4Y49B

Crystal structure of yeast n-terminal acetyltransferase (ppgpp) nate in complex with a bisubstrate
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
203
structure length
164
Chain Sequence
PINIRRATINDIICMQNANLHNLPENYMMKYYMYHILSWPEASFVATTTTLDGEKLVGYVLVKMNDDPEPPNGHITSLSVMRTYRRMGIAENLMRQALFALREVHQAEYVSLHVRQSNRAALHLYRDTLAFEVLSIEKSYYQDGEDAYAMKKVLKLEELQISNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of yeast N-terminal acetyltransferase (ppGpp) NatE in complex with a bisubstrate
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords N-terminal acetyltransferase A complex subunit NAT1
total genus 9
structure length 164
sequence length 203
chains with identical sequence H, N
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2015-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4y49B00
4JXRA 1Q2DA 1IICA 2REEA 3BJ7A 3R1KA 4JXQA 1Z9UA 2B5GB 2Z0ZA 1Q2CA 4KVOE 3TTHA 4UWIA 3QB8A 5KTCA 3C26A 3T90A 2FIWA 4PSXA 4AVAA 1GHEA 1S5KA 2D4PA 5IV0A 4MY3A 1S7NA 4U9YA 4KVME 4AG7A 4R3LA 1IYLA 2Q44A 4KOXA 1CJWA 1KZFA 4EVYA 4PK3A 1YR0A 2ATRA 2ZPAA 2ARHA 2Q4VA 1PUAA 2PC1A 2OU2A 1S7LA 4AVBA 2Z11A 1LRZA 1I12A 2O28A 4PV6A 2I00A 4MBUA 4R9MA 2J8NA 2G0BA 1WK4A 4JJXA 3B8GA 1UFHA 1YGHA 1KUVA 2P6FA 2VEZA 3IGRA 4E0AA 3W91A 2PRBA 3S6FA 1S60A 1QSMA 1QSNA 5JQ4A 3TE4A 2J8MA 3BJ8A 2AJ6A 3FNCA 4KOUA 4NF1A 3OWCA 4DNCA 4ZBGA 1VKCA 5DWNA 1YVOA 1TIQA 3F0AA 4BMHA 3CXQA 2HUZA 2CNSA 4CAVA 1NMTA 1Y9KA 4II9A 1V0CA 1Y7RA 2B58A 2GIVA 2FL4A 4E2AA 2G3TA 2PDOA 4KLWA 5HH1A 2JDCA 3FB3A 4NEXA 3VWDA 2Y0MA 3TO6A 4U9ZA 4B5PA 1I21A 3TT2A 4R57A 2PQ8A 4XPDC 2JEVA 4Y49B 1P0HA 1ON0A 3EO4A 3R9EA 3TOAA 3TO9A 2OZGA 2P0WA 1XE4A 4PK2A 3CXSA 3PGPA 1XIXA 3FXTA 4JWPA 3TCVA 4UWJA 1OZPA 4YGOA 2DXQA 1IIDA 5C88A 4HNXB 2FSRA 4GS4A 3VWEA 5F49A 1M44A 5EBVA 3GY9A 2X7BA 2B4BA 1K4JA 3N7ZA 4KOVA 1S3ZA 3I3GA 4QC6A 1Z4RA 1L0CA 2BSWA 2QMLA 1FY7A 2NMTA 4CRZB 1IYKA 4K30A 3I9SA 2VQYA 3SXNA 1M1DA 4NSQA 2D4OA 3S6HA 1MJ9A 1M4GA 4KORA 4E8OA 2FXFA 2Q04A 4NXYA 2GANA 4J3GA 3S6KA 3EY5A 2Q4YA 4F6AA 3EXNA 1R57A 5JPHA 5F47A 4IF5A 3P2HA 3P2FA 4M85A 1S7KA 5DWMA 1M4IA 2HQYA 3V8IA 4AG9A 4FD5A 4ORFA 1N71A 3G8WA 5J8FA 3LD2A 4UA3A 1BOBA 1XMTA 3DSBA 1NSLA 3F5BA 4B5OA 1QSOA 4OADA 5HMNA 2KCWA 1B87A 5E96A 5GCNA 2A4NA 4XPLA 2JLMA 2OZHA 3R95A 3RYOA 4LUAA 3SXOA 3JVNA 5FVJA 2PR8A 4UBRA 1KUXA 4KZTA 5C82A 2EUIA 4KUAA 4KOYA 1MJBA 2FS5A 2JDDA 2Q7BA 4HNWB 4AB7A 3DR6A 3R96A 4KOWA 1IB1E 2PSWA 1Z4EA 4FD6A 3GYAA 2J8RA 3D8PA 4CAXA 2F5IA 4NCZA 3TFYA 2P6EA 4F0YA 1XEBA 3IWGA 1MK4A 1QSTA 3BLNA 3MGDA 1S7FA 2FCKA 2R1IA 3H4QA 3W6SA 2VI7A 2IL4A 4L8AA 4KVXA 3EC4A 2OZUA 2B3UA 2H5MA 1YREA 2BUEA 4XNHC 2VZYA 2EVNA 2P6GA 3KKWA 3EFAA 4H89A 4XPKA 3NE7A 2ZW4A 3F8KA 5H86A 2CY2A 4FD7A 4JD6A 5F48A 3S6GA 3D2MA 3DDDA 1BO4A 3TO7A 1U6MA 4KOTA 2QECA 4M3SA 2REFA 5ISVA 4MJ8A 1VHSA 2ZW6A 2VBQA 4XPDB 4HNYB 1YX0A 2AE6A 3D2PA 4R87A 2GE3A 4YFJA 2ZXVA 1YK3A 1B6BA 4CAWA 3D3SA 1WWZA 2B5GA 3DR8A 1Y9WA 4ONUA 2R98A 3R9GA 5KTAA 3LODA 2C27A 3DNSA 2VXKA 3TOBA 1NE9A 2B4DA 3K9UA 4OLLA 3PZJA 4KUBA 1KUYA 3FIXA 1Q2YA 5J8CA 2ZW5A 2RC4A 3JUWA 4AVCA 2R7HA 1RXTA 2WPWA 4FD4A 4LX9A 2Z10A 4MY0A 2HV2A 4JLYA 4L89A 4H6ZA 3G3SA 1RO5A 3FYNA 4HKFA 2OH1A 5IX3A 4R3KA 4Y49C 1SQHA 4PSWA 4YRHA 4U5YA 2CNTA 2BEIA 1CM0A 5IB0A 4IUSA 3SHPA 2WPXA 4QUSA 3ZZIA 1P4NA 3W6XA 3QAHA 2FT0A 4KOSA 3T9YA 2BL1A 2R8VA 4H6UA 4KLVA 3E0KA 2B3VA 5I0CA 5F46A 5KTDA 2ZW7A 2PR1A 4QBJA 1XF8A 2FIAA 1M4DA 1MJAA 1I1DA 2I79A 3CXPA 1QSRA 5CNPA 4I49A 1YLEA 4QB9A 3UY5A 1J4JA 3PP9A 1PU9A 2VZZA 3GKRA 2G3AA 4OAEA 4CRYB 4QVTA 4MHDA 4XNHB 1YVKA 3FBUA 5H84A 4RS2A 4MI4A 4RI1A 2Q0YA 2B4DB 2FE7A 5EC4A 4X5KA 2CNMA 2OB0A 3R9FA 3WR7A 2QIRA 3ZJ0A 3FRMA 4CS0B 4B5PB 2K5TA
chains in the Genus database with same CATH superfamily
