4UFWA

Plasmodium vivax n-myristoyltransferase in complex with a pyridyl inhibitor (compound 22)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of Pyridyl-Based Inhibitors of Plasmodium Falciparum N-Myristoyltransferase
pubmed doi rcsb
source organism Plasmodium vivax
total genus 118
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ufwA00
4BBHA 4A2ZA 4CAEA 4B14A 3IU1A 5AG5A 4C2YA 3H5ZA 4CGPA 4B10A 4UCMA 4CGLA 4C2ZA 4CYQA 4UFVA 5G1ZA 5AG7A 4CAFA 5AGEA 4CGOA 4CYOA 5G21A 4A95A 4A33A 4UFXA 4C7HA 3JTKA 4UCNA 2WSAA 4C2XA 4C68A 2YNCC 4CGNA 4CYPA 2YNCA 4CYNA 4UCPA 5G22A 4UFWA 3IU2A 3IWEA 4C7IA 5A27A 4A32A 4B12A 2WUUA 2YNDA 4B13A 4CGMA 4A31A 5G20A 2YNEA 5AG4A 5AG6A 5A28A 4B11A 4A30A
chains in the Genus database with same CATH superfamily
4NEXA 4IHMA 4YU9A 2B4DA 4C2YA 5HVHA 1GHEA 3TO6A 3W91A 2PSWA 1Y0YA 3SJEA 3BJ7A 2PR8A 3PBBA 4M85A 1V0CA 4E0AA 4KSFA 3QAYA 4X2TA 2NSMA 1A2ZA 3SHPA 3K9UA 3D2MA 3B3WA 4OMEA 4AVBA 2QJ8A 5HVFA 1XJOA 3R96A 2Q7BA 4DUKA 4UBRA 2EVNA 1GYTA 3B3SA 2B58A 3BLNA 3CPXA 1RO5A 4B5OA 5A27A 3GYAA 3H8FA 2CNMA 1QSRA 1YLOA 2XEGA 4A32A 4ZY0A 4BINA 1Z8TA 2GLJA 3TX8A 2C6PA 2IJZA 3FNCA 4CAVA 3C26A 3H8GA 3NH8A 4ZX9A 2AFSA 1OBRA 1F2OA 2C6CA 1R3NA 3PFOA 2RB7A 4Y49B 5F46A 4O23A 3BJ8A 3VATA 3MN8A 4E8OA 4KSIA 4CGLA 3IGRA 4MFQA 3WT4A 2Q4VA 2GU2A 4JD6A 1MJAA 2RFHA 2VXKA 4P10A 5HH1A 4UEZA 4P45A 2CIJA 4UFXA 4PQAA 1M4IA 4MY3A 3TO7A 4YWYA 4MFJA 5F49A 4XPKA 3I9SA 4R3KA 3S9NA 2EK8A 1PUAA 1MK4A 3NFZA 4KUAA 4CPAA 3FX6A 2K5TA 4TWEA 4WWVA 4YGOA 1Z4RA 5G22A 2GANA 3V7ZA 4M3SA 2Q7SA 3F0AA 4R57A 4R9MA 2ATRA 4B13A 5AG4A 4MBUA 4A37A 2ZOGA 2RC4A 4A38A 4CGPA 5LYFA 1X10A 3D68A 4JXRA 1TKJA 3B3TA 4H6ZA 2B4BA 4G1PA 1AMPA 4F0XA 5K8MA 3B7IA 1R57A 2NMTA 4CYOA 1YW6A 4P6YA 1HDUA 4B6ZA 4A33A 3SI2A 3FYNA 2HB6A 4P4JA 4KVOE 2PJ8A 2VQYA 4NJQA 4PSXA 2WSAA 4Q38A 4MMOA 1LOKA 4U9YA 3RBUA 4F9VA 1J4JA 4MHYA 2P6FA 2AFUA 2JLMA 1ZLIA 3CT9A 1Z2LA 4KOWA 4NGTA 2CTBA 1VIXA 3WC7A 3HUVA 1KZFA 4FD6A 2R98A 2YNDA 2BOAA 2OU2A 2FXFA 4HPSA 2PJCA 2V8GA 1U6MA 5J8CA 4KZTA 4MFKA 2B3VA 3D2PA 5I0CA 2FL4A 3IC1A 4OC4A 4IK2A 4MHZA 4KUBA 4TNUA 2JBKA 5C82A 2ODFA 4KOYA 4AVAA 4FUUA 5IB9A 2G0BA 3D7HA 4UFVA 1M4GA 1RTQA 3PEIA 5BWAB 2CY2A 1DTDA 2V8VA 3B35A 6CPAA 4LQGA 3KZWA 1ELMP 2OZHA 2V8DA 2ZW4A 3GY9A 4H2KA 1CJWA 3SJGA 3SI0A 2YNCA 3I3GA 1CPSA 4OLLA 3I1UA 1BPNA 3FMCA 2DXQA 2ZEMA 3IIBA 2ANPA 3PB7X 4A31A 3TE4A 3IEHA 1DE4C 2R1IA 4P4IA 2YGWA 1N71A 4KOTA 2J8MA 1S7FA 3H4QA 4LUAA 2IL4A 4UIBA 2A4NA 1KUXA 4UCMA 4EFDA 1BLLE 5THWA 2EK9A 5KTDA 2PJ7A 1TF9A 4IUSA 4MI4A 2KCWA 3T90A 1VHOA 4UIAA 4C7HA 4UCNA 2ZEGA 2JEVA 4ONWA 4P4DA 5HXDA 3TOBA 2V77A 4FD4A 3K9TA 3P2HA 4IAVA 1NSAA 2FVGA 2ZXVA 3BHXA 4MJ8A 4NCZA 4YRHA 1YLEA 3R9GA 1FY7A 5LRGA 4OIWA 5IX3A 5DWMA 2G3AA 2I00A 3SXNA 3KHXA 1ZG8A 3S6FA 1M1DA 1S60A 2PE3A 3GUXA 2I79A 2ZW5A 2Q44A 2WZNA 4BBHA 4MCPA 4F9UA 3F8KA 2Q43A 1KWMA 4WJBA 1YK3A 3FXTA 1F57A 1XBUA 2BEIA 2PDOA 4XPDC 3KQXA 2J8RA 3DSBA 2EWBA 5JM6A 1YREA 4LX9A 2Q0YA 1P4NA 5IV0A 4FWUA 4UEEA 4MCRA 3CXQA 4J3GA 3JRUA 1Z9UA 4PXDA 1VHEA 1PCAA 2F5IA 2PIYA 2Z11A 4R6TA 4Y49C 3CXPA 3ZJ0A 4DJLA 3FECA 4C7IA 5LYLA 4QUSA 1CG2A 4EVYA 4B12A 1L0CA 4CAXA 3JUWA 1Z8WA 1MJBA 1XMTA 1XMBA 2FIAA 5CNPA 3DNSA 4OC0A 3IO1A 5ISVA 4KS9A 4FAIA 3H5ZA 