4UFWA

Plasmodium vivax n-myristoyltransferase in complex with a pyridyl inhibitor (compound 22)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of Pyridyl-Based Inhibitors of Plasmodium Falciparum N-Myristoyltransferase
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 118
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ufwA00
4CGLA 4C7IA 4B13A 4CYPA 4UCPA 2WUUA 4B11A 5AG6A 5G1ZA 4C2XA 3IWEA 4A30A 4C68A 4CAEA 4B10A 4CGOA 5A27A 2YNEA 3JTKA 4A33A 4C2ZA 4A2ZA 2YNCC 4UCNA 4UFVA 5G20A 2WSAA 4UCMA 2YNCA 4CGNA 4CYQA 5G22A 4C2YA 4CAFA 5A28A 4B12A 3IU1A 5AGEA 4B14A 4CGMA 2YNDA 4UFWA 4A31A 4CYNA 5AG5A 4A32A 4CYOA 5AG4A 5G21A 4CGPA 5AG7A 4A95A 3IU2A 4UFXA 4BBHA 3H5ZA 4C7HA
chains in the Genus database with same CATH superfamily
1BO4A 2Q04A 2XEJA 2JDCA 3CZXA 2B5GB 1VHSA 2ATRA 4M6HA 1TKHA 3IWEA 3EO4A 2D4PA 3TOAA 4B10A 4CAEA 4YFJA 2Z11A 2ZELA 4NJRA 1YVKA 1KUVA 4EWTA 2B3VA 2G3TA 3G8WA 1QSTA 3OWCA 4F6AA 5H84A 4FAIA 3FBUA 4HNWB 3GLJA 2CNMA 2GLJA 2AFWA 4UEEA 3DLJA 4PXEA 2PJ7A 2PJ4A 3B2YA 4MBUA 4R3KA 4X3RA 4CPAA 2A4NA 1YQEA 2Z10A 3NH8A 1Z2LA 3TX8A 4F0XA 4KOSA 2AFXA 2FS5A 2BCOA 1B87A 3ZZIA 4IUSA 2ODFA 2REFA 2ZW4A 3LD2A 3PB7X 1NE9A 4KSAA 1GHEA 2ZEEA 4MHPA 4BD9A 5K8PA 1Y9WA 1P0HA 3PP9A 3NE7A 3E0KA 5IX3A 2QMLA 4H2KA 2QVPA 2C1CA 5G20A 2WSAA 4CGNA 2ZEGA 2QIRA 4WJBA 3V8IA 3GYAA 3BXMA 3EY5A 3PBEA 1UFHA 4P4EA 5JPHA 2PJ1A 3D7FA 4CRZB 4XNHC 2JBKA 3TE4A 2ZEHA 3CXPA 1S3ZA 8CPAA 5D8NA 3MRUA 4YWYA 1Y9KA 3FYNA 1JWQA 3D4UA 2G3AA 3FXTA 2AFUA 5LRGA 4NEXA 2CNSA 4MCRA 2WUUA 4MFPA 3NA6A 4TWEA 5F48A 4B6ZA 4KOYA 2AFZA 1MJBA 3PB4X 3SI2A 2O28A 2YGWA 1IIDA 4EVYA 4X5KA 4P45A 2REEA 3H4QA 1AMPA 2ZW5A 4JLYA 2B4BA 1I12A 3S6GA 3TCVA 4AVCA 3D7HA 4CAFA 2P6GA 4NXYA 2PJ9A 4U5YA 1IICA 2JEWA 4WWVA 3SJGA 2H5MA 1AYEA 1TKJA 3ISZA 4F9VA 4ZYQA 1JQGA 2ZEPA 1IOFA 2ZEDA 3F8KA 2CTBA 4CYOA 1KWMA 2AJ6A 5KTAA 1YR0A 1Z8XA 1QMUA 4F0YA 1XMBA 1LCPA 4H6UA 1Q7LA 2AFMA 2CXAA 4KLWA 4CYPA 2Q4VA 4XPLA 3K2KA 2CNTA 3D68A 2Q44A 3KKWA 4YGOA 3LODA 4B11A 4J3GA 4QBJA 3IEHA 5C82A 4G1PA 2IMOA 4MFQA 2R98A 4MRIA 3FF3A 3S9LA 1Z8TA 5LYDA 3T90A 2VQYA 4OP4A 3PB6X 1VHOA 1WWZA 4KOXA 3VH9A 3D2PA 4C2YA 3SJFA 1QQ9A 3FVLA 2JEVA 1CPSA 4MHZA 5LYLA 2WYRA 1HEEA 4HNXB 3WT4A 2V8DA 1CJWA 3N7ZA 5E96A 4I49A 4Y49C 5EMIA 4UWIA 5HVGA 4PSXA 3PEIA 1R43A 5HXDA 2V8VA 3H8FA 1CPXA 4M6GA 4R6TA 4DYOA 3T8WA 4C7IA 5IV0A 4RN7A 4P6YA 2XEIA 1VGYA 2G0BA 2GE3A 1M4GA 1S7FA 4PQAA 3B3SA 3H8GA 5A27A 2OZHA 4MJ8A 2BEIA 3D67A 4EMEA 3RYOA 2GU2A 1F57A 2GREA 2PJAA 1CX8A 3DNSA 4UCNA 4CAXA 3R9GA 5K8OA 4FUUA 2VZZA 3F5BA 4JZ0A 2C6GA 4EFDA 3FB3A 4HKFA 3FX6A 4XPDB 5F46A 4IF5A 1XJOA 4H89A 1YLOA 1NSAA 2IJZA 4YRHA 1MK4A 5THWA 4ZY1A 3BJ8A 5FVJA 2C6CA 2JBJA 2D4OA 2Q7SA 1R3NA 1Z5RA 4JYWA 3IU2A 2Q4ZA 3SJXA 1BPMA 2XEFA 4OKOA 3WABA 2Z3NA 3SXNA 4ONWA 3CPAA 2CY2A 3NFZA 3PFEA 3C26A 2Q4YA 3MGDA 3RAMA 3S9MA 2HV2A 2CTCA 3GY9A 5DWMA 4GM5A 2PE3A 1QSMA 2B4DA 2DXQA 2DPTA 2C6PA 4PPZA 2PJ3A 5CPAA 2PQ8A 5DS0A 3R9FA 1YK3A 2AFOA 2K5TA 4A94A 5A28A 2ZEMA 1FT7A 1XBUA 3PZJA 1S60A 1VHEA 3R9EA 2EVNA 3FJUA 4KVME 5D29A 3TT2A 2Q0YA 3CXQA 5CBMA 3IC1A 1YGHA 2FVGA 3KZWA 1RTQA 4JD6A 1PUAA 1BPNA 1ZO0A 2PCUA 2ZW7A 2AFSA 4Q7AA 3S9NA 4MXUA 4ZBGA 4AVAA 2V77A 3KHXA 4BINA 3EXNA 4MFLA 1TIQA 3FEEA 5HVHA 