4Y49B

Crystal structure of yeast n-terminal acetyltransferase (ppgpp) nate in complex with a bisubstrate
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
203
structure length
164
Chain Sequence
PINIRRATINDIICMQNANLHNLPENYMMKYYMYHILSWPEASFVATTTTLDGEKLVGYVLVKMNDDPEPPNGHITSLSVMRTYRRMGIAENLMRQALFALREVHQAEYVSLHVRQSNRAALHLYRDTLAFEVLSIEKSYYQDGEDAYAMKKVLKLEELQISNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-terminal acetyltransferase A complex subunit NAT1
publication title Crystal structure of yeast N-terminal acetyltransferase (ppGpp) NatE in complex with a bisubstrate
rcsb
source organism Saccharomyces cerevisiae
total genus 9
structure length 164
sequence length 203
chains with identical sequence H, N
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2015-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4y49B00
4KOVA 1L0CA 1UFHA 2HQYA 4JLYA 4KOSA 4YGOA 5DWMA 4J3GA 4AVAA 1U6MA 1KZFA 4PK3A 1IYLA 1Y9WA 3SXNA 4I49A 5HH1A 4UA3A 4OLLA 4U9YA 3TFYA 2O28A 4XPLA 4NEXA 3TE4A 2D4PA 4LUAA 2DXQA 2REFA 1Z4RA 4FD6A 4KVOE 2FL4A 2FIAA 4FD4A 3W91A 4K30A 2CNTA 3TO9A 2PC1A 5HMNA 4KOUA 4E8OA 2KCWA 2ZW5A 4KZTA 1MJ9A 3CXQA 1YK3A 3I9SA 3D3SA 4MBUA 4FD5A 1BOBA 2PSWA 2Z11A 2B4DB 1I21A 2B5GB 2B3UA 2FIWA 3ZJ0A 3VWDA 2BEIA 4KOWA 1Y7RA 4PK2A 1CJWA 2FCKA 5JQ4A 4Y49B 1QSMA 1M44A 4KLWA 3BLNA 1GHEA 4KOYA 2ARHA 3TO7A 4BMHA 2JLMA 1YLEA 2PR8A 4HNXB 1ON0A 2B4BA 4HKFA 1Z9UA 1Y9KA 2QECA 2ZW4A 5IB0A 1XMTA 5F47A 2VI7A 4AVCA 4U9ZA 3EXNA 4DNCA 4M3SA 3TOAA 5H84A 4F6AA 4NSQA 2AJ6A 1M4IA 4PSXA 2FSRA 4EVYA 4B5PB 5DWNA 5E96A 1Z4EA 3R96A 1MK4A 3FXTA 1YR0A 1B6BA 1QSRA 1S7FA 1IYKA 3W6XA 2Q04A 2PRBA 4MJ8A 2EVNA 2Q7BA 2J8RA 3D8PA 2VQYA 2VZZA 1LRZA 3TT2A 1IB1E 3DDDA 1S7NA 4AVBA 1S7KA 2P6EA 4NCZA 5GCNA 2EUIA 5F49A 5JPHA 3IGRA 1B87A 4FD7A 3T9YA 2PR1A 4KORA 3EY5A 5I0CA 3GY9A 2P6FA 3T90A 5J8CA 4CRYB 4XNHC 2GE3A 4R3KA 3WR7A 4QUSA 2ZW7A 3JUWA 2Y0MA 3EFAA 4YRHA 4CAVA 2VZYA 3H4QA 1S7LA 3NE7A 2CNMA 1BO4A 1XIXA 2D4OA 3LD2A 3DNSA 4MY3A 1RO5A 1S60A 4M85A 2OB0A 2BL1A 3R9FA 4II9A 3C26A 4H89A 5KTCA 4B5PA 4QC6A 3P2HA 3R9GA 1M4DA 4OADA 3SXOA 1WWZA 2Z0ZA 2J8MA 3TCVA 2JEVA 2PDOA 4F0YA 2B3VA 1KUYA 4H6UA 4KOXA 4MI4A 3N7ZA 1MJBA 3K9UA 1CM0A 2Q4VA 1J4JA 2G3TA 2P0WA 2C27A 1IICA 4HNYB 4RS2A 1MJAA 4KVXA 5H86A 3JVNA 2G3AA 3DR6A 4X5KA 4ZBGA 4XPDB 4E0AA 4CRZB 4NXYA 3F8KA 4JD6A 4JXRA 5EC4A 4R9MA 2AE6A 3BJ7A 4XPDC 2FS5A 4LX9A 2H5MA 1R57A 4R87A 3P2FA 4GS4A 3D2MA 1S5KA 1Q2DA 4JJXA 3G8WA 2QMLA 4U5YA 1Q2CA 1M1DA 2Q4YA 3FRMA 4L8AA 1KUXA 3G3SA 2Q44A 3VWEA 4AG7A 1YX0A 1WK4A 4PV6A 5CNPA 5KTDA 2OZUA 3R9EA 1K4JA 3ZZIA 4JXQA 1QSNA 2GIVA 2ZW6A 1OZPA 3RYOA 4B5OA 4OAEA 3TTHA 2B4DA 1NMTA 2B5GA 2NMTA 4JWPA 4NF1A 4IUSA 3F0AA 3FYNA 3MGDA 3R95A 5J8FA 4XNHB 5C82A 2CNSA 4H6ZA 4KOTA 3SHPA 2OZGA 4AB7A 5KTAA 3W6SA 3IWGA 4QB9A 3UY5A 4RI1A 1FY7A 2G0BA 3TO6A 2R98A 1PU9A 2ZPAA 1NSLA 3FIXA 1Q2YA 4UWJA 2I79A 2HUZA 2QIRA 4AG9A 1XE4A 2Q0YA 2REEA 5EBVA 3S6FA 4ORFA 5F48A 3BJ8A 2GANA 5F46A 2VEZA 3FNCA 3QB8A 1P0HA 2OU2A 4HNWB 3EO4A 4UBRA 3S6GA 4QBJA 4XPKA 2OH1A 1KUVA 4IF5A 3FBUA 3E0KA 4L89A 5FVJA 3V8IA 4UWIA 1VKCA 1XEBA 4CS0B 1YVOA 1YGHA 1N71A 3DSBA 1V0CA 4CAXA 4QVTA 2WPXA 2VXKA 2X7BA 3FB3A 2P6GA 2ATRA 2I00A 1XF8A 1SQHA 2PQ8A 2OZHA 2A4NA 2J8NA 3PZJA 2WPWA 2FE7A 5IV0A 3S6HA 4R3LA 4PSWA 3LODA 4Y49C 3B8GA 1P4NA 3OWCA 2BUEA 2HV2A 5ISVA 1YVKA 1I1DA 1QSOA 2CY2A 3D2PA 4ONUA 1PUAA 2BSWA 3DR8A 4MHDA 2RC4A 3R1KA 3PP9A 3CXPA 4KUAA 3PGPA 3QAHA 4CAWA 4KVME 1TIQA 2R7HA 1QSTA 3KKWA 4MY0A 1RXTA 2VBQA 1I12A 5C88A 4E2AA 3GYAA 2B58A 4KLVA 1NE9A 1S3ZA 2FT0A 2F5IA 4KUBA 4R57A 3GKRA 3TOBA 3F5BA 1IIDA 3EC4A 3CXSA 2JDCA 2Z10A 3I3GA 2R8VA 2FXFA 4YFJA 5IX3A 3S6KA 1YREA 2JDDA 2R1IA 1M4GA 2IL4A 2K5TA 1VHSA 2ZXVA
chains in the Genus database with same CATH superfamily