1RXTA 2PVVA 3BI1A 1XF8A 4B5PB 1ZG7A 3DDDA 3KGQA 4KVXA 5E96A 3H8EA 2CXAA 5AGEA 4CS0B 2OOTA 3FJUA 4KSAA 3B3VA 2JDCA 2VBQA 4NGRA 4AB7A 3NA6A 4UA3A 3LMSA 1VKCA 3FF3A 3T8WA 2FS5A 3R9EA 4H89A 4UEFA 3RNZA 1I1DA 3IWEA 5J8FA 3KL9A 4ONUA 4X3RA 3WABA 3RZAA 2FIWA 2P0WA 4NGMA 3FIXA 4CGMA 3HLPA 2X7BA 2PJ2A 1XOVA 4PXBA 1K4JA 1S7KA 2R8VA 2YNEA 4OIDA 5AG6A 3VARA 1YW4A 2QMLA 3NE8A 3W6XA 1UFHA 3UY5A 4CAEA 4B14A 2ZEHA 4HNYB 2ZEEA 5AG5A 5D29A 2B5GA 3EXNA 1JWQA 4PV6A 1CPXA 4ZX8A 4PPZA 2BUEA 4CYQA 2Z3MA 3VH9A 2R7HA 1XRYA 5K8OA 2OB0A 4M6IA 5EBVA 4R8FA 5HMNA 3FEDA 5ELYA 1KUVA 2FT0A 2O53A 1YMEA 3ISZA 3RO0A 1TKFA 3CDXA 1IY7A 2ARHA 3FVLA 3D66A 1NE9A 5H86A 3TTHA 4JLYA 1ON0A 5EC4A 5DS0A 3TOAA 2AFOA 4W9YA 3FEEA 2EUIA 4MHPA 4AXVA 2VEZA 4MFLA 4MFPA 1B6BA 1Z4EA 2PJ0A 1NSLA 4CAWA 5KTAA 2OZGA 4P4EA 3VWDA 4A30A 1ZLHA 4KORA 3KHZA 2NYQA 1LAMA 4OC5A 3IU1A 1SQHA 3CXSA 4KOVA 3K2KA 1JQGA 4MCSA 2GIVA 2Q4ZA 4BMHA 1KUYA 3LD2A 3KQZA 4OAEA 5DWNA 3QNVA 2F8HA 4CGOA 4GS4A 3RAMA 2HQYA 3SXOA 3V38A 4XNHC 3F5BA 1YGHA 2FE7A 4II9A 3D8PA 3S9MA 3TCVA 5K8NA 4JWPA 1LAPA 2JEWA 3IU2A 4CRZB 3PZJA 3TFYA 3MRUA 1ZO0A 2DPSA 2AE6A 2WUUA 5JQ4A 3NH5A 4KOXA 1IICA 3SJFA 2OZUA 2VI7A 4OC1A 3PB6X 4OP4A 5HVGA 2ZEDA 1PYTB 1Z5RA 4MCQA 3R9FA 3D4UA 1B87A 2P6EA 1IOIA 3KR4A 3R1KA 1XFOA 1BAVA 1FNOA 2PRBA 2GFQA 1H8LA 2DPTA 3G8WA 2IMOA 4RN7A 3R95A 4CAFA 2O4HA 4MY0A 2PVWA 1Q2CA 2G3TA 1Y9WA 4L8AA 4UWIA 2B4DB 4JZ0A 5D8NA 5LRKA 1S5KA 2GREA 2XEFA 2PC1A 2VZZA 3ISXA 4NGNA 4C68A 2BL1A 3MGDA 3SI1A 2GLFA 4E2AA 3NE7A 1QMUA 3GB0A 2PR1A 2PIZA 1XIXA 5F47A 1Z8XA 1ZG9A 1BOBA 2FCKA 4AVCA 2PJAA 4H6UA 2EBJA 3BXMA 3BI0A 1S3ZA 3PP9A 4Q36A 4OADA 2VZYA 3T9YA 2G9DA 4KLWA 4A39A 4EWTA 7CPAA 1CM0A 3PB8X 2JBJA 1CBXA 2PJBA 5JGFA 2Z3PA 5CBMA 3PBEA 4JYWA 2ZW6A 2Z3KA 3B2YA 1VGYA 2Z10A 3D7DA 4HNWB 3LACA 2REEA 1YR0A 3DGVA 3IWGA 4HNXB 3LODA 2QYVA 2WPXA 2Z3OA 2XEJA 2ZEOA 1LANA 1BO4A 2AFWA 3EFAA 4U5YA 4KOSA 2HV2A 3DR6A 4PXCA 4R3LA 2BCOA 4XPLA 2QECA 2PCUA 4R7MA 3WC5A 2ZELA 4BD9A 2CTCA 4KLVA 4KOUA 2PJ3A 2F7VA 1I21A 1TXRA 3VWEA 2P6GA 3QB8A 4MRIA 4C2ZA 2JDDA 5I4MA 2HC9A 3FB3A 2Y0MA 1YQEA 1IGBA 1F2PA 1M44A 5F09A 1M4LA 2B5GB 1EE3P 1QSMA 1Y9KA 2POKA 3JTKA 3PRTA 3QAHA 4PK2A 4NGPA 3IJ3A 1WWZA 3SJXA 3D7GA 4CYPA 1NMTA 4Q7AA 4U9ZA 4XPDB 3EY5A 1LCPA 4ZGYB 1LFWA 2V8HA 4MHDA 1ARLA 3S6HA 2OH1A 1PU9A 3N7ZA 3PFEA 5H84A 3S6GA 2C6GA 1MJ9A 4PK3A 5EMIA 2DF5A 4ZBGA 2C1CA 2PJ4A 4K3NA 2C27A 4NFRA 1Y7EA 2AFXA 1I12A 1UWYA 2REFA 1Z8LA 2AJ6A 2VL1A 4JJXA 4QVTA 3S9LA 1R43A 2O28A 1IYLA 1XEBA 5LRJA 2I3CA 4OC3A 4HKFA 4M6HA 3IFEA 4RI1A 4ZY2A 1HDQA 4F8ZA 4ZY1A 3KASA 1XE4A 2J9AA 5LYIA 4C2XA 2YNCC 2ZOFA 4UF4A 1QQ9A 4NJRA 3V8IA 4UFWA 3KR5A 3G3SA 4F0YA 1Y0RA 2DEAA 4ORFA 4ZYQA 3PB4X 4A94A 2CNSA 1TIQA 4B5PA 4CRYB 3JVNA 2PRQA 1S7LA 4QC6A 1QSNA 3B3CA 2ZPAA 1QSOA 5A28A 4F6AA 2ZW7A 4B11A 3CPAA 4NF1A 5K8PA 2B3UA 1M4DA 1AYEA 1FT7A 4R76A 1YVKA 3A9LA 1ELLP 1Q2YA 3GIUA 3FH4A 1YX0A 3KI9A 3OWCA 4OC2A 3WC6A 3RYOA 5KTCA 2AFZA 4ZI6A 4P4FA 4MFZA 4A95A 5J1QA 2PJ1A 4GXHA 1Q7LA 1WK4A 4JXQA 3CZXA 8CPAA 4NSQA 2QIRA 1P0HA 1AUGA 1QSTA 3PGPA 3ZZIA 2AFMA 2Q4YA 3TT2A 1IB1E 4LQ6A 3TC8A 3D67A 4UCPA 1CP7A 4CYNA 2BO9A 3WR7A 3DR8A 3N5FA 4L89A 4M6GA 5LYDA 3D3SA 4NGSA 1S7NA 5C88A 2J8NA 5G20A 1TKHA 1Q2DA 1CP6A 3PB9X 3EC4A 3KKWA 4P4BA 