4UFWA

Plasmodium vivax n-myristoyltransferase in complex with a pyridyl inhibitor (compound 22)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
385
structure length
385
Chain Sequence
b'MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of Pyridyl-Based Inhibitors of Plasmodium Falciparum N-Myristoyltransferase
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 118
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ufwA00
2YNCC 4A33A 4C7IA 2YNDA 4UCNA 4CYOA 3H5ZA 4A31A 4UFWA 4UCPA 4B11A 4UFVA 4A95A 4UFXA 4B12A 2WUUA 4CGMA 5AG5A 5A28A 4CYQA 4CGNA 4A2ZA 3IU1A 4CYNA 4C2YA 3IWEA 5AG4A 4CAFA 4C2XA 3JTKA 4UCMA 4C68A 4B14A 4B10A 5G20A 5AG6A 2YNCA 4C7HA 4CGOA 4CYPA 4BBHA 5AGEA 5A27A 5AG7A 5G1ZA 4B13A 4A32A 2WSAA 4C2ZA 4CAEA 5G22A 4CGPA 4CGLA 4A30A 3IU2A 5G21A 2YNEA
chains in the Genus database with same CATH superfamily
5J8CA 3D2MA 2YNDA 5LYDA 3H5ZA 4IHMA 3D7DA 1JQGA 1Z5RA 2GREA 2WZNA 4JLYA 2AFUA 2HUZA 4M85A 3T9YA 3FX6A 2PE3A 1PYTB 2CNTA 4KUBA 1YREA 1XEBA 4WWVA 1OBRA 2ZOFA 4LQGA 3R95A 2IMOA 4MFJA 2Z3OA 4BINA 2P0WA 4A38A 4M3SA 1TXRA 4UF4A 3VATA 1U6MA 1IGBA 1BOBA 5LYFA 3TX8A 5AGEA 1QSMA 5CPAA 3KZWA 5C82A 5K8NA 3SXOA 4K30A 5I4MA 2PSWA 1ZLIA 4P45A 2PJ9A 3EC4A 4R87A 5HMNA 2HQYA 4W9YA 2PJ3A 1S7FA 1QQ9A 1XRYA 4FAIA 1TKJA 2AFXA 1H8LA 1OZPA 4E2AA 2FVGA 5CBMA 5K8MA 2ZW7A 3A9LA 2YGWA 3PFOA 1LAMA 2POKA 3VWDA 5GCNA 5HVHA 2Q44A 4MY3A 4YU9A 4F6AA 2ZOGA 2CY2A 2P6GA 2VI7A 4CGNA 1YW6A 4UWIA 5BWAB 2D4OA 5K8PA 3VARA 4BMHA 4B5PA 4F9VA 3TCVA 3IJ3A 2PRQA 3B2YA 3FB3A 4MI4A 1KUVA 1CPXA 2ZEDA 1HDQA 2ZENA 3D66A 4A32A 4FD6A 4PSWA 3SI1A 3K9TA 2BL1A 5G21A 3S9MA 1MK4A 3WABA 2JLMA 4JJXA 1ELLP 1M4GA 3GLJA 4UFVA 4X3RA 5KTDA 1BPMA 1KUYA 2Z3NA 4ZGYB 3KI9A 3S9LA 3WC7A 4EMEA 2HB6A 4E0AA 1VHEA 2FSRA 4MRIA 4I49A 1S7KA 1A2ZA 2V77A 4O23A 3KHXA 3R9GA 3CXSA 5HXDA 1MJBA 3D8PA 2CTBA 2GANA 4OAEA 2JEWA 2D4PA 4MJ8A 1ZG9A 4U5YA 4AG7A 1Z4EA 3LODA 4OADA 5ISVA 2WSAA 2WPXA 3B3SA 5H84A 4CAEA 1LOKA 3SJFA 2QECA 4CGPA 3F5BA 3H8FA 2GIVA 5IX3A 1M4IA 2C27A 4F0XA 5I0CA 3TT2A 1IOIA 3NH5A 3I3GA 4JXQA 3B7IA 1Y9KA 3KASA 3TO9A 4B11A 2VBQA 3S9NA 2OZUA 4UEEA 2G0BA 4KVME 4UFXA 1YX0A 1LANA 1X12A 2PJ2A 4FD5A 2I79A 3K9UA 5A28A 4CYQA 4PSXA 2FXFA 2EK8A 4KOVA 1PCAA 3HLPA 3EY5A 2B5GB 4UA3A 3TC8A 4AVAA 4B14A 4A39A 2ZEFA 4PV6A 4PXBA 4UWJA 3D7GA 5AG7A 4OLLA 4P10A 4OC5A 3SXNA 2WYRA 1TF9A 4B5OA 2PIZA 4OKOA 4ZY0A 5KTAA 5EBVA 2Q7BA 3SI2A 5HVGA 2ZEOA 4NFRA 4C7IA 4X2TA 1UWYA 2KCWA 1NSLA 3GIUA 5IV0A 4H6UA 2F5IA 3B3TA 2P6EA 1I21A 4KOTA 1LAPA 2VL1A 3F0AA 1IIDA 2Z11A 3BLNA 1Q2YA 3HUVA 3GYAA 3TOAA 2O4HA 5J8FA 1VIXA 3GKRA 1IU8A 4KSAA 2Q7SA 4A2ZA 3KKWA 2PR1A 1TF8A 2DF5A 4XNHB 4C68A 3FMCA 1CBXA 1ARMA 2AFSA 2PVVA 2ZEEA 4P4DA 2PVWA 4NGNA 2C6PA 3V7ZA 5G1ZA 2Q51A 5LRKA 4CGLA 2O53A 2BUEA 4YWYA 5F46A 2R8VA 4HKFA 1YW4A 2C6GA 3D67A 4L8AA 4PK2A 2R1IA 2EUIA 3TFYA 1XBUA 2ZEGA 1DE4C 3IWGA 4X5KA 3JVNA 1S7NA 4ZYQA 4OIWA 2ZEPA 2Q43A 4R3LA 3T90A 3I9SA 2V8DA 2PJAA 2PJ8A 2EO8A 3FVLA 4KOYA 1Q2DA 3IGRA 1X10A 4ONWA 4PXEA 3WC5A 4MFZA 3T8WA 4E8OA 1HEEA 3JTKA 4YGOA 2J8MA 1IYKA 1TKHA 4UCMA 4NF1A 2F7VA 3FEDA 1Z8WA 4MHYA 4R7MA 4TNUA 2ATRA 4IUSA 4B13A 3GB0A 3RYOA 4U9YA 3DLJA 5HVFA 2PJ0A 3EFAA 3KGQA 4KVXA 4M6HA 3PEIA 2J8NA 3CXPA 3IFEA 1Z8LA 4R8FA 4RN7A 4PK3A 