4Y49B

Crystal structure of yeast n-terminal acetyltransferase (ppgpp) nate in complex with a bisubstrate
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
203
structure length
164
Chain Sequence
PINIRRATINDIICMQNANLHNLPENYMMKYYMYHILSWPEASFVATTTTLDGEKLVGYVLVKMNDDPEPPNGHITSLSVMRTYRRMGIAENLMRQALFALREVHQAEYVSLHVRQSNRAALHLYRDTLAFEVLSIEKSYYQDGEDAYAMKKVLKLEELQISNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-terminal acetyltransferase A complex subunit NAT1
publication title Crystal structure of yeast N-terminal acetyltransferase (ppGpp) NatE in complex with a bisubstrate
rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 9
structure length 164
sequence length 203
chains with identical sequence H, N
ec nomenclature ec 2.3.1.255: N-terminal amino-acid N(alpha)-acetyltransferase NatA.
pdb deposition date 2015-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4y49B00
5FVJA 1S5KA 4AVCA 3FB3A 3K9UA 3SXNA 5H84A 2Q4VA 4DNCA 2KCWA 4OAEA 4UWJA 4K30A 3QAHA 4NCZA 1M4GA 3V8IA 3T90A 1YLEA 4QBJA 4ORFA 2FSRA 3S6HA 1B6BA 3T9YA 2Q04A 2B4DA 3D2MA 1NSLA 1Q2CA 5HH1A 4E8OA 3CXSA 4R3KA 2BSWA 4ONUA 4HNWB 2B5GA 2BEIA 5DWNA 4R3LA 4Y49B 4MI4A 3B8GA 5EC4A 4M3SA 4JJXA 4L89A 2EUIA 1MJ9A 2CNTA 3LODA 3MGDA 4XPDB 2PRBA 2VQYA 4KVXA 1MJBA 5KTAA 1GHEA 2FE7A 2HQYA 3R9EA 1QSTA 1YX0A 4YGOA 1S7NA 4BMHA 2FIAA 2Q0YA 3OWCA 4KOTA 3SXOA 2ZXVA 5IB0A 4NXYA 4R57A 1M1DA 2JDDA 2Q4YA 4EVYA 5H86A 1I12A 5C88A 4JXQA 1YVOA 2G0BA 2D4PA 4AVAA 3FNCA 4QVTA 3R9FA 4JLYA 4PK2A 4RS2A 4X5KA 3EFAA 2OZHA 5IX3A 2AJ6A 4PSWA 2B3VA 2QIRA 4UWIA 1M44A 4PSXA 2BUEA 3IWGA 2ZW6A 4B5OA 1IICA 1I1DA 3GYAA 3TO6A 5GCNA 3WR7A 1XE4A 2R7HA 3ZJ0A 2WPWA 3TOBA 2CNMA 1KUYA 3I9SA 3FBUA 1VHSA 4MBUA 4U5YA 5JQ4A 1R57A 4R87A 4F6AA 5J8FA 1S7LA 4OADA 4U9YA 1IYLA 2CNSA 1PUAA 1Q2DA 2K5TA 2VEZA 2RC4A 2FT0A 3TO9A 1NMTA 1S7FA 2Q44A 4MY0A 1UFHA 4KOUA 1IB1E 1QSMA 1U6MA 1RO5A 5KTDA 3FYNA 1P0HA 1M4DA 3KKWA 1S60A 3H4QA 1YGHA 1KZFA 2VI7A 5F47A 3TTHA 2Q7BA 2EVNA 1XEBA 1CJWA 3TOAA 4M85A 2B3UA 5EBVA 2ZW7A 4JXRA 4MJ8A 2J8RA 4CRZB 5CNPA 4XNHB 3EO4A 2ZW4A 1OZPA 2P6GA 2J8NA 2CY2A 4HKFA 3W6SA 3R96A 5JPHA 4H6UA 4I49A 1N71A 1QSRA 3I3GA 3VWDA 3F0AA 3GKRA 4FD5A 2ZW5A 3S6GA 2PR1A 3FXTA 2H5MA 1KUXA 4FD4A 1YR0A 2I79A 1B87A 4E2AA 2B4BA 2P6FA 2Z11A 3ZZIA 2Z0ZA 5C82A 4KZTA 2C27A 1K4JA 1YVKA 1SQHA 3SHPA 1WK4A 2IL4A 5KTCA 2HUZA 2FL4A 1TIQA 4YRHA 4QC6A 4U9ZA 3BLNA 4B5PA 4YFJA 2Y0MA 2JEVA 5F48A 1Y7RA 1WWZA 2G3TA 4JD6A 3RYOA 3TO7A 2REFA 2GE3A 3EC4A 4KUAA 2OZGA 1QSOA 3D8PA 1XF8A 4QB9A 1XIXA 4H6ZA 2B5GB 4GS4A 4H89A 3DSBA 2VBQA 2BL1A 4OLLA 4XPLA 4CS0B 3CXQA 3E0KA 1LRZA 2P0WA 1Y9KA 4F0YA 1PU9A 4IUSA 4CAXA 3VWEA 2QECA 5ISVA 1Q2YA 1P4NA 3G8WA 4II9A 2FCKA 4KLVA 4CAVA 2R1IA 1VKCA 4PV6A 4IF5A 4KORA 2HV2A 2D4OA 3DNSA 2R98A 1Z4EA 2VZZA 2ZPAA 1V0CA 3IGRA 3R95A 5DWMA 2F5IA 1YK3A 2NMTA 2O28A 2JLMA 2WPXA 1RXTA 3P2HA 2Z10A 5F49A 3NE7A 3S6FA 3LD2A 1IIDA 1S3ZA 2REEA 4AG7A 4XPKA 2FIWA 4R9MA 4JWPA 4LX9A 1YREA 3PP9A 4QUSA 3W6XA 2OB0A 2R8VA 3EY5A 1I21A 3D3SA 2PSWA 1CM0A 4E0AA 3BJ7A 3UY5A 1J4JA 4AG9A 4CRYB 1M4IA 4HNXB 3QB8A 4XNHC 3GY9A 3R9GA 4UA3A 4PK3A 4B5PB 2FS5A 4AB7A 4KVOE 3DR8A 4L8AA 4FD6A 4Y49C 5E96A 4KOXA 2I00A 3DR6A 4NF1A 2PC1A 4XPDC 4RI1A 2DXQA 1BOBA 3JUWA 1S7KA 4UBRA 3D2PA 4FD7A 2JDCA 4HNYB 4KUBA 1Z4RA 2GANA 2OH1A 4NEXA 4KOSA 5J8CA 2B58A 4KLWA 3EXNA 2ARHA 1MK4A 1FY7A 2B4DB 3CXPA 3DDDA 3F8KA 4KOWA 1Z9UA 3C26A 3JVNA 3F5BA 2P6EA 2OZUA 4J3GA 3TCVA 4ZBGA 3W91A 4MHDA 2QMLA 2OU2A 3TE4A 2J8MA 3S6KA 1XMTA 5F46A 1IYKA 4AVBA 1Y9WA 2ATRA 3TT2A 1KUVA 4KOVA 4LUAA 3BJ8A 3N7ZA 2PR8A 4CAWA 3PZJA 2X7BA 2AE6A 4NSQA 2VXKA 5HMNA 2GIVA 3R1KA 2FXFA 2PQ8A 3FRMA 1NE9A 2G3AA 3P2FA 1ON0A 1BO4A 5I0CA 4KOYA 1MJAA 2A4NA 2VZYA 4KVME 5IV0A 3TFYA 2PDOA 1QSNA 3FIXA 4MY3A 3PGPA 3G3SA 1L0CA
chains in the Genus database with same CATH superfamily
