4UFWA

Plasmodium vivax n-myristoyltransferase in complex with a pyridyl inhibitor (compound 22)
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
385
structure length
385
Chain Sequence
b'MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Pyridyl-Based Inhibitors of Plasmodium Falciparum N-Myristoyltransferase
pubmed doi rcsb
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
source organism Plasmodium vivax
molecule tags Transferase
total genus 118
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ufwA00
5AGEA 2YNEA 4CGPA 4UCMA 2WSAA 4A33A 4CAEA 4BBHA 4A30A 3H5ZA 5G1ZA 4A31A 4C2XA 5A27A 3JTKA 4A32A 2YNCA 4UCPA 4UFWA 4C68A 4C7IA 4B14A 4CGMA 5AG7A 2YNDA 5AG4A 5AG6A 4CYNA 4CYQA 4UFVA 4A2ZA 4CYOA 4UCNA 4B13A 4C2YA 4UFXA 5G20A 2YNCC 4CGLA 5G22A 2WUUA 4C7HA 5AG5A 4B11A 4CGNA 5A28A 3IU2A 4B12A 4CGOA 3IU1A 4B10A 4CYPA 4C2ZA 4CAFA 3IWEA 5G21A 4A95A
chains in the Genus database with same CATH superfamily
2O4HA 4QVTA 1J4JA 4R3LA 1FNOA 4OC3A 2REEA 2GANA 4KOTA 3D7DA 5LYIA 2AE6A 1CJWA 2B4BA 5JH9A 3H5ZA 5G1ZA 5CBMA 4BD9A 4PXEA 5AG4A 1ZG7A 3FF3A 3PP9A 4ZYQA 4XNHC 2IL4A 3D2MA 2PE3A 3V38A 4UF4A 1YW6A 4JXRA 4P4JA 1MK4A 2EBJA 1VHOA 1TKJA 1BO4A 3FYNA 3G8WA 1CPXA 1MJBA 4KLVA 1M1DA 4F9VA 1KZFA 3FRMA 3B35A 1XOVA 2F5IA 2IMOA 3I1UA 4IF5A 2PIZA 2ZW5A 4KVXA 1CP7A 2B3UA 3SI1A 3SJFA 3GKRA 2OU2A 1KUXA 2RB7A 1Y7EA 2Q4YA 1SQHA 3KKWA 2V8DA 2ZW7A 4MHDA 2K5TA 2Q7BA 4C2XA 2Z3NA 3RAMA 5A27A 4R87A 5CNPA 4QUSA 1MJAA 5H86A 3CXQA 4B14A 3DDDA 3LACA 4MFLA 5AG7A 4ZX8A 2AFSA 3B3TA 4J3GA 2VI7A 3LWUA 2FT0A 3FEEA 2OR4A 4YGOA 1QSRA 4CYOA 3EXNA 1BOBA 2PCUA 2CY2A 4KSAA 2WUUA 3F5BA 4ZX9A 3SI0A 4ZY1A 3L2NA 1R43A 2FE7A 2XEGA 1CPSA 2FIAA 3B3VA 1H8LA 2ZEPA 2ZEHA 4MHZA 4CAFA 2Q43A 3W6SA 4NGQA 4EWTA 1TF9A 2ARHA 4C2ZA 2Z3LA 4A37A 5K8PA 2CTCA 3FNCA 1S3ZA 3IWGA 3KL9A 1BPMA 1FT7A 3RNZA 1IU8A 3C26A 5HH1A 1KUYA 2PRBA 4UBRA 4AVAA 4B6ZA 4PV6A 3V8IA 3ZJ0A 2BCOA 4IK2A 2AFOA 4ZY2A 3FECA 2B3VA 4OKOA 4UWIA 3NE7A 4HKFA 4UFXA 3RO0A 2GLJA 4F8ZA 2VZYA 2WPXA 2VEZA 1Z8LA 5K8NA 1I21A 4KVOE 4OC5A 2B5GB 2VXKA 1YLOA 3KASA 2Z3OA 1TKFA 2FL4A 1NMTA 3GB0A 3QB8A 3R9FA 4Y49C 2BO9A 4UCMA 1YREA 3GYAA 1R57A 4M6IA 2PIYA 4PPZA 2AFWA 2B4DA 4MI4A 5F47A 3SJEA 3T90A 5J8CA 1IB1E 1P4NA 3HLPA 4ZBGA 1VGYA 3NE8A 2IJZA 3CPXA 5E96A 3D68A 1I1DA 2VQYA 1LAMA 1PU9A 4ONWA 3ZZIA 1KUVA 3RBUA 5HMNA 3KHXA 2YNCC 4R8FA 1X10A 3KQXA 4PQAA 4XPKA 4ZGYB 2V8VA 2GE3A 4GM5A 7CPAA 3PB9X 2OZUA 4R57A 4OIWA 4BMHA 4QBJA 4CGOA 3B3SA 1AYEA 4KSFA 4EFDA 5G21A 3VWEA 4FAIA 2OH1A 1QSMA 1YGHA 1TXRA 2ABZA 1JQGA 3DR6A 2C6PA 5D29A 4LX9A 4TNUA 2R8VA 2FIWA 3NA6A 3D7FA 2O28A 4FD6A 3CPAA 3F0AA 4A30A 2XEIA 2G3AA 2I3CA 3ISZA 3NH5A 4X2TA 4B5OA 4NGPA 2WYRA 3D3SA 3GLJA 4C68A 2R1IA 4MCPA 4KSIA 4E0AA 3D2PA 1DTDA 1CP6A 1MJ9A 4MXUA 2H5MA 3KQZA 3D4UA 4Y49B 3R96A 2QYVA 3FH4A 4AG9A 2B5GA 2J8RA 3LODA 4KOVA 4AVCA 4DYOA 3B7IA 2ANPA 4DJLA 2HC9A 2IQ6A 4NJRA 4Z65A 5KTDA 5HVFA 2CIJA 3S6GA 3SJXA 3CXSA 1OBRA 4MHNA 5LRJA 3TOAA 4UIAA 1XJOA 2HQYA 4K30A 4CAEA 1ZG9A 2DXQA 3DSBA 5F48A 2ODFA 3TTHA 4M85A 4KOXA 2CNSA 2WPWA 4G1PA 1HDQA 1Q7LA 4OLLA 1GHEA 1VHEA 4P6YA 3SI2A 5JM6A 1ZO0A 2HB6A 3B3CA 3PGPA 4IUSA 1KWMA 2ZXVA 4KLWA 1S7NA 3BI1A 4MCQA 4KUBA 4NEXA 3W6XA 3WT4A 2Z0ZA 4CGNA 5HVGA 3TOBA 1WWZA 1XRYA 4NGSA 3B3WA 