AVA A;  4L8A A;  4WWV A;  2VBQ A;  1CJW A;  2PJ7 A;  2FVG A;  2XEI A;  4Q7A A;  3BXM A;  4UIB A;  5HMN A;  3F5B A;  3KZW A;  3S6G A;  3IEH A;  4AVB A;  3GKR A;  1M4G A;  2OZU A;  4OP4 A;  4P4E A;  5AG5 A;  3K2K A;  3FJU A;  3PRT A;  4K30 A;  4O23 A;  1JQG A;  2Q04 A;  4X8I A;  4HNX B;  4GM5 A;  3TOA A;  5AG4 A;  1RO5 A;  2ANP A;  3S9M A;  3KHZ A;  5HXD A;  3S9L A;  4H6U A;  3D67 A;  3B3T A;  4OC2 A;  3SI2 A;  1LAM A;  2PRQ A;  1YVK A;  1YX0 A;  2ZEO A;  4OIW A;  2ZW5 A;  3A9L A;  3IO1 A;  4A31 A;  5AGE A;  1Z8W A;  2ZXV A;  4JJX A;  4UWI A;  2AJ6 A;  3EXN A;  4LX9 A;  4OC5 A;  2AFX A;  1BAV A;  1Q2Y A;  2F8H A;  2GE3 A;  2REF A;  3IGR A;  4CGN A;  4MHZ A;  3BJ7 A;  1XMT A;  1M4I A;  2QIR A;  3P2F A;  5FVJ A;  3W91 A;  4B6Z A;  1XIX A;  1MJB A;  3B8G A;  3VAT A;  3I1U A;  1B87 A;  4KOX A;  3DGV A;  3DLJ A;  1GYT A;  3TX8 A;  4P4I A;  1M4D A;  4JWP A;  2R1I A;  4U5Y A;  3KGQ A;  4A39 A;  2H5M A;  3EFA A;  4NFR A;  1S7N A;  4ORF A;  2PJ9 A;  3MN8 A;  3C26 A;  1IYL A;  4H89 A;  2QVP A;  1TKJ A;  2XEF A;  2OZH A;  3F8K A;  1BPM A;  4JXQ A;  5J8F A;  3NFZ A;  4UFV A;  3JRU A;  1KUV A;  3D2P A;  3NH4 A;  2IJZ A;  3H8F A;  4XPD C;  2PR1 A;  3TE4 A;  1LFW A;  1OBR A;  2GRE A;  2VEZ A;  4C2Y A;  1Y0Y A;  1Y7R A;  4J3G A;  3CXS A;  4R8F A;  1VHO A;  5CPA A;  2Z3L A;  2WPW A;  4UF4 A;  4A33 A;  2P6F A;  4MHD A;  4EME A;  1QMU A;  5IX3 A;  1NSA A;  3TTH A;  4LQG A;  2ZW6 A;  4OME A;  4DJL A;  3WC5 A;  1Z8T A;  4F0X A;  3IWG A;  2GFQ A;  4KSA A;  1DE4 C;  5K8N A;  3CXP A;  5JM6 A;  5DWN A;  4FAI A;  1F2P A;  3SJG A;  2D4O A;  2WZN A;  4ONU A;  4G1P A;  2V8H A;  2PR8 A;  2ZEN A;  3IC1 A;  1NMT A;  3PBE A;  4UCP A;  2I79 A;  1Y7E A;  4OAD A;  1ARM A;  4UIA A;  1QSR A;  2ZPA A;  1M44 A;  4U9Y A;  2YNE A;  3TOB A;  2V8V A;  1IU8 A;  2FS5 A;  1PCA A;  2ODF A;  4CRZ B;  2JDD A;  3DDD A;  1ZLI A;  2EK8 A;  2PCU A;  4KOS A;  1Y9K A;  1XOV A;  1NSL A;  4B10 A;  4CAX A;  4FD5 A;  3V38 A;  2EK9 A;  3FEC A;  4A94 