1ZLIA 5FVJA 2IMOA 2C6PA 4PQAA 2ODFA 1ZG9A 2GLFA 1S5KA 2PJ3A 2DPTA 3WT4A 3FB3A 4AVCA 5BWAB 3K9UA 3K9TA 3PBBA 4MCRA 3SXNA 3H8GA 4MCPA 5K8MA 5H84A 4OC0A 2EK9A 2Q4VA 4DNCA 2Q7SA 1IOFA 2KCWA 2Q43A 4OAEA 4UWJA 1Y0RA 4K30A 2PJ4A 3LWUA 1H8LA 3QAHA 4NCZA 1M4GA 3V7ZA 1XBUA 2YNEA 3HUVA 3V8IA 2PVWA 3T90A 4B12A 2C1CA 4DYOA 1YLEA 4QBJA 1TKFA 2C6GA 1AUGA 1LOKA 2CTBA 4ORFA 2FSRA 3KR5A 1R3NA 4CPAA 4MFPA 4ONWA 4NFRA 2PJ8A 3S6HA 1B6BA 3FEEA 2Q51A 3T9YA 3V38A 2Q04A 2B4DA 1IGBA 4ZY1A 4KSIA 4NGSA 3D2MA 1NSLA 1Q2CA 5HH1A 4E8OA 1Z8LA 4NGTA 4NGPA 2PJAA 3CXSA 2AFOA 3FMCA 4NGRA 2BSWA 4R3KA 1AMPA 2BOAA 4HNWB 2B5GA 2BEIA 2VL1A 4ONUA 2PJ0A 3PB7X 5DWNA 3WC6A 4R3LA 3KGQA 4Y49B 2ZOFA 4MI4A 3B8GA 5EC4A 5G21A 4M3SA 1CPSA 3PB6X 4JJXA 5G20A 4L89A 2EUIA 4CYPA 1CPXA 1MJ9A 3KZWA 2CNTA 1JWQA 3LODA 3PFEA 3MGDA 4XPDB 1YQEA 2PRBA 2VQYA 1QMUA 4YWYA 5G22A 4KVXA 4ZX8A 1ELLP 1MJBA 1DTDA 5THWA 3FH4A 5KTAA 1GHEA 2FE7A 1ZG7A 4ZI6A 2HQYA 3JTKA 5D8NA 3R9EA 1QSTA 1YX0A 3JRUA 4YGOA 1S7NA 4BMHA 2FIAA 2Q0YA 3KL9A 3OWCA 2OR4A 4IK2A 4KOTA 1Y0YA 5J8FA 3SXOA 2ZXVA 5IB0A 2PIZA 4P4DA 3KQXA 4NXYA 5ELYA 4OMEA 3H8EA 4R57A 1M1DA 5AG5A 5DS0A 2JDDA 2Q4YA 4M6HA 4EVYA 5H86A 4G1PA 4GXHA 3VATA 4KSAA 2AFSA 4OIDA 4CYQA 1I12A 5C88A 4JXQA 4RUHA 1YVOA 2G0BA 2D4PA 4AVAA 2QVPA 4F9UA 4R76A 4A38A 3FNCA 1LFWA 4UCPA 3D67A 4QVTA 3R9FA 4JLYA 4C2XA 1CBXA 2V77A 5AGEA 2YNDA 3SJXA 4PK2A 3B2YA 4RS2A 3NH5A 5I4MA 4A39A 5A28A 4PXEA 4X5KA 4MFKA 3EFAA 2OZHA 5IX3A 2C6CA 3DGVA 2AJ6A 4PSWA 2XEJA 4MFJA 1XFOA 2B3VA 2QIRA 1DE4C 2O4HA 2ZEMA 1M44A 4UWIA 5AG6A 3H5ZA 4PSXA 2BUEA 3IWGA 4F8ZA 2CTCA 2ZW6A 2Z3OA 4B5OA 4JZ0A 1IICA 1I1DA 3GYAA 3SI1A 2ANPA 3CZXA 3D7HA 4MFLA 4R7MA 5GCNA 3RAMA 3TO6A 4MHYA 1XE4A 3WR7A 2J9AA 5HXDA 1ELMP 1Z8WA 2R7HA 3ZJ0A 2WPWA 4FBEA 1CX8A 3GB0A 3TOBA 2CNMA 1KUYA 3I9SA 3FBUA 2ZEGA 1VHSA 4MBUA 4U5YA 4UEZA 1R57A 4R87A 3VARA 4F6AA 1S7LA 4OADA 4U9YA 1IYLA 4UEFA 3B3CA 4F0XA 2CNSA 1PUAA 3IO1A 1Q2DA 2PE3A 2K5TA 3T8WA 4P4BA 3RNZA 2ZEHA 1XJOA 2WSAA 2VEZA 4UCNA 2JBKA 2HB6A 1BPMA 2RC4A 4FWUA 4MHPA 2FT0A 4TWEA 3TO9A 1NMTA 2AFUA 2EK8A 1S7FA 3MRUA 4PXBA 4MHZA 2Q44A 3GIUA 4MY0A 1UFHA 1FNOA 4KOUA 1IB1E 1QSMA 2AFMA 4B13A 1U6MA 1RO5A 5K8NA 1XRYA 5KTDA 1TF9A 3FYNA 3ISXA 2FVGA 1P0HA 1M4DA 2QYVA 2GREA 3KKWA 2AFXA 1PYTB 1S60A 4C2YA 1GYTA 4WWVA 3B3TA 3SJEA 4NGQA 4MMOA 3H4QA 1YGHA 2RB7A 1KZFA 1M4LA 2VI7A 5F47A 4A33A 4A95A 2PJ1A 4OIWA 4FUUA 3TTHA 2Q7BA 4B14A 2EVNA 2IQ6A 1XEBA 3D68A 3S9LA 1CJWA 3TOAA 4M85A 4MCSA 2O53A 2JBJA 4Q7AA 4EMEA 1X10A 2B3UA 1TKHA 5EBVA 1BPNA 2ZW7A 4JXRA 4MJ8A 2J8RA 3D4UA 4CRZB 4WJBA 5CNPA 1YSJA 4XNHB 4K3NA 3IC1A 3EO4A 2ZW4A 1OZPA 4ZX9A 2P6GA 2Z3MA 4NJRA 2J8NA 2BCOA 2PJ9A 4PPZA 4ZYQA 5D29A 2CY2A 4HKFA 4A31A 3B7IA 3NA6A 3RZAA 3W6SA 3R96A 5K8OA 5JPHA 1Z2LA 4H6UA 4I49A 1N71A 1QSRA 1HDUA 3IFEA 3I3GA 2AFWA 3VWDA 1HEEA 5JM6A 3CPAA 2DF5A 3F0AA 2Q4ZA 3WC7A 3GKRA 2ZEDA 1RTQA 1YLOA 4FD5A 2ZW5A 3S6GA 2BO9A 2PR1A 4UFWA 1OBRA 3FXTA 3FF3A 2H5MA 4UFVA 1KUXA 3PB9X 4P10A 4ZY2A 2GLJA 4P44A 2PCUA 4FD4A 1YR0A 2I79A 5LYDA 4MHNA 3D66A 4P6YA 2DPSA 2EWBA 1B87A 4E2AA 2B4BA 1XMBA 3N5FA 2P6FA 2NYQA 3QNVA 2Z11A 4BBHA 4F9VA 4RN7A 3ZZIA 4B11A 5LRJA 4MXUA 5A27A 2Z0ZA 5C82A 3ISZA 1TKJA 2XEFA 3KASA 2C27A 4KZTA 1Z8XA 1YVKA 1K4JA 1SQHA 3FECA 3MN8A 1VHEA 5J1QA 3KHXA 3SHPA 5LYFA 2ZEPA 1WK4A 2IL4A 5KTCA 2HUZA 2FL4A 5LRKA 3FX6A 4UIBA 1TIQA 4YRHA 2ZEEA 4QC6A 4U9ZA 3NH8A 1UWYA 3BLNA 3IWWA 1KWMA 3PBEA 4B5PA 1Z8TA 4R8FA 2Y0MA 2JEVA 3B3WA 5F48A 4A2ZA 4AXVA 4YFJA 5HVGA 4OC4A 4CGOA 1Y7RA 1WWZA 2G3TA 4JD6A 3RYOA 3TO7A 2REFA 2GE3A 3EC4A 4UF4A 4KUAA 1BAVA 2OZGA 1QSOA 4NGMA 8CPAA 4JYWA 3D8PA 1LAPA 1XF8A 5JQ4A 1LCPA 4QB9A 1XIXA 4H6ZA 2B5GB 3HLPA 4GS4A 4DJLA 4MFZA 1VHOA 4H89A 3DSBA 2VBQA 4NJQA 4P45A 2BL1A 4P4EA 4OP4A 2WYRA 4IAVA 6CPAA 1VIXA 4PXDA 3IJ3A 4OLLA 4CGPA 2ZEOA 2CIJA 4XPLA 4CS0B 1XOVA 3CXQA 3WC5A 5IB9A 1X12A 2PJ5A 3E0KA 1LRZA 2P0WA 1Y9KA 4F0YA 1PU9A 4IUSA 2WUUA 5G1ZA 4B6ZA 4LQ6A 2PIYA 4CAXA 3VWEA 2QECA 5ISVA 2CF4A 1Q2YA 4MFQA 1P4NA 3G8WA 4CYOA 4II9A 2FCKA 2YNCA 4KLVA 1YW4A 4O23A 4CAVA 1JQGA 7CPAA 2RFHA 2PJBA 2R1IA 1VKCA 5CBMA 2XEIA 2EO8A 4PV6A 4IF5A 1LANA 2GFQA 1LAMA 2I3CA 1PCAA 4KORA 2HV2A 3D7GA 2D4OA 3DNSA 1EE3P 2R98A 1Z4EA 2VZZA 2ZPAA 2HC9A 1IOIA 3IIBA 1V0CA 3IGRA 4PXCA 4CAFA 2YGWA 3R95A 4OKOA 1YMEA 4UIAA 4Q38A 4A37A 5DWMA 4H2KA 3KR4A 3B3SA 2F5IA 1YK3A 2NMTA 4YU9A 3PFOA 2NSMA 1TF8A 2JLMA 2O28A 