3PRTA 1LANA 1XIXA 3IGRA 4JWPA 4UEZA 5I0CA 4MHDA 4DUKA 2EBJA 3JRUA 4MHYA 2DEAA 2HC9A 2J8NA 2Z0ZA 3GB0A 4UWJA 3SI1A 4NGNA 4OC5A 2GANA 1LFWA 3L2NA 4PV6A 1MJAA 4OAEA 3DR6A 4HPSA 1B6BA 2FXFA 4OC1A 2P0WA 3PBBA 2GLFA 4MY3A 2FSRA 4UEFA 2RC4A 3P2FA 4X8IA 2VXKA 2QYVA 4A32A 4E2AA 2C27A 2F7VA 2OOTA 1L0CA 2B4DB 4FD4A 4MHNA 1F2PA 4OC4A 1BLLE 3G3SA 2WPXA 3RO0A 3KQXA 4M3SA 3NE8A 1Y0RA 4B5OA 5G1ZA 2VEZA 1LRZA 1M4LA 2EO8A 3I1UA 3VATA 3D2MA 3VWDA 1IB1E 2DF5A 2PJ0A 3A9LA 4IAVA 4R57A 4NJQA 4AG7A 4C2ZA 2FCKA 4A2ZA 4ZX9A 4R87A 4P4FA 2YNCA 2BSWA 4B5PA 2ZEFA 3WR7A 4FWUA 2NYQA 4ZX8A 1P4NA 4UIBA 3KI9A 2IQ6A 5I4MA 1YMEA 1S7NA 2QECA 3R96A 4M6IA 1LAMA 3W91A 4MI4A 2ZPAA 4LQ6A 4LX9A 4PK2A 4NSQA 2Y0MA 1XMTA 4K30A 4R9MA 1X12A 1ZG8A 1OZPA 4FD7A 1EE3P 2WPWA 2O4HA 3IWGA 3DGVA 1Y7RA 4C2XA 3IIBA 2B3UA 2V8GA 3B3WA 2EK8A 3I9SA 1Z4RA 2Z3LA 1ON0A 1X10A 5HVFA 5JM6A 4NGRA 4E0AA 2B58A 4KLVA 5EBVA 5LYFA 3CPXA 1ZG9A 1XFOA 4II9A 4KOVA 3GIUA 3SHPA 4KOWA 4H6ZA 4W9YA 4E8OA 2ARHA 2PJBA 4P4JA 1IGBA 4KZTA 3K9UA 4QB9A 3H5ZA 3QAYA 1N71A 3IO1A 2BO9A 4NF1A 3P2HA 2PRBA 3SJEA 1NMTA 2EWBA 4Z65A 4PK3A 4B5PB 4OC2A 6CPAA 1R57A 4NGSA 5ELYA 4CGOA 1BAVA 1CM0A 1MJ9A 1S5KA 5LYIA 4MCSA 2J8MA 4M85A 2OZUA 3D8PA 5JGFA 1Q2CA 3GKRA 1GYTA 5LRKA 1CP6A 1DTDA 1Q2YA 3KGQA 1XEBA 4DJLA 2VBQA 2ZXVA 3BJ7A 1IY7A 2PIZA 3KR4A 1TXRA 3JVNA 4ONUA 3TO7A 4A39A 4FD5A 3EC4A 4NGTA 5AG5A 2ANPA 3B7IA 4OMEA 2ZOFA 1A2ZA 4QC6A 4XPDC 1YX0A 5G21A 3R95A 4CGPA 1QSOA 2HQYA 4GS4A 1KUYA 4KSIA 2PVWA 4MFJA 3LWUA 5JH9A 4CGLA 2FIWA 2Q43A 1ZLIA 4F9UA 4NCZA 3FIXA 5HMNA 2OZGA 4UBRA 4AG9A 2VZYA 2OU2A 1IU8A 3ISXA 3KHZA 3KASA 2EK9A 1CBXA 1Z9UA 4JJXA 2PR1A 4UA3A 3LACA 2F8HA 2RFHA 4P10A 4R76A 3MN8A 3VARA 2JDDA 3KR5A 4GXHA 5KTDA 1XE4A 3S6FA 5IB9A 1IYKA 3WC5A 5J1QA 3PFOA 1HDQA 1OBRA 2OR4A 1YW4A 4HNYB 4KORA 3CDXA 1TF8A 2J8RA 2NMTA 1ELMP 2I3CA 3FMCA 4MCPA 4OIDA 1U6MA 1ARLA 2ZOGA 1PYTB 2BL1A 2R8VA 3DDDA 4JXQA 4OADA 5LRJA 2VI7A 5H86A 1F2OA 4BBHA 2CIJA 4R3LA 2I79A 3PB8X 3DSBA 2AE6A 4FBEA 2PJCA 3B3CA 5ISVA 1QSRA 1IYLA 3S6KA 3D66A 3F0AA 2PSWA 1RO5A 1CP7A 4UF4A 4R7MA 2XEGA 2PJ6A 4Q36A 4CAVA 5K8NA 4UFVA 5IB0A 4R8FA 4NGQA 3HUVA 2ZENA 4KUAA 1YLEA 2R1IA 3IJ3A 4OC0A 4P44A 4DNCA 1IOIA 4B12A 3IU1A 4K3NA 4KVOE 1Y0YA 1Z4EA 3DR8A 2ZW6A 1VKCA 4LQGA 4TNUA 4CYNA 2PC1A 5AG4A 4IK2A 3B3TA 4A95A 4C7HA 3RZAA 5J8FA 2PJ5A 1K4JA 1YREA 2DPSA 3RBUA 1ELLP 5F49A 3CT9A 4ORFA 5CNPA 4BMHA 1J4JA 2F5IA 2PR8A 4A30A 3NH4A 5C88A 2PRQA 2OB0A 4O23A 3WC7A 3FEDA 1YW6A 2GFQA 4JXRA 4PSWA 4A33A 3TFYA 4UIAA 4UCMA 1V0CA 4CYQA 4XNHB 4XPKA 5G22A 5BWAB 3TO6A 4NFRA 4AB7A 3UY5A 3QNVA 4KSFA 3W6XA 4RUHA 2RB7A 3WC6A 2HUZA 3T9YA 4UFWA 3K9TA 4NGMA 2O53A 2PDOA 2G9DA 3FECA 1Z8LA 4PXBA 2PIYA 1I1DA 1AUGA 4UFXA 3IWWA 4MY0A 3NH5A 3QAHA 3S6HA 2FE7A 2HB6A 2PVVA 1YSJA 5GCNA 3R1KA 3CXSA 2J9AA 3HLPA 4A38A 2P6EA 4MCQA 4A37A 5KTCA 1SQHA 2FL4A 1PCAA 4OC3A 4AXVA 2YNEA 1H8LA 3H8EA 2IL4A 4RI1A 2ZEOA 3FH4A 1LOKA 3TTHA 2KCWA 1I21A 3GUXA 4L89A 4MFKA 4RS2A 1ZLHA 4P4BA 4CAWA 4MMOA 1M44A 4B14A 2WZNA 4LUAA 1CG2A 4U9YA 4NGPA 3TOBA 4F8ZA 3B8GA 3PGPA 1NSLA 4ZY0A 3BI1A 1S7LA 1KZFA 3PB9X 4CGMA 4B13A 2OH1A 4ZGYB 1FNOA 2EUIA 4Q38A 4UCPA 1PU9A 2NSMA 1TKFA 3FRMA 4ZI6A 4C68A 1ARMA 4KOUA 1M1DA 2JLMA 2P6FA 3BLNA 3JTKA 4CRYB 2YNCC 4OLLA 2CF4A 1XOVA 