1KUXA 5DWMA 2REFA 3NH4A 3B8GA 2FIWA 4AXVA 3ISZA 4Q7AA 4R3KA 3QB8A 2DPTA 3PZJA 4B6ZA 2JBJA 3IU2A 2WUUA 1BAVA 4QUSA 4NGTA 3JUWA 4Y49B 1M4LA 6CPAA 4XPLA 4OMEA 1CX8A 3WR7A 4Q36A 2OU2A 4GM5A 3SJEA 1AUGA 4B10A 1R57A 4RS2A 1IYLA 1I12A 3B3VA 3VWEA 3CPAA 2G3AA 2GLJA 1NE9A 4HNYB 5JGFA 2QMLA 3FNCA 3MN8A 2GLFA 4RUHA 3NH8A 4OIDA 1XFOA 2PJ1A 1KWMA 2PRBA 2JBKA 3DGVA 1QSOA 1MJAA 3QNVA 4MHPA 3WT4A 4A33A 4A37A 4AVBA 4UCNA 4F9UA 1N71A 2XEIA 4OC1A 4DJLA 2XEFA 2PR8A 2X7BA 3MRUA 4XNHC 2PDOA 3DSBA 3R1KA 5HH1A 1NMTA 2ZEHA 1IOFA 4FD4A 2QYVA 4K3NA 2H5MA 4P4JA 3PGPA 3FRMA 1ON0A 3LACA 4MY0A 4P44A 4R6TA 1J4JA 2CF4A 4JZ0A 5THWA 4OP4A 1RO5A 1Z8XA 1Y7RA 2C1CA 4MCRA 4CYNA 5F09A 5ELYA 4AVCA 3E0KA 3FH4A 1LCPA 3RO0A 4NXYA 4NCZA 4NGRA 4CGOA 2V8HA 3KQXA 2CTCA 2I00A 5DWNA 2AFWA 2PJ4A 1QSNA 3D68A 1UFHA 2OH1A 1ELMP 3LMSA 4A30A 4CS0B 4GXHA 5DS0A 2VXKA 4NGQA 1FT7A 2P6FA 5IB9A 3TO7A 3ZJ0A 1XMBA 1RXTA 4CYOA 3PBEA 1XF8A 1QMUA 3D3SA 2Q04A 2ZW6A 3H4QA 4ONUA 4YRHA 2B3UA 3PB4X 1WWZA 4B5PB 4UBRA 2ZEMA 5JQ4A 1V0CA 4LQ6A 2R7HA 2NSMA 4NGSA 3SJGA 1XE4A 1IICA 3IWEA 1BO4A 3FXTA 1B87A 3W6XA 2VZZA 1GYTA 1YLEA 1F2OA 3PB8X 4IK2A 3V8IA 2G3TA 4MCPA 4OC3A 4ZY2A 4CPAA 5E96A 2JDDA 4M6IA 1AYEA 5JH9A 3L2NA 3F8KA 2WPWA 4A94A 1S3ZA 1Z8TA 4DYOA 2BCOA 4Y49C 2B4DA 4GS4A 2AFOA 3OWCA 5H86A 4UCPA 4HNXB 3FYNA 5J1QA 3QAYA 3TE4A 4IAVA 4X8IA 3S6KA 3VH9A 1QSTA 4MCQA 5AG5A 2VQYA 2XEGA 3CXQA 1HDUA 2IJZA 1Y7EA 2J9AA 3B3CA 1S60A 3PB7X 3PBBA 3RBUA 2Q4VA 4RI1A 1YR0A 4FWUA 1YGHA 1Z2LA 3PB6X 8CPAA 3BI1A 2FE7A 4PQAA 2O28A 4JWPA 4NJQA 4DUKA 1M44A 1MJ9A 4QC6A 2GFQA 2FL4A 3QAHA 5LRGA 1TKFA 3DNSA 1ZG7A 2ZW5A 2YNEA 2PC1A 4H6ZA 4UIBA 5C88A 4ZBGA 3BHXA 4KSIA 1CP7A 1XIXA 3K2KA 4MFQA 4G1PA 1XMTA 4R57A 1ZLHA 2ANPA 4PPZA 4JD6A 5D8NA 4OC0A 5EC4A 2A4NA 1IB1E 2IQ6A 1B6BA 1Y0YA 1YVOA 3NFZA 4ZY1A 3PB9X 3IO1A 5K8OA 5LYLA 1XOVA 2HC9A 4BD9A 1KZFA 2AFMA 3DR6A 4MHDA 3D7FA 4C7HA 2ABZA 4FD7A 3KR4A 2J8RA 4QVTA 4XPDB 4MFLA 4C2ZA 1LFWA 4P4EA 4NEXA 4JXRA 3KHZA 2I3CA 4KOSA 2G9DA 3P2FA 3FIXA 4KLVA 3S6HA 2VEZA 2BEIA 3DR8A 1CM0A 3PFEA 4L89A 1BPNA 3ZZIA 1K4JA 2Y0MA 3D4UA 3KL9A 4ZX9A 4HNWB 2JEVA 4B12A 5KTCA 4CAVA 2ODFA 4MHNA 4H2KA 1SQHA 5JPHA 3PP9A 1F2PA 2AE6A 2Z0ZA 4MCSA 4KOXA 4P4IA 3G3SA 4MFPA 5AG4A 4CAFA 3MGDA 4Z65A 3NA6A 2B4BA 4NSQA 2BOAA 4H89A 2PIYA 2OR4A 1Q7LA 1RTQA 4ORFA 2ZELA 3C26A 4XPKA 2Z3KA 3UY5A 4DNCA 1FNOA 4KS9A 2QIRA 4R9MA 5D29A 5CNPA 3W6SA 3H8EA 4M6GA 4MBUA 1FY7A 2FS5A 2CIJA 2V8VA 3KQZA 1BLLE 2EK9A 1M1DA 1VKCA 2ZXVA 3NE8A 4Q38A 4UIAA 1F57A 4EWTA 4ZI6A 2CXAA 4P6YA 4II9A 3TTHA 1IY7A 3EO4A 2F8HA 4U9ZA 1LRZA 3TO6A 2GE3A 1Z9UA 3S6FA 4KVOE 5LYIA 4CAWA 4CAXA 2EBJA 5EMIA 1EE3P 1S7LA 5AG6A 4MMOA 4NGPA 2OZGA 2Q4ZA 3D2PA 2NMTA 4PXDA 1VHSA 3RNZA 2PJ5A 4NJRA 2B5GA 3H8GA 2OZHA 3G8WA 3B3WA 2HV2A 4QB9A 4F8ZA 1PU9A 3LWUA 4KSFA 4MFKA 5F49A 2VZYA 3BXMA 4KLWA 4P4BA 4UFWA 1ZO0A 2C6CA 2NYQA 1YVKA 3IC1A 3V38A 2IL4A 3FECA 1XJOA 3DDDA 1JWQA 4AB7A 1GHEA 1YK3A 5F48A 4XPDC 5FVJA 4FBEA 2Z3MA 3FF3A 4WJBA 3FBUA 3I1UA 1YLOA 3CZXA 3GY9A 3IU1A 3NE7A 2Z10A 3GUXA 4PXCA 4NGMA 3RZAA 2GU2A 2K5TA 4IF5A 1QSRA 1R3NA 4BBHA 2Z3LA 1S5KA 2DXQA 1CPSA 4OC4A 2DPSA 4LX9A 1NSAA 3N7ZA 3WC6A 3W91A 4YFJA 5IB0A 2OB0A 3PRTA 2EWBA 2PJ7A 1AMPA 2FT0A 2YNCC 1Z4RA 2ARHA 3JRUA 1I1DA 2Q4YA 4LUAA 2XEJA 5F47A 4A31A 