4OAEA 4EMEA 5LYLA 2OB0A 3CDXA 3I9SA 3IFEA 3IIBA 3F8KA 3IWEA 4PK2A 3R9GA 1Z2LA 1CG2A 1XMBA 2EVNA 1F2OA 1ELMP 5BWAB 5IX3A 2HV2A 1S7LA 1YX0A 2D4OA 4R9MA 5THWA 4E8OA 3CXPA 2B4DB 2FXFA 3D8PA 2JLMA 3PB6X 4MFZA 3TO9A 2YGWA 4WWVA 3R95A 4BINA 3SJGA 2C6GA 2EUIA 4UCPA 2JBJA 4RS2A 3S9MA 3P2HA 4UEEA 3TE4A 4AG7A 4B13A 4M3SA 2CXAA 2RC4A 4U9YA 4GXHA 1CBXA 4MY0A 1QSTA 2J8MA 4ORFA 4WJBA 1PUAA 4B10A 4CYPA 2PJ2A 2BSWA 1UWYA 3WC6A 5H84A 4GS4A 2PQ8A 1TKHA 4U9ZA 2Q51A 2VBQA 3DGVA 3JVNA 4UEFA 5HXDA 3PB7X 5KTCA 4Q36A 4MHYA 5F09A 4OC0A 4EVYA 4B5PB 4IAVA 4DNCA 1PCAA 2PDOA 1XE4A 3SXNA 4CRYB 4PXBA 4XNHB 5DWNA 2XEFA 1IY7A 2Z3KA 2Y0MA 2ZOGA 2YNCA 3JTKA 4AB7A 3BHXA 3RYOA 2YNDA 4L89A 2G9DA 5AG6A 2X7BA 2REFA 3TO6A 1LFWA 2ATRA 2Q44A 2POKA 3NH4A 4KOSA 5G22A 3FIXA 3EC4A 2PJ5A 5AG5A 1VKCA 2VZZA 4U5YA 3PZJA 1FY7A 4IHMA 3K2KA 2CF4A 3MRUA 1AMPA 4E2AA 3I3GA 2J8NA 1M4GA 1VIXA 1Z8WA 2PR8A 3D67A 4R3KA 4UIBA 1RXTA 4FD7A 1JWQA 5JPHA 2C27A 4CRZB 2DPSA 2EO8A 2F7VA 3OWCA 1YVKA 3NH8A 2DPTA 2JEVA 4MJ8A 5JQ4A 4H89A 2Z11A 4HNWB 4NGNA 1ARLA 2NSMA 3PFOA 4PSXA 4UWJA 2Q4VA 4M6HA 2QIRA 2Z3MA 3S6KA 4CYQA 4YWYA 4CYNA 3PFEA 5ISVA 4P4BA 1YLEA 5CPAA 3P2FA 4FD5A 3S6HA 2PR1A 3S9LA 2CNMA 3FXTA 2ZENA 5F46A 3B2YA 5A28A 1PYTB 2HUZA 1LCPA 1IOIA 4MCSA 1Z4EA 2Q0YA 2JEWA 4A95A 1X12A 4CGPA 5JGFA 5LYFA 4UA3A 1S7KA 4AVBA 4B5PA 3KR5A 2PJ6A 2C1CA 4JLYA 5D8NA 4NSQA 1DE4C 2JDCA 2AJ6A 3FEDA 4JYWA 2ZEGA 5FVJA 4P4EA 3TO7A 4A31A 2G3TA 1YK3A 4R7MA 3TC8A 4KOUA 4CGMA 1S7FA 1ON0A 4DUKA 4H6ZA 2G0BA 3BJ8A 2OZGA 4P4DA 4R6TA 2DEAA 5C82A 1QSNA 2PJAA 5LRKA 4PXCA 3TFYA 4OC4A 1P0HA 4B11A 4CAXA 4PSWA 1R3NA 4OC2A 4F9UA 1Z8TA 3GUXA 3JRUA 4KVME 3MN8A 3FX6A 2YNEA 3LMSA 4CPAA 4ZI6A 2P0WA 3UY5A 1Z9UA 3K9UA 2GLFA 3FBUA 1BPNA 1CX8A 1B6BA 1ZLHA 3N5FA 4C7IA 2ZEFA 2NMTA 1YW4A 3TCVA 4P45A 4CS0B 4A2ZA 1IICA 1V0CA 3KZWA 4MFKA 2AFZA 4NCZA 2FS5A 2ZW6A 4O23A 2B58A 3FB3A 4P4FA 1XEBA 3PB4X 4XPDC 3CT9A 4A94A 2BUEA 2V77A 4KOWA 3IC1A 4JZ0A 4LQGA 4OADA 4F0YA 3E0KA 4TWEA 2PVVA 3BXMA 4MFPA 2ZEDA 4OIDA 1ELLP 2P6FA 4RUHA 3EFAA 2RFHA 3T8WA 3WC7A 4KZTA 2JBKA 4YRHA 1AUGA 4P10A 1NSLA 4YFJA 3IGRA 1GYTA 2OZHA 3D7GA 1YVOA 2ZW4A 6CPAA 4I49A 3QAYA 1YR0A 8CPAA 2GREA 4MRIA 1LOKA 5C88A 4H2KA 1Y0RA 2DF5A 3HUVA 3R1KA 4UFWA 2F8HA 4A38A 3KGQA 3H4QA 4RN7A 5J8FA 3D7HA 5IB0A 4UFVA 3FMCA 4MHPA 4UCNA 1Z5RA 5G20A 2ZPAA 2PJCA 3H8FA 4C7HA 1RTQA 3H8EA 1F57A 3VWDA 4FBEA 1NE9A 3PEIA 4H6UA 1LAPA 2PJ4A 3KI9A 3IU1A 1XFOA 1A2ZA 2OOTA 3QNVA 2V8HA 4CAVA 2Z3PA 1QQ9A 2Z10A 4P44A 4MY3A 4PK3A 3CZXA 4MFQA 1LANA 2ZEEA 1Y0YA 2Q04A 3A9LA 5DWMA 1ZLIA 2EWBA 4FUUA 1VHSA 2D4PA 2PJ9A 1M44A 1QMUA 4A32A 4MBUA 4XPDB 1YSJA 2R7HA 4F6AA 3IEHA 2PRQA 2BEIA 2CTBA 2P6GA 1YMEA 2EK9A 2PJ3A 1M4IA 3BJ7A 4K3NA 4X5KA 3VATA 1U6MA 1HDUA 3R9EA 1YQEA 2ZELA 1HEEA 3D66A 2CNTA 3H8GA 4JJXA 5EC4A 1EE3P 1Y7RA 4KUAA 5I4MA 1I12A 5AGEA 1BLLE 2GU2A 4II9A 2Q7SA 2R98A 3JUWA 4KOYA 2AFXA 3VARA 4AXVA 2WSAA 2JDDA 4JWPA 3TT2A 3T9YA 2BOAA 2PC1A 2FSRA 4LQ6A 1IYLA 3KHZA 3RZAA 2QECA 1XF8A 1M4LA 4OP4A 3IWWA 5HVHA 1TIQA 4YU9A 1ARMA 3NFZA 3IO1A 1QSOA 1Q2DA 1CM0A 2NYQA 4P4IA 4NGTA 5GCNA 4C2YA 2C6CA 4HNXB 4NFRA 1Q2CA 3B8GA 4M6GA 3V7ZA 5IV0A 1XMTA 2QMLA 4Q38A 2PJ0A 1S5KA 2V8GA 4ONUA 4JXQA 2PVWA 4CAWA 3PRTA 1IOFA 2ZEOA 1IYKA 1OZPA 3FJUA 4HPSA 2GIVA 3DR8A 5EBVA 4OC1A 1NSAA 