4KOVA 1Y0RA 4ZI6A 1L0CA 1PYTB 1UFHA 2HQYA 4JLYA 4KOSA 4YGOA 2JBKA 2PJ7A 4PPZA 5DWMA 2QJ8A 3NA6A 4J3GA 4AVAA 4B6ZA 1U6MA 4JZ0A 2V8GA 3PRTA 1KZFA 4PK3A 6CPAA 4B11A 1IYLA 4W9YA 1Y9WA 3I1UA 3PB4X 4OC5A 3SXNA 4C2YA 4CGMA 4I49A 4X3RA 3WABA 3IU2A 5HH1A 2PJBA 4K3NA 2VL1A 4UA3A 2EO8A 1R3NA 2Z3PA 1ELMP 2ZEGA 4OLLA 4U9YA 4B13A 3TFYA 2O28A 3SJXA 4XPLA 4UIBA 4NEXA 4CYQA 3TE4A 2DPSA 4GM5A 4MHPA 4ZY1A 4NFRA 2D4PA 1Y7EA 3PB6X 4LUAA 2DXQA 4BBHA 4RUHA 2DPTA 2GLJA 2REFA 1XOVA 1Z4RA 4FD6A 4AXVA 4CGNA 4DYOA 4KVOE 1TKHA 2FIAA 2FL4A 3IWEA 4FD4A 2ZEFA 4K30A 4PQAA 2CNTA 4UIAA 3W91A 2XEGA 2C6GA 2YGWA 4O23A 3TO9A 2PC1A 3NH8A 5HMNA 1TKFA 4KOUA 4UF4A 3FX6A 4E8OA 2KCWA 2ZW5A 4KZTA 3KQXA 1MJ9A 3CXQA 4NJRA 4B12A 1YK3A 3I9SA 4NGMA 1CP6A 3IJ3A 4CYOA 3FF3A 1YSJA 3D3SA 4KSIA 5G22A 5HXDA 4MBUA 2POKA 4FD5A 4FBEA 4H2KA 4PXEA 3KHXA 1BOBA 2V8VA 2PSWA 2Z11A 2B4DB 1I21A 4GXHA 2B5GB 1YQEA 5D8NA 4MRIA 2B3UA 1ZG9A 2FIWA 2AFSA 2QVPA 3QAYA 3ZJ0A 3VWDA 2BEIA 2O4HA 1Y7RA 3K9TA 4KOWA 4PK2A 4PXBA 1CJWA 4CYNA 2FCKA 2ANPA 1CG2A 4Y49B 1QSMA 4ZY0A 4UCMA 5JQ4A 1M44A 4IHMA 4P44A 1ZG7A 4YWYA 1LOKA 3CT9A 1ZO0A 2IMOA 3PB9X 4KLWA 4YU9A 1PCAA 4TWEA 3BLNA 1GHEA 4KOYA 5D29A 2ARHA 3TO7A 4NGRA 4Q7AA 4BMHA 2JLMA 3PBBA 1YLEA 2PR8A 4HNXB 1ON0A 3KZWA 5G1ZA 4OC2A 2B4BA 5F09A 4HKFA 4NGSA 4A37A 5HVHA 5A27A 4UFWA 1Z9UA 2PJ0A 3KR4A 1Y9KA 2QECA 3L2NA 3CZXA 3S9MA 2ZW4A 3KI9A 1YW6A 2PJCA 4ZGYB 3RAMA 5HVGA 1XMTA 4A33A 5IB0A 2Q43A 4KS9A 4NGPA 2ZEDA 1LAMA 4ZX8A 3RO0A 3FEDA 5F47A 2Q4ZA 2VI7A 4AVCA 2PRQA 3GLJA 4U9ZA 3EXNA 4DNCA 4F9UA 2Z3NA 4UCNA 1Z8XA 4OIWA 4M3SA 3TOAA 5CBMA 5H84A 4F6AA 4MFQA 3S9LA 5AG4A 4NSQA 2AJ6A 1M4IA 4ZY2A 4PSXA 2FSRA 4EVYA 4B5PB 5DWNA 5E96A 1Z4EA 2ODFA 4MCRA 2Z3KA 3R96A 3D67A 5A28A 2ZEHA 1MK4A 4MFZA 2WZNA 2PCUA 1Z8WA 4X8IA 3FXTA 3D7HA 1LAPA 4RN7A 4DUKA 2PJ2A 1YR0A 1B6BA 1QSRA 4C68A 4C2ZA 1S7FA 1IYKA 3FH4A 3PFOA 3W6XA 2Q04A 5G21A 4OMEA 2PRBA 3DLJA 4CYPA 1CX8A 3NH5A 4MJ8A 5LRGA 8CPAA 3D7GA 4BD9A 2Z3LA 2EVNA 1IU8A 1NSAA 2XEIA 1DE4C 2Q7BA 3V7ZA 2J8RA 3D8PA 4MCPA 2VQYA 2RB7A 3IIBA 4A38A 2VZZA 4OKOA 3PBEA 1LRZA 3TT2A 1IB1E 1QMUA 2ZENA 3DDDA 4OC1A 1S7NA 4JYWA 4ZX9A 4R6TA 4AVBA 2IQ6A 4MFKA 1S7KA 1ARMA 2P6EA 3FMCA 5K8PA 4NCZA 2PJ9A 2V8HA 5GCNA 4MCSA 2EUIA 2PJ5A 2YNCC 4LQGA 1CP7A 5F49A 4OC4A 5JPHA 3IGRA 4Q36A 1B87A 4FD7A 3T9YA 5AG5A 2PR1A 2ZEOA 4KORA 3EY5A 5I0CA 3D7FA 1JQGA 4P4JA 3GY9A 4R7MA 2HC9A 2P6FA 1VHEA 3CDXA 3T90A 5J8CA 2Z3OA 4M6IA 2YNDA 4CRYB 2PJ3A 4XNHC 4KSFA 3PFEA 2GE3A 3SI2A 4P6YA 4X2TA 3B35A 4FAIA 2C6PA 4R3KA 1F57A 4QUSA 3WR7A 2ZW7A 4ONWA 2BO9A 2PJ6A 3BHXA 3H8FA 4P4FA 2V8DA 3B2YA 3IWWA 3JUWA 4PXCA 5HVFA 4A94A 2F8HA 4P4BA 3H8GA 2Y0MA 1UWYA 3GUXA 3EFAA 4M6HA 4YRHA 3V38A 1AYEA 4CAVA 3H4QA 5DS0A 1S7LA 3BI1A 3NE7A 4A30A 3D68A 3IU1A 2CNMA 1GYTA 1Z5RA 1BO4A 4P45A 4C7IA 1XIXA 2D4OA 1Z8LA 3LD2A 4MHYA 3DNSA 2EBJA 4Q38A 4M6GA 4MY3A 1ARLA 1RO5A 1S60A 4M85A 4BINA 4UEEA 2OB0A 2BL1A 3R9FA 4II9A 1VGYA 3C26A 4H89A 5KTCA 4B5PA 3JTKA 4QC6A 4DJLA 3P2HA 4TNUA 3R9GA 1M4DA 4LQ6A 4OADA 1A2ZA 5AG7A 3MRUA 3SXOA 4A31A 1WWZA 3VATA 2Z0ZA 3BXMA 2J8MA 3TCVA 2PE3A 2C1CA 2JEVA 1XJOA 4A32A 2PDOA 4MFPA 3RZAA 4F0YA 2B3VA 3LMSA 1KUYA 4H6UA 2PJ1A 4KOXA 1YMEA 1XBUA 1ZG8A 4MI4A 1TF8A 1MJBA 2CTCA 2YNEA 3K9UA 3N7ZA 1CM0A 4IK2A 2Q4VA 1J4JA 5ELYA 2G3TA 2ABZA 2NYQA 2ZEMA 1BPMA 2P0WA 2C27A 4UEZA 1X12A 4UFXA 1IICA 2AFOA 4HNYB 4OC0A 4RS2A 4UFVA 3ISXA 5LYLA 1MJAA 4KVXA 5H86A 4FUUA 1Y0YA 5THWA 3B7IA 3JVNA 1CBXA 2G3AA 3DR6A 4X5KA 3BI0A 4ZBGA 1HDUA 2ZXVA 2IJZA 5LYDA 4XPDB 4E0AA 2OOTA 1ZLIA 4CRZB 4NXYA 1IOIA 3F8KA 4JD6A 1YLOA 1XRYA 4JXRA 4CAEA 3RBUA 2Q51A 4B14A 5EC4A 4R9MA 2AE6A 3BJ7A 4UCPA 4EFDA 3FVLA 4WWVA 4XPDC 2FS5A 3DGVA 3IC1A 1M4LA 4LX9A 1Z8TA 2H5MA 3SJEA 3H8EA 1VIXA 2CIJA 3B3CA 1R57A 4EWTA 4MMOA 4R87A 4MXUA 3P2FA 4GS4A 3D2MA 2AFMA 3GB0A 2JEWA 1S5KA 1Q2DA 4JJXA 3G8WA 2QMLA 1YW4A 3LWUA 3WC7A 2WSAA 4P10A 4U5YA 1Q2CA 2AFXA 1IOFA 1M1DA 2DF5A 1F2OA 1H8LA 2Q4YA 2XEFA 3FRMA 3KL9A 4L8AA 1KUXA 3IFEA 2ZELA 3FJUA 3G3SA 3MN8A 4P4IA 2Q44A 3VWEA 3D7DA 4G1PA 4AG7A 5JGFA 1YX0A 1WK4A 4PV6A 1IY7A 2PJ8A 2RFHA 5CNPA 1VHOA 5KTDA 2FVGA 2OZUA 3R9EA 4ZYQA 1Q7LA 1K4JA 2F7VA 3ZZIA 5K8OA 4JXQA 5EMIA 1QSNA 7CPAA 2GIVA 2ZW6A 1OZPA 3RYOA 4CGPA 4B5OA 4A2ZA 1BLLE 4OAEA 3TTHA 2B4DA 1NMTA 2B5GA 2NMTA 3B3TA 4JWPA 4NF1A 3N5FA 4IUSA 4NGQA 4R76A 3KR5A 4EMEA 3F0AA 3B3WA 3FYNA 1X10A 3MGDA 3R95A 5IB9A 5J8FA 4XNHB 5C82A 1OBRA 2CNSA 2J9AA 4H6ZA 4KOTA 