4JXRA 1Q2DA 2YNDA 1IICA 1FNOA 2REEA 3BJ7A 1F57A 3R1KA 4JXQA 2PCUA 1Z9UA 4PXEA 2B5GB 4CAFA 2Z0ZA 1VHEA 1XJOA 1Q2CA 3H5ZA 1YSJA 4KVOE 3KZWA 3TTHA 5A28A 4UWIA 3QB8A 2YGWA 5KTCA 3FF3A 3C26A 3T90A 3DLJA 2FIWA 4A38A 4PSXA 4RN7A 1GHEA 4AVAA 1S5KA 2D4PA 5IV0A 1F2OA 4MY3A 1S7NA 1XRYA 5G1ZA 4MCRA 5D29A 1Z8WA 3JTKA 3NH5A 4U9YA 4KVME 4AG7A 4R3LA 1IYLA 2PJ8A 2Q44A 4KOXA 4ZY2A 1CJWA 3TC8A 1KZFA 4EVYA 4JZ0A 4PK3A 1YR0A 2AFOA 2ATRA 2C6PA 2ZPAA 2ARHA 2Q4VA 3KQXA 1TF9A 1PUAA 2PC1A 3NA6A 4IHMA 2OU2A 1S7LA 2VL1A 4AVBA 4UIAA 2Z11A 3LWUA 1LRZA 4ZGYB 1I12A 2O28A 3JRUA 4PV6A 1CG2A 3B7IA 2I00A 4MBUA 5K8NA 1NSAA 4MFJA 2IMOA 4R9MA 2J8NA 2G0BA 1WK4A 2IJZA 3FMCA 3PRTA 4BINA 4JJXA 3B8GA 1UFHA 1YGHA 2EK8A 1KUVA 2P6FA 1ARLA 2VEZA 2PRQA 3IGRA 3W91A 4E0AA 5JGFA 2PRBA 3S6FA 2QJ8A 4KS9A 3B3VA 3H8FA 3H8EA 1CP6A 1Z2LA 1S60A 1QSMA 4FBEA 5K8PA 4A30A 2ZEOA 2Z3OA 1ZO0A 1QSNA 4MHPA 3K2KA 5JQ4A 1HDUA 4Q36A 4OIWA 3KQZA 3TE4A 1XOVA 2CTBA 2EBJA 3KGQA 2J8MA 3S9MA 3LACA 3BJ8A 2AJ6A 3FNCA 4KOUA 2GLFA 5JM6A 4NF1A 3OWCA 4PXCA 4DNCA 4ZBGA 1VKCA 4ZX8A 5DWNA 4P4DA 3PB8X 1YVOA 1VGYA 1TIQA 4NGMA 4CPAA 3F0AA 4BMHA 3CXQA 2HC9A 2PJ0A 2HUZA 3RO0A 2CNSA 3SI0A 4CAVA 1NMTA 1Y9KA 2WSAA 3D7FA 4II9A 2AFWA 4OP4A 3L2NA 1V0CA 1Y7RA 2B58A 2GIVA 2FL4A 4P44A 4E2AA 3ISXA 2G3TA 2PDOA 3VARA 5K8MA 4KLWA 4A37A 5HH1A 4NGPA 1YQEA 2JDCA 2AFXA 2PJ2A 5AG7A 3FB3A 3KI9A 5BWAB 4NEXA 3VWDA 2Y0MA 3TO6A 4U9ZA 1CPSA 4B5PA 4CGNA 1I21A 3BI1A 4R57A 3TT2A 2NYQA 1XBUA 2V8DA 1EE3P 4YU9A 3IU2A 2PQ8A 2POKA 1Z5RA 2JEVA 4XPDC 1TF8A 2ZENA 1BAVA 4GM5A 2CIJA 1P0HA 4OIDA 4Y49B 1ON0A 4C2YA 1OBRA 3EO4A 4M6HA 3R9EA 3TOAA 3TO9A 4EFDA 3BHXA 2OZGA 2ZEGA 2V77A 2P0WA 1XE4A 4MHYA 4PK2A 2PJCA 3CXSA 1IY7A 1XIXA 3FXTA 3PGPA 4P4JA 4JWPA 4UF4A 3TCVA 3PB9X 4UWJA 1M4LA 1OZPA 1PCAA 2HB6A 1PYTB 2Q7SA 3K9TA 4YGOA 2DXQA 1IIDA 5C88A 2Z3NA 4HNXB 2Z3LA 4MCSA 2FSRA 2JBJA 4M6IA 2C6CA 4GS4A 1IU8A 4CGPA 3VWEA 1QQ9A 4P4IA 5F49A 1M44A 4R8FA 5EBVA 3SJFA 4C2XA 2OOTA 3GY9A 4P6YA 2X7BA 4RUHA 2B4BA 1K4JA 3N7ZA 4KOVA 1S3ZA 3KHZA 3I3GA 4QC6A 1Z4RA 3FX6A 4CYOA 2GFQA 1X10A 1L0CA 2BSWA 3GUXA 2Z3KA 1VHOA 2QMLA 6CPAA 1FY7A 5F09A 2NMTA 4NFRA 4CRZB 1IYKA 4K30A 4HPSA 4Q7AA 3I9SA 3V38A 5HXDA 2VQYA 1F2PA 1Z8TA 3T8WA 1Q7LA 4UFXA 4NGNA 5AG5A 3SXNA 1M1DA 1VIXA 2EWBA 4R6TA 4NSQA 2D4OA 3S6HA 1CBXA 1MJ9A 1M4GA 3A9LA 2DEAA 4KORA 4E8OA 4ZY0A 2FXFA 2DPTA 2Q04A 1LCPA 4MMOA 4CGLA 4F9VA 4MCPA 2Q43A 4NXYA 3FEDA 4X2TA 3PFEA 1AYEA 1IOFA 2GANA 4J3GA 3S6KA 3B3SA 3MN8A 3EY5A 2Q4YA 4F0XA 3IO1A 4F9UA 1AUGA 3TX8A 4EMEA 2AFUA 4F6AA 3EXNA 2V8VA 4MRIA 1R57A 5JH9A 2YNCC 5JPHA 1H8LA 3S9NA 4P10A 5F47A 4MFQA 2BOAA 1LAPA 2ZOFA 4IF5A 3P2HA 2XEIA 3P2FA 4M85A 1S7KA 3D66A 4FUUA 3RAMA 4P4FA 1HDQA 1IOIA 4NGTA 1YLOA 4OC1A 5DWMA 4KSIA 1M4IA 2HQYA 4UCMA 3V8IA 4AG9A 2GLJA 1YW4A 4FD5A 4ORFA 1N71A 1AMPA 4OC4A 3G8WA 5J8FA 2Z3MA 4PXDA 1CX8A 3LD2A 2PIYA 1BOBA 4UA3A 1XMTA 5A27A 3DSBA 4H2KA 1NSLA 2YNCA 3F5BA 4MHZA 4MFLA 3IEHA 1Z8XA 3KASA 1A2ZA 3IWWA 4OMEA 3D7HA 1QSOA 4B5OA 4OC0A 1HEEA 4OADA 5ELYA 5HMNA 3WC7A 1XFOA 2KCWA 2V8GA 1B87A 5E96A 5GCNA 4TNUA 1RTQA 2A4NA 3IWEA 4WJBA 3IFEA 4XPLA 4UEZA 4UCPA 2JLMA 1X12A 1GYTA 2OZHA 4R76A 3R95A 3RYOA 4YWYA 4LUAA 3NH8A 4P4EA 2WYRA 3JVNA 3SXOA 5FVJA 2BCOA 2XEGA 2PR8A 4P4BA 3PEIA 3KL9A 4UBRA 1KUXA 4KZTA 5C82A 2EUIA 4KUAA 5DS0A 4KOYA 2CXAA 3B3CA 1MJBA 2FS5A 2JDDA 3CDXA 4MHNA 1Y0RA 2Q7BA 1Y0YA 4HNWB 1ZG9A 4UFWA 4G1PA 3RBUA 2ZEHA 4AB7A 3DR6A 3IIBA 3R96A 4KOWA 2PSWA 1IB1E 1UWYA 1YMEA 1Z4EA 2XEFA 3B3WA 4IAVA 4FD6A 1Y7EA 3PBEA 4ZYQA 3GYAA 2JEWA 2J8RA 3D8PA 4CAXA 2PJBA 1XMBA 2F5IA 4NCZA 2P6EA 3TFYA 5LYLA 2PJ9A 2ZEMA 2DPSA 5AG6A 4F0YA 1XEBA 3IWGA 1MK4A 2YNEA 1QSTA 2AFMA 5D8NA 4ZY1A 3CPAA 1TKFA 1DE4C 3BLNA 3H8GA 3MGDA 2PE3A 3D67A 1S7FA 2FCKA 2R1IA 3I1UA 3SJGA 3H4QA 2PVVA 5CPAA 3W6SA 4B11A 2VI7A 3FEEA 2IL4A 4L8AA 3WABA 4CYPA 4KVXA 3EC4A 3ISZA 4W9YA 4LQ6A 2OZUA 2B3UA 1LOKA 2H5MA 5G20A 1YREA 2BUEA 2XEJA 5G21A 4XNHC 2G9DA 2VZYA 3KR5A 5I4MA 4KSAA 2EVNA 4UEEA 4JYWA 2P6GA 5G22A 3KKWA 3EFAA 2J9AA 1ZLHA 4H89A 4MFZA 4PPZA 4XPKA 3NE7A 3IC1A 1DTDA 2ZW4A 1BPNA 2C6GA 2ZEFA 2RB7A 3F8KA 5H86A 1JWQA 2CY2A 3GIUA 2PJ4A 4FD7A 1ZG8A 4JD6A 4MFKA 3IU1A 5F48A 1ZG7A 3S6GA 4O23A 3D2MA 5LYDA 3VH9A 3DDDA 4ZX9A 3CT9A 3SI1A 3FJUA 1BO4A 3TO7A 1U6MA 4KOTA 1CPXA 4FWUA 1ELLP 3GB0A 1FT7A 2QECA 4M3SA 2REFA 1LANA 4M6GA 3D7GA 4A31A 5ISVA 4TWEA 2ANPA 4A39A 4WWVA 4MJ8A 3QNVA 2EO8A 1VHSA 2ZW6A 2VBQA 4OC2A 4HNYB 1YX0A 4XPDB 2AE6A 