1YX0A

Solution structure of bacillus subtilis protein ysne: the northeast structural genomics consortium target sr220
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
151
structure length
151
Chain Sequence
MHIKIDDLTGRQVVSLVNEHLHSMTLMSPPESIHALGLEKLRGPEITFWSAWEGDELAGCGALKELDTRHGEIKSMRTSASHLRKGVAKQVLQHIIEEAEKRGYERLSLETGSMASFEPARKLYESFGFQYCEPFADYGEDPNSVFMTKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein ysnE
publication title Solution Structure of Bacillus subtilis Protein ysnE
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
total genus 20
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yx0A00
4HNXB 2P6EA 2CNMA 1M1DA 3FYNA 2VXKA 4PSXA 4E0AA 1S7FA 1Z4RA 4AG7A 4Y49B 1J4JA 2JDCA 2PR1A 1Z9UA 4YGOA 3LD2A 1L0CA 1XMTA 2B4DB 5HH1A 4XPKA 1YR0A 4NF1A 2OZGA 3IWGA 1YGHA 2D4OA 3G3SA 3P2FA 3I9SA 5CNPA 3WR7A 3FBUA 4XPDC 2VBQA 5DWMA 2QIRA 2Q0YA 4CRYB 1R57A 1WK4A 4Y49C 1NMTA 4R57A 2OB0A 4KOUA 2Q4VA 2ZW7A 3FNCA 4MY3A 2Q44A 4BMHA 1Q2CA 4XNHB 1Q2YA 2G3AA 2PSWA 2RC4A 1BO4A 4UWJA 1MJBA 3EY5A 4NSQA 3EC4A 2FE7A 3D8PA 5IV0A 2VI7A 5H86A 3R1KA 4F0YA 3R95A 1Z4EA 1P4NA 1S7LA 4AVCA 2QMLA 4KLVA 3PZJA 4QB9A 5F46A 2JLMA 2Q7BA 1IYLA 4MBUA 2J8RA 5FVJA 3FRMA 4I49A 1M4GA 5DWNA 1S60A 4UWIA 2FSRA 2BUEA 2VQYA 3K9UA 5J8CA 1WWZA 2PQ8A 1RO5A 3PGPA 3S6GA 1XIXA 4FD6A 2R8VA 1CJWA 3SXOA 2FL4A 3CXPA 5ISVA 1OZPA 4F6AA 4K30A 4R3KA 3TE4A 1LRZA 4KOTA 2GIVA 1XEBA 4XPLA 2FT0A 4KLWA 2P0WA 2Q04A 4II9A 1SQHA 3D2MA 1M4IA 2REEA 1YLEA 4QBJA 1QSTA 4KVXA 3R9FA 2ARHA 4R87A 1NE9A 3S6FA 4U9YA 4H6UA 3FB3A 2FCKA 3GKRA 4ORFA 2VZYA 3BJ7A 1IYKA 2D4PA 4AVBA 3JUWA 3KKWA 1U6MA 4QC6A 3T9YA 1YK3A 5F49A 3SHPA 3W6XA 1XE4A 4XPDB 5KTCA 3DDDA 3EO4A 5KTDA 2ZW5A 4KOYA 4YRHA 3LODA 5JQ4A 1PU9A 2Z10A 5I0CA 4E2AA 2WPWA 4L89A 3F8KA 2OH1A 1KUXA 