4I49A 5FVJA 5JH9A 2EO8A 3P2FA 4B10A 3L2NA 5GCNA 3DLJA 2WPWA 3LWUA 4FD5A 4AG7A 3S6KA 5G1ZA 3GKRA 2D4OA 3E0KA 4PSWA 1IOFA 4YFJA 5G21A 4FD7A 4DYOA 4EMEA 1CX8A 1IYKA 2PJ5A 3D7FA 4X5KA 4P44A 3IWWA 1BPMA 1YVOA 3B8GA 4AG9A 4DNCA 1TF8A 5IB0A 4FBEA 3W6SA 4NGQA 5F48A 4XNHB 4GM5A 2QVPA 2PJ6A 2WYRA 2D4PA 1IIDA 4RS2A 4A2ZA 5JPHA 4Z65A 5CPAA 4X8IA 2H5MA 2CF4A 1ARMA 2Z0ZA 2Q04A 4PXEA 5AG7A 2Z3NA 2IQ6A 4IF5A 2XEIA 3EO4A 4NXYA 3FRMA 2HUZA 1OZPA 1IU8A 3GLJA 4CGNA 4KVME 1X12A 4QBJA 1VHSA 2Q51A 2ZEPA 4MXUA 2ZEFA 2ZENA 4OKOA 4QB9A 4UWJA 4R87A 2ABZA 2GE3A 4MHNA 1LRZA 2PJ9A 3TO9A 2BSWA 2CNTA 2FSRA 2Z3LA 3FBUA 1HEEA 3NH4A 4K30A 4RUHA 1Y7RA 1YSJA 2PQ8A 2OR4A
chains in the Genus database with same CATH topology
4NEXA 2B4DA 4C2YA 1GHEA 3TO6A 3W91A 2PSWA 3BJ7A 2PR8A 4M85A 1V0CA 4E0AA 4KSFA 3SHPA 3K9UA 3D2MA 4AVBA 3R96A 2Q7BA 4UBRA 2EVNA 2B58A 3BLNA 4B5OA 1RO5A 5A27A 3GYAA 2CNMA 1QSRA 4A32A 4CAVA 3FNCA 3C26A 5F46A 4Y49B 3BJ8A 4E8OA 4CGLA 3IGRA 4MFQA 2Q4VA 4JD6A 5HH1A 1MJAA 2VXKA 4UFXA 1M4IA 4MY3A 3TO7A 4MFJA 5F49A 4XPKA 3I9SA 4R3KA 1PUAA 1MK4A 4KUAA 2K5TA 5G22A 4YGOA 1Z4RA 2GANA 4M3SA 3F0AA 4R57A 4R9MA 2ATRA 4B13A 5AG4A 4MBUA 2RC4A 4CGPA 4JXRA 4H6ZA 2B4BA 4F0XA 1R57A 2NMTA 4CYOA 4A33A 3FYNA 4PSXA 4Q38A 4KVOE 2VQYA 2WSAA 4U9YA 1J4JA 2P6FA 2JLMA 4KOWA 1KZFA 4FD6A 2R98A 2YNDA 2OU2A 2FXFA 1U6MA 5J8CA 4KZTA 4MFKA 2B3VA 3D2PA 5I0CA 2FL4A 4KUBA 5C82A 4KOYA 4AVAA 2G0BA 4UFVA 1M4GA 5BWAB 2CY2A 2OZHA 2ZW4A 3GY9A 1CJWA 2YNCA 3I3GA 4OLLA 2DXQA 3TE4A 4A31A 2R1IA 2YGWA 1N71A 4KOTA 2J8MA 1S7FA 3H4QA 4LUAA 2IL4A 2A4NA 1KUXA 4UCMA 5KTDA 4IUSA 4MI4A 2KCWA 3T90A 4C7HA 4UCNA 2JEVA 3TOBA 4FD4A 3P2HA 4NCZA 2ZXVA 5IX3A 4MJ8A 4YRHA 3R9GA 1YLEA 1FY7A 5DWMA 2G3AA 2I00A 3SXNA 3S6FA 1M1DA 1S60A 2I79A 2ZW5A 2Q44A 4BBHA 3F8KA 1YK3A 3FXTA 4XPDC 2BEIA 2PDOA 2J8RA 3DSBA 1YREA 4LX9A 2Q0YA 1P4NA 5IV0A 3CXQA 4J3GA 1Z9UA 2F5IA 2Z11A 4Y49C 3CXPA 3ZJ0A 4C7IA 4QUSA 4EVYA 4B12A 1L0CA 4CAXA 3JUWA 1MJBA 1XMTA 2FIAA 5CNPA 3DNSA 5ISVA 4KS9A 3H5ZA 1RXTA 1XF8A 4B5PB 3DDDA 4KVXA 5E96A 5AGEA 2CXAA 4CS0B 4KSAA 2JDCA 2VBQA 4AB7A 4UA3A 1VKCA 2FS5A 3R9EA 4H89A 1I1DA 3IWEA 5J8FA 4ONUA 2FIWA 2P0WA 3FIXA 4CGMA 2X7BA 1K4JA 1S7KA 2R8VA 2YNEA 5AG6A 2QMLA 3W6XA 1UFHA 3UY5A 4CAEA 4B14A 4HNYB 5AG5A 2B5GA 3EXNA 4PV6A 4CYQA 2BUEA 2Z3MA 2R7HA 2OB0A 5EBVA 5HMNA 1KUVA 2FT0A 5H86A 2ARHA 3TTHA 1NE9A 4JLYA 1ON0A 5EC4A 3TOAA 2EUIA 2VEZA 4MFLA 4MFPA 1B6BA 1Z4EA 1NSLA 4CAWA 5KTAA 2OZGA 3VWDA 4A30A 4KORA 3IU1A 1SQHA 3CXSA 4KOVA 2GIVA 4BMHA 1KUYA 3LD2A 4OAEA 5DWNA 4CGOA 4GS4A 2HQYA 3SXOA 4XNHC 3F5BA 1YGHA 2FE7A 4II9A 3D8PA 3TCVA 4JWPA 3IU2A 4CRZB 3PZJA 3TFYA 1ZO0A 2DPSA 2AE6A 2WUUA 5JQ4A 4KOXA 1IICA 2OZUA 2VI7A 3R9FA 1B87A 2P6EA 3R1KA 2PRBA 3G8WA 2DPTA 3R95A 4CAFA 4MY0A 1Q2CA 2G3TA 1Y9WA 4L8AA 4UWIA 2B4DB 1S5KA 4C68A 2PC1A 2VZZA 2BL1A 3MGDA 4E2AA 3NE7A 5F47A 2PR1A 1XIXA 1BOBA 2FCKA 4AVCA 4H6UA 3PP9A 1S3ZA 4Q36A 4OADA 2VZYA 3T9YA 4KLWA 1CM0A 2Z3PA 2ZW6A 2Z3KA 2Z10A 4HNWB 2REEA 1YR0A 3IWGA 4HNXB 3LODA 2WPXA 2Z3OA 1BO4A 3EFAA 4U5YA 4KOSA 2HV2A 3DR6A 4R3LA 4XPLA 2QECA 4KLVA 4KOUA 1I21A 3VWEA 2P6GA 3QB8A 4C2ZA 2JDDA 3FB3A 2Y0MA 1M44A 2B5GB 3JTKA 3QAHA 1QSMA 1Y9KA 4PK2A 1WWZA 4CYPA 1NMTA 4ZGYB 4U9ZA 4XPDB 3EY5A 4MHDA 3S6HA 2OH1A 1PU9A 3N7ZA 