1YX0A

Solution structure of bacillus subtilis protein ysne: the northeast structural genomics consortium target sr220
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
151
structure length
151
Chain Sequence
MHIKIDDLTGRQVVSLVNEHLHSMTLMSPPESIHALGLEKLRGPEITFWSAWEGDELAGCGALKELDTRHGEIKSMRTSASHLRKGVAKQVLQHIIEEAEKRGYERLSLETGSMASFEPARKLYESFGFQYCEPFADYGEDPNSVFMTKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Bacillus subtilis Protein ysnE
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein ysnE
total genus 20
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yx0A00
1KUYA 3B8GA 3DR8A 4CAXA 2O28A 2HQYA 2CNTA 1YVOA 2HV2A 2J8MA 4KUAA 1XEBA 2I00A 4R87A 2Q4YA 3S6HA 1YREA 5EC4A 3TOAA 2Z0ZA 4L89A 1S7FA 3K9UA 4AVCA 2GE3A 4Y49B 2J8RA 3OWCA 2QMLA 2BUEA 3W6SA 3MGDA 1Z9UA 3DSBA 1NE9A 1P4NA 1MJ9A 4PSWA 3FXTA 3TO7A 1R57A 5F47A 3BJ8A 5C88A 4B5OA 4UA3A 3G3SA 3R96A 1J4JA 2VI7A 4DNCA 3DNSA 4KOYA 4XPKA 1VHSA 3S6GA 4MHDA 1MK4A 4XPDC 2Y0MA 1YR0A 2FIAA 4CS0B 3KKWA 4KORA 3NE7A 3RYOA 2QIRA 5I0CA 2R98A 1S7LA 2ZW6A 4UBRA 3T9YA 2VQYA 4NF1A 2VBQA 1Y7RA 2RC4A 5FVJA 4FD4A 1V0CA 2HUZA 2J8NA 2OU2A 5KTDA 4H89A 2ZW5A 4CAVA 4PK2A 3I3GA 4FD5A 1Y9KA 1KZFA 4II9A 2OB0A 4UWJA 4ONUA 4R9MA 2PR8A 4E2AA 4FD7A 1NMTA 2VXKA 1I12A 1Q2DA 2OH1A 3C26A 4OAEA 1P0HA 2P6EA 2PRBA 1ON0A 4LUAA 1M4DA 1IB1E 2B58A 1S7KA 2FE7A 4XPDB 1CJWA 4JLYA 5ISVA 1I1DA 4YRHA 3SXNA 2B3VA 1TIQA 4PK3A 3PZJA 2NMTA 3TO6A 4K30A 2Q0YA 3W91A 4L8AA 1MJBA 2Q7BA 3TT2A 4KLVA 3SXOA 3TTHA 1S5KA 5IB0A 2EUIA 2DXQA 1L0CA 1K4JA 1MJAA 4YGOA 2R8VA 1IIDA 2B5GA 4QVTA 2VZYA 3TFYA 2PDOA 3DR6A 3F8KA 4JXQA 5JQ4A 1Y9WA 1QSNA 4MJ8A 3CXQA 4QC6A 5H84A 2B4DB 4AG9A 2AJ6A 4QUSA 4NEXA 5F48A 2G3AA 2JDCA 3EC4A 1QSTA 2B5GB 4KVME 3D3SA 1M44A 4EVYA 1IYLA 2FIWA 2PC1A 2PQ8A 3R95A 3TCVA 3SHPA 3LODA 2VZZA 1XF8A 2R1IA 2ZPAA 3ZJ0A 1QSRA 2FCKA 4AB7A 3EO4A 3N7ZA 3R9EA 5C82A 4KOSA 2FSRA 2BL1A 4KUBA 4UWIA 4KOUA 5EBVA 2B3UA 4R3LA 4U9YA 4CRZB 3UY5A 2B4BA 2PR1A 5H86A 2K5TA 4U5YA 3P2FA 1S3ZA 4U9ZA 5CNPA 2CNSA 4KZTA 3R9GA 1NSLA 4OADA 4XNHC 1M1DA 3TO9A 1N71A 3PP9A 3P2HA 4IUSA 4MY0A 3CXSA 3R9FA 2EVNA 5HMNA 5E96A 1YLEA 2AE6A 2KCWA 2Q4VA 3GYAA 1I21A 2D4OA 2G3TA 2GANA 4HNWB 4E8OA 3S6KA 2WPXA 1S60A 4M3SA 2ARHA 2F5IA 1OZPA 2JDDA 3FYNA 4FD6A 4PV6A 1XIXA 1B6BA 5KTAA 3GKRA 3F5BA 1WK4A 4F0YA 4IF5A 2JEVA 4AVBA 3ZZIA 4J3GA 2A4NA 2REEA 5F46A 3FRMA 1QSMA 4CAWA 4KVXA 4JXRA 4CRYB 2Q44A 3FBUA 2CNMA 2X7BA 3E0KA 3EXNA 2Q04A 1YK3A 2REFA 1WWZA 1SQHA 1IICA 3TOBA 4R3KA 1VKCA 4XNHB 4R57A 4YFJA 4BMHA 4XPLA 4HNYB 3CXPA 4QB9A 3BJ7A 1FY7A 1Q2CA 2ATRA 3FNCA 4MY3A 3FB3A 3TE4A 1M4GA 1S7NA 1RXTA 4QBJA 2FT0A 2D4PA 2GIVA 4Y49C 3I9SA 5HH1A 5DWNA 3H4QA 2ZW7A 1BOBA 2Z11A 4LX9A 5IV0A 4OLLA 4F6AA 5J8FA 4NSQA 4MI4A 1Z4EA 2B4DA 1Z4RA 1UFHA 2OZGA 2WPWA 1M4IA 3V8IA 2R7HA 1YGHA 4NCZA 4ORFA 3D2MA 2H5MA 3QAHA 3QB8A 2ZW4A 4E0AA 3D2PA 5IX3A 1B87A 1KUVA 3WR7A 2C27A 2FXFA 1Q2YA 4AVAA 3VWDA 1PUAA 2OZHA 4JWPA 4M85A 5KTCA 5GCNA 3EY5A 4JD6A 4B5PB 3D8PA 2BEIA 4AG7A 4RI1A 3W6XA 4KOWA 4H6UA 1XE4A 3G8WA 4GS4A 1KUXA 4JJXA 4I49A 2Z10A 3T90A 2P6FA 5J8CA 4KOVA 3R1KA 3GY9A 3PGPA 4RS2A 1GHEA 1IYKA 3VWEA 4KLWA 2PSWA 3BLNA 3IWGA 4B5PA 3F0AA 1QSOA 1CM0A 2QECA 5JPHA 4PSXA 3JVNA 1PU9A 5DWMA 4X5KA 2IL4A 1YVKA 3EFAA 2P0WA 1U6MA 3DDDA 3S6FA 4HNXB 2CY2A 3FIXA 4H6ZA 1LRZA 2P6GA 4MBUA 5F49A 2VEZA 1YX0A 2BSWA 2G0BA 2OZUA 3JUWA 4NXYA 4ZBGA 3LD2A 2JLMA 3IGRA 4KOTA 1BO4A 1RO5A 4KOXA 2FS5A 4HKFA 4KVOE 2FL4A 1XMTA 2ZXVA 2I79A
chains in the Genus database with same CATH superfamily