3TTHA 1B87A 4J3GA 4UA3A 1Q2DA 2ATRA 3T90A 4QUSA 4KUBA 3TOBA 2G0BA 1BOBA 1MJAA 3QB8A 2GANA 4KOWA 3F0AA 4OLLA 2PR8A 4E8OA 5HMNA 4ONUA 3D3SA 1MJ9A 2ZW6A 1RXTA 4M85A 3FIXA 3EXNA 3TO7A 5C82A 4CAWA 2HQYA 4HKFA 2H5MA 4ZBGA 3ZZIA 3R9GA 2CNSA 3TO6A 2I79A 1FY7A 1TIQA 1Y9WA 4MI4A 3S6KA 3C26A 4JLYA 4AB7A 3F5BA 4OAEA 5E96A 2QECA 2B3VA 4CAXA 4PK2A 3V8IA 2CY2A 4IF5A 2PRBA 2B5GB 2R7HA 1YX0A 2CNTA 4U5YA 1YVKA 4AG9A 4RS2A 2DXQA 4NXYA 3BLNA 2NMTA 4CRZB 4LX9A 1VHSA 2REFA 2ZW4A 4MHDA 1B6BA 3I3GA 4NCZA 3TO9A 1YVOA 1QSOA 1S7NA 2P6GA 2EUIA 2B3UA 4FD7A 5EC4A 2ZPAA 1I12A 4YFJA 1P0HA 4KVME 3SXNA 4JD6A 4KOSA 5H84A 2AE6A 4LUAA 3MGDA 3D2PA 3PP9A 2PDOA 1YREA 2Z11A 3EFAA 4B5OA 1XF8A 4R9MA 2JEVA 5F47A 1I1DA 4JXQA 4CAVA 5F48A 2FXFA 3R9EA 2P6FA 2R98A 3GYAA 5EBVA 3H4QA 3RYOA 5IB0A 1S7KA 1NSLA 1ON0A 5J8FA 2OZUA 2Y0MA 4L8AA 4OADA 2GE3A 3TOAA 2VZZA 2FIAA 3QAHA 1IB1E 4NEXA 5IX3A 2R1IA 4KOVA 5KTAA 4MY0A 1QSNA 1PUAA 4CS0B 4UBRA 4MJ8A 4U9ZA 2BEIA 2HUZA 1GHEA 2O28A 1Y9KA 4X5KA 2X7BA 3E0KA 2BSWA 3TFYA 4FD4A 1K4JA 2B5GA 2B58A 4M3SA 2OZHA 3VWEA 3DNSA 3OWCA 1QSRA 3IGRA 2Q4YA 4AVAA 3FXTA 1CM0A 4PK3A 3BJ8A 3NE7A 4IUSA 2C27A 3DR8A 3W91A 4DNCA 2I00A 4HNWB 2HV2A 1KUYA 4KZTA 3TT2A 1MK4A 1KZFA 2IL4A 2JDDA 2J8MA 2Z0ZA 4KORA 4B5PA 4PV6A 1IICA 4EVYA 1UFHA 3P2HA 2F5IA 5JPHA 4H6ZA 3GY9A 4R3LA 4KVOE 1N71A 2OU2A 3B8GA 4HNYB 4GS4A 3ZJ0A 2ZXVA 3DSBA 2J8NA 3JVNA 4XNHC 2KCWA 4KUAA 1IIDA 3DR6A 4QVTA 2BL1A 1S3ZA 2VEZA 3S6HA 4JXRA 2FIWA 3CXSA 4KOXA 1QSMA 3R96A 3TCVA 4H89A 4B5PB 2AJ6A 1S5KA 5C88A 1M44A 4FD5A 4PSWA 3UY5A 4JJXA 2G3TA 1KUVA 1Y7RA 1V0CA 4RI1A 2EVNA 3N7ZA 2A4NA 2B4DA 2K5TA 2WPXA 2FS5A 1M4DA 2B4BA 3VWDA 1I21A 3G8WA 3W6SA 3CXQA 2PC1A 1VKCA 4JWPA 5GCNA
chains in the Genus database with same CATH superfamily