3D7GA 2I00A 4L8AA 4PXDA 2B5GA 1QSNA 4PXCA 1ZG7A 5J8CA 1S7KA 4FD6A 2Q7BA 4KOTA 1Z8WA 4X2TA 5AGEA 1Q2DA 4Y49B 5F09A 3KL9A 2R7HA 4QUSA 3D3SA 5EC4A 3SXOA 1YVOA 4KUBA 2YNDA 3FNCA 3B3VA 3LMSA 4KVXA 3VWEA 4IHMA 4MFZA 1HDUA 2X7BA 2Z3OA 2QJ8A 1VIXA 4U9ZA 5AG6A 5K8MA 1M4DA 2BUEA 3TO9A 2POKA 3W6SA 4CS0B 2Q51A 1WK4A 3RNZA 3BI0A 3JUWA 2PJ8A 3TC8A 5JQ4A 2ABZA 7CPAA 2VL1A 4ZY2A 2BOAA 3V38A 4KS9A 3KQZA 4QVTA 5F47A 3ZJ0A 3SI0A 1LAPA 4P4IA 1XRYA 2Z3KA 3BHXA 5HH1A 1RXTA 3EFAA 2GIVA 4AVBA 3V7ZA 3IFEA 1BOBA 1KUXA 4OIWA 5DWNA 4YU9A 1FY7A 1M4IA 1XF8A 1Y7EA 2PJ2A 4A31A 3QB8A 1DE4C 2V8HA 2Z3PA 2Z3MA 3N5FA 3B35A 5AG7A 3D7DA 1UWYA 2FIAA 3I3GA 4P4DA 1TF9A 2FT0A
chains in the Genus database with same CATH topology
1BO4A 2Q04A 2JDCA 2B5GB 1VHSA 2ATRA 3IWEA 3EO4A 2D4PA 3TOAA 4B10A 4CAEA 4YFJA 2Z11A 1YVKA 1KUVA 2B3VA 2G3TA 3G8WA 1QSTA 3OWCA 4F6AA 5H84A 3FBUA 4HNWB 2CNMA 5KTDA 4R3KA 4MBUA 2A4NA 2Z10A 4F0XA 4KOSA 2FS5A 1B87A 3ZZIA 4IUSA 2REFA 2ZW4A 3LD2A 1NE9A 4KSAA 1GHEA 1Y9WA 1P0HA 3PP9A 3NE7A 3E0KA 5IX3A 2QMLA 5G20A 2WSAA 4CGNA 2QIRA 3V8IA 3GYAA 3EY5A 1UFHA 5JPHA 3TE4A 4CRZB 4XNHC 3CXPA 1S3ZA 1Y9KA 3FYNA 2G3AA 3FXTA 4NEXA 2CNSA 2WUUA 4MFPA 5F48A 4KOYA 1MJBA 2O28A 2YGWA 1IIDA 4EVYA 4X5KA 2REEA 3H4QA 2ZW5A 4JLYA 2B4BA 1I12A 3S6GA 3TCVA 4AVCA 4CAFA 2P6GA 4NXYA 4U5YA 1IICA 2H5MA 3F8KA 4CYOA 2AJ6A 5KTAA 1YR0A 4F0YA 4H6UA 4CYPA 2CXAA 4KLWA 2Q4VA 4XPLA 2CNTA 3KKWA 2Q44A 4B11A 4YGOA 3LODA 4J3GA 4QBJA 5C82A 4MFQA 2R98A 3T90A 2VQYA 4C2YA 1WWZA 4KOXA 3D2PA 2JEVA 4HNXB 1CJWA 3N7ZA 5E96A 4I49A 4Y49C 4UWIA 4PSXA 4C7IA 5IV0A 2G0BA 2GE3A 1M4GA 1S7FA 5A27A 2OZHA 4MJ8A 2BEIA 4CAXA 4UCNA 3DNSA 3R9GA 2VZZA 3F5BA 3FB3A 4HKFA 4XPDB 5F46A 4IF5A 4H89A 4YRHA 1MK4A 3BJ8A 5FVJA 2D4OA 3IU2A 2Z3NA 3SXNA 2CY2A 3C26A 2Q4YA 3MGDA 2HV2A 3GY9A 5DWMA 1QSMA 2B4DA 2DXQA 2DPTA 3R9FA 2PQ8A 1YK3A 2K5TA 5A28A 3PZJA 1S60A 3R9EA 2EVNA 4KVME 3TT2A 2Q0YA 3CXQA 1YGHA 4JD6A 1PUAA 1ZO0A 2ZW7A 4AVAA 4ZBGA 3EXNA 4MFLA 1TIQA 1XIXA 4JWPA 3IGRA 5I0CA 4MHDA 2Z0ZA 2J8NA 4UWJA 2GANA 4PV6A 1MJAA 4OAEA 3DR6A 1B6BA 2FXFA 2P0WA 4MY3A 2FSRA 2RC4A 3P2FA 2VXKA 4E2AA 2C27A 1L0CA 2B4DB 4FD4A 3G3SA 2WPXA 4M3SA 4B5OA 5G1ZA 2VEZA 1LRZA 3VWDA 3D2MA 1IB1E 3A9LA 4R57A 4AG7A 4C2ZA 2FCKA 4A2ZA 4R87A 2YNCA 2BSWA 4B5PA 3WR7A 1P4NA 1S7NA 2QECA 3R96A 3W91A 4MI4A 2ZPAA 4LX9A 4PK2A 4NSQA 2Y0MA 1XMTA 4K30A 4R9MA 1OZPA 4FD7A 2WPWA 3IWGA 1Y7RA 4C2XA 2B3UA 3I9SA 1Z4RA 2Z3LA 1ON0A 4E0AA 2B58A 4KLVA 5EBVA 4II9A 4KOVA 3SHPA 4KOWA 4H6ZA 4E8OA 2ARHA 4KZTA 3K9UA 4QB9A 3H5ZA 1N71A 4NF1A 3P2HA 2PRBA 1NMTA 4PK3A 4B5PB 1R57A 4CGOA 1CM0A 1MJ9A 1S5KA 2J8MA 4M85A 2OZUA 3D8PA 1Q2CA 3GKRA 1Q2YA 1XEBA 2VBQA 2ZXVA 3BJ7A 3JVNA 4ONUA 3TO7A 4FD5A 3EC4A 5AG5A 4A32A 4QC6A 4XPDC 1YX0A 5G21A 3R95A 4CGPA 1QSOA 2HQYA 4GS4A 1KUYA 4MFJA 4CGLA 2FIWA 4NCZA 3FIXA 5HMNA 2OZGA 4UBRA 4AG9A 2VZYA 2OU2A 4JJXA 4UA3A 1Z9UA 2PR1A 2JDDA 1XE4A 3S6FA 1IYKA 4HNYB 4KORA 2J8RA 2NMTA 1U6MA 2BL1A 2R8VA 3DDDA 4JXQA 4OADA 2VI7A 5H86A 4BBHA 4R3LA 2I79A 3DSBA 2AE6A 5ISVA 1QSRA 1IYLA 3S6KA 3F0AA 2PSWA 1RO5A 4Q36A 4CAVA 4UFVA 5IB0A 4KUAA 1YLEA 2R1IA 4DNCA 4B12A 3IU1A 4KVOE 1Z4EA 3DR8A 2ZW6A 1VKCA 4CYNA 2PC1A 5AG4A 4A95A 4C7HA 5J8FA 1K4JA 1YREA 2DPSA 5F49A 4ORFA 5CNPA 4BMHA 1J4JA 2F5IA 2PR8A 4A30A 5C88A 