4TWEA 2RC4A 1Y9WA 4JYWA 4CRZB 1CJWA 2CNMA 2FCKA 2PJ6A 3IWWA 4AG9A 4R76A 3P2HA 4CGMA 3BJ8A 4CRYB 2PJCA 1VGYA 1ZG8A 1TIQA 3BJ7A 1YQEA 3CPXA 4FUUA 2R98A 2PCUA 1L0CA 2CNSA 2JDCA 3LD2A 4P4FA 2FIAA 2PQ8A 3BI0A 3N5FA 3RAMA 4UEZA 4MXUA 4F0YA 5A27A 1P0HA 2BO9A 1CG2A 3SJXA 4J3GA 3EXNA 4EFDA 4MHZA 4ZX8A 2BSWA 2PJBA 3R96A 1YSJA 2EVNA 2ZPAA 1Y0RA 1R43A 1M4DA 3TOBA 1CP6A 4KOUA 3IIBA 1DTDA 2REEA 1WK4A 4EVYA 5JM6A 7CPAA 2ZW4A 2OOTA 1PUAA 2B3VA 2QJ8A 1Q2CA 2V8GA 2RB7A 3SI0A 3SHPA 4A95A 4HPSA 2AFZA 3S6GA 3FJUA 4KORA 2AJ6A 4OC2A 1YMEA 3ISXA 5LRJA 3FEEA 3R9FA 4C2YA 2B58A 3CDXA 4KZTA 2RFHA 4KOWA 4KUAA 1ARLA 4UEFA 4C2XA 2DEAA 3CT9A 5G20A 2YNCA 4CYPA 1P4NA 2B4DB 4QBJA 3D7HA 1VHOA 3IEHA 2QVPA 3B35A 2Q0YA 5G22A 3R9EA 3KR5A 2Z3PA
chains in the Genus database with same CATH topology
5J8CA 3D2MA 2YNDA 3H5ZA 4JLYA 4M85A 3T9YA 2HUZA 2CNTA 4KUBA 1YREA 1XEBA 3R95A 4MFJA 2Z3OA 2P0WA 4M3SA 1U6MA 1BOBA 5AGEA 1QSMA 5C82A 3SXOA 4K30A 2PSWA 3EC4A 4R87A 5HMNA 2HQYA 1S7FA 4E2AA 1OZPA 2ZW7A 3A9LA 2YGWA 3VWDA 5GCNA 2Q44A 4MY3A 4F6AA 2CY2A 2P6GA 2VI7A 4CGNA 4UWIA 5BWAB 2D4OA 4BMHA 4B5PA 3TCVA 3FB3A 4MI4A 1KUVA 4A32A 4FD6A 4PSWA 2BL1A 5G21A 1MK4A 2JLMA 4JJXA 1M4GA 4UFVA 5KTDA 1KUYA 2Z3NA 4ZGYB 4E0AA 2FSRA 4I49A 1S7KA 3R9GA 3CXSA 1MJBA 3D8PA 2GANA 4OAEA 2D4PA 4MJ8A 4U5YA 4AG7A 1Z4EA 3LODA 4OADA 2WSAA 2WPXA 5H84A 4CAEA 2QECA 4CGPA 3F5BA 5IX3A 2GIVA 1M4IA 2C27A 4F0XA 5I0CA 3TT2A 3I3GA 4JXQA 1Y9KA 4B11A 3TO9A 2VBQA 2OZUA 2G0BA 4KVME 4UFXA 1YX0A 4FD5A 2I79A 3K9UA 5A28A 4CYQA 4PSXA 2FXFA 4KOVA 3EY5A 2B5GB 4UA3A 4AVAA 4B14A 4PV6A 4UWJA 5AG7A 4OLLA 3SXNA 4B5OA 5KTAA 5EBVA 2Q7BA 4C7IA 2KCWA 1NSLA 5IV0A 4H6UA 2F5IA 2P6EA 1I21A 4KOTA 3F0AA 1IIDA 2Z11A 3BLNA 1Q2YA 3GYAA 3TOAA 5J8FA 3GKRA 4KSAA 4A2ZA 3KKWA 2PR1A 4XNHB 4C68A 5G1ZA 4CGLA 2BUEA 5F46A 2R8VA 4HKFA 4L8AA 4PK2A 2R1IA 2EUIA 3TFYA 4X5KA 3IWGA 3JVNA 1S7NA 4R3LA 3T90A 3I9SA 4KOYA 1Q2DA 3IGRA 4MFZA 4E8OA 3JTKA 4YGOA 2J8MA 1IYKA 4UCMA 4NF1A 2ATRA 4IUSA 4B13A 3RYOA 4U9YA 3EFAA 4KVXA 2J8NA 3CXPA 4PK3A 1KUXA 5DWMA 2REFA 3B8GA 2FIWA 4R3KA 3QB8A 2DPTA 3PZJA 3IU2A 2WUUA 4QUSA 3JUWA 4Y49B 4XPLA 3WR7A 4Q36A 2OU2A 4B10A 1R57A 4RS2A 1I12A 1IYLA 3VWEA 2G3AA 1NE9A 4HNYB 2QMLA 3FNCA 2PRBA 1QSOA 1MJAA 4AVBA 4A33A 4UCNA 1N71A 2PR8A 2X7BA 4XNHC 3DSBA 3R1KA 2PDOA 5HH1A 1NMTA 4FD4A 2H5MA 5ISVA 3PGPA 3FRMA 1ON0A 4MY0A 1J4JA 1RO5A 1Y7RA 4CYNA 4AVCA 3E0KA 4NXYA 4NCZA 4CGOA 2I00A 1QSNA 1UFHA 2OH1A 4A30A 4CS0B 2VXKA 2P6FA 3TO7A 3ZJ0A 1RXTA 4CYOA 1XF8A 3D3SA 2Q04A 2ZW6A 3H4QA 4ONUA 4YRHA 2B3UA 4B5PB 1WWZA 4UBRA 5JQ4A 1V0CA 2R7HA 1XE4A 1IICA 3IWEA 1BO4A 3FXTA 1B87A 3W6XA 2VZZA 1YLEA 3V8IA 2G3TA 5E96A 2JDDA 3F8KA 2WPWA 1S3ZA 4Y49C 2B4DA 4GS4A 3OWCA 5H86A 4UCPA 4HNXB 3FYNA 3TE4A 3S6KA 1QSTA 5AG5A 2VQYA 3CXQA 1S60A 2Q4VA 4RI1A 1YR0A 1YGHA 2FE7A 2O28A 1M44A 1MJ9A 4QC6A 3QAHA 2FL4A 3DNSA 2ZW5A 2YNEA 2PC1A 4H6ZA 5C88A 4ZBGA 1XIXA 4MFQA 1XMTA 4R57A 4JD6A 5EC4A 2A4NA 1IB1E 1B6BA 1YVOA 1KZFA 3DR6A 4MHDA 4C7HA 4FD7A 4QVTA 2J8RA 4XPDB 4MFLA 4C2ZA 4NEXA 4JXRA 4KOSA 3P2FA 3FIXA 4KLVA 3S6HA 2VEZA 2BEIA 3DR8A 1CM0A 4L89A 3ZZIA 1K4JA 2Y0MA 4HNWB 2JEVA 4B12A 5KTCA 4CAVA 1SQHA 5JPHA 3PP9A 2AE6A 2Z0ZA 4KOXA 3G3SA 4MFPA 5AG4A 4CAFA 3MGDA 2B4BA 4NSQA 4H89A 4ORFA 5DWNA 4DNCA 4XPKA 3C26A 2Z3KA 3UY5A 