4TNUA 4OC2A 1FT7A 2WPXA 1RXTA 3IU1A 3P2HA 2Z10A 5F09A 1Y7EA 5F49A 4CGLA 3NE7A 3S6FA 3PB4X 3LD2A 4CGMA 2ZOGA 4A94A 1IIDA 1S3ZA 2REEA 4P4JA 4AG7A 1QQ9A 4EFDA 4XPKA 2FIWA 3B35A 4R9MA 4JWPA 4BINA 4LX9A 2PJ7A 1R43A 4DUKA 2JEWA 1YREA 3PP9A 4MCQA 4QUSA 4KS9A 3W6XA 3FEDA 2OB0A 5HVFA 5EMIA 5LYIA 2R8VA 3EY5A 3SJFA 1I21A 3IWEA 2PJ2A 1F57A 3D3SA 4LQGA 2PSWA 4W9YA 1CM0A 3CPXA 4E0AA 3BJ7A 4X2TA 3UY5A 4EWTA 3SI2A 1CP7A 1NSAA 1J4JA 3TC8A 1F2PA 4AG9A 1IU8A 5K8PA 3CT9A 2G9DA 3I1UA 4CRYB 1M4IA 4HNXB 2YNCC 2Z3PA 3FJUA 3QB8A 3KQZA 1AYEA 4B10A 4XNHC 3GY9A 3R9GA 4UA3A 4PK3A 4ZGYB 4B5PB 2FS5A 3CDXA 3L2NA 4Q36A 4KVOE 3DR8A 2PRQA 4L8AA 4FD6A 4AB7A 4Y49C 2QJ8A 2F7VA 4KOXA 1Q7LA 5E96A 1ZO0A 3BXMA 2I00A 3BHXA 2AFZA 4P4FA 2ZENA 3D7FA 3DR6A 3LMSA 3S9MA 4HPSA 2PC1A 2WZNA 3D7DA 4NF1A 4XPDC 1IY7A 4RI1A 4KSFA 3LACA 2DXQA 2PJ6A 1BOBA 3JUWA 1S7KA 5AG7A 4UBRA 3PRTA 4FAIA 3D2PA 4FD7A 2JDCA 4OC3A 4Z65A 2ZEFA 3IEHA 4UEEA 4A30A 4C2ZA 1ZG8A 4GM5A 2PJCA 4HNYB 3FVLA 3SI0A 4KUBA 1Z4RA 2POKA 3PEIA 2GANA 2OH1A 3TX8A 4NEXA 2Z3KA 4CYNA 4KOSA 4X3RA 5J8CA 1TXRA 2B58A 4KLWA 3EXNA 1ZLHA 4C68A 4M6IA 2ARHA 1MK4A 1FY7A 2B4DB 3CXPA 3VH9A 3A9LA 3DDDA 2Z3LA 1HDQA 3B3VA 3F8KA 3H8FA 1YW6A 4KOWA 1Z9UA 3C26A 3JVNA 4OC1A 1CP6A 3PB8X 1VGYA 4C7HA 3F5BA 5CPAA 2CXAA 2V8GA 2F8HA 2P6EA 3RO0A 2OZUA 4J3GA 3RBUA 3TCVA 4ZBGA 1ARLA 3NH4A 4R6TA 2Z3NA 3KHZA 3W91A 4MHDA 2V8VA 3WABA 4MRIA 2QMLA 2OU2A 4BD9A 3TE4A 2J8MA 5JH9A 4OC5A 4UFXA 3S6KA 1XMTA 4CGNA 3NFZA 3SJGA 5F46A 1IYKA 3BI1A 3GLJA 2V8HA 5LRGA 4AVBA 1Y9WA 2ATRA 3TT2A 3IU2A 2OOTA 1KUVA 4KOVA 2DEAA 1A2ZA 3BJ8A 2PR8A 3N7ZA 3PZJA 4LUAA 4CAWA 2X7BA 3QAYA 2AE6A 3DLJA 4NSQA 2VXKA 2EBJA 4C7IA 5HMNA 5AG4A 5JGFA 3S9NA 1ARMA 3GUXA 2V8DA 2GU2A 2ABZA 3BI0A 2GIVA 3R1KA 2FXFA 2PQ8A 1F2OA 3FRMA 1NE9A 4CAEA 2G3AA 4UCMA 4ZY0A 2ZELA 4IHMA 3P2FA 1CG2A 1ON0A 1BO4A 3NE8A 4X8IA 4A32A 5I0CA 3K2KA 5LYLA 4KOYA 5HVHA 2XEGA 1MJAA 2A4NA 2VZYA 3KI9A 4KVME 4M6GA 5IV0A 1BLLE 2PVVA 3TFYA 4NGNA 2PDOA 4P4IA 1QSNA 3FIXA 4MY3A 3PGPA 3G3SA 1L0CA 1Z5RA 2IJZA
chains in the Genus database with same CATH topology
5FVJA 1S5KA 2DPTA 4AVCA 3FB3A 5BWAB 3K9UA 3SXNA 5H84A 2Q4VA 4DNCA 2KCWA 4OAEA 4UWJA 4K30A 3QAHA 4NCZA 1M4GA 2YNEA 3V8IA 3T90A 4B12A 1YLEA 4QBJA 4ORFA 2FSRA 4MFPA 3S6HA 1B6BA 3T9YA 2Q04A 2B4DA 3D2MA 1NSLA 1Q2CA 5HH1A 4E8OA 3CXSA 4R3KA 2BSWA 4ONUA 4HNWB 2B5GA 2BEIA 5DWNA 4R3LA 4Y49B 5G21A 4MI4A 3B8GA 5EC4A 4M3SA 4JJXA 5G20A 4L89A 2EUIA 4CYPA 1MJ9A 2CNTA 3LODA 3MGDA 4XPDB 2PRBA 2VQYA 5G22A 4KVXA 1MJBA 5KTAA 1GHEA 2FE7A 2HQYA 3JTKA 3R9EA 1QSTA 1YX0A 4YGOA 1S7NA 4BMHA 2FIAA 2Q0YA 3OWCA 4KOTA 3SXOA 2ZXVA 5IB0A 4NXYA 4R57A 1M1DA 5AG5A 2JDDA 2Q4YA 4EVYA 5H86A 4KSAA 4CYQA 1I12A 5C88A 4JXQA 1YVOA 2G0BA 2D4PA 4AVAA 3FNCA 4UCPA 4QVTA 3R9FA 4JLYA 4C2XA 5AGEA 2YNDA 4PK2A 4RS2A 5A28A 4X5KA 4MFKA 3EFAA 2OZHA 5IX3A 2AJ6A 4PSWA 4MFJA 2B3VA 2QIRA 4UWIA 1M44A 5AG6A 3H5ZA 4PSXA 2BUEA 3IWGA 2ZW6A 2Z3OA 4B5OA 1IICA 1I1DA 3GYAA 3TO6A 4MFLA 5GCNA 3WR7A 1XE4A 2R7HA 3ZJ0A 2WPWA 3TOBA 2CNMA 1KUYA 3I9SA 3FBUA 1VHSA 4MBUA 4U5YA 5JQ4A 1R57A 4R87A 4F6AA 5J8FA 1S7LA 4OADA 4U9YA 1IYLA 4F0XA 2CNSA 1PUAA 1Q2DA 2K5TA 2WSAA 2VEZA 4UCNA 2RC4A 2FT0A 3TO9A 1NMTA 1S7FA 2Q44A 4MY0A 1UFHA 4KOUA 1IB1E 1QSMA 4B13A 1U6MA 1RO5A 5KTDA 3FYNA 1P0HA 1M4DA 3KKWA 1S60A 4C2YA 3H4QA 1YGHA 1KZFA 2VI7A 5F47A 4A33A 4A95A 3TTHA 2Q7BA 4B14A 2EVNA 1XEBA 1CJWA 3TOAA 4M85A 2B3UA 5EBVA 2ZW7A 4JXRA 4MJ8A 2J8RA 4CRZB 5CNPA 4XNHB 3EO4A 2ZW4A 1OZPA 2P6GA 2Z3MA 2J8NA 2CY2A 4HKFA 4A31A 3W6SA 3R96A 5JPHA 4H6UA 4I49A 1N71A 1QSRA 3I3GA 3VWDA 3F0AA 3GKRA 4FD5A 2ZW5A 3S6GA 2PR1A 4UFWA 3FXTA 2H5MA 4UFVA 1KUXA 4FD4A 1YR0A 2I79A 2DPSA 1B87A 4E2AA 2B4BA 2P6FA 4BBHA 2Z11A 3ZZIA 4B11A 5A27A 2Z0ZA 5C82A 4KZTA 2C27A 1K4JA 1YVKA 1SQHA 3SHPA 1WK4A 2IL4A 5KTCA 2HUZA 2FL4A 1TIQA 4YRHA 4QC6A 4U9ZA 3BLNA 4B5PA 4YFJA 2Y0MA 2JEVA 5F48A 4A2ZA 4CGOA 1Y7RA 1WWZA 2G3TA 4JD6A 3RYOA 3TO7A 2REFA 2GE3A 3EC4A 4KUAA 2OZGA 1QSOA 3D8PA 1XF8A 4QB9A 1XIXA 4H6ZA 2B5GB 4GS4A 4MFZA 4H89A 3DSBA 2VBQA 2BL1A 4OLLA 4CGPA 4XPLA 4CS0B 3CXQA 3E0KA 1LRZA 2P0WA 1Y9KA 4F0YA 1PU9A 4IUSA 2WUUA 