4M85A

Crystal structure of n-acetyltransferase from staphylococcus aureus mu50
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
185
structure length
185
Chain Sequence
SNAMIRQARPEDRFDIAKLVYMVWDDMELELVKHLPKDMVLDAIEKSCVDATYRTFYQHILVYEVENKVAGCIISYSGENELKYEKAWELLDLPEEIKQYGTPLPVKEAKDDEYYIETIATFAAYRGRGIATKLLTSLLESNTHVKWSLNCDINNEAALKLYKKVGFISDGQIELYKHMYHHLIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-acetyltransferase
publication title Expression,purification and X-ray crystallography of N-acetyltransferase from Staphylococcus aureus
rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 58
structure length 185
sequence length 185
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4m85A00
4E8OA 1S7FA 2CNMA 2CNSA 1IYLA 1M4GA 4I49A 4KOXA 4M85A 4KUAA 2D4PA 3TFYA 3R9FA 3H4QA 2PQ8A 1XEBA 3TT2A 4MI4A 5IX3A 1XF8A 5JPHA 4Y49C 3FYNA 3EO4A 3DSBA 1P4NA 2ZW4A 1BO4A 2AJ6A 3DDDA 4L89A 4UBRA 1KUYA 2OZGA 4IF5A 4B5PA 3I3GA 4PSWA 4XNHC 3UY5A 2Z11A 5EBVA 4RS2A 3DR6A 4CAVA 5HMNA 1K4JA 3FXTA 1UFHA 2G3AA 3EFAA 4R3KA 2VZZA 3W6XA 4NF1A 2J8NA 1NMTA 3SXOA 1TIQA 2B3VA 2ZW7A 4KVXA 2JDDA 1B87A 4MBUA 2HQYA 3MGDA 4B5OA 2R7HA 1WK4A 1R57A 3GYAA 1MJ9A 1LRZA 2ZW5A 1M4DA 4XNHB 1PU9A 2IL4A 4HKFA 4OLLA 3VWEA 1GHEA 1MK4A 2DXQA 2OB0A 4MJ8A 4HNWB 3K9UA 1QSOA 2B3UA 4LUAA 5FVJA 4CRZB 2KCWA 3D8PA 1RXTA 2G0BA 4NSQA 5EC4A 3T9YA 1WWZA 5IV0A 3TE4A 4MY0A 2A4NA 3JUWA 4KOSA 5GCNA 2VEZA 3C26A 2PRBA 5E96A 4NXYA 1CM0A 1Q2YA 3GKRA 1Q2DA 4KORA 4F0YA 1I1DA 4XPKA 3EXNA 4JD6A 4M3SA 3R1KA 2VXKA 3E0KA 4AVAA 4HNYB 3FRMA 1IICA 4H6UA 2J8MA 3D2MA 3TO9A 4MHDA 1QSNA 2CY2A 2X7BA 3IWGA 4U9YA 3LODA 4CS0B 4XPLA 4L8AA 2I00A 2BL1A 2WPXA 3JVNA 4PK3A 2ZPAA 3F8KA 1KUXA 4JLYA 2EUIA 4R87A 3FBUA 2AE6A 4XPDB 1YLEA 3W6SA 3T90A 4U9ZA 4R9MA 3BJ8A 2P6EA 3ZJ0A 1YVOA 2OZHA 1Y9WA 2Z0ZA 4FD5A 4QBJA 1FY7A 2PR8A 4BMHA 1RO5A 2I79A 1YREA 3SXNA 3CXSA 4AG7A 1Z9UA 2RC4A 2ARHA 4KZTA 1YGHA 1M44A 1XIXA 2OH1A 1CJWA 4AVCA 3TOBA 2K5TA 2B5GA 3WR7A 1YR0A 4IUSA 5KTCA 1Y9KA 5C88A 2R8VA 5KTDA 3G3SA 3R96A 4AVBA 2B4DA 2G3TA 2Y0MA 4ORFA 4NCZA 3I9SA 3FIXA 4UA3A 5KTAA 2B4BA 1S7LA 1M4IA 2P0WA 1I21A 3BLNA 1S7KA 3P2FA 4UWJA 1YVKA 1MJBA 3TCVA 3FB3A 4FD7A 4YFJA 5DWNA 3BJ7A 2PC1A 2JEVA 1OZPA 3S6HA 2NMTA 2ZXVA 1NSLA 3EC4A 3QAHA 2JLMA 4PK2A 4R3LA 3NE7A 4OAEA 3FNCA 2P6GA 4II9A 2R1IA 2H5MA 2FSRA 4JXQA 1L0CA 2BEIA 1QSRA 2CNTA 4XPDC 2FT0A 5JQ4A 5ISVA 3F0AA 4CAXA 3SHPA 2J8RA 5DWMA 2Q7BA 2D4OA 1PUAA 3P2HA 4KVOE 4FD6A 4R57A 3S6GA 4KUBA 4FD4A 2FS5A 3F5BA 2BUEA 5J8CA 3R9EA 1S7NA 5J8FA 3TOAA 2PSWA 4EVYA 4LX9A 1IB1E 3RYOA 5IB0A 3TO6A 3R9GA 2FE7A 1Y7RA 4HNXB 5HH1A 2QECA 1QSMA 2Q44A 2REFA 3B8GA 5CNPA 2VQYA 4UWIA 3S6FA 3V8IA 3QB8A 4QC6A 4KVME 2OZUA 2R98A 4KOTA 2Q4YA 2ATRA 4K30A 2OU2A 2Z10A 4JWPA 2FIWA 5F49A 1N71A 4B5PB 1KUVA 4QUSA 1QSTA 2PR1A 4QVTA 1Q2CA 2P6FA 4YGOA 2FIAA 1P0HA 1KZFA 2WPWA 4OADA 5F48A 4GS4A 2VZYA 1VKCA 1I12A 1S60A 4AG9A 2HUZA 2B5GB 4JXRA 3TTHA 1YX0A 2GIVA 2QMLA 1B6BA 2PDOA 2B4DB 1J4JA 4U5YA 4AB7A 3TO7A 2C27A 3DR8A 4PV6A 2VI7A 4MY3A 3KKWA 2B58A 3ZZIA 4KOYA 3OWCA 4CAWA 4KLWA 3PP9A 2FL4A 3G8WA 3IGRA 2REEA 2BSWA 2Q0YA 2Q4VA 4ONUA 3GY9A 5H84A 3VWDA 4Y49B 4E0AA 4CRYB 4DNCA 3PGPA 2F5IA 4F6AA 4RI1A 4X5KA 4KLVA 1U6MA 1IIDA 3D3SA 4E2AA 1SQHA 4PSXA 1Z4RA 5H86A 3CXQA 4YRHA 1XE4A 4JJXA 3EY5A 1S3ZA 3PZJA 2VBQA 2ZW6A 3N7ZA 1Z4EA 2GANA 5F46A 2EVNA 2HV2A 5F47A 1IYKA 2QIRA 4QB9A 5I0CA 2FXFA 4NEXA 1NE9A 3LD2A 2JDCA 1YK3A 4ZBGA 1XMTA 1BOBA 3S6KA 2O28A 3DNSA 4H6ZA 1MJAA 2Q04A 4KOVA 3R95A 3CXPA 5C82A 4KOWA 3D2PA 4H89A 1VHSA 1S5KA 4J3GA 3W91A 2FCKA 1V0CA 2GE3A 4KOUA 1M1DA 1ON0A
chains in the Genus database with same CATH superfamily