3CPXA 4EWTA 4CGMA 5HVHA 3D2PA 4R87A 2GE3A 1LAMA 4PQAA 4X3RA 4YFJA 4Z65A 3NE8A 2ZEPA 2ZXVA 1YK3A 3B2YA 3KHXA 4MXUA 1B6BA 3V7ZA 4CAWA 2PJAA 3N5FA 3D3SA 2NSMA 3RZAA 3B35A 3LMSA 3PFOA 2IQ6A 1TXRA 4NGQA 4P45A 4AXVA 1WWZA 2B5GA 4C2ZA 2PJ3A 3DR8A 1Y9WA 3QAYA 2PIZA 4ONUA 4UCNA 2R98A 3R9GA 5KTAA 3LODA 2C27A 3DNSA 2VXKA 2GREA 4OC5A 2F8HA 4IK2A 5HVGA 2Q51A 3TOBA 2ABZA 2WZNA 5K8OA 1NE9A 2B4DA 3SI2A 5LRKA 2PJ1A 2RFHA 2ZELA 3K9UA 3PZJA 4OLLA 4B10A 4KUBA 1KUYA 3FIXA 1Q2YA 5J8CA 2ZW5A 1CP7A 2RC4A 3JUWA 4AVCA 2R7HA 1RXTA 5LRJA 5J1QA 2WPWA 4FD4A 4LX9A 2Z10A 4UIBA 1TKJA 4DJLA 4MY0A 3PB4X 4CYQA 2HV2A 4JLYA 3B3TA 2I3CA 3HLPA 4L89A 5AG4A 4NGSA 2V8HA 5HVFA 4ZI6A 4H6ZA 5CBMA 4A95A 3G3SA 1RO5A 2DF5A 3FYNA 3DGVA 4HKFA 4C68A 1JQGA 3WC5A 4F8ZA 2Z3PA 2OH1A 5IX3A 4R3KA 4KSFA 4Y49C 1BPMA 1SQHA 4MCQA 4PSWA 5AGEA 4CYNA 2CF4A 1Z8LA 3RNZA 2QVPA 2FVGA 2F7VA 3PB7X 4YRHA 4U5YA 4A32A 2CNTA 4A2ZA 3BI0A 4B6ZA 2BEIA 1CM0A 5IB0A 2BO9A 4GXHA 4NJRA 4IUSA 5LYFA 3SHPA 2WPXA 4QUSA 3ZZIA 4CGOA 1QMUA 1P4NA 4Q38A 3D68A 3W6XA 3GLJA 2GU2A 2JBKA 2AFZA 3QAHA 4NGRA 3KR4A 2FT0A 4DUKA 1ARMA 4KOSA 1R3NA 4R7MA 3T9YA 2BL1A 2R8VA 3FH4A 2PJ7A 3D7DA 4H6UA 4KLVA 3E0KA 2B3VA 5I0CA 5F46A 4X8IA 1KWMA 5IB9A 5KTDA 2ZW7A 3SJXA 2QYVA 4UEFA 2PR1A 5LRGA 3FECA 4QBJA 1XF8A 2FIAA 1LFWA 1M4DA 4MFPA 1MJAA 2O4HA 1BLLE 1I1DA 1ZLIA 4FAIA 2EK9A 2AFSA 2I79A 4BBHA 4BD9A 3CXPA 1QSRA 4C7HA 4K3NA 3S9LA 5CNPA 4A33A 4I49A 1YLEA 3IJ3A 4QB9A 5THWA 4ONWA 3UY5A 1J4JA 3SJEA 4B14A 2CTCA 1TKHA 8CPAA 3PP9A 4OC3A 1PU9A 3HUVA 3NFZA 4B13A 2VZZA 3BXMA 3CZXA 3GKRA 2G3AA 5LYIA 2ZEEA 4OAEA 2WUUA 4CRYB 2Q4ZA 3MRUA 5EMIA 2ODFA 4CAEA 4QVTA 2ZOGA 7CPAA 4UFVA 1ELMP 4MHDA 1IGBA 4XNHB 2ZEDA 3FVLA 3VATA 1YVKA 1YW6A 1R43A 4C7IA 3FBUA 5H84A 3PB6X 4PXBA 4RS2A 4OKOA 4NJQA 2PJ6A 4MI4A 3NH4A 2PJ5A 2Q0YA 2B4DB 2FE7A 4RI1A 4LQGA 2PVWA 3D4UA 5EC4A 3WC6A 4B12A 2OR4A 4X5KA 2CNMA 2OB0A 3WT4A 2O53A 3R9FA 3WR7A 4A94A 2QIRA 3ZJ0A 2C1CA 3FRMA 4CS0B 4DYOA 4B5PB 2K5TA 3PBBA
chains in the Genus database with same CATH topology
4JXRA 1Q2DA 2YNDA 1IICA 2REEA 3BJ7A 3R1KA 4JXQA 1Z9UA 2B5GB 4CAFA 2Z0ZA 1Q2CA 3H5ZA 4KVOE 3TTHA 5A28A 4UWIA 3QB8A 2YGWA 5KTCA 3C26A 3T90A 2FIWA 4PSXA 4AVAA 1GHEA 1S5KA 2D4PA 5IV0A 4MY3A 1S7NA 5G1ZA 3JTKA 4U9YA 4KVME 4AG7A 4R3LA 1IYLA 2Q44A 4KOXA 1CJWA 1KZFA 4EVYA 4PK3A 1YR0A 2ATRA 2ZPAA 2ARHA 2Q4VA 1PUAA 2PC1A 2OU2A 1S7LA 4AVBA 2Z11A 4ZGYB 1LRZA 1I12A 2O28A 4PV6A 2I00A 4MBUA 4MFJA 4R9MA 2J8NA 2G0BA 1WK4A 4JJXA 3B8GA 1UFHA 1YGHA 1KUVA 2P6FA 2VEZA 3IGRA 4E0AA 3W91A 2PRBA 3S6FA 4KS9A 1S60A 1QSMA 4A30A 2Z3OA 1ZO0A 1QSNA 5JQ4A 4Q36A 3TE4A 2J8MA 3BJ8A 2AJ6A 3FNCA 4KOUA 4NF1A 3OWCA 4DNCA 4ZBGA 1VKCA 5DWNA 1YVOA 1TIQA 3F0AA 4BMHA 3CXQA 2HUZA 2CNSA 4CAVA 1NMTA 1Y9KA 2WSAA 4II9A 1V0CA 1Y7RA 2B58A 2GIVA 2FL4A 4E2AA 2G3TA 2PDOA 4KLWA 5HH1A 2JDCA 5BWAB 5AG7A 3FB3A 4NEXA 3VWDA 2Y0MA 3TO6A 4U9ZA 4B5PA 4CGNA 1I21A 3TT2A 4R57A 3IU2A 2PQ8A 4XPDC 2JEVA 4Y49B 1P0HA 4C2YA 1ON0A 3EO4A 3R9EA 3TOAA 3TO9A 2OZGA 2P0WA 1XE4A 4PK2A 3CXSA 3PGPA 1XIXA 3FXTA 4JWPA 3TCVA 4UWJA 1OZPA 4YGOA 2DXQA 1IIDA 5C88A 2Z3NA 4HNXB 2Z3LA 2FSRA 4GS4A 4CGPA 3VWEA 5F49A 1M44A 5EBVA 4C2XA 3GY9A 2X7BA 2B4BA 1K4JA 3N7ZA 4KOVA 1S3ZA 3I3GA 4QC6A 1Z4RA 4CYOA 1L0CA 2BSWA 2Z3KA 2QMLA 1FY7A 2NMTA 4CRZB 1IYKA 4K30A 3I9SA 2VQYA 4UFXA 5AG5A 3SXNA 1M1DA 4NSQA 2D4OA 3S6HA 1MJ9A 1M4GA 3A9LA 4KORA 4E8OA 2FXFA 2DPTA 2Q04A 4CGLA 4NXYA 2GANA 4J3GA 3S6KA 3EY5A 2Q4YA 4F0XA 4F6AA 3EXNA 1R57A 2YNCC 5JPHA 5F47A 4MFQA 4IF5A 3P2HA 3P2FA 4M85A 1S7KA 5DWMA 1M4IA 2HQYA 4UCMA 3V8IA 4AG9A 4FD5A 4ORFA 1N71A 3G8WA 5J8FA 2Z3MA 3LD2A 4UA3A 1BOBA 1XMTA 5A27A 3DSBA 1NSLA 2YNCA 3F5BA 4MFLA 4B5OA 1QSOA 4OADA 5HMNA 2KCWA 1B87A 5E96A 5GCNA 3IWEA 2A4NA 4XPLA 4UCPA 2JLMA 2OZHA 3R95A 3RYOA 4LUAA 3SXOA 3JVNA 5FVJA 2PR8A 4UBRA 1KUXA 4KZTA 5C82A 2EUIA 4KUAA 4KOYA 2CXAA 1MJBA 2FS5A 2JDDA 2Q7BA 4HNWB 4UFWA 4AB7A 3DR6A 3R96A 4KOWA 1IB1E 2PSWA 1Z4EA 4FD6A 3GYAA 2J8RA 3D8PA 4CAXA 2F5IA 4NCZA 3TFYA 2P6EA 5AG6A 2DPSA 4F0YA 1XEBA 3IWGA 1MK4A 2YNEA 1QSTA 3BLNA 3MGDA 1S7FA 2FCKA 2R1IA 3H4QA 3W6SA 4B11A 2VI7A 2IL4A 4L8AA 4CYPA 