5K8NA 3KHXA 4BBHA 1KUYA 3B8GA 4IAVA 3DR8A 3NA6A 5HXDA 4CAXA 2O28A 2HQYA 2CNTA 3T8WA 1X10A 1YVOA 1YSJA 2HV2A 2J8MA 2YGWA 2ZEGA 4P4FA 4PXBA 4KUAA 5A27A 2PVWA 2NYQA 1LOKA 1XEBA 2DPSA 2I00A 3PB7X 4GM5A 4LQ6A 4BD9A 4R87A 4ZX8A 4WJBA 1ARLA 2Q4YA 3IO1A 1YREA 2PVVA 4PXEA 5EC4A 2Z0ZA 3S6HA 4ZY2A 3TOAA 4L89A 3FEEA 1VGYA 1JQGA 1S7FA 2PJ3A 3K9UA 5LYLA 4AVCA 1BAVA 2GE3A 4MFZA 4F9UA 3H8GA 4CYPA 4Y49B 1XRYA 1Z8WA 3WC5A 3D7FA 2J8RA 4G1PA 4LQGA 2ZEMA 3D67A 3OWCA 4MCQA 1TXRA 2QMLA 4RN7A 2XEJA 4CGMA 2BUEA 2ZEEA 2OR4A 3W6SA 2AFUA 2PJ0A 2QYVA 2YNEA 3MGDA 4JZ0A 1Z9UA 2C1CA 1NE9A 1YW4A 2YNCC 3DSBA 1P4NA 1MJ9A 2GLJA 4MFJA 3WC6A 1ZG8A 4PSWA 3FXTA 1FT7A 1ZG9A 1LANA 3TO7A 1R57A 5F47A 3BJ8A 1PCAA 5C88A 4B5OA 4NGTA 4ZYQA 4WWVA 4P4DA 4NGSA 2QJ8A 4UA3A 3G3SA 3R96A 7CPAA 3JRUA 5D29A 1BLLE 1J4JA 4Q36A 3IC1A 2VI7A 3LWUA 1F57A 5I4MA 4DNCA 1CPSA 3B2YA 2EK9A 3DNSA 4KOYA 4AXVA 4XPKA 1VHSA 4X8IA 3S6GA 5IB9A 4HPSA 4MHDA 1Y7EA 1MK4A 4MHZA 4XPDC 1OBRA 2Y0MA 1YR0A 2FIAA 4CS0B 3KI9A 3KKWA 5HVHA 1YLOA 3WC7A 4CAFA 5HVGA 1IOFA 4KORA 3IWEA 3NE7A 3RYOA 2BOAA 2QIRA 3HLPA 3TX8A 3CDXA 2R98A 5I0CA 2PIYA 1S7LA 2ZW6A 4UBRA 3T9YA 2EO8A 2C6CA 3H8FA 2VQYA 4MHNA 4OKOA 4NF1A 1LCPA 2VBQA 4B10A 3KR5A 1Y7RA 2RC4A 3D4UA 4MHYA 4KSIA 4X2TA 4FBEA 3D68A 3FVLA 1LFWA 5FVJA 4FD4A 1V0CA 4CPAA 2HUZA 2J8NA 2JEWA 2OU2A 5KTDA 4H89A 2ZW5A 2WZNA 4OIDA 4PK2A 4CAVA 3I3GA 4FD5A 2ANPA 3SJEA 1Y9KA 2Q43A 4M6GA 2ZEHA 1KZFA 2EWBA 4II9A 2ABZA 3B3TA 2OB0A 4IK2A 4UWJA 4TWEA 4ONUA 4KS9A 4R9MA 4OC4A 2PR8A 3K2KA 4E2AA 1CP6A 1BPMA 4FD7A 2PE3A 4NFRA 1NMTA 1ZO0A 2ZOFA 2VXKA 1I12A 4MFPA 4MXUA 1Q2DA 3ISXA 2AFOA 3QAYA 2OH1A 2PJ4A 3KL9A 3C26A 4OAEA 1P0HA 2P6EA 2PRBA 1A2ZA 1ON0A 2ZEFA 4UIBA 3VARA 4LUAA 4NJQA 4PQAA 4Z65A 1ELLP 1M4DA 2Z3OA 1IB1E 5LYDA 1XJOA 2B58A 1S7KA 2FE7A 4XPDB 3VH9A 1CJWA 1Y0RA 4JLYA 5ISVA 4A94A 1I1DA 4YRHA 3SXNA 4ZY1A 2B3VA 2Q4ZA 2JBKA 2POKA 1TIQA 3NFZA 4PK3A 2PJBA 3B3CA 5G20A 3PZJA 3BI1A 2XEFA 2NMTA 3RBUA 4P44A 2PJ2A 1F2OA 3TO6A 4K30A 2Q0YA 3SI1A 3W91A 3IFEA 1CP7A 4L8AA 4F8ZA 1ZLIA 1MJBA 1PYTB 1ELMP 1Q7LA 2Q7BA 3TT2A 1CG2A 2ODFA 4KLVA 3SXOA 3K9TA 2PIZA 1YQEA 3TTHA 1S5KA 5IB0A 2EUIA 4GXHA 3SI2A 3IU1A 2DF5A 2DXQA 3NE8A 1L0CA 3KQXA 3CT9A 1VIXA 4MMOA 1K4JA 3B3SA 4OMEA 1MJAA 3IIBA 3D7HA 3FEDA 3KR4A 2Z3PA 2R8VA 4UCMA 4UFXA 4YGOA 1CPXA 1IIDA 4OC1A 4PXCA 3I1UA 4C2XA 2B5GA 4YWYA 5A28A 4QVTA 1ZLHA 1VHOA 2VZYA 4NGRA 4W9YA 3TFYA 2PDOA 5JM6A 5J1QA 4P4BA 3DR6A 2BCOA 3F8KA 4JXQA 3GIUA 5JQ4A 1Y9WA 2ZENA 1GYTA 4CAEA 1QSNA 4C68A 4MJ8A 3CXQA 3KZWA 4QC6A 5H84A 3IWWA 5CPAA 2B4DB 4AG9A 2WUUA 2AJ6A 4QUSA 1VHEA 4P4IA 4NEXA 5F48A 5HVFA 2G3AA 2AFSA 2PJ7A 3PEIA 4OC0A 2JDCA 2GREA 5AG5A 3EC4A 1QSTA 2B5GB 4OC2A 4Q38A 5LYIA 4KVME 2V8VA 3D3SA 5AG7A 1M44A 4EVYA 1IYLA 2FIWA 1FNOA 2PC1A 2PQ8A 4ONWA 3R95A 3TCVA 3SHPA 4K3NA 3NH5A 3LODA 2VZZA 4MCRA 3PB6X 1XF8A 1H8LA 2R1IA 2RFHA 2ZPAA 3ZJ0A 4A2ZA 4CGPA 2YNCA 4NGQA 1QSRA 2FCKA 3RNZA 4C7IA 2PJ5A 4CGOA 4F0XA 4AB7A 3EO4A 3N7ZA 3R9EA 5C82A 4KOSA 2FSRA 2C6PA 2BL1A 5G21A 1Z2LA 4KUBA 2HC9A 1QQ9A 4UWIA 3QNVA 4KOUA 5EBVA 1QMUA 4CGNA 4UCNA 2B3UA 4R3LA 4MCSA 5ELYA 4U9YA 2EBJA 1X12A 4CYNA 4CRZB 4PXDA 2B4BA 3UY5A 3B7IA 5JGFA 2PR1A 4NGMA 4R8FA 5H86A 8CPAA 2K5TA 4U5YA 4UEEA 3P2FA 1S3ZA 4U9ZA 2NSMA 3H8EA 5K8OA 5CNPA 4KSAA 1XBUA 2CNSA 2HB6A 4KZTA 3PFOA 3R9GA 4DJLA 1M4LA 4C2ZA 4MFQA 1NSLA 4PPZA 4OADA 5AG4A 4XNHC 2ZOGA 4Q7AA 1M1DA 3WT4A 3TO9A 4RUHA 3BXMA 1N71A 4C2YA 3PP9A 3RAMA 3SJXA 4A37A 1Z5RA 3DGVA 3P2HA 2DEAA 4IUSA 4MY0A 4YU9A 1DTDA 4BINA 3S9NA 2PRQA 3D7DA 3CXSA 2O53A 3R9FA 5K8MA 3RZAA 2EVNA 4FAIA 3PFEA 1TF8A 1XMBA 2AFZA 5HMNA 5E96A 2EK8A 2CTBA 1YLEA 2AE6A 2KCWA 2Q4VA 3GYAA 2GFQA 1IU8A 1I21A 4CYOA 2D4OA 2G3TA 1HDUA 2GANA 2XEIA 1EE3P 4HNWB 4E8OA 3S6KA 2WPXA 4OIWA 1S60A 4M3SA 2ARHA 2F5IA 1OZPA 2ZELA 3D7GA 4H2KA 3MRUA 2WSAA 2BO9A 2JDDA 3H5ZA 2Q51A 3FYNA 4FD6A 1LAMA 4PV6A 1XIXA 1B6BA 5KTAA 3GKRA 4UEFA 3F5BA 1WK4A 1Y0YA 3B3VA 4IF5A 4F0YA 4P10A 2JEVA 4AVBA 3ZZIA 2ZEDA 4J3GA 2A4NA 2REEA 4A31A 3KASA 5F46A 4EWTA 3NH8A 3FRMA 1Z8LA 1QSMA 3DLJA 2PJ9A 4P4EA 4CAWA 4B13A 4KVXA 3SJFA 4ZX9A 1IGBA 4JXRA 4B6ZA 4CRYB 3JTKA 4ZI6A 2Q44A 3FBUA 3B35A 2CNMA 2JBJA 2X7BA 3CPAA 3E0KA 3EXNA 1AMPA 4UF4A 2Q04A 3KQZA 4MRIA 1YK3A 2REFA 2AFMA 4UCPA 1WWZA 4B12A 4EMEA 4OP4A 1SQHA 2V8HA 4TNUA 1HDQA 2OOTA 3S9MA 1IICA 3TOBA 3GB0A 4R3KA 1TKFA 1VKCA 2PCUA 1TKHA 4XNHB 1Z8XA 4R57A 1BPNA 2PJ8A 4YFJA 3KHZA 4BMHA 4XPLA 4HNYB 3CXPA 6CPAA 4QB9A 4C7HA 3BJ7A 1FY7A 2IJZA 1AYEA 1Q2CA 2ATRA 3FNCA 3FB3A 4MY3A 5AGEA 4A38A 4CGLA 1NSAA 1LAPA 1M4GA 3GLJA 3PB4X 4OC5A 2Z3NA 3TE4A 4ZY0A 1S7NA 1RXTA 2ZEPA 1CBXA 5CBMA 3CPXA 4O23A 2CXAA 