3A9LA

Structure of bacteriophage poly-gamma-glutamate hydrolase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
207
structure length
207
Chain Sequence
TDTYPNIEALENAETVGVAYNIEVKRQNPSMIYFSPHAGGIEVGTTELIYRVVELTGGSLYLFQGLLPSGNSRLHVTSTHFDEPMAVCMLSKHTDAVSFHGYKDDYNKNTLVGGLNTELRNLIVSKLNSKGIAAEVATDRFTATDPDNIVNRCASGKGVQLEISSAQRRAFFQNNDWSKANRGNVTQEFLDYAEAIKEAEAEYYGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Poly-gamma-glutamate hydrolase
publication title Crystal structure of bacteriophage PhiNIT1 zinc peptidase PghP that hydrolyzes gamma-glutamyl linkage of bacterial poly-gamma-glutamate
pubmed doi rcsb
source organism Bacillus phage phinit1
total genus 79
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05908 Gamma_PGA_hydro Poly-gamma-glutamate hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.100 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3a9lA00
3A9LA
chains in the Genus database with same CATH superfamily
5IX3A 3EC4A 1YW4A 2PIZA 2PRBA 4M85A 3WC7A 2KCWA 1VHSA 5CPAA 3QB8A 1OBRA 2YNEA 4FAIA 1YW6A 3R9FA 3V7ZA 4BMHA 3IC1A 1MJAA 2ZW6A 4NGSA 3VH9A 4UEFA 5I4MA 4YU9A 1KZFA 2HC9A 3FVLA 1FY7A 2YNCA 7CPAA 4OIWA 4B12A 4FD6A 2BCOA 3GYAA 3PBBA 2Q7BA 3VWDA 5GCNA 4NGNA 2ODFA 2BOAA 3SJXA 1Z8WA 1CG2A 4X8IA 2JDDA 4UWJA 3VWEA 3ISZA 4JXQA 2PJ4A 4FUUA 4NGRA 4ZX8A 1S7LA 2FL4A 5HMNA 2EBJA 3D7GA 4F6AA 4YFJA 4XNHC 4A38A 2NMTA 3PP9A 1XE4A 3WR7A 4GS4A 3DSBA 2FCKA 3TO6A 4B13A 4CAWA 2VXKA 1S7KA 2QECA 2RB7A 3KHXA 4BBHA 4CPAA 2ABZA 4F0XA 3GKRA 2IMOA 4R6TA 1JWQA 2PC1A 3IWWA 4ZI6A 4OC4A 4UIAA 2AFMA 4OAEA 2ATRA 2RFHA 2ZOFA 4KSIA 4UCNA 5CBMA 2BO9A 3FH4A 4JXRA 1IOFA 2VL1A 5H84A 1XMBA 4E8OA 2FIWA 3TFYA 4PK3A 5HVHA 3P2HA 4R57A 4B6ZA 2R8VA 2ANPA 3K9UA 3NH8A 5IB9A 1I12A 2NSMA 3TOBA 1Q2YA 3K9TA 2V8GA 1M4IA 4ZX9A 2V8HA 4EVYA 4MY0A 2ZW7A 4KOSA 4B5OA 2Q4VA 1IYLA 3IU2A 1X10A 1S3ZA 1LANA 4NGQA 1FT7A 2OZGA 4UWIA 2PR8A 4UCPA 3TTHA 5DWMA 3NA6A 1YR0A 2IQ6A 1QSMA 3SXNA 4KOUA 4MHYA 1KWMA 4C2ZA 2CY2A 4IK2A 2EUIA 4YGOA 3CXSA 3IEHA 4QVTA 3L2NA 3RYOA 2O28A 2Z11A 4PXDA 5G20A 2Z3LA 4YWYA 4A32A 4R9MA 3FF3A 3KQZA 2FIAA 1M1DA 3KQXA 4NEXA 4F9VA 3BHXA 2JEVA 3B2YA 4R7MA 4CRZB 1M44A 1ELLP 4MCPA 2JEWA 2PIYA 1CPXA 2ZPAA 4OC3A 2Z10A 2FXFA 4Q38A 1HDUA 3S6GA 2PJ5A 2WPXA 1S60A 1RTQA 1BPNA 4MMOA 2C6GA 3C26A 4KZTA 1JQGA 2HUZA 2VZYA 3I3GA 4KOVA 4AG7A 2FVGA 2ZEFA 4U5YA 3JRUA 4P4EA 1HEEA 4KLWA 3IU1A 1VKCA 3W6XA 4JZ0A 4L8AA 4MHNA 4PSWA 5J8FA 3S9MA 4KSFA 3B3VA 1IB1E 3SI1A 2ZEDA 3OWCA 4UF4A 2BEIA 1ZG9A 1XJOA 1TF9A 1IY7A 1M4GA 3A9LA 4K30A 4TNUA 5FVJA 3H8GA 4JYWA 4AVBA 2PDOA 4KOWA 2CNTA 4CRYB 4JWPA 2OZUA 3IWGA 1H8LA 1QSRA 3QAHA 4UFXA 2K5TA 4CAXA 2YNCC 4ZY2A 4CAFA 1Z8XA 5A27A 2C27A 1QQ9A 5JGFA 1XOVA 2C1CA 3DLJA 3KGQA 1M4LA 1ZLHA 1Z4RA 2OH1A 4P10A 3S9NA 2H5MA 4NXYA 4KOXA 1ON0A 1Z4EA 3NH5A 2HQYA 3V38A 3KHZA 3FEDA 1F2PA 4PXBA 5AG6A 4H6ZA 4O23A 3W91A 1N71A 3KR5A 1XIXA 2VI7A 1Y7RA 3JTKA 3DR8A 3IIBA 3PEIA 1TKJA 3DDDA 4GM5A 2PCUA 3RZAA 3I1UA 5LRKA 5D8NA 2X7BA 2J9AA 2AFUA 1Q2CA 2WZNA 4AVAA 5BWAB 2PJ2A 4P44A 2R98A 2Z3NA 1NE9A 3IWEA 4OIDA 4MFJA 3TO9A 2Q43A 2IL4A 2C6PA 5D29A 5JPHA 5JQ4A 5DS0A 3HUVA 3WT4A 4OC0A 4P4FA 4CGOA 1ZLIA 4LQGA 2GIVA 2BUEA 1SQHA 4KUBA 4HNWB 