5H84A 3S6GA 1MJ9A 4PK3A 4ZBGA 2C27A 1I12A 2REFA 4QVTA 2AJ6A 4JJXA 2O28A 1IYLA 1XEBA 4RI1A 4HKFA 1XE4A 4C2XA 2YNCC 3V8IA 4UFWA 4F0YA 3G3SA 4ORFA 2CNSA 1TIQA 4B5PA 4CRYB 3JVNA 4QC6A 1S7LA 1QSNA 2ZPAA 1QSOA 5A28A 4F6AA 2ZW7A 4B11A 4NF1A 2B3UA 1M4DA 1YVKA 3A9LA 1Q2YA 1YX0A 3OWCA 3RYOA 5KTCA 4MFZA 4A95A 4JXQA 1WK4A 4NSQA 2QIRA 1P0HA 3PGPA 1QSTA 3ZZIA 2Q4YA 3TT2A 1IB1E 4CYNA 4UCPA 3WR7A 3DR8A 4L89A 3D3SA 1S7NA 5C88A 2J8NA 5G20A 1Q2DA 3EC4A 3KKWA 4I49A 5FVJA 3P2FA 4B10A 5GCNA 4FD5A 2WPWA 4AG7A 3S6KA 5G1ZA 3GKRA 2D4OA 3E0KA 4PSWA 4YFJA 5G21A 4FD7A 1IYKA 4X5KA 1YVOA 3B8GA 4AG9A 4DNCA 5IB0A 3W6SA 5F48A 4XNHB 2D4PA 1IIDA 4RS2A 4A2ZA 5JPHA 2H5MA 2Z0ZA 2Q04A 5AG7A 2Z3NA 4IF5A 3EO4A 4NXYA 3FRMA 2HUZA 1OZPA 4CGNA 4KVME 4QBJA 1VHSA 4QB9A 4UWJA 4R87A 2GE3A 1LRZA 3TO9A 2BSWA 2CNTA 2FSRA 2Z3LA 3FBUA 4K30A 1Y7RA 2PQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBH A;  4A2Z A;  4CAE A;  4B14 A;  3IU1 A;  5AG5 A;  4C2Y A;  3H5Z A;  4CGP A;  4B10 A;  4UCM A;  4CGL A;  4C2Z A;  4CYQ A;  4UFV A;  5G1Z A;  5AG7 A;  4CAF A;  5AGE A;  4CGO A;  4CYO A;  5G21 A;  4A95 A;  4A33 A;  4UFX A;  4C7H A;  3JTK A;  4UCN A;  2WSA A;  4C2X A;  4C68 A;  2YNC C;  4CGN A;  4CYP A;  2YNC A;  4CYN A;  4UCP A;  5G22 A;  4UFW A;  3IU2 A;  3IWE A;  4C7I A;  5A27 A;  4A32 A;  4B12 A;  2WUU A;  2YND A;  4B13 A;  4CGM A;  4A31 A;  5G20 A;  2YNE A;  5AG4 A;  5AG6 A;  5A28 A;  4B11 A;  4A30 A; 
#chains in the Genus database with same CATH topology
 4NEX A;  4IHM A;  4YU9 A;  2B4D A;  4C2Y A;  5HVH A;  1GHE A;  3TO6 A;  3W91 A;  2PSW A;  1Y0Y A;  3SJE A;  3BJ7 A;  2PR8 A;  3PBB A;  4M85 A;  1V0C A;  4E0A A;  4KSF A;  3QAY A;  4X2T A;  2NSM A;  1A2Z A;  3SHP A;  3K9U A;  3D2M A;  3B3W A;  4OME A;  4AVB A;  2QJ8 A;  5HVF A;  1XJO A;  3R96 A;  2Q7B A;  4DUK A;  4UBR A;  2EVN A;  1GYT A;  3B3S A;  2B58 A;  3BLN A;  3CPX A;  1RO5 A;  4B5O A;  5A27 A;  3GYA A;  3H8F A;  2CNM A;  1QSR A;  1YLO A;  2XEG A;  4A32 A;  4ZY0 A;  4BIN A;  1Z8T A;  2GLJ A;  3TX8 A;  2C6P A;  2IJZ A;  3FNC A;  4CAV A;  3C26 A;  3H8G A;  3NH8 A;  4ZX9 A;  2AFS A;  1OBR A;  1F2O A;  2C6C A;  1R3N A;  3PFO A;  2RB7 A;  4Y49 B;  5F46 A;  4O23 A;  3BJ8 A;  3VAT A;  3MN8 A;  4E8O A;  4KSI A;  4CGL A;  3IGR A;  4MFQ A;  3WT4 A;  2Q4V A;  2GU2 A;  4JD6 A;  1MJA A;  2RFH A;  2VXK A;  4P10 A;  5HH1 A;  4UEZ A;  4P45 A;  2CIJ A;  4UFX A;  4PQA A;  1M4I A;  4MY3 A;  3TO7 A;  4YWY A;  4MFJ A;  5F49 A;  4XPK A;  3I9S A;  4R3K A;  3S9N A;  2EK8 A;  1PUA A;  1MK4 A;  3NFZ A;  4KUA A;  4CPA A;  3FX6 A;  2K5T A;  4TWE A;  4WWV A;  4YGO A;  1Z4R A;  5G22 A;  2GAN A;  3V7Z A;  4M3S A;  2Q7S A;  3F0A A;  4R57 A;  4R9M A;  2ATR A;  4B13 A;  5AG4 A;  4MBU A;  4A37 A;  2ZOG A;  2RC4 A;  4A38 A;  4CGP A;  5LYF A;  1X10 A;  3D68 A;  4JXR A;  1TKJ A;  3B3T A;  4H6Z A;  2B4B A;  4G1P A;  1AMP A;  4F0X A;  5K8M A;  3B7I A;  1R57 A;  2NMT A;  4CYO A;  1YW6 A;  4P6Y A;  1HDU A;  4B6Z A;  4A33 A;  3SI2 A;  3FYN A;  2HB6 A;  4P4J A;  4KVO E;  2PJ8 A;  2VQY A;  4NJQ A;  4PSX A;  2WSA A;  4Q38 A;  4MMO A;  1LOK A;  4U9Y A;  3RBU A;  4F9V A;  1J4J A;  4MHY A;  2P6F A;  2AFU A;  2JLM A;  1ZLI A;  3CT9 A;  1Z2L A;  4KOW A;  4NGT A;  2CTB A;  1VIX A;  