3FX6A 4QBJA 4B14A 2FT0A 3GUXA 2D4PA 2AFWA 4UFVA 2GIVA 2PJAA 3FF3A 3CZXA 3PRTA 4Y49C 3I9SA 3IJ3A 3FH4A 2IQ6A 3TC8A 3FMCA 5HH1A 5DWNA 4OC3A 2XEGA 2ZW7A 3H4QA 1BOBA 2Z11A 3BHXA 4LX9A 3ISZA 5IV0A 1TF9A 4OLLA 3LACA 3SJGA 4NGNA 3D66A 4F6AA 5J8FA 1R43A 4MI4A 4NSQA 1Z4EA 2F7VA 1TKJA 2B4DA 3PBBA 4R6TA 1Z4RA 1UFHA 2OZGA 2WPWA 2FVGA 2J9AA 2CIJA 4DUKA 3V7ZA 1M4IA 2QVPA 3V8IA 4DYOA 2R7HA 1HEEA 3MN8A 1YGHA 4NCZA 4B11A 4ORFA 3D2MA 3V38A 2WYRA 2H5MA 3QAHA 5F09A 3QB8A 2ZW4A 1R3NA 4MFKA 2DPTA 4UEZA 4NGPA 4X3RA 4E0AA 1F2PA 2Z3LA 3D2PA 3PBEA 1B87A 3IEHA 5IX3A 2PJ1A 2VL1A 1CX8A 1KUVA 1Z8TA 4R76A 3WR7A 2C27A 2FXFA 1Q2YA 4AVAA 5LRKA 2C6GA 4JYWA 3VWDA 3NH4A 4NJRA 1ARMA 1PUAA 4A30A 3PB9X 2AFXA 2OZHA 4JWPA 4M85A 5KTCA 5GCNA 4A39A 3EY5A 4JD6A 1YW6A 1RTQA 4B5PB 2ZEOA 3L2NA 3A9LA 1JWQA 3D8PA 2BEIA 2PJCA 4MFLA 4A32A 4AG7A 1YMEA 5LRGA 4RI1A 3W6XA 4P4JA 5K8PA 4EFDA 3S9LA 4KSFA 4KOWA 4H6UA 1XE4A 2RB7A 3WABA 4UIAA 2F8HA 3G8WA 2GLFA 4GS4A 4CYQA 3LMSA 5BWAB 1KUXA 4I49A 4JJXA 2Z10A 3T90A 2P6FA 4M6IA 5J8CA 4KOVA 3R1KA 3GY9A 1IOIA 3N5FA 3SI0A 3BI0A 3PGPA 4UFWA 4IHMA 4RS2A 1IYKA 1GHEA 3VWEA 4KLWA 2PSWA 3BLNA 3IWGA 4B5PA 3F0AA 4FUUA 4ZGYB 1QSOA 1CM0A 2QECA 4FWUA 5JPHA 4PSXA 3JVNA 1PU9A 5DWMA 5AG6A 5THWA 4P6YA 3IU2A 4X5KA 2IL4A 2PJ6A 1YVKA 2P0WA 1U6MA 3DDDA 2V77A 2V8GA 3EFAA 3KGQA 4HNXB 3S6FA 2Z3MA 3FECA 3PB8X 2CY2A 4F9VA 3FIXA 2YNDA 1XFOA 5G1ZA 4P45A 1AUGA 4H6ZA 1ZG7A 1LRZA 4A33A 2P6GA 4MBUA 5F49A 2VEZA 1YX0A 2BSWA 2G0BA 2O4HA 4MCPA 5G22A 2OZUA 3JUWA 4NXYA 4ZBGA 2V8DA 4MHPA 3VATA 5JH9A 1UWYA 3LD2A 2Q7SA 2G9DA 2JLMA 3HUVA 2Z3KA 3RO0A 3IGRA 4R7MA 2CF4A 1BO4A 1RO5A 4KOTA 1DE4C 5D8NA 4KOXA 2FS5A 1KWMA 4HKFA 4A95A 3FJUA 2CTCA 5EMIA 4M6HA 5LYFA 4KVOE 5LRJA 2GU2A 5DS0A 1XOVA 2FL4A 1IY7A 1XMTA 2ZXVA 2I79A 2IMOA 3B3WA 2I3CA
chains in the Genus database with same CATH topology
4BBHA 1KUYA 3B8GA 3DR8A 4CAXA 2O28A 2HQYA 2CNTA 1YVOA 2HV2A 2J8MA 2YGWA 4KUAA 5A27A 2DPSA 1XEBA 2I00A 4R87A 2Q4YA 3S6HA 1YREA 5EC4A 3TOAA 2Z0ZA 4L89A 1S7FA 3K9UA 4AVCA 4MFZA 2GE3A 4CYPA 4Y49B 2J8RA 3OWCA 2QMLA 4CGMA 2BUEA 3W6SA 2YNEA 3MGDA 1Z9UA 2YNCC 1NE9A 3DSBA 1P4NA 1MJ9A 4MFJA 4PSWA 3FXTA 3TO7A 1R57A 5F47A 3BJ8A 5C88A 4B5OA 4UA3A 3G3SA 3R96A 4Q36A 1J4JA 2VI7A 4DNCA 3DNSA 4KOYA 4XPKA 1VHSA 3S6GA 4MHDA 1MK4A 4XPDC 2Y0MA 1YR0A 2FIAA 4CS0B 3KKWA 4CAFA 4KORA 3IWEA 3NE7A 3RYOA 2QIRA 5I0CA 2R98A 1S7LA 2ZW6A 4UBRA 3T9YA 2VQYA 4NF1A 2VBQA 4B10A 1Y7RA 2RC4A 5FVJA 4FD4A 1V0CA 2HUZA 2J8NA 2OU2A 5KTDA 4H89A 2ZW5A 4CAVA 4PK2A 3I3GA 4FD5A 1Y9KA 1KZFA 4II9A 2OB0A 4UWJA 4ONUA 4KS9A 4R9MA 2PR8A 4E2AA 4FD7A 1NMTA 1ZO0A 4MFPA 2VXKA 1I12A 1Q2DA 2OH1A 3C26A 4OAEA 1P0HA 2P6EA 2PRBA 1ON0A 4LUAA 1M4DA 2Z3OA 1IB1E 2B58A 1S7KA 2FE7A 4XPDB 1CJWA 4JLYA 5ISVA 1I1DA 4YRHA 3SXNA 2B3VA 1TIQA 4PK3A 5G20A 3PZJA 2NMTA 3TO6A 4K30A 2Q0YA 3W91A 4L8AA 1MJBA 2Q7BA 3TT2A 4KLVA 3SXOA 3TTHA 1S5KA 5IB0A 2EUIA 3IU1A 2DXQA 1L0CA 1K4JA 1MJAA 4UFXA 4YGOA 4UCMA 2Z3PA 2R8VA 1IIDA 4C2XA 2B5GA 5A28A 4QVTA 2VZYA 3TFYA 2PDOA 3DR6A 3F8KA 4JXQA 5JQ4A 1Y9WA 4CAEA 1QSNA 4C68A 4MJ8A 3CXQA 4QC6A 5H84A 2B4DB 4AG9A 2WUUA 2AJ6A 4QUSA 4NEXA 5F48A 2G3AA 2JDCA 5AG5A 3EC4A 1QSTA 2B5GB 4Q38A 4KVME 3D3SA 5AG7A 1M44A 4EVYA 1IYLA 2FIWA 2PC1A 2PQ8A 3R95A 3TCVA 3SHPA 3LODA 2VZZA 4A2ZA 1XF8A 2R1IA 2ZPAA 3ZJ0A 4CGPA 2YNCA 1QSRA 2FCKA 4C7IA 4CGOA 4F0XA 4AB7A 3EO4A 3N7ZA 3R9EA 5C82A 4KOSA 2FSRA 2BL1A 5G21A 4KUBA 4UWIA 4KOUA 5EBVA 4CGNA 4UCNA 2B3UA 4R3LA 4U9YA 4CYNA 4CRZB 3UY5A 2B4BA 2PR1A 5H86A 2K5TA 4U5YA 3P2FA 1S3ZA 4U9ZA 5CNPA 4KSAA 2CNSA 4KZTA 3R9GA 4C2ZA 4MFQA 1NSLA 4OADA 5AG4A 4XNHC 1M1DA 3TO9A 1N71A 4C2YA 3PP9A 3P2HA 4IUSA 4MY0A 3CXSA 3R9FA 2EVNA 5HMNA 5E96A 1YLEA 2AE6A 2KCWA 2Q4VA 3GYAA 1I21A 4CYOA 2D4OA 2G3TA 2GANA 4HNWB 4E8OA 3S6KA 2WPXA 1S60A 4M3SA 2ARHA 2F5IA 1OZPA 2WSAA 2JDDA 3H5ZA 3FYNA 4FD6A 4PV6A 1XIXA 1B6BA 5KTAA 3GKRA 3F5BA 1WK4A 4F0YA 4IF5A 2JEVA 4AVBA 3ZZIA 4J3GA 2A4NA 2REEA 4A31A 5F46A 3FRMA 1QSMA 4CAWA 4B13A 4KVXA 4JXRA 4CRYB 3JTKA 2Q44A 3FBUA 2CNMA 2X7BA 3E0KA 3EXNA 2Q04A 1YK3A 2REFA 4UCPA 1WWZA 4B12A 1SQHA 1IICA 