4R3KA 3V8IA 4LX9A 2Q0YA 4MFQA 1TF8A 2ZEOA 3FRMA 4KOTA 2EVNA 4KSAA 2IJZA 4MHDA 4UA3A 5H86A 4ZY1A 4ONUA 2PR1A 3BXMA 2ZW5A 4OC1A 2HB6A 3R1KA 2CNMA 2B5GA 4CAEA 4E2AA 3TE4A 4CYQA 2B4DA 3MGDA 1QSNA 3MRUA 1Y9KA 1S7FA 1Y9WA 1AMPA 4MI4A 4K3NA 1XFOA 3T90A 3ZJ0A 2B5GB 3B35A 1R43A 4XPDB 3FBUA 2ZEGA 1Y0YA 4UBRA 1BOBA 4UFWA 1DE4C 2O53A 3PB4X 2OOTA 4KVME 3EY5A 1B87A 3KASA 4U9YA 1ZO0A 2Z3KA 1ELMP 1S5KA 4X2TA 2PJ7A 2PJBA 2AFSA 2OB0A 3LD2A 4OP4A 2WPWA 2CIJA 4G1PA 1QSOA 3EFAA 2R1IA 3SI2A 4A39A 2FT0A 2XEJA 5LRJA 2XEIA 3PFOA 4NSQA 3TT2A 5HVGA 1CP7A 1F57A 1UWYA 3D8PA 4MJ8A 4R76A 5LRGA 2O4HA 4A94A 3GUXA 5AG4A 4MCRA 1S7NA 2ZOGA 5F09A 3D67A 1CP6A 2B3UA 1QSTA 2Z3MA 1LCPA 1TIQA 4C68A 3TOAA 3NFZA 3SJEA 2AFZA 4DYOA 5F49A 4JJXA 2XEFA 3KI9A 4IAVA 5F46A 2GREA 2WUUA 3IO1A 3FXTA 2QVPA 4Q7AA 5AGEA 4HNXB 3ZZIA 4CYOA 1P0HA 2AFWA 4UIBA 1PUAA 2GLFA 3B7IA 3D2MA 4PSXA 4I49A 4W9YA 2G0BA 4ZGYB 2Z0ZA 5DWNA 4PQAA 3JVNA 1XEBA 1BAVA 2V77A 3IFEA 3PB9X 3PRTA 4GXHA 1KUVA 4OLLA 1YLEA 4MY3A 2FE7A 4KS9A 3CXPA 3RBUA 1OZPA 1LAMA 2Z3PA 3BJ8A 2QMLA 4DNCA 2PVVA 5CNPA 5KTAA 1L0CA 4NF1A 4H89A 4II9A 4A31A 1Q7LA 4OC2A 1AYEA 4KVOE 4R8FA 4CGPA 4OC5A 4RN7A 4HNYB 1M4DA 4B11A 1XBUA 3FECA 5J1QA 4C2XA 1CPSA 5I0CA 3T9YA 5KTDA 1RO5A 5K8NA 3H8EA 2EO8A 4FWUA 1HDQA 5LYFA 5A28A 3BI0A 3H5ZA 4MBUA 2V8DA 4Z65A 3LWUA 3P2FA 3LODA 4QB9A 1I1DA 4EMEA 4H2KA 2DPSA 3BLNA 6CPAA 4ZYQA 1IU8A 4HPSA 1TKFA 1YVOA 4CGNA 1WWZA 4KORA 2PJ6A 4CYPA 3CXQA 1A2ZA 2CTBA 5JH9A 3CT9A 4PPZA 4PXEA 1IGBA 4CAVA 2PJ0A 4NJQA 4IHMA 2G3TA 1IOIA 1KUXA 2OZHA 3N7ZA 1IICA 2JBJA 2REEA 4L89A 4XPKA 4B14A 2AFOA 4AB7A 4AXVA 3QAYA 1B6BA 3FMCA 4CYNA 3KKWA 4KUAA 4JLYA 3D3SA 1TXRA 5LYDA 4PV6A 5EMIA 1ARMA 4OMEA 1Y7EA 5G1ZA 3SJFA 2GU2A 2PJCA 2NYQA 3FEEA 3KL9A 2Q44A 1K4JA 3KR4A 5F48A 2F8HA 5C82A 1BLLE 2ZW4A 2QJ8A 4MFKA 4A37A 4HKFA 4CGMA 1Z8TA 3S6FA 1NSAA 4FD4A 2WYRA 4AVCA 2C6CA 4M6IA 2CF4A 3QNVA 4CGLA 2JLMA 3N5FA 4XPDC 1NSLA 1GYTA 4NFRA 3EO4A 1YREA 1PYTB 4E0AA 2QIRA 3S6HA 4H6UA 4J3GA 5LYLA 3DNSA 3F0AA 3G3SA 3PB7X 1Z5RA 4MHZA 4RS2A 1I21A 2GE3A 1XRYA 2Q04A 3IGRA 4UFVA 3RO0A 3LACA 3NE7A 4F0YA 1PU9A 2J8RA 3DR6A 5JM6A 4A30A 4NJRA 3RNZA 1YVKA 4C7HA 2PJAA 2P6EA 5ELYA 3BJ7A 2AJ6A 4BD9A 3GY9A 3WABA 1NMTA 3TC8A 1LAPA 4M3SA 3ISXA 3WC5A 1TKHA 3RAMA 4MFZA 4Y49B 3F5BA 4OADA 3D66A 3FJUA 3D7DA 4EWTA 2B4DB 2R7HA 3B3CA 3EXNA 4P4DA 3CZXA 2DF5A 2WSAA 3IJ3A 3CPXA 5C88A 1ZG8A 3SJGA 4WJBA 3CPAA 3GLJA 3PZJA 1EE3P 4M6HA 5HVFA 3R9EA 4C2YA 1FNOA 2P6FA 1J4JA 4P45A 4XPLA 5HXDA 1XF8A 2ZENA 2CNSA 2VBQA 4MCSA 3FB3A 1ARLA 3F8KA 1GHEA 2CTCA 2A4NA 2JDCA 2ZELA 3B3TA 1X12A 2ZXVA 3D4UA 1DTDA 1Z8LA 2PJ1A 2ARHA 4OKOA 4ORFA 4KVXA 3K2KA 4QBJA 2I79A 4LQ6A 2YGWA 3D68A 2XEGA 4YRHA 5THWA 3SHPA 2AFXA 2I3CA 1U6MA 2REFA 4MFLA 4MCQA 2VZZA 5AG7A 5LYIA 4NGMA 1AUGA 4DJLA 2ZEEA 1RXTA 3FYNA 4NGTA 5IB0A 5G22A 4F8ZA 2HV2A 5F47A 3CDXA 1KUYA 4X5KA 4QUSA 3D7FA 4TWEA 4BINA 4A2ZA 5KTCA 4R3LA 2V8VA 4PXCA 4P4IA 4RI1A 1VGYA 2Z3OA 3R95A 2B4BA 3H4QA 2FSRA 2AE6A 4MRIA 3VARA 1Y0RA 2EWBA 3B8GA 2PJ8A 1YLOA 3R9GA 5IV0A 1IIDA 1ZG7A 4XNHB 4P4JA 1CX8A 3FNCA 2VQYA 2G3AA 3H8FA 3JUWA 3B3WA 4UEZA 5K8PA 5ISVA 3LMSA 4ONWA 1IYKA 4RUHA 5G21A 3W6SA 4FBEA 2PJ3A 3SI0A 1VIXA 3DGVA 3D7HA 4M6GA 1YQEA 3PBEA 1YMEA 