1Z8XA 1B87A 1N71A 3PBEA 3QAHA 5LRGA 4BBHA 1F2PA 1LRZA 2Q4ZA 3PB8X 3TX8A 4FWUA 2QVPA 4L8AA 4RI1A 2I00A 4HNYB 4QB9A 1Y9KA 4MFJA 3IJ3A 4QC6A 2AFUA 5IB9A 3G3SA 3LD2A 4W9YA 1ZG8A 4NGRA 1RO5A 4NF1A 4Q7AA 1XIXA 3VH9A 3ISXA 1Z4RA 4X8IA 3N7ZA 4FD4A 2PSWA 5KTAA 3DLJA 2O53A 3IU2A 3SHPA 4A39A 4NGMA 2P6EA 3EO4A 4F0XA 3DNSA 3KR4A 1Y9WA 4PXDA 5F49A 2I79A 2KCWA 2VL1A 1IIDA 2WZNA 3MGDA 3S6FA 4R76A 2A4NA 3GY9A 4KS9A 3WC5A 1Q2YA 4MMOA 4KORA 3WABA 4JD6A 4A33A 5ELYA 4OMEA 2AFMA 1K4JA 1UFHA 2ZEMA 2ZOFA 2PJBA 2QJ8A 3K9TA 5DS0A 3S9NA 2PJ7A 2J9AA 5EMIA 2FCKA 3W91A 2BL1A 5K8MA 3BLNA 2FVGA 1IGBA 1BAVA 4MCRA 5LYDA 2PJ8A 2EK8A 2GFQA 1S60A 5J1QA 2XEJA 1WK4A 3EY5A 3WR7A 5I0CA 5K8OA 4NJQA 4CGLA 1TF8A 1XBUA 2PJ1A 1M4DA 4B12A 4NXYA 4UEZA 3SXOA 1L0CA 3BI0A 3PBBA 3FVLA 4X3RA 3GIUA 4XPLA 4ZY0A 4LUAA
chains in the Genus database with same CATH topology
4QVTA 1J4JA 4R3LA 2REEA 2GANA 4KOTA 2AE6A 1CJWA 2B4BA 3H5ZA 5G1ZA 5AG4A 3PP9A 4XNHC 2IL4A 3D2MA 4JXRA 1MK4A 1BO4A 3FYNA 3G8WA 1MJBA 4KLVA 1M1DA 1KZFA 3FRMA 2F5IA 4KVXA 4IF5A 4C2ZA 2ZW5A 2B3UA 3GKRA 2OU2A 1KUXA 2Q4YA 1SQHA 3KKWA 2ZW7A 4MHDA 2K5TA 2Q7BA 4C2XA 2Z3NA 5A27A 4R87A 5CNPA 4QUSA 1MJAA 5H86A 3CXQA 4B14A 3DDDA 5AG7A 4MFLA 4BMHA 4J3GA 4YGOA 2VI7A 2FT0A 4CYOA 1QSRA 3EXNA 1BOBA 2CY2A 4KSAA 2WUUA 3F5BA 2FE7A 2FIAA 4CAFA 3W6SA 2ARHA 2Z3LA 3FNCA 1S3ZA 3IWGA 3C26A 5HH1A 1KUYA 2PRBA 4UBRA 4AVAA 4PV6A 3V8IA 3ZJ0A 2B3VA 4UWIA 3NE7A 4HKFA 4UFXA 2VZYA 2WPXA 2VEZA 1I21A 4KVOE 2B5GB 2VXKA 2Z3OA 2FL4A 1NMTA 3QB8A 3R9FA 4Y49C 4UCMA 1YREA 3GYAA 1R57A 2B4DA 4MI4A 5F47A 3T90A 5J8CA 1IB1E 1P4NA 4ZBGA 5E96A 1I1DA 2VQYA 1PU9A 3ZZIA 1KUVA 5HMNA 2YNCC 4ZGYB 4XPKA 2GE3A 2OZUA 4R57A 4QBJA 4CGOA 4KSFA 5G21A 3VWEA 2OH1A 3DR6A 1YGHA 1QSMA 4LX9A 2R8VA 2FIWA 2O28A 4FD6A 3F0AA 4A30A 2G3AA 4B5OA 3D3SA 4C68A 2R1IA 4E0AA 3D2PA 1MJ9A 2H5MA 4Y49B 3R96A 4AG9A 2B5GA 2J8RA 3LODA 4KOVA 4AVCA 5KTDA 3S6GA 3CXSA 3TOAA 2HQYA 4K30A 4CAEA 2DXQA 3DSBA 5F48A 3TTHA 4M85A 4KOXA 2CNSA 2WPWA 4OLLA 1GHEA 1ZO0A 3PGPA 4IUSA 4KLWA 2ZXVA 1S7NA 4KUBA 4NEXA 3W6XA 2Z0ZA 4CGNA 3TOBA 1WWZA 4OAEA 2OB0A 3I9SA 4PK2A 3R9GA 3IWEA 3F8KA 2EVNA 5BWAB 5IX3A 2HV2A 1S7LA 1YX0A 2D4OA 4R9MA 4E8OA 3CXPA 2B4DB 2FXFA 3D8PA 2JLMA 4MFZA 3TO9A 2YGWA 3R95A 2EUIA 4UCPA 4RS2A 3P2HA 3TE4A 4AG7A 4B13A 4M3SA 2CXAA 2RC4A 4U9YA 4MY0A 1QSTA 2J8MA 4ORFA 1PUAA 4B10A 4CYPA 2BSWA 5H84A 4GS4A 2PQ8A 4U9ZA 2VBQA 3JVNA 5KTCA 4Q36A 4EVYA 4B5PB 4DNCA 2PDOA 1XE4A 3SXNA 4CRYB 4XNHB 5DWNA 2Z3KA 2Y0MA 3JTKA 2YNCA 4AB7A 3RYOA 2YNDA 4L89A 5AG6A 2X7BA 2REFA 3TO6A 2ATRA 2Q44A 4KOSA 5G22A 3FIXA 3EC4A 5AG5A 1VKCA 2VZZA 4U5YA 3PZJA 1FY7A 4E2AA 3I3GA 2PR8A 2J8NA 1M4GA 4R3KA 1RXTA 4FD7A 5JPHA 2C27A 4CRZB 2DPSA 3OWCA 1YVKA 2DPTA 2JEVA 4MJ8A 5JQ4A 4H89A 2Z11A 4HNWB 4PSXA 4UWJA 2Q4VA 4CYQA 2QIRA 2Z3MA 3S6KA 4CYNA 5ISVA 1YLEA 3P2FA 4FD5A 3S6HA 2PR1A 2CNMA 3FXTA 5F46A 5A28A 2HUZA 1Z4EA 2Q0YA 4A95A 4CGPA 4UA3A 1S7KA 4AVBA 4B5PA 4JLYA 4NSQA 2JDCA 2AJ6A 4A31A 5FVJA 3TO7A 2G3TA 1YK3A 4KOUA 4CGMA 1S7FA 1ON0A 4H6ZA 2G0BA 3BJ8A 2OZGA 5C82A 1QSNA 3TFYA 1P0HA 4B11A 4CAXA 4PSWA 4KVME 2YNEA 2P0WA 3UY5A 1Z9UA 3K9UA 3FBUA 1B6BA 4C7IA 2NMTA 3TCVA 4CS0B 4A2ZA 1IICA 1V0CA 4MFKA 4NCZA 2FS5A 2ZW6A 2B58A 3FB3A 1XEBA 4XPDC 2BUEA 4KOWA 4OADA 4F0YA 3E0KA 4MFPA 2P6FA 3EFAA 4KZTA 