5G1ZA 4CAXA 3VWEA 2QECA 5ISVA 1Q2YA 4MFQA 1P4NA 3G8WA 4CYOA 4II9A 2FCKA 2YNCA 4KLVA 4CAVA 2R1IA 1VKCA 4PV6A 4IF5A 4KORA 2HV2A 2D4OA 3DNSA 2R98A 1Z4EA 2VZZA 2ZPAA 1V0CA 3IGRA 4CAFA 2YGWA 3R95A 4Q38A 5DWMA 2F5IA 1YK3A 2NMTA 2O28A 2JLMA 2WPXA 1RXTA 3IU1A 3P2HA 2Z10A 5F49A 4CGLA 3NE7A 3S6FA 4CGMA 3LD2A 1IIDA 1S3ZA 2REEA 4AG7A 4XPKA 2FIWA 4R9MA 4JWPA 4LX9A 1YREA 3PP9A 4QUSA 4KS9A 3W6XA 2OB0A 2R8VA 3EY5A 1I21A 3IWEA 3D3SA 2PSWA 1CM0A 4E0AA 3BJ7A 3UY5A 1J4JA 4AG9A 4CRYB 1M4IA 4HNXB 2YNCC 2Z3PA 3QB8A 4B10A 4XNHC 3GY9A 3R9GA 4UA3A 4PK3A 4ZGYB 4B5PB 2FS5A 4AB7A 4Q36A 4KVOE 3DR8A 4L8AA 4FD6A 4Y49C 5E96A 4KOXA 1ZO0A 2I00A 3DR6A 4NF1A 2PC1A 4XPDC 4RI1A 4KSFA 2DXQA 1BOBA 3JUWA 1S7KA 5AG7A 4UBRA 3D2PA 4FD7A 2JDCA 4A30A 4C2ZA 4HNYB 4KUBA 1Z4RA 2GANA 2OH1A 4NEXA 2Z3KA 4CYNA 4KOSA 5J8CA 2B58A 4KLWA 3EXNA 4C68A 3CXPA 1MK4A 1FY7A 2ARHA 2B4DB 3A9LA 3DDDA 2Z3LA 3F8KA 4KOWA 1Z9UA 3C26A 3JVNA 4C7HA 3F5BA 2CXAA 2P6EA 2OZUA 4J3GA 3TCVA 4ZBGA 2Z3NA 3W91A 4MHDA 2QMLA 2OU2A 3TE4A 2J8MA 3S6KA 4UFXA 1XMTA 4CGNA 5F46A 1IYKA 4AVBA 1Y9WA 2ATRA 3TT2A 3IU2A 1KUVA 4KOVA 4LUAA 3BJ8A 3N7ZA 2PR8A 4CAWA 3PZJA 2X7BA 2AE6A 4NSQA 2VXKA 4C7IA 5HMNA 5AG4A 2GIVA 3R1KA 2FXFA 2PQ8A 3FRMA 1NE9A 4CAEA 2G3AA 4UCMA 3P2FA 1ON0A 1BO4A 4A32A 5I0CA 4KOYA 1MJAA 2A4NA 2VZYA 4KVME 5IV0A 3TFYA 2PDOA 1QSNA 3FIXA 4MY3A 3PGPA 3G3SA 1L0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FVJ A;  1S5K A;  4AVC A;  3FB3 A;  3K9U A;  3SXN A;  5H84 A;  2Q4V A;  4DNC A;  2KCW A;  4OAE A;  4UWJ A;  4K30 A;  3QAH A;  4NCZ A;  1M4G A;  3V8I A;  3T90 A;  1YLE A;  4QBJ A;  4ORF A;  2FSR A;  3S6H A;  1B6B A;  3T9Y A;  2Q04 A;  2B4D A;  3D2M A;  1NSL A;  1Q2C A;  5HH1 A;  4E8O A;  3CXS A;  4R3K A;  2BSW A;  4ONU A;  4HNW B;  2B5G A;  2BEI A;  5DWN A;  4R3L A;  4Y49 B;  4MI4 A;  3B8G A;  5EC4 A;  4M3S A;  4JJX A;  4L89 A;  2EUI A;  1MJ9 A;  2CNT A;  3LOD A;  3MGD A;  4XPD B;  2PRB A;  2VQY A;  4KVX A;  1MJB A;  5KTA A;  1GHE A;  2FE7 A;  2HQY A;  3R9E A;  1QST A;  1YX0 A;  4YGO A;  1S7N A;  4BMH A;  2FIA A;  2Q0Y A;  3OWC A;  4KOT A;  3SXO A;  2ZXV A;  5IB0 A;  4NXY A;  4R57 A;  1M1D A;  2JDD A;  2Q4Y A;  4EVY A;  5H86 A;  1I12 A;  5C88 A;  4JXQ A;  1YVO A;  2G0B A;  2D4P A;  4AVA A;  3FNC A;  4QVT A;  3R9F A;  4JLY A;  4PK2 A;  4RS2 A;  4X5K A;  3EFA A;  2OZH A;  5IX3 A;  2AJ6 A;  4PSW A;  2B3V A;  2QIR A;  4UWI A;  1M44 A;  4PSX A;  2BUE A;  3IWG A;  2ZW6 A;  4B5O A;  1IIC A;  1I1D A;  3GYA A;  3TO6 A;  5GCN A;  3WR7 A;  1XE4 A;  2R7H A;  3ZJ0 A;  2WPW A;  3TOB A;  2CNM A;  1KUY A;  3I9S A;  3FBU A;  1VHS A;  4MBU A;  4U5Y A;  5JQ4 A;  1R57 A;  4R87 A;  4F6A A;  5J8F A;  1S7L A;  4OAD A;  4U9Y A;  1IYL A;  2CNS A;  1PUA A;  1Q2D A;  2K5T A;  2VEZ A;  2RC4 A;  2FT0 A;  3TO9 A;  1NMT A;  1S7F A;  2Q44 A;  4MY0 A;  1UFH A;  4KOU A;  1IB1 E;  1QSM A;  1U6M A;  1RO5 A;  5KTD A;  3FYN A;  1P0H A;  1M4D A;  3KKW A;  1S60 A;  3H4Q A;  1YGH A;  1KZF A;  2VI7 A;  5F47 A;  3TTH A;  2Q7B A;  2EVN A;  1XEB A;  1CJW A;  3TOA A;  4M85 A;  2B3U A;  5EBV A;  2ZW7 A;  4JXR A;  4MJ8 A;  2J8R A;  4CRZ B;  5CNP A;  4XNH B;  3EO4 A;  2ZW4 A;  1OZP A;  2P6G A;  2J8N A;  2CY2 A;  4HKF A;  3W6S A;  3R96 A;  5JPH A;  4H6U A;  4I49 A;  1N71 A;  1QSR A;  3I3G A;  3VWD A;  3F0A A;  3GKR A;  4FD5 A;  2ZW5 A;  3S6G A;  2PR1 A;  3FXT A;  2H5M A;  1KUX A;  4FD4 A;  1YR0 A;  2I79 A;  1B87 A;  4E2A A;  2B4B A;  2P6F A;  2Z11 A;  3ZZI A;  2Z0Z A;  5C82 A;  4KZT A;  2C27 A;  1K4J A;  1YVK A;  1SQH A;  3SHP A;  1WK4 A;  2IL4 A;  5KTC A;  2HUZ A;  2FL4 A;  1TIQ A;  4YRH A;  4QC6 A;  4U9Z A;  3BLN A;  4B5P A;  4YFJ A;  2Y0M A;  2JEV A;  5F48 A;  1Y7R A;  1WWZ A;  2G3T A;  4JD6 A;  3RYO A;  3TO7 A;  2REF A;  2GE3 A;  3EC4 A;  4KUA A;  2OZG A;  1QSO A;  3D8P A;  1XF8 A;  4QB9 A;  1XIX A;  4H6Z A;  2B5G B;  4GS4 A;  4H89 A;  3DSB A;  2VBQ A;  2BL1 A;  4OLL A;  4XPL A;  4CS0 B;  3CXQ A;  3E0K A;  1LRZ A;  2P0W A;  1Y9K A;  4F0Y A;  1PU9 A;  4IUS A;  4CAX A;  3VWE A;  2QEC A;  5ISV A;  1Q2Y A;  1P4N A;  3G8W A;  4II9 A;  2FCK A;  4KLV A;  4CAV