4FD7A 2QYVA 3MN8A 3T8WA 3S6KA 3VATA 4A33A 2YNDA 2DEAA 2ZEPA 3B3SA 4IUSA 4KOYA 3R96A 3FX6A 1XMTA 2OU2A 4PK2A 3NH4A 1R3NA 2Q4ZA 3G8WA 4LUAA 1Q2DA 3TO7A 3KZWA 3GB0A 5EBVA 3E0KA 2GFQA 1R57A 2D4PA 2J8MA 2D4OA 4NCZA 2Y0MA 3WC6A 5K8OA 1MK4A 1LRZA 4NGPA 4MHPA 2POKA 2B58A 2F7VA 4FD5A 4X3RA 1YX0A 3FIXA 3PB6X 4WWVA 4B5PA 4P4BA 2P0WA 1CJWA 2I00A 5E96A 2CXAA 1MJ9A 1WK4A 3S9LA 2FS5A 2DPTA 4B5PB 3TCVA 2PQ8A 1V0CA 2PRQA 3D2PA 1YGHA 2P6GA 2Q7SA 2ZEHA 3PFEA 3UY5A 1Z9UA 2BL1A 4B10A 1MJBA 1BO4A 1LOKA 5EC4A 4IF5A 1F2OA 1YSJA 4C7IA 5HH1A 4DUKA 2OR4A 2B3VA 4MXUA 2F5IA 5AG5A 4ZY0A 2GANA 2G9DA 2Q4YA 2RC4A 4U9ZA 4Y49C 4UEEA 2PSWA 4KLVA 1CBXA 2J8NA 3PGPA 3PB8X 2Q51A 1UFHA 2BSWA 3BI1A 3NE8A 4A95A 2PJ9A 2GLJA 3I9SA 4JD6A 5J8CA 1QMUA 4F9UA 2PE3A 3HLPA 4UCMA 2EK9A 1CM0A 2PVWA 4P6YA 1VHOA 1YK3A 3SXOA 4CS0B 1Z2LA 2VEZA 3TX8A 3GIUA 5K8MA 4Q36A 1BPMA 4EFDA 1VHEA 1P4NA 4AG9A 2EK8A 2JBKA 4MFPA 4ZBGA 1LFWA 2ZEMA 8CPAA 2DXQA 4QC6A 4R87A 1PCAA
chains in the Genus database with same CATH topology
5IX3A 3EC4A 2PRBA 4M85A 2KCWA 1VHSA 3QB8A 2YNEA 3R9FA 4BMHA 1MJAA 2ZW6A 1KZFA 1FY7A 2YNCA 4B12A 4FD6A 3GYAA 2Q7BA 3VWDA 5GCNA 2JDDA 4UWJA 3VWEA 4JXQA 1S7LA 2FL4A 5HMNA 4F6AA 4YFJA 4XNHC 2NMTA 3PP9A 1XE4A 3WR7A 4GS4A 3DSBA 2FCKA 3TO6A 4B13A 4CAWA 2VXKA 1S7KA 2QECA 4BBHA 4F0XA 3GKRA 2PC1A 4OAEA 2ATRA 4UCNA 4JXRA 5H84A 4E8OA 2FIWA 3TFYA 4PK3A 3P2HA 4R57A 2R8VA 3K9UA 1I12A 3TOBA 1Q2YA 1M4IA 4EVYA 4MY0A 2ZW7A 4KOSA 4B5OA 2Q4VA 1IYLA 3IU2A 1S3ZA 4UWIA 2OZGA 2PR8A 4UCPA 3TTHA 5DWMA 1YR0A 1QSMA 3SXNA 4KOUA 4C2ZA 2CY2A 2EUIA 4YGOA 3CXSA 4QVTA 3RYOA 2O28A 2Z11A 5G20A 2Z3LA 4A32A 4R9MA 2FIAA 1M1DA 4NEXA 2JEVA 4CRZB 1M44A 2ZPAA 4Q38A 2Z10A 2FXFA 3S6GA 2WPXA 1S60A 3C26A 4KZTA 2HUZA 2VZYA 3I3GA 4KOVA 4AG7A 4U5YA 4KLWA 3IU1A 1VKCA 3W6XA 4L8AA 4PSWA 5J8FA 4KSFA 1IB1E 3OWCA 2BEIA 4K30A 1M4GA 3A9LA 5FVJA 4AVBA 2PDOA 4KOWA 2CNTA 4CRYB 4JWPA 2OZUA 3IWGA 1QSRA 3QAHA 4UFXA 2K5TA 4CAXA 2YNCC 4CAFA 5A27A 2C27A 1Z4RA 2OH1A 2H5MA 4NXYA 4KOXA 1ON0A 1Z4EA 2HQYA 5AG6A 3W91A 4H6ZA 1N71A 1XIXA 2VI7A 1Y7RA 3JTKA 3DR8A 3DDDA 2X7BA 1Q2CA 4AVAA 5BWAB 2R98A 2Z3NA 1NE9A 3IWEA 3TO9A 4MFJA 2IL4A 5JPHA 5JQ4A 4CGOA 2GIVA 2BUEA 1SQHA 4KUBA 4HNWB 4R3KA 3V8IA 4LX9A 2Q0YA 4MFQA 4KSAA 3FRMA 4KOTA 2EVNA 4MHDA 4UA3A 5H86A 4ONUA 2PR1A 2ZW5A 3R1KA 2CNMA 2B5GA 4CAEA 4E2AA 3TE4A 4CYQA 2B4DA 3MGDA 1QSNA 1Y9KA 1S7FA 1Y9WA 4MI4A 3T90A 3ZJ0A 2B5GB 4XPDB 3FBUA 4UBRA 1BOBA 4UFWA 4KVME 3EY5A 1B87A 4U9YA 1ZO0A 2Z3KA 1S5KA 2OB0A 3LD2A 5J8CA 2WPWA 1QSOA 3EFAA 2R1IA 2FT0A 4NSQA 3TT2A 3D8PA 4MJ8A 5AG4A 1S7NA 2B3UA 1QSTA 2Z3MA 4C68A 1TIQA 3TOAA 5F49A 4JJXA 5F46A 2WUUA 5AGEA 3FXTA 4HNXB 3ZZIA 4CYOA 1P0HA 1PUAA 3D2MA 4PSXA 4I49A 2G0BA 4ZGYB 2Z0ZA 5DWNA 3JVNA 1XEBA 1KUVA 4OLLA 1YLEA 4MY3A 2FE7A 4KS9A 3CXPA 1OZPA 2Z3PA 3BJ8A 2QMLA 4DNCA 5CNPA 5KTAA 1L0CA 4NF1A 4H89A 4II9A 4A31A 4KVOE 4CGPA 4HNYB 1M4DA 4B11A 4C2XA 5I0CA 3T9YA 5KTDA 1RO5A 5A28A 3H5ZA 4MBUA 3P2FA 3LODA 4QB9A 1I1DA 2DPSA 3BLNA 1YVOA 4CGNA 1WWZA 4KORA 4CYPA 3CXQA 4CAVA 2G3TA 1KUXA 2OZHA 3N7ZA 1IICA 2REEA 4L89A 4XPKA 4B14A 4AB7A 1B6BA 4CYNA 3KKWA 4KUAA 4JLYA 3D3SA 4PV6A 5G1ZA 2Q44A 1K4JA 5F48A 5C82A 4MFKA 2ZW4A 4HKFA 4CGMA 3S6FA 4FD4A 4AVCA 4CGLA 2JLMA 