4KS9A 2QIRA 4R9MA 5CNPA 3W6SA 4MBUA 1FY7A 2FS5A 2ZXVA 1M1DA 1VKCA 4Q38A 2CXAA 4II9A 3TTHA 3EO4A 4U9ZA 1LRZA 3TO6A 2GE3A 1Z9UA 3S6FA 4KVOE 4CAWA 4CAXA 1S7LA 5AG6A 2OZGA 3D2PA 2NMTA 1VHSA 2B5GA 2OZHA 3G8WA 2HV2A 4QB9A 1PU9A 4KSFA 4MFKA 5F49A 2VZYA 4KLWA 4UFWA 1ZO0A 1YVKA 2IL4A 3DDDA 4AB7A 1GHEA 1YK3A 5F48A 4XPDC 5FVJA 2Z3MA 3FBUA 3IU1A 3GY9A 3NE7A 2Z10A 2K5TA 4IF5A 1QSRA 4BBHA 2Z3LA 1S5KA 2DXQA 2DPSA 4LX9A 3N7ZA 3W91A 4YFJA 5IB0A 2OB0A 2FT0A 2YNCC 1Z4RA 2ARHA 1I1DA 2Q4YA 4LUAA 5F47A 4A31A 2RC4A 1Y9WA 4CRZB 1CJWA 2CNMA 2FCKA 2Z3PA 4AG9A 3P2HA 4CGMA 3BJ8A 4CRYB 1TIQA 3BJ7A 2R98A 1L0CA 2CNSA 2JDCA 3LD2A 2FIAA 2PQ8A 5A27A 4F0YA 1P0HA 4J3GA 3EXNA 2BSWA 3R96A 2EVNA 2ZPAA 1M4DA 3TOBA 4KOUA 2REEA 1WK4A 4EVYA 2ZW4A 1PUAA 2B3VA 4A95A 1Q2CA 3SHPA 3S6GA 4KORA 2AJ6A 3R9FA 4C2YA 2B58A 4C2XA 4KZTA 4KOWA 4KUAA 5G20A 2YNCA 4CYPA 1P4NA 2B4DB 4QBJA 2Q0YA 5G22A 3R9EA 4JWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNC C;  4A33 A;  4C7I A;  2YND A;  4UCN A;  4CYO A;  3H5Z A;  4A31 A;  4UFW A;  4UCP A;  4B11 A;  4UFV A;  4A95 A;  4UFX A;  4B12 A;  2WUU A;  4CGM A;  5AG5 A;  5A28 A;  4CYQ A;  4CGN A;  4A2Z A;  3IU1 A;  4CYN A;  4C2Y A;  3IWE A;  5AG4 A;  4CAF A;  4C2X A;  3JTK A;  4UCM A;  4C68 A;  4B14 A;  4B10 A;  5G20 A;  5AG6 A;  2YNC A;  4C7H A;  4CGO A;  4CYP A;  4BBH A;  5AGE A;  5A27 A;  5AG7 A;  5G1Z A;  4B13 A;  4A32 A;  2WSA A;  4C2Z A;  4CAE A;  5G22 A;  4CGP A;  4CGL A;  4A30 A;  3IU2 A;  5G21 A;  2YNE A; 
#chains in the Genus database with same CATH topology
 5J8C A;  3D2M A;  2YND A;  5LYD A;  3H5Z A;  4IHM A;  3D7D A;  1JQG A;  1Z5R A;  2GRE A;  2WZN A;  4JLY A;  2AFU A;  2HUZ A;  4M85 A;  3T9Y A;  3FX6 A;  2PE3 A;  1PYT B;  2CNT A;  4KUB A;  1YRE A;  1XEB A;  4WWV A;  1OBR A;  2ZOF A;  4LQG A;  3R95 A;  2IMO A;  4MFJ A;  2Z3O A;  4BIN A;  2P0W A;  4A38 A;  4M3S A;  1TXR A;  4UF4 A;  3VAT A;  1U6M A;  1IGB A;  1BOB A;  5LYF A;  3TX8 A;  5AGE A;  1QSM A;  5CPA A;  3KZW A;  5C82 A;  5K8N A;  3SXO A;  4K30 A;  5I4M A;  2PSW A;  1ZLI A;  4P45 A;  2PJ9 A;  3EC4 A;  4R87 A;  5HMN A;  2HQY A;  4W9Y A;  2PJ3 A;  1S7F A;  1QQ9 A;  1XRY A;  4FAI A;  1TKJ A;  2AFX A;  1H8L A;  1OZP A;  4E2A A;  2FVG A;  5CBM A;  5K8M A;  2ZW7 A;  3A9L A;  2YGW A;  3PFO A;  1LAM A;  2POK A;  3VWD A;  5GCN A;  5HVH A;  2Q44 A;  4MY3 A;  4YU9 A;  4F6A A;  2ZOG A;  2CY2 A;  2P6G A;  2VI7 A;  4CGN A;  1YW6 A;  4UWI A;  5BWA B;  2D4O A;  5K8P A;  3VAR A;  4BMH A;  4B5P A;  4F9V A;  3TCV A;  3IJ3 A;  2PRQ A;  3B2Y A;  3FB3 A;  4MI4 A;  1KUV A;  1CPX A;  2ZED A;  1HDQ A;  2ZEN A;  3D66 A;  4A32 A;  4FD6 A;  4PSW A;  3SI1 A;  3K9T A;  2BL1 A;  5G21 A;  3S9M A;  1MK4 A;  3WAB A;  2JLM A;  4JJX A;  1ELL P;  1M4G A;  3GLJ A;  4UFV A;  4X3R A;  5KTD A;  1BPM A;  1KUY A;  2Z3N A;  4ZGY B;  3KI9 A;  3S9L A;  3WC7 A;  4EME A;  2HB6 A;  4E0A A;  1VHE A;  2FSR A;  4MRI A;  4I49 A;  1S7K A;  1A2Z A;  2V77 A;  4O23 A;  3KHX A;  3R9G A;  3CXS A;  5HXD A;  1MJB A;  3D8P A;  2CTB A;  2GAN A;  4OAE A;  2JEW A;  2D4P A;  4MJ8 A;  1ZG9 A;  4U5Y A;  4AG7 A;  1Z4E A;  3LOD A;  4OAD A;  5ISV A;  2WSA A;  2WPX A;  3B3S A;  5H84 A;  4CAE A;  1LOK A;  3SJF A;  2QEC A;  4CGP A;  3F5B A;  3H8F A;  2GIV A;  5IX3 A;  1M4I A;  2C27 A;  4F0X A;  5I0C A;  3TT2 A;  1IOI A;  3NH5 A;  3I3G A;  4JXQ A;  3B7I A;  1Y9K A;  3KAS A;  3TO9 A;  4B11 A;  2VBQ A;  3S9N A;  2OZU A;  4UEE A;  2G0B A;  4KVM E;  4UFX A;  1YX0 A;  1LAN A;  1X12 A;  2PJ2 A;  4FD5 A;  2I79 A;  3K9U A;  5A28 A;  4CYQ A;  4PSX A;  2FXF A;  2EK8 A;  4KOV A;  1PCA A;  3HLP A;  3EY5 A;  2B5G B;  4UA3 A;  3TC8 A;  4AVA A;  4B14 A;  4A39 A;  2ZEF A;  4PV6 A;  4PXB A;  4UWJ A;  3D7G A;  5AG7 A;  4OLL A;  4P10 A;  4OC5 A;  3SXN A;  2WYR A;  1TF9 A;  4B5O A;  2PIZ A;  4OKO A;  4ZY0 A;  5KTA A;  5EBV A;  2Q7B A;  3SI2 A;  5HVG A;  2ZEO A;  4NFR A;  4C7I A;  4X2T A;  1UWY A;  2KCW A;  1NSL A;  3GIU A;  5IV0 A;  4H6U A;  2F5I A;  3B3T A;  2P6E A;  1I21 A;  4KOT A;  1LAP A;  2VL1 A;  3F0A A;  1IID A;  2Z11 A;  3BLN A;  1Q2Y A;  3HUV A;  3GYA A;  3TOA A;  2O4H A;  5J8F A;  1VIX A;  3GKR A;  1IU8 A;  4KSA A;  2Q7S A;  4A2Z A;  3KKW A;  2PR1 A;  1TF8 A;  2DF5 A;  4XNH B;  4C68 A;  3FMC A;  1CBX A;  1ARM A;  2AFS A;  2PVV A;  2ZEE A;  4P4D A;  2PVW A;  4NGN A;  2C6P A;  3V7Z A;  5G1Z A;  2Q51 A;  5LRK A;  4CGL A;  2O53 A;  2BUE A;  4YWY A;  5F46 A;  2R8V A;  4HKF A;  1YW4 A;  2C6G A;  3D67 A;  4L8A A;  4PK2 A;  2R1I A;  2EUI A;  3TFY A;  1XBU A;  2ZEG A;  1DE4 C;  3IWG A;  4X5K A;  3JVN A;  1S7N A;  4ZYQ A;  4OIW A;  2ZEP A;  2Q43 A;  4R3L A;  3T90 A;  3I9S A;  2V8D A;  2PJA A;  2PJ8 A;  2EO8 A;  3FVL A;  4KOY A;  1Q2D A;  3IGR A;  1X10 A;  4ONW A;  4PXE A;  3WC5 A;  4MFZ A;  3T8W A;  4E8O A;  1HEE A;  3JTK A;  4YGO A;  2J8M A;  1IYK A;  1TKH A;  4UCM A;  4NF1 A;  2F7V A;  3FED A;  1Z8W A;  4MHY A;  4R7M A;  4TNU A;  2ATR A;  4IUS A;  4B13 A;  3GB0 A;  3RYO A;  4U9Y A;  3DLJ A;  5HVF A;  2PJ0 A;  3EFA A;  3KGQ A;  4KVX A;  4M6H A;  3PEI A;  2J8N A;  3CXP A;  3IFE A;  1Z8L A;  4R8F A;  4RN7 A;  4PK3 A;  1KUX A;  5DWM A;  2REF A;  3NH4 A;  3B8G A;  2FIW A;  4AXV A;  3ISZ A;  4Q7A A;  4R3K A;  3QB8 A;  2DPT A;  3PZJ A;  4B6Z A;  2JBJ A;  3IU2 A;  2WUU A;  1BAV A;  4QUS A;  4NGT A;  3JUW A;  4Y49 B;  1M4L A;  6CPA A;  4XPL A;  4OME A;  1CX8 A;  3WR7 A;  4Q36 A;  2OU2 A;  4GM5 A;  3SJE A;  1AUG A;  4B10 A;  1R57 A;  4RS2 A;  1IYL A;  1I12 A;  3B3V A;  3VWE A;  3CPA A;  2G3A A;  2GLJ A;  1NE9 A;  4HNY B;  5JGF A;  2QML A;  3FNC A;  3MN8 A;  2GLF A;  4RUH A;  3NH8 A;  4OID A;  1XFO A;  2PJ1 A;  1KWM A;  2PRB A;  2JBK A;  3DGV A;  1QSO A;  1MJA A;  3QNV A;  4MHP A;  3WT4 A;  4A33 A;  4A37 A;  4AVB A;  4UCN A;  4F9U A;  1N71 A;  2XEI A;  4OC1 A;  4DJL A;  2XEF A;  2PR8 A;  2X7B A;  3MRU A;  4XNH C;  2PDO A;  3DSB A;  3R1K A;  5HH1 A;  1NMT A;  2ZEH A;  1IOF A;  4FD4 A;  2QYV A;  4K3N A;  2H5M A;  4P4J A;  3PGP A;  3FRM A;  1ON0 A;  3LAC A;  4MY0 A;  4P44 A;  4R6T A;  1J4J A;  2CF4 A;  4JZ0 A;  5THW A;  4OP4 A;  1RO5 A;  1Z8X A;  1Y7R A;  2C1C A;  4MCR A;  4CYN A;  5F09 A;  5ELY A;  4AVC A;  3E0K A;  3FH4 A;  1LCP A;  3RO0 A;  4NXY A;  4NCZ A;  4NGR A;  4CGO A;  2V8H A;  3KQX A;  2CTC A;  2I00 A;  5DWN A;  2AFW A;  2PJ4 A;  1QSN A;  3D68 A;  1UFH A;  2OH1 A;  1ELM P;  3LMS A;  4A30 A;  4CS0 B;  4GXH A;  5DS0 A;  2VXK A;  4NGQ A;  1FT7 A;  2P6F A;  5IB9 A;  3TO7 A;  3ZJ0 A;  1XMB A;  1RXT A;  4CYO A;  3PBE A;  1XF8 