4E8OA 1S7FA 4UFXA 4C2YA 2Z3NA 2CNMA 3H8EA 1ZG7A 2YNCC 2CNSA 1IYLA 1M4GA 4I49A 4KOXA 4M85A 5K8OA 3PEIA 4KUAA 3FX6A 1CBXA 2D4PA 2I3CA 3IU2A 2YNEA 3TFYA 4G1PA 5D29A 1ARMA 2FVGA 3R9FA 1Y7EA 1TKHA 5LRGA 3H4QA 2PQ8A 3PBBA 4MHYA 1XEBA 4UFWA 5LYDA 3TT2A 4MI4A 4P4JA 4IK2A 1YW6A 2CIJA 4OC0A 5IX3A 2WZNA 1BAVA 1BPNA 3FECA 1XF8A 2OOTA 2GLFA 5JPHA 4Y49C 3FYNA 3EO4A 3DSBA 1P4NA 2ZW4A 1BO4A 2AJ6A 4B13A 4K3NA 3DDDA 4MFPA 3CT9A 4AXVA 2PJ9A 4L89A 3B3TA 4UBRA 4CGNA 2RFHA 1KUYA 2OZGA 3ISZA 3LWUA 4IF5A 2POKA 4YWYA 4B5PA 3B7IA 3WC6A 3I3GA 4PSWA 2NYQA 4XNHC 3V7ZA 3UY5A 4NFRA 2Z11A 4MFJA 1LCPA 5EBVA 4RS2A 4CGOA 3DR6A 4CAVA 2Z3OA 5HMNA 2EO8A 1VHEA 1Z8XA 2GLJA 1K4JA 3FXTA 2YNDA 3D66A 3KQXA 2V8HA 1XOVA 2PJAA 1UFHA 1ELMP 4F9UA 2G3AA 3EFAA 4R3KA 1CPSA 1XMBA 2VZZA 3W6XA 1X10A 4NF1A 2XEIA 2J8NA 1NMTA 3SXOA 1TIQA 4NGPA 4UIBA 4CGPA 4F9VA 2B3VA 2C6GA 2AFWA 2ZW7A 4KVXA 2JDDA 4MFLA 4M6IA 3NH4A 1B87A 2PVVA 4MBUA 3PRTA 4ZY2A 3CZXA 4ZGYB 5A28A 3MRUA 2HQYA 3MGDA 3IC1A 2QJ8A 4B5OA 4P4FA 2Z3MA 5LYLA 2PJ1A 4ZI6A 4FAIA 4IAVA 2R7HA 1WK4A 2ZEMA 2ZENA 1R57A 3GYAA 2ZOGA 1LRZA 1CX8A 1MJ9A 2ZW5A 3SJEA 3VARA 1F57A 5JH9A 1M4DA 4XNHB 1PU9A 2IL4A 4HKFA 4A32A 4OLLA 3VWEA 3RZAA 1GHEA 1IGBA 1MK4A 3S9MA 2DXQA 1IY7A 2OB0A 4HNWB 4MJ8A 3K9UA 3IO1A 3PBEA 2BCOA 2QYVA 3GUXA 4ZX8A 1QSOA 2B3UA 1Z5RA 2BO9A 4MFQA 4MHPA 4LUAA 5FVJA 4CRZB 3D68A 5F09A 2KCWA 3D8PA 3KZWA 3RAMA 3K2KA 1RXTA 2G0BA 1LFWA 4KSAA 4MFZA 1TKFA 4NSQA 5EC4A 3T9YA 1WWZA 1Z8LA 5IV0A 4Q38A 5A27A 1Y0YA 4ZY1A 2G9DA 3NA6A 3TE4A 4MY0A 2A4NA 3JUWA 4KOSA 2GREA 1TKJA 2PJ5A 2VEZA 5GCNA 3C26A 2F7VA 2PRBA 5E96A 4NXYA 1CM0A 4A95A 2ZEFA 4NGRA 4P44A 3FH4A 7CPAA 1Q2YA 3GKRA 4NGTA 1Q2DA 3RO0A 4KORA 4F0YA 1I1DA 2V8GA 3KGQA 2AFUA 4XPKA 3EXNA 4JD6A 4R76A 4UEFA 2Q7SA 4M3SA 1HEEA 2NSMA 2PE3A 2VXKA 3R1KA 3WC5A 4F0XA 3E0KA 4AVAA 4HNYB 3FRMA 3PB4X 4R8FA 1IICA 3FJUA 4H6UA 2J8MA 3D2MA 4MHNA 4OMEA 1YMEA 3TO9A 5K8MA 4MHDA 1QSNA 2CY2A 2X7BA 4EMEA 1ZG8A 3SJGA 3IWGA 4U9YA 3LODA 4CS0B 2PIYA 1ELLP 2WUUA 4XPLA 3JTKA 4L8AA 2I00A 4MMOA 2BL1A 3PFEA 1HDQA 5HXDA 5JGFA 2C6PA 4RUHA 3HUVA 2WPXA 1TXRA 3JVNA 4PK3A 2ZPAA 3VH9A 3F8KA 1KUXA 2DPSA 3K9TA 4M6HA 3GB0A 1JQGA 2BOAA 1LAMA 1CPXA 2EUIA 4GXHA 4JLYA 4A30A 4R87A 3FBUA 3KI9A 4C7HA 3IU1A 1X12A 2AE6A 3BHXA 4XPDB 2PJBA 1YLEA 4A31A 4X2TA 4P10A 3W6SA 3T90A 2AFXA 2EK9A 8CPAA 2PVWA 4U9ZA 4UIAA 3D7FA 1IOIA 2J9AA 2Z3KA 3LMSA 4R9MA 2ZEHA 2O53A 2OR4A 3BJ8A 5HVGA 2P6EA 3T8WA 1GYTA 2HC9A 3ZJ0A 1YVOA 6CPAA 5CBMA 4X8IA 3WABA 2OZHA 5THWA 1Y9WA 3PFOA 2Z0ZA 4FD5A 4QBJA 1FY7A 4UFVA 2PR8A 3D4UA 3CPXA 1RO5A 4BMHA 2I79A 1YREA 4OIWA 4PXDA 3GIUA 5I4MA 5CPAA 4CAFA 3SXNA 4NJRA 4CYQA 3CXSA 1FNOA 4B6ZA 4AG7A 2Q51A 4CYOA 1Z9UA 4EWTA 2RC4A 4CGMA 2ARHA 5AG6A 4KZTA 3V38A 2AFZA 3NE8A 4HPSA 2IJZA 1YGHA 3CPAA 1M44A 1XIXA 2OH1A 1CJWA 4AVCA 1PCAA 3IIBA 4OC1A 2V77A 5ELYA 3TOBA 2K5TA 4NGNA 2B5GA 3WR7A 1YR0A 2WSAA 4IUSA 4P4EA 4CYPA 5KTCA 2Q43A 3SI0A 1Y9KA 4JZ0A 4KS9A 4A94A 5C88A 2R8VA 3IFEA 3KR5A 5KTDA 3G3SA 3R96A 4AVBA 4MCRA 2B4DA 1ZLHA 1RTQA 3B3WA 3BI0A 1F2OA 4P45A 2G3TA 4NGQA 4R6TA 2Y0MA 2HB6A 4ORFA 4NCZA 3DLJA 4MRIA 4OKOA 2ABZA 3FIXA 3BXMA 3HLPA 3I9SA 4UA3A 2B4BA 2PJ6A 1S7LA 5KTAA 1M4IA 4C68A 3WC7A 4C2XA 4DUKA 2P0WA 1I21A 3BLNA 4WJBA 1S7KA 2PJ7A 3P2FA 4UWJA 1YVKA 4Q36A 1MJBA 2Q4ZA 3TCVA 3FB3A 4FD7A 1FT7A 4YFJA 3KQZA 1CP7A 3BJ7A 5DWNA 2PC1A 2JEVA 1ZO0A 5LRJA 1OZPA 1XJOA 3S6HA 2NMTA 2ZXVA 4Q7AA 4A39A 1XRYA 2PIZA 1NSLA 2JBKA 4A2ZA 3D7DA 1ZLIA 2EK8A 3QAHA 1CG2A 4PXBA 2JLMA 4WWVA 5K8PA 4PK2A 2PJ2A 4R3LA 3SJFA 1QMUA 3NE7A 2ZOFA 4OAEA 3FNCA 2P6GA 3GLJA 4II9A 2R1IA 4Z65A 1JWQA 2H5MA 2VL1A 2FSRA 4CPAA 4JXQA 1L0CA 2BEIA 1QSRA 2CNTA 4XPDC 1ZG9A 2CTCA 4UEEA 3B3VA 4MCQA 5IB9A 2FT0A 1LAPA 5JQ4A 5ISVA 1DE4C 5HVFA 3F0AA 4CAXA 3SHPA 2J8RA 2YGWA 3H8FA 2CTBA 5DWMA 2Q7BA 4FBEA 4UF4A 2D4OA 1PUAA 1BLLE 4A37A 3L2NA 4MXUA 3P2HA 4KVOE 4FD6A 4R57A 2V8VA 3S9NA 3S6GA 4KUBA 4A33A 3JRUA 4FD4A 2FS5A 2PJ0A 3D7HA 3F5BA 2PRQA 3FMCA 4B12A 2BUEA 3PB6X 5J8CA 3R9EA 1S7NA 1Z8WA 4UCPA 3FF3A 4BD9A 4DJLA 3BI1A 2CF4A 3DGVA 5J8FA 2IQ6A 3TOAA 3RNZA 2PSWA 1TF8A 2F8HA 4TWEA 4EVYA 5DS0A 4LX9A 1IB1E 3RYOA 5IB0A 3TO6A 3R9GA 2JEWA 3H8GA 2FE7A 3B3CA 1VGYA 2PJCA 1Y7RA 4HNXB 1R3NA 5EMIA 2QECA 5HH1A 1BPMA 4TNUA 3IJ3A 4M6GA 1QSMA 2GFQA 2Q44A 2REFA 3B8GA 4X3RA 2VQYA 4UWIA 5CNPA 3S6FA 3V8IA 3QB8A 4QC6A 3TC8A 4CYNA 4KVME 5LYFA 1AMPA 4IHMA 4PQAA 1OBRA 1A2ZA 2XEFA 3NH5A 3SJXA 4UEZA 4MCPA 2OZUA 2R98A 4KOTA 2Q4YA 4ZX9A 2ATRA 4FUUA 4PPZA 1PYTB 3KASA 3D7GA 4C2ZA 4K30A 4EFDA 2ZEEA 2OU2A 4LQ6A 