4YRHA 1NSLA 4YFJA 3IGRA 2OZHA 1YVOA 2ZW4A 4I49A 1YR0A 5C88A 3R1KA 4UFWA 3H4QA 5J8FA 5IB0A 4UFVA 4UCNA 5G20A 2ZPAA 4C7HA 3VWDA 1NE9A 4H6UA 3IU1A 4CAVA 2Z3PA 2Z10A 4MY3A 4PK3A 4MFQA 2Q04A 3A9LA 5DWMA 1VHSA 2D4PA 1M44A 4A32A 4MBUA 4XPDB 4F6AA 2R7HA 2BEIA 2P6GA 3BJ7A 1M4IA 4X5KA 1U6MA 3R9EA 4JJXA 2CNTA 5EC4A 1Y7RA 4KUAA 1I12A 5AGEA 4II9A 3JUWA 2R98A 4KOYA 2WSAA 2JDDA 4JWPA 3TT2A 3T9YA 2PC1A 2FSRA 1IYLA 2QECA 1XF8A 1TIQA 1QSOA 1Q2DA 1CM0A 5GCNA 4C2YA 4HNXB 1Q2CA 3B8GA 5IV0A 1XMTA 2QMLA 4Q38A 1S5KA 4ONUA 4JXQA 4CAWA 1IYKA 1OZPA 2GIVA 3DR8A 5EBVA 3QAHA 1B87A 1N71A 4BBHA 1LRZA 4L8AA 4RI1A 2I00A 4HNYB 4QB9A 1Y9KA 4MFJA 4QC6A 3G3SA 3LD2A 1RO5A 4NF1A 1XIXA 1Z4RA 3N7ZA 4FD4A 2PSWA 5KTAA 3SHPA 3IU2A 4F0XA 2P6EA 3EO4A 3DNSA 1Y9WA 5F49A 2I79A 2KCWA 3MGDA 1IIDA 3S6FA 2A4NA 3GY9A 4KS9A 1Q2YA 4KORA 4JD6A 4A33A 1K4JA 1UFHA 2FCKA 3W91A 2BL1A 3BLNA 1S60A 3WR7A 1WK4A 3EY5A 5I0CA 4CGLA 1M4DA 4B12A 4NXYA 3SXOA 1L0CA 4XPLA 4LUAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AGE A;  2YNE A;  4CGP A;  4UCM A;  2WSA A;  4A33 A;  4CAE A;  4BBH A;  4A30 A;  3H5Z A;  5G1Z A;  4A31 A;  4C2X A;  5A27 A;  3JTK A;  4A32 A;  2YNC A;  4UCP A;  4UFW A;  4C68 A;  4C7I A;  4B14 A;  4CGM A;  5AG7 A;  2YND A;  5AG4 A;  5AG6 A;  4CYN A;  4CYQ A;  4UFV A;  4A2Z A;  4CYO A;  4UCN A;  4B13 A;  4C2Y A;  4UFX A;  5G20 A;  2YNC C;  4CGL A;  5G22 A;  2WUU A;  4C7H A;  5AG5 A;  4B11 A;  4CGN A;  5A28 A;  3IU2 A;  4B12 A;  4CGO A;  3IU1 A;  4B10 A;  4CYP A;  4C2Z A;  4CAF A;  3IWE A;  5G21 A;  4A95 A; 
#chains in the Genus database with same CATH topology
 2O4H A;  4QVT A;  1J4J A;  4R3L A;  1FNO A;  4OC3 A;  2REE A;  2GAN A;  4KOT A;  3D7D A;  5LYI A;  2AE6 A;  1CJW A;  2B4B A;  5JH9 A;  3H5Z A;  5G1Z A;  5CBM A;  4BD9 A;  4PXE A;  5AG4 A;  1ZG7 A;  3FF3 A;  3PP9 A;  4ZYQ A;  4XNH C;  2IL4 A;  3D2M A;  2PE3 A;  3V38 A;  4UF4 A;  1YW6 A;  4JXR A;  4P4J A;  1MK4 A;  2EBJ A;  1VHO A;  1TKJ A;  1BO4 A;  3FYN A;  3G8W A;  1CPX A;  1MJB A;  4KLV A;  1M1D A;  4F9V A;  1KZF A;  3FRM A;  3B35 A;  1XOV A;  2F5I A;  2IMO A;  3I1U A;  4IF5 A;  2PIZ A;  2ZW5 A;  4KVX A;  1CP7 A;  2B3U A;  3SI1 A;  3SJF A;  3GKR A;  2OU2 A;  1KUX A;  2RB7 A;  1Y7E A;  2Q4Y A;  1SQH A;  3KKW A;  2V8D A;  2ZW7 A;  4MHD A;  2K5T A;  2Q7B A;  4C2X A;  2Z3N A;  3RAM A;  5A27 A;  4R87 A;  5CNP A;  4QUS A;  1MJA A;  5H86 A;  3CXQ A;  4B14 A;  3DDD A;  3LAC A;  4MFL A;  5AG7 A;  4ZX8 A;  2AFS A;  3B3T A;  4J3G A;  2VI7 A;  3LWU A;  2FT0 A;  3FEE A;  2OR4 A;  4YGO A;  1QSR A;  4CYO A;  3EXN A;  1BOB A;  2PCU A;  2CY2 A;  4KSA A;  2WUU A;  3F5B A;  4ZX9 A;  3SI0 A;  4ZY1 A;  3L2N A;  1R43 A;  2FE7 A;  2XEG A;  1CPS A;  2FIA A;  3B3V A;  1H8L A;  2ZEP A;  2ZEH A;  4MHZ A;  4CAF A;  2Q43 A;  3W6S A;  4NGQ A;  4EWT A;  1TF9 A;  2ARH A;  4C2Z A;  2Z3L A;  4A37 A;  5K8P A;  2CTC A;  3FNC A;  1S3Z A;  3IWG A;  3KL9 A;  1BPM A;  1FT7 A;  3RNZ A;  1IU8 A;  3C26 A;  5HH1 A;  1KUY A;  2PRB A;  4UBR A;  4AVA A;  4B6Z A;  4PV6 A;  3V8I A;  3ZJ0 A;  2BCO A;  4IK2 A;  2AFO A;  4ZY2 A;  3FEC A;  2B3V A;  4OKO A;  4UWI A;  3NE7 A;  4HKF A;  4UFX A;  3RO0 A;  2GLJ A;  4F8Z A;  2VZY A;  2WPX A;  2VEZ A;  1Z8L A;  5K8N A;  1I21 A;  4KVO E;  4OC5 A;  2B5G B;  