2OB0A 4A33A 4JXRA 4PSWA 3TFYA 4UCMA 1V0CA 4CYQA 4XNHB 4XPKA 5G22A 5BWAB 3TO6A 4AB7A 3UY5A 4KSFA 3W6XA 2HUZA 3T9YA 4UFWA 2PDOA 1I1DA 4UFXA 4MY0A 3QAHA 3S6HA 2FE7A 5GCNA 3R1KA 3CXSA 2P6EA 5KTCA 1SQHA 2FL4A 2YNEA 2IL4A 4RI1A 3TTHA 2KCWA 1I21A 4MFKA 4L89A 4RS2A 4CAWA 1M44A 4B14A 4LUAA 4U9YA 3TOBA 3B8GA 3PGPA 1NSLA 1S7LA 1KZFA 4CGMA 4B13A 2OH1A 4ZGYB 4Q38A 2EUIA 4UCPA 1PU9A 3FRMA 4C68A 4KOUA 1M1DA 2JLMA 2P6FA 3BLNA 3JTKA 4CRYB 2YNCC 4OLLA 4L8AA 2I00A 2B5GA 1QSNA 5J8CA 1S7KA 4FD6A 2Q7BA 4KOTA 5AGEA 1Q2DA 4Y49B 2R7HA 4QUSA 3D3SA 5EC4A 3SXOA 1YVOA 4KUBA 2YNDA 3FNCA 4KVXA 3VWEA 4MFZA 2X7BA 2Z3OA 4U9ZA 5AG6A 1M4DA 2BUEA 3TO9A 3W6SA 4CS0B 1WK4A 3JUWA 5JQ4A 4KS9A 4QVTA 5F47A 3ZJ0A 2Z3KA 5HH1A 1RXTA 3EFAA 2GIVA 4AVBA 1BOBA 1KUXA 5DWNA 1FY7A 1M4IA 1XF8A 4A31A 3QB8A 2Z3PA 2Z3MA 5AG7A 2FIAA 3I3GA 3RYOA 2FT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGL A;  4C7I A;  4B13 A;  4CYP A;  4UCP A;  2WUU A;  4B11 A;  5AG6 A;  5G1Z A;  4C2X A;  3IWE A;  4A30 A;  4C68 A;  4CAE A;  4B10 A;  4CGO A;  5A27 A;  2YNE A;  3JTK A;  4A33 A;  4C2Z A;  4A2Z A;  2YNC C;  4UCN A;  4UFV A;  5G20 A;  2WSA A;  4UCM A;  2YNC A;  4CGN A;  4CYQ A;  5G22 A;  4C2Y A;  4CAF A;  5A28 A;  4B12 A;  3IU1 A;  5AGE A;  4B14 A;  4CGM A;  2YND A;  4UFW A;  4A31 A;  4CYN A;  5AG5 A;  4A32 A;  4CYO A;  5AG4 A;  5G21 A;  4CGP A;  5AG7 A;  4A95 A;  3IU2 A;  4UFX A;  4BBH A;  3H5Z A;  4C7H A; 
#chains in the Genus database with same CATH topology
 1BO4 A;  2Q04 A;  2XEJ A;  2JDC A;  3CZX A;  2B5G B;  1VHS A;  2ATR A;  4M6H A;  1TKH A;  3IWE A;  3EO4 A;  2D4P A;  3TOA A;  4B10 A;  4CAE A;  4YFJ A;  2Z11 A;  2ZEL A;  4NJR A;  1YVK A;  1KUV A;  4EWT A;  2B3V A;  2G3T A;  3G8W A;  1QST A;  3OWC A;  4F6A A;  5H84 A;  4FAI A;  3FBU A;  4HNW B;  3GLJ A;  2CNM A;  2GLJ A;  2AFW A;  4UEE A;  3DLJ A;  4PXE A;  2PJ7 A;  2PJ4 A;  3B2Y A;  4MBU A;  4R3K A;  4X3R A;  4CPA A;  2A4N A;  1YQE A;  2Z10 A;  3NH8 A;  1Z2L A;  3TX8 A;  4F0X A;  4KOS A;  2AFX A;  2FS5 A;  2BCO A;  1B87 A;  3ZZI A;  4IUS A;  2ODF A;  2REF A;  2ZW4 A;  3LD2 A;  3PB7 X;  1NE9 A;  4KSA A;  1GHE A;  2ZEE A;  4MHP A;  4BD9 A;  5K8P A;  1Y9W A;  1P0H A;  3PP9 A;  3NE7 A;  3E0K A;  5IX3 A;  2QML A;  4H2K A;  2QVP A;  2C1C A;  5G20 A;  2WSA A;  4CGN A;  2ZEG A;  2QIR A;  4WJB A;  3V8I A;  3GYA A;  3BXM A;  3EY5 A;  3PBE A;  1UFH A;  4P4E A;  5JPH A;  2PJ1 A;  3D7F A;  4CRZ B;  4XNH C;  2JBK A;  3TE4 A;  2ZEH A;  3CXP A;  1S3Z A;  8CPA A;  5D8N A;  3MRU A;  4YWY A;  1Y9K A;  3FYN A;  1JWQ A;  3D4U A;  2G3A A;  3FXT A;  2AFU A;  5LRG A;  4NEX A;  2CNS A;  4MCR A;  2WUU A;  4MFP A;  3NA6 A;  4TWE A;  5F48 A;  4B6Z A;  4KOY A;  2AFZ A;  1MJB A;  3PB4 X;  3SI2 A;  2O28 A;  2YGW A;  1IID A;  4EVY A;  4X5K A;  4P45 A;  2REE A;  3H4Q A;  1AMP A;  2ZW5 A;  4JLY A;  2B4B A;  1I12 A;  3S6G A;  3TCV A;  4AVC A;  3D7H A;  4CAF A;  2P6G A;  4NXY A;  2PJ9 A;  4U5Y A;  1IIC A;  2JEW A;  4WWV A;  3SJG A;  2H5M A;  1AYE A;  1TKJ A;  3ISZ A;  4F9V A;  4ZYQ A;  1JQG A;  2ZEP A;  1IOF A;  2ZED A;  3F8K A;  2CTB A;  4CYO A;  1KWM A;  2AJ6 A;  5KTA A;  1YR0 A;  1Z8X A;  1QMU A;  4F0Y A;  1XMB A;  1LCP A;  4H6U A;  1Q7L A;  2AFM A;  2CXA A;  4KLW A;  4CYP