4ONWA 2Z10A 1VIXA 2FIWA 2WYRA 4JWPA 1ARLA 1N71A 5AGEA 5F49A 1Z8TA 4W9YA 4B5PB 3CDXA 3QNVA 4DYOA 4OC4A 1Y0RA 1KUVA 4P4IA 3PB9X 4QUSA 2V8DA 3NFZA 4P4DA 4GM5A 1Q7LA 3KHXA 4KSFA 3SI2A 1QSTA 1EE3P 2PR1A 5LRKA 4O23A 4QVTA 1Q2CA 2P6FA 4YGOA 5G1ZA 2FIAA 1P0HA 5AG4A 4P4BA 4OP4A 1KZFA 2WPWA 4OADA 5F48A 1CP6A 1YLOA 4OC5A 4JYWA 2XEGA 4GS4A 2DPTA 2VZYA 4B10A 1IOFA 1VKCA 3S9LA 3IWEA 4R7MA 1F2PA 1I12A 1S60A 2YNCA 4AG9A 2HUZA 4H2KA 2ZEGA 4C7IA 2B5GB 3N5FA 4JXRA 2PJ4A 3TTHA 1YX0A 4NGSA 1LANA 2GIVA 2QMLA 1B6BA 1DTDA 2AFOA 3ISXA 4RN7A 2JBJA 1QQ9A 1YW4A 2PDOA 2B4DB 4MFKA 1J4JA 4U5YA 4AB7A 3TO7A 2C27A 2ZEPA 3DR8A 4OC2A 4PV6A 2VI7A 3FEEA 3MN8A 4MY3A 3KKWA 2B58A 3ZZIA 1YQEA 4KOYA 1UWYA 3OWCA 2C6CA 4CAWA 3NH8A 4KLWA 3KHZA 1XBUA 3PP9A 4FWUA 5LYIA 2O4HA 3B35A 2FL4A 3G8WA 3IEHA 2REEA 2BSWA 2Q0YA 2Q4VA 3IGRA 4MCSA 3GY9A 4ONUA 5H84A 2PJ3A 3VWDA 4BINA 2XEJA 4Y49B 2Z3LA 4E0AA 2GU2A 4CRYB 4DNCA 2PJ8A 3PGPA 2F5IA 4B14A 4F6AA 4RI1A 4ZY0A 4KSIA 2AFSA 1NSAA 1KWMA 1LOKA 2AFMA 4CGLA 2C1CA 4X5KA 4KLVA 3FEDA 3LACA 4YU9A 5J1QA 5JM6A 1U6MA 2EBJA 1IIDA 3D3SA 2ODFA 1SQHA 4NJQA 4E2AA 4PSXA 1Z4RA 2ZELA 3RBUA 3PB8X 5H86A 1IU8A 5G20A 2RB7A 3CXQA 4P6YA 4YRHA 3H5ZA 1HDUA 1XE4A 2DF5A 3B3SA 3TX8A 3IWWA 1VHOA 4OC3A 4PXCA 4ZYQA 4JJXA 1R43A 4OIDA 4MHZA 3VATA 3EY5A 1H8LA 1S3ZA 3PZJA 2VBQA 2ZW6A 3KR4A 3N7ZA 5D8NA 4KOUA 3D67A 2IMOA 4UCMA 1Z4EA 2GANA 5F46A 5AG7A 1M4LA 1Z2LA 2EWBA 5G21A 5HVHA 2EVNA 2HV2A 5F47A 2PCUA 1YSJA 1IYKA 2ANPA 2QIRA 2ZEDA 3I1UA 4QB9A 2FXFA 5I0CA 3SI1A 4LQGA 1XFOA 4NEXA 1NE9A 3LD2A 2ZEOA 1AUGA 2JDCA 1YK3A 5BWAB 5K8NA 4ZBGA 1XMTA 1BOBA 3S6KA 5G22A 3FVLA 2QVPA 4UCNA 3PB7X 4B11A 2O28A 3DNSA 4H6ZA 1MJAA 2Q04A 2CXAA 1TF9A 3KL9A 2Z3PA 4KOVA 3A9LA 4PXEA 3R95A 4BBHA 2DEAA 3QAYA 3CXPA 4NGMA 3WT4A 4CAEA 4KOWA 5AG5A 5C82A 3D2PA 3B2YA 4H89A 1VHSA 1S5KA 4J3GA 3W91A 1AYEA 4A38A 2FCKA 1V0CA 2GE3A 3EC4A 1M1DA 1ON0A 4F8ZA
chains in the Genus database with same CATH topology
4E8OA 1S7FA 4UFXA 4C2YA 2Z3NA 2CNMA 2YNCC 2CNSA 1IYLA 1M4GA 4I49A 4KOXA 4M85A 4KUAA 2D4PA 3IU2A 2YNEA 3TFYA 3R9FA 3H4QA 2PQ8A 4UFWA 1XEBA 3TT2A 4MI4A 5IX3A 1XF8A 5JPHA 4Y49C 3FYNA 3EO4A 3DSBA 1P4NA 2ZW4A 1BO4A 2AJ6A 4B13A 3DDDA 4MFPA 4L89A 4UBRA 4CGNA 1KUYA 2OZGA 4IF5A 4B5PA 3I3GA 4PSWA 4XNHC 3UY5A 2Z11A 4MFJA 5EBVA 4RS2A 4CGOA 3DR6A 4CAVA 2Z3OA 5HMNA 1K4JA 3FXTA 2YNDA 1UFHA 2G3AA 3EFAA 4R3KA 2VZZA 3W6XA 4NF1A 2J8NA 1NMTA 3SXOA 1TIQA 4CGPA 2B3VA 2ZW7A 4KVXA 2JDDA 4MFLA 1B87A 4MBUA 4ZGYB 5A28A 2HQYA 3MGDA 4B5OA 2Z3MA 2R7HA 1WK4A 1R57A 3GYAA 1MJ9A 1LRZA 2ZW5A 1M4DA 4XNHB 1PU9A 2IL4A 4HKFA 4A32A 4OLLA 3VWEA 1GHEA 1MK4A 2DXQA 2OB0A 4MJ8A 4HNWB 3K9UA 1QSOA 2B3UA 4MFQA 4LUAA 5FVJA 4CRZB 2KCWA 3D8PA 4KSAA 1RXTA 2G0BA 4NSQA 4MFZA 5EC4A 3T9YA 1WWZA 5IV0A 4Q38A 5A27A 3TE4A 4MY0A 2A4NA 3JUWA 2GE3A 4KOSA 5GCNA 2VEZA 3C26A 2PRBA 5E96A 4NXYA 1CM0A 4A95A 1Q2YA 3GKRA 1Q2DA 4KORA 4F0YA 1I1DA 4XPKA 3EXNA 4JD6A 4M3SA 3R1KA 2VXKA 4F0XA 3E0KA 4AVAA 4HNYB 3FRMA 1IICA 4H6UA 2J8MA 3D2MA 3TO9A 4MHDA 1QSNA 2CY2A 2X7BA 3IWGA 4U9YA 3LODA 4CS0B 2WUUA 4XPLA 3JTKA 4L8AA 2I00A 2BL1A 2WPXA 3JVNA 4PK3A 2ZPAA 3F8KA 1KUXA 2DPSA 4JLYA 2EUIA 4A30A 4R87A 3FBUA 4C7HA 3IU1A 2AE6A 4XPDB 1YLEA 4A31A 3W6SA 3T90A 4U9ZA 2Z3KA 4R9MA 3BJ8A 2P6EA 3ZJ0A 1YVOA 2OZHA 1Y9WA 2Z0ZA 4FD5A 4QBJA 1FY7A 4UFVA 2PR8A 4BMHA 1RO5A 2I79A 1YREA 4CAFA 3SXNA 4CYQA 3CXSA 4AG7A 4CYOA 1Z9UA 2RC4A 4CGMA 2ARHA 5AG6A 4KZTA 1YGHA 1M44A 1XIXA 2OH1A 1CJWA 4AVCA 3TOBA 2K5TA 2B5GA 3WR7A 1YR0A 2WSAA 4IUSA 4CYPA 5KTCA 1Y9KA 4KS9A 5C88A 2R8VA 5KTDA 3G3SA 3R96A 4AVBA 2B4DA 2G3TA 2Y0MA 4ORFA 4NCZA 3I9SA 3FIXA 4UA3A 5KTAA 2B4BA 1S7LA 1M4IA 4C68A 4C2XA 2P0WA 1I21A 3BLNA 1S7KA 3P2FA 4UWJA 1YVKA 4Q36A 1MJBA 3TCVA 3FB3A 4FD7A 4YFJA 5DWNA 3BJ7A 2PC1A 2JEVA 1ZO0A 1OZPA 3S6HA 2NMTA 2ZXVA 1NSLA 4A2ZA 3QAHA 2JLMA 4PK2A 4R3LA 3NE7A 4OAEA 3FNCA 2P6GA 4II9A 2R1IA 2H5MA 2FSRA 4JXQA 1L0CA 2BEIA 1QSRA 2CNTA 4XPDC 2FT0A 5JQ4A 5ISVA 3F0AA 4CAXA 3SHPA 2J8RA 5DWMA 2Q7BA 2D4OA 1PUAA 3P2HA 4KVOE 4FD6A 4R57A 3S6GA 4KUBA 4A33A 4FD4A 2FS5A 3F5BA 4B12A 2BUEA 5J8CA 3R9EA 1S7NA 4UCPA 5J8FA 3TOAA 