3ISZA 2GLFA 3IO1A 2EK8A 1LANA 2QYVA 2OZGA 3SHPA 3PB7X 4AB7A 5JH9A 5KTAA 1F2PA 2GREA 3IWGA 3W6SA 3HLPA 1LCPA 1QQ9A 3D4UA 4NGTA 4QB9A 3UY5A 4RI1A 1FY7A 2G0BA 3TO6A 2R98A 4CGOA 1PU9A 4A39A 2ZPAA 3SI1A 4CPAA 1NSLA 3FIXA 4CAFA 1Q2YA 4UWJA 2I79A 3SJGA 2HUZA 2QIRA 4FWUA 4AG9A 3FECA 1XE4A 3JRUA 1ZLHA 2Q0YA 2REEA 5EBVA 3S6FA 4ORFA 5F48A 3BJ8A 2CXAA 3QNVA 5G20A 1CPXA 2GANA 4MHNA 5F46A 2VEZA 3FNCA 3QB8A 5K8MA 1P0HA 2OU2A 4HNWB 4NJQA 3S9NA 3EO4A 2PVVA 2JBJA 4UBRA 4B10A 3B3VA 3S6GA 1XFOA 2CTBA 2AFZA 4QBJA 5AGEA 2PIYA 4XPKA 2OH1A 5JM6A 5CPAA 1KUVA 3GIUA 1TF9A 4IF5A 2C6CA 3FBUA 3WT4A 4F9VA 2EWBA 3E0KA 1HDQA 2G9DA 3FEEA 4L89A 3WC5A 2GU2A 5FVJA 1TKJA 3V8IA 4UEFA 4UWIA 1BPNA 1VKCA 1XEBA 4CS0B 1YVOA 2BCOA 1YGHA 1N71A 3DSBA 5BWAB 5LYIA 1V0CA 4CAXA 4QVTA 3H5ZA 2WPXA 4PXDA 2VXKA 2GFQA 2X7BA 3TC8A 3KASA 4C2XA 4F0XA 3A9LA 4IAVA 1XMBA 2ZOGA 4MFJA 3FB3A 2P6GA 1BAVA 2ATRA 2I00A 3T8WA 1XF8A 1SQHA 2PQ8A 1AUGA 2WYRA 4Z65A 1RTQA 2OZHA 2V77A 2I3CA 4HPSA 4NGNA 2A4NA 1LFWA 2J8NA 2ZOFA 3PZJA 2WPWA 3PEIA 2FE7A 1ELLP 1HEEA 5IV0A 3S6HA 4R3LA 3KHZA 4C7HA 4P4DA 4PSWA 3LODA 4Y49C 3B3SA 1FNOA 1P4NA 2OR4A 3B8GA 3OWCA 2YNCA 2BUEA 3KQZA 2HV2A 4KSAA 4F8ZA 2O53A 4MFLA 5ISVA 1CPSA 1YVKA 3KGQA 1I1DA 1QSOA 2CY2A 3D2PA 4OP4A 3SI0A 3PB8X 2PJAA 4OIDA 1KWMA 4ONUA 1PUAA 2BSWA 3DR8A 4MHDA 3HUVA 1TXRA 4MCQA 2RC4A 3R1KA 3PP9A 3RNZA 4A95A 3CXPA 4CGLA 2BOAA 3CPAA 3CPXA 2DEAA 4KUAA 3PGPA 3QAHA 4CAWA 2PVWA 4OC3A 3WC6A 4KVME 1TIQA 3NH4A 3D66A 2R7HA 1QSTA 5J1QA 3KKWA 4MHZA 4MY0A 1RXTA 2ZEEA 2VBQA 1I12A 2NSMA 5C88A 5I4MA 2AFWA 4E2AA 2CF4A 3GYAA 2B58A 3NFZA 1NE9A 1S3ZA 2FT0A 4KLVA 2F5IA 4KUBA 2XEJA 3LACA 1AMPA 2Q7SA 4R57A 2WUUA 1Z2LA 2HB6A 5AG6A 1R43A 3GKRA 3VH9A 5K8NA 3TOBA 3F5BA 3VARA 1IIDA 5LRJA 3EC4A 3CXSA 2JDCA 2Z10A 1IGBA 3SJFA 3I3GA 2R8VA 4R8FA 3K2KA 2FXFA 4YFJA 2EK9A 2PJ4A 5IX3A 5LYFA 1EE3P 2ZEPA 1FT7A 3S6KA 3TX8A 1YREA 2JDDA 1DTDA 2R1IA 3IEHA 4P4EA 5LRKA 1M4GA 2IL4A 1JWQA 2K5TA 1VHSA 4WJBA 2Z3MA 2PIZA 2VZYA 2AFUA 3NE8A
chains in the Genus database with same CATH topology
4KOVA 1L0CA 1UFHA 2HQYA 4JLYA 4KOSA 4YGOA 5DWMA 4J3GA 4AVAA 1U6MA 1KZFA 4PK3A 4B11A 1IYLA 1Y9WA 3SXNA 4C2YA 4CGMA 4I49A 3IU2A 5HH1A 4UA3A 2Z3PA 4OLLA 4U9YA 4B13A 3TFYA 2O28A 4XPLA 4CYQA 4NEXA 3TE4A 2DPSA 2D4PA 4BBHA 4LUAA 2DXQA 2DPTA 2REFA 1Z4RA 4FD6A 4CGNA 4KVOE 2FL4A 2FIAA 3IWEA 4FD4A 4K30A 3W91A 2CNTA 2YGWA 3TO9A 2PC1A 5HMNA 4KOUA 4E8OA 2KCWA 2ZW5A 4KZTA 1MJ9A 3CXQA 4B12A 1YK3A 3I9SA 4CYOA 3D3SA 5G22A 4MBUA 4FD5A 1BOBA 2PSWA 2Z11A 2B4DB 1I21A 2B5GB 2B3UA 2FIWA 3ZJ0A 3VWDA 2BEIA 4KOWA 1Y7RA 4PK2A 1CJWA 4CYNA 2FCKA 5JQ4A 4Y49B 1QSMA 4UCMA 1M44A 1ZO0A 4KLWA 3BLNA 1GHEA 4KOYA 2ARHA 3TO7A 4BMHA 2JLMA 1YLEA 2PR8A 4HNXB 1ON0A 5G1ZA 2B4BA 4HKFA 5A27A 4UFWA 1Z9UA 1Y9KA 2QECA 2ZW4A 4ZGYB 5IB0A 1XMTA 4A33A 4KS9A 5F47A 2VI7A 4AVCA 4U9ZA 3EXNA 4DNCA 2Z3NA 4UCNA 4M3SA 3TOAA 5H84A 4F6AA 4MFQA 4NSQA 2AJ6A 1M4IA 4PSXA 2FSRA 4EVYA 4B5PB 5DWNA 5E96A 1Z4EA 2Z3KA 3R96A 5A28A 1MK4A 4MFZA 3FXTA 1YR0A 1B6BA 1QSRA 4C68A 4C2ZA 1S7FA 1IYKA 3W6XA 2Q04A 5G21A 2PRBA 4CYPA 4MJ8A 2Z3LA 2EVNA 2Q7BA 2J8RA 3D8PA 2VQYA 2VZZA 1LRZA 3TT2A 1IB1E 3DDDA 1S7NA 4AVBA 4MFKA 1S7KA 2P6EA 4NCZA 5GCNA 2EUIA 2YNCC 5F49A 5JPHA 3IGRA 4Q36A 1B87A 4FD7A 3T9YA 5AG5A 2PR1A 4KORA 3EY5A 5I0CA 3GY9A 2P6FA 3T90A 5J8CA 2Z3OA 2YNDA 4CRYB 4XNHC 4KSFA 2GE3A 4R3KA 3WR7A 4QUSA 2ZW7A 3JUWA 2Y0MA 3EFAA 4YRHA 4CAVA 2VZYA 3H4QA 1S7LA 4A30A 3NE7A 3IU1A 2CNMA 1BO4A 4C7IA 1XIXA 2D4OA 3LD2A 3DNSA 4Q38A 4MY3A 1RO5A 1S60A 4M85A 2OB0A 2BL1A 3R9FA 4II9A 3C26A 4H89A 5KTCA 4B5PA 3JTKA 4QC6A 3P2HA 3R9GA 1M4DA 4OADA 5AG7A 3SXOA 4A31A 1WWZA 2Z0ZA 2J8MA 3TCVA 5AG4A 2JEVA 4A32A 2PDOA 4MFPA 4F0YA 2B3VA 1KUYA 4H6UA 4KOXA 4MI4A 2YNEA 1MJBA 3K9UA 3N7ZA 1CM0A 2Q4VA 1J4JA 2G3TA 2P0WA 2C27A 4UFXA 1IICA 4HNYB 4RS2A 4UFVA 1MJAA 4KVXA 5H86A 3JVNA 2G3AA 3DR6A 4X5KA 4ZBGA 4XPDB 4E0AA 4CRZB 4NXYA 3F8KA 4JD6A 4JXRA 4CAEA 4B14A 5EC4A 4R9MA 2AE6A 3BJ7A 4UCPA 4XPDC 2FS5A 4LX9A 2H5MA 1R57A 4R87A 3P2FA 4GS4A 3D2MA 1S5KA 1Q2DA 4JJXA 3G8WA 2QMLA 2WSAA 4U5YA 1Q2CA 1M1DA 2Q4YA 3FRMA 4L8AA 1KUXA 3G3SA 2Q44A 