3TOBA 4R3KA 1VKCA 4XNHB 4R57A 4YFJA 4BMHA 4XPLA 4HNYB 3CXPA 4QB9A 4C7HA 3BJ7A 1FY7A 5AGEA 1Q2CA 2ATRA 3FNCA 4MY3A 3FB3A 4CGLA 3TE4A 1M4GA 2Z3NA 1S7NA 1RXTA 2CXAA 4QBJA 4B14A 2FT0A 2D4PA 4UFVA 2GIVA 4Y49C 3I9SA 5HH1A 5DWNA 3H4QA 2ZW7A 1BOBA 2Z11A 4LX9A 5IV0A 4OLLA 4F6AA 5J8FA 4NSQA 4MI4A 1Z4EA 2B4DA 1Z4RA 1UFHA 2OZGA 2WPWA 1M4IA 3V8IA 2R7HA 1YGHA 4NCZA 4B11A 4ORFA 3D2MA 2H5MA 3QAHA 3QB8A 2ZW4A 4MFKA 2DPTA 4E0AA 3D2PA 2Z3LA 5IX3A 1B87A 1KUVA 3WR7A 2C27A 2FXFA 1Q2YA 4AVAA 3VWDA 1PUAA 4A30A 2OZHA 4JWPA 4M85A 5KTCA 5GCNA 3EY5A 4JD6A 4B5PB 3A9LA 3D8PA 2BEIA 4MFLA 4A32A 4AG7A 4RI1A 3W6XA 4KSFA 4KOWA 4H6UA 1XE4A 3G8WA 4GS4A 4CYQA 5BWAB 1KUXA 4JJXA 4I49A 2Z10A 3T90A 2P6FA 5J8CA 4KOVA 3R1KA 3GY9A 3PGPA 4UFWA 4RS2A 1GHEA 1IYKA 3VWEA 4KLWA 2PSWA 3BLNA 3IWGA 4B5PA 3F0AA 4ZGYB 1QSOA 1CM0A 2QECA 5JPHA 4PSXA 3JVNA 1PU9A 5DWMA 5AG6A 3IU2A 4X5KA 2IL4A 1YVKA 3EFAA 2P0WA 1U6MA 3DDDA 3S6FA 4HNXB 2Z3MA 2CY2A 3FIXA 2YNDA 5G1ZA 4H6ZA 1LRZA 4A33A 2P6GA 4MBUA 5F49A 2VEZA 1YX0A 2BSWA 2G0BA 5G22A 2OZUA 3JUWA 4NXYA 4ZBGA 3LD2A 2JLMA 2Z3KA 3IGRA 4KOTA 1BO4A 1RO5A 4KOXA 2FS5A 4HKFA 4A95A 4KVOE 2FL4A 1XMTA 2ZXVA 2I79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KUY A;  3B8G A;  3DR8 A;  4CAX A;  2O28 A;  2HQY A;  2CNT A;  1YVO A;  2HV2 A;  2J8M A;  4KUA A;  1XEB A;  2I00 A;  4R87 A;  2Q4Y A;  3S6H A;  1YRE A;  5EC4 A;  3TOA A;  2Z0Z A;  4L89 A;  1S7F A;  3K9U A;  4AVC A;  2GE3 A;  4Y49 B;  2J8R A;  3OWC A;  2QML A;  2BUE A;  3W6S A;  3MGD A;  1Z9U A;  3DSB A;  1NE9 A;  1P4N A;  1MJ9 A;  4PSW A;  3FXT A;  3TO7 A;  1R57 A;  5F47 A;  3BJ8 A;  5C88 A;  4B5O A;  4UA3 A;  3G3S A;  3R96 A;  1J4J A;  2VI7 A;  4DNC A;  3DNS A;  4KOY A;  4XPK A;  1VHS A;  3S6G A;  4MHD A;  1MK4 A;  4XPD C;  2Y0M A;  1YR0 A;  2FIA A;  4CS0 B;  3KKW A;  4KOR A;  3NE7 A;  3RYO A;  2QIR A;  5I0C A;  2R98 A;  1S7L A;  2ZW6 A;  4UBR A;  3T9Y A;  2VQY A;  4NF1 A;  2VBQ A;  1Y7R A;  2RC4 A;  5FVJ A;  4FD4 A;  1V0C A;  2HUZ A;  2J8N A;  2OU2 A;  5KTD A;  4H89 A;  2ZW5 A;  4CAV A;  4PK2 A;  3I3G A;  4FD5 A;  1Y9K A;  1KZF A;  4II9 A;  2OB0 A;  4UWJ A;  4ONU A;  4R9M A;  2PR8 A;  4E2A A;  4FD7 A;  1NMT A;  2VXK A;  1I12 A;  1Q2D A;  2OH1 A;  3C26 A;  4OAE A;  1P0H A;  2P6E A;  2PRB A;  1ON0 A;  4LUA A;  1M4D A;  1IB1 E;  2B58 A;  1S7K A;  2FE7 A;  4XPD B;  1CJW A;  4JLY A;  5ISV A;  1I1D A;  4YRH A;  3SXN A;  2B3V A;  1TIQ A;  4PK3 A;  3PZJ A;  2NMT A;  3TO6 A;  4K30 A;  2Q0Y A;  3W91 A;  4L8A A;  1MJB A;  2Q7B A;  3TT2 A;  4KLV A;  3SXO A;  3TTH A;  1S5K A;  5IB0 A;  2EUI A;  2DXQ A;  1L0C A;  1K4J A;  1MJA A;  4YGO A;  2R8V A;  1IID A;  2B5G A;  4QVT A;  2VZY A;  3TFY A;  2PDO A;  3DR6 A;  3F8K A;  4JXQ A;  5JQ4 A;  1Y9W A;  1QSN A;  4MJ8 A;  3CXQ A;  4QC6 A;  5H84 A;  2B4D B;  4AG9 A;  2AJ6 A;  4QUS A;  4NEX A;  5F48 A;  2G3A A;  2JDC A;  3EC4 A;  1QST A;  2B5G B;  4KVM E;  3D3S A;  1M44 A;  4EVY A;  1IYL A;  2FIW A;  2PC1 A;  2PQ8 A;  3R95 A;  3TCV A;  3SHP A;  3LOD A;  2VZZ A;  1XF8 A;  2R1I A;  2ZPA A;  3ZJ0 A;  1QSR A;  2FCK A;  4AB7 A;  3EO4 A;  3N7Z A;  3R9E A;  5C82 A;  4KOS A;  2FSR A;  2BL1 A;  4KUB A;  4UWI A;  4KOU A;  5EBV A;  2B3U A;  4R3L A;  4U9Y A;  4CRZ B;  3UY5 A;  2B4B A;  2PR1 A;  5H86 A;  2K5T A;  4U5Y A;  3P2F A;  1S3Z A;  4U9Z A;  5CNP A;  2CNS A;  4KZT A;  3R9G A;  1NSL A;  4OAD A;  4XNH C;  1M1D A;  3TO9 A;  1N71 A;  3PP9 A;  3P2H A;  4IUS A;  4MY0 A;  3CXS A;  3R9F A;  2EVN A;  5HMN A;  5E96 A;  1YLE A;  2AE6 A;  2KCW A;  2Q4V A;  3GYA A;  1I21 A;  2D4O A;  2G3T A;  2GAN A;  4HNW B;  4E8O A;  3S6K A;  2WPX A;  1S60 A;  4M3S A;  2ARH A;  2F5I A;  1OZP A;  2JDD A;  3FYN A;  4FD6 A;  4PV6 A;  1XIX A;  1B6B A;  5KTA A;  3GKR A;  3F5B A;  1WK4 A;  4F0Y A;  4IF5 A;  2JEV A;  4AVB A;  3ZZI A;  4J3G A;  2A4N A;  2REE A;  5F46 A;  3FRM A;  1QSM A;  4CAW A;  4KVX A;  4JXR A;  4CRY B;  2Q44 A;  3FBU A;  2CNM A;  2X7B A;  3E0K A;  3EXN A;  2Q04 A;  1YK3 A;  2REF A;  1WWZ A;  1SQH A;  1IIC A;  3TOB A;  4R3K A;  1VKC A;  4XNH B;  4R57 