4HNXB 1IU8A 2P6EA 2WZNA 2CNMA 2PJCA 1M1DA 4C68A 3FYNA 2VXKA 4PSXA 4E0AA 1S7FA 3H8EA 3IO1A 3NA6A 1Z4RA 2RFHA 3D4UA 4K3NA 4MHPA 3S9LA 1IOIA 3SI2A 4AG7A 4UEZA 1KWMA 1J4JA 1VIXA 2JDCA 2JBKA 3MRUA 1TKHA 4Y49B 4FAIA 2PR1A 4Z65A 4MCSA 8CPAA 1Z9UA 3CPAA 2CTBA 4YGOA 2J9AA 1LCPA 2V8GA 4JYWA 3LD2A 1L0CA 5G20A 1M4LA 3RAMA 1XMTA 2B4DB 5HH1A 1HDUA 4RN7A 4XPKA 4A30A 2VL1A 1YR0A 4NF1A 2OZGA 2JBJA 3IWGA 4ZX9A 1YGHA 1TXRA 5G22A 2D4OA 3G3SA 4CGMA 1ELMP 3P2FA 3CPXA 3I9SA 5CNPA 3WR7A 3FBUA 4XPDC 1LAMA 1TKJA 3NFZA 4UEEA 2NYQA 2VBQA 2OR4A 2PVVA 3KQXA 5DWMA 2QIRA 2Q0YA 4LQGA 4CRYB 2PJ2A 4A39A 1R57A 1CP6A 1WK4A 4CGPA 5F09A 4OC4A 4Y49C 3D7DA 4C2ZA 1NMTA 4R57A 2OB0A 4KOUA 4B13A 2Q4VA 1Y0YA 2ZW7A 3FNCA 4MY3A 2DPSA 5LRKA 4AXVA 2Q44A 2IQ6A 4W9YA 3GLJA 1ZO0A 4BMHA 1Q2CA 4XNHB 1Q2YA 2ZOFA 2G3AA 2PSWA 2RC4A 3SJEA 3FECA 2DEAA 1BO4A 2PE3A 4UWJA 1MJBA 3EY5A 4MCPA 4Q7AA 4NSQA 3EC4A 5LRGA 1F57A 3PB9X 4B12A 2FE7A 4IHMA 2GFQA 3D8PA 3WT4A 5IV0A 2VI7A 3RZAA 5THWA 5H86A 4X3RA 3R1KA 4F0YA 3CZXA 1QMUA 2QJ8A 1Z4EA 3R95A 1P4NA 1S7LA 4AVCA 2QMLA 4KLVA 4DYOA 3B2YA 3PZJA 3QAYA 4QB9A 1XOVA 4Q36A 4P10A 2Z3NA 4GM5A 2JLMA 5F46A 2Q7BA 3PB6X 3JTKA 1CPSA 4B6ZA 4C7HA 1ARMA 1IYLA 4CAEA 2AFSA 2ZEFA 4MBUA 2WYRA 4NGPA 2J8RA 1NSAA 3FRMA 5FVJA 4I49A 1M4GA 2QVPA 1Z8TA 5DWNA 1S60A 3D68A 4UWIA 2FSRA 2Z3OA 2BUEA 3IEHA 4P4EA 2VQYA 4OIDA 3K9UA 4OC5A 5J8CA 1WWZA 2JEWA 2PQ8A 1ZG8A 2PVWA 1RO5A 2ZEGA 5HVHA 2CTCA 1RTQA 4NGTA 3PGPA 3S6GA 4MFPA 1XIXA 4FD6A 2R8VA 1CJWA 2FVGA 3SXOA 2FL4A 3CXPA 3T8WA 4A38A 5ISVA 1OZPA 2EWBA 2PIZA 4K30A 4F6AA 4R3KA 2ZEPA 3TE4A 1LRZA 5K8OA 4Q38A 4KOTA 2F8HA 2GIVA 2ZENA 1XEBA 3PFOA 4P44A 4XPLA 1PCAA 2DPTA 2FT0A 4KLWA 4CPAA 5K8MA 1PYTB 2P0WA 3B3SA 2Q04A 3KR4A 4II9A 1SQHA 1Z8XA 3D2MA 1M4IA 2REEA 3PEIA 4OMEA 1YLEA 1CP7A 1QSTA 3WC6A 4QBJA 1Z2LA 4KVXA 4MHNA 1JWQA 