A;  2R1I A;  1VKC A;  4PV6 A;  4IF5 A;  4KOR A;  2HV2 A;  2D4O A;  3DNS A;  2R98 A;  1Z4E A;  2VZZ A;  2ZPA A;  1V0C A;  3IGR A;  3R95 A;  5DWM A;  2F5I A;  1YK3 A;  2NMT A;  2O28 A;  2JLM A;  2WPX A;  1RXT A;  3P2H A;  2Z10 A;  5F49 A;  3NE7 A;  3S6F A;  3LD2 A;  1IID A;  1S3Z A;  2REE A;  4AG7 A;  4XPK A;  2FIW A;  4R9M A;  4JWP A;  4LX9 A;  1YRE A;  3PP9 A;  4QUS A;  3W6X A;  2OB0 A;  2R8V A;  3EY5 A;  1I21 A;  3D3S A;  2PSW A;  1CM0 A;  4E0A A;  3BJ7 A;  3UY5 A;  1J4J A;  4AG9 A;  4CRY B;  1M4I A;  4HNX B;  3QB8 A;  4XNH C;  3GY9 A;  3R9G A;  4UA3 A;  4PK3 A;  4B5P B;  2FS5 A;  4AB7 A;  4KVO E;  3DR8 A;  4L8A A;  4FD6 A;  4Y49 C;  5E96 A;  4KOX A;  2I00 A;  3DR6 A;  4NF1 A;  2PC1 A;  4XPD C;  4RI1 A;  2DXQ A;  1BOB A;  3JUW A;  1S7K A;  4UBR A;  3D2P A;  4FD7 A;  2JDC A;  4HNY B;  4KUB A;  1Z4R A;  2GAN A;  2OH1 A;  4NEX A;  4KOS A;  5J8C A;  2B58 A;  4KLW A;  3EXN A;  2ARH A;  1MK4 A;  1FY7 A;  2B4D B;  3CXP A;  3DDD A;  3F8K A;  4KOW A;  1Z9U A;  3C26 A;  3JVN A;  3F5B A;  2P6E A;  2OZU A;  4J3G A;  3TCV A;  4ZBG A;  3W91 A;  4MHD A;  2QML A;  2OU2 A;  3TE4 A;  2J8M A;  3S6K A;  1XMT A;  5F46 A;  1IYK A;  4AVB A;  1Y9W A;  2ATR A;  3TT2 A;  1KUV A;  4KOV A;  4LUA A;  3BJ8 A;  3N7Z A;  2PR8 A;  4CAW A;  3PZJ A;  2X7B A;  2AE6 A;  4NSQ A;  2VXK A;  5HMN A;  2GIV A;  3R1K A;  2FXF A;  2PQ8 A;  3FRM A;  1NE9 A;  2G3A A;  3P2F A;  1ON0 A;  1BO4 A;  5I0C A;  4KOY A;  1MJA A;  2A4N A;  2VZY A;  4KVM E;  5IV0 A;  3TFY A;  2PDO A;  1QSN A;  3FIX A;  4MY3 A;  3PGP A;  3G3S A;  1L0C A; 
#chains in the Genus database with same CATH topology
 1ZLI A;  5FVJ A;  2IMO A;  2C6P A;  4PQA A;  2ODF A;  1ZG9 A;  2GLF A;  1S5K A;  2PJ3 A;  2DPT A;  3WT4 A;  3FB3 A;  4AVC A;  5BWA B;  3K9U A;  3K9T A;  3PBB A;  4MCR A;  3SXN A;  3H8G A;  4MCP A;  5K8M A;  5H84 A;  4OC0 A;  2EK9 A;  2Q4V A;  4DNC A;  2Q7S A;  1IOF A;  2KCW A;  2Q43 A;  4OAE A;  4UWJ A;  1Y0R A;  4K30 A;  2PJ4 A;  3LWU A;  1H8L A;  3QAH A;  4NCZ A;  1M4G A;  3V7Z A;  1XBU A;  2YNE A;  3HUV A;  3V8I A;  2PVW A;  3T90 A;  4B12 A;  2C1C A;  4DYO A;  1YLE A;  4QBJ A;  1TKF A;  2C6G A;  1AUG A;  1LOK A;  2CTB A;  4ORF A;  2FSR A;  3KR5 A;  1R3N A;  4CPA A;  4MFP A;  4ONW A;  4NFR A;  2PJ8 A;  3S6H A;  1B6B A;  3FEE A;  2Q51 A;  3T9Y A;  3V38 A;  2Q04 A;  2B4D A;  1IGB A;  4ZY1 A;  4KSI A;  4NGS A;  3D2M A;  1NSL A;  1Q2C A;  5HH1 A;  4E8O A;  1Z8L A;  4NGT A;  4NGP A;  2PJA A;  3CXS A;  2AFO A;  3FMC A;  4NGR A;  2BSW A;  4R3K A;  1AMP A;  2BOA A;  4HNW B;  2B5G A;  2BEI A;  2VL1 A;  4ONU A;  2PJ0 A;  3PB7 X;  5DWN A;  3WC6 A;  4R3L A;  3KGQ A;  4Y49 B;  2ZOF A;  4MI4 A;  3B8G A;  5EC4 A;  5G21 A;  4M3S A;  1CPS A;  3PB6 X;  4JJX A;  5G20 A;  4L89 A;  2EUI A;  4CYP A;  1CPX A;  1MJ9 A;  3KZW A;  2CNT A;  1JWQ A;  3LOD A;  3PFE A;  3MGD A;  4XPD B;  1YQE A;  2PRB A;  2VQY A;  1QMU A;  4YWY A;  5G22 A;  4KVX A;  4ZX8 A;  1ELL P;  1MJB A;  1DTD A;  5THW A;  3FH4 A;  5KTA A;  1GHE A;  2FE7 A;  1ZG7 A;  4ZI6 A;  2HQY A;  3JTK A;  5D8N A;  3R9E A;  1QST A;  1YX0 A;  3JRU A;  4YGO A;  1S7N A;  4BMH A;  2FIA A;  2Q0Y A;  3KL9 A;  3OWC A;  2OR4 A;  4IK2 A;  4KOT A;  1Y0Y A;  5J8F A;  3SXO A;  2ZXV A;  5IB0 A;  2PIZ A;  4P4D A;  3KQX A;  4NXY A;  5ELY A;  4OME A;  3H8E A;  4R57 A;  1M1D A;  5AG5 A;  5DS0 A;  2JDD A;  2Q4Y A;  4M6H A;  4EVY A;  5H86 A;  4G1P A;  4GXH A;  3VAT A;  4KSA A;  2AFS A;  4OID A;  4CYQ A;  1I12 A;  5C88 A;  4JXQ A;  4RUH A;  1YVO A;  2G0B A;  2D4P A;  4AVA A;  2QVP A;  4F9U A;  4R76 A;  4A38 A;  3FNC A;  1LFW A;  4UCP A;  3D67 A;  4QVT A;  3R9F A;  4JLY A;  4C2X A;  1CBX A;  2V77 A;  5AGE A;  2YND A;  3SJX A;  4PK2 A;  3B2Y A;  4RS2 A;  3NH5 A;  5I4M A;  4A39 A;  5A28 A;  4PXE A;  4X5K A;  4MFK A;  3EFA A;  2OZH A;  5IX3 A;  2C6C A;  3DGV A;  2AJ6 A;  4PSW A;  2XEJ A;  4MFJ A;  1XFO A;  2B3V A;  2QIR A;  1DE4 C;  2O4H A;  2ZEM A;  1M44 A;  4UWI A;  5AG6 A;  3H5Z A;  4PSX A;  2BUE A;  3IWG A;  4F8Z A;  2CTC A;  2ZW6 A;  2Z3O A;  4B5O A;  4JZ0 A;  1IIC A;  1I1D A;  3GYA