A;  4YFJ A;  4BMH A;  4XPL A;  4HNY B;  3CXP A;  4QB9 A;  3BJ7 A;  1FY7 A;  1Q2C A;  2ATR A;  3FNC A;  4MY3 A;  3FB3 A;  3TE4 A;  1M4G A;  1S7N A;  1RXT A;  4QBJ A;  2FT0 A;  2D4P A;  2GIV A;  4Y49 C;  3I9S A;  5HH1 A;  5DWN A;  3H4Q A;  2ZW7 A;  1BOB A;  2Z11 A;  4LX9 A;  5IV0 A;  4OLL A;  4F6A A;  5J8F A;  4NSQ A;  4MI4 A;  1Z4E A;  2B4D A;  1Z4R A;  1UFH A;  2OZG A;  2WPW A;  1M4I A;  3V8I A;  2R7H A;  1YGH A;  4NCZ A;  4ORF A;  3D2M A;  2H5M A;  3QAH A;  3QB8 A;  2ZW4 A;  4E0A A;  3D2P A;  5IX3 A;  1B87 A;  1KUV A;  3WR7 A;  2C27 A;  2FXF A;  1Q2Y A;  4AVA A;  3VWD A;  1PUA A;  2OZH A;  4JWP A;  4M85 A;  5KTC A;  5GCN A;  3EY5 A;  4JD6 A;  4B5P B;  3D8P A;  2BEI A;  4AG7 A;  4RI1 A;  3W6X A;  4KOW A;  4H6U A;  1XE4 A;  3G8W A;  4GS4 A;  1KUX A;  4JJX A;  4I49 A;  2Z10 A;  3T90 A;  2P6F A;  5J8C A;  4KOV A;  3R1K A;  3GY9 A;  3PGP A;  4RS2 A;  1GHE A;  1IYK A;  3VWE A;  4KLW A;  2PSW A;  3BLN A;  3IWG A;  4B5P A;  3F0A A;  1QSO A;  1CM0 A;  2QEC A;  5JPH A;  4PSX A;  3JVN A;  1PU9 A;  5DWM A;  4X5K A;  2IL4 A;  1YVK A;  3EFA A;  2P0W A;  1U6M A;  3DDD A;  3S6F A;  4HNX B;  2CY2 A;  3FIX A;  4H6Z A;  1LRZ A;  2P6G A;  4MBU A;  5F49 A;  2VEZ A;  1YX0 A;  2BSW A;  2G0B A;  2OZU A;  3JUW A;  4NXY A;  4ZBG A;  3LD2 A;  2JLM A;  3IGR A;  4KOT A;  1BO4 A;  1RO5 A;  4KOX A;  2FS5 A;  4HKF A;  4KVO E;  2FL4 A;  1XMT A;  2ZXV A;  2I79 A; 
#chains in the Genus database with same CATH topology
 5K8N A;  3KHX A;  4BBH A;  1KUY A;  3B8G A;  4IAV A;  3DR8 A;  3NA6 A;  5HXD A;  4CAX A;  2O28 A;  2HQY A;  2CNT A;  3T8W A;  1X10 A;  1YVO A;  1YSJ A;  2HV2 A;  2J8M A;  2YGW A;  2ZEG A;  4P4F A;  4PXB A;  4KUA A;  5A27 A;  2PVW A;  2NYQ A;  1LOK A;  1XEB A;  2DPS A;  2I00 A;  3PB7 X;  4GM5 A;  4LQ6 A;  4BD9 A;  4R87 A;  4ZX8 A;  4WJB A;  1ARL A;  2Q4Y A;  3IO1 A;  1YRE A;  2PVV A;  4PXE A;  5EC4 A;  2Z0Z A;  3S6H A;  4ZY2 A;  3TOA A;  4L89 A;  3FEE A;  1VGY A;  1JQG A;  1S7F A;  2PJ3 A;  3K9U A;  5LYL A;  4AVC A;  1BAV A;  2GE3 A;  4MFZ A;  4F9U A;  3H8G A;  4CYP A;  4Y49 B;  1XRY A;  1Z8W A;  3WC5 A;  3D7F A;  2J8R A;  4G1P A;  4LQG A;  2ZEM A;  3D67 A;  3OWC A;  4MCQ A;  1TXR A;  2QML A;  4RN7 A;  2XEJ A;  4CGM A;  2BUE A;  2ZEE A;  2OR4 A;  3W6S A;  2AFU A;  2PJ0 A;  2QYV A;  2YNE A;  3MGD A;  4JZ0 A;  1Z9U A;  2C1C A;  1NE9 A;  1YW4 A;  2YNC C;  3DSB A;  1P4N A;  1MJ9 A;  2GLJ A;  4MFJ A;  3WC6 A;  1ZG8 A;  4PSW A;  3FXT A;  1FT7 A;  1ZG9 A;  1LAN A;  3TO7 A;  1R57 A;  5F47 A;  3BJ8 A;  1PCA A;  5C88 A;  4B5O A;  4NGT A;  4ZYQ A;  4WWV A;  4P4D A;  4NGS A;  2QJ8 A;  4UA3 A;  3G3S A;  3R96 A;  7CPA A;  3JRU A;  5D29 A;  1BLL E;  1J4J A;  4Q36 A;  3IC1 A;  2VI7 A;  3LWU A;  1F57 A;  5I4M A;  4DNC A;  1CPS A;  3B2Y A;  2EK9 A;  3DNS A;  4KOY A;  4AXV A;  4XPK A;  1VHS A;  4X8I A;  3S6G A;  5IB9 A;  4HPS A;  4MHD A;  1Y7E A;  1MK4 A;  4MHZ A;  4XPD C;  1OBR A;  2Y0M A;  1YR0 A;  2FIA A;  4CS0 B;  3KI9 A;  3KKW A;  5HVH A;  1YLO A;  3WC7 A;  4CAF A;  5HVG A;  1IOF A;  4KOR A;  3IWE A;  3NE7 A;  3RYO A;  2BOA A;  2QIR A;  3HLP A;  3TX8 A;  3CDX A;  2R98 A;  5I0C A;  2PIY A;  1S7L A;  2ZW6 A;  4UBR A;  3T9Y A;  2EO8 A;  2C6C A;  3H8F A;  2VQY A;  4MHN A;  4OKO A;  4NF1 A;  1LCP A;  2VBQ A;  4B10 A;  3KR5 A;  1Y7R A;  2RC4 A;  3D4U A;  4MHY A;  4KSI A;  4X2T A;  4FBE A;  3D68 A;  3FVL A;  1LFW A;  5FVJ A;  4FD4 A;  1V0C A;  4CPA A;  2HUZ A;  2J8N A;  2JEW A;  2OU2 A;  5KTD A;  4H89 A;  2ZW5 A;  2WZN A;  4OID A;  4PK2 A;  4CAV A;  3I3G A;  4FD5 A;  2ANP A;  3SJE A;  1Y9K A;  2Q43 A;  4M6G A;  2ZEH A;  1KZF A;  2EWB A;  4II9 A;  2ABZ A;  3B3T A;  2OB0 A;  4IK2 A;  4UWJ A;  4TWE A;  4ONU A;  4KS9 A;  4R9M A;  4OC4 A;  2PR8 A;  3K2K A;  4E2A A;  1CP6 A;  1BPM A;  4FD7 A;  2PE3 A;  4NFR A;  1NMT A;  1ZO0 A;  2ZOF A;  2VXK A;  1I12 A;  4MFP A;  4MXU A;  1Q2D A;  3ISX A;  2AFO A;  3QAY A;  2OH1 A;  2PJ4 A;  3KL9 A;  3C26 A;  4OAE A;  1P0H A;  2P6E A;  2PRB A;  1A2Z A;  1ON0 A;  2ZEF A;  4UIB A;  3VAR A;  4LUA A;  4NJQ A;  4PQA A;  4Z65 A;  1ELL P;  1M4D A;  2Z3O A;  1IB1 E;  5LYD A;  1XJO A;  2B58 A;  1S7K A;  2FE7 A;  4XPD B;  3VH9 A;  1CJW A;  1Y0R A;  4JLY A;  5ISV A;  4A94 A;  1I1D A;  4YRH A;  3SXN A;  4ZY1 A;  2B3V A;  2Q4Z A;  2JBK A;  2POK A;  1TIQ A;  3NFZ A;  4PK3 A;  2PJB A;  3B3C A;  5G20 A;  3PZJ A;  3BI1 A;  2XEF A;  2NMT A;  3RBU A;  4P44 A;  2PJ2 A;  1F2O A;  3TO6 A;  4K30 A;  2Q0Y A;  3SI1 A;  3W91 A;  3IFE A;  1CP7 A;  4L8A A;  4F8Z A;  1ZLI A;  1MJB A;  1PYT B;  1ELM P;  1Q7L A;  2Q7B A;  3TT2 A;  1CG2 A;  2ODF A;  4KLV A;  3SXO A;  3K9T A;  2PIZ A;  1YQE A;  3TTH A;  1S5K A;  5IB0 A;  2EUI A;  4GXH A;  3SI2 A;  3IU1 A;  2DF5 A;  2DXQ A;  3NE8 A;  1L0C A;  3KQX A;  3CT9 A;  1VIX A;  4MMO A;  1K4J A;  3B3S A;  4OME A;  1MJA A;  3IIB A;  3D7H A;  3FED A;  3KR4 A;  2Z3P A;  2R8V A;  4UCM A;  4UFX A;  4YGO A;  1CPX A;  1IID A;  4OC1 A;  4PXC A;  3I1U A;  4C2X A;  2B5G A;  4YWY A;  5A28 A;  4QVT A;  1ZLH A;  1VHO A;  2VZY A;  4NGR A;  4W9Y A;  3TFY A;  2PDO A;  5JM6 A;  5J1Q A;  4P4B A;  3DR6 A;  2BCO A;  3F8K A;  4JXQ A;  3GIU A;  5JQ4 A;  1Y9W A;  2ZEN A;  1GYT A;  4CAE A;  1QSN A;  4C68 A;  4MJ8 A;  3CXQ A;  3KZW A;  4QC6 A;  5H84 A;  3IWW A;  5CPA A;  2B4D B;  4AG9 A;  2WUU A;  2AJ6 A;  4QUS A;  1VHE A;  4P4I A;  4NEX A;  5F48 A;  5HVF A;  2G3A A;  2AFS A;  2PJ7 A;  3PEI A;  4OC0 A;  2JDC A;  2GRE A;  5AG5 A;  3EC4 A;  1QST A;  2B5G B;  4OC2 A;  4Q38 A;  5LYI A;  4KVM E;  2V8V A;  3D3S A;  5AG7 A;  1M44 A;  4EVY A;  1IYL A;  2FIW A;  1FNO A;  2PC1 A;  2PQ8 A;  4ONW A;  3R95 A;  3TCV A;  3SHP A;  4K3N A;  3NH5 A;  3LOD A;  2VZZ A;  4MCR A;  3PB6 X;  1XF8 A;  1H8L A;  2R1I A;  2RFH A;  2ZPA A;  3ZJ0 A;  4A2Z A;  4CGP A;  2YNC A;  4NGQ A;  1QSR A;  2FCK A;  3RNZ A;  4C7I A;  2PJ5 A;  4CGO A;  4F0X A;  4AB7 A;  3EO4 A;  3N7Z A;  3R9E A;  5C82 A;  4KOS A;  2FSR A;  2C6P A;  2BL1 A;  5G21 A;  1Z2L A;  4KUB A;  2HC9 A;  1QQ9 A;  4UWI A;  3QNV A;  4KOU A;  5EBV A;  1QMU A;  4CGN A;  4UCN A;  2B3U A;  4R3L A;  4MCS A;  5ELY A;  4U9Y A;  2EBJ A;  1X12 A;  4CYN A;  4CRZ B;  4PXD A;  2B4B A;  3UY5 A;  3B7I A;  5JGF A;  2PR1 A;  4NGM A;  4R8F A;  5H86 A;  8CPA A;  2K5T A;  4U5Y A;  4UEE A;  3P2F A;  1S3Z A;  4U9Z A;  2NSM A;  3H8E A;  5K8O A;  5CNP A;  4KSA A;  1XBU A;  2CNS A;  2HB6 A;  4KZT A;  3PFO A;  3R9G A;  4DJL A;  1M4L A;  4C2Z A;  4MFQ A;  1NSL A;  4PPZ A;  4OAD A;  5AG4 A;  4XNH C;  2ZOG A;  4Q7A A;  1M1D A;  3WT4 A;  3TO9 A;  4RUH A;  3BXM A;  1N71 A;  4C2Y A;  3PP9 A;  3RAM A;  3SJX A;  4A37 A;  1Z5R A;  3DGV A;  3P2H A;  2DEA A;  4IUS A;  4MY0 A;  4YU9 A;  1DTD A;  4BIN A;  3S9N A;  2PRQ A;  3D7D A;  3CXS A;  2O53 A;  3R9F A;  5K8M A;  3RZA A;  2EVN A;  4FAI A;  3PFE A;  1TF8 A;  1XMB A;  2AFZ A;  5HMN A;  5E96 A;  2EK8 A;  2CTB A;  1YLE A;  2AE6 A;  2KCW A;  2Q4V A;  3GYA A;  2GFQ A;  1IU8 A;  1I21 A;  4CYO A;  2D4O A;  2G3T A;  1HDU A;  2GAN A;  2XEI A;  1EE3 P;  4HNW B;  4E8O A;  3S6K A;  2WPX A;  4OIW A;  1S60 A;  4M3S A;  2ARH A;  2F5I A;  1OZP A;  2ZEL A;  3D7G A;  4H2K A;  3MRU A;  2WSA A;  2BO9 A;  2JDD A;  3H5Z A;  2Q51 A;  3FYN A;  4FD6 A;  1LAM A;  4PV6 A;  1XIX A;  1B6B A;  5KTA A;  3GKR A;  4UEF A;  3F5B A;  1WK4 A;  1Y0Y A;  3B3V A;  4IF5 A;  4F0Y A;  4P10 A;  2JEV A;  4AVB A;  3ZZI A;  2ZED A;  4J3G A;  2A4N A;  2REE A;  4A31 A;  3KAS A;  5F46 A;  4EWT A;  3NH8 A;  3FRM A;  1Z8L A;  1QSM A;  3DLJ A;  2PJ9 A;  4P4E A;  4CAW A;  4B13 A;  4KVX A;  3SJF A;  4ZX9 A;  1IGB A;  4JXR A;  4B6Z A;  4CRY B;  3JTK A;  4ZI6 A;  2Q44 A;  3FBU A;  3B35 A;  2CNM A;  2JBJ A;  2X7B A;  3CPA A;  3E0K A;  3EXN A;  1AMP A;  4UF4 A;  2Q04 A;  3KQZ A;  4MRI A;  1YK3 A;  2REF A;  2AFM A;  4UCP A;  1WWZ A;  4B12 A;  4EME A;  4OP4 A;  1SQH A;  2V8H A;  4TNU A;  1HDQ A;  2OOT A;  3S9M A;  1IIC A;  3TOB A;  3GB0 A;  4R3K A;  1TKF A;  1VKC A;  2PCU A;  1TKH A;  4XNH B;  1Z8X A;  4R57 A;  1BPN A;  2PJ8 A;  4YFJ A;  3KHZ A;  4BMH A;  4XPL A;  4HNY B;  3CXP A;  6CPA A;  4QB9 A;  4C7H A;  3BJ7 A;  