3NH4A 4MFJA 3R9FA 2ARHA 1DE4C 4R87A 1NE9A 3PRTA 3IU1A 2V8VA 4H6UA 4PXEA 3FB3A 4PXDA 4U9YA 3S6FA 1ELLP 2FCKA 1CBXA 3KR5A 3GKRA 3NE8A 4TNUA 2ZEOA 1VGYA 2O53A 2XEFA 4ORFA 1FT7A 2GU2A 2VZYA 4IAVA 3WABA 1IGBA 3BJ7A 1IYKA 2D4PA 4AVBA 3JUWA 2AFMA 3KKWA 1U6MA 4QC6A 3T9YA 2ABZA 1YK3A 5F49A 1HDQA 3ISXA 3SHPA 2PJAA 3KZWA 3W6XA 1XE4A 1TKFA 2ZELA 4XPDB 3PBEA 5KTCA 3DDDA 3KL9A 3EO4A 2AFZA 3LWUA 4F9VA 5KTDA 1YLOA 2V8DA 2ZW5A 4KOYA 4YRHA 2WSAA 1ARLA 2O4HA 4M6GA 3LODA 3IIBA 5JQ4A 1PU9A 1Y0RA 3LACA 3ISZA 2Z10A 1ZG7A 2PIYA 4MCRA 5CPAA 2WPWA 4E2AA 5I0CA 4L89A 4MXUA 4LQ6A 3SI0A 3F8KA 2OH1A 1KUXA 2ZEDA 1EE3P 4PXCA 3TTHA 1B87A 2IMOA 4J3GA 4UA3A 1Q2DA 2ATRA 3KASA 5EMIA 4EMEA 3T90A 3SJGA 5K8PA 2Q7SA 4QUSA 4WWVA 4GXHA 1LANA 4NJQA 4PXBA 4KUBA 3PBBA 3TOBA 3MN8A 3FVLA 1CG2A 3A9LA 4MFQA 4A32A 2G0BA 4BBHA 2PJ8A 5HVGA 1BOBA 3BI0A 1MJAA 3QB8A 4R8FA 2GANA 2PCUA 2QYVA 4KOWA 4MFZA 1FNOA 3KQZA 2Z3KA 3S9MA 2ZEEA 3CT9A 3F0AA 4OLLA 2PR8A 5LYLA 3PB7X 1BAVA 3BHXA 4E8OA 3RNZA 4NGNA 4C7IA 3BXMA 1ZLHA 3FH4A 4ONUA 2CXAA 1TF9A 4P4FA 3D3SA 5IB9A 1LFWA 2PJ0A 1MJ9A 2ZW6A 1RXTA 5D8NA 4M85A 3FIXA 2Z3LA 3EXNA 3TO7A 2WUUA 2GLFA 3KHZA 5C82A 4CAWA 2HQYA 3IC1A 4HKFA 4A37A 2C1CA 2H5MA 4R6TA 4X8IA 1QQ9A 2PJ9A 3S9NA 1Q7LA 4ZBGA 1X10A 4MFLA 3ZZIA 5HXDA 3R9GA 4NGMA 1CX8A 2CNSA 4YWYA 3TO6A 5D29A 2I79A 4P4JA 4KSAA 1FY7A 2Z3MA 2AFXA 2CIJA 5G21A 1TIQA 1Y9WA 4O23A 3N5FA 4MI4A 1HEEA 2PJ5A 3S6KA 2HC9A 4F8ZA 3C26A 4JLYA 4AB7A 3F5BA 4OAEA 6CPAA 5E96A 2QECA 2B3VA 2I3CA 4CAXA 4PK2A 3LMSA 4OKOA 4P6YA 2F7VA 4MCQA 3KHXA 3GB0A 3V8IA 2DF5A 4ZGYB 4ZI6A 2CY2A 4IF5A 2BOAA 4B14A 2PRBA 2B5GB 2R7HA 1YX0A 4P45A 2CNTA 4U5YA 3FEDA 1YVKA 4AG9A 4RS2A 2DXQA 2Q4ZA 1XFOA 2V8HA 3FJUA 4UIAA 4NXYA 3BLNA 4A33A 2NMTA 4F9UA 5HMNA 4ONWA 1VHEA 3H5ZA 1YQEA 4OC1A 2Z3PA 4CRZB 4UFVA 