A;  1AYE A;  2B4D A;  2FXF A;  2HB6 A;  4XNH B;  2I3C A;  2ZW7 A;  2WYR A;  3QB8 A;  5IV0 A;  4P44 A;  2HUZ A;  2JEW A;  4MRI A;  4QB9 A;  4X3R A;  4UFW A;  6CPA A;  2EBJ A;  1Z5R A;  4Z65 A;  4MXU A;  2ZEM A;  2NYQ A;  3OWC A;  4P6Y A;  3DSB A;  5HVH A;  2ZEF A;  3B3V A;  4BD9 A;  2OOT A;  1I12 A;  1BOB A;  4F0Y A;  4XPL A;  2ARH A;  4EVY A;  3FF3 A;  4ZGY B;  1TF8 A;  5A27 A;  5JGF A;  2J8M A;  1Q2D A;  4P45 A;  5LYF A;  4NCZ A;  4X5K A;  1P0H A;  2B58 A;  2QYV A;  4MJ8 A;  4OAE A;  3MGD A;  3PB8 X;  2ZEL A;  3D7H A;  3SI1 A;  5EBV A;  2PRB A;  4MFL A;  1XFO A;  2FIA A;  2I00 A;  4PXD A;  3W6X A;  4C7H A;  3NH8 A;  3SJX A;  1Q2C A;  3R9F A;  1U6M A;  1PUA A;  4MHY A;  2P0W A;  4RN7 A;  3FRM A;  4ZY2 A;  5DWM A;  2GU2 A;  2KCW A;  3K9T A;  1F57 A;  2PQ8 A;  4UWJ A;  2PJC A;  3NA6 A;  1Z9U A;  1M1D A;  2CTB A;  3FVL A;  3H8G A;  3LMS A;  1BPN A;  4YGO A;  3KR4 A;  1YLE A;  2O4H A;  4M6H A;  3LAC A;  5E96 A;  4YFJ A;  3D4U A;  1R43 A;  8CPA A;  4M3S A;  3PB9 X;  4NGQ A;  5J1Q A;  3B3S A;  3IIB A;  1K4J A;  1Y9W A;  2FCK A;  2Q7S A;  4UCM A;  5G1Z A;  1R3N A;  4BIN A;  5AG6 A;  3SXO A;  4CAW A;  2VZZ A;  2R98 A;  4OC3 A;  1KUY A;  3RZA A;  2VL1 A;  2JLM A;  3D68 A;  2VI7 A;  3R96 A;  1X12 A;  5ELY A;  2BL1 A;  5BWA B;  2PJ0 A;  2PVV A;  4KOT A;  4KSI A;  3IWE A;  1I21 A;  4A38 A;  4MFQ A;  3T8W A;  1YQE A;  2AFS A;  1Z8L A;  2PIZ A;  4UA3 A;  4H2K A;  3QAH A;  3GB0 A;  4DYO A;  4ZY1 A;  1TXR A;  1MJA A;  4ZI6 A;  3FXT A;  4Q38 A;  2PJ2 A;  4M6G A;  2XEJ A;  3CPA A;  3TT2 A;  4MCP A;  1QSN A;  1YW4 A;  5HVG A;  1VKC A;  1Z2L A;  1FNO A;  2HC9 A;  3FYN A;  3CPX A;  2AFZ A;  4IK2 A;  4MBU A;  5J8C A;  4A37 A;  1N71 A;  2DPT A;  2AFO A;  1VGY A;  3B3C A;  3G3S A;  1XJO A;  3PB7 X;  2CF4 A;  3NE8 A;  5CNP A;  3KR5 A;  3I3G A;  5C88 A;  1EE3 P;  5F49 A;  4FD4 A;  1IOF A;  3P2H A;  2C6P A;  4MFP A;  3B3W A;  3GY9 A;  4XNH C;  4E2A A;  2JEV A;  3PEI A;  2RC4 A;  1A2Z A;  4CRY B;  3D66 A;  2C6C A;  2ZEH A;  3GUX A;  4YWY A;  2Q44 A;  4Y49 C;  2K5T A;  4KOW A;  4AXV A;  2REE A;  1LRZ A;  3FEE A;  4IUS A;  2V8G A;  2GIV A;  4MI4 A;  3RBU A;  3WT4 A;  4U9Z A;  1MJ9 A;  5D29 A;  2BEI A;  1YLO A;  4F9U A;  1YR0 A;  3D8P A;  1HDQ A;  2IMO A;  4AVC A;  4FD6 A;  3WC7 A;  2PE3 A;  4R3K A;  4B5P A;  1TF9 A;  4P4F A;  3RO0 A;  2O28 A;  1CP7 A;  4Y49 B;  3GLJ A;  1P4N A;  2VXK A;  3D3S A;  4WJB A;  1Z8X A;  4M85 A;  1Z4R A;  1CPS A;  5C82 A;  2V77 A;  4FWU A;  1I1D A;  5IB0 A;  5DS0 A;  3K9U A;  4CGP A;  2PJ6 A;  4ONW A;  4PPZ A;  4OC0 A;  4CGO A;  4MY3 A;  2DXQ A;  4P4J A;  2EWB A;  3T90 A;  3D2M A;  4B5P B;  4FD7 A;  2OB0 A;  4R6T A;  2XEG A;  4B12 A;  1H8L A;  2PSW A;  1QSO A;  2FL4 A;  2GLJ A;  3DR8 A;  2B4D B;  3TO7 A;  4II9 A;  3E0K A;  3R1K A;  4OID A;  1RTQ A;  2F7V A;  2Q4Z A;  2PJ4 A;  2VZY A;  3F0A A;  1XMB A;  4ZYQ A;  5EC4 A; 
#chains in the Genus database with same CATH homology
 5G22 A;  2WUU A;  1YGH A;  4HNY B;  1S7F A;  1TIQ A;  5KTD A;  2B3U A;  2CNT A;  1YK3 A;  4C68 A;  3JVN A;  3DNS A;  3JTK A;  1IB1 E;  2G3A A;  3WR7 A;  2F5I A;  3FBU A;  4AG9 A;  2EVN A;  4CAV A;  2D4P A;  4A2Z A;  3FNC A;  4A32 A;  5A28 A;  4CYP A;  2Z3M A;  4E0A A;  2B4B A;  2J8N A;  1QSM A;  4KSF A;  2YNC A;  4PSW A;  4C2Z A;  1IID A;  2YGW A;  1IYK A;  3TO9 A;  2BSW A;  4R57 A;  2Z3N A;  3JUW A;  2Z3O A;  4AG7 A;  4PSX A;  3G8W A;  1BO4 A;  4F6A A;  4LUA A;  4QUS A;  4C2X A;  2IL4 A;  2Q0Y A;  2YND A;  1ZO0 A;  4L89 A;  2A4N A;  3GYA A;  2P6G A;  4KZT A;  5F48 A;  2CNS A;  4DNC A;  4UCN A;  5H84 A;  3LD2 A;  2JDC A;  3I9S A;  2HV2 A;  5GCN A;  2GAN A;  5KTC A;  4ZBG A;  4MY0 A;  4KOY A;  2AE6 A;  4UBR A;  3R9G A;  1V0C A;  3SXN A;  4AB7 A;  4BMH A;  2VQY A;  1Z4E A;  5ISV A;  4KS9 A;  4KOV A;  4R3L A;  2Z3P A;  3IU2 A;  2G3T A;  4NF1 A;  1NE9 A;  1S7K A;  4NEX A;  4CAE A;  2Z11 A;  4RI1 A;  3VWE A;  3S6K A;  4MFK A;  3FB3 A;  3N7Z A;  3LOD A;  4CAF A;  1PU9 A;  4E8O A;  1KUX A;  4OLL A;  4PK2 A;  