4XPDC 1NSLA 3EO4A 1YREA 4E0AA 2QIRA 3S6HA 4H6UA 4J3GA 3DNSA 3F0AA 3G3SA 4RS2A 1I21A 2GE3A 2Q04A 4UFVA 3IGRA 3NE7A 4F0YA 1PU9A 2J8RA 3DR6A 4A30A 1YVKA 4C7HA 2P6EA 3BJ7A 2AJ6A 3GY9A 1NMTA 4M3SA 4MFZA 4Y49B 3F5BA 4OADA 2B4DB 2R7HA 3EXNA 2WSAA 5C88A 4C2YA 3PZJA 3R9EA 2P6FA 1J4JA 4XPLA 1XF8A 2CNSA 2VBQA 3FB3A 3F8KA 1GHEA 2A4NA 2JDCA 2ZXVA 2ARHA 4ORFA 4KVXA 4QBJA 2I79A 2YGWA 4YRHA 3SHPA 2REFA 1U6MA 4MFLA 2VZZA 5AG7A 1RXTA 3FYNA 5IB0A 5G22A 2HV2A 5F47A 1KUYA 4X5KA 4QUSA 5KTCA 4A2ZA 4R3LA 4RI1A 2Z3OA 3R95A 2B4BA 3H4QA 2FSRA 2AE6A 3B8GA 3R9GA 5IV0A 1IIDA 4XNHB 3FNCA 2VQYA 2G3AA 3JUWA 5ISVA 1IYKA 5G21A 3W6SA 4FD7A 4A33A 3S6KA 2YNDA 4KOYA 4IUSA 3R96A 1XMTA 2OU2A 4PK2A 4LUAA 3G8WA 1Q2DA 3TO7A 5EBVA 3E0KA 1R57A 2D4PA 2J8MA 2D4OA 4NCZA 2Y0MA 1MK4A 1LRZA 2B58A 4FD5A 1YX0A 3FIXA 4B5PA 2P0WA 1CJWA 2I00A 5E96A 2CXAA 1MJ9A 1WK4A 2FS5A 2DPTA 4B5PB 3TCVA 2PQ8A 1V0CA 3D2PA 1YGHA 2P6GA 3UY5A 1Z9UA 2BL1A 4B10A 1MJBA 1BO4A 5EC4A 4IF5A 4C7IA 5HH1A 2B3VA 2F5IA 5AG5A 2GANA 2RC4A 2Q4YA 4U9ZA 4Y49C 2PSWA 4KLVA 2J8NA 3PGPA 1UFHA 2BSWA 4A95A 3I9SA 4JD6A 4UCMA 1CM0A 1YK3A 3SXOA 4CS0B 2VEZA 4Q36A 1P4NA 4AG9A 4MFPA 4ZBGA 2DXQA 4QC6A 4R87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A9L A; 
#chains in the Genus database with same CATH topology
 5IX3 A;  3EC4 A;  1YW4 A;  2PIZ A;  2PRB A;  4M85 A;  3WC7 A;  2KCW A;  1VHS A;  5CPA A;  3QB8 A;  1OBR A;  2YNE A;  4FAI A;  1YW6 A;  3R9F A;  3V7Z A;  4BMH A;  3IC1 A;  1MJA A;  2ZW6 A;  4NGS A;  3VH9 A;  4UEF A;  5I4M A;  4YU9 A;  1KZF A;  2HC9 A;  3FVL A;  1FY7 A;  2YNC A;  7CPA A;  4OIW A;  4B12 A;  4FD6 A;  2BCO A;  3GYA A;  3PBB A;  2Q7B A;  3VWD A;  5GCN A;  4NGN A;  2ODF A;  2BOA A;  3SJX A;  1Z8W A;  1CG2 A;  4X8I A;  2JDD A;  4UWJ A;  3VWE A;  3ISZ A;  4JXQ A;  2PJ4 A;  4FUU A;  4NGR A;  4ZX8 A;  1S7L A;  2FL4 A;  5HMN A;  2EBJ A;  3D7G A;  4F6A A;  4YFJ A;  4XNH C;  4A38 A;  2NMT A;  3PP9 A;  1XE4 A;  3WR7 A;  4GS4 A;  3DSB A;  2FCK A;  3TO6 A;  4B13 A;  4CAW A;  2VXK A;  1S7K A;  2QEC A;  2RB7 A;  3KHX A;  4BBH A;  4CPA A;  2ABZ A;  4F0X A;  3GKR A;  2IMO A;  4R6T A;  1JWQ A;  2PC1 A;  3IWW A;  4ZI6 A;  4OC4 A;  4UIA A;  2AFM A;  4OAE A;  2ATR A;  2RFH A;  2ZOF A;  4KSI A;  4UCN A;  5CBM A;  2BO9 A;  3FH4 A;  4JXR A;  1IOF A;  2VL1 A;  5H84 A;  1XMB A;  4E8O A;  2FIW A;  3TFY A;  4PK3 A;  5HVH A;  3P2H A;  4R57 A;  4B6Z A;  2R8V A;  2ANP A;  3K9U A;  3NH8 A;  5IB9 A;  1I12 A;  2NSM A;  3TOB A;  1Q2Y A;  3K9T A;  2V8G A;  1M4I A;  4ZX9 A;  2V8H A;  4EVY A;  4MY0 A;  2ZW7 A;  4KOS A;  4B5O A;  2Q4V A;  1IYL A;  3IU2 A;  1X10 A;  1S3Z A;  1LAN A;  4NGQ A;  1FT7 A;  2OZG A;  4UWI A;  2PR8 A;  4UCP A;  3TTH A;  5DWM A;  3NA6 A;  1YR0 A;  2IQ6 A;  1QSM A;  3SXN A;  4KOU A;  4MHY A;  1KWM A;  4C2Z A;  2CY2 A;  4IK2 A;  2EUI A;  4YGO A;  3CXS A;  3IEH A;  4QVT A;  3L2N A;  3RYO A;  2O28 A;  2Z11 A;  4PXD A;  5G20 A;  2Z3L A;  4YWY A;  4A32 A;  4R9M A;  3FF3 A;  3KQZ A;  2FIA A;  1M1D A;  3KQX A;  4NEX A;  4F9V A;  3BHX A;  2JEV A;  3B2Y A;  4R7M A;  4CRZ B;  1M44 A;  1ELL P;  4MCP A;  2JEW A;  2PIY A;  1CPX A;  2ZPA A;  4OC3 A;  2Z10 A;  2FXF A;  4Q38 A;  1HDU A;  3S6G A;  2PJ5 