1FY7 A;  2IJZ A;  1AYE A;  1Q2C A;  2ATR A;  3FNC A;  3FB3 A;  4MY3 A;  5AGE A;  4A38 A;  4CGL A;  1NSA A;  1LAP A;  1M4G A;  3GLJ A;  3PB4 X;  4OC5 A;  2Z3N A;  3TE4 A;  4ZY0 A;  1S7N A;  1RXT A;  2ZEP A;  1CBX A;  5CBM A;  3CPX A;  4O23 A;  2CXA A;  3FX6 A;  4QBJ A;  4B14 A;  2FT0 A;  3GUX A;  2D4P A;  2AFW A;  4UFV A;  2GIV A;  2PJA A;  3FF3 A;  3CZX A;  3PRT A;  4Y49 C;  3I9S A;  3IJ3 A;  3FH4 A;  2IQ6 A;  3TC8 A;  3FMC A;  5HH1 A;  5DWN A;  4OC3 A;  2XEG A;  2ZW7 A;  3H4Q A;  1BOB A;  2Z11 A;  3BHX A;  4LX9 A;  3ISZ A;  5IV0 A;  1TF9 A;  4OLL A;  3LAC A;  3SJG A;  4NGN A;  3D66 A;  4F6A A;  5J8F A;  1R43 A;  4MI4 A;  4NSQ A;  1Z4E A;  2F7V A;  1TKJ A;  2B4D A;  3PBB A;  4R6T A;  1Z4R A;  1UFH A;  2OZG A;  2WPW A;  2FVG A;  2J9A A;  2CIJ A;  4DUK A;  3V7Z A;  1M4I A;  2QVP A;  3V8I A;  4DYO A;  2R7H A;  1HEE A;  3MN8 A;  1YGH A;  4NCZ A;  4B11 A;  4ORF A;  3D2M A;  3V38 A;  2WYR A;  2H5M A;  3QAH A;  5F09 A;  3QB8 A;  2ZW4 A;  1R3N A;  4MFK A;  2DPT A;  4UEZ A;  4NGP A;  4X3R A;  4E0A A;  1F2P A;  2Z3L A;  3D2P A;  3PBE A;  1B87 A;  3IEH A;  5IX3 A;  2PJ1 A;  2VL1 A;  1CX8 A;  1KUV A;  1Z8T A;  4R76 A;  3WR7 A;  2C27 A;  2FXF A;  1Q2Y A;  4AVA A;  5LRK A;  2C6G A;  4JYW A;  3VWD A;  3NH4 A;  4NJR A;  1ARM A;  1PUA A;  4A30 A;  3PB9 X;  2AFX A;  2OZH A;  4JWP A;  4M85 A;  5KTC A;  5GCN A;  4A39 A;  3EY5 A;  4JD6 A;  1YW6 A;  1RTQ A;  4B5P B;  2ZEO A;  3L2N A;  3A9L A;  1JWQ A;  3D8P A;  2BEI A;  2PJC A;  4MFL A;  4A32 A;  4AG7 A;  1YME A;  5LRG A;  4RI1 A;  3W6X A;  4P4J A;  5K8P A;  4EFD A;  3S9L A;  4KSF A;  4KOW A;  4H6U A;  1XE4 A;  2RB7 A;  3WAB A;  4UIA A;  2F8H A;  3G8W A;  2GLF A;  4GS4 A;  4CYQ A;  3LMS A;  5BWA B;  1KUX A;  4I49 A;  4JJX A;  2Z10 A;  3T90 A;  2P6F A;  4M6I A;  5J8C A;  4KOV A;  3R1K A;  3GY9 A;  1IOI A;  3N5F A;  3SI0 A;  3BI0 A;  3PGP A;  4UFW A;  4IHM A;  4RS2 A;  1IYK A;  1GHE A;  3VWE A;  4KLW A;  2PSW A;  3BLN A;  3IWG A;  4B5P A;  3F0A A;  4FUU A;  4ZGY B;  1QSO A;  1CM0 A;  2QEC A;  4FWU A;  5JPH A;  4PSX A;  3JVN A;  1PU9 A;  5DWM A;  5AG6 A;  5THW A;  4P6Y A;  3IU2 A;  4X5K A;  2IL4 A;  2PJ6 A;  1YVK A;  2P0W A;  1U6M A;  3DDD A;  2V77 A;  2V8G A;  3EFA A;  3KGQ A;  4HNX B;  3S6F A;  2Z3M A;  3FEC A;  3PB8 X;  2CY2 A;  4F9V A;  3FIX A;  2YND A;  1XFO A;  5G1Z A;  4P45 A;  1AUG A;  4H6Z A;  1ZG7 A;  1LRZ A;  4A33 A;  2P6G A;  4MBU A;  5F49 A;  2VEZ A;  1YX0 A;  2BSW A;  2G0B A;  2O4H A;  4MCP A;  5G22 A;  2OZU A;  3JUW A;  4NXY A;  4ZBG A;  2V8D A;  4MHP A;  3VAT A;  5JH9 A;  1UWY A;  3LD2 A;  2Q7S A;  2G9D A;  2JLM A;  3HUV A;  2Z3K A;  3RO0 A;  3IGR A;  4R7M A;  2CF4 A;  1BO4 A;  1RO5 A;  4KOT A;  1DE4 C;  5D8N A;  4KOX A;  2FS5 A;  1KWM A;  4HKF A;  4A95 A;  3FJU A;  2CTC A;  5EMI A;  4M6H A;  5LYF A;  4KVO E;  5LRJ A;  2GU2 A;  5DS0 A;  1XOV A;  2FL4 A;  1IY7 A;  1XMT A;  2ZXV A;  2I79 A;  2IMO A;  3B3W A;  2I3C A; 
#chains in the Genus database with same CATH homology
 4BBH A;  1KUY A;  3B8G A;  3DR8 A;  4CAX A;  2O28 A;  2HQY A;  2CNT A;  1YVO A;  2HV2 A;  2J8M A;  2YGW A;  4KUA A;  5A27 A;  2DPS A;  1XEB A;  2I00 A;  4R87 A;  2Q4Y A;  3S6H A;  1YRE A;  5EC4 A;  3TOA A;  2Z0Z A;  4L89 A;  1S7F A;  3K9U A;  4AVC A;  4MFZ A;  2GE3 A;  4CYP A;  4Y49 B;  2J8R A;  3OWC A;  2QML A;  4CGM A;  2BUE A;  3W6S A;  2YNE A;  3MGD A;  1Z9U A;  2YNC C;  1NE9 A;  3DSB A;  1P4N A;  1MJ9 A;  4MFJ A;  4PSW A;  3FXT A;  3TO7 A;  1R57 A;  5F47 A;  3BJ8 A;  5C88 A;  4B5O A;  4UA3 A;  3G3S A;  3R96 A;  4Q36 A;  1J4J A;  2VI7 A;  4DNC A;  3DNS A;  4KOY A;  4XPK A;  1VHS A;  3S6G A;  4MHD A;  1MK4 A;  4XPD C;  2Y0M A;  1YR0 A;  2FIA A;  4CS0 B;  3KKW A;  4CAF A;  4KOR A;  3IWE A;  3NE7 A;  3RYO A;  2QIR A;  5I0C A;  2R98 A;  1S7L A;  2ZW6 A;  4UBR A;  3T9Y A;  2VQY A;  4NF1 A;  2VBQ A;  4B10 A;  1Y7R A;  2RC4 A;  5FVJ A;  4FD4 A;  1V0C A;  2HUZ A;  2J8N A;  2OU2 A;  5KTD A;  4H89 A;  2ZW5 A;  4CAV A;  4PK2 A;  3I3G A;  4FD5 A;  1Y9K A;  1KZF A;  4II9 A;  2OB0 A;  4UWJ A;  