5F46 A;  1SQH A;  3EC4 A;  1IIC A;  5HH1 A;  1XE4 A;  4KOU A;  2B5G B;  4QBJ A;  2QML A;  3PP9 A;  2FIW A;  3VWD A;  4HNW B;  3PGP A;  1L0C A;  1QST A;  3S6F A;  1OZP A;  4CS0 B;  3BJ8 A;  4NXY A;  4KLV A;  4PK3 A;  2Z10 A;  1R57 A;  3IU1 A;  3NE7 A;  4CGM A;  4YRH A;  1B6B A;  1S60 A;  4XPD B;  4HKF A;  3W6S A;  2OZG A;  3RYO A;  3KKW A;  1XF8 A;  2FE7 A;  3R95 A;  4NSQ A;  2X7B A;  4GS4 A;  4JLY A;  1RXT A;  1WWZ A;  4I49 A;  2DPS A;  4IF5 A;  2Q4Y A;  3H5Z A;  2WSA A;  2HQY A;  2P6E A;  3H4Q A;  2BUE A;  3TCV A;  3T9Y A;  1S7L A;  4UFX A;  1MK4 A;  2EUI A;  1UFH A;  5H86 A;  5JQ4 A;  1KZF A;  3DR6 A;  3BLN A;  1YVO A;  4B13 A;  5AG7 A;  4C7I A;  2C27 A;  1FY7 A;  1WK4 A;  3V8I A;  2B5G A;  3PZJ A;  2PDO A;  2ZW4 A;  3EO4 A;  4Q36 A;  2NMT A;  2Q7B A;  2G0B A;  4JD6 A;  2Z3K A;  1YRE A;  1S3Z A;  4A30 A;  2PC1 A;  3CXQ A;  4B14 A;  3FIX A;  4QC6 A;  4RS2 A;  2FT0 A;  5G20 A;  4MFJ A;  1ON0 A;  4KLW A;  2Z0Z A;  4R87 A;  2QEC A;  2FSR A;  2ATR A;  5JPH A;  3TO6 A;  5I0C A;  4MFZ A;  4KVX A;  4B5O A;  3TFY A;  2CY2 A;  4BBH A;  1VHS A;  5G21 A;  1J4J A;  2Q4V A;  4R9M A;  3R9E A;  4KUA A;  4XPK A;  2Y0M A;  4B11 A;  2J8R A;  4JXR A;  3SHP A;  4CYQ A;  2CNM A;  2OU2 A;  1GHE A;  4KOR A;  4CYO A;  2R8V A;  4H6Z A;  3ZJ0 A;  4PV6 A;  5F47 A;  2OH1 A;  2R7H A;  2CXA A;  2B3V A;  4CGL A;  2WPX A;  3ZZI A;  4A95 A;  3UY5 A;  1XEB A;  2YNC C;  4KUB A;  4CYN A;  4KVO E;  3S6H A;  3EY5 A;  5KTA A;  4QVT A;  1S5K A;  1CM0 A;  4KVM E;  4AVA A;  4L8A A;  2VBQ A;  1CJW A;  5HMN A;  3F5B A;  3S6G A;  4AVB A;  3GKR A;  1M4G A;  2OZU A;  5AG5 A;  4K30 A;  4II9 A;  2Q04 A;  3TOA A;  4HNX B;  5AG4 A;  1RO5 A;  4H6U A;  1YVK A;  1YX0 A;  2ZW5 A;  3A9L A;  4A31 A;  5AGE A;  2ZXV A;  4UWI A;  4JJX A;  2AJ6 A;  3EXN A;  4LX9 A;  1Q2Y A;  2GE3 A;  2REF A;  3IGR A;  4CGN A;  3BJ7 A;  1XMT A;  1M4I A;  2QIR A;  3P2F A;  5FVJ A;  3W91 A;  1XIX A;  1MJB A;  3B8G A;  1B87 A;  4KOX A;  1M4D A;  4JWP A;  2R1I A;  