2VXK A;  1YLO A;  3KAS A;  2Z3O A;  1TKF A;  2FL4 A;  1NMT A;  3GB0 A;  3QB8 A;  3R9F A;  4Y49 C;  2BO9 A;  4UCM A;  1YRE A;  3GYA A;  1R57 A;  4M6I A;  2PIY A;  4PPZ A;  2AFW A;  2B4D A;  4MI4 A;  5F47 A;  3SJE A;  3T90 A;  5J8C A;  1IB1 E;  1P4N A;  3HLP A;  4ZBG A;  1VGY A;  3NE8 A;  2IJZ A;  3CPX A;  5E96 A;  3D68 A;  1I1D A;  2VQY A;  1LAM A;  1PU9 A;  4ONW A;  3ZZI A;  1KUV A;  3RBU A;  5HMN A;  3KHX A;  2YNC C;  4R8F A;  1X10 A;  3KQX A;  4PQA A;  4XPK A;  4ZGY B;  2V8V A;  2GE3 A;  4GM5 A;  7CPA A;  3PB9 X;  2OZU A;  4R57 A;  4OIW A;  4BMH A;  4QBJ A;  4CGO A;  3B3S A;  1AYE A;  4KSF A;  4EFD A;  5G21 A;  3VWE A;  4FAI A;  2OH1 A;  1QSM A;  1YGH A;  1TXR A;  2ABZ A;  1JQG A;  3DR6 A;  2C6P A;  5D29 A;  4LX9 A;  4TNU A;  2R8V A;  2FIW A;  3NA6 A;  3D7F A;  2O28 A;  4FD6 A;  3CPA A;  3F0A A;  4A30 A;  2XEI A;  2G3A A;  2I3C A;  3ISZ A;  3NH5 A;  4X2T A;  4B5O A;  4NGP A;  2WYR A;  3D3S A;  3GLJ A;  4C68 A;  2R1I A;  4MCP A;  4KSI A;  4E0A A;  3D2P A;  1DTD A;  1CP6 A;  1MJ9 A;  4MXU A;  2H5M A;  3KQZ A;  3D4U A;  4Y49 B;  3R96 A;  2QYV A;  3FH4 A;  4AG9 A;  2B5G A;  2J8R A;  3LOD A;  4KOV A;  4AVC A;  4DYO A;  3B7I A;  2ANP A;  4DJL A;  2HC9 A;  2IQ6 A;  4NJR A;  4Z65 A;  5KTD A;  5HVF A;  2CIJ A;  3S6G A;  3SJX A;  3CXS A;  1OBR A;  4MHN A;  5LRJ A;  3TOA A;  4UIA A;  1XJO A;  2HQY A;  4K30 A;  4CAE A;  1ZG9 A;  2DXQ A;  3DSB A;  5F48 A;  2ODF A;  3TTH A;  4M85 A;  4KOX A;  2CNS A;  2WPW A;  4G1P A;  1HDQ A;  1Q7L A;  4OLL A;  1GHE A;  1VHE A;  4P6Y A;  3SI2 A;  5JM6 A;  1ZO0 A;  2HB6 A;  3B3C A;  3PGP A;  4IUS A;  1KWM A;  2ZXV A;  4KLW A;  1S7N A;  3BI1 A;  4MCQ A;  4KUB A;  4NEX A;  3W6X A;  3WT4 A;  2Z0Z A;  4CGN A;  5HVG A;  3TOB A;  1WWZ A;  1XRY A;  4NGS A;  3B3W A;  4OAE A;  4EME A;  5LYL A;  2OB0 A;  3CDX A;  3I9S A;  3IFE A;  3IIB A;  3F8K A;  3IWE A;  4PK2 A;  3R9G A;  1Z2L A;  1CG2 A;  1XMB A;  2EVN A;  1F2O A;  1ELM P;  5BWA B;  5IX3 A;  2HV2 A;  1S7L A;  1YX0 A;  2D4O A;  4R9M A;  5THW A;  4E8O A;  3CXP A;  2B4D B;  2FXF A;  3D8P A;  2JLM A;  3PB6 X;  4MFZ A;  3TO9 A;  2YGW A;  4WWV A;  3R95 A;  4BIN A;  3SJG A;  2C6G A;  2EUI A;  4UCP A;  2JBJ A;  4RS2 A;  3S9M A;  3P2H A;  4UEE A;  3TE4 A;  4AG7 A;  4B13 A;  4M3S A;  2CXA A;  2RC4 A;  4U9Y A;  4GXH A;  1CBX A;  4MY0 A;  1QST A;  2J8M A;  4ORF A;  4WJB A;  1PUA A;  4B10 A;  4CYP A;  2PJ2 A;  2BSW A;  1UWY A;  3WC6 A;  5H84 A;  4GS4 A;  2PQ8 A;  1TKH A;  4U9Z A;  2Q51 A;  2VBQ A;  3DGV A;  3JVN A;  4UEF A;  5HXD A;  3PB7 X;  5KTC A;  4Q36 A;  4MHY A;  5F09 A;  4OC0 A;  4EVY A;  4B5P B;  4IAV A;  4DNC A;  1PCA A;  2PDO A;  1XE4 A;  3SXN A;  4CRY B;  4PXB A;  4XNH B;  5DWN A;  2XEF A;  1IY7 A;  2Z3K A;  2Y0M A;  2ZOG A;  2YNC A;  3JTK A;  4AB7 A;  3BHX A;  3RYO A;  2YND A;  4L89 A;  2G9D A;  5AG6 A;  2X7B A;  2REF A;  3TO6 A;  1LFW A;  2ATR A;  2Q44 A;  2POK A;  3NH4 A;  4KOS A;  5G22 A;  3FIX A;  3EC4 A;  2PJ5 A;  5AG5 A;  1VKC A;  2VZZ A;  4U5Y A;  3PZJ A;  1FY7 A;  4IHM A;  3K2K A;  2CF4 A;  3MRU A;  1AMP A;  4E2A A;  3I3G A;  2J8N A;  1M4G A;  1VIX A;  1Z8W A;  2PR8 A;  3D67 A;  4R3K A;  4UIB A;  1RXT A;  4FD7 A;  1JWQ A;  5JPH A;  2C27 A;  4CRZ B;  2DPS A;  2EO8 A;  2F7V A;  3OWC A;  