4LX9A 5JM6A 1VHSA 2REFA 2ZW4A 4UCPA 1R3NA 2AFOA 2G9DA 4MHDA 4UIBA 4TWEA 1B6BA 3I3GA 4NCZA 3TO9A 3IFEA 3IJ3A 4CYOA 3GIUA 1YVOA 4JZ0A 2ZEHA 1QSOA 3GUXA 1S7NA 3V38A 2P6GA 2EUIA 4WJBA 1CPXA 1YSJA 2B3UA 3JRUA 4FD7A 1XBUA 1TF8A 5EC4A 2ZPAA 1I12A 3KGQA 1XRYA 1R43A 4YFJA 1P0HA 4OC0A 4KVME 4FBEA 2OOTA 4UF4A 4CGOA 3CDXA 3SXNA 4M6IA 2YGWA 4JD6A 4KOSA 3FEEA 4P4IA 5H84A 2AE6A 4LUAA 1DTDA 3MGDA 3D2PA 4MHYA 3K9TA 2XEIA 3PP9A 2PDOA 1YREA 2Z11A 3EFAA 4B5OA 1XF8A 4R9MA 2JEVA 5F47A 1I1DA 3RBUA 2HB6A 4JXQA 4CAVA 3QNVA 5LRJA 4CAFA 5F48A 2BO9A 2FXFA 4PPZA 3R9EA 3TC8A 2P6FA 3V7ZA 2BCOA 2R98A 3GYAA 4NJRA 3D7FA 4UFWA 5EBVA 3H4QA 1OBRA 4OP4A 2PJ1A 3RYOA 5IB0A 3H8GA 1F2PA 1S7KA 1NSLA 1ON0A 5J8FA 2OZUA 3IWWA 2Y0MA 4L8AA 4OADA 1BLLE 3IWEA 3D66A 4A94A 2EK9A 1BPMA 2GE3A 3BI1A 3TOAA 4KSFA 2VZZA 5ELYA 4C2YA 2FIAA 3HLPA 3QAHA 1IB1E 4NEXA 2XEJA 5IX3A 2R1IA 4KOVA 5KTAA 4A2ZA 4MY0A 2V77A 1A2ZA 3VATA 1QSNA 4H2KA 3IU2A 1PUAA 3VH9A 4R7MA 4KSIA 4NFRA 4CS0B 4B10A 2EBJA 4M6HA 4UBRA 4MJ8A 3FX6A 4MHZA 4U9ZA 2BEIA 2HUZA 1GHEA 2O28A 2YNCC 3B3VA 5AG4A 4C2XA 1Y9KA 4X5KA 2AFUA 1XJOA 2X7BA 5JH9A 1VHOA 3RO0A 3WC5A 5LYIA 3E0KA 2BSWA 3B3CA 2CF4A 3TFYA 3D67A 4FD4A 1K4JA 4ZY1A 5AGEA 4A95A 2B5GA 1YW4A 3B3TA 2B58A 5AG6A 4EWTA 4M3SA 2OZHA 4KS9A 3VWEA 5A28A 3DNSA 3OWCA 4OC3A 4ZY0A 1QSRA 4OC2A 4PQAA 3IGRA 2Q4YA 4AVAA 3FXTA 3DGVA 4FUUA 2ZOGA 3D7HA 4CYPA 4DJLA 1CM0A 4PK3A 3BJ8A 4NGSA 1H8LA 2PJ3A 3NH8A 4HPSA 2EK8A 3NE7A 1Z8WA 1LAPA 2PJBA 4IUSA 7CPAA 4FWUA 2C27A 4ZYQA 1X12A 1XMBA 4R76A 2POKA 4YU9A 3DR8A 3PB8X 3L2NA 3PB4X 4MMOA 3W91A 5G1ZA 4DNCA 2I00A 3DLJA 4HNWB 5J1QA 4P4BA 2ZEMA 2HV2A 2EO8A 1KUYA 3VARA 4KZTA 3SJFA 3TT2A 4CGLA 4F0XA 1MK4A 2GLJA 1KZFA 1Z8LA 2IL4A 4MFKA 3HUVA 2JDDA 2IJZA 2J8MA 5I4MA 1ZLIA 3I1UA 2Z0ZA 4KORA 4CYNA 5JGFA 4B5PA 4PV6A 