3VWEA 4AG7A 1YX0A 1WK4A 4PV6A 5CNPA 5KTDA 2OZUA 3R9EA 1K4JA 3ZZIA 4JXQA 1QSNA 2GIVA 2ZW6A 1OZPA 3RYOA 4CGPA 4B5OA 4A2ZA 4OAEA 3TTHA 2B4DA 1NMTA 2B5GA 2NMTA 4JWPA 4NF1A 4IUSA 3F0AA 3FYNA 3MGDA 3R95A 5J8FA 4XNHB 5C82A 2CNSA 4H6ZA 4KOTA 3SHPA 2OZGA 4AB7A 5KTAA 3W6SA 3IWGA 4QB9A 3UY5A 4RI1A 1FY7A 2G0BA 3TO6A 2R98A 4CGOA 1PU9A 2ZPAA 1NSLA 3FIXA 4CAFA 1Q2YA 4UWJA 2I79A 2HUZA 2QIRA 4AG9A 1XE4A 2Q0YA 2REEA 5EBVA 3S6FA 4ORFA 5F48A 3BJ8A 2CXAA 5G20A 2GANA 5F46A 2VEZA 3FNCA 3QB8A 1P0HA 2OU2A 4HNWB 3EO4A 4UBRA 4B10A 3S6GA 4QBJA 5AGEA 4XPKA 2OH1A 1KUVA 4IF5A 3FBUA 3E0KA 4L89A 5FVJA 3V8IA 4UWIA 1VKCA 1XEBA 4CS0B 1YVOA 1YGHA 1N71A 3DSBA 5BWAB 1V0CA 4CAXA 4QVTA 3H5ZA 2WPXA 2VXKA 2X7BA 4C2XA 4F0XA 3A9LA 4MFJA 3FB3A 2P6GA 2ATRA 2I00A 1XF8A 1SQHA 2PQ8A 2OZHA 2A4NA 2J8NA 3PZJA 2WPWA 2FE7A 5IV0A 3S6HA 4R3LA 4C7HA 4PSWA 3LODA 4Y49C 3B8GA 1P4NA 3OWCA 2YNCA 2BUEA 2HV2A 4KSAA 4MFLA 5ISVA 1YVKA 1I1DA 1QSOA 2CY2A 3D2PA 4ONUA 1PUAA 2BSWA 3DR8A 4MHDA 2RC4A 3R1KA 3PP9A 4A95A 3CXPA 4CGLA 4KUAA 3PGPA 3QAHA 4CAWA 4KVME 1TIQA 2R7HA 1QSTA 3KKWA 4MY0A 1RXTA 2VBQA 1I12A 5C88A 4E2AA 3GYAA 2B58A 4KLVA 1NE9A 1S3ZA 2FT0A 2F5IA 4KUBA 4R57A 2WUUA 5AG6A 3GKRA 3TOBA 3F5BA 1IIDA 3EC4A 3CXSA 2JDCA 2Z10A 3I3GA 2R8VA 2FXFA 4YFJA 5IX3A 3S6KA 1YREA 2JDDA 2R1IA 1M4GA 2IL4A 2K5TA 1VHSA 2Z3MA 2ZXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOV A;  1L0C A;  1UFH A;  2HQY A;  4JLY A;  4KOS A;  4YGO A;  5DWM A;  4J3G A;  4AVA A;  1U6M A;  1KZF A;  4PK3 A;  1IYL A;  1Y9W A;  3SXN A;  4I49 A;  5HH1 A;  4UA3 A;  4OLL A;  4U9Y A;  3TFY A;  2O28 A;  4XPL A;  4NEX A;  3TE4 A;  2D4P A;  4LUA A;  2DXQ A;  2REF A;  1Z4R A;  4FD6 A;  4KVO E;  2FL4 A;  2FIA A;  4FD4 A;  3W91 A;  4K30 A;  2CNT A;  3TO9 A;  2PC1 A;  5HMN A;  4KOU A;  4E8O A;  2KCW A;  2ZW5 A;  4KZT A;  1MJ9 A;  3CXQ A;  1YK3 A;  3I9S A;  3D3S A;  4MBU A;  4FD5 A;  1BOB A;  2PSW A;  2Z11 A;  2B4D B;  1I21 A;  2B5G B;  2B3U A;  2FIW A;  3ZJ0 A;  3VWD A;  2BEI A;  4KOW A;  1Y7R A;  4PK2 A;  1CJW A;  2FCK A;  5JQ4 A;  4Y49 B;  1QSM A;  1M44 A;  4KLW A;  3BLN A;  1GHE A;  4KOY A;  2ARH A;  3TO7 A;  4BMH A;  2JLM A;  1YLE A;  2PR8 A;  4HNX B;  1ON0 A;  2B4B A;  4HKF A;  1Z9U A;  1Y9K A;  2QEC A;  2ZW4 A;  5IB0 A;  1XMT A;  5F47 A;  2VI7 A;  4AVC A;  4U9Z A;  3EXN A;  4DNC A;  4M3S A;  3TOA A;  5H84 A;  4F6A A;  4NSQ A;  2AJ6 A;  1M4I A;  4PSX A;  2FSR A;  4EVY A;  4B5P B;  5DWN A;  5E96 A;  1Z4E A;  3R96 A;  1MK4 A;  3FXT A;  1YR0 A;  1B6B A;  1QSR A;  1S7F A;  1IYK A;  3W6X A;  2Q04 A;  2PRB A;  4MJ8 A;  2EVN A;  2Q7B A;  2J8R A;  3D8P A;  2VQY A;  2VZZ A;  1LRZ A;  3TT2 A;  1IB1 E;  3DDD A;  1S7N A;  4AVB A;  1S7K A;  2P6E A;  4NCZ A;  5GCN A;  2EUI A;  5F49 A;  5JPH A;  3IGR A;  1B87 A;  4FD7 A;  3T9Y A;  2PR1 A;  4KOR A;  3EY5 A;  5I0C A;  3GY9 A;  2P6F A;  3T90 A;  5J8C A;  4CRY B;  4XNH C;  2GE3 A;  4R3K A;  3WR7 A;  4QUS A;  2ZW7 A;  3JUW A;  2Y0M A;  3EFA A;  4YRH A;  4CAV A;  2VZY A;  3H4Q A;  1S7L A;  3NE7 A;  2CNM A;  1BO4 A;  1XIX A;  2D4O A;  3LD2 A;  3DNS A;  4MY3 A;  1RO5 A;  1S60 A;  4M85 A;  2OB0 A;  2BL1 A;  3R9F A;  4II9 A;  3C26 A;  4H89 A;  5KTC A;  4B5P A;  4QC6 A;  3P2H A;  3R9G A;  1M4D A;  4OAD A;  3SXO A;  1WWZ A;  2Z0Z A;  2J8M A;  3TCV A;  2JEV A;  2PDO A;  4F0Y A;  2B3V A;  1KUY A;  4H6U A;  4KOX A;  4MI4 A;  3N7Z A;  1MJB A;  3K9U A;  1CM0 A;  2Q4V A;  1J4J A;  2G3T A;  2P0W A;  2C27 A;  1IIC A;  4HNY B;  4RS2 A;  1MJA A;  4KVX A;  5H86 A;  3JVN A;  2G3A A;  3DR6 A;  4X5K A;  4ZBG A;  4XPD B;  4E0A A;  4CRZ B;  4NXY A;  3F8K A;  4JD6 A;  4JXR A;  5EC4 A;  4R9M A;  2AE6 A;  3BJ7 A;  4XPD C;  2FS5 A;  4LX9 A;  2H5M A;  1R57 A;  4R87 A;  3P2F A;  4GS4 A;  3D2M A;  1S5K A;  1Q2D A;  4JJX A;  3G8W A;  2QML A;  4U5Y A;  1Q2C A;  1M1D A;  2Q4Y A;  3FRM A;  4L8A A;  1KUX A;  3G3S A;  2Q44 A;  3VWE A;  4AG7 A;  1YX0 A;  1WK4 A;  4PV6 A;  5CNP A;  5KTD A;  2OZU A;  3R9E A;  1K4J A;  3ZZI A;  4JXQ A;  1QSN A;  2GIV A;  2ZW6 A;  1OZP A;  3RYO A;  4B5O A;  4OAE A;  3TTH A;  2B4D A;  1NMT A;  2B5G A;  2NMT