3WC7 A;  3HUV A;  1KZF A;  4FD6 A;  2R98 A;  2YND A;  2BOA A;  2OU2 A;  2FXF A;  4HPS A;  2PJC A;  2V8G A;  1U6M A;  5J8C A;  4KZT A;  4MFK A;  2B3V A;  3D2P A;  5I0C A;  2FL4 A;  3IC1 A;  4OC4 A;  4IK2 A;  4MHZ A;  4KUB A;  4TNU A;  2JBK A;  5C82 A;  2ODF A;  4KOY A;  4AVA A;  4FUU A;  5IB9 A;  2G0B A;  3D7H A;  4UFV A;  1M4G A;  1RTQ A;  3PEI A;  5BWA B;  2CY2 A;  1DTD A;  2V8V A;  3B35 A;  6CPA A;  4LQG A;  3KZW A;  1ELM P;  2OZH A;  2V8D A;  2ZW4 A;  3GY9 A;  4H2K A;  1CJW A;  3SJG A;  3SI0 A;  2YNC A;  3I3G A;  1CPS A;  4OLL A;  3I1U A;  1BPN A;  3FMC A;  2DXQ A;  2ZEM A;  3IIB A;  2ANP A;  3PB7 X;  4A31 A;  3TE4 A;  3IEH A;  1DE4 C;  2R1I A;  4P4I A;  2YGW A;  1N71 A;  4KOT A;  2J8M A;  1S7F A;  3H4Q A;  4LUA A;  2IL4 A;  4UIB A;  2A4N A;  1KUX A;  4UCM A;  4EFD A;  1BLL E;  5THW A;  2EK9 A;  5KTD A;  2PJ7 A;  1TF9 A;  4IUS A;  4MI4 A;  2KCW A;  3T90 A;  1VHO A;  4UIA A;  4C7H A;  4UCN A;  2ZEG A;  2JEV A;  4ONW A;  4P4D A;  5HXD A;  3TOB A;  2V77 A;  4FD4 A;  3K9T A;  3P2H A;  4IAV A;  1NSA A;  2FVG A;  2ZXV A;  3BHX A;  4MJ8 A;  4NCZ A;  4YRH A;  1YLE A;  3R9G A;  1FY7 A;  5LRG A;  4OIW A;  5IX3 A;  5DWM A;  2G3A A;  2I00 A;  3SXN A;  3KHX A;  1ZG8 A;  3S6F A;  1M1D A;  1S60 A;  2PE3 A;  3GUX A;  2I79 A;  2ZW5 A;  2Q44 A;  2WZN A;  4BBH A;  4MCP A;  4F9U A;  3F8K A;  2Q43 A;  1KWM A;  4WJB A;  1YK3 A;  3FXT A;  1F57 A;  1XBU A;  2BEI A;  2PDO A;  4XPD C;  3KQX A;  2J8R A;  3DSB A;  2EWB A;  5JM6 A;  1YRE A;  4LX9 A;  2Q0Y A;  1P4N A;  5IV0 A;  4FWU A;  4UEE A;  4MCR A;  3CXQ A;  4J3G A;  3JRU A;  1Z9U A;  4PXD A;  1VHE A;  1PCA A;  2F5I A;  2PIY A;  2Z11 A;  4R6T A;  4Y49 C;  3CXP A;  3ZJ0 A;  4DJL A;  3FEC A;  4C7I A;  5LYL A;  4QUS A;  1CG2 A;  4EVY A;  4B12 A;  1L0C A;  4CAX A;  3JUW A;  1Z8W A;  1MJB A;  1XMT A;  1XMB A;  2FIA A;  5CNP A;  3DNS A;  4OC0 A;  3IO1 A;  5ISV A;  4KS9 A;  4FAI A;  3H5Z A;  1RXT A;  2PVV A;  3BI1 A;  1XF8 A;  4B5P B;  1ZG7 A;  3DDD A;  3KGQ A;  4KVX A;  5E96 A;  3H8E A;  2CXA A;  5AGE A;  4CS0 B;  2OOT A;  3FJU A;  4KSA A;  3B3V A;  2JDC A;  2VBQ A;  4NGR A;  4AB7 A;  3NA6 A;  4UA3 A;  3LMS A;  1VKC A;  3FF3 A;  3T8W A;  2FS5 A;  3R9E A;  4H89 A;  4UEF A;  3RNZ A;  1I1D A;  3IWE A;  5J8F A;  3KL9 A;  4ONU A;  4X3R A;  3WAB A;  3RZA A;  2FIW A;  2P0W A;  4NGM A;  3FIX A;  4CGM A;  3HLP A;  2X7B A;  2PJ2 A;  1XOV A;  4PXB A;  1K4J A;  1S7K A;  2R8V A;  2YNE A;  4OID A;  5AG6 A;  3VAR A;  1YW4 A;  2QML A;  3NE8 A;  3W6X A;  1UFH A;  3UY5 A;  4CAE A;  4B14 A;  2ZEH A;  4HNY B;  2ZEE A;  5AG5 A;  5D29 A;  2B5G A;  3EXN A;  1JWQ A;  4PV6 A;  1CPX A;  4ZX8 A;  4PPZ A;  2BUE A;  4CYQ A;  2Z3M A;  3VH9 A;  2R7H A;  1XRY A;  5K8O A;  2OB0 A;  4M6I A;  5EBV A;  4R8F A;  5HMN A;  3FED A;  5ELY A;  1KUV A;  2FT0 A;  2O53 A;  1YME A;  3ISZ A;  3RO0 A;  1TKF A;  3CDX A;  1IY7 A;  2ARH A;  3FVL A;  3D66 A;  1NE9 A;  5H86 A;  3TTH A;  4JLY A;  1ON0 A;  5EC4 A;  5DS0 A;  3TOA A;  2AFO A;  4W9Y A;  3FEE A;  2EUI A;  4MHP A;  4AXV A;  2VEZ A;  4MFL A;  4MFP A;  1B6B A;  1Z4E A;  2PJ0 A;  1NSL A;  4CAW A;  5KTA A;  2OZG A;  4P4E A;  3VWD A;  4A30 A;  1ZLH A;  4KOR A;  3KHZ A;  2NYQ A;  1LAM A;  4OC5 A;  3IU1 A;  1SQH