A;  2Q4V A;  4XPL A;  3K2K A;  2CNT A;  3D68 A;  2Q44 A;  3KKW A;  4YGO A;  3LOD A;  4B11 A;  4J3G A;  4QBJ A;  3IEH A;  5C82 A;  4G1P A;  2IMO A;  4MFQ A;  2R98 A;  4MRI A;  3FF3 A;  3S9L A;  1Z8T A;  5LYD A;  3T90 A;  2VQY A;  4OP4 A;  3PB6 X;  1VHO A;  1WWZ A;  4KOX A;  3VH9 A;  3D2P A;  4C2Y A;  3SJF A;  1QQ9 A;  3FVL A;  2JEV A;  1CPS A;  4MHZ A;  5LYL A;  2WYR A;  1HEE A;  4HNX B;  3WT4 A;  2V8D A;  1CJW A;  3N7Z A;  5E96 A;  4I49 A;  4Y49 C;  5EMI A;  4UWI A;  5HVG A;  4PSX A;  3PEI A;  1R43 A;  5HXD A;  2V8V A;  3H8F A;  1CPX A;  4M6G A;  4R6T A;  4DYO A;  3T8W A;  4C7I A;  5IV0 A;  4RN7 A;  4P6Y A;  2XEI A;  1VGY A;  2G0B A;  2GE3 A;  1M4G A;  1S7F A;  4PQA A;  3B3S A;  3H8G A;  5A27 A;  2OZH A;  4MJ8 A;  2BEI A;  3D67 A;  4EME A;  3RYO A;  2GU2 A;  1F57 A;  2GRE A;  2PJA A;  1CX8 A;  3DNS A;  4UCN A;  4CAX A;  3R9G A;  5K8O A;  4FUU A;  2VZZ A;  3F5B A;  4JZ0 A;  2C6G A;  4EFD A;  3FB3 A;  4HKF A;  3FX6 A;  4XPD B;  5F46 A;  4IF5 A;  1XJO A;  4H89 A;  1YLO A;  1NSA A;  2IJZ A;  4YRH A;  1MK4 A;  5THW A;  4ZY1 A;  3BJ8 A;  5FVJ A;  2C6C A;  2JBJ A;  2D4O A;  2Q7S A;  1R3N A;  1Z5R A;  4JYW A;  3IU2 A;  2Q4Z A;  3SJX A;  1BPM A;  2XEF A;  4OKO A;  3WAB A;  2Z3N A;  3SXN A;  4ONW A;  3CPA A;  2CY2 A;  3NFZ A;  3PFE A;  3C26 A;  2Q4Y A;  3MGD A;  3RAM A;  3S9M A;  2HV2 A;  2CTC A;  3GY9 A;  5DWM A;  4GM5 A;  2PE3 A;  1QSM A;  2B4D A;  2DXQ A;  2DPT A;  2C6P A;  4PPZ A;  2PJ3 A;  5CPA A;  2PQ8 A;  5DS0 A;  3R9F A;  1YK3 A;  2AFO A;  2K5T A;  4A94 A;  5A28 A;  2ZEM A;  1FT7 A;  1XBU A;  3PZJ A;  1S60 A;  1VHE A;  3R9E A;  2EVN A;  3FJU A;  4KVM E;  5D29 A;  3TT2 A;  2Q0Y A;  3CXQ A;  5CBM A;  3IC1 A;  1YGH A;  2FVG A;  3KZW A;  1RTQ A;  4JD6 A;  1PUA A;  1BPN A;  1ZO0 A;  2PCU A;  2ZW7 A;  2AFS A;  4Q7A A;  3S9N A;  4MXU A;  4ZBG A;  4AVA A;  2V77 A;  3KHX A;  4BIN A;  3EXN A;  4MFL A;  1TIQ A;  3FEE A;  5HVH A;  3PRT A;  1LAN A;  1XIX A;  3IGR A;  4JWP A;  4UEZ A;  5I0C A;  4MHD A;  4DUK A;  2EBJ A;  3JRU A;  4MHY A;  2DEA A;  2HC9 A;  2J8N A;  2Z0Z A;  3GB0 A;  4UWJ A;  3SI1 A;  4NGN A;  4OC5 A;  2GAN A;  1LFW A;  3L2N A;  4PV6 A;  1MJA A;  4OAE A;  3DR6 A;  4HPS A;  1B6B A;  2FXF A;  4OC1 A;  2P0W A;  3PBB A;  2GLF A;  4MY3 A;  2FSR A;  4UEF A;  2RC4 A;  3P2F A;  4X8I A;  2VXK A;  2QYV A;  4A32 A;  4E2A A;  2C27 A;  2F7V A;  2OOT A;  1L0C A;  2B4D B;  4FD4 A;  4MHN A;  1F2P A;  4OC4 A;  1BLL E;  3G3S A;  2WPX A;  3RO0 A;  3KQX A;  4M3S A;  3NE8 A;  1Y0R A;  4B5O A;  5G1Z A;  2VEZ A;  1LRZ A;  1M4L A;  2EO8 A;  3I1U A;  3VAT A;  3D2M A;  3VWD A;  1IB1 E;  2DF5 A;  2PJ0 A;  3A9L A;  4IAV A;  4R57 A;  4NJQ A;  4AG7 A;  4C2Z A;  2FCK A;  4A2Z A;  4ZX9 A;  4R87 A;  4P4F A;  2YNC A;  2BSW A;  4B5P A;  2ZEF A;  3WR7 A;  4FWU A;  2NYQ A;  4ZX8 A;  1P4N A;  4UIB A;  3KI9 A;  2IQ6 A;  5I4M A;  1YME A;  1S7N A;  2QEC A;  3R96 A;  4M6I A;  1LAM A;  3W91 A;  4MI4 A;  2ZPA A;  4LQ6 A;  4LX9 A;  4PK2 A;  4NSQ A;  2Y0M A;  1XMT A;  4K30 A;  4R9M A;  1X12 A;  1ZG8 A;  1OZP A;  4FD7 A;  1EE3 P;  2WPW A;  2O4H A;  3IWG A;  3DGV A;  1Y7R A;  4C2X A;  3IIB A;  2B3U A;  2V8G A;  3B3W A;  2EK8 A;  3I9S A;  1Z4R A;  2Z3L A;  1ON0 A;  1X10 A;  5HVF