A;  3SI1 A;  2ANP A;  3CZX A;  3D7H A;  4MFL A;  4R7M A;  5GCN A;  3RAM A;  3TO6 A;  4MHY A;  1XE4 A;  3WR7 A;  2J9A A;  5HXD A;  1ELM P;  1Z8W A;  2R7H A;  3ZJ0 A;  2WPW A;  4FBE A;  1CX8 A;  3GB0 A;  3TOB A;  2CNM A;  1KUY A;  3I9S A;  3FBU A;  2ZEG A;  1VHS A;  4MBU A;  4U5Y A;  4UEZ A;  1R57 A;  4R87 A;  3VAR A;  4F6A A;  1S7L A;  4OAD A;  4U9Y A;  1IYL A;  4UEF A;  3B3C A;  4F0X A;  2CNS A;  1PUA A;  3IO1 A;  1Q2D A;  2PE3 A;  2K5T A;  3T8W A;  4P4B A;  3RNZ A;  2ZEH A;  1XJO A;  2WSA A;  2VEZ A;  4UCN A;  2JBK A;  2HB6 A;  1BPM A;  2RC4 A;  4FWU A;  4MHP A;  2FT0 A;  4TWE A;  3TO9 A;  1NMT A;  2AFU A;  2EK8 A;  1S7F A;  3MRU A;  4PXB A;  4MHZ A;  2Q44 A;  3GIU A;  4MY0 A;  1UFH A;  1FNO A;  4KOU A;  1IB1 E;  1QSM A;  2AFM A;  4B13 A;  1U6M A;  1RO5 A;  5K8N A;  1XRY A;  5KTD A;  1TF9 A;  3FYN A;  3ISX A;  2FVG A;  1P0H A;  1M4D A;  2QYV A;  2GRE A;  3KKW A;  2AFX A;  1PYT B;  1S60 A;  4C2Y A;  1GYT A;  4WWV A;  3B3T A;  3SJE A;  4NGQ A;  4MMO A;  3H4Q A;  1YGH A;  2RB7 A;  1KZF A;  1M4L A;  2VI7 A;  5F47 A;  4A33 A;  4A95 A;  2PJ1 A;  4OIW A;  4FUU A;  3TTH A;  2Q7B A;  4B14 A;  2EVN A;  2IQ6 A;  1XEB A;  3D68 A;  3S9L A;  1CJW A;  3TOA A;  4M85 A;  4MCS A;  2O53 A;  2JBJ A;  4Q7A A;  4EME A;  1X10 A;  2B3U A;  1TKH A;  5EBV A;  1BPN A;  2ZW7 A;  4JXR A;  4MJ8 A;  2J8R A;  3D4U A;  4CRZ B;  4WJB A;  5CNP A;  1YSJ A;  4XNH B;  4K3N A;  3IC1 A;  3EO4 A;  2ZW4 A;  1OZP A;  4ZX9 A;  2P6G A;  2Z3M A;  4NJR A;  2J8N A;  2BCO A;  2PJ9 A;  4PPZ A;  4ZYQ A;  5D29 A;  2CY2 A;  4HKF A;  4A31 A;  3B7I A;  3NA6 A;  3RZA A;  3W6S A;  3R96 A;  5K8O A;  5JPH A;  1Z2L A;  4H6U A;  4I49 A;  1N71 A;  1QSR A;  1HDU A;  3IFE A;  3I3G A;  2AFW A;  3VWD A;  1HEE A;  5JM6 A;  3CPA A;  2DF5 A;  3F0A A;  2Q4Z A;  3WC7 A;  3GKR A;  2ZED A;  1RTQ A;  1YLO A;  4FD5 A;  2ZW5 A;  3S6G A;  2BO9 A;  2PR1 A;  4UFW A;  1OBR A;  3FXT A;  3FF3 A;  2H5M A;  4UFV A;  1KUX A;  3PB9 X;  4P10 A;  4ZY2 A;  2GLJ A;  4P44 A;  2PCU A;  4FD4 A;  1YR0 A;  2I79 A;  5LYD A;  4MHN A;  3D66 A;  4P6Y A;  2DPS A;  2EWB A;  1B87 A;  4E2A A;  2B4B A;  1XMB A;  3N5F A;  2P6F A;  2NYQ A;  3QNV A;  2Z11 A;  4BBH A;  4F9V A;  4RN7 A;  3ZZI A;  4B11 A;  5LRJ A;  4MXU A;  5A27 A;  2Z0Z A;  5C82 A;  3ISZ A;  1TKJ A;  2XEF A;  3KAS A;  2C27 A;  4KZT A;  1Z8X A;  1YVK A;  1K4J A;  1SQH A;  3FEC A;  3MN8 A;  1VHE A;  5J1Q A;  3KHX A;  3SHP A;  5LYF A;  2ZEP A;  1WK4 A;  2IL4 A;  5KTC A;  2HUZ A;  2FL4 A;  5LRK A;  3FX6 A;  4UIB A;  1TIQ A;  4YRH A;  2ZEE A;  4QC6 A;  4U9Z A;  3NH8 A;  1UWY A;  3BLN A;  3IWW A;  1KWM A;  3PBE A;  4B5P A;  1Z8T A;  4R8F A;  2Y0M A;  2JEV A;  3B3W A;  5F48 A;  4A2Z A;  4AXV A;  4YFJ A;  5HVG A;  4OC4 A;  4CGO A;  1Y7R A;  1WWZ A;  2G3T A;  4JD6 A;  3RYO A;  3TO7 A;  2REF A;  2GE3 A;  3EC4 A;  4UF4 A;  4KUA A;  1BAV A;  2OZG A;  1QSO A;  4NGM A;  8CPA A;  4JYW A;  3D8P A;  1LAP A;  1XF8 A;  5JQ4 A;  1LCP A;  4QB9 A;  1XIX A;  4H6Z A;  2B5G B;  3HLP A;  4GS4 A;  4DJL A;  4MFZ A;  1VHO A;  4H89 A;  3DSB A;  2VBQ A;  4NJQ A;  4P45 A;  2BL1 A;  4P4E A;  4OP4 A;  2WYR A;  4IAV A;  6CPA A;  1VIX A;  4PXD A;  3IJ3 A;  4OLL A;  4CGP A;  2ZEO A;  2CIJ A;  4XPL A;  4CS0 B;  1XOV A;  3CXQ A;  3WC5 A;  5IB9 A;  1X12 A;  2PJ5 A;  3E0K A;  1LRZ A;  2P0W A;  1Y9K A;  4F0Y A;  1PU9 A;  4IUS A;  2WUU A;  5G1Z A;  4B6Z A;  4LQ6 A;  2PIY A;  4CAX A;  3VWE A;  2QEC A;  5ISV A;  2CF4 A;  1Q2Y A;  4MFQ A;  1P4N A;  3G8W A;  4CYO A;  4II9 A;  2FCK A;  2YNC A;  4KLV A;  1YW4 A;  4O23 A;  4CAV A;  1JQG A;  7CPA A;  2RFH A;  2PJB A;  2R1I A;  1VKC A;  5CBM A;  2XEI A;  2EO8 A;  4PV6 A;  4IF5 A;  1LAN A;  2GFQ A;  1LAM A;  2I3C A;  1PCA A;  4KOR A;  2HV2 A;  3D7G A;  2D4O A;  3DNS A;  1EE3 P;  2R98 A;  1Z4E A;  2VZZ A;  2ZPA A;  2HC9 A;  1IOI A;  3IIB A;  1V0C A;  3IGR A;  4PXC A;  4CAF A;  2YGW A;  3R95 A;  4OKO A;  1YME A;  4UIA A;  4Q38 A;  4A37 A;  5DWM A;  4H2K A;  3KR4 A;  3B3S A;  2F5I A;  1YK3 A;  2NMT A;  4YU9 A;  3PFO A;  2NSM A;  1TF8 A;  2JLM A;  2O28 A;  4TNU A;  4OC2 