5CBMA 2GREA 1IICA 5A27A 3FF3A 1Y7EA 4EVYA 5LYDA 1UFHA 3P2HA 1Z5RA 2Q43A 3SJXA 3K2KA 2PJ4A 2F5IA 2Q51A 4BINA 5JPHA 1JQGA 4H6ZA 3GY9A 4UEFA 4R3LA 2YNCA 4KVOE 1N71A 2OU2A 3B8GA 4HNYB 1YMEA 4GS4A 3ZJ0A 3D7GA 4ZX8A 2ZXVA 2PRQA 3DSBA 2J8NA 3JVNA 4X2TA 4XNHC 4MRIA 2KCWA 1BPNA 4KUAA 1IIDA 3DR6A 2AFWA 2BL1A 3B3WA 3KI9A 4QVTA 2ANPA 1S3ZA 4CGNA 2PJ6A 4B11A 2VEZA 3S6HA 4CYQA 4IK2A 2C6GA 4JXRA 4P4DA 3TX8A 2FIWA 4A31A 1GYTA 3B35A 3CXSA 1F2OA 4KOXA 1QSMA 3R96A 4BD9A 3WC7A 4RUHA 5K8NA 3TCVA 4H89A 4B5PB 3SI1A 1AYEA 2AJ6A 1S5KA 2ODFA 4NGRA 5C88A 2YNEA 1M44A 3B7IA 4FD5A 4NGQA 4PSWA 5AG7A 3UY5A 4JJXA 1LOKA 4ZY2A 2G3TA 1KUVA 5LYFA 2YNDA 1ZG9A 1Y7RA 2RB7A 5DS0A 1IOFA 4G1PA 1V0CA 4UFXA 3H8FA 2PJ7A 4RI1A 3PFEA 1AMPA 2C6PA 2EVNA 3N7ZA 2A4NA 2B4DA 2K5TA 5HVFA 2WPXA 2FS5A 1M4DA 3NH5A 4UCMA 4UCNA 2B4BA 3VWDA 4DUKA 3FMCA 4OIWA 1I21A 1UWYA 1YW6A 2XEGA 2C6CA 3G8WA 1IY7A 3W6SA 3CXQA 4EFDA 5AG5A 2NSMA 2PC1A 1VKCA 4JWPA 5GCNA 1AUGA 5BWAB
chains in the Genus database with same CATH topology
4HNXB 2P6EA 4C68A 2CNMA 1M1DA 3FYNA 2VXKA 4PSXA 4E0AA 1S7FA 1Z4RA 4AG7A 4Y49B 1J4JA 2JDCA 2PR1A 1Z9UA 4YGOA 3LD2A 1L0CA 5G20A 1XMTA 2B4DB 5HH1A 4XPKA 4A30A 1YR0A 4NF1A 2OZGA 3IWGA 1YGHA 5G22A 2D4OA 3G3SA 4CGMA 3P2FA 3I9SA 5CNPA 3WR7A 3FBUA 4XPDC 2VBQA 5DWMA 2QIRA 2Q0YA 4CRYB 1R57A 4CGPA 1WK4A 4Y49C 4C2ZA 1NMTA 4R57A 2OB0A 4KOUA 4B13A 2Q4VA 2ZW7A 3FNCA 4MY3A 2DPSA 2Q44A 1ZO0A 4BMHA 1Q2CA 4XNHB 1Q2YA 2G3AA 2PSWA 2RC4A 1BO4A 4UWJA 1MJBA 3EY5A 4NSQA 3EC4A 4B12A 2FE7A 3D8PA 5IV0A 2VI7A 5H86A 3R1KA 4F0YA 3R95A 1Z4EA 1P4NA 1S7LA 4AVCA 2QMLA 4KLVA 3PZJA 4QB9A 4Q36A 2Z3NA 5F46A 2JLMA 2Q7BA 3JTKA 4C7HA 1IYLA 4CAEA 4MBUA 2J8RA 5FVJA 3FRMA 4I49A 1M4GA 5DWNA 1S60A 4UWIA 2FSRA 2Z3OA 2BUEA 2VQYA 3K9UA 5J8CA 1WWZA 2PQ8A 1RO5A 3PGPA 3S6GA 4MFPA 