2PSWA 4EVYA 4LX9A 1IB1E 3RYOA 5IB0A 3TO6A 3R9GA 2FE7A 1Y7RA 4HNXB 5HH1A 2QECA 1QSMA 2Q44A 2REFA 3B8GA 5CNPA 2VQYA 4UWIA 3S6FA 3V8IA 4CYNA 3QB8A 4QC6A 4KVME 2OZUA 2R98A 4KOTA 2Q4YA 2ATRA 4C2ZA 4K30A 2OU2A 2Z10A 4JWPA 2FIWA 5F49A 1N71A 5AGEA 4B5PB 1KUVA 4QUSA 4KSFA 1QSTA 2PR1A 4QVTA 1Q2CA 2P6FA 4YGOA 5G1ZA 2FIAA 1P0HA 5AG4A 1KZFA 2WPWA 4OADA 5F48A 4GS4A 2DPTA 2VZYA 4B10A 1VKCA 3IWEA 1I12A 1S60A 2YNCA 4AG9A 2HUZA 4C7IA 2B5GB 4JXRA 3TTHA 1YX0A 2GIVA 2QMLA 1B6BA 2PDOA 2B4DB 4MFKA 1J4JA 4U5YA 4AB7A 3TO7A 2C27A 3DR8A 4PV6A 2VI7A 4MY3A 3KKWA 2B58A 3ZZIA 4KOYA 3OWCA 4CAWA 4KLWA 3PP9A 2FL4A 3G8WA 3IGRA 2REEA 2BSWA 2Q0YA 2Q4VA 4ONUA 3GY9A 5H84A 3VWDA 4Y49B 2Z3LA 4E0AA 4CRYB 4DNCA 3PGPA 2F5IA 4B14A 4F6AA 4RI1A 4CGLA 4X5KA 4KLVA 1U6MA 1IIDA 3D3SA 4E2AA 1SQHA 4PSXA 1Z4RA 5H86A 5G20A 3CXQA 4YRHA 3H5ZA 1XE4A 4JJXA 3EY5A 1S3ZA 3PZJA 2VBQA 2ZW6A 3N7ZA 4KOUA 4UCMA 1Z4EA 2GANA 5F46A 5AG7A 5G21A 2EVNA 2HV2A 5F47A 1IYKA 2QIRA 4QB9A 5I0CA 2FXFA 4NEXA 1NE9A 3LD2A 2JDCA 1YK3A 5BWAB 4ZBGA 1XMTA 1BOBA 3S6KA 5G22A 4UCNA 4B11A 2O28A 3DNSA 4H6ZA 1MJAA 2Q04A 2CXAA 2Z3PA 4KOVA 3A9LA 3R95A 4BBHA 3CXPA 4CAEA 5C82A 4KOWA 5AG5A 3D2PA 4H89A 1VHSA 1S5KA 4J3GA 3W91A 2FCKA 1V0CA 2YGWA 3EC4A 1M1DA 1ON0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E8O A;  1S7F A;  2CNM A;  2CNS A;  1IYL A;  1M4G A;  4I49 A;  4KOX A;  4M85 A;  4KUA A;  2D4P A;  3TFY A;  3R9F A;  3H4Q A;  2PQ8 A;  1XEB A;  3TT2 A;  4MI4 A;  5IX3 A;  1XF8 A;  5JPH A;  4Y49 C;  3FYN A;  3EO4 A;  3DSB A;  1P4N A;  2ZW4 A;  1BO4 A;  2AJ6 A;  3DDD A;  4L89 A;  4UBR A;  1KUY A;  2OZG A;  4IF5 A;  4B5P A;  3I3G A;  4PSW A;  4XNH C;  3UY5 A;  2Z11 A;  5EBV A;  4RS2 A;  3DR6 A;  4CAV A;  5HMN A;  1K4J A;  3FXT A;  1UFH A;  2G3A A;  3EFA A;  4R3K A;  2VZZ A;  3W6X A;  4NF1 A;  2J8N A;  1NMT A;  3SXO A;  1TIQ A;  2B3V A;  2ZW7 A;  4KVX A;  2JDD A;  1B87 A;  4MBU A;  2HQY A;  3MGD A;  4B5O A;  2R7H A;  1WK4 A;  1R57 A;  3GYA A;  1MJ9 A;  1LRZ A;  2ZW5 A;  1M4D A;  4XNH B;  1PU9 A;  2IL4 A;  4HKF A;  4OLL A;  3VWE A;  1GHE A;  1MK4 A;  2DXQ A;  2OB0 A;  4MJ8 A;  4HNW B;  3K9U A;  1QSO A;  2B3U A;  4LUA A;  5FVJ A;  4CRZ B;  2KCW A;  3D8P A;  1RXT A;  2G0B A;  4NSQ A;  5EC4 A;  3T9Y A;  1WWZ A;  5IV0 A;  3TE4 A;  4MY0 A;  2A4N A;  3JUW A;  4KOS A;  5GCN A;  2VEZ A;  3C26 A;  2PRB A;  5E96 A;  4NXY A;  1CM0 A;  1Q2Y A;  3GKR A;  1Q2D A;  4KOR A;  4F0Y A;  1I1D A;  4XPK A;  3EXN A;  4JD6 A;  4M3S A;  3R1K A;  2VXK A;  3E0K A;  4AVA A;  4HNY B;  3FRM A;  1IIC A;  4H6U A;  2J8M A;  3D2M A;  3TO9 A;  4MHD A;  1QSN A;  2CY2 A;  2X7B A;  3IWG A;  4U9Y A;  3LOD A;  4CS0 B;  4XPL A;  4L8A A;  2I00 A;  2BL1 A;  2WPX A;  3JVN A;  4PK3 A;  2ZPA A;  3F8K A;  1KUX A;  4JLY A;  2EUI A;  4R87 A;  3FBU A;  2AE6 A;  4XPD B;  1YLE A;  3W6S A;  3T90 A;  4U9Z A;  4R9M A;  3BJ8 A;  2P6E A;  3ZJ0 A;  1YVO A;  2OZH A;  1Y9W A;  2Z0Z A;  4FD5 A;  4QBJ A;  1FY7 A;  2PR8 A;  4BMH A;  1RO5 A;  2I79 A;  1YRE A;  3SXN A;  3CXS A;  4AG7 A;  1Z9U A;  2RC4 A;  2ARH A;  4KZT A;  1YGH A;  1M44 A;  1XIX A;  2OH1 A;  1CJW A;  4AVC A;  3TOB A;  2K5T A;  2B5G A;  3WR7 A;  1YR0 A;  4IUS A;  5KTC A;  1Y9K A;  5C88 A;  2R8V A;  5KTD A;  3G3S A;  3R96 A;  4AVB A;  2B4D A;  2G3T A;  2Y0M A;  4ORF A;  4NCZ A;  3I9S A;  3FIX A;  4UA3 A;  5KTA A;  2B4B A;  1S7L A;  1M4I A;  2P0W A;  1I21 A;  3BLN A;  1S7K A;  3P2F A;  4UWJ A;  1YVK A;  1MJB A;  3TCV A;  3FB3 A;  4FD7 A;  4YFJ A;  5DWN A;  3BJ7 A;  2PC1 A;  2JEV A;  1OZP A;  3S6H A;  2NMT A;  2ZXV A;  1NSL A;  3EC4 A;  3QAH A;  2JLM A;  4PK2 A;  4R3L A;  3NE7 A;  4OAE A;  3FNC A;  2P6G A;  4II9 A;  2R1I A;  2H5M A;  2FSR A;  4JXQ A;  1L0C A;  2BEI A;  1QSR A;  2CNT A;  4XPD C;  2FT0 A;  5JQ4 A;  5ISV A;  3F0A A;  4CAX A;  3SHP A;  2J8R A;  5DWM A;  2Q7B A;  2D4O A;  1PUA A;  3P2H A;  4KVO E;  4FD6 A;  4R57 A;  3S6G A;  4KUB A;  4FD4 A;  2FS5 A;  3F5B A;  2BUE A;  5J8C A;  3R9E A;  1S7N A;  5J8F A;  3TOA A;  2PSW A;  4EVY A;  4LX9 A;  1IB1 E;  3RYO A;  5IB0 A;  3TO6 A;  3R9G A;  2FE7 