4KVXA 3EC4A 2OZUA 2B3UA 2H5MA 5G20A 1YREA 2BUEA 5G21A 4XNHC 2VZYA 4KSAA 2EVNA 2P6GA 5G22A 3KKWA 3EFAA 4H89A 4MFZA 4XPKA 3NE7A 2ZW4A 3F8KA 5H86A 2CY2A 4FD7A 4JD6A 4MFKA 3IU1A 5F48A 3S6GA 3D2MA 3DDDA 1BO4A 3TO7A 1U6MA 4KOTA 2QECA 4M3SA 2REFA 5ISVA 4A31A 4MJ8A 1VHSA 2ZW6A 2VBQA 4XPDB 4HNYB 1YX0A 2AE6A 4CGMA 3D2PA 4R87A 2GE3A 4YFJA 2ZXVA 1YK3A 1B6BA 4CAWA 3D3SA 1WWZA 2B5GA 4C2ZA 3DR8A 1Y9WA 4ONUA 4UCNA 2R98A 3R9GA 5KTAA 3LODA 2C27A 3DNSA 2VXKA 3TOBA 1NE9A 2B4DA 3K9UA 4OLLA 3PZJA 4B10A 4KUBA 1KUYA 3FIXA 1Q2YA 5J8CA 2ZW5A 2RC4A 3JUWA 4AVCA 2R7HA 1RXTA 2WPWA 4FD4A 4LX9A 2Z10A 4MY0A 4CYQA 2HV2A 4JLYA 4L89A 5AG4A 4H6ZA 4A95A 3G3SA 1RO5A 3FYNA 4HKFA 4C68A 2Z3PA 2OH1A 5IX3A 4R3KA 4KSFA 4Y49C 1SQHA 4PSWA 5AGEA 4CYNA 4YRHA 4A32A 4U5YA 4A2ZA 2CNTA 2BEIA 1CM0A 5IB0A 4IUSA 3SHPA 2WPXA 4QUSA 3ZZIA 4CGOA 1P4NA 4Q38A 3W6XA 3QAHA 2FT0A 4KOSA 3T9YA 2BL1A 2R8VA 4H6UA 4KLVA 3E0KA 2B3VA 5I0CA 5F46A 5KTDA 2ZW7A 2PR1A 4QBJA 1XF8A 2FIAA 1M4DA 4MFPA 1MJAA 1I1DA 2I79A 4BBHA 4C7HA 3CXPA 1QSRA 5CNPA 4A33A 4I49A 1YLEA 4QB9A 3UY5A 1J4JA 4B14A 3PP9A 1PU9A 4B13A 2VZZA 3GKRA 2G3AA 4OAEA 2WUUA 4CRYB 4CAEA 4QVTA 4UFVA 4MHDA 4XNHB 1YVKA 4C7IA 3FBUA 5H84A 4RS2A 4MI4A 2Q0YA 2B4DB 2FE7A 4RI1A 4B12A 5EC4A 4X5KA 2CNMA 2OB0A 3R9FA 3WR7A 2QIRA 3ZJ0A 3FRMA 4CS0B 4B5PB 2K5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JXR A;  1Q2D A;  1IIC A;  2REE A;  3BJ7 A;  3R1K A;  4JXQ A;  1Z9U A;  2B5G B;  2Z0Z A;  1Q2C A;  4KVO E;  3TTH A;  4UWI A;  3QB8 A;  5KTC A;  3C26 A;  3T90 A;  2FIW A;  4PSX A;  4AVA A;  1GHE A;  1S5K A;  2D4P A;  5IV0 A;  4MY3 A;  1S7N A;  4U9Y A;  4KVM E;  4AG7 A;  4R3L A;  1IYL A;  2Q44 A;  4KOX A;  1CJW A;  1KZF A;  4EVY A;  4PK3 A;  1YR0 A;  2ATR A;  2ZPA A;  2ARH A;  2Q4V A;  1PUA A;  2PC1 A;  2OU2 A;  1S7L A;  4AVB A;  2Z11 A;  1LRZ A;  1I12 A;  2O28 A;  4PV6 A;  2I00 A;  4MBU A;  4R9M A;  2J8N A;  2G0B A;  1WK4 A;  4JJX A;  3B8G A;  1UFH A;  1YGH A;  1KUV A;  2P6F A;  2VEZ A;  3IGR A;  4E0A A;  3W91 A;  2PRB A;  3S6F A;  1S60 A;  1QSM A;  1QSN A;  5JQ4 A;  3TE4 A;  2J8M A;  3BJ8 A;  2AJ6 A;  3FNC A;  4KOU A;  4NF1 A;  3OWC A;  4DNC A;  4ZBG A;  1VKC A;  5DWN A;  1YVO A;  1TIQ A;  3F0A A;  4BMH A;  3CXQ A;  2HUZ A;  2CNS A;  4CAV A;  1NMT A;  1Y9K A;  4II9 A;  1V0C A;  1Y7R A;  2B58 A;  2GIV A;  2FL4 A;  4E2A A;  2G3T A;  2PDO A;  4KLW A;  5HH1 A;  2JDC A;  3FB3 A;  4NEX A;  3VWD A;  2Y0M A;  3TO6 A;  4U9Z A;  4B5P A;  1I21 A;  3TT2 A;  4R57 A;  2PQ8 A;  4XPD C;  2JEV A;  4Y49 B;  1P0H A;  1ON0 A;  3EO4 A;  3R9E A;  3TOA A;  3TO9 A;  2OZG A;  2P0W A;  1XE4 A;  4PK2 A;  3CXS A;  3PGP A;  1XIX A;  3FXT A;  4JWP A;  3TCV A;  4UWJ A;  1OZP A;  4YGO A;  2DXQ A;  1IID A;  5C88 A;  4HNX B;  2FSR A;  4GS4 A;  3VWE A;  5F49 A;  1M44 A;  5EBV A;  3GY9 A;  2X7B A;  2B4B A;  1K4J A;  3N7Z A;  4KOV A;  1S3Z A;  3I3G A;  4QC6 A;  1Z4R A;  1L0C A;  2BSW A;  2QML A;  1FY7 A;  2NMT A;  4CRZ B;  1IYK A;  4K30 A;  3I9S A;  2VQY A;  3SXN A;  1M1D A;  4NSQ A;  2D4O A;  3S6H A;  1MJ9 A;  1M4G A;  4KOR A;  4E8O A;  2FXF A;  2Q04 A;  4NXY A;  2GAN A;  4J3G A;  3S6K A;  3EY5 A;  2Q4Y A;  4F6A A;  3EXN A;  1R57 A;  5JPH A;  5F47 A;  4IF5 A;  3P2H A;  3P2F A;  4M85 A;  1S7K A;  5DWM A;  1M4I A;  2HQY A;  3V8I A;  4AG9 A;  4FD5 A;  4ORF A;  1N71 A;  3G8W A;  5J8F A;  3LD2 A;  4UA3 A;  1BOB A;  1XMT A;  3DSB A;  1NSL A;  3F5B A;  4B5O A;  1QSO A;  4OAD A;  5HMN A;  2KCW A;  1B87 A;  5E96 A;  5GCN A;  2A4N A;  4XPL A;  2JLM A;  2OZH A;  3R95 A;  3RYO A;  4LUA A;  3SXO A;  3JVN A;  5FVJ A;  2PR8 A;  4UBR A;  1KUX A;  4KZT A;  5C82 A;  2EUI A;  4KUA A;  4KOY A;  1MJB A;  2FS5 A;  2JDD A;  2Q7B A;  4HNW B;  4AB7 A;  3DR6 A;  3R96 A;  4KOW A;  1IB1 E;  2PSW A;  1Z4E A;  4FD6 A;  3GYA A;  2J8R A;  3D8P A;  4CAX A;  2F5I A;  4NCZ A;  3TFY A;  2P6E A;  4F0Y A;  1XEB A;  3IWG A;  1MK4 A;  1QST A;  3BLN A;  3MGD A;  1S7F A;  2FCK A;  2R1I A;  3H4Q A;  3W6S A;  2VI7 A;  2IL4 A;  4L8A A;  4KVX A;  3EC4 A;  2OZU A;  2B3U A;  2H5M A;  1YRE A;  2BUE A;  4XNH C;  2VZY A;  2EVN