1YVK A;  3NH8 A;  2DPT A;  2JEV A;  4MJ8 A;  5JQ4 A;  4H89 A;  2Z11 A;  4HNW B;  4NGN A;  1ARL A;  2NSM A;  3PFO A;  4PSX A;  4UWJ A;  2Q4V A;  4M6H A;  2QIR A;  2Z3M A;  3S6K A;  4CYQ A;  4YWY A;  4CYN A;  3PFE A;  5ISV A;  4P4B A;  1YLE A;  5CPA A;  3P2F A;  4FD5 A;  3S6H A;  2PR1 A;  3S9L A;  2CNM A;  3FXT A;  2ZEN A;  5F46 A;  3B2Y A;  5A28 A;  1PYT B;  2HUZ A;  1LCP A;  1IOI A;  4MCS A;  1Z4E A;  2Q0Y A;  2JEW A;  4A95 A;  1X12 A;  4CGP A;  5JGF A;  5LYF A;  4UA3 A;  1S7K A;  4AVB A;  4B5P A;  3KR5 A;  2PJ6 A;  2C1C A;  4JLY A;  5D8N A;  4NSQ A;  1DE4 C;  2JDC A;  2AJ6 A;  3FED A;  4JYW A;  2ZEG A;  5FVJ A;  4P4E A;  3TO7 A;  4A31 A;  2G3T A;  1YK3 A;  4R7M A;  3TC8 A;  4KOU A;  4CGM A;  1S7F A;  1ON0 A;  4DUK A;  4H6Z A;  2G0B A;  3BJ8 A;  2OZG A;  4P4D A;  4R6T A;  2DEA A;  5C82 A;  1QSN A;  2PJA A;  5LRK A;  4PXC A;  3TFY A;  4OC4 A;  1P0H A;  4B11 A;  4CAX A;  4PSW A;  1R3N A;  4OC2 A;  4F9U A;  1Z8T A;  3GUX A;  3JRU A;  4KVM E;  3MN8 A;  3FX6 A;  2YNE A;  3LMS A;  4CPA A;  4ZI6 A;  2P0W A;  3UY5 A;  1Z9U A;  3K9U A;  2GLF A;  3FBU A;  1BPN A;  1CX8 A;  1B6B A;  1ZLH A;  3N5F A;  4C7I A;  2ZEF A;  2NMT A;  1YW4 A;  3TCV A;  4P45 A;  4CS0 B;  4A2Z A;  1IIC A;  1V0C A;  3KZW A;  4MFK A;  2AFZ A;  4NCZ A;  2FS5 A;  2ZW6 A;  4O23 A;  2B58 A;  3FB3 A;  4P4F A;  1XEB A;  3PB4 X;  4XPD C;  3CT9 A;  4A94 A;  2BUE A;  2V77 A;  4KOW A;  3IC1 A;  4JZ0 A;  4LQG A;  4OAD A;  4F0Y A;  3E0K A;  4TWE A;  2PVV A;  3BXM A;  4MFP A;  2ZED A;  4OID A;  1ELL P;  2P6F A;  4RUH A;  3EFA A;  2RFH A;  3T8W A;  3WC7 A;  4KZT A;  2JBK A;  4YRH A;  1AUG A;  4P10 A;  1NSL A;  4YFJ A;  3IGR A;  1GYT A;  2OZH A;  3D7G A;  1YVO A;  2ZW4 A;  6CPA A;  4I49 A;  3QAY A;  1YR0 A;  8CPA A;  2GRE A;  4MRI A;  1LOK A;  5C88 A;  4H2K A;  1Y0R A;  2DF5 A;  3HUV A;  3R1K A;  4UFW A;  2F8H A;  4A38 A;  3KGQ A;  3H4Q A;  4RN7 A;  5J8F A;  3D7H A;  5IB0 A;  4UFV A;  3FMC A;  4MHP A;  4UCN A;  1Z5R A;  5G20 A;  2ZPA A;  2PJC A;  3H8F A;  4C7H A;  1RTQ A;  3H8E A;  1F57 A;  3VWD A;  4FBE A;  1NE9 A;  3PEI A;  4H6U A;  1LAP A;  2PJ4 A;  3KI9 A;  3IU1 A;  1XFO A;  1A2Z A;  2OOT A;  3QNV A;  2V8H A;  4CAV A;  2Z3P A;  1QQ9 A;  2Z10 A;  4P44 A;  4MY3 A;  4PK3 A;  3CZX A;  4MFQ A;  1LAN A;  2ZEE A;  1Y0Y A;  2Q04 A;  3A9L A;  5DWM A;  1ZLI A;  2EWB A;  4FUU A;  1VHS A;  2D4P A;  2PJ9 A;  1M44 A;  1QMU A;  4A32 A;  4MBU A;  4XPD B;  1YSJ A;  2R7H A;  4F6A A;  3IEH A;  2PRQ A;  2BEI A;  2CTB A;  2P6G A;  1YME A;  2EK9 A;  2PJ3 A;  1M4I A;  3BJ7 A;  4K3N A;  4X5K A;  3VAT A;  1U6M A;  1HDU A;  3R9E A;  1YQE A;  2ZEL A;  1HEE A;  3D66 A;  2CNT A;  3H8G A;  4JJX A;  5EC4 A;  1EE3 P;  1Y7R A;  4KUA A;  5I4M A;  1I12 A;  5AGE A;  1BLL E;  2GU2 A;  4II9 A;  2Q7S A;  2R98 A;  3JUW A;  4KOY A;  2AFX A;  3VAR A;  4AXV A;  2WSA A;  2JDD A;  4JWP A;  3TT2 A;  3T9Y A;  2BOA A;  2PC1 A;  2FSR A;  4LQ6 A;  1IYL A;  3KHZ A;  3RZA A;  2QEC A;  1XF8 A;  1M4L A;  4OP4 A;  3IWW A;  5HVH A;  1TIQ A;  4YU9 A;  1ARM A;  3NFZ A;  3IO1 A;  1QSO A;  1Q2D A;  1CM0 A;  2NYQ A;  4P4I A;  4NGT A;  5GCN A;  4C2Y A;  2C6C A;  4HNX B;  4NFR A;  1Q2C A;  3B8G A;  4M6G A;  3V7Z A;  5IV0 A;  1XMT A;  2QML A;  4Q38 A;  2PJ0 A;  1S5K A;  