A;  1QMU A;  3D3S A;  2Q04 A;  2ZW6 A;  3H4Q A;  4ONU A;  4YRH A;  2B3U A;  3PB4 X;  1WWZ A;  4B5P B;  4UBR A;  2ZEM A;  5JQ4 A;  1V0C A;  4LQ6 A;  2R7H A;  2NSM A;  4NGS A;  3SJG A;  1XE4 A;  1IIC A;  3IWE A;  1BO4 A;  3FXT A;  1B87 A;  3W6X A;  2VZZ A;  1GYT A;  1YLE A;  1F2O A;  3PB8 X;  4IK2 A;  3V8I A;  2G3T A;  4MCP A;  4OC3 A;  4ZY2 A;  4CPA A;  5E96 A;  2JDD A;  4M6I A;  1AYE A;  5JH9 A;  3L2N A;  3F8K A;  2WPW A;  4A94 A;  1S3Z A;  1Z8T A;  4DYO A;  2BCO A;  4Y49 C;  2B4D A;  4GS4 A;  2AFO A;  3OWC A;  5H86 A;  4UCP A;  4HNX B;  3FYN A;  5J1Q A;  3QAY A;  3TE4 A;  4IAV A;  4X8I A;  3S6K A;  3VH9 A;  1QST A;  4MCQ A;  5AG5 A;  2VQY A;  2XEG A;  3CXQ A;  1HDU A;  2IJZ A;  1Y7E A;  2J9A A;  3B3C A;  1S60 A;  3PB7 X;  3PBB A;  3RBU A;  2Q4V A;  4RI1 A;  1YR0 A;  4FWU A;  1YGH A;  1Z2L A;  3PB6 X;  8CPA A;  3BI1 A;  2FE7 A;  4PQA A;  2O28 A;  4JWP A;  4NJQ A;  4DUK A;  1M44 A;  1MJ9 A;  4QC6 A;  2GFQ A;  2FL4 A;  3QAH A;  5LRG A;  1TKF A;  3DNS A;  1ZG7 A;  2ZW5 A;  2YNE A;  2PC1 A;  4H6Z A;  4UIB A;  5C88 A;  4ZBG A;  3BHX A;  4KSI A;  1CP7 A;  1XIX A;  3K2K A;  4MFQ A;  4G1P A;  1XMT A;  4R57 A;  1ZLH A;  2ANP A;  4PPZ A;  4JD6 A;  5D8N A;  4OC0 A;  5EC4 A;  2A4N A;  1IB1 E;  2IQ6 A;  1B6B A;  1Y0Y A;  1YVO A;  3NFZ A;  4ZY1 A;  3PB9 X;  3IO1 A;  5K8O A;  5LYL A;  1XOV A;  2HC9 A;  4BD9 A;  1KZF A;  2AFM A;  3DR6 A;  4MHD A;  3D7F A;  4C7H A;  2ABZ A;  4FD7 A;  3KR4 A;  2J8R A;  4QVT A;  4XPD B;  4MFL A;  4C2Z A;  1LFW A;  4P4E A;  4NEX A;  4JXR A;  3KHZ A;  2I3C A;  4KOS A;  2G9D A;  3P2F A;  3FIX A;  4KLV A;  3S6H A;  2VEZ A;  2BEI A;  3DR8 A;  1CM0 A;  3PFE A;  4L89 A;  1BPN A;  3ZZI A;  1K4J A;  2Y0M A;  3D4U A;  3KL9 A;  4ZX9 A;  4HNW B;  2JEV A;  4B12 A;  5KTC A;  4CAV A;  2ODF A;  4MHN A;  4H2K A;  1SQH A;  5JPH A;  3PP9 A;  1F2P A;  2AE6 A;  2Z0Z A;  4MCS A;  4KOX A;  4P4I A;  3G3S A;  4MFP A;  5AG4 A;  4CAF A;  3MGD A;  4Z65 A;  3NA6 A;  2B4B A;  4NSQ A;  2BOA A;  4H89 A;  2PIY A;  2OR4 A;  1Q7L A;  1RTQ A;  4ORF A;  2ZEL A;  3C26 A;  4XPK A;  2Z3K A;  3UY5 A;  4DNC A;  1FNO A;  4KS9 A;  2QIR A;  4R9M A;  5D29 A;  5CNP A;  3W6S A;  3H8E A;  4M6G A;  4MBU A;  1FY7 A;  2FS5 A;  2CIJ A;  2V8V A;  3KQZ A;  1BLL E;  2EK9 A;  1M1D A;  1VKC A;  2ZXV A;  3NE8 A;  4Q38 A;  4UIA A;  1F57 A;  4EWT A;  4ZI6 A;  2CXA A;  4P6Y A;  4II9 A;  3TTH A;  1IY7 A;  3EO4 A;  2F8H A;  4U9Z A;  1LRZ A;  3TO6 A;  2GE3 A;  1Z9U A;  3S6F A;  4KVO E;  5LYI A;  4CAW A;  4CAX A;  2EBJ A;  5EMI A;  1EE3 P;  1S7L A;  5AG6 A;  4MMO A;  4NGP A;  2OZG A;  2Q4Z A;  3D2P A;  2NMT A;  4PXD A;  1VHS A;  3RNZ A;  2PJ5 A;  4NJR A;  2B5G A;  3H8G A;  2OZH A;  3G8W A;  3B3W A;  2HV2 A;  4QB9 A;  4F8Z A;  1PU9 A;  3LWU A;  4KSF A;  4MFK A;  5F49 A;  2VZY A;  3BXM A;  4KLW A;  4P4B A;  4UFW A;  1ZO0 A;  2C6C A;  2NYQ A;  1YVK A;  3IC1 A;  3V38 A;  2IL4 A;  3FEC A;  1XJO A;  3DDD A;  1JWQ A;  4AB7 A;  1GHE A;  1YK3 A;  5F48 A;  4XPD C;  5FVJ A;  4FBE A;  2Z3M A;  3FF3 A;  4WJB A;  3FBU A;  3I1U A;  1YLO A;  3CZX A;  3GY9 A;  3IU1 A;  3NE7 A;  2Z10 A;  3GUX A;  4PXC A;  4NGM A;  3RZA A;  2GU2 A;  2K5T A;  4IF5 A;  1QSR A;  1R3N A;  4BBH A;  2Z3L A;  1S5K A;  2DXQ A;  1CPS A;  4OC4 