4U5Y A;  2H5M A;  3EFA A;  1S7N A;  4ORF A;  3C26 A;  1IYL A;  4H89 A;  4JXQ A;  3F8K A;  2OZH A;  5J8F A;  4UFV A;  1KUV A;  3D2P A;  4XPD C;  2PR1 A;  3TE4 A;  2VEZ A;  4C2Y A;  1Y7R A;  4J3G A;  3CXS A;  2Z3L A;  2WPW A;  4A33 A;  2P6F A;  4MHD A;  5IX3 A;  3TTH A;  2ZW6 A;  4F0X A;  3IWG A;  4KSA A;  3CXP A;  5DWN A;  2D4O A;  4ONU A;  2PR8 A;  4UCP A;  1NMT A;  2I79 A;  4OAD A;  1QSR A;  2ZPA A;  1M44 A;  4U9Y A;  2YNE A;  3TOB A;  2FS5 A;  4CRZ B;  2JDD A;  3DDD A;  4B10 A;  4KOS A;  1NSL A;  1Y9K A;  4CAX A;  4FD5 A;  2B4D A;  2FXF A;  4XNH B;  2ZW7 A;  3QB8 A;  5IV0 A;  2HUZ A;  4QB9 A;  4UFW A;  3OWC A;  3DSB A;  1I12 A;  1BOB A;  4F0Y A;  4XPL A;  2ARH A;  4EVY A;  4ZGY B;  5A27 A;  2J8M A;  1Q2D A;  4NCZ A;  4X5K A;  1P0H A;  2B58 A;  4OAE A;  4MJ8 A;  3MGD A;  5EBV A;  2PRB A;  4MFL A;  2FIA A;  2I00 A;  3W6X A;  4C7H A;  1Q2C A;  3R9F A;  1U6M A;  1PUA A;  2P0W A;  3FRM A;  5DWM A;  2KCW A;  2PQ8 A;  4UWJ A;  1Z9U A;  1M1D A;  4YGO A;  1YLE A;  5E96 A;  4YFJ A;  4M3S A;  1K4J A;  1Y9W A;  2FCK A;  4UCM A;  5G1Z A;  5AG6 A;  3SXO A;  4CAW A;  2VZZ A;  2R98 A;  1KUY A;  2JLM A;  2VI7 A;  3R96 A;  5BWA B;  2BL1 A;  4KOT A;  3IWE A;  1I21 A;  4MFQ A;  4UA3 A;  3QAH A;  1MJA A;  3FXT A;  4Q38 A;  3TT2 A;  1QSN A;  1VKC A;  3FYN A;  4MBU A;  5J8C A;  1N71 A;  2DPT A;  5CNP A;  3G3S A;  3I3G A;  5C88 A;  5F49 A;  4FD4 A;  3P2H A;  4MFP A;  3GY9 A;  4XNH C;  4E2A A;  2JEV A;  2RC4 A;  4CRY B;  2Q44 A;  4Y49 C;  2K5T A;  4KOW A;  2REE A;  1LRZ A;  4IUS A;  4MI4 A;  2GIV A;  4U9Z A;  1MJ9 A;  2BEI A;  1YR0 A;  3D8P A;  4AVC A;  4FD6 A;  4R3K A;  4B5P A;  2O28 A;  4Y49 B;  1P4N A;  2VXK A;  3D3S A;  4M85 A;  1Z4R A;  5C82 A;  1I1D A;  5IB0 A;  3K9U A;  4CGP A;  4CGO A;  4MY3 A;  2DXQ A;  3T90 A;  3D2M A;  4B5P B;  4FD7 A;  2OB0 A;  4B12 A;  1QSO A;  2PSW A;  2FL4 A;  3TO7 A;  3DR8 A;  2B4D B;  3E0K A;  3R1K A;  2VZY A;  3F0A A;  5EC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...