2V8G A;  4ONU A;  4JXQ A;  2PVW A;  4CAW A;  3PRT A;  1IOF A;  2ZEO A;  1IYK A;  1OZP A;  3FJU A;  4HPS A;  2GIV A;  3DR8 A;  5EBV A;  4OC1 A;  1NSA A;  1Z8X A;  1B87 A;  1N71 A;  3PBE A;  3QAH A;  5LRG A;  4BBH A;  1F2P A;  1LRZ A;  2Q4Z A;  3PB8 X;  3TX8 A;  4FWU A;  2QVP A;  4L8A A;  4RI1 A;  2I00 A;  4HNY B;  4QB9 A;  1Y9K A;  4MFJ A;  3IJ3 A;  4QC6 A;  2AFU A;  5IB9 A;  3G3S A;  3LD2 A;  4W9Y A;  1ZG8 A;  4NGR A;  1RO5 A;  4NF1 A;  4Q7A A;  1XIX A;  3VH9 A;  3ISX A;  1Z4R A;  4X8I A;  3N7Z A;  4FD4 A;  2PSW A;  5KTA A;  3DLJ A;  2O53 A;  3IU2 A;  3SHP A;  4A39 A;  4NGM A;  2P6E A;  3EO4 A;  4F0X A;  3DNS A;  3KR4 A;  1Y9W A;  4PXD A;  5F49 A;  2I79 A;  2KCW A;  2VL1 A;  1IID A;  2WZN A;  3MGD A;  3S6F A;  4R76 A;  2A4N A;  3GY9 A;  4KS9 A;  3WC5 A;  1Q2Y A;  4MMO A;  4KOR A;  3WAB A;  4JD6 A;  4A33 A;  5ELY A;  4OME A;  2AFM A;  1K4J A;  1UFH A;  2ZEM A;  2ZOF A;  2PJB A;  2QJ8 A;  3K9T A;  5DS0 A;  3S9N A;  2PJ7 A;  2J9A A;  5EMI A;  2FCK A;  3W91 A;  2BL1 A;  5K8M A;  3BLN A;  2FVG A;  1IGB A;  1BAV A;  4MCR A;  5LYD A;  2PJ8 A;  2EK8 A;  2GFQ A;  1S60 A;  5J1Q A;  2XEJ A;  1WK4 A;  3EY5 A;  3WR7 A;  5I0C A;  5K8O A;  4NJQ A;  4CGL A;  1TF8 A;  1XBU A;  2PJ1 A;  1M4D A;  4B12 A;  4NXY A;  4UEZ A;  3SXO A;  1L0C A;  3BI0 A;  3PBB A;  3FVL A;  4X3R A;  3GIU A;  4XPL A;  4ZY0 A;  4LUA A; 
#chains in the Genus database with same CATH homology
 4QVT A;  1J4J A;  4R3L A;  2REE A;  2GAN A;  4KOT A;  2AE6 A;  1CJW A;  2B4B A;  3H5Z A;  5G1Z A;  5AG4 A;  3PP9 A;  4XNH C;  2IL4 A;  3D2M A;  4JXR A;  1MK4 A;  1BO4 A;  3FYN A;  3G8W A;  1MJB A;  4KLV A;  1M1D A;  1KZF A;  3FRM A;  2F5I A;  4KVX A;  4IF5 A;  4C2Z A;  2ZW5 A;  2B3U A;  3GKR A;  2OU2 A;  1KUX A;  2Q4Y A;  1SQH A;  3KKW A;  2ZW7 A;  4MHD A;  2K5T A;  2Q7B A;  4C2X A;  2Z3N A;  5A27 A;  4R87 A;  5CNP A;  4QUS A;  1MJA A;  5H86 A;  3CXQ A;  4B14 A;  3DDD A;  5AG7 A;  4MFL A;  4BMH A;  4J3G A;  4YGO A;  2VI7 A;  2FT0 A;  4CYO A;  1QSR A;  3EXN A;  1BOB A;  2CY2 A;  4KSA A;  2WUU A;  3F5B A;  2FE7 A;  2FIA A;  4CAF A;  3W6S A;  2ARH A;  2Z3L A;  3FNC A;  1S3Z A;  3IWG A;  3C26 A;  5HH1 A;  1KUY A;  2PRB A;  4UBR A;  4AVA A;  4PV6 A;  3V8I A;  3ZJ0 A;  2B3V A;  4UWI A;  3NE7 A;  4HKF A;  4UFX A;  2VZY A;  2WPX A;  2VEZ A;  1I21 A;  4KVO E;  2B5G B;  2VXK A;  2Z3O A;  2FL4 A;  1NMT A;  3QB8 A;  3R9F A;  4Y49 C;  4UCM A;  1YRE A;  3GYA A;  1R57 A;  2B4D A;  4MI4 A;  5F47 A;  3T90 A;  5J8C A;  1IB1 E;  1P4N A;  4ZBG A;  5E96 A;  1I1D A;  2VQY A;  1PU9 A;  3ZZI A;  1KUV A;  5HMN A;  2YNC C;  4ZGY B;  4XPK A;  2GE3 A;  2OZU A;  4R57 A;  4QBJ A;  4CGO A;  4KSF A;  5G21 A;  3VWE A;  2OH1 A;  3DR6 A;  1YGH A;  1QSM A;  4LX9 A;  2R8V A;  2FIW A;  2O28 A;  4FD6 A;  3F0A A;  4A30 A;  2G3A A;  4B5O A;  3D3S A;  4C68 A;  2R1I A;  4E0A A;  3D2P A;  1MJ9 A;  2H5M A;  4Y49 B;  3R96 A;  4AG9 A;  2B5G A;  2J8R A;  3LOD A;  4KOV A;  4AVC A;  5KTD A;  3S6G A;  3CXS A;  3TOA A;  2HQY A;  4K30 A;  4CAE A;  2DXQ A;  3DSB A;  5F48 A;  3TTH A;  4M85 A;  4KOX A;  2CNS A;  2WPW A;  4OLL A;  1GHE A;  1ZO0 A;  3PGP A;  4IUS A;  4KLW A;  2ZXV A;  1S7N A;  4KUB A;  4NEX A;  3W6X A;  2Z0Z A;  4CGN A;  3TOB A;  1WWZ A;  4OAE A;  2OB0 