A;  2WPX A;  1S60 A;  1RTQ A;  1BPN A;  4MMO A;  2C6G A;  3C26 A;  4KZT A;  1JQG A;  2HUZ A;  2VZY A;  3I3G A;  4KOV A;  4AG7 A;  2FVG A;  2ZEF A;  4U5Y A;  3JRU A;  4P4E A;  1HEE A;  4KLW A;  3IU1 A;  1VKC A;  3W6X A;  4JZ0 A;  4L8A A;  4MHN A;  4PSW A;  5J8F A;  3S9M A;  4KSF A;  3B3V A;  1IB1 E;  3SI1 A;  2ZED A;  3OWC A;  4UF4 A;  2BEI A;  1ZG9 A;  1XJO A;  1TF9 A;  1IY7 A;  1M4G A;  3A9L A;  4K30 A;  4TNU A;  5FVJ A;  3H8G A;  4JYW A;  4AVB A;  2PDO A;  4KOW A;  2CNT A;  4CRY B;  4JWP A;  2OZU A;  3IWG A;  1H8L A;  1QSR A;  3QAH A;  4UFX A;  2K5T A;  4CAX A;  2YNC C;  4ZY2 A;  4CAF A;  1Z8X A;  5A27 A;  2C27 A;  1QQ9 A;  5JGF A;  1XOV A;  2C1C A;  3DLJ A;  3KGQ A;  1M4L A;  1ZLH A;  1Z4R A;  2OH1 A;  4P10 A;  3S9N A;  2H5M A;  4NXY A;  4KOX A;  1ON0 A;  1Z4E A;  3NH5 A;  2HQY A;  3V38 A;  3KHZ A;  3FED A;  1F2P A;  4PXB A;  5AG6 A;  4H6Z A;  4O23 A;  3W91 A;  1N71 A;  3KR5 A;  1XIX A;  2VI7 A;  1Y7R A;  3JTK A;  3DR8 A;  3IIB A;  3PEI A;  1TKJ A;  3DDD A;  4GM5 A;  2PCU A;  3RZA A;  3I1U A;  5LRK A;  5D8N A;  2X7B A;  2J9A A;  2AFU A;  1Q2C A;  2WZN A;  4AVA A;  5BWA B;  2PJ2 A;  4P44 A;  2R98 A;  2Z3N A;  1NE9 A;  3IWE A;  4OID A;  4MFJ A;  3TO9 A;  2Q43 A;  2IL4 A;  2C6P A;  5D29 A;  5JPH A;  5JQ4 A;  5DS0 A;  3HUV A;  3WT4 A;  4OC0 A;  4P4F A;  4CGO A;  1ZLI A;  4LQG A;  2GIV A;  2BUE A;  1SQH A;  4KUB A;  4HNW B;  4R3K A;  3V8I A;  4LX9 A;  2Q0Y A;  4MFQ A;  1TF8 A;  2ZEO A;  3FRM A;  4KOT A;  2EVN A;  4KSA A;  2IJZ A;  4MHD A;  4UA3 A;  5H86 A;  4ZY1 A;  4ONU A;  2PR1 A;  3BXM A;  2ZW5 A;  4OC1 A;  2HB6 A;  3R1K A;  2CNM A;  2B5G A;  4CAE A;  4E2A A;  3TE4 A;  4CYQ A;  2B4D A;  3MGD A;  1QSN A;  3MRU A;  1Y9K A;  1S7F A;  1Y9W A;  1AMP A;  4MI4 A;  4K3N A;  1XFO A;  3T90 A;  3ZJ0 A;  2B5G B;  3B35 A;  1R43 A;  4XPD B;  3FBU A;  2ZEG A;  1Y0Y A;  4UBR A;  1BOB A;  4UFW A;  1DE4 C;  2O53 A;  3PB4 X;  2OOT A;  4KVM E;  3EY5 A;  1B87 A;  3KAS A;  4U9Y A;  1ZO0 A;  2Z3K A;  1ELM P;  1S5K A;  4X2T A;  2PJ7 A;  2PJB A;  2AFS A;  2OB0 A;  3LD2 A;  4OP4 A;  2WPW A;  2CIJ A;  4G1P A;  1QSO A;  3EFA A;  2R1I A;  3SI2 A;  4A39 A;  2FT0 A;  2XEJ A;  5LRJ A;  2XEI A;  3PFO A;  4NSQ A;  3TT2 A;  5HVG A;  1CP7 A;  1F57 A;  1UWY A;  3D8P A;  4MJ8 A;  4R76 A;  5LRG A;  2O4H A;  4A94 A;  3GUX A;  5AG4 A;  4MCR A;  1S7N A;  2ZOG A;  5F09 A;  3D67 A;  1CP6 A;  2B3U A;  1QST A;  2Z3M A;  1LCP A;  1TIQ A;  4C68 A;  3TOA A;  3NFZ A;  3SJE A;  2AFZ A;  4DYO A;  5F49 A;  4JJX A;  2XEF A;  3KI9 A;  4IAV A;  5F46 A;  2GRE A;  2WUU A;  3IO1 A;  3FXT A;  2QVP A;  4Q7A A;  5AGE A;  4HNX B;  3ZZI A;  4CYO A;  1P0H A;  2AFW A;  4UIB A;  1PUA A;  2GLF A;  3B7I A;  3D2M A;  4PSX A;  4I49 A;  4W9Y A;  2G0B A;  4ZGY B;  2Z0Z A;  5DWN A;  4PQA A;  3JVN A;  1XEB A;  1BAV A;  2V77 A;  3IFE A;  3PB9 X;  3PRT A;  4GXH A;  1KUV A;  4OLL A;  1YLE A;  4MY3 A;  2FE7 A;  4KS9 A;  3CXP A;  3RBU A;  1OZP A;  1LAM A;  2Z3P A;  3BJ8 A;  2QML A;  4DNC A;  2PVV A;  5CNP A;  5KTA A;  1L0C A;  4NF1 A;  4H89 A;  4II9 A;  4A31 A;  1Q7L A;  4OC2 A;  1AYE A;  4KVO E;  4R8F A;  4CGP A;  4OC5 A;  4RN7 A;  4HNY B;  1M4D A;  4B11 A;  1XBU A;  3FEC A;  