A;  2P6G A;  3KKW A;  3EFA A;  4H89 A;  4XPK A;  3NE7 A;  2ZW4 A;  3F8K A;  5H86 A;  2CY2 A;  4FD7 A;  4JD6 A;  5F48 A;  3S6G A;  3D2M A;  3DDD A;  1BO4 A;  3TO7 A;  1U6M A;  4KOT A;  2QEC A;  4M3S A;  2REF A;  5ISV A;  4MJ8 A;  1VHS A;  2ZW6 A;  2VBQ A;  4XPD B;  4HNY B;  1YX0 A;  2AE6 A;  3D2P A;  4R87 A;  2GE3 A;  4YFJ A;  2ZXV A;  1YK3 A;  1B6B A;  4CAW A;  3D3S A;  1WWZ A;  2B5G A;  3DR8 A;  1Y9W A;  4ONU A;  2R98 A;  3R9G A;  5KTA A;  3LOD A;  2C27 A;  3DNS A;  2VXK A;  3TOB A;  1NE9 A;  2B4D A;  3K9U A;  4OLL A;  3PZJ A;  4KUB A;  1KUY A;  3FIX A;  1Q2Y A;  5J8C A;  2ZW5 A;  2RC4 A;  3JUW A;  4AVC A;  2R7H A;  1RXT A;  2WPW A;  4FD4 A;  4LX9 A;  2Z10 A;  4MY0 A;  2HV2 A;  4JLY A;  4L89 A;  4H6Z A;  3G3S A;  1RO5 A;  3FYN A;  4HKF A;  2OH1 A;  5IX3 A;  4R3K A;  4Y49 C;  1SQH A;  4PSW A;  4YRH A;  4U5Y A;  2CNT A;  2BEI A;  1CM0 A;  5IB0 A;  4IUS A;  3SHP A;  2WPX A;  4QUS A;  3ZZI A;  1P4N A;  3W6X A;  3QAH A;  2FT0 A;  4KOS A;  3T9Y A;  2BL1 A;  2R8V A;  4H6U A;  4KLV A;  3E0K A;  2B3V A;  5I0C A;  5F46 A;  5KTD A;  2ZW7 A;  2PR1 A;  4QBJ A;  1XF8 A;  2FIA A;  1M4D A;  1MJA A;  1I1D A;  2I79 A;  3CXP A;  1QSR A;  5CNP A;  4I49 A;  1YLE A;  4QB9 A;  3UY5 A;  1J4J A;  3PP9 A;  1PU9 A;  2VZZ A;  3GKR A;  2G3A A;  4OAE A;  4CRY B;  4QVT A;  4MHD A;  4XNH B;  1YVK A;  3FBU A;  5H84 A;  4RS2 A;  4MI4 A;  4RI1 A;  2Q0Y A;  2B4D B;  2FE7 A;  5EC4 A;  4X5K A;  2CNM A;  2OB0 A;  3R9F A;  3WR7 A;  2QIR A;  3ZJ0 A;  3FRM A;  4CS0 B;  4B5P B;  2K5T A; 
#chains in the Genus database with same CATH topology
 4JXR A;  1Q2D A;  2YND A;  1IIC A;  1FNO A;  2REE A;  3BJ7 A;  1F57 A;  3R1K A;  4JXQ A;  2PCU A;  1Z9U A;  4PXE A;  2B5G B;  4CAF A;  2Z0Z A;  1VHE A;  1XJO A;  1Q2C A;  3H5Z A;  1YSJ A;  4KVO E;  3KZW A;  3TTH A;  5A28 A;  4UWI A;  3QB8 A;  2YGW A;  5KTC A;  3FF3 A;  3C26 A;  3T90 A;  3DLJ A;  2FIW A;  4A38 A;  4PSX A;  4RN7 A;  1GHE A;  4AVA A;  1S5K A;  2D4P A;  5IV0 A;  1F2O A;  4MY3 A;  1S7N A;  1XRY A;  5G1Z A;  4MCR A;  5D29 A;  1Z8W A;  3JTK A;  3NH5 A;  4U9Y A;  4KVM E;  4AG7 A;  4R3L A;  1IYL A;  2PJ8 A;  2Q44 A;  4KOX A;  4ZY2 A;  1CJW A;  3TC8 A;  1KZF A;  4EVY A;  4JZ0 A;  4PK3 A;  1YR0 A;  2AFO A;  2ATR A;  2C6P A;  2ZPA A;  2ARH A;  2Q4V A;  3KQX A;  1TF9 A;  1PUA A;  2PC1 A;  3NA6 A;  4IHM A;  2OU2 A;  1S7L A;  2VL1 A;  4AVB A;  4UIA A;  2Z11 A;  3LWU A;  1LRZ A;  4ZGY B;  1I12 A;  2O28 A;  3JRU A;  4PV6 A;  1CG2 A;  3B7I A;  2I00 A;  4MBU A;  5K8N A;  1NSA A;  4MFJ A;  2IMO A;  4R9M A;  2J8N A;  2G0B A;  1WK4 A;  2IJZ A;  3FMC A;  3PRT A;  4BIN A;  4JJX A;  3B8G A;  1UFH A;  1YGH A;  2EK8 A;  1KUV A;  2P6F A;  1ARL A;  2VEZ A;  2PRQ A;  3IGR A;  3W91 A;  4E0A A;  5JGF A;  2PRB A;  3S6F A;  2QJ8 A;  4KS9 A;  3B3V A;  3H8F A;  3H8E A;  1CP6 A;  1Z2L A;  1S60 A;  1QSM A;  4FBE A;  5K8P A;  4A30 A;  2ZEO A;  2Z3O A;  1ZO0 A;  1QSN A;  4MHP A;  3K2K A;  5JQ4 A;  1HDU A;  4Q36 A;  4OIW A;  3KQZ A;  3TE4 A;  1XOV A;  2CTB A;  2EBJ A;  3KGQ A;  2J8M A;  3S9M A;  3LAC A;  3BJ8 A;  2AJ6 A;  3FNC A;  4KOU A;  2GLF A;  5JM6 A;  4NF1 A;  3OWC A;  4PXC A;  4DNC A;  4ZBG A;  1VKC A;  4ZX8 A;  5DWN A;  4P4D A;  3PB8 X;  1YVO A;  1VGY A;  1TIQ A;  4NGM A;  4CPA A;  3F0A A;  4BMH A;  3CXQ A;  2HC9 A;  2PJ0 A;  2HUZ A;  3RO0 A;  2CNS A;  3SI0 A;  4CAV A;  1NMT A;  1Y9K A;  2WSA A;  3D7F A;  4II9 A;  2AFW A;  4OP4 A;  3L2N A;  1V0C A;  1Y7R A;  2B58 A;  2GIV A;  2FL4 A;  4P44 A;  4E2A A;  3ISX A;  2G3T A;  2PDO A;  3VAR A;  5K8M A;  4KLW A;  4A37 A;  5HH1 A;  4NGP A;  1YQE A;  2JDC A;  2AFX A;  2PJ2 A;  5AG7 A;  3FB3 A;  3KI9 A;  5BWA B;  4NEX A;  3VWD A;  2Y0M A;  3TO6 A;  4U9Z A;  1CPS A;  4B5P A;  4CGN A;  1I21 A;  3BI1 A;  4R57 A;  3TT2 A;  2NYQ A;  1XBU A;  2V8D A;  1EE3 P;  4YU9 A;  3IU2 A;  2PQ8 A;  2POK A;  1Z5R A;  2JEV A;  4XPD C;  1TF8 A;  2ZEN A;  1BAV A;  4GM5 A;  2CIJ A;  1P0H A;  4OID A;  4Y49 B;  1ON0 A;  4C2Y A;  1OBR A;  3EO4 A;  4M6H A;  3R9E A;  3TOA A;  3TO9 A;  4EFD A;  3BHX A;  2OZG A;  2ZEG A;  2V77 