A;  1Y7R A;  4HNX B;  5HH1 A;  2QEC A;  1QSM A;  2Q44 A;  2REF A;  3B8G A;  5CNP A;  2VQY A;  4UWI A;  3S6F A;  3V8I A;  3QB8 A;  4QC6 A;  4KVM E;  2OZU A;  2R98 A;  4KOT A;  2Q4Y A;  2ATR A;  4K30 A;  2OU2 A;  2Z10 A;  4JWP A;  2FIW A;  5F49 A;  1N71 A;  4B5P B;  1KUV A;  4QUS A;  1QST A;  2PR1 A;  4QVT A;  1Q2C A;  2P6F A;  4YGO A;  2FIA A;  1P0H A;  1KZF A;  2WPW A;  4OAD A;  5F48 A;  4GS4 A;  2VZY A;  1VKC A;  1I12 A;  1S60 A;  4AG9 A;  2HUZ A;  2B5G B;  4JXR A;  3TTH A;  1YX0 A;  2GIV A;  2QML A;  1B6B A;  2PDO A;  2B4D B;  1J4J A;  4U5Y A;  4AB7 A;  3TO7 A;  2C27 A;  3DR8 A;  4PV6 A;  2VI7 A;  4MY3 A;  3KKW A;  2B58 A;  3ZZI A;  4KOY A;  3OWC A;  4CAW A;  4KLW A;  3PP9 A;  2FL4 A;  3G8W A;  3IGR A;  2REE A;  2BSW A;  2Q0Y A;  2Q4V A;  4ONU A;  3GY9 A;  5H84 A;  3VWD A;  4Y49 B;  4E0A A;  4CRY B;  4DNC A;  3PGP A;  2F5I A;  4F6A A;  4RI1 A;  4X5K A;  4KLV A;  1U6M A;  1IID A;  3D3S A;  4E2A A;  1SQH A;  4PSX A;  1Z4R A;  5H86 A;  3CXQ A;  4YRH A;  1XE4 A;  4JJX A;  3EY5 A;  1S3Z A;  3PZJ A;  2VBQ A;  2ZW6 A;  3N7Z A;  1Z4E A;  2GAN A;  5F46 A;  2EVN A;  2HV2 A;  5F47 A;  1IYK A;  2QIR A;  4QB9 A;  5I0C A;  2FXF A;  4NEX A;  1NE9 A;  3LD2 A;  2JDC A;  1YK3 A;  4ZBG A;  1XMT A;  1BOB A;  3S6K A;  2O28 A;  3DNS A;  4H6Z A;  1MJA A;  2Q04 A;  4KOV A;  3R95 A;  3CXP A;  5C82 A;  4KOW A;  3D2P A;  4H89 A;  1VHS A;  1S5K A;  4J3G A;  3W91 A;  2FCK A;  1V0C A;  2GE3 A;  4KOU A;  1M1D A;  1ON0 A; 
#chains in the Genus database with same CATH topology
 4E8O A;  1S7F A;  4UFX A;  4C2Y A;  2Z3N A;  2CNM A;  3H8E A;  1ZG7 A;  2YNC C;  2CNS A;  1IYL A;  1M4G A;  4I49 A;  4KOX A;  4M85 A;  5K8O A;  3PEI A;  4KUA A;  3FX6 A;  1CBX A;  2D4P A;  2I3C A;  3IU2 A;  2YNE A;  3TFY A;  4G1P A;  5D29 A;  1ARM A;  2FVG A;  3R9F A;  1Y7E A;  1TKH A;  5LRG A;  3H4Q A;  2PQ8 A;  3PBB A;  4MHY A;  1XEB A;  4UFW A;  5LYD A;  3TT2 A;  4MI4 A;  4P4J A;  4IK2 A;  1YW6 A;  2CIJ A;  4OC0 A;  5IX3 A;  2WZN A;  1BAV A;  1BPN A;  3FEC A;  1XF8 A;  2OOT A;  2GLF A;  5JPH A;  4Y49 C;  3FYN A;  3EO4 A;  3DSB A;  1P4N A;  2ZW4 A;  1BO4 A;  2AJ6 A;  4B13 A;  4K3N A;  3DDD A;  4MFP A;  3CT9 A;  4AXV A;  2PJ9 A;  4L89 A;  3B3T A;  4UBR A;  4CGN A;  2RFH A;  1KUY A;  2OZG A;  3ISZ A;  3LWU A;  4IF5 A;  2POK A;  4YWY A;  4B5P A;  3B7I A;  3WC6 A;  3I3G A;  4PSW A;  2NYQ A;  4XNH C;  3V7Z A;  3UY5 A;  4NFR A;  2Z11 A;  4MFJ A;  1LCP A;  5EBV A;  4RS2 A;  4CGO A;  3DR6 A;  4CAV A;  2Z3O A;  5HMN A;  2EO8 A;  1VHE A;  1Z8X A;  2GLJ A;  1K4J A;  3FXT A;  2YND A;  3D66 A;  3KQX A;  2V8H A;  1XOV A;  2PJA A;  1UFH A;  1ELM P;  4F9U A;  2G3A A;  3EFA A;  4R3K A;  1CPS A;  1XMB A;  2VZZ A;  3W6X A;  1X10 A;  4NF1 A;  2XEI A;  2J8N A;  1NMT A;  3SXO A;  1TIQ A;  4NGP A;  4UIB A;  4CGP A;  4F9V A;  2B3V A;  2C6G A;  2AFW A;  2ZW7 A;  4KVX A;  2JDD A;  4MFL A;  4M6I A;  3NH4 A;  1B87 A;  2PVV A;  4MBU A;  3PRT A;  4ZY2 A;  3CZX A;  4ZGY B;  5A28 A;  3MRU A;  2HQY A;  3MGD A;  3IC1 A;  2QJ8 A;  4B5O A;  4P4F A;  2Z3M A;  5LYL A;  2PJ1 A;  4ZI6 A;  4FAI A;  4IAV A;  2R7H A;  1WK4 A;  2ZEM A;  2ZEN A;  1R57 A;  3GYA A;  2ZOG A;  1LRZ A;  1CX8 A;  1MJ9 A;  2ZW5 A;  3SJE A;  3VAR A;  1F57 A;  5JH9 A;  1M4D A;  4XNH B;  1PU9 A;  2IL4 A;  4HKF A;  4A32 A;  4OLL A;  3VWE A;  3RZA A;  1GHE A;  1IGB A;  1MK4 A;  3S9M A;  2DXQ A;  1IY7 A;  2OB0 A;  4HNW B;  4MJ8 A;  3K9U A;  3IO1 A;  3PBE A;  2BCO A;  2QYV A;  3GUX A;  4ZX8 A;  1QSO A;  2B3U A;  1Z5R A;  2BO9 A;  4MFQ A;  4MHP A;  4LUA A;  5FVJ A;  4CRZ B;  3D68 A;  5F09 A;  2KCW A;  3D8P A;  3KZW A;  3RAM A;  3K2K A;  1RXT A;  2G0B A;  1LFW A;  4KSA A;  4MFZ A;  1TKF A;  4NSQ A;  5EC4 A;  3T9Y A;  1WWZ A;  1Z8L A;  5IV0 A;  4Q38 A;  5A27 A;  1Y0Y A;  4ZY1 A;  2G9D A;  3NA6 A;  3TE4 A;  4MY0 A;  2A4N A;  3JUW A;  4KOS A;  2GRE A;  1TKJ A;  2PJ5 A;  2VEZ A;  5GCN A;  3C26 A;  2F7V A;  2PRB A;  5E96 A;  4NXY A;  1CM0 A;  4A95 A;  2ZEF A;  4NGR A;  4P44 A;  3FH4 A;  7CPA A;  1Q2Y A;  3GKR A;  4NGT A;  1Q2D A;  3RO0 A;  