5J1Q A;  4C2X A;  1CPS A;  5I0C A;  3T9Y A;  5KTD A;  1RO5 A;  5K8N A;  3H8E A;  2EO8 A;  4FWU A;  1HDQ A;  5LYF A;  5A28 A;  3BI0 A;  3H5Z A;  4MBU A;  2V8D A;  4Z65 A;  3LWU A;  3P2F A;  3LOD A;  4QB9 A;  1I1D A;  4EME A;  4H2K A;  2DPS A;  3BLN A;  6CPA A;  4ZYQ A;  1IU8 A;  4HPS A;  1TKF A;  1YVO A;  4CGN A;  1WWZ A;  4KOR A;  2PJ6 A;  4CYP A;  3CXQ A;  1A2Z A;  2CTB A;  5JH9 A;  3CT9 A;  4PPZ A;  4PXE A;  1IGB A;  4CAV A;  2PJ0 A;  4NJQ A;  4IHM A;  2G3T A;  1IOI A;  1KUX A;  2OZH A;  3N7Z A;  1IIC A;  2JBJ A;  2REE A;  4L89 A;  4XPK A;  4B14 A;  2AFO A;  4AB7 A;  4AXV A;  3QAY A;  1B6B A;  3FMC A;  4CYN A;  3KKW A;  4KUA A;  4JLY A;  3D3S A;  1TXR A;  5LYD A;  4PV6 A;  5EMI A;  1ARM A;  4OME A;  1Y7E A;  5G1Z A;  3SJF A;  2GU2 A;  2PJC A;  2NYQ A;  3FEE A;  3KL9 A;  2Q44 A;  1K4J A;  3KR4 A;  5F48 A;  2F8H A;  5C82 A;  1BLL E;  2ZW4 A;  2QJ8 A;  4MFK A;  4A37 A;  4HKF A;  4CGM A;  1Z8T A;  3S6F A;  1NSA A;  4FD4 A;  2WYR A;  4AVC A;  2C6C A;  4M6I A;  2CF4 A;  3QNV A;  4CGL A;  2JLM A;  3N5F A;  4XPD C;  1NSL A;  1GYT A;  4NFR A;  3EO4 A;  1YRE A;  1PYT B;  4E0A A;  2QIR A;  3S6H A;  4H6U A;  4J3G A;  5LYL A;  3DNS A;  3F0A A;  3G3S A;  3PB7 X;  1Z5R A;  4MHZ A;  4RS2 A;  1I21 A;  2GE3 A;  1XRY A;  2Q04 A;  3IGR A;  4UFV A;  3RO0 A;  3LAC A;  3NE7 A;  4F0Y A;  1PU9 A;  2J8R A;  3DR6 A;  5JM6 A;  4A30 A;  4NJR A;  3RNZ A;  1YVK A;  4C7H A;  2PJA A;  2P6E A;  5ELY A;  3BJ7 A;  2AJ6 A;  4BD9 A;  3GY9 A;  3WAB A;  1NMT A;  3TC8 A;  1LAP A;  4M3S A;  3ISX A;  3WC5 A;  1TKH A;  3RAM A;  4MFZ A;  4Y49 B;  3F5B A;  4OAD A;  3D66 A;  3FJU A;  3D7D A;  4EWT A;  2B4D B;  2R7H A;  3B3C A;  3EXN A;  4P4D A;  3CZX A;  2DF5 A;  2WSA A;  3IJ3 A;  3CPX A;  5C88 A;  1ZG8 A;  3SJG A;  4WJB A;  3CPA A;  3GLJ A;  3PZJ A;  1EE3 P;  4M6H A;  5HVF A;  3R9E A;  4C2Y A;  1FNO A;  2P6F A;  1J4J A;  4P45 A;  4XPL A;  5HXD A;  1XF8 A;  2ZEN A;  2CNS A;  2VBQ A;  4MCS A;  3FB3 A;  1ARL A;  3F8K A;  1GHE A;  2CTC A;  2A4N A;  2JDC A;  2ZEL A;  3B3T A;  1X12 A;  2ZXV A;  3D4U A;  1DTD A;  1Z8L A;  2PJ1 A;  2ARH A;  4OKO A;  4ORF A;  4KVX A;  3K2K A;  4QBJ A;  2I79 A;  4LQ6 A;  2YGW A;  3D68 A;  2XEG A;  4YRH A;  5THW A;  3SHP A;  2AFX A;  2I3C A;  1U6M A;  2REF A;  4MFL A;  4MCQ A;  2VZZ A;  5AG7 A;  5LYI A;  4NGM A;  1AUG A;  4DJL A;  2ZEE A;  1RXT A;  3FYN A;  4NGT A;  5IB0 A;  5G22 A;  4F8Z A;  2HV2 A;  5F47 A;  3CDX A;  1KUY A;  4X5K A;  4QUS A;  3D7F A;  4TWE A;  4BIN A;  4A2Z A;  5KTC A;  4R3L A;  2V8V A;  4PXC A;  4P4I A;  4RI1 A;  1VGY A;  2Z3O A;  3R95 A;  2B4B A;  3H4Q A;  2FSR A;  2AE6 A;  4MRI A;  3VAR A;  1Y0R A;  2EWB A;  3B8G A;  2PJ8 A;  1YLO A;  3R9G A;  5IV0 A;  1IID A;  1ZG7 A;  4XNH B;  4P4J A;  1CX8 A;  3FNC A;  2VQY A;  2G3A A;  3H8F A;  3JUW A;  3B3W A;  4UEZ A;  5K8P A;  5ISV A;  3LMS A;  4ONW A;  1IYK A;  4RUH A;  5G21 A;  3W6S A;  4FBE A;  2PJ3 A;  3SI0 A;  1VIX A;  3DGV A;  3D7H A;  4M6G A;  1YQE A;  3PBE A;  1YME A;  4FD7 A;  2QYV A;  3MN8 A;  3T8W A;  3S6K A;  3VAT A;  4A33 A;  2YND A;  2DEA A;  2ZEP A;  3B3S A;  4IUS A;  4KOY A;  3R96 A;  3FX6 A;  1XMT A;  2OU2 A;  4PK2 A;  3NH4 A;  1R3N A;  