A;  2P0W A;  1XE4 A;  4MHY A;  4PK2 A;  2PJC A;  3CXS A;  1IY7 A;  1XIX A;  3FXT A;  3PGP A;  4P4J A;  4JWP A;  4UF4 A;  3TCV A;  3PB9 X;  4UWJ A;  1M4L A;  1OZP A;  1PCA A;  2HB6 A;  1PYT B;  2Q7S A;  3K9T A;  4YGO A;  2DXQ A;  1IID A;  5C88 A;  2Z3N A;  4HNX B;  2Z3L A;  4MCS A;  2FSR A;  2JBJ A;  4M6I A;  2C6C A;  4GS4 A;  1IU8 A;  4CGP A;  3VWE A;  1QQ9 A;  4P4I A;  5F49 A;  1M44 A;  4R8F A;  5EBV A;  3SJF A;  4C2X A;  2OOT A;  3GY9 A;  4P6Y A;  2X7B A;  4RUH A;  2B4B A;  1K4J A;  3N7Z A;  4KOV A;  1S3Z A;  3KHZ A;  3I3G A;  4QC6 A;  1Z4R A;  3FX6 A;  4CYO A;  2GFQ A;  1X10 A;  1L0C A;  2BSW A;  3GUX A;  2Z3K A;  1VHO A;  2QML A;  6CPA A;  1FY7 A;  5F09 A;  2NMT A;  4NFR A;  4CRZ B;  1IYK A;  4K30 A;  4HPS A;  4Q7A A;  3I9S A;  3V38 A;  5HXD A;  2VQY A;  1F2P A;  1Z8T A;  3T8W A;  1Q7L A;  4UFX A;  4NGN A;  5AG5 A;  3SXN A;  1M1D A;  1VIX A;  2EWB A;  4R6T A;  4NSQ A;  2D4O A;  3S6H A;  1CBX A;  1MJ9 A;  1M4G A;  3A9L A;  2DEA A;  4KOR A;  4E8O A;  4ZY0 A;  2FXF A;  2DPT A;  2Q04 A;  1LCP A;  4MMO A;  4CGL A;  4F9V A;  4MCP A;  2Q43 A;  4NXY A;  3FED A;  4X2T A;  3PFE A;  1AYE A;  1IOF A;  2GAN A;  4J3G A;  3S6K A;  3B3S A;  3MN8 A;  3EY5 A;  2Q4Y A;  4F0X A;  3IO1 A;  4F9U A;  1AUG A;  3TX8 A;  4EME A;  2AFU A;  4F6A A;  3EXN A;  2V8V A;  4MRI A;  1R57 A;  5JH9 A;  2YNC C;  5JPH A;  1H8L A;  3S9N A;  4P10 A;  5F47 A;  4MFQ A;  2BOA A;  1LAP A;  2ZOF A;  4IF5 A;  3P2H A;  2XEI A;  3P2F A;  4M85 A;  1S7K A;  3D66 A;  4FUU A;  3RAM A;  4P4F A;  1HDQ A;  1IOI A;  4NGT A;  1YLO A;  4OC1 A;  5DWM A;  4KSI A;  1M4I A;  2HQY A;  4UCM A;  3V8I A;  4AG9 A;  2GLJ A;  1YW4 A;  4FD5 A;  4ORF A;  1N71 A;  1AMP A;  4OC4 A;  3G8W A;  5J8F A;  2Z3M A;  4PXD A;  1CX8 A;  3LD2 A;  2PIY A;  1BOB A;  4UA3 A;  1XMT A;  5A27 A;  3DSB A;  4H2K A;  1NSL A;  2YNC A;  3F5B A;  4MHZ A;  4MFL A;  3IEH A;  1Z8X A;  3KAS A;  1A2Z A;  3IWW A;  4OME A;  3D7H A;  1QSO A;  4B5O A;  4OC0 A;  1HEE A;  4OAD A;  5ELY A;  5HMN A;  3WC7 A;  1XFO A;  2KCW A;  2V8G A;  1B87 A;  5E96 A;  5GCN A;  4TNU A;  1RTQ A;  2A4N A;  3IWE A;  4WJB A;  3IFE A;  4XPL A;  4UEZ A;  4UCP A;  2JLM A;  1X12 A;  1GYT A;  2OZH A;  4R76 A;  3R95 A;  3RYO A;  4YWY A;  4LUA A;  3NH8 A;  4P4E A;  2WYR A;  3JVN A;  3SXO A;  5FVJ A;  2BCO A;  2XEG A;  2PR8 A;  4P4B A;  3PEI A;  3KL9 A;  4UBR A;  1KUX A;  4KZT A;  5C82 A;  2EUI A;  4KUA A;  5DS0 A;  4KOY A;  2CXA A;  3B3C A;  1MJB A;  2FS5 A;  2JDD A;  3CDX A;  4MHN A;  1Y0R A;  2Q7B A;  1Y0Y A;  4HNW B;  1ZG9 A;  4UFW A;  4G1P A;  3RBU A;  2ZEH A;  4AB7 A;  3DR6 A;  3IIB A;  3R96 A;  4KOW A;  2PSW A;  1IB1 E;  1UWY A;  1YME A;  1Z4E A;  2XEF A;  3B3W A;  4IAV A;  4FD6 A;  1Y7E A;  3PBE A;  4ZYQ A;  3GYA A;  2JEW A;  2J8R A;  3D8P A;  4CAX A;  2PJB A;  1XMB A;  2F5I A;  4NCZ A;  2P6E A;  3TFY A;  5LYL A;  2PJ9 A;  2ZEM A;  2DPS A;  5AG6 A;  4F0Y A;  1XEB A;  3IWG A;  1MK4 A;  2YNE A;  1QST A;  2AFM A;  5D8N A;  4ZY1 A;  3CPA A;  1TKF A;  1DE4 C;  3BLN A;  3H8G A;  3MGD A;  2PE3 A;  3D67 A;  1S7F A;  2FCK A;  2R1I A;  3I1U A;  3SJG A;  3H4Q A;  2PVV A;  5CPA A;  3W6S A;  4B11 A;  2VI7 A;  3FEE A;  2IL4 A;  4L8A A;  3WAB A;  4CYP A;  4KVX A;  3EC4 A;  3ISZ A;  4W9Y A;  4LQ6 A;  2OZU A;  2B3U A;  1LOK A;  2H5M A;  5G20 A;  1YRE A;  2BUE A;  2XEJ A;  5G21 A;  4XNH C;  2G9D A;  2VZY A;  3KR5 A;  5I4M A;  4KSA A;  2EVN A;  4UEE A;  4JYW A;  2P6G A;  5G22 A;  3KKW A;  3EFA A;  2J9A A;  1ZLH A;  4H89 A;  4MFZ A;  4PPZ A;  4XPK A;  3NE7 A;  3IC1 A;  1DTD A;  2ZW4 A;  1BPN A;  2C6G A;  2ZEF A;  2RB7 A;  3F8K A;  5H86 A;  1JWQ A;  2CY2 A;  3GIU A;  2PJ4 A;  4FD7 A;  1ZG8 A;  4JD6 A;  4MFK A;  3IU1 A;  5F48 A;  1ZG7 A;  3S6G A;  4O23 A;  3D2M A;  5LYD A;  3VH9 A;  3DDD A;  4ZX9 A;  3CT9 A;  3SI1 A;  3FJU A;  1BO4 A;  3TO7 A;  1U6M A;  4KOT A;  1CPX A;  4FWU A;  1ELL P;  3GB0 A;  1FT7 A;  2QEC A;  4M3S A;  2REF A;  1LAN A;  4M6G A;  3D7G A;  4A31 A;  5ISV A;  4TWE A;  2ANP A;  4A39 A;  4WWV A;  4MJ8 A;  3QNV A;  2EO8 A;  1VHS A;  2ZW6 A;  2VBQ A;  4OC2 A;  4HNY B;  1YX0 A;  4XPD B;  2AE6 A;  3CPX A;  4EWT A;  4CGM A;  5HVH A;  3D2P A;  4R87 A;  2GE3 A;  1LAM A;  4PQA A;  4X3R A;  4YFJ A;  4Z65 A;  3NE8 A;  2ZEP A;  2ZXV A;  1YK3 A;  3B2Y A;  3KHX A;  4MXU A;  1B6B A;  3V7Z A;  4CAW A;  2PJA A;  3N5F A;  3D3S A;  2NSM A;  3RZA A;  3B35 A;  3LMS A;  3PFO A;  2IQ6 A;  1TXR A;  4NGQ A;  4P45 A;  4AXV A;  1WWZ A;  2B5G A;  4C2Z A;  2PJ3 A;  3DR8 A;  1Y9W A;  3QAY A;  2PIZ A;  4ONU A;  4UCN A;  2R98 A;  3R9G A;  5KTA A;  3LOD A;  2C27 A;  3DNS A;  2VXK A;  2GRE A;  4OC5 A;  2F8H A;  4IK2 A;  5HVG A;  2Q51 A;  3TOB A;  2ABZ A;  2WZN A;  5K8O A;  1NE9 A;  2B4D A;  3SI2 A;  5LRK A;  2PJ1 A;  2RFH A;  2ZEL A;  3K9U A;  3PZJ A;  4OLL A;  4B10 A;  4KUB A;  1KUY A;  3FIX A;  1Q2Y A;  5J8C A;  2ZW5 A;  1CP7 A;  2RC4 A;  3JUW A;  4AVC A;  2R7H A;  1RXT A;  5LRJ A;  5J1Q A;  2WPW A;  4FD4 A;  4LX9 A;  2Z10 A;  4UIB A;  1TKJ A;  4DJL A;  4MY0 A;  3PB4 X;  4CYQ A;  2HV2 A;  4JLY A;  3B3T A;  2I3C A;  3HLP A;  4L89 A;  5AG4 A;  4NGS A;  2V8H A;  5HVF A;  4ZI6 A;  4H6Z A;  5CBM A;  4A95 A;  3G3S A;  1RO5 A;  2DF5 A;  3FYN A;  3DGV A;  4HKF A;  4C68 A;  1JQG A;  3WC5 A;  4F8Z A;  2Z3P A;  2OH1 A;  5IX3 A;  4R3K A;  4KSF A;  4Y49 C;  1BPM A;  1SQH A;  4MCQ A;  4PSW A;  5AGE A;  4CYN A;  2CF4 A;  1Z8L A;  3RNZ A;  2QVP A;  2FVG A;  2F7V A;  3PB7 X;  4YRH A;  4U5Y A;  4A32 A;  2CNT A;  4A2Z A;  3BI0 A;  4B6Z A;  2BEI A;  1CM0 A;  5IB0 A;  2BO9 A;  4GXH A;  4NJR A;  4IUS A;  5LYF A;  3SHP A;  2WPX A;  4QUS A;  3ZZI A;  4CGO A;  1QMU A;  1P4N A;  4Q38 A;  3D68 A;  3W6X A;  3GLJ A;  2GU2 A;  2JBK A;  2AFZ A;  3QAH A;  4NGR A;  3KR4 A;  2FT0 A;  4DUK A;  1ARM A;  4KOS A;  1R3N A;  4R7M A;  3T9Y A;  2BL1 A;  2R8V A;  3FH4 A;  2PJ7 A;  3D7D A;  4H6U A;  4KLV A;  3E0K A;  2B3V A;  5I0C A;  5F46 A;  4X8I A;  1KWM A;  5IB9 A;  5KTD A;  2ZW7 A;  3SJX A;  2QYV A;  4UEF A;  2PR1 A;  5LRG A;  3FEC A;  4QBJ A;  1XF8 A;  2FIA A;  1LFW A;  1M4D A;  4MFP A;  1MJA A;  2O4H A;  1BLL E;  1I1D A;  1ZLI A;  4FAI A;  2EK9 A;  2AFS A;  2I79 A;  4BBH A;  4BD9 A;  3CXP A;  1QSR A;  4C7H A;  4K3N A;  3S9L A;  5CNP A;  4A33 A;  4I49 A;  1YLE A;  3IJ3 A;  4QB9 A;  5THW A;  4ONW A;  3UY5 A;  1J4J A;  3SJE A;  4B14 A;  2CTC A;  1TKH A;  8CPA A;  3PP9 A;  4OC3 A;  1PU9 A;  3HUV A;  3NFZ A;  4B13 A;  2VZZ A;  3BXM A;  3CZX A;  3GKR A;  2G3A A;  5LYI A;  2ZEE A;  4OAE A;  2WUU A;  4CRY B;  2Q4Z A;  3MRU A;  5EMI A;  2ODF A;  4CAE A;  4QVT A;  2ZOG A;  7CPA A;  4UFV A;  1ELM P;  4MHD A;  1IGB A;  4XNH B;  2ZED A;  3FVL A;  3VAT A;  1YVK A;  1YW6 A;  1R43 A;  4C7I A;  3FBU A;  5H84 A;  3PB6 X;  4PXB A;  4RS2 A;  4OKO A;  4NJQ A;  2PJ6 A;  4MI4 A;  3NH4 A;  2PJ5 A;  2Q0Y A;  2B4D B;  2FE7 A;  4RI1 A;  4LQG A;  2PVW A;  3D4U A;  5EC4 A;  3WC6 A;  4B12 A;  2OR4 A;  4X5K A;  2CNM A;  2OB0 A;  3WT4 A;  2O53 A;  3R9F A;  3WR7 A;  4A94 A;  2QIR A;  3ZJ0 A;  2C1C A;  3FRM A;  4CS0 B;  4DYO A;  4B5P B;  2K5T A;  3PBB A; 
#chains in the Genus database with same CATH homology
 4JXR A;  1Q2D A;  2YND A;  1IIC A;  2REE A;  3BJ7 A;  3R1K A;  4JXQ A;  1Z9U A;  2B5G B;  4CAF A;  2Z0Z A;  1Q2C A;  3H5Z A;  4KVO E;  3TTH A;  5A28 A;  4UWI A;  3QB8 A;  2YGW A;  5KTC A;  3C26 A;  3T90 A;  2FIW A;  4PSX A;  4AVA A;  1GHE A;  1S5K A;  2D4P A;  5IV0 A;  4MY3 A;  1S7N A;  5G1Z A;  3JTK A;  4U9Y A;  4KVM E;  4AG7 A;  4R3L A;  1IYL A;  2Q44 A;  4KOX A;  1CJW A;  1KZF A;  4EVY A;  4PK3 A;  1YR0 A;  2ATR A;  2ZPA A;  2ARH A;  2Q4V A;  1PUA A;  2PC1 A;  2OU2 A;  1S7L A;  4AVB A;  2Z11 A;  4ZGY B;  1LRZ A;  1I12 A;  2O28 A;  4PV6 A;  2I00 A;  4MBU A;  4MFJ A;  4R9M A;  2J8N A;  2G0B A;  1WK4 A;  4JJX A;  3B8G A;  1UFH A;  1YGH A;  1KUV A;  2P6F A;  2VEZ A;  3IGR A;  4E0A A;  3W91 A;  2PRB A;  3S6F A;  4KS9 A;  1S60 A;  1QSM A;  4A30 A;  2Z3O A;  1ZO0 A;  1QSN A;  5JQ4 A;  4Q36 A;  3TE4 A;  2J8M A;  3BJ8 A;  2AJ6 A;  3FNC A;  4KOU A;  4NF1 A;  3OWC A;  4DNC A;  4ZBG A;  1VKC A;  5DWN A;  1YVO A;  1TIQ A;  3F0A A;  4BMH A;  3CXQ A;  2HUZ A;  2CNS