A;  4JWP A;  4NF1 A;  4IUS A;  3F0A A;  3FYN A;  3MGD A;  3R95 A;  5J8F A;  4XNH B;  5C82 A;  2CNS A;  4H6Z A;  4KOT A;  3SHP A;  2OZG A;  4AB7 A;  5KTA A;  3W6S A;  3IWG A;  4QB9 A;  3UY5 A;  4RI1 A;  1FY7 A;  2G0B A;  3TO6 A;  2R98 A;  1PU9 A;  2ZPA A;  1NSL A;  3FIX A;  1Q2Y A;  4UWJ A;  2I79 A;  2HUZ A;  2QIR A;  4AG9 A;  1XE4 A;  2Q0Y A;  2REE A;  5EBV A;  3S6F A;  4ORF A;  5F48 A;  3BJ8 A;  2GAN A;  5F46 A;  2VEZ A;  3FNC A;  3QB8 A;  1P0H A;  2OU2 A;  4HNW B;  3EO4 A;  4UBR A;  3S6G A;  4QBJ A;  4XPK A;  2OH1 A;  1KUV A;  4IF5 A;  3FBU A;  3E0K A;  4L89 A;  5FVJ A;  3V8I A;  4UWI A;  1VKC A;  1XEB A;  4CS0 B;  1YVO A;  1YGH A;  1N71 A;  3DSB A;  1V0C A;  4CAX A;  4QVT A;  2WPX A;  2VXK A;  2X7B A;  3FB3 A;  2P6G A;  2ATR A;  2I00 A;  1XF8 A;  1SQH A;  2PQ8 A;  2OZH A;  2A4N A;  2J8N A;  3PZJ A;  2WPW A;  2FE7 A;  5IV0 A;  3S6H A;  4R3L A;  4PSW A;  3LOD A;  4Y49 C;  3B8G A;  1P4N A;  3OWC A;  2BUE A;  2HV2 A;  5ISV A;  1YVK A;  1I1D A;  1QSO A;  2CY2 A;  3D2P A;  4ONU A;  1PUA A;  2BSW A;  3DR8 A;  4MHD A;  2RC4 A;  3R1K A;  3PP9 A;  3CXP A;  4KUA A;  3PGP A;  3QAH A;  4CAW A;  4KVM E;  1TIQ A;  2R7H A;  1QST A;  3KKW A;  4MY0 A;  1RXT A;  2VBQ A;  1I12 A;  5C88 A;  4E2A A;  3GYA A;  2B58 A;  4KLV A;  1NE9 A;  1S3Z A;  2FT0 A;  2F5I A;  4KUB A;  4R57 A;  3GKR A;  3TOB A;  3F5B A;  1IID A;  3EC4 A;  3CXS A;  2JDC A;  2Z10 A;  3I3G A;  2R8V A;  2FXF A;  4YFJ A;  5IX3 A;  3S6K A;  1YRE A;  2JDD A;  2R1I A;  1M4G A;  2IL4 A;  2K5T A;  1VHS A;  2ZXV A; 
#chains in the Genus database with same CATH topology
 4KOV A;  1Y0R A;  4ZI6 A;  1L0C A;  1PYT B;  1UFH A;  2HQY A;  4JLY A;  4KOS A;  4YGO A;  2JBK A;  2PJ7 A;  4PPZ A;  5DWM A;  2QJ8 A;  3NA6 A;  4J3G A;  4AVA A;  4B6Z A;  1U6M A;  4JZ0 A;  2V8G A;  3PRT A;  1KZF A;  4PK3 A;  6CPA A;  4B11 A;  1IYL A;  4W9Y A;  1Y9W A;  3I1U A;  3PB4 X;  4OC5 A;  3SXN A;  4C2Y A;  4CGM A;  4I49 A;  4X3R A;  3WAB A;  3IU2 A;  5HH1 A;  2PJB A;  4K3N A;  2VL1 A;  4UA3 A;  2EO8 A;  1R3N A;  2Z3P A;  1ELM P;  2ZEG A;  4OLL A;  4U9Y A;  4B13 A;  3TFY A;  2O28 A;  3SJX A;  4XPL A;  4UIB A;  4NEX A;  4CYQ A;  3TE4 A;  2DPS A;  4GM5 A;  4MHP A;  4ZY1 A;  4NFR A;  2D4P A;  1Y7E A;  3PB6 X;  4LUA A;  2DXQ A;  4BBH A;  4RUH A;  2DPT A;  2GLJ A;  2REF A;  1XOV A;  1Z4R A;  4FD6 A;  4AXV A;  4CGN A;  4DYO A;  4KVO E;  1TKH A;  2FIA A;  2FL4 A;  3IWE A;  4FD4 A;  2ZEF A;  4K30 A;  4PQA A;  2CNT A;  4UIA A;  3W91 A;  2XEG A;  2C6G A;  2YGW A;  4O23 A;  3TO9 A;  2PC1 A;  3NH8 A;  5HMN A;  1TKF A;  4KOU A;  4UF4 A;  3FX6 A;  4E8O A;  2KCW A;  2ZW5 A;  4KZT A;  3KQX A;  1MJ9 A;  3CXQ A;  4NJR A;  4B12 A;  1YK3 A;  3I9S A;  4NGM A;  1CP6 A;  3IJ3 A;  4CYO A;  3FF3 A;  1YSJ A;  3D3S A;  4KSI A;  5G22 A;  5HXD A;  4MBU A;  2POK A;  4FD5 A;  4FBE A;  4H2K A;  4PXE A;  3KHX A;  1BOB A;  2V8V A;  2PSW A;  2Z11 A;  2B4D B;  1I21 A;  4GXH A;  2B5G B;  1YQE A;  5D8N A;  4MRI A;  2B3U A;  1ZG9 A;  2FIW A;  2AFS A;  2QVP A;  3QAY A;  3ZJ0 A;  3VWD A;  2BEI A;  2O4H A;  1Y7R A;  3K9T A;  4KOW A;  4PK2 A;  4PXB A;  1CJW A;  4CYN A;  2FCK A;  2ANP A;  1CG2 A;  4Y49 B;  1QSM A;  4ZY0 A;  4UCM A;  5JQ4 A;  1M44 A;  4IHM A;  4P44 A;  1ZG7 A;  4YWY A;  1LOK A;  3CT9 A;  1ZO0 A;  2IMO A;  3PB9 X;  4KLW A;  4YU9 A;  1PCA A;  4TWE A;  3BLN A;  1GHE A;  4KOY A;  5D29 A;  2ARH A;  3TO7 A;  4NGR A;  4Q7A A;  4BMH A;  2JLM A;  3PBB A;  1YLE A;  2PR8 A;  4HNX B;  1ON0 A;  3KZW A;  5G1Z A;  4OC2 A;  2B4B A;  5F09 A;  4HKF A;  4NGS A;  4A37 A;  5HVH A;  5A27 A;  4UFW A;  1Z9U A;  2PJ0 A;  3KR4 A;  1Y9K A;  2QEC A;  3L2N A;  3CZX A;  3S9M A;  2ZW4 A;  3KI9 A;  1YW6 A;  2PJC A;  4ZGY B;  3RAM A;  5HVG A;  1XMT A;  4A33 A;  5IB0 A;  2Q43 A;  4KS9 A;  4NGP A;  2ZED A;  1LAM A;  4ZX8 A;  3RO0 A;  3FED A;  5F47 A;  2Q4Z A;  2VI7 A;  4AVC A;  2PRQ A;  3GLJ A;  4U9Z A;  3EXN A;  4DNC A;  4F9U A;  2Z3N A;  4UCN A;  1Z8X A;  4OIW A;  4M3S A;  3TOA A;  5CBM A;  5H84 A;  4F6A A;  4MFQ A;  3S9L A;  5AG4 A;  4NSQ A;  2AJ6 A;  1M4I A;  4ZY2 