A;  2DPS A;  4LX9 A;  1NSA A;  3N7Z A;  3WC6 A;  3W91 A;  4YFJ A;  5IB0 A;  2OB0 A;  3PRT A;  2EWB A;  2PJ7 A;  1AMP A;  2FT0 A;  2YNC C;  1Z4R A;  2ARH A;  3JRU A;  1I1D A;  2Q4Y A;  4LUA A;  2XEJ A;  5F47 A;  4A31 A;  4TWE A;  2RC4 A;  1Y9W A;  4JYW A;  4CRZ B;  1CJW A;  2CNM A;  2FCK A;  2PJ6 A;  3IWW A;  4AG9 A;  4R76 A;  3P2H A;  4CGM A;  3BJ8 A;  4CRY B;  2PJC A;  1VGY A;  1ZG8 A;  1TIQ A;  3BJ7 A;  1YQE A;  3CPX A;  4FUU A;  2R98 A;  2PCU A;  1L0C A;  2CNS A;  2JDC A;  3LD2 A;  4P4F A;  2FIA A;  2PQ8 A;  3BI0 A;  3N5F A;  3RAM A;  4UEZ A;  4MXU A;  4F0Y A;  5A27 A;  1P0H A;  2BO9 A;  1CG2 A;  3SJX A;  4J3G A;  3EXN A;  4EFD A;  4MHZ A;  4ZX8 A;  2BSW A;  2PJB A;  3R96 A;  1YSJ A;  2EVN A;  2ZPA A;  1Y0R A;  1R43 A;  1M4D A;  3TOB A;  1CP6 A;  4KOU A;  3IIB A;  1DTD A;  2REE A;  1WK4 A;  4EVY A;  5JM6 A;  7CPA A;  2ZW4 A;  2OOT A;  1PUA A;  2B3V A;  2QJ8 A;  1Q2C A;  2V8G A;  2RB7 A;  3SI0 A;  3SHP A;  4A95 A;  4HPS A;  2AFZ A;  3S6G A;  3FJU A;  4KOR A;  2AJ6 A;  4OC2 A;  1YME A;  3ISX A;  5LRJ A;  3FEE A;  3R9F A;  4C2Y A;  2B58 A;  3CDX A;  4KZT A;  2RFH A;  4KOW A;  4KUA A;  1ARL A;  4UEF A;  4C2X A;  2DEA A;  3CT9 A;  5G20 A;  2YNC A;  4CYP A;  1P4N A;  2B4D B;  4QBJ A;  3D7H A;  1VHO A;  3IEH A;  2QVP A;  3B35 A;  2Q0Y A;  5G22 A;  3R9E A;  3KR5 A;  2Z3P A; 
#chains in the Genus database with same CATH homology
 5J8C A;  3D2M A;  2YND A;  3H5Z A;  4JLY A;  4M85 A;  3T9Y A;  2HUZ A;  2CNT A;  4KUB A;  1YRE A;  1XEB A;  3R95 A;  4MFJ A;  2Z3O A;  2P0W A;  4M3S A;  1U6M A;  1BOB A;  5AGE A;  1QSM A;  5C82 A;  3SXO A;  4K30 A;  2PSW A;  3EC4 A;  4R87 A;  5HMN A;  2HQY A;  1S7F A;  4E2A A;  1OZP A;  2ZW7 A;  3A9L A;  2YGW A;  3VWD A;  5GCN A;  2Q44 A;  4MY3 A;  4F6A A;  2CY2 A;  2P6G A;  2VI7 A;  4CGN A;  4UWI A;  5BWA B;  2D4O A;  4BMH A;  4B5P A;  3TCV A;  3FB3 A;  4MI4 A;  1KUV A;  4A32 A;  4FD6 A;  4PSW A;  2BL1 A;  5G21 A;  1MK4 A;  2JLM A;  4JJX A;  1M4G A;  4UFV A;  5KTD A;  1KUY A;  2Z3N A;  4ZGY B;  4E0A A;  2FSR A;  4I49 A;  1S7K A;  3R9G A;  3CXS A;  1MJB A;  3D8P A;  2GAN A;  4OAE A;  2D4P A;  4MJ8 A;  4U5Y A;  4AG7 A;  1Z4E A;  3LOD A;  4OAD A;  2WSA A;  2WPX A;  5H84 A;  4CAE A;  2QEC A;  4CGP A;  3F5B A;  5IX3 A;  2GIV A;  1M4I A;  2C27 A;  4F0X A;  5I0C A;  3TT2 A;  3I3G A;  4JXQ A;  1Y9K A;  4B11 A;  3TO9 A;  2VBQ A;  2OZU A;  2G0B A;  4KVM E;  4UFX A;  1YX0 A;  4FD5 A;  2I79 A;  3K9U A;  5A28 A;  4CYQ A;  4PSX A;  2FXF A;  4KOV A;  3EY5 A;  2B5G B;  4UA3 A;  4AVA A;  4B14 A;  4PV6 A;  4UWJ A;  5AG7 A;  4OLL A;  3SXN A;  4B5O A;  5KTA A;  5EBV A;  2Q7B A;  4C7I A;  2KCW A;  1NSL A;  5IV0 A;  4H6U A;  2F5I A;  2P6E A;  1I21 A;  4KOT A;  3F0A A;  1IID A;  2Z11 A;  3BLN A;  1Q2Y A;  3GYA A;  3TOA A;  5J8F A;  3GKR A;  4KSA A;  4A2Z A;  3KKW A;  2PR1 A;  4XNH B;  4C68 A;  5G1Z A;  4CGL A;  2BUE A;  5F46 A;  2R8V A;  4HKF A;  4L8A A;  4PK2 A;  2R1I A;  2EUI A;  3TFY A;  4X5K A;  3IWG A;  3JVN A;  1S7N A;  4R3L A;  3T90 A;  3I9S A;  4KOY A;  1Q2D A;  3IGR A;  4MFZ A;  4E8O A;  3JTK A;  4YGO A;  2J8M A;  1IYK A;  4UCM A;  4NF1 A;  2ATR A;  4IUS A;  4B13 A;  3RYO A;  4U9Y A;  3EFA A;  4KVX A;  2J8N A;  3CXP A;  4PK3 A;  1KUX A;  