A;  5JM6 A;  4NGR A;  4E0A A;  2B58 A;  4KLV A;  5EBV A;  5LYF A;  3CPX A;  1ZG9 A;  1XFO A;  4II9 A;  4KOV A;  3GIU A;  3SHP A;  4KOW A;  4H6Z A;  4W9Y A;  4E8O A;  2ARH A;  2PJB A;  4P4J A;  1IGB A;  4KZT A;  3K9U A;  4QB9 A;  3H5Z A;  3QAY A;  1N71 A;  3IO1 A;  2BO9 A;  4NF1 A;  3P2H A;  2PRB A;  3SJE A;  1NMT A;  2EWB A;  4Z65 A;  4PK3 A;  4B5P B;  4OC2 A;  6CPA A;  1R57 A;  4NGS A;  5ELY A;  4CGO A;  1BAV A;  1CM0 A;  1MJ9 A;  1S5K A;  5LYI A;  4MCS A;  2J8M A;  4M85 A;  2OZU A;  3D8P A;  5JGF A;  1Q2C A;  3GKR A;  1GYT A;  5LRK A;  1CP6 A;  1DTD A;  1Q2Y A;  3KGQ A;  1XEB A;  4DJL A;  2VBQ A;  2ZXV A;  3BJ7 A;  1IY7 A;  2PIZ A;  3KR4 A;  1TXR A;  3JVN A;  4ONU A;  3TO7 A;  4A39 A;  4FD5 A;  3EC4 A;  4NGT A;  5AG5 A;  2ANP A;  3B7I A;  4OME A;  2ZOF A;  1A2Z A;  4QC6 A;  4XPD C;  1YX0 A;  5G21 A;  3R95 A;  4CGP A;  1QSO A;  2HQY A;  4GS4 A;  1KUY A;  4KSI A;  2PVW A;  4MFJ A;  3LWU A;  5JH9 A;  4CGL A;  2FIW A;  2Q43 A;  1ZLI A;  4F9U A;  4NCZ A;  3FIX A;  5HMN A;  2OZG A;  4UBR A;  4AG9 A;  2VZY A;  2OU2 A;  1IU8 A;  3ISX A;  3KHZ A;  3KAS A;  2EK9 A;  1CBX A;  1Z9U A;  4JJX A;  2PR1 A;  4UA3 A;  3LAC A;  2F8H A;  2RFH A;  4P10 A;  4R76 A;  3MN8 A;  3VAR A;  2JDD A;  3KR5 A;  4GXH A;  5KTD A;  1XE4 A;  3S6F A;  5IB9 A;  1IYK A;  3WC5 A;  5J1Q A;  3PFO A;  1HDQ A;  1OBR A;  2OR4 A;  1YW4 A;  4HNY B;  4KOR A;  3CDX A;  1TF8 A;  2J8R A;  2NMT A;  1ELM P;  2I3C A;  3FMC A;  4MCP A;  4OID A;  1U6M A;  1ARL A;  2ZOG A;  1PYT B;  2BL1 A;  2R8V A;  3DDD A;  4JXQ A;  4OAD A;  5LRJ A;  2VI7 A;  5H86 A;  1F2O A;  4BBH A;  2CIJ A;  4R3L A;  2I79 A;  3PB8 X;  3DSB A;  2AE6 A;  4FBE A;  2PJC A;  3B3C A;  5ISV A;  1QSR A;  1IYL A;  3S6K A;  3D66 A;  3F0A A;  2PSW A;  1RO5 A;  1CP7 A;  4UF4 A;  4R7M A;  2XEG A;  2PJ6 A;  4Q36 A;  4CAV A;  5K8N A;  4UFV A;  5IB0 A;  4R8F A;  4NGQ A;  3HUV A;  2ZEN A;  4KUA A;  1YLE A;  2R1I A;  3IJ3 A;  4OC0 A;  4P44 A;  4DNC A;  1IOI A;  4B12 A;  3IU1 A;  4K3N A;  4KVO E;  1Y0Y A;  1Z4E A;  3DR8 A;  2ZW6 A;  1VKC A;  4LQG A;  4TNU A;  4CYN A;  2PC1 A;  5AG4 A;  4IK2 A;  3B3T A;  4A95 A;  4C7H A;  3RZA A;  5J8F A;  2PJ5 A;  1K4J A;  1YRE A;  2DPS A;  3RBU A;  1ELL P;  5F49 A;  3CT9 A;  4ORF A;  5CNP A;  4BMH A;  1J4J A;  2F5I A;  2PR8 A;  4A30 A;  3NH4 A;  5C88 A;  2PRQ A;  2OB0 A;  4O23 A;  3WC7 A;  3FED A;  1YW6 A;  2GFQ A;  4JXR A;  4PSW A;  4A33 A;  3TFY A;  4UIA A;  4UCM A;  1V0C A;  4CYQ A;  4XNH B;  4XPK A;  5G22 A;  5BWA B;  3TO6 A;  4NFR A;  4AB7 A;  3UY5 A;  3QNV A;  4KSF A;  3W6X A;  4RUH A;  2RB7 A;  3WC6 A;  2HUZ A;  3T9Y A;  4UFW A;  3K9T A;  4NGM A;  2O53 A;  2PDO A;  2G9D A;  3FEC A;  1Z8L A;  4PXB A;  2PIY A;  1I1D A;  1AUG A;  4UFX A;  3IWW A;  4MY0 A;  3NH5 A;  3QAH A;  3S6H A;  2FE7 A;  2HB6 A;  2PVV A;  1YSJ A;  5GCN A;  3R1K A;  3CXS A;  2J9A A;  3HLP A;  4A38 A;  2P6E A;  4MCQ A;  4A37 A;  5KTC A;  1SQH A;  2FL4 A;  1PCA A;  4OC3 A;  4AXV A;  2YNE A;  1H8L A;  3H8E A;  2IL4 A;  4RI1 A;  2ZEO A;  3FH4 A;  1LOK A;  3TTH A;  2KCW A;  1I21 A;  3GUX A;  4L89 A;  4MFK A;  4RS2 A;  1ZLH A;  4P4B A;  4CAW A;  4MMO A;  1M44 A;  4B14 A;  2WZN A;  4LUA A;  1CG2 A;  4U9Y A;  4NGP A;  3TOB A;  4F8Z A;  