A;  4CAV A;  1NMT A;  1Y9K A;  2WSA A;  4II9 A;  1V0C A;  1Y7R A;  2B58 A;  2GIV A;  2FL4 A;  4E2A A;  2G3T A;  2PDO A;  4KLW A;  5HH1 A;  2JDC A;  5BWA B;  5AG7 A;  3FB3 A;  4NEX A;  3VWD A;  2Y0M A;  3TO6 A;  4U9Z A;  4B5P A;  4CGN A;  1I21 A;  3TT2 A;  4R57 A;  3IU2 A;  2PQ8 A;  4XPD C;  2JEV A;  4Y49 B;  1P0H A;  4C2Y A;  1ON0 A;  3EO4 A;  3R9E A;  3TOA A;  3TO9 A;  2OZG A;  2P0W A;  1XE4 A;  4PK2 A;  3CXS A;  3PGP A;  1XIX A;  3FXT A;  4JWP A;  3TCV A;  4UWJ A;  1OZP A;  4YGO A;  2DXQ A;  1IID A;  5C88 A;  2Z3N A;  4HNX B;  2Z3L A;  2FSR A;  4GS4 A;  4CGP A;  3VWE A;  5F49 A;  1M44 A;  5EBV A;  4C2X A;  3GY9 A;  2X7B A;  2B4B A;  1K4J A;  3N7Z A;  4KOV A;  1S3Z A;  3I3G A;  4QC6 A;  1Z4R A;  4CYO A;  1L0C A;  2BSW A;  2Z3K A;  2QML A;  1FY7 A;  2NMT A;  4CRZ B;  1IYK A;  4K30 A;  3I9S A;  2VQY A;  4UFX A;  5AG5 A;  3SXN A;  1M1D A;  4NSQ A;  2D4O A;  3S6H A;  1MJ9 A;  1M4G A;  3A9L A;  4KOR A;  4E8O A;  2FXF A;  2DPT A;  2Q04 A;  4CGL A;  4NXY A;  2GAN A;  4J3G A;  3S6K A;  3EY5 A;  2Q4Y A;  4F0X A;  4F6A A;  3EXN A;  1R57 A;  2YNC C;  5JPH A;  5F47 A;  4MFQ A;  4IF5 A;  3P2H A;  3P2F A;  4M85 A;  1S7K A;  5DWM A;  1M4I A;  2HQY A;  4UCM A;  3V8I A;  4AG9 A;  4FD5 A;  4ORF A;  1N71 A;  3G8W A;  5J8F A;  2Z3M A;  3LD2 A;  4UA3 A;  1BOB A;  1XMT A;  5A27 A;  3DSB A;  1NSL A;  2YNC A;  3F5B A;  4MFL A;  4B5O A;  1QSO A;  4OAD A;  5HMN A;  2KCW A;  1B87 A;  5E96 A;  5GCN A;  3IWE A;  2A4N A;  4XPL A;  4UCP A;  2JLM A;  2OZH A;  3R95 A;  3RYO A;  4LUA A;  3SXO A;  3JVN A;  5FVJ A;  2PR8 A;  4UBR A;  1KUX A;  4KZT A;  5C82 A;  2EUI A;  4KUA A;  4KOY A;  2CXA A;  1MJB A;  2FS5 A;  2JDD A;  2Q7B A;  4HNW B;  4UFW A;  4AB7 A;  3DR6 A;  3R96 A;  4KOW A;  1IB1 E;  2PSW A;  1Z4E A;  4FD6 A;  3GYA A;  2J8R A;  3D8P A;  4CAX A;  2F5I A;  4NCZ A;  3TFY A;  2P6E A;  5AG6 A;  2DPS A;  4F0Y A;  1XEB A;  3IWG A;  1MK4 A;  2YNE A;  1QST A;  3BLN A;  3MGD A;  1S7F A;  2FCK A;  2R1I A;  3H4Q A;  3W6S A;  4B11 A;  2VI7 A;  2IL4 A;  4L8A A;  4CYP A;  4KVX A;  3EC4 A;  2OZU A;  2B3U A;  2H5M A;  5G20 A;  1YRE A;  2BUE A;  5G21 A;  4XNH C;  2VZY A;  4KSA A;  2EVN A;  2P6G A;  5G22 A;  3KKW A;  3EFA A;  4H89 A;  4MFZ A;  4XPK A;  3NE7 A;  2ZW4 A;  3F8K A;  5H86 A;  2CY2 A;  4FD7 A;  4JD6 A;  4MFK A;  3IU1 A;  5F48 A;  3S6G A;  3D2M A;  3DDD A;  1BO4 A;  3TO7 A;  1U6M A;  4KOT A;  2QEC A;  4M3S A;  2REF A;  5ISV A;  4A31 A;  4MJ8 A;  1VHS A;  2ZW6 A;  2VBQ A;  4XPD B;  4HNY B;  1YX0 A;  2AE6 A;  4CGM A;  3D2P A;  4R87 A;  2GE3 A;  4YFJ A;  2ZXV A;  1YK3 A;  1B6B A;  4CAW A;  3D3S A;  1WWZ A;  2B5G A;  4C2Z A;  3DR8 A;  1Y9W A;  4ONU A;  4UCN A;  2R98 A;  3R9G A;  5KTA A;  3LOD A;  2C27 A;  3DNS A;  2VXK A;  3TOB A;  1NE9 A;  2B4D A;  3K9U A;  4OLL A;  3PZJ A;  4B10 A;  4KUB A;  1KUY A;  3FIX A;  1Q2Y A;  5J8C A;  2ZW5 A;  2RC4 A;  3JUW A;  4AVC A;  2R7H A;  1RXT A;  2WPW A;  4FD4 A;  4LX9 A;  2Z10 A;  4MY0 A;  4CYQ A;  2HV2 A;  4JLY A;  4L89 A;  5AG4 A;  4H6Z A;  4A95 A;  3G3S A;  1RO5 A;  3FYN A;  4HKF A;  4C68 A;  2Z3P A;  2OH1 A;  5IX3 A;  4R3K A;  4KSF A;  4Y49 C;  1SQH A;  4PSW A;  5AGE A;  4CYN A;  4YRH A;  4A32 A;  4U5Y A;  4A2Z A;  2CNT A;  2BEI A;  1CM0 A;  5IB0 A;  4IUS A;  3SHP A;  2WPX A;  4QUS A;  3ZZI A;  4CGO A;  1P4N A;  4Q38 A;  3W6X A;  3QAH A;  2FT0 A;  4KOS A;  3T9Y A;  2BL1 A;  2R8V A;  4H6U A;  4KLV A;  3E0K A;  2B3V A;  5I0C A;  5F46 A;  5KTD A;  2ZW7 A;  2PR1 A;  4QBJ A;  1XF8 A;  2FIA A;  1M4D A;  4MFP A;  1MJA A;  1I1D A;  2I79 A;  4BBH A;  4C7H A;  3CXP A;  1QSR A;  5CNP A;  4A33 A;  4I49 A;  1YLE A;  4QB9 A;  3UY5 A;  1J4J A;  4B14 A;  3PP9 A;  1PU9 A;  4B13 A;  2VZZ A;  3GKR A;  2G3A A;  4OAE A;  2WUU A;  4CRY B;  4CAE A;  4QVT A;  4UFV A;  4MHD A;  4XNH B;  1YVK A;  4C7I A;  3FBU A;  5H84 A;  4RS2 A;  4MI4 A;  2Q0Y A;  2B4D B;  2FE7 A;  4RI1 A;  4B12 A;  5EC4 A;  4X5K A;  2CNM A;  2OB0 A;  3R9F A;  3WR7 A;  2QIR A;  3ZJ0 A;  3FRM A;  4CS0 B;  4B5P B;  2K5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...