4KOR A;  4F0Y A;  1I1D A;  2V8G A;  3KGQ A;  2AFU A;  4XPK A;  3EXN A;  4JD6 A;  4R76 A;  4UEF A;  2Q7S A;  4M3S A;  1HEE A;  2NSM A;  2PE3 A;  2VXK A;  3R1K A;  3WC5 A;  4F0X A;  3E0K A;  4AVA A;  4HNY B;  3FRM A;  3PB4 X;  4R8F A;  1IIC A;  3FJU A;  4H6U A;  2J8M A;  3D2M A;  4MHN A;  4OME A;  1YME A;  3TO9 A;  5K8M A;  4MHD A;  1QSN A;  2CY2 A;  2X7B A;  4EME A;  1ZG8 A;  3SJG A;  3IWG A;  4U9Y A;  3LOD A;  4CS0 B;  2PIY A;  1ELL P;  2WUU A;  4XPL A;  3JTK A;  4L8A A;  2I00 A;  4MMO A;  2BL1 A;  3PFE A;  1HDQ A;  5HXD A;  5JGF A;  2C6P A;  4RUH A;  3HUV A;  2WPX A;  1TXR A;  3JVN A;  4PK3 A;  2ZPA A;  3VH9 A;  3F8K A;  1KUX A;  2DPS A;  3K9T A;  4M6H A;  3GB0 A;  1JQG A;  2BOA A;  1LAM A;  1CPX A;  2EUI A;  4GXH A;  4JLY A;  4A30 A;  4R87 A;  3FBU A;  3KI9 A;  4C7H A;  3IU1 A;  1X12 A;  2AE6 A;  3BHX A;  4XPD B;  2PJB A;  1YLE A;  4A31 A;  4X2T A;  4P10 A;  3W6S A;  3T90 A;  2AFX A;  2EK9 A;  8CPA A;  2PVW A;  4U9Z A;  4UIA A;  3D7F A;  1IOI A;  2J9A A;  2Z3K A;  3LMS A;  4R9M A;  2ZEH A;  2O53 A;  2OR4 A;  3BJ8 A;  5HVG A;  2P6E A;  3T8W A;  1GYT A;  2HC9 A;  3ZJ0 A;  1YVO A;  6CPA A;  5CBM A;  4X8I A;  3WAB A;  2OZH A;  5THW A;  1Y9W A;  3PFO A;  2Z0Z A;  4FD5 A;  4QBJ A;  1FY7 A;  4UFV A;  2PR8 A;  3D4U A;  3CPX A;  1RO5 A;  4BMH A;  2I79 A;  1YRE A;  4OIW A;  4PXD A;  3GIU A;  5I4M A;  5CPA A;  4CAF A;  3SXN A;  4NJR A;  4CYQ A;  3CXS A;  1FNO A;  4B6Z A;  4AG7 A;  2Q51 A;  4CYO A;  1Z9U A;  4EWT A;  2RC4 A;  4CGM A;  2ARH A;  5AG6 A;  4KZT A;  3V38 A;  2AFZ A;  3NE8 A;  4HPS A;  2IJZ A;  1YGH A;  3CPA A;  1M44 A;  1XIX A;  2OH1 A;  1CJW A;  4AVC A;  1PCA A;  3IIB A;  4OC1 A;  2V77 A;  5ELY A;  3TOB A;  2K5T A;  4NGN A;  2B5G A;  3WR7 A;  1YR0 A;  2WSA A;  4IUS A;  4P4E A;  4CYP A;  5KTC A;  2Q43 A;  3SI0 A;  1Y9K A;  4JZ0 A;  4KS9 A;  4A94 A;  5C88 A;  2R8V A;  3IFE A;  3KR5 A;  5KTD A;  3G3S A;  3R96 A;  4AVB A;  4MCR A;  2B4D A;  1ZLH A;  1RTQ A;  3B3W A;  3BI0 A;  1F2O A;  4P45 A;  2G3T A;  4NGQ A;  4R6T A;  2Y0M A;  2HB6 A;  4ORF A;  4NCZ A;  3DLJ A;  4MRI A;  4OKO A;  2ABZ A;  3FIX A;  3BXM A;  3HLP A;  3I9S A;  4UA3 A;  2B4B A;  2PJ6 A;  1S7L A;  5KTA A;  1M4I A;  4C68 A;  3WC7 A;  4C2X A;  4DUK A;  2P0W A;  1I21 A;  3BLN A;  4WJB A;  1S7K A;  2PJ7 A;  3P2F A;  4UWJ A;  1YVK A;  4Q36 A;  1MJB A;  2Q4Z A;  3TCV A;  3FB3 A;  4FD7 A;  1FT7 A;  4YFJ A;  3KQZ A;  1CP7 A;  3BJ7 A;  5DWN A;  2PC1 A;  2JEV A;  1ZO0 A;  5LRJ A;  1OZP A;  1XJO A;  3S6H A;  2NMT A;  2ZXV A;  4Q7A A;  4A39 A;  1XRY A;  2PIZ A;  1NSL A;  2JBK A;  4A2Z A;  3D7D A;  1ZLI A;  2EK8 A;  3QAH A;  1CG2 A;  4PXB A;  2JLM A;  4WWV A;  5K8P A;  4PK2 A;  2PJ2 A;  4R3L A;  3SJF A;  1QMU A;  3NE7 A;  2ZOF A;  4OAE A;  3FNC A;  2P6G A;  3GLJ A;  4II9 A;  2R1I A;  4Z65 A;  1JWQ A;  2H5M A;  2VL1 A;  2FSR A;  4CPA A;  4JXQ A;  1L0C A;  2BEI A;  1QSR A;  2CNT A;  4XPD C;  1ZG9 A;  2CTC A;  4UEE A;  3B3V A;  4MCQ A;  5IB9 A;  2FT0 A;  1LAP A;  5JQ4 A;  5ISV A;  1DE4 C;  5HVF A;  3F0A A;  4CAX A;  3SHP A;  2J8R A;  2YGW A;  3H8F A;  2CTB A;  5DWM A;  2Q7B A;  4FBE A;  4UF4 A;  2D4O A;  1PUA A;  1BLL E;  4A37 A;  3L2N A;  4MXU A;  3P2H A;  4KVO E;  4FD6 A;  4R57 A;  2V8V A;  3S9N A;  3S6G A;  4KUB A;  4A33 A;  3JRU A;  4FD4 A;  2FS5 A;  2PJ0 A;  3D7H A;  3F5B A;  2PRQ A;  3FMC A;  4B12 A;  2BUE A;  3PB6 X;  5J8C A;  3R9E A;  1S7N A;  1Z8W A;  4UCP A;  3FF3 A;  4BD9 A;  4DJL A;  3BI1 A;  2CF4 A;  3DGV A;  5J8F A;  2IQ6 A;  3TOA A;  3RNZ A;  2PSW A;  1TF8 A;  2F8H A;  4TWE A;  4EVY A;  5DS0 A;  4LX9 A;  1IB1 E;  3RYO A;  5IB0 A;  3TO6 A;  3R9G A;  2JEW A;  3H8G A;  2FE7 A;  3B3C A;  1VGY A;  2PJC A;  1Y7R A;  4HNX B;  1R3N A;  5EMI A;  2QEC A;  5HH1 A;  1BPM A;  4TNU A;  3IJ3 A;  4M6G A;  1QSM A;  2GFQ A;  2Q44 A;  2REF A;  3B8G A;  4X3R A;  2VQY A;  4UWI A;  5CNP A;  3S6F A;  3V8I A;  3QB8 A;  4QC6 A;  3TC8 A;  4CYN A;  4KVM E;  5LYF A;  1AMP A;  4IHM A;  4PQA A;  1OBR A;  1A2Z A;  2XEF A;  3NH5 A;  3SJX A;  4UEZ A;  4MCP A;  2OZU A;  2R98 