3B8G A;  3PGP A;  1NSL A;  4ZY0 A;  3BI1 A;  1S7L A;  1KZF A;  3PB9 X;  4CGM A;  4B13 A;  2OH1 A;  4ZGY B;  1FNO A;  2EUI A;  4Q38 A;  4UCP A;  1PU9 A;  2NSM A;  1TKF A;  3FRM A;  4ZI6 A;  4C68 A;  1ARM A;  4KOU A;  1M1D A;  2JLM A;  2P6F A;  3BLN A;  3JTK A;  4CRY B;  2YNC C;  4OLL A;  2CF4 A;  1XOV A;  3D7G A;  2I00 A;  4L8A A;  4PXD A;  2B5G A;  1QSN A;  4PXC A;  1ZG7 A;  5J8C A;  1S7K A;  4FD6 A;  2Q7B A;  4KOT A;  1Z8W A;  4X2T A;  5AGE A;  1Q2D A;  4Y49 B;  5F09 A;  3KL9 A;  2R7H A;  4QUS A;  3D3S A;  5EC4 A;  3SXO A;  1YVO A;  4KUB A;  2YND A;  3FNC A;  3B3V A;  3LMS A;  4KVX A;  3VWE A;  4IHM A;  4MFZ A;  1HDU A;  2X7B A;  2Z3O A;  2QJ8 A;  1VIX A;  4U9Z A;  5AG6 A;  5K8M A;  1M4D A;  2BUE A;  3TO9 A;  2POK A;  3W6S A;  4CS0 B;  2Q51 A;  1WK4 A;  3RNZ A;  3BI0 A;  3JUW A;  2PJ8 A;  3TC8 A;  5JQ4 A;  2ABZ A;  7CPA A;  2VL1 A;  4ZY2 A;  2BOA A;  3V38 A;  4KS9 A;  3KQZ A;  4QVT A;  5F47 A;  3ZJ0 A;  3SI0 A;  1LAP A;  4P4I A;  1XRY A;  2Z3K A;  3BHX A;  5HH1 A;  1RXT A;  3EFA A;  2GIV A;  4AVB A;  3V7Z A;  3IFE A;  1BOB A;  1KUX A;  4OIW A;  5DWN A;  4YU9 A;  1FY7 A;  1M4I A;  1XF8 A;  1Y7E A;  2PJ2 A;  4A31 A;  3QB8 A;  1DE4 C;  2V8H A;  2Z3P A;  2Z3M A;  3N5F A;  3B35 A;  5AG7 A;  3D7D A;  1UWY A;  2FIA A;  3I3G A;  4P4D A;  1TF9 A;  2FT0 A; 
#chains in the Genus database with same CATH homology
 1BO4 A;  2Q04 A;  2JDC A;  2B5G B;  1VHS A;  2ATR A;  3IWE A;  3EO4 A;  2D4P A;  3TOA A;  4B10 A;  4CAE A;  4YFJ A;  2Z11 A;  1YVK A;  1KUV A;  2B3V A;  2G3T A;  3G8W A;  1QST A;  3OWC A;  4F6A A;  5H84 A;  3FBU A;  4HNW B;  2CNM A;  5KTD A;  4R3K A;  4MBU A;  2A4N A;  2Z10 A;  4F0X A;  4KOS A;  2FS5 A;  1B87 A;  3ZZI A;  4IUS A;  2REF A;  2ZW4 A;  3LD2 A;  1NE9 A;  4KSA A;  1GHE A;  1Y9W A;  1P0H A;  3PP9 A;  3NE7 A;  3E0K A;  5IX3 A;  2QML A;  5G20 A;  2WSA A;  4CGN A;  2QIR A;  3V8I A;  3GYA A;  3EY5 A;  1UFH A;  5JPH A;  3TE4 A;  4CRZ B;  4XNH C;  3CXP A;  1S3Z A;  1Y9K A;  3FYN A;  2G3A A;  3FXT A;  4NEX A;  2CNS A;  2WUU A;  4MFP A;  5F48 A;  4KOY A;  1MJB A;  2O28 A;  2YGW A;  1IID A;  4EVY A;  4X5K A;  2REE A;  3H4Q A;  2ZW5 A;  4JLY A;  2B4B A;  1I12 A;  3S6G A;  3TCV A;  4AVC A;  4CAF A;  2P6G A;  4NXY A;  4U5Y A;  1IIC A;  2H5M A;  3F8K A;  4CYO A;  2AJ6 A;  5KTA A;  1YR0 A;  4F0Y A;  4H6U A;  4CYP A;  2CXA A;  4KLW A;  2Q4V A;  4XPL A;  2CNT A;  3KKW A;  2Q44 A;  4B11 A;  4YGO A;  3LOD A;  4J3G A;  4QBJ A;  5C82 A;  4MFQ A;  2R98 A;  3T90 A;  2VQY A;  4C2Y A;  1WWZ A;  4KOX A;  3D2P A;  2JEV A;  4HNX B;  1CJW A;  3N7Z A;  5E96 A;  4I49 A;  4Y49 C;  4UWI A;  4PSX A;  4C7I A;  5IV0 A;  2G0B A;  2GE3 A;  1M4G A;  1S7F A;  5A27 A;  2OZH A;  4MJ8 A;  2BEI A;  4CAX A;  4UCN A;  3DNS A;  3R9G A;  2VZZ A;  3F5B A;  3FB3 A;  4HKF A;  4XPD B;  5F46 A;  4IF5 A;  4H89 A;  4YRH A;  1MK4 A;  3BJ8 A;  5FVJ A;  2D4O A;  3IU2 A;  2Z3N A;  3SXN A;  2CY2 A;  3C26 A;  2Q4Y A;  3MGD A;  2HV2 A;  3GY9 A;  5DWM A;  1QSM A;  2B4D A;  2DXQ A;  2DPT A;  3R9F A;  2PQ8 A;  1YK3 A;  2K5T A;  5A28 A;  3PZJ A;  1S60 A;  3R9E A;  2EVN A;  4KVM E;  3TT2 A;  2Q0Y A;  3CXQ A;  1YGH A;  4JD6 A;  1PUA A;  1ZO0 A;  2ZW7 A;  4AVA A;  4ZBG A;  3EXN A;  4MFL A;  