A;  3I9S A;  4PK2 A;  3R9G A;  3IWE A;  3F8K A;  2EVN A;  5BWA B;  5IX3 A;  2HV2 A;  1S7L A;  1YX0 A;  2D4O A;  4R9M A;  4E8O A;  3CXP A;  2B4D B;  2FXF A;  3D8P A;  2JLM A;  4MFZ A;  3TO9 A;  2YGW A;  3R95 A;  2EUI A;  4UCP A;  4RS2 A;  3P2H A;  3TE4 A;  4AG7 A;  4B13 A;  4M3S A;  2CXA A;  2RC4 A;  4U9Y A;  4MY0 A;  1QST A;  2J8M A;  4ORF A;  1PUA A;  4B10 A;  4CYP A;  2BSW A;  5H84 A;  4GS4 A;  2PQ8 A;  4U9Z A;  2VBQ A;  3JVN A;  5KTC A;  4Q36 A;  4EVY A;  4B5P B;  4DNC A;  2PDO A;  1XE4 A;  3SXN A;  4CRY B;  4XNH B;  5DWN A;  2Z3K A;  2Y0M A;  3JTK A;  2YNC A;  4AB7 A;  3RYO A;  2YND A;  4L89 A;  5AG6 A;  2X7B A;  2REF A;  3TO6 A;  2ATR A;  2Q44 A;  4KOS A;  5G22 A;  3FIX A;  3EC4 A;  5AG5 A;  1VKC A;  2VZZ A;  4U5Y A;  3PZJ A;  1FY7 A;  4E2A A;  3I3G A;  2PR8 A;  2J8N A;  1M4G A;  4R3K A;  1RXT A;  4FD7 A;  5JPH A;  2C27 A;  4CRZ B;  2DPS A;  3OWC A;  1YVK A;  2DPT A;  2JEV A;  4MJ8 A;  5JQ4 A;  4H89 A;  2Z11 A;  4HNW B;  4PSX A;  4UWJ A;  2Q4V A;  4CYQ A;  2QIR A;  2Z3M A;  3S6K A;  4CYN A;  5ISV A;  1YLE A;  3P2F A;  4FD5 A;  3S6H A;  2PR1 A;  2CNM A;  3FXT A;  5F46 A;  5A28 A;  2HUZ A;  1Z4E A;  2Q0Y A;  4A95 A;  4CGP A;  4UA3 A;  1S7K A;  4AVB A;  4B5P A;  4JLY A;  4NSQ A;  2JDC A;  2AJ6 A;  4A31 A;  5FVJ A;  3TO7 A;  2G3T A;  1YK3 A;  4KOU A;  4CGM A;  1S7F A;  1ON0 A;  4H6Z A;  2G0B A;  3BJ8 A;  2OZG A;  5C82 A;  1QSN A;  3TFY A;  1P0H A;  4B11 A;  4CAX A;  4PSW A;  4KVM E;  2YNE A;  2P0W A;  3UY5 A;  1Z9U A;  3K9U A;  3FBU A;  1B6B A;  4C7I A;  2NMT A;  3TCV A;  4CS0 B;  4A2Z A;  1IIC A;  1V0C A;  4MFK A;  4NCZ A;  2FS5 A;  2ZW6 A;  2B58 A;  3FB3 A;  1XEB A;  4XPD C;  2BUE A;  4KOW A;  4OAD A;  4F0Y A;  3E0K A;  4MFP A;  2P6F A;  3EFA A;  4KZT A;  4YRH A;  1NSL A;  4YFJ A;  3IGR A;  2OZH A;  1YVO A;  2ZW4 A;  4I49 A;  1YR0 A;  5C88 A;  3R1K A;  4UFW A;  3H4Q A;  5J8F A;  5IB0 A;  4UFV A;  4UCN A;  5G20 A;  2ZPA A;  4C7H A;  3VWD A;  1NE9 A;  4H6U A;  3IU1 A;  4CAV A;  2Z3P A;  2Z10 A;  4MY3 A;  4PK3 A;  4MFQ A;  2Q04 A;  3A9L A;  5DWM A;  1VHS A;  2D4P A;  1M44 A;  4A32 A;  4MBU A;  4XPD B;  4F6A A;  2R7H A;  2BEI A;  2P6G A;  3BJ7 A;  1M4I A;  4X5K A;  1U6M A;  3R9E A;  4JJX A;  2CNT A;  5EC4 A;  1Y7R A;  4KUA A;  1I12 A;  5AGE A;  4II9 A;  3JUW A;  2R98 A;  4KOY A;  2WSA A;  2JDD A;  4JWP A;  3TT2 A;  3T9Y A;  2PC1 A;  2FSR A;  1IYL A;  2QEC A;  1XF8 A;  1TIQ A;  1QSO A;  1Q2D A;  1CM0 A;  5GCN A;  4C2Y A;  4HNX B;  1Q2C A;  3B8G A;  5IV0 A;  1XMT A;  2QML A;  4Q38 A;  1S5K A;  4ONU A;  4JXQ A;  4CAW A;  1IYK A;  1OZP A;  2GIV A;  3DR8 A;  5EBV A;  3QAH A;  1B87 A;  1N71 A;  4BBH A;  1LRZ A;  4L8A A;  4RI1 A;  2I00 A;  4HNY B;  4QB9 A;  1Y9K A;  4MFJ A;  4QC6 A;  3G3S A;  3LD2 A;  1RO5 A;  4NF1 A;  1XIX A;  1Z4R A;  3N7Z A;  4FD4 A;  2PSW A;  5KTA A;  3SHP A;  3IU2 A;  4F0X A;  2P6E A;  3EO4 A;  3DNS A;  1Y9W A;  5F49 A;  2I79 A;  2KCW A;  3MGD A;  1IID A;  3S6F A;  2A4N A;  3GY9 A;  4KS9 A;  1Q2Y A;  4KOR A;  4JD6 A;  4A33 A;  1K4J A;  1UFH A;  2FCK A;  3W91 A;  2BL1 A;  3BLN A;  1S60 A;  3WR7 A;  1WK4 A;  3EY5 A;  5I0C A;  4CGL A;  1M4D A;  4B12 A;  4NXY A;  3SXO A;  1L0C A;  4XPL A;  4LUA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...