2Q4Z A;  3G8W A;  4LUA A;  1Q2D A;  3TO7 A;  3KZW A;  3GB0 A;  5EBV A;  3E0K A;  2GFQ A;  1R57 A;  2D4P A;  2J8M A;  2D4O A;  4NCZ A;  2Y0M A;  3WC6 A;  5K8O A;  1MK4 A;  1LRZ A;  4NGP A;  4MHP A;  2POK A;  2B58 A;  2F7V A;  4FD5 A;  4X3R A;  1YX0 A;  3FIX A;  3PB6 X;  4WWV A;  4B5P A;  4P4B A;  2P0W A;  1CJW A;  2I00 A;  5E96 A;  2CXA A;  1MJ9 A;  1WK4 A;  3S9L A;  2FS5 A;  2DPT A;  4B5P B;  3TCV A;  2PQ8 A;  1V0C A;  2PRQ A;  3D2P A;  1YGH A;  2P6G A;  2Q7S A;  2ZEH A;  3PFE A;  3UY5 A;  1Z9U A;  2BL1 A;  4B10 A;  1MJB A;  1BO4 A;  1LOK A;  5EC4 A;  4IF5 A;  1F2O A;  1YSJ A;  4C7I A;  5HH1 A;  4DUK A;  2OR4 A;  2B3V A;  4MXU A;  2F5I A;  5AG5 A;  4ZY0 A;  2GAN A;  2G9D A;  2Q4Y A;  2RC4 A;  4U9Z A;  4Y49 C;  4UEE A;  2PSW A;  4KLV A;  1CBX A;  2J8N A;  3PGP A;  3PB8 X;  2Q51 A;  1UFH A;  2BSW A;  3BI1 A;  3NE8 A;  4A95 A;  2PJ9 A;  2GLJ A;  3I9S A;  4JD6 A;  5J8C A;  1QMU A;  4F9U A;  2PE3 A;  3HLP A;  4UCM A;  2EK9 A;  1CM0 A;  2PVW A;  4P6Y A;  1VHO A;  1YK3 A;  3SXO A;  4CS0 B;  1Z2L A;  2VEZ A;  3TX8 A;  3GIU A;  5K8M A;  4Q36 A;  1BPM A;  4EFD A;  1VHE A;  1P4N A;  4AG9 A;  2EK8 A;  2JBK A;  4MFP A;  4ZBG A;  1LFW A;  2ZEM A;  8CPA A;  2DXQ A;  4QC6 A;  4R87 A;  1PCA A; 
#chains in the Genus database with same CATH homology
 5IX3 A;  3EC4 A;  2PRB A;  4M85 A;  2KCW A;  1VHS A;  3QB8 A;  2YNE A;  3R9F A;  4BMH A;  1MJA A;  2ZW6 A;  1KZF A;  1FY7 A;  2YNC A;  4B12 A;  4FD6 A;  3GYA A;  2Q7B A;  3VWD A;  5GCN A;  2JDD A;  4UWJ A;  3VWE A;  4JXQ A;  1S7L A;  2FL4 A;  5HMN A;  4F6A A;  4YFJ A;  4XNH C;  2NMT A;  3PP9 A;  1XE4 A;  3WR7 A;  4GS4 A;  3DSB A;  2FCK A;  3TO6 A;  4B13 A;  4CAW A;  2VXK A;  1S7K A;  2QEC A;  4BBH A;  4F0X A;  3GKR A;  2PC1 A;  4OAE A;  2ATR A;  4UCN A;  4JXR A;  5H84 A;  4E8O A;  2FIW A;  3TFY A;  4PK3 A;  3P2H A;  4R57 A;  2R8V A;  3K9U A;  1I12 A;  3TOB A;  1Q2Y A;  1M4I A;  4EVY A;  4MY0 A;  2ZW7 A;  4KOS A;  4B5O A;  2Q4V A;  1IYL A;  3IU2 A;  1S3Z A;  4UWI A;  2OZG A;  2PR8 A;  4UCP A;  3TTH A;  5DWM A;  1YR0 A;  1QSM A;  3SXN A;  4KOU A;  4C2Z A;  2CY2 A;  2EUI A;  4YGO A;  3CXS A;  4QVT A;  3RYO A;  2O28 A;  2Z11 A;  5G20 A;  2Z3L A;  4A32 A;  4R9M A;  2FIA A;  1M1D A;  4NEX A;  2JEV A;  4CRZ B;  1M44 A;  2ZPA A;  4Q38 A;  2Z10 A;  2FXF A;  3S6G A;  2WPX A;  1S60 A;  3C26 A;  4KZT A;  2HUZ A;  2VZY A;  3I3G A;  4KOV A;  4AG7 A;  4U5Y A;  4KLW A;  3IU1 A;  1VKC A;  3W6X A;  4L8A A;  4PSW A;  5J8F A;  4KSF A;  1IB1 E;  3OWC A;  2BEI A;  4K30 A;  1M4G A;  3A9L A;  5FVJ A;  4AVB A;  2PDO A;  4KOW A;  2CNT A;  4CRY B;  4JWP A;  2OZU A;  3IWG A;  1QSR A;  3QAH A;  4UFX A;  2K5T A;  4CAX A;  2YNC C;  4CAF A;  5A27 A;  2C27 A;  1Z4R A;  2OH1 A;  2H5M A;  4NXY A;  4KOX A;  1ON0 A;  1Z4E A;  2HQY A;  5AG6 A;  3W91 A;  4H6Z A;  1N71 A;  1XIX A;  2VI7 A;  1Y7R A;  3JTK A;  3DR8 A;  3DDD A;  2X7B A;  1Q2C A;  4AVA A;  5BWA B;  2R98 A;  2Z3N A;  1NE9 A;  3IWE A;  3TO9 A;  4MFJ A;  2IL4 A;  5JPH A;  5JQ4 A;  4CGO A;  2GIV A;  2BUE A;  1SQH A;  4KUB A;  4HNW B;  4R3K A;  3V8I A;  4LX9 A;  2Q0Y A;  4MFQ A;  4KSA A;  3FRM A;  4KOT A;  2EVN A;  4MHD A;  4UA3 A;  5H86 A;  4ONU A;  2PR1 