A;  1FT7 A;  2WPX A;  1RXT A;  3IU1 A;  3P2H A;  2Z10 A;  5F09 A;  1Y7E A;  5F49 A;  4CGL A;  3NE7 A;  3S6F A;  3PB4 X;  3LD2 A;  4CGM A;  2ZOG A;  4A94 A;  1IID A;  1S3Z A;  2REE A;  4P4J A;  4AG7 A;  1QQ9 A;  4EFD A;  4XPK A;  2FIW A;  3B35 A;  4R9M A;  4JWP A;  4BIN A;  4LX9 A;  2PJ7 A;  1R43 A;  4DUK A;  2JEW A;  1YRE A;  3PP9 A;  4MCQ A;  4QUS A;  4KS9 A;  3W6X A;  3FED A;  2OB0 A;  5HVF A;  5EMI A;  5LYI A;  2R8V A;  3EY5 A;  3SJF A;  1I21 A;  3IWE A;  2PJ2 A;  1F57 A;  3D3S A;  4LQG A;  2PSW A;  4W9Y A;  1CM0 A;  3CPX A;  4E0A A;  3BJ7 A;  4X2T A;  3UY5 A;  4EWT A;  3SI2 A;  1CP7 A;  1NSA A;  1J4J A;  3TC8 A;  1F2P A;  4AG9 A;  1IU8 A;  5K8P A;  3CT9 A;  2G9D A;  3I1U A;  4CRY B;  1M4I A;  4HNX B;  2YNC C;  2Z3P A;  3FJU A;  3QB8 A;  3KQZ A;  1AYE A;  4B10 A;  4XNH C;  3GY9 A;  3R9G A;  4UA3 A;  4PK3 A;  4ZGY B;  4B5P B;  2FS5 A;  3CDX A;  3L2N A;  4Q36 A;  4KVO E;  3DR8 A;  2PRQ A;  4L8A A;  4FD6 A;  4AB7 A;  4Y49 C;  2QJ8 A;  2F7V A;  4KOX A;  1Q7L A;  5E96 A;  1ZO0 A;  3BXM A;  2I00 A;  3BHX A;  2AFZ A;  4P4F A;  2ZEN A;  3D7F A;  3DR6 A;  3LMS A;  3S9M A;  4HPS A;  2PC1 A;  2WZN A;  3D7D A;  4NF1 A;  4XPD C;  1IY7 A;  4RI1 A;  4KSF A;  3LAC A;  2DXQ A;  2PJ6 A;  1BOB A;  3JUW A;  1S7K A;  5AG7 A;  4UBR A;  3PRT A;  4FAI A;  3D2P A;  4FD7 A;  2JDC A;  4OC3 A;  4Z65 A;  2ZEF A;  3IEH A;  4UEE A;  4A30 A;  4C2Z A;  1ZG8 A;  4GM5 A;  2PJC A;  4HNY B;  3FVL A;  3SI0 A;  4KUB A;  1Z4R A;  2POK A;  3PEI A;  2GAN A;  2OH1 A;  3TX8 A;  4NEX A;  2Z3K A;  4CYN A;  4KOS A;  4X3R A;  5J8C A;  1TXR A;  2B58 A;  4KLW A;  3EXN A;  1ZLH A;  4C68 A;  4M6I A;  2ARH A;  1MK4 A;  1FY7 A;  2B4D B;  3CXP A;  3VH9 A;  3A9L A;  3DDD A;  2Z3L A;  1HDQ A;  3B3V A;  3F8K A;  3H8F A;  1YW6 A;  4KOW A;  1Z9U A;  3C26 A;  3JVN A;  4OC1 A;  1CP6 A;  3PB8 X;  1VGY A;  4C7H A;  3F5B A;  5CPA A;  2CXA A;  2V8G A;  2F8H A;  2P6E A;  3RO0 A;  2OZU A;  4J3G A;  3RBU A;  3TCV A;  4ZBG A;  1ARL A;  3NH4 A;  4R6T A;  2Z3N A;  3KHZ A;  3W91 A;  4MHD A;  2V8V A;  3WAB A;  4MRI A;  2QML A;  2OU2 A;  4BD9 A;  3TE4 A;  2J8M A;  5JH9 A;  4OC5 A;  4UFX A;  3S6K A;  1XMT A;  4CGN A;  3NFZ A;  3SJG A;  5F46 A;  1IYK A;  3BI1 A;  3GLJ A;  2V8H A;  5LRG A;  4AVB A;  1Y9W A;  2ATR A;  3TT2 A;  3IU2 A;  2OOT A;  1KUV A;  4KOV A;  2DEA A;  1A2Z A;  3BJ8 A;  2PR8 A;  3N7Z A;  3PZJ A;  4LUA A;  4CAW A;  2X7B A;  3QAY A;  2AE6 A;  3DLJ A;  4NSQ A;  2VXK A;  2EBJ A;  4C7I A;  5HMN A;  5AG4 A;  5JGF A;  3S9N A;  1ARM A;  3GUX A;  2V8D A;  2GU2 A;  2ABZ A;  3BI0 A;  2GIV A;  3R1K A;  2FXF A;  2PQ8 A;  1F2O A;  3FRM A;  1NE9 A;  4CAE A;  2G3A A;  4UCM A;  4ZY0 A;  2ZEL A;  4IHM A;  3P2F A;  1CG2 A;  1ON0 A;  1BO4 A;  3NE8 A;  4X8I A;  4A32 A;  5I0C A;  3K2K A;  5LYL A;  4KOY A;  5HVH A;  2XEG A;  1MJA A;  2A4N A;  2VZY A;  3KI9 A;  4KVM E;  4M6G A;  5IV0 A;  1BLL E;  2PVV A;  3TFY A;  4NGN A;  2PDO A;  4P4I A;  1QSN A;  3FIX A;  4MY3 A;  3PGP A;  3G3S A;  1L0C A;  1Z5R A;  2IJZ A; 
#chains in the Genus database with same CATH homology
 5FVJ A;  1S5K A;  2DPT A;  4AVC A;  3FB3 A;  5BWA B;  3K9U A;  3SXN A;  5H84 A;  2Q4V A;  4DNC A;  2KCW A;  4OAE A;  4UWJ A;  4K30 A;  3QAH A;  4NCZ A;  1M4G A;  2YNE A;  3V8I A;  3T90 A;  4B12 A;  1YLE A;  4QBJ A;  4ORF A;  2FSR A;  4MFP A;  3S6H A;  1B6B A;  3T9Y A;  2Q04 A;  2B4D A;  3D2M A;  1NSL A;  1Q2C A;  5HH1 A;  4E8O A;  3CXS A;  4R3K A;  2BSW A;  4ONU A;  4HNW B;  2B5G A;  2BEI A;  5DWN A;  4R3L A;  4Y49 B;  5G21 A;  4MI4 A;  3B8G A;  5EC4 A;  4M3S A;  4JJX A;  5G20 A;  4L89 A;  2EUI A;  4CYP A;  1MJ9 A;  2CNT A;  3LOD A;  3MGD A;  4XPD B;  2PRB A;  2VQY A;  5G22 A;  4KVX A;  1MJB A;  5KTA A;  1GHE A;  2FE7 A;  2HQY A;  3JTK A;  3R9E A;  1QST A;  1YX0 A;  4YGO A;  1S7N A;  4BMH A;  2FIA A;  2Q0Y A;  3OWC A;  4KOT A;  3SXO A;  2ZXV A;  5IB0 A;  4NXY A;  4R57 A;  1M1D A;  5AG5 A;  2JDD A;  2Q4Y A;  4EVY A;  5H86 A;  4KSA A;  4CYQ A;  1I12 A;  5C88 A;  4JXQ A;  1YVO A;  2G0B A;  2D4P A;  4AVA A;  3FNC A;  4UCP A;  4QVT A;  3R9F A;  4JLY