A;  4KOT A;  2Q4Y A;  4ZX9 A;  2ATR A;  4FUU A;  4PPZ A;  1PYT B;  3KAS A;  3D7G A;  4C2Z A;  4K30 A;  4EFD A;  2ZEE A;  2OU2 A;  4LQ6 A;  4ONW A;  2Z10 A;  1VIX A;  2FIW A;  2WYR A;  4JWP A;  1ARL A;  1N71 A;  5AGE A;  5F49 A;  1Z8T A;  4W9Y A;  4B5P B;  3CDX A;  3QNV A;  4DYO A;  4OC4 A;  1Y0R A;  1KUV A;  4P4I A;  3PB9 X;  4QUS A;  2V8D A;  3NFZ A;  4P4D A;  4GM5 A;  1Q7L A;  3KHX A;  4KSF A;  3SI2 A;  1QST A;  1EE3 P;  2PR1 A;  5LRK A;  4O23 A;  4QVT A;  1Q2C A;  2P6F A;  4YGO A;  5G1Z A;  2FIA A;  1P0H A;  5AG4 A;  4P4B A;  4OP4 A;  1KZF A;  2WPW A;  4OAD A;  5F48 A;  1CP6 A;  1YLO A;  4OC5 A;  4JYW A;  2XEG A;  4GS4 A;  2DPT A;  2VZY A;  4B10 A;  1IOF A;  1VKC A;  3S9L A;  3IWE A;  4R7M A;  1F2P A;  1I12 A;  1S60 A;  2YNC A;  4AG9 A;  2HUZ A;  4H2K A;  2ZEG A;  4C7I A;  2B5G B;  3N5F A;  4JXR A;  2PJ4 A;  3TTH A;  1YX0 A;  4NGS A;  1LAN A;  2GIV A;  2QML A;  1B6B A;  1DTD A;  2AFO A;  3ISX A;  4RN7 A;  2JBJ A;  1QQ9 A;  1YW4 A;  2PDO A;  2B4D B;  4MFK A;  1J4J A;  4U5Y A;  4AB7 A;  3TO7 A;  2C27 A;  2ZEP A;  3DR8 A;  4OC2 A;  4PV6 A;  2VI7 A;  3FEE A;  3MN8 A;  4MY3 A;  3KKW A;  2B58 A;  3ZZI A;  1YQE A;  4KOY A;  1UWY A;  3OWC A;  2C6C A;  4CAW A;  3NH8 A;  4KLW A;  3KHZ A;  1XBU A;  3PP9 A;  4FWU A;  5LYI A;  2O4H A;  3B35 A;  2FL4 A;  3G8W A;  3IEH A;  2REE A;  2BSW A;  2Q0Y A;  2Q4V A;  3IGR A;  4MCS A;  3GY9 A;  4ONU A;  5H84 A;  2PJ3 A;  3VWD A;  4BIN A;  2XEJ A;  4Y49 B;  2Z3L A;  4E0A A;  2GU2 A;  4CRY B;  4DNC A;  2PJ8 A;  3PGP A;  2F5I A;  4B14 A;  4F6A A;  4RI1 A;  4ZY0 A;  4KSI A;  2AFS A;  1NSA A;  1KWM A;  1LOK A;  2AFM A;  4CGL A;  2C1C A;  4X5K A;  4KLV A;  3FED A;  3LAC A;  4YU9 A;  5J1Q A;  5JM6 A;  1U6M A;  2EBJ A;  1IID A;  3D3S A;  2ODF A;  1SQH A;  4NJQ A;  4E2A A;  4PSX A;  1Z4R A;  2ZEL A;  3RBU A;  3PB8 X;  5H86 A;  1IU8 A;  5G20 A;  2RB7 A;  3CXQ A;  4P6Y A;  4YRH A;  3H5Z A;  1HDU A;  1XE4 A;  2DF5 A;  3B3S A;  3TX8 A;  3IWW A;  1VHO A;  4OC3 A;  4PXC A;  4ZYQ A;  4JJX A;  1R43 A;  4OID A;  4MHZ A;  3VAT A;  3EY5 A;  1H8L A;  1S3Z A;  3PZJ A;  2VBQ A;  2ZW6 A;  3KR4 A;  3N7Z A;  5D8N A;  4KOU A;  3D67 A;  2IMO A;  4UCM A;  1Z4E A;  2GAN A;  5F46 A;  5AG7 A;  1M4L A;  1Z2L A;  2EWB A;  5G21 A;  5HVH A;  2EVN A;  2HV2 A;  5F47 A;  2PCU A;  1YSJ A;  1IYK A;  2ANP A;  2QIR A;  2ZED A;  3I1U A;  4QB9 A;  2FXF A;  5I0C A;  3SI1 A;  4LQG A;  1XFO A;  4NEX A;  1NE9 A;  3LD2 A;  2ZEO A;  1AUG A;  2JDC A;  1YK3 A;  5BWA B;  5K8N A;  4ZBG A;  1XMT A;  1BOB A;  3S6K A;  5G22 A;  3FVL A;  2QVP A;  4UCN A;  3PB7 X;  4B11 A;  2O28 A;  3DNS A;  4H6Z A;  1MJA A;  2Q04 A;  2CXA A;  1TF9 A;  3KL9 A;  2Z3P A;  4KOV A;  3A9L A;  4PXE A;  3R95 A;  4BBH A;  2DEA A;  3QAY A;  3CXP A;  4NGM A;  3WT4 A;  4CAE A;  4KOW A;  5AG5 A;  5C82 A;  3D2P A;  3B2Y A;  4H89 A;  1VHS A;  1S5K A;  4J3G A;  3W91 A;  1AYE A;  4A38 A;  2FCK A;  1V0C A;  2GE3 A;  3EC4 A;  1M1D A;  1ON0 A;  4F8Z A; 
#chains in the Genus database with same CATH homology
 4E8O A;  1S7F A;  4UFX A;  4C2Y A;  2Z3N A;  2CNM A;  2YNC C;  2CNS A;  1IYL A;  1M4G A;  4I49 A;  4KOX A;  4M85 A;  4KUA A;  2D4P A;  3IU2 A;  2YNE A;  3TFY A;  3R9F A;  3H4Q A;  2PQ8 A;  4UFW A;  1XEB A;  3TT2 A;  4MI4 A;  5IX3 A;  1XF8 A;  5JPH A;  4Y49 C;  3FYN A;  3EO4 A;  3DSB A;  1P4N A;  2ZW4 A;  1BO4 A;  2AJ6 A;  4B13 A;  3DDD A;  4MFP A;  4L89 A;  4UBR A;  4CGN A;  1KUY A;  2OZG A;  4IF5 A;  4B5P A;  3I3G A;  4PSW A;  4XNH C;  3UY5 A;  2Z11 A;  4MFJ A;  5EBV A;  4RS2 A;  4CGO A;  3DR6 A;  4CAV A;  2Z3O A;  5HMN A;  1K4J A;  3FXT A;  2YND A;  1UFH A;  2G3A A;  3EFA A;  4R3K A;  2VZZ A;  3W6X A;  4NF1 A;  2J8N A;  1NMT A;  3SXO A;  1TIQ A;  4CGP A;  2B3V A;  2ZW7 A;  4KVX A;  2JDD A;  4MFL A;  1B87 A;  4MBU A;  4ZGY B;  5A28 A;  2HQY A;  3MGD A;  4B5O A;  2Z3M A;  2R7H A;  1WK4 A;  1R57 A;  3GYA A;  1MJ9 A;  1LRZ A;  2ZW5 A;  1M4D A;  4XNH B;  1PU9 A;  2IL4 A;  4HKF A;  4A32 A;  4OLL A;  3VWE A;  1GHE A;  1MK4 A;  2DXQ A;  2OB0 A;  4MJ8 A;  4HNW B;  3K9U A;  