A;  4PSX A;  2FSR A;  4EVY A;  4B5P B;  5DWN A;  5E96 A;  1Z4E A;  2ODF A;  4MCR A;  2Z3K A;  3R96 A;  3D67 A;  5A28 A;  2ZEH A;  1MK4 A;  4MFZ A;  2WZN A;  2PCU A;  1Z8W A;  4X8I A;  3FXT A;  3D7H A;  1LAP A;  4RN7 A;  4DUK A;  2PJ2 A;  1YR0 A;  1B6B A;  1QSR A;  4C68 A;  4C2Z A;  1S7F A;  1IYK A;  3FH4 A;  3PFO A;  3W6X A;  2Q04 A;  5G21 A;  4OME A;  2PRB A;  3DLJ A;  4CYP A;  1CX8 A;  3NH5 A;  4MJ8 A;  5LRG A;  8CPA A;  3D7G A;  4BD9 A;  2Z3L A;  2EVN A;  1IU8 A;  1NSA A;  2XEI A;  1DE4 C;  2Q7B A;  3V7Z A;  2J8R A;  3D8P A;  4MCP A;  2VQY A;  2RB7 A;  3IIB A;  4A38 A;  2VZZ A;  4OKO A;  3PBE A;  1LRZ A;  3TT2 A;  1IB1 E;  1QMU A;  2ZEN A;  3DDD A;  4OC1 A;  1S7N A;  4JYW A;  4ZX9 A;  4R6T A;  4AVB A;  2IQ6 A;  4MFK A;  1S7K A;  1ARM A;  2P6E A;  3FMC A;  5K8P A;  4NCZ A;  2PJ9 A;  2V8H A;  5GCN A;  4MCS A;  2EUI A;  2PJ5 A;  2YNC C;  4LQG A;  1CP7 A;  5F49 A;  4OC4 A;  5JPH A;  3IGR A;  4Q36 A;  1B87 A;  4FD7 A;  3T9Y A;  5AG5 A;  2PR1 A;  2ZEO A;  4KOR A;  3EY5 A;  5I0C A;  3D7F A;  1JQG A;  4P4J A;  3GY9 A;  4R7M A;  2HC9 A;  2P6F A;  1VHE A;  3CDX A;  3T90 A;  5J8C A;  2Z3O A;  4M6I A;  2YND A;  4CRY B;  2PJ3 A;  4XNH C;  4KSF A;  3PFE A;  2GE3 A;  3SI2 A;  4P6Y A;  4X2T A;  3B35 A;  4FAI A;  2C6P A;  4R3K A;  1F57 A;  4QUS A;  3WR7 A;  2ZW7 A;  4ONW A;  2BO9 A;  2PJ6 A;  3BHX A;  3H8F A;  4P4F A;  2V8D A;  3B2Y A;  3IWW A;  3JUW A;  4PXC A;  5HVF A;  4A94 A;  2F8H A;  4P4B A;  3H8G A;  2Y0M A;  1UWY A;  3GUX A;  3EFA A;  4M6H A;  4YRH A;  3V38 A;  1AYE A;  4CAV A;  3H4Q A;  5DS0 A;  1S7L A;  3BI1 A;  3NE7 A;  4A30 A;  3D68 A;  3IU1 A;  2CNM A;  1GYT A;  1Z5R A;  1BO4 A;  4P45 A;  4C7I A;  1XIX A;  2D4O A;  1Z8L A;  3LD2 A;  4MHY A;  3DNS A;  2EBJ A;  4Q38 A;  4M6G A;  4MY3 A;  1ARL A;  1RO5 A;  1S60 A;  4M85 A;  4BIN A;  4UEE A;  2OB0 A;  2BL1 A;  3R9F A;  4II9 A;  1VGY A;  3C26 A;  4H89 A;  5KTC A;  4B5P A;  3JTK A;  4QC6 A;  4DJL A;  3P2H A;  4TNU A;  3R9G A;  1M4D A;  4LQ6 A;  4OAD A;  1A2Z A;  5AG7 A;  3MRU A;  3SXO A;  4A31 A;  1WWZ A;  3VAT A;  2Z0Z A;  3BXM A;  2J8M A;  3TCV A;  2PE3 A;  2C1C A;  2JEV A;  1XJO A;  4A32 A;  2PDO A;  4MFP A;  3RZA A;  4F0Y A;  2B3V A;  3LMS A;  1KUY A;  4H6U A;  2PJ1 A;  4KOX A;  1YME A;  1XBU A;  1ZG8 A;  4MI4 A;  1TF8 A;  1MJB A;  2CTC A;  2YNE A;  3K9U A;  3N7Z A;  1CM0 A;  4IK2 A;  2Q4V A;  1J4J A;  5ELY A;  2G3T A;  2ABZ A;  2NYQ A;  2ZEM A;  1BPM A;  2P0W A;  2C27 A;  4UEZ A;  1X12 A;  4UFX A;  1IIC A;  2AFO A;  4HNY B;  4OC0 A;  4RS2 A;  4UFV A;  3ISX A;  5LYL A;  1MJA A;  4KVX A;  5H86 A;  4FUU A;  1Y0Y A;  5THW A;  3B7I A;  3JVN A;  1CBX A;  2G3A A;  3DR6 A;  4X5K A;  3BI0 A;  4ZBG A;  1HDU A;  2ZXV A;  2IJZ A;  5LYD A;  4XPD B;  4E0A A;  2OOT A;  1ZLI A;  4CRZ B;  4NXY A;  1IOI A;  3F8K A;  4JD6 A;  1YLO A;  1XRY A;  4JXR A;  4CAE A;  3RBU A;  2Q51 A;  4B14 A;  5EC4 A;  4R9M A;  2AE6 A;  3BJ7 A;  4UCP A;  4EFD A;  3FVL A;  4WWV A;  4XPD C;  2FS5 A;  3DGV A;  3IC1 A;  1M4L A;  4LX9 A;  1Z8T A;  2H5M A;  3SJE A;  3H8E A;  1VIX A;  2CIJ A;  3B3C A;  1R57 A;  4EWT A;  4MMO A;  4R87 A;  4MXU A;  3P2F A;  4GS4 A;  3D2M A;  2AFM A;  3GB0 A;  2JEW A;  1S5K A;  1Q2D A;  4JJX A;  3G8W A;  2QML A;  1YW4 A;  3LWU A;  3WC7 A;  2WSA A;  4P10 A;  4U5Y A;  1Q2C A;  2AFX A;  1IOF A;  1M1D A;  2DF5 A;  1F2O A;  1H8L A;  2Q4Y A;  2XEF A;  3FRM A;  3KL9 A;  4L8A A;  1KUX A;  3IFE A;  2ZEL A;  3FJU A;  3G3S A;  3MN8 A;  4P4I A;  2Q44 A;  3VWE A;  3D7D A;  4G1P A;  4AG7 A;  5JGF A;  1YX0 A;  1WK4 A;  4PV6 A;  1IY7 A;  2PJ8 A;  2RFH A;  5CNP A;  1VHO A;  5KTD A;  2FVG A;  2OZU A;  3R9E A;  4ZYQ A;  1Q7L A;  1K4J A;  2F7V A;  3ZZI A;  5K8O A;  4JXQ A;  5EMI A;  1QSN A;  7CPA A;  2GIV A;  2ZW6 A;  1OZP A;  3RYO A;  4CGP A;  4B5O A;  4A2Z A;  1BLL E;  4OAE A;  3TTH A;  2B4D A;  1NMT A;  2B5G A;  2NMT A;  3B3T A;  4JWP A;  4NF1 A;  3N5F A;  4IUS A;  4NGQ A;  4R76 A;  3KR5 A;  4EME A;  3F0A A;  3B3W A;  3FYN A;  1X10 A;  3MGD A;  3R95 A;  5IB9 A;  5J8F A;  4XNH B;  5C82 A;  1OBR A;  2CNS A;  