1XIXA 4FD6A 2R8VA 1CJWA 3SXOA 2FL4A 3CXPA 5ISVA 1OZPA 4F6AA 4K30A 4R3KA 3TE4A 1LRZA 4Q38A 4KOTA 2GIVA 1XEBA 4XPLA 2DPTA 2FT0A 4KLWA 2P0WA 2Q04A 4II9A 1SQHA 3D2MA 1M4IA 2REEA 1YLEA 4QBJA 1QSTA 4KVXA 3R9FA 4MFJA 2ARHA 4R87A 1NE9A 3S6FA 3IU1A 4U9YA 4H6UA 3FB3A 2FCKA 3GKRA 4ORFA 2VZYA 3BJ7A 1IYKA 2D4PA 4AVBA 3JUWA 3KKWA 1U6MA 4QC6A 3T9YA 1YK3A 5F49A 3SHPA 3W6XA 1XE4A 4XPDB 5KTCA 3DDDA 3EO4A 5KTDA 2ZW5A 4KOYA 4YRHA 2WSAA 3LODA 5JQ4A 1PU9A 2Z10A 5I0CA 4E2AA 2WPWA 4L89A 3F8KA 2OH1A 1KUXA 3TTHA 1B87A 4J3GA 4UA3A 1Q2DA 2ATRA 3T90A 4QUSA 4KUBA 3TOBA 4MFQA 3A9LA 4A32A 2G0BA 4BBHA 1BOBA 1MJAA 3QB8A 2GANA 4KOWA 4MFZA 2Z3KA 3F0AA 4OLLA 2PR8A 4E8OA 5HMNA 4C7IA 4ONUA 2CXAA 3D3SA 1MJ9A 2ZW6A 1RXTA 4M85A 3FIXA 2Z3LA 3EXNA 3TO7A 2WUUA 5C82A 4CAWA 2HQYA 4HKFA 2H5MA 4ZBGA 4MFLA 3ZZIA 3R9GA 2CNSA 3TO6A 2I79A 4KSAA 1FY7A 2Z3MA 5G21A 1TIQA 1Y9WA 4MI4A 3S6KA 3C26A 4JLYA 4AB7A 3F5BA 4OAEA 5E96A 2QECA 2B3VA 4CAXA 4PK2A 3V8IA 4ZGYB 2CY2A 4IF5A 4B14A 2PRBA 2B5GB 2R7HA 1YX0A 2CNTA 4U5YA 1YVKA 4AG9A 4RS2A 2DXQA 4NXYA 3BLNA 4A33A 2NMTA 3H5ZA 2Z3PA 4CRZB 4UFVA 4LX9A 1VHSA 2REFA 2ZW4A 4UCPA 5AG6A 4MHDA 1B6BA 3I3GA 4NCZA 3TO9A 4CYOA 1YVOA 1QSOA 1S7NA 2P6GA 2EUIA 2B3UA 4FD7A 5EC4A 2ZPAA 1I12A 4YFJA 1P0HA 4KVME 4CGOA 3SXNA 2YGWA 4JD6A 4KOSA 5H84A 2AE6A 4LUAA 3MGDA 3D2PA 3PP9A 2PDOA 1YREA 2Z11A 3EFAA 4B5OA 1XF8A 4R9MA 2JEVA 5F47A 1I1DA 4JXQA 4CAVA 4CAFA 5F48A 2FXFA 3R9EA 2P6FA 2R98A 3GYAA 4UFWA 5EBVA 3H4QA 3RYOA 5IB0A 1S7KA 1NSLA 1ON0A 5J8FA 2OZUA 2Y0MA 4L8AA 4OADA 3IWEA 2GE3A 3TOAA 4KSFA 2VZZA 4C2YA 2FIAA 3QAHA 1IB1E 4NEXA 5IX3A 2R1IA 4KOVA 5KTAA 4A2ZA 4MY0A 1QSNA 3IU2A 1PUAA 4CS0B 4B10A 4UBRA 4MJ8A 4U9ZA 5AG4A 2BEIA 2HUZA 1GHEA 2O28A 2YNCC 4C2XA 1Y9KA 4X5KA 2X7BA 3E0KA 2BSWA 3TFYA 4FD4A 1K4JA 5AGEA 4A95A 2B5GA 2B58