A;  4C2X A;  5AGE A;  2YND A;  4PK2 A;  4RS2 A;  5A28 A;  4X5K A;  4MFK A;  3EFA A;  2OZH A;  5IX3 A;  2AJ6 A;  4PSW A;  4MFJ A;  2B3V A;  2QIR A;  4UWI A;  1M44 A;  5AG6 A;  3H5Z A;  4PSX A;  2BUE A;  3IWG A;  2ZW6 A;  2Z3O A;  4B5O A;  1IIC A;  1I1D A;  3GYA A;  3TO6 A;  4MFL A;  5GCN A;  3WR7 A;  1XE4 A;  2R7H A;  3ZJ0 A;  2WPW A;  3TOB A;  2CNM A;  1KUY A;  3I9S A;  3FBU A;  1VHS A;  4MBU A;  4U5Y A;  5JQ4 A;  1R57 A;  4R87 A;  4F6A A;  5J8F A;  1S7L A;  4OAD A;  4U9Y A;  1IYL A;  4F0X A;  2CNS A;  1PUA A;  1Q2D A;  2K5T A;  2WSA A;  2VEZ A;  4UCN A;  2RC4 A;  2FT0 A;  3TO9 A;  1NMT A;  1S7F A;  2Q44 A;  4MY0 A;  1UFH A;  4KOU A;  1IB1 E;  1QSM A;  4B13 A;  1U6M A;  1RO5 A;  5KTD A;  3FYN A;  1P0H A;  1M4D A;  3KKW A;  1S60 A;  4C2Y A;  3H4Q A;  1YGH A;  1KZF A;  2VI7 A;  5F47 A;  4A33 A;  4A95 A;  3TTH A;  2Q7B A;  4B14 A;  2EVN A;  1XEB A;  1CJW A;  3TOA A;  4M85 A;  2B3U A;  5EBV A;  2ZW7 A;  4JXR A;  4MJ8 A;  2J8R A;  4CRZ B;  5CNP A;  4XNH B;  3EO4 A;  2ZW4 A;  1OZP A;  2P6G A;  2Z3M A;  2J8N A;  2CY2 A;  4HKF A;  4A31 A;  3W6S A;  3R96 A;  5JPH A;  4H6U A;  4I49 A;  1N71 A;  1QSR A;  3I3G A;  3VWD A;  3F0A A;  3GKR A;  4FD5 A;  2ZW5 A;  3S6G A;  2PR1 A;  4UFW A;  3FXT A;  2H5M A;  4UFV A;  1KUX A;  4FD4 A;  1YR0 A;  2I79 A;  2DPS A;  1B87 A;  4E2A A;  2B4B A;  2P6F A;  4BBH A;  2Z11 A;  3ZZI A;  4B11 A;  5A27 A;  2Z0Z A;  5C82 A;  4KZT A;  2C27 A;  1K4J A;  1YVK A;  1SQH A;  3SHP A;  1WK4 A;  2IL4 A;  5KTC A;  2HUZ A;  2FL4 A;  1TIQ A;  4YRH A;  4QC6 A;  4U9Z A;  3BLN A;  4B5P A;  4YFJ A;  2Y0M A;  2JEV A;  5F48 A;  4A2Z A;  4CGO A;  1Y7R A;  1WWZ A;  2G3T A;  4JD6 A;  3RYO A;  3TO7 A;  2REF A;  2GE3 A;  3EC4 A;  4KUA A;  2OZG A;  1QSO A;  3D8P A;  1XF8 A;  4QB9 A;  1XIX A;  4H6Z A;  2B5G B;  4GS4 A;  4MFZ A;  4H89 A;  3DSB A;  2VBQ A;  2BL1 A;  4OLL A;  4CGP A;  4XPL A;  4CS0 B;  3CXQ A;  3E0K A;  1LRZ A;  2P0W A;  1Y9K A;  4F0Y A;  1PU9 A;  4IUS A;  2WUU A;  5G1Z A;  4CAX A;  3VWE A;  2QEC A;  5ISV A;  1Q2Y A;  4MFQ A;  1P4N A;  3G8W A;  4CYO A;  4II9 A;  2FCK A;  2YNC A;  4KLV A;  4CAV A;  2R1I A;  1VKC A;  4PV6 A;  4IF5 A;  4KOR A;  2HV2 A;  2D4O A;  3DNS A;  2R98 A;  1Z4E A;  2VZZ A;  2ZPA A;  1V0C A;  3IGR A;  4CAF A;  2YGW A;  3R95 A;  4Q38 A;  5DWM A;  2F5I A;  1YK3 A;  2NMT A;  2O28 A;  2JLM A;  2WPX A;  1RXT A;  3IU1 A;  3P2H A;  2Z10 A;  5F49 A;  4CGL A;  3NE7 A;  3S6F A;  4CGM A;  3LD2 A;  1IID A;  1S3Z A;  2REE A;  4AG7 A;  4XPK A;  2FIW A;  4R9M A;  4JWP A;  4LX9 A;  1YRE A;  3PP9 A;  4QUS A;  4KS9 A;  3W6X A;  2OB0 A;  2R8V A;  3EY5 A;  1I21 A;  3IWE A;  3D3S A;  2PSW A;  1CM0 A;  4E0A A;  3BJ7 A;  3UY5 A;  1J4J A;  4AG9 A;  4CRY B;  1M4I A;  4HNX B;  2YNC C;  2Z3P A;  3QB8 A;  4B10 A;  4XNH C;  3GY9 A;  3R9G A;  4UA3 A;  4PK3 A;  4ZGY B;  4B5P B;  2FS5 A;  4AB7 A;  4Q36 A;  4KVO E;  3DR8 A;  4L8A A;  4FD6 A;  4Y49 C;  5E96 A;  4KOX A;  1ZO0 A;  2I00 A;  3DR6 A;  4NF1 A;  2PC1 A;  4XPD C;  4RI1 A;  4KSF A;  2DXQ A;  1BOB A;  3JUW A;  1S7K A;  5AG7 A;  4UBR A;  3D2P A;  4FD7 A;  2JDC A;  4A30 A;  4C2Z A;  4HNY B;  4KUB A;  1Z4R A;  2GAN A;  2OH1 A;  4NEX A;  2Z3K A;  4CYN A;  4KOS A;  5J8C A;  2B58 A;  4KLW A;  3EXN A;  4C68 A;  3CXP A;  1MK4 A;  1FY7 A;  2ARH A;  2B4D B;  3A9L A;  3DDD A;  2Z3L A;  3F8K A;  4KOW A;  1Z9U A;  3C26 A;  3JVN A;  4C7H A;  3F5B A;  2CXA A;  2P6E A;  2OZU A;  4J3G A;  3TCV A;  4ZBG A;  2Z3N A;  3W91 A;  4MHD A;  2QML A;  2OU2 A;  3TE4 A;  2J8M A;  3S6K A;  4UFX A;  1XMT A;  4CGN A;  5F46 A;  1IYK A;  4AVB A;  1Y9W A;  2ATR A;  3TT2 A;  3IU2 A;  1KUV A;  4KOV A;  4LUA A;  3BJ8 A;  3N7Z A;  2PR8 A;  4CAW A;  3PZJ A;  2X7B A;  2AE6 A;  4NSQ A;  2VXK A;  4C7I A;  5HMN A;  5AG4 A;  2GIV A;  3R1K A;  2FXF A;  2PQ8 A;  3FRM A;  1NE9 A;  4CAE A;  2G3A A;  4UCM A;  3P2F A;  1ON0 A;  1BO4 A;  4A32 A;  5I0C A;  4KOY A;  1MJA A;  2A4N A;  2VZY A;  4KVM E;  5IV0 A;  3TFY A;  2PDO A;  1QSN A;  3FIX A;  4MY3 A;  3PGP A;  3G3S A;  1L0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...