2J9A A;  4H6Z A;  4KOT A;  3ISZ A;  2GLF A;  3IO1 A;  2EK8 A;  1LAN A;  2QYV A;  2OZG A;  3SHP A;  3PB7 X;  4AB7 A;  5JH9 A;  5KTA A;  1F2P A;  2GRE A;  3IWG A;  3W6S A;  3HLP A;  1LCP A;  1QQ9 A;  3D4U A;  4NGT A;  4QB9 A;  3UY5 A;  4RI1 A;  1FY7 A;  2G0B A;  3TO6 A;  2R98 A;  4CGO A;  1PU9 A;  4A39 A;  2ZPA A;  3SI1 A;  4CPA A;  1NSL A;  3FIX A;  4CAF A;  1Q2Y A;  4UWJ A;  2I79 A;  3SJG A;  2HUZ A;  2QIR A;  4FWU A;  4AG9 A;  3FEC A;  1XE4 A;  3JRU A;  1ZLH A;  2Q0Y A;  2REE A;  5EBV A;  3S6F A;  4ORF A;  5F48 A;  3BJ8 A;  2CXA A;  3QNV A;  5G20 A;  1CPX A;  2GAN A;  4MHN A;  5F46 A;  2VEZ A;  3FNC A;  3QB8 A;  5K8M A;  1P0H A;  2OU2 A;  4HNW B;  4NJQ A;  3S9N A;  3EO4 A;  2PVV A;  2JBJ A;  4UBR A;  4B10 A;  3B3V A;  3S6G A;  1XFO A;  2CTB A;  2AFZ A;  4QBJ A;  5AGE A;  2PIY A;  4XPK A;  2OH1 A;  5JM6 A;  5CPA A;  1KUV A;  3GIU A;  1TF9 A;  4IF5 A;  2C6C A;  3FBU A;  3WT4 A;  4F9V A;  2EWB A;  3E0K A;  1HDQ A;  2G9D A;  3FEE A;  4L89 A;  3WC5 A;  2GU2 A;  5FVJ A;  1TKJ A;  3V8I A;  4UEF A;  4UWI A;  1BPN A;  1VKC A;  1XEB A;  4CS0 B;  1YVO A;  2BCO A;  1YGH A;  1N71 A;  3DSB A;  5BWA B;  5LYI A;  1V0C A;  4CAX A;  4QVT A;  3H5Z A;  2WPX A;  4PXD A;  2VXK A;  2GFQ A;  2X7B A;  3TC8 A;  3KAS A;  4C2X A;  4F0X A;  3A9L A;  4IAV A;  1XMB A;  2ZOG A;  4MFJ A;  3FB3 A;  2P6G A;  1BAV A;  2ATR A;  2I00 A;  3T8W A;  1XF8 A;  1SQH A;  2PQ8 A;  1AUG A;  2WYR A;  4Z65 A;  1RTQ A;  2OZH A;  2V77 A;  2I3C A;  4HPS A;  4NGN A;  2A4N A;  1LFW A;  2J8N A;  2ZOF A;  3PZJ A;  2WPW A;  3PEI A;  2FE7 A;  1ELL P;  1HEE A;  5IV0 A;  3S6H A;  4R3L A;  3KHZ A;  4C7H A;  4P4D A;  4PSW A;  3LOD A;  4Y49 C;  3B3S A;  1FNO A;  1P4N A;  2OR4 A;  3B8G A;  3OWC A;  2YNC A;  2BUE A;  3KQZ A;  2HV2 A;  4KSA A;  4F8Z A;  2O53 A;  4MFL A;  5ISV A;  1CPS A;  1YVK A;  3KGQ A;  1I1D A;  1QSO A;  2CY2 A;  3D2P A;  4OP4 A;  3SI0 A;  3PB8 X;  2PJA A;  4OID A;  1KWM A;  4ONU A;  1PUA A;  2BSW A;  3DR8 A;  4MHD A;  3HUV A;  1TXR A;  4MCQ A;  2RC4 A;  3R1K A;  3PP9 A;  3RNZ A;  4A95 A;  3CXP A;  4CGL A;  2BOA A;  3CPA A;  3CPX A;  2DEA A;  4KUA A;  3PGP A;  3QAH A;  4CAW A;  2PVW A;  4OC3 A;  3WC6 A;  4KVM E;  1TIQ A;  3NH4 A;  3D66 A;  2R7H A;  1QST A;  5J1Q A;  3KKW A;  4MHZ A;  4MY0 A;  1RXT A;  2ZEE A;  2VBQ A;  1I12 A;  2NSM A;  5C88 A;  5I4M A;  2AFW A;  4E2A A;  2CF4 A;  3GYA A;  2B58 A;  3NFZ A;  1NE9 A;  1S3Z A;  2FT0 A;  4KLV A;  2F5I A;  4KUB A;  2XEJ A;  3LAC A;  1AMP A;  2Q7S A;  4R57 A;  2WUU A;  1Z2L A;  2HB6 A;  5AG6 A;  1R43 A;  3GKR A;  3VH9 A;  5K8N A;  3TOB A;  3F5B A;  3VAR A;  1IID A;  5LRJ A;  3EC4 A;  3CXS A;  2JDC A;  2Z10 A;  1IGB A;  3SJF A;  3I3G A;  2R8V A;  4R8F A;  3K2K A;  2FXF A;  4YFJ A;  2EK9 A;  2PJ4 A;  5IX3 A;  5LYF A;  1EE3 P;  2ZEP A;  1FT7 A;  3S6K A;  3TX8 A;  1YRE A;  2JDD A;  1DTD A;  2R1I A;  3IEH A;  4P4E A;  5LRK A;  1M4G A;  2IL4 A;  1JWQ A;  2K5T A;  1VHS A;  4WJB A;  2Z3M A;  2PIZ A;  2VZY A;  2AFU A;  3NE8 A; 
#chains in the Genus database with same CATH homology
 4KOV A;  1L0C A;  1UFH A;  2HQY A;  4JLY A;  4KOS A;  4YGO A;  5DWM A;  4J3G A;  4AVA A;  1U6M A;  1KZF A;  4PK3 A;  4B11 A;  1IYL A;  1Y9W A;  3SXN A;  4C2Y A;  4CGM A;  4I49 A;  3IU2 A;  5HH1 A;  4UA3 A;  2Z3P A;  4OLL A;  4U9Y A;  4B13 A;  3TFY A;  2O28 A;  4XPL A;  4CYQ A;  4NEX A;  3TE4 A;  2DPS A;  2D4P A;  4BBH A;  4LUA A;  2DXQ A;  2DPT A;  2REF A;  1Z4R A;  4FD6 A;  4CGN A;  4KVO E;  2FL4 A;  2FIA A;  3IWE A;  4FD4 A;  4K30 A;  3W91 A;  2CNT A;  2YGW A;  3TO9 A;  2PC1 A;  5HMN A;  4KOU A;  4E8O A;  2KCW A;  2ZW5 A;  4KZT A;  1MJ9 A;  3CXQ A;  4B12 A;  1YK3 A;  3I9S A;  4CYO A;  3D3S A;  5G22 A;  4MBU A;  4FD5 A;  1BOB A;  2PSW A;  2Z11 A;  2B4D B;  1I21 A;  2B5G B;  2B3U A;  2FIW A;  3ZJ0 A;  3VWD A;  2BEI A;  4KOW A;  1Y7R A;  4PK2 A;  1CJW A;  4CYN A;  2FCK A;  5JQ4 A;  4Y49 B;  1QSM A;  4UCM A;  1M44 A;  1ZO0 A;  4KLW A;  3BLN A;  1GHE A;  4KOY A;  2ARH A;  3TO7 A;  4BMH A;  2JLM A;  1YLE A;  2PR8 A;  4HNX B;  1ON0 A;  5G1Z A;  2B4B A;  