A;  3CXS A;  4KOV A;  3K2K A;  1JQG A;  4MCS A;  2GIV A;  2Q4Z A;  4BMH A;  1KUY A;  3LD2 A;  3KQZ A;  4OAE A;  5DWN A;  3QNV A;  2F8H A;  4CGO A;  4GS4 A;  3RAM A;  2HQY A;  3SXO A;  3V38 A;  4XNH C;  3F5B A;  1YGH A;  2FE7 A;  4II9 A;  3D8P A;  3S9M A;  3TCV A;  5K8N A;  4JWP A;  1LAP A;  2JEW A;  3IU2 A;  4CRZ B;  3PZJ A;  3TFY A;  3MRU A;  1ZO0 A;  2DPS A;  2AE6 A;  2WUU A;  5JQ4 A;  3NH5 A;  4KOX A;  1IIC A;  3SJF A;  2OZU A;  2VI7 A;  4OC1 A;  3PB6 X;  4OP4 A;  5HVG A;  2ZED A;  1PYT B;  1Z5R A;  4MCQ A;  3R9F A;  3D4U A;  1B87 A;  2P6E A;  1IOI A;  3KR4 A;  3R1K A;  1XFO A;  1BAV A;  1FNO A;  2PRB A;  2GFQ A;  1H8L A;  2DPT A;  3G8W A;  2IMO A;  4RN7 A;  3R95 A;  4CAF A;  2O4H A;  4MY0 A;  2PVW A;  1Q2C A;  2G3T A;  1Y9W A;  4L8A A;  4UWI A;  2B4D B;  4JZ0 A;  5D8N A;  5LRK A;  1S5K A;  2GRE A;  2XEF A;  2PC1 A;  2VZZ A;  3ISX A;  4NGN A;  4C68 A;  2BL1 A;  3MGD A;  3SI1 A;  2GLF A;  4E2A A;  3NE7 A;  1QMU A;  3GB0 A;  2PR1 A;  2PIZ A;  1XIX A;  5F47 A;  1Z8X A;  1ZG9 A;  1BOB A;  2FCK A;  4AVC A;  2PJA A;  4H6U A;  2EBJ A;  3BXM A;  3BI0 A;  1S3Z A;  3PP9 A;  4Q36 A;  4OAD A;  2VZY A;  3T9Y A;  2G9D A;  4KLW A;  4A39 A;  4EWT A;  7CPA A;  1CM0 A;  3PB8 X;  2JBJ A;  1CBX A;  2PJB A;  5JGF A;  2Z3P A;  5CBM A;  3PBE A;  4JYW A;  2ZW6 A;  2Z3K A;  3B2Y A;  1VGY A;  2Z10 A;  3D7D A;  4HNW B;  3LAC A;  2REE A;  1YR0 A;  3DGV A;  3IWG A;  4HNX B;  3LOD A;  2QYV A;  2WPX A;  2Z3O A;  2XEJ A;  2ZEO A;  1LAN A;  1BO4 A;  2AFW A;  3EFA A;  4U5Y A;  4KOS A;  2HV2 A;  3DR6 A;  4PXC A;  4R3L A;  2BCO A;  4XPL A;  2QEC A;  2PCU A;  4R7M A;  3WC5 A;  2ZEL A;  4BD9 A;  2CTC A;  4KLV A;  4KOU A;  2PJ3 A;  2F7V A;  1I21 A;  1TXR A;  3VWE A;  2P6G A;  3QB8 A;  4MRI A;  4C2Z A;  2JDD A;  5I4M A;  2HC9 A;  3FB3 A;  2Y0M A;  1YQE A;  1IGB A;  1F2P A;  1M44 A;  5F09 A;  1M4L A;  2B5G B;  1EE3 P;  1QSM A;  1Y9K A;  2POK A;  3JTK A;  3PRT A;  3QAH A;  4PK2 A;  4NGP A;  3IJ3 A;  1WWZ A;  3SJX A;  3D7G A;  4CYP A;  1NMT A;  4Q7A A;  4U9Z A;  4XPD B;  3EY5 A;  1LCP A;  4ZGY B;  1LFW A;  2V8H A;  4MHD A;  1ARL A;  3S6H A;  2OH1 A;  1PU9 A;  3N7Z A;  3PFE A;  5H84 A;  3S6G A;  2C6G A;  1MJ9 A;  4PK3 A;  5EMI A;  2DF5 A;  4ZBG A;  2C1C A;  2PJ4 A;  4K3N A;  2C27 A;  4NFR A;  1Y7E A;  2AFX A;  1I12 A;  1UWY A;  2REF A;  1Z8L A;  2AJ6 A;  2VL1 A;  4JJX A;  4QVT A;  3S9L A;  1R43 A;  2O28 A;  1IYL A;  1XEB A;  5LRJ A;  2I3C A;  4OC3 A;  4HKF A;  4M6H A;  3IFE A;  4RI1 A;  4ZY2 A;  1HDQ A;  4F8Z A;  4ZY1 A;  3KAS A;  1XE4 A;  2J9A A;  5LYI A;  4C2X A;  2YNC C;  2ZOF A;  4UF4 A;  1QQ9 A;  4NJR A;  3V8I A;  4UFW A;  3KR5 A;  3G3S A;  4F0Y A;  1Y0R A;  2DEA A;  4ORF A;  4ZYQ A;  3PB4 X;  4A94 A;  2CNS A;  1TIQ A;  4B5P A;  4CRY B;  3JVN A;  2PRQ A;  1S7L A;  4QC6 A;  1QSN A;  3B3C A;  2ZPA A;  1QSO A;  5A28 A;  4F6A A;  2ZW7 A;  4B11 A;  3CPA A;  4NF1 A;  5K8P A;  2B3U A;  1M4D A;  1AYE A;  1FT7 A;  4R76 A;  1YVK A;  3A9L A;  1ELL P;  1Q2Y A;  3GIU A;  3FH4 A;  1YX0 A;  3KI9 A;  3OWC A;  4OC2 A;  3WC6 A;  3RYO A;  5KTC A;  2AFZ A;  4ZI6 A;  4P4F A;  4MFZ A;  4A95 A;  5J1Q A;  2PJ1 A;  4GXH A;  1Q7L A;  1WK4 A;  4JXQ A;  3CZX A;  8CPA A;  4NSQ A;  2QIR A;  1P0H A;  