4ONU A;  4KS9 A;  4R9M A;  2PR8 A;  4E2A A;  4FD7 A;  1NMT A;  1ZO0 A;  4MFP A;  2VXK A;  1I12 A;  1Q2D A;  2OH1 A;  3C26 A;  4OAE A;  1P0H A;  2P6E A;  2PRB A;  1ON0 A;  4LUA A;  1M4D A;  2Z3O A;  1IB1 E;  2B58 A;  1S7K A;  2FE7 A;  4XPD B;  1CJW A;  4JLY A;  5ISV A;  1I1D A;  4YRH A;  3SXN A;  2B3V A;  1TIQ A;  4PK3 A;  5G20 A;  3PZJ A;  2NMT A;  3TO6 A;  4K30 A;  2Q0Y A;  3W91 A;  4L8A A;  1MJB A;  2Q7B A;  3TT2 A;  4KLV A;  3SXO A;  3TTH A;  1S5K A;  5IB0 A;  2EUI A;  3IU1 A;  2DXQ A;  1L0C A;  1K4J A;  1MJA A;  4UFX A;  4YGO A;  4UCM A;  2Z3P A;  2R8V A;  1IID A;  4C2X A;  2B5G A;  5A28 A;  4QVT A;  2VZY A;  3TFY A;  2PDO A;  3DR6 A;  3F8K A;  4JXQ A;  5JQ4 A;  1Y9W A;  4CAE A;  1QSN A;  4C68 A;  4MJ8 A;  3CXQ A;  4QC6 A;  5H84 A;  2B4D B;  4AG9 A;  2WUU A;  2AJ6 A;  4QUS A;  4NEX A;  5F48 A;  2G3A A;  2JDC A;  5AG5 A;  3EC4 A;  1QST A;  2B5G B;  4Q38 A;  4KVM E;  3D3S A;  5AG7 A;  1M44 A;  4EVY A;  1IYL A;  2FIW A;  2PC1 A;  2PQ8 A;  3R95 A;  3TCV A;  3SHP A;  3LOD A;  2VZZ A;  4A2Z A;  1XF8 A;  2R1I A;  2ZPA A;  3ZJ0 A;  4CGP A;  2YNC A;  1QSR A;  2FCK A;  4C7I A;  4CGO A;  4F0X A;  4AB7 A;  3EO4 A;  3N7Z A;  3R9E A;  5C82 A;  4KOS A;  2FSR A;  2BL1 A;  5G21 A;  4KUB A;  4UWI A;  4KOU A;  5EBV A;  4CGN A;  4UCN A;  2B3U A;  4R3L A;  4U9Y A;  4CYN A;  4CRZ B;  3UY5 A;  2B4B A;  2PR1 A;  5H86 A;  2K5T A;  4U5Y A;  3P2F A;  1S3Z A;  4U9Z A;  5CNP A;  4KSA A;  2CNS A;  4KZT A;  3R9G A;  4C2Z A;  4MFQ A;  1NSL A;  4OAD A;  5AG4 A;  4XNH C;  1M1D A;  3TO9 A;  1N71 A;  4C2Y A;  3PP9 A;  3P2H A;  4IUS A;  4MY0 A;  3CXS A;  3R9F A;  2EVN A;  5HMN A;  5E96 A;  1YLE A;  2AE6 A;  2KCW A;  2Q4V A;  3GYA A;  1I21 A;  4CYO A;  2D4O A;  2G3T A;  2GAN A;  4HNW B;  4E8O A;  3S6K A;  2WPX A;  1S60 A;  4M3S A;  2ARH A;  2F5I A;  1OZP A;  2WSA A;  2JDD A;  3H5Z A;  3FYN A;  4FD6 A;  4PV6 A;  1XIX A;  1B6B A;  5KTA A;  3GKR A;  3F5B A;  1WK4 A;  4F0Y A;  4IF5 A;  2JEV A;  4AVB A;  3ZZI A;  4J3G A;  2A4N A;  2REE A;  4A31 A;  5F46 A;  3FRM A;  1QSM A;  4CAW A;  4B13 A;  4KVX A;  4JXR A;  4CRY B;  3JTK A;  2Q44 A;  3FBU A;  2CNM A;  2X7B A;  3E0K A;  3EXN A;  2Q04 A;  1YK3 A;  2REF A;  4UCP A;  1WWZ A;  4B12 A;  1SQH A;  1IIC A;  3TOB A;  4R3K A;  1VKC A;  4XNH B;  4R57 A;  4YFJ A;  4BMH A;  4XPL A;  4HNY B;  3CXP A;  4QB9 A;  4C7H A;  3BJ7 A;  1FY7 A;  5AGE A;  1Q2C A;  2ATR A;  3FNC A;  4MY3 A;  3FB3 A;  4CGL A;  3TE4 A;  1M4G A;  2Z3N A;  1S7N A;  1RXT A;  2CXA A;  4QBJ A;  4B14 A;  2FT0 A;  2D4P A;  4UFV A;  2GIV A;  4Y49 C;  3I9S A;  5HH1 A;  5DWN A;  3H4Q A;  2ZW7 A;  1BOB A;  2Z11 A;  4LX9 A;  5IV0 A;  4OLL A;  4F6A A;  5J8F A;  4NSQ A;  4MI4 A;  1Z4E A;  2B4D A;  1Z4R A;  1UFH A;  2OZG A;  2WPW A;  1M4I A;  3V8I A;  2R7H A;  1YGH A;  4NCZ A;  4B11 A;  4ORF A;  3D2M A;  2H5M A;  3QAH A;  3QB8 A;  2ZW4 A;  4MFK A;  2DPT A;  4E0A A;  3D2P A;  2Z3L A;  5IX3 A;  1B87 A;  1KUV A;  3WR7 A;  2C27 A;  2FXF A;  1Q2Y A;  4AVA A;  3VWD A;  1PUA A;  4A30 A;  2OZH A;  4JWP A;  4M85 A;  5KTC A;  5GCN A;  3EY5 A;  4JD6 A;  4B5P B;  3A9L A;  3D8P A;  2BEI A;  4MFL A;  4A32 A;  4AG7 A;  4RI1 A;  3W6X A;  4KSF A;  4KOW A;  4H6U A;  1XE4 A;  3G8W A;  4GS4 A;  4CYQ A;  5BWA B;  1KUX A;  4JJX A;  4I49 A;  2Z10 A;  3T90 A;  2P6F A;  5J8C A;  4KOV A;  3R1K A;  3GY9 A;  3PGP A;  4UFW A;  4RS2 A;  1GHE A;  1IYK A;  3VWE A;  4KLW A;  2PSW A;  3BLN A;  3IWG A;  4B5P A;  3F0A A;  4ZGY B;  1QSO A;  1CM0 A;  2QEC A;  5JPH A;  4PSX A;  3JVN A;  1PU9 A;  5DWM A;  5AG6 A;  3IU2 A;  4X5K A;  2IL4 A;  1YVK A;  3EFA A;  2P0W A;  1U6M A;  3DDD A;  3S6F A;  4HNX B;  2Z3M A;  2CY2 A;  3FIX A;  2YND A;  5G1Z A;  4H6Z A;  1LRZ A;  4A33 A;  2P6G A;  4MBU A;  5F49 A;  2VEZ A;  1YX0 A;  2BSW A;  2G0B A;  5G22 A;  2OZU A;  3JUW A;  4NXY A;  4ZBG A;  3LD2 A;  2JLM A;  2Z3K A;  3IGR A;  4KOT A;  1BO4 A;  1RO5 A;  4KOX A;  2FS5 A;  4HKF A;  4A95 A;  4KVO E;  2FL4 A;  1XMT A;  2ZXV A;  2I79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...