4HKF A;  5A27 A;  4UFW A;  1Z9U A;  1Y9K A;  2QEC A;  2ZW4 A;  4ZGY B;  5IB0 A;  1XMT A;  4A33 A;  4KS9 A;  5F47 A;  2VI7 A;  4AVC A;  4U9Z A;  3EXN A;  4DNC A;  2Z3N A;  4UCN A;  4M3S A;  3TOA A;  5H84 A;  4F6A A;  4MFQ A;  4NSQ A;  2AJ6 A;  1M4I A;  4PSX A;  2FSR A;  4EVY A;  4B5P B;  5DWN A;  5E96 A;  1Z4E A;  2Z3K A;  3R96 A;  5A28 A;  1MK4 A;  4MFZ A;  3FXT A;  1YR0 A;  1B6B A;  1QSR A;  4C68 A;  4C2Z A;  1S7F A;  1IYK A;  3W6X A;  2Q04 A;  5G21 A;  2PRB A;  4CYP A;  4MJ8 A;  2Z3L A;  2EVN A;  2Q7B A;  2J8R A;  3D8P A;  2VQY A;  2VZZ A;  1LRZ A;  3TT2 A;  1IB1 E;  3DDD A;  1S7N A;  4AVB A;  4MFK A;  1S7K A;  2P6E A;  4NCZ A;  5GCN A;  2EUI A;  2YNC C;  5F49 A;  5JPH A;  3IGR A;  4Q36 A;  1B87 A;  4FD7 A;  3T9Y A;  5AG5 A;  2PR1 A;  4KOR A;  3EY5 A;  5I0C A;  3GY9 A;  2P6F A;  3T90 A;  5J8C A;  2Z3O A;  2YND A;  4CRY B;  4XNH C;  4KSF A;  2GE3 A;  4R3K A;  3WR7 A;  4QUS A;  2ZW7 A;  3JUW A;  2Y0M A;  3EFA A;  4YRH A;  4CAV A;  2VZY A;  3H4Q A;  1S7L A;  4A30 A;  3NE7 A;  3IU1 A;  2CNM A;  1BO4 A;  4C7I A;  1XIX A;  2D4O A;  3LD2 A;  3DNS A;  4Q38 A;  4MY3 A;  1RO5 A;  1S60 A;  4M85 A;  2OB0 A;  2BL1 A;  3R9F A;  4II9 A;  3C26 A;  4H89 A;  5KTC A;  4B5P A;  3JTK A;  4QC6 A;  3P2H A;  3R9G A;  1M4D A;  4OAD A;  5AG7 A;  3SXO A;  4A31 A;  1WWZ A;  2Z0Z A;  2J8M A;  3TCV A;  5AG4 A;  2JEV A;  4A32 A;  2PDO A;  4MFP A;  4F0Y A;  2B3V A;  1KUY A;  4H6U A;  4KOX A;  4MI4 A;  2YNE A;  1MJB A;  3K9U A;  3N7Z A;  1CM0 A;  2Q4V A;  1J4J A;  2G3T A;  2P0W A;  2C27 A;  4UFX A;  1IIC A;  4HNY B;  4RS2 A;  4UFV A;  1MJA A;  4KVX A;  5H86 A;  3JVN A;  2G3A A;  3DR6 A;  4X5K A;  4ZBG A;  4XPD B;  4E0A A;  4CRZ B;  4NXY A;  3F8K A;  4JD6 A;  4JXR A;  4CAE A;  4B14 A;  5EC4 A;  4R9M A;  2AE6 A;  3BJ7 A;  4UCP A;  4XPD C;  2FS5 A;  4LX9 A;  2H5M A;  1R57 A;  4R87 A;  3P2F A;  4GS4 A;  3D2M A;  1S5K A;  1Q2D A;  4JJX A;  3G8W A;  2QML A;  2WSA A;  4U5Y A;  1Q2C A;  1M1D A;  2Q4Y A;  3FRM A;  4L8A A;  1KUX A;  3G3S A;  2Q44 A;  3VWE A;  4AG7 A;  1YX0 A;  1WK4 A;  4PV6 A;  5CNP A;  5KTD A;  2OZU A;  3R9E A;  1K4J A;  3ZZI A;  4JXQ A;  1QSN A;  2GIV A;  2ZW6 A;  1OZP A;  3RYO A;  4CGP A;  4B5O A;  4A2Z A;  4OAE A;  3TTH A;  2B4D A;  1NMT A;  2B5G A;  2NMT A;  4JWP A;  4NF1 A;  4IUS A;  3F0A A;  3FYN A;  3MGD A;  3R95 A;  5J8F A;  4XNH B;  5C82 A;  2CNS A;  4H6Z A;  4KOT A;  3SHP A;  2OZG A;  4AB7 A;  5KTA A;  3W6S A;  3IWG A;  4QB9 A;  3UY5 A;  4RI1 A;  1FY7 A;  2G0B A;  3TO6 A;  2R98 A;  4CGO A;  1PU9 A;  2ZPA A;  1NSL A;  3FIX A;  4CAF A;  1Q2Y A;  4UWJ A;  2I79 A;  2HUZ A;  2QIR A;  4AG9 A;  1XE4 A;  2Q0Y A;  2REE A;  5EBV A;  3S6F A;  4ORF A;  5F48 A;  3BJ8 A;  2CXA A;  5G20 A;  2GAN A;  5F46 A;  2VEZ A;  3FNC A;  3QB8 A;  1P0H A;  2OU2 A;  4HNW B;  3EO4 A;  4UBR A;  4B10 A;  3S6G A;  4QBJ A;  5AGE A;  4XPK A;  2OH1 A;  1KUV A;  4IF5 A;  3FBU A;  3E0K A;  4L89 A;  5FVJ A;  3V8I A;  4UWI A;  1VKC A;  1XEB A;  4CS0 B;  1YVO A;  1YGH A;  1N71 A;  3DSB A;  5BWA B;  1V0C A;  4CAX A;  4QVT A;  3H5Z A;  2WPX A;  2VXK A;  2X7B A;  4C2X A;  4F0X A;  3A9L A;  4MFJ A;  3FB3 A;  2P6G A;  2ATR A;  2I00 A;  1XF8 A;  1SQH A;  2PQ8 A;  2OZH A;  2A4N A;  2J8N A;  3PZJ A;  2WPW A;  2FE7 A;  5IV0 A;  3S6H A;  4R3L A;  4C7H A;  4PSW A;  3LOD A;  4Y49 C;  3B8G A;  1P4N A;  3OWC A;  2YNC A;  2BUE A;  2HV2 A;  4KSA A;  4MFL A;  5ISV A;  1YVK A;  1I1D A;  1QSO A;  2CY2 A;  3D2P A;  4ONU A;  1PUA A;  2BSW A;  3DR8 A;  4MHD A;  2RC4 A;  3R1K A;  3PP9 A;  4A95 A;  3CXP A;  4CGL A;  4KUA A;  3PGP A;  3QAH A;  4CAW A;  4KVM E;  1TIQ A;  2R7H A;  1QST A;  3KKW A;  4MY0 A;  1RXT A;  2VBQ A;  1I12 A;  5C88 A;  4E2A A;  3GYA A;  2B58 A;  4KLV A;  1NE9 A;  1S3Z A;  2FT0 A;  2F5I A;  4KUB A;  4R57 A;  2WUU A;  5AG6 A;  3GKR A;  3TOB A;  3F5B A;  1IID A;  3EC4 A;  3CXS A;  2JDC A;  2Z10 A;  3I3G A;  2R8V A;  2FXF A;  4YFJ A;  5IX3 A;  3S6K A;  1YRE A;  2JDD A;  2R1I A;  1M4G A;  2IL4 A;  2K5T A;  1VHS A;  2Z3M A;  2ZXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...