1TIQ A;  1XIX A;  4JWP A;  3IGR A;  5I0C A;  4MHD A;  2Z0Z A;  2J8N A;  4UWJ A;  2GAN A;  4PV6 A;  1MJA A;  4OAE A;  3DR6 A;  1B6B A;  2FXF A;  2P0W A;  4MY3 A;  2FSR A;  2RC4 A;  3P2F A;  2VXK A;  4E2A A;  2C27 A;  1L0C A;  2B4D B;  4FD4 A;  3G3S A;  2WPX A;  4M3S A;  4B5O A;  5G1Z A;  2VEZ A;  1LRZ A;  3VWD A;  3D2M A;  1IB1 E;  3A9L A;  4R57 A;  4AG7 A;  4C2Z A;  2FCK A;  4A2Z A;  4R87 A;  2YNC A;  2BSW A;  4B5P A;  3WR7 A;  1P4N A;  1S7N A;  2QEC A;  3R96 A;  3W91 A;  4MI4 A;  2ZPA A;  4LX9 A;  4PK2 A;  4NSQ A;  2Y0M A;  1XMT A;  4K30 A;  4R9M A;  1OZP A;  4FD7 A;  2WPW A;  3IWG A;  1Y7R A;  4C2X A;  2B3U A;  3I9S A;  1Z4R A;  2Z3L A;  1ON0 A;  4E0A A;  2B58 A;  4KLV A;  5EBV A;  4II9 A;  4KOV A;  3SHP A;  4KOW A;  4H6Z A;  4E8O A;  2ARH A;  4KZT A;  3K9U A;  4QB9 A;  3H5Z A;  1N71 A;  4NF1 A;  3P2H A;  2PRB A;  1NMT A;  4PK3 A;  4B5P B;  1R57 A;  4CGO A;  1CM0 A;  1MJ9 A;  1S5K A;  2J8M A;  4M85 A;  2OZU A;  3D8P A;  1Q2C A;  3GKR A;  1Q2Y A;  1XEB A;  2VBQ A;  2ZXV A;  3BJ7 A;  3JVN A;  4ONU A;  3TO7 A;  4FD5 A;  3EC4 A;  5AG5 A;  4A32 A;  4QC6 A;  4XPD C;  1YX0 A;  5G21 A;  3R95 A;  4CGP A;  1QSO A;  2HQY A;  4GS4 A;  1KUY A;  4MFJ A;  4CGL A;  2FIW A;  4NCZ A;  3FIX A;  5HMN A;  2OZG A;  4UBR A;  4AG9 A;  2VZY A;  2OU2 A;  4JJX A;  4UA3 A;  1Z9U A;  2PR1 A;  2JDD A;  1XE4 A;  3S6F A;  1IYK A;  4HNY B;  4KOR A;  2J8R A;  2NMT A;  1U6M A;  2BL1 A;  2R8V A;  3DDD A;  4JXQ A;  4OAD A;  2VI7 A;  5H86 A;  4BBH A;  4R3L A;  2I79 A;  3DSB A;  2AE6 A;  5ISV A;  1QSR A;  1IYL A;  3S6K A;  3F0A A;  2PSW A;  1RO5 A;  4Q36 A;  4CAV A;  4UFV A;  5IB0 A;  4KUA A;  1YLE A;  2R1I A;  4DNC A;  4B12 A;  3IU1 A;  4KVO E;  1Z4E A;  3DR8 A;  2ZW6 A;  1VKC A;  4CYN A;  2PC1 A;  5AG4 A;  4A95 A;  4C7H A;  5J8F A;  1K4J A;  1YRE A;  2DPS A;  5F49 A;  4ORF A;  5CNP A;  4BMH A;  1J4J A;  2F5I A;  2PR8 A;  4A30 A;  5C88 A;  2OB0 A;  4A33 A;  4JXR A;  4PSW A;  3TFY A;  4UCM A;  1V0C A;  4CYQ A;  4XNH B;  4XPK A;  5G22 A;  5BWA B;  3TO6 A;  4AB7 A;  3UY5 A;  4KSF A;  3W6X A;  2HUZ A;  3T9Y A;  4UFW A;  2PDO A;  1I1D A;  4UFX A;  4MY0 A;  3QAH A;  3S6H A;  2FE7 A;  5GCN A;  3R1K A;  3CXS A;  2P6E A;  5KTC A;  1SQH A;  2FL4 A;  2YNE A;  2IL4 A;  4RI1 A;  3TTH A;  2KCW A;  1I21 A;  4MFK A;  4L89 A;  4RS2 A;  4CAW A;  1M44 A;  4B14 A;  4LUA A;  4U9Y A;  3TOB A;  3B8G A;  3PGP A;  1NSL A;  1S7L A;  1KZF A;  4CGM A;  4B13 A;  2OH1 A;  4ZGY B;  4Q38 A;  2EUI A;  4UCP A;  1PU9 A;  3FRM A;  4C68 A;  4KOU A;  1M1D A;  2JLM A;  2P6F A;  3BLN A;  3JTK A;  4CRY B;  2YNC C;  4OLL A;  4L8A A;  2I00 A;  2B5G A;  1QSN A;  5J8C A;  1S7K A;  4FD6 A;  2Q7B A;  4KOT A;  5AGE A;  1Q2D A;  4Y49 B;  2R7H A;  4QUS A;  3D3S A;  5EC4 A;  3SXO A;  1YVO A;  4KUB A;  2YND A;  3FNC A;  4KVX A;  3VWE A;  4MFZ A;  2X7B A;  2Z3O A;  4U9Z A;  5AG6 A;  1M4D A;  2BUE A;  3TO9 A;  3W6S A;  4CS0 B;  1WK4 A;  3JUW A;  5JQ4 A;  4KS9 A;  4QVT A;  5F47 A;  3ZJ0 A;  2Z3K A;  5HH1 A;  1RXT A;  3EFA A;  2GIV A;  4AVB A;  1BOB A;  1KUX A;  5DWN A;  1FY7 A;  1M4I A;  1XF8 A;  4A31 A;  3QB8 A;  2Z3P A;  2Z3M A;  5AG7 A;  2FIA A;  3I3G A;  3RYO A;  2FT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...