A;  2ZW5 A;  3R1K A;  2CNM A;  2B5G A;  4CAE A;  4E2A A;  3TE4 A;  4CYQ A;  2B4D A;  3MGD A;  1QSN A;  1Y9K A;  1S7F A;  1Y9W A;  4MI4 A;  3T90 A;  3ZJ0 A;  2B5G B;  4XPD B;  3FBU A;  4UBR A;  1BOB A;  4UFW A;  4KVM E;  3EY5 A;  1B87 A;  4U9Y A;  1ZO0 A;  2Z3K A;  1S5K A;  2OB0 A;  3LD2 A;  5J8C A;  2WPW A;  1QSO A;  3EFA A;  2R1I A;  2FT0 A;  4NSQ A;  3TT2 A;  3D8P A;  4MJ8 A;  5AG4 A;  1S7N A;  2B3U A;  1QST A;  2Z3M A;  4C68 A;  1TIQ A;  3TOA A;  5F49 A;  4JJX A;  5F46 A;  2WUU A;  5AGE A;  3FXT A;  4HNX B;  3ZZI A;  4CYO A;  1P0H A;  1PUA A;  3D2M A;  4PSX A;  4I49 A;  2G0B A;  4ZGY B;  2Z0Z A;  5DWN A;  3JVN A;  1XEB A;  1KUV A;  4OLL A;  1YLE A;  4MY3 A;  2FE7 A;  4KS9 A;  3CXP A;  1OZP A;  2Z3P A;  3BJ8 A;  2QML A;  4DNC A;  5CNP A;  5KTA A;  1L0C A;  4NF1 A;  4H89 A;  4II9 A;  4A31 A;  4KVO E;  4CGP A;  4HNY B;  1M4D A;  4B11 A;  4C2X A;  5I0C A;  3T9Y A;  5KTD A;  1RO5 A;  5A28 A;  3H5Z A;  4MBU A;  3P2F A;  3LOD A;  4QB9 A;  1I1D A;  2DPS A;  3BLN A;  1YVO A;  4CGN A;  1WWZ A;  4KOR A;  4CYP A;  3CXQ A;  4CAV A;  2G3T A;  1KUX A;  2OZH A;  3N7Z A;  1IIC A;  2REE A;  4L89 A;  4XPK A;  4B14 A;  4AB7 A;  1B6B A;  4CYN A;  3KKW A;  4KUA A;  4JLY A;  3D3S A;  4PV6 A;  5G1Z A;  2Q44 A;  1K4J A;  5F48 A;  5C82 A;  4MFK A;  2ZW4 A;  4HKF A;  4CGM A;  3S6F A;  4FD4 A;  4AVC A;  4CGL A;  2JLM A;  4XPD C;  1NSL A;  3EO4 A;  1YRE A;  4E0A A;  2QIR A;  3S6H A;  4H6U A;  4J3G A;  3DNS A;  3F0A A;  3G3S A;  4RS2 A;  1I21 A;  2GE3 A;  2Q04 A;  4UFV A;  3IGR A;  3NE7 A;  4F0Y A;  1PU9 A;  2J8R A;  3DR6 A;  4A30 A;  1YVK A;  4C7H A;  2P6E A;  3BJ7 A;  2AJ6 A;  3GY9 A;  1NMT A;  4M3S A;  4MFZ A;  4Y49 B;  3F5B A;  4OAD A;  2B4D B;  2R7H A;  3EXN A;  2WSA A;  5C88 A;  4C2Y A;  3PZJ A;  3R9E A;  2P6F A;  1J4J A;  4XPL A;  1XF8 A;  2CNS A;  2VBQ A;  3FB3 A;  3F8K A;  1GHE A;  2A4N A;  2JDC A;  2ZXV A;  2ARH A;  4ORF A;  4KVX A;  4QBJ A;  2I79 A;  2YGW A;  4YRH A;  3SHP A;  2REF A;  1U6M A;  4MFL A;  2VZZ A;  5AG7 A;  1RXT A;  3FYN A;  5IB0 A;  5G22 A;  2HV2 A;  5F47 A;  1KUY A;  4X5K A;  4QUS A;  5KTC A;  4A2Z A;  4R3L A;  4RI1 A;  2Z3O A;  3R95 A;  2B4B A;  3H4Q A;  2FSR A;  2AE6 A;  3B8G A;  3R9G A;  5IV0 A;  1IID A;  4XNH B;  3FNC A;  2VQY A;  2G3A A;  3JUW A;  5ISV A;  1IYK A;  5G21 A;  3W6S A;  4FD7 A;  4A33 A;  3S6K A;  2YND A;  4KOY A;  4IUS A;  3R96 A;  1XMT A;  2OU2 A;  4PK2 A;  4LUA A;  3G8W A;  1Q2D A;  3TO7 A;  5EBV A;  3E0K A;  1R57 A;  2D4P A;  2J8M A;  2D4O A;  4NCZ A;  2Y0M A;  1MK4 A;  1LRZ A;  2B58 A;  4FD5 A;  1YX0 A;  3FIX A;  4B5P A;  2P0W A;  1CJW A;  2I00 A;  5E96 A;  2CXA A;  1MJ9 A;  1WK4 A;  2FS5 A;  2DPT A;  4B5P B;  3TCV A;  2PQ8 A;  1V0C A;  3D2P A;  1YGH A;  2P6G A;  3UY5 A;  1Z9U A;  2BL1 A;  4B10 A;  1MJB A;  1BO4 A;  5EC4 A;  4IF5 A;  4C7I A;  5HH1 A;  2B3V A;  2F5I A;  5AG5 A;  2GAN A;  2RC4 A;  2Q4Y A;  4U9Z A;  4Y49 C;  2PSW A;  4KLV A;  2J8N A;  3PGP A;  1UFH A;  2BSW A;  4A95 A;  3I9S A;  4JD6 A;  4UCM A;  1CM0 A;  1YK3 A;  3SXO A;  4CS0 B;  2VEZ A;  4Q36 A;  1P4N A;  4AG9 A;  4MFP A;  4ZBG A;  2DXQ A;  4QC6 A;  4R87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...