5DWM A;  2REF A;  3B8G A;  2FIW A;  4R3K A;  3QB8 A;  2DPT A;  3PZJ A;  3IU2 A;  2WUU A;  4QUS A;  3JUW A;  4Y49 B;  4XPL A;  3WR7 A;  4Q36 A;  2OU2 A;  4B10 A;  1R57 A;  4RS2 A;  1I12 A;  1IYL A;  3VWE A;  2G3A A;  1NE9 A;  4HNY B;  2QML A;  3FNC A;  2PRB A;  1QSO A;  1MJA A;  4AVB A;  4A33 A;  4UCN A;  1N71 A;  2PR8 A;  2X7B A;  4XNH C;  3DSB A;  3R1K A;  2PDO A;  5HH1 A;  1NMT A;  4FD4 A;  2H5M A;  5ISV A;  3PGP A;  3FRM A;  1ON0 A;  4MY0 A;  1J4J A;  1RO5 A;  1Y7R A;  4CYN A;  4AVC A;  3E0K A;  4NXY A;  4NCZ A;  4CGO A;  2I00 A;  1QSN A;  1UFH A;  2OH1 A;  4A30 A;  4CS0 B;  2VXK A;  2P6F A;  3TO7 A;  3ZJ0 A;  1RXT A;  4CYO A;  1XF8 A;  3D3S A;  2Q04 A;  2ZW6 A;  3H4Q A;  4ONU A;  4YRH A;  2B3U A;  4B5P B;  1WWZ A;  4UBR A;  5JQ4 A;  1V0C A;  2R7H A;  1XE4 A;  1IIC A;  3IWE A;  1BO4 A;  3FXT A;  1B87 A;  3W6X A;  2VZZ A;  1YLE A;  3V8I A;  2G3T A;  5E96 A;  2JDD A;  3F8K A;  2WPW A;  1S3Z A;  4Y49 C;  2B4D A;  4GS4 A;  3OWC A;  5H86 A;  4UCP A;  4HNX B;  3FYN A;  3TE4 A;  3S6K A;  1QST A;  5AG5 A;  2VQY A;  3CXQ A;  1S60 A;  2Q4V A;  4RI1 A;  1YR0 A;  1YGH A;  2FE7 A;  2O28 A;  1M44 A;  1MJ9 A;  4QC6 A;  3QAH A;  2FL4 A;  3DNS A;  2ZW5 A;  2YNE A;  2PC1 A;  4H6Z A;  5C88 A;  4ZBG A;  1XIX A;  4MFQ A;  1XMT A;  4R57 A;  4JD6 A;  5EC4 A;  2A4N A;  1IB1 E;  1B6B A;  1YVO A;  1KZF A;  3DR6 A;  4MHD A;  4C7H A;  4FD7 A;  4QVT A;  2J8R A;  4XPD B;  4MFL A;  4C2Z A;  4NEX A;  4JXR A;  4KOS A;  3P2F A;  3FIX A;  4KLV A;  3S6H A;  2VEZ A;  2BEI A;  3DR8 A;  1CM0 A;  4L89 A;  3ZZI A;  1K4J A;  2Y0M A;  4HNW B;  2JEV A;  4B12 A;  5KTC A;  4CAV A;  1SQH A;  5JPH A;  3PP9 A;  2AE6 A;  2Z0Z A;  4KOX A;  3G3S A;  4MFP A;  5AG4 A;  4CAF A;  3MGD A;  2B4B A;  4NSQ A;  4H89 A;  4ORF A;  5DWN A;  4DNC A;  4XPK A;  3C26 A;  2Z3K A;  3UY5 A;  4KS9 A;  2QIR A;  4R9M A;  5CNP A;  3W6S A;  4MBU A;  1FY7 A;  2FS5 A;  2ZXV A;  1M1D A;  1VKC A;  4Q38 A;  2CXA A;  4II9 A;  3TTH A;  3EO4 A;  4U9Z A;  1LRZ A;  3TO6 A;  2GE3 A;  1Z9U A;  3S6F A;  4KVO E;  4CAW A;  4CAX A;  1S7L A;  5AG6 A;  2OZG A;  3D2P A;  2NMT A;  1VHS A;  2B5G A;  2OZH A;  3G8W A;  2HV2 A;  4QB9 A;  1PU9 A;  4KSF A;  4MFK A;  5F49 A;  2VZY A;  4KLW A;  4UFW A;  1ZO0 A;  1YVK A;  2IL4 A;  3DDD A;  4AB7 A;  1GHE A;  1YK3 A;  5F48 A;  4XPD C;  5FVJ A;  2Z3M A;  3FBU A;  3IU1 A;  3GY9 A;  3NE7 A;  2Z10 A;  2K5T A;  4IF5 A;  1QSR A;  4BBH A;  2Z3L A;  1S5K A;  2DXQ A;  2DPS A;  4LX9 A;  3N7Z A;  3W91 A;  4YFJ A;  5IB0 A;  2OB0 A;  2FT0 A;  2YNC C;  1Z4R A;  2ARH A;  1I1D A;  2Q4Y A;  4LUA A;  5F47 A;  4A31 A;  2RC4 A;  1Y9W A;  4CRZ B;  1CJW A;  2CNM A;  2FCK A;  2Z3P A;  4AG9 A;  3P2H A;  4CGM A;  3BJ8 A;  4CRY B;  1TIQ A;  3BJ7 A;  2R98 A;  1L0C A;  2CNS A;  2JDC A;  3LD2 A;  2FIA A;  2PQ8 A;  5A27 A;  4F0Y A;  1P0H A;  4J3G A;  3EXN A;  2BSW A;  3R96 A;  2EVN A;  2ZPA A;  1M4D A;  3TOB A;  4KOU A;  2REE A;  1WK4 A;  4EVY A;  2ZW4 A;  1PUA A;  2B3V A;  4A95 A;  1Q2C A;  3SHP A;  3S6G A;  4KOR A;  2AJ6 A;  3R9F A;  4C2Y A;  2B58 A;  4C2X A;  4KZT A;  4KOW A;  4KUA A;  5G20 A;  2YNC A;  4CYP A;  1P4N A;  2B4D B;  4QBJ A;  2Q0Y A;  5G22 A;  3R9E A;  4JWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...