1QSO A;  2B3U A;  4MFQ A;  4LUA A;  5FVJ A;  4CRZ B;  2KCW A;  3D8P A;  4KSA A;  1RXT A;  2G0B A;  4NSQ A;  4MFZ A;  5EC4 A;  3T9Y A;  1WWZ A;  5IV0 A;  4Q38 A;  5A27 A;  3TE4 A;  4MY0 A;  2A4N A;  3JUW A;  2GE3 A;  4KOS A;  5GCN A;  2VEZ A;  3C26 A;  2PRB A;  5E96 A;  4NXY A;  1CM0 A;  4A95 A;  1Q2Y A;  3GKR A;  1Q2D A;  4KOR A;  4F0Y A;  1I1D A;  4XPK A;  3EXN A;  4JD6 A;  4M3S A;  3R1K A;  2VXK A;  4F0X A;  3E0K A;  4AVA A;  4HNY B;  3FRM A;  1IIC A;  4H6U A;  2J8M A;  3D2M A;  3TO9 A;  4MHD A;  1QSN A;  2CY2 A;  2X7B A;  3IWG A;  4U9Y A;  3LOD A;  4CS0 B;  2WUU A;  4XPL A;  3JTK A;  4L8A A;  2I00 A;  2BL1 A;  2WPX A;  3JVN A;  4PK3 A;  2ZPA A;  3F8K A;  1KUX A;  2DPS A;  4JLY A;  2EUI A;  4A30 A;  4R87 A;  3FBU A;  4C7H A;  3IU1 A;  2AE6 A;  4XPD B;  1YLE A;  4A31 A;  3W6S A;  3T90 A;  4U9Z A;  2Z3K A;  4R9M A;  3BJ8 A;  2P6E A;  3ZJ0 A;  1YVO A;  2OZH A;  1Y9W A;  2Z0Z A;  4FD5 A;  4QBJ A;  1FY7 A;  4UFV A;  2PR8 A;  4BMH A;  1RO5 A;  2I79 A;  1YRE A;  4CAF A;  3SXN A;  4CYQ A;  3CXS A;  4AG7 A;  4CYO A;  1Z9U A;  2RC4 A;  4CGM A;  2ARH A;  5AG6 A;  4KZT A;  1YGH A;  1M44 A;  1XIX A;  2OH1 A;  1CJW A;  4AVC A;  3TOB A;  2K5T A;  2B5G A;  3WR7 A;  1YR0 A;  2WSA A;  4IUS A;  4CYP A;  5KTC A;  1Y9K A;  4KS9 A;  5C88 A;  2R8V A;  5KTD A;  3G3S A;  3R96 A;  4AVB A;  2B4D A;  2G3T A;  2Y0M A;  4ORF A;  4NCZ A;  3I9S A;  3FIX A;  4UA3 A;  5KTA A;  2B4B A;  1S7L A;  1M4I A;  4C68 A;  4C2X A;  2P0W A;  1I21 A;  3BLN A;  1S7K A;  3P2F A;  4UWJ A;  1YVK A;  4Q36 A;  1MJB A;  3TCV A;  3FB3 A;  4FD7 A;  4YFJ A;  5DWN A;  3BJ7 A;  2PC1 A;  2JEV A;  1ZO0 A;  1OZP A;  3S6H A;  2NMT A;  2ZXV A;  1NSL A;  4A2Z A;  3QAH A;  2JLM A;  4PK2 A;  4R3L A;  3NE7 A;  4OAE A;  3FNC A;  2P6G A;  4II9 A;  2R1I A;  2H5M A;  2FSR A;  4JXQ A;  1L0C A;  2BEI A;  1QSR A;  2CNT A;  4XPD C;  2FT0 A;  5JQ4 A;  5ISV A;  3F0A A;  4CAX A;  3SHP A;  2J8R A;  5DWM A;  2Q7B A;  2D4O A;  1PUA A;  3P2H A;  4KVO E;  4FD6 A;  4R57 A;  3S6G A;  4KUB A;  4A33 A;  4FD4 A;  2FS5 A;  3F5B A;  4B12 A;  2BUE A;  5J8C A;  3R9E A;  1S7N A;  4UCP A;  5J8F A;  3TOA A;  2PSW A;  4EVY A;  4LX9 A;  1IB1 E;  3RYO A;  5IB0 A;  3TO6 A;  3R9G A;  2FE7 A;  1Y7R A;  4HNX B;  5HH1 A;  2QEC A;  1QSM A;  2Q44 A;  2REF A;  3B8G A;  5CNP A;  2VQY A;  4UWI A;  3S6F A;  3V8I A;  4CYN A;  3QB8 A;  4QC6 A;  4KVM E;  2OZU A;  2R98 A;  4KOT A;  2Q4Y A;  2ATR A;  4C2Z A;  4K30 A;  2OU2 A;  2Z10 A;  4JWP A;  2FIW A;  5F49 A;  1N71 A;  5AGE A;  4B5P B;  1KUV A;  4QUS A;  4KSF A;  1QST A;  2PR1 A;  4QVT A;  1Q2C A;  2P6F A;  4YGO A;  5G1Z A;  2FIA A;  1P0H A;  5AG4 A;  1KZF A;  2WPW A;  4OAD A;  5F48 A;  4GS4 A;  2DPT A;  2VZY A;  4B10 A;  1VKC A;  3IWE A;  1I12 A;  1S60 A;  2YNC A;  4AG9 A;  2HUZ A;  4C7I A;  2B5G B;  4JXR A;  3TTH A;  1YX0 A;  2GIV A;  2QML A;  1B6B A;  2PDO A;  2B4D B;  4MFK A;  1J4J A;  4U5Y A;  4AB7 A;  3TO7 A;  2C27 A;  3DR8 A;  4PV6 A;  2VI7 A;  4MY3 A;  3KKW A;  2B58 A;  3ZZI A;  4KOY A;  3OWC A;  4CAW A;  4KLW A;  3PP9 A;  2FL4 A;  3G8W A;  3IGR A;  2REE A;  2BSW A;  2Q0Y A;  2Q4V A;  4ONU A;  3GY9 A;  5H84 A;  3VWD A;  4Y49 B;  2Z3L A;  4E0A A;  4CRY B;  4DNC A;  3PGP A;  2F5I A;  4B14 A;  4F6A A;  4RI1 A;  4CGL A;  4X5K A;  4KLV A;  1U6M A;  1IID A;  3D3S A;  4E2A A;  1SQH A;  4PSX A;  1Z4R A;  5H86 A;  5G20 A;  3CXQ A;  4YRH A;  3H5Z A;  1XE4 A;  4JJX A;  3EY5 A;  1S3Z A;  3PZJ A;  2VBQ A;  2ZW6 A;  3N7Z A;  4KOU A;  4UCM A;  1Z4E A;  2GAN A;  5F46 A;  5AG7 A;  5G21 A;  2EVN A;  2HV2 A;  5F47 A;  1IYK A;  2QIR A;  4QB9 A;  5I0C A;  2FXF A;  4NEX A;  1NE9 A;  3LD2 A;  2JDC A;  1YK3 A;  5BWA B;  4ZBG A;  1XMT A;  1BOB A;  3S6K A;  5G22 A;  4UCN A;  4B11 A;  2O28 A;  3DNS A;  4H6Z A;  1MJA A;  2Q04 A;  2CXA A;  2Z3P A;  4KOV A;  3A9L A;  3R95 A;  4BBH A;  3CXP A;  4CAE A;  5C82 A;  4KOW A;  5AG5 A;  3D2P A;  4H89 A;  1VHS A;  1S5K A;  4J3G A;  3W91 A;  2FCK A;  1V0C A;  2YGW A;  3EC4 A;  1M1D A;  1ON0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...