1AUG A;  1QST A;  3PGP A;  3ZZI A;  2AFM A;  2Q4Y A;  3TT2 A;  1IB1 E;  4LQ6 A;  3TC8 A;  3D67 A;  4UCP A;  1CP7 A;  4CYN A;  2BO9 A;  3WR7 A;  3DR8 A;  3N5F A;  4L89 A;  4M6G A;  5LYD A;  3D3S A;  4NGS A;  1S7N A;  5C88 A;  2J8N A;  5G20 A;  1TKH A;  1Q2D A;  1CP6 A;  3PB9 X;  3EC4 A;  3KKW A;  4P4B A;  4I49 A;  5FVJ A;  5JH9 A;  2EO8 A;  3P2F A;  4B10 A;  3L2N A;  5GCN A;  3DLJ A;  2WPW A;  3LWU A;  4FD5 A;  4AG7 A;  3S6K A;  5G1Z A;  3GKR A;  2D4O A;  3E0K A;  4PSW A;  1IOF A;  4YFJ A;  5G21 A;  4FD7 A;  4DYO A;  4EME A;  1CX8 A;  1IYK A;  2PJ5 A;  3D7F A;  4X5K A;  4P44 A;  3IWW A;  1BPM A;  1YVO A;  3B8G A;  4AG9 A;  4DNC A;  1TF8 A;  5IB0 A;  4FBE A;  3W6S A;  4NGQ A;  5F48 A;  4XNH B;  4GM5 A;  2QVP A;  2PJ6 A;  2WYR A;  2D4P A;  1IID A;  4RS2 A;  4A2Z A;  5JPH A;  4Z65 A;  5CPA A;  4X8I A;  2H5M A;  2CF4 A;  1ARM A;  2Z0Z A;  2Q04 A;  4PXE A;  5AG7 A;  2Z3N A;  2IQ6 A;  4IF5 A;  2XEI A;  3EO4 A;  4NXY A;  3FRM A;  2HUZ A;  1OZP A;  1IU8 A;  3GLJ A;  4CGN A;  4KVM E;  1X12 A;  4QBJ A;  1VHS A;  2Q51 A;  2ZEP A;  4MXU A;  2ZEF A;  2ZEN A;  4OKO A;  4QB9 A;  4UWJ A;  4R87 A;  2ABZ A;  2GE3 A;  4MHN A;  1LRZ A;  2PJ9 A;  3TO9 A;  2BSW A;  2CNT A;  2FSR A;  2Z3L A;  3FBU A;  1HEE A;  3NH4 A;  4K30 A;  4RUH A;  1Y7R A;  1YSJ A;  2PQ8 A;  2OR4 A; 
#chains in the Genus database with same CATH homology
 4NEX A;  2B4D A;  4C2Y A;  1GHE A;  3TO6 A;  3W91 A;  2PSW A;  3BJ7 A;  2PR8 A;  4M85 A;  1V0C A;  4E0A A;  4KSF A;  3SHP A;  3K9U A;  3D2M A;  4AVB A;  3R96 A;  2Q7B A;  4UBR A;  2EVN A;  2B58 A;  3BLN A;  4B5O A;  1RO5 A;  5A27 A;  3GYA A;  2CNM A;  1QSR A;  4A32 A;  4CAV A;  3FNC A;  3C26 A;  5F46 A;  4Y49 B;  3BJ8 A;  4E8O A;  4CGL A;  3IGR A;  4MFQ A;  2Q4V A;  4JD6 A;  5HH1 A;  1MJA A;  2VXK A;  4UFX A;  1M4I A;  4MY3 A;  3TO7 A;  4MFJ A;  5F49 A;  4XPK A;  3I9S A;  4R3K A;  1PUA A;  1MK4 A;  4KUA A;  2K5T A;  5G22 A;  4YGO A;  1Z4R A;  2GAN A;  4M3S A;  3F0A A;  4R57 A;  4R9M A;  2ATR A;  4B13 A;  5AG4 A;  4MBU A;  2RC4 A;  4CGP A;  4JXR A;  4H6Z A;  2B4B A;  4F0X A;  1R57 A;  2NMT A;  4CYO A;  4A33 A;  3FYN A;  4PSX A;  4Q38 A;  4KVO E;  2VQY A;  2WSA A;  4U9Y A;  1J4J A;  2P6F A;  2JLM A;  4KOW A;  1KZF A;  4FD6 A;  2R98 A;  2YND A;  2OU2 A;  2FXF A;  1U6M A;  5J8C A;  4KZT A;  4MFK A;  2B3V A;  3D2P A;  5I0C A;  2FL4 A;  4KUB A;  5C82 A;  4KOY A;  4AVA A;  2G0B A;  4UFV A;  1M4G A;  5BWA B;  2CY2 A;  2OZH A;  2ZW4 A;  3GY9 A;  1CJW A;  2YNC A;  3I3G A;  4OLL A;  2DXQ A;  3TE4 A;  4A31 A;  2R1I A;  2YGW A;  1N71 A;  4KOT A;  2J8M A;  1S7F A;  3H4Q A;  4LUA A;  2IL4 A;  2A4N A;  1KUX A;  4UCM A;  5KTD A;  4IUS A;  4MI4 A;  2KCW A;  3T90 A;  4C7H A;  4UCN A;  2JEV A;  3TOB A;  4FD4 A;  3P2H A;  4NCZ A;  2ZXV A;  5IX3 A;  4MJ8 A;  4YRH A;  3R9G A;  1YLE A;  1FY7 A;  5DWM A;  2G3A A;  2I00 A;  3SXN A;  3S6F A;  1M1D A;  1S60 A;  2I79 A;  2ZW5 A;  2Q44 A;  4BBH A;  3F8K A;  1YK3 A;  3FXT A;  4XPD C;  2BEI A;  2PDO A;  2J8R A;  3DSB A;  1YRE A;  4LX9 A;  2Q0Y A;  1P4N A;  5IV0 A;  3CXQ A;  4J3G A;  1Z9U A;  2F5I A;  2Z11 A;  4Y49 C;  3CXP A;  3ZJ0 A;  4C7I A;  4QUS A;  4EVY A;  4B12 A;  1L0C A;  4CAX A;  3JUW A;  1MJB A;  1XMT A;  2FIA A;  5CNP A;  3DNS A;  5ISV A;  4KS9 A;  3H5Z A;  1RXT A;  1XF8 A;  4B5P B;  3DDD A;  4KVX A;  5E96 A;  5AGE A;  2CXA A;  4CS0 B;  4KSA A;  2JDC A;  2VBQ A;  4AB7 A;  4UA3 A;  1VKC A;  2FS5 A;  3R9E A;  4H89 A;  1I1D A;  3IWE A;  5J8F A;  4ONU A;  2FIW A;  2P0W A;  3FIX A;  4CGM A;  2X7B A;  1K4J A;  1S7K A;  2R8V A;  2YNE A;  5AG6 A;  2QML A;  3W6X A;  1UFH A;  3UY5 A;  4CAE A;  4B14 A;  4HNY B;  5AG5 A;  2B5G A;  3EXN A;  4PV6 A;  4CYQ A;  2BUE A;  2Z3M A;  2R7H A;  2OB0 A;  5EBV A;  5HMN A;  1KUV A;  2FT0 A;  5H86 A;  2ARH A;  3TTH A;  1NE9 A;  4JLY A;  1ON0 A;  5EC4 A;  3TOA A;  2EUI A;  2VEZ A;  4MFL A;  4MFP A;  1B6B A;  1Z4E A;  1NSL A;  4CAW A;  5KTA A;  2OZG A;  3VWD A;  4A30 A;  4KOR A;  3IU1 A;  1SQH A;  3CXS A;  4KOV A;  2GIV A;  4BMH A;  1KUY A;  3LD2 A;  4OAE A;  5DWN A;  4CGO A;  4GS4 A;  2HQY A;  3SXO A;  4XNH C;  3F5B A;  1YGH A;  2FE7 A;  4II9 A;  3D8P A;  3TCV A;  4JWP A;  3IU2 A;  4CRZ B;  3PZJ A;  3TFY A;  1ZO0 A;  2DPS A;  2AE6 A;  2WUU A;  5JQ4 A;  4KOX A;  1IIC A;  2OZU A;  2VI7 A;  3R9F A;  1B87 A;  2P6E A;  3R1K A;  2PRB A;  3G8W A;  2DPT A;  3R95 A;  4CAF A;  4MY0 A;  1Q2C A;  2G3T A;  1Y9W A;  4L8A A;  4UWI A;  2B4D B;  1S5K A;  4C68 A;  2PC1 A;  2VZZ A;  2BL1 A;  3MGD A;  4E2A A;  3NE7 A;  5F47 A;  2PR1 A;  1XIX A;  1BOB A;  2FCK A;  4AVC A;  4H6U A;  3PP9 A;  1S3Z A;  4Q36 A;  4OAD A;  2VZY A;  3T9Y A;  4KLW A;  1CM0 A;  2Z3P A;  2ZW6 A;  2Z3K A;  2Z10 A;  4HNW B;  2REE A;  1YR0 A;  3IWG A;  4HNX B;  3LOD A;  2WPX A;  2Z3O A;  1BO4 A;  3EFA A;  4U5Y A;  4KOS A;  2HV2 A;  3DR6 A;  4R3L A;  4XPL A;  2QEC A;  4KLV A;  4KOU A;  1I21 A;  3VWE A;  2P6G A;  3QB8 A;  4C2Z A;  2JDD A;  3FB3 A;  2Y0M A;  1M44 A;  2B5G B;  3JTK A;  3QAH A;  1QSM A;  1Y9K A;  4PK2 A;  1WWZ A;  4CYP A;  1NMT A;  4ZGY B;  4U9Z A;  4XPD B;  3EY5 A;  4MHD A;  3S6H A;  2OH1 A;  1PU9 A;  3N7Z A;  5H84 A;  3S6G A;  1MJ9 A;  4PK3 A;  4ZBG A;  2C27 A;  1I12 A;  2REF A;  4QVT A;  2AJ6 A;  4JJX A;  2O28 A;  1IYL A;  1XEB A;  4RI1 A;  4HKF A;  1XE4 A;  4C2X A;  2YNC C;  3V8I A;  4UFW A;  4F0Y A;  3G3S A;  4ORF A;  2CNS A;  1TIQ A;  4B5P A;  4CRY B;  3JVN A;  4QC6 A;  1S7L A;  1QSN A;  2ZPA A;  1QSO A;  5A28 A;  4F6A A;  2ZW7 A;  4B11 A;  4NF1 A;  2B3U A;  1M4D A;  1YVK A;  3A9L A;  1Q2Y A;  1YX0 A;  3OWC A;  3RYO A;  5KTC A;  4MFZ A;  4A95 A;  4JXQ A;  1WK4 A;  4NSQ A;  2QIR A;  1P0H A;  3PGP A;  1QST A;  3ZZI A;  2Q4Y A;  3TT2 A;  1IB1 E;  4CYN A;  4UCP A;  3WR7 A;  3DR8 A;  4L89 A;  3D3S A;  1S7N A;  5C88 A;  2J8N A;  5G20 A;  1Q2D A;  3EC4 A;  3KKW A;  4I49 A;  5FVJ A;  3P2F A;  4B10 A;  5GCN A;  4FD5 A;  2WPW A;  4AG7 A;  3S6K A;  5G1Z A;  3GKR A;  2D4O A;  3E0K A;  4PSW A;  4YFJ A;  5G21 A;  4FD7 A;  1IYK A;  4X5K A;  1YVO A;  3B8G A;  4AG9 A;  4DNC A;  5IB0 A;  3W6S A;  5F48 A;  4XNH B;  2D4P A;  1IID A;  4RS2 A;  4A2Z A;  5JPH A;  2H5M A;  2Z0Z A;  2Q04 A;  5AG7 A;  2Z3N A;  4IF5 A;  3EO4 A;  4NXY A;  3FRM A;  2HUZ A;  1OZP A;  4CGN A;  4KVM E;  4QBJ A;  1VHS A;  4QB9 A;  4UWJ A;  4R87 A;  2GE3 A;  1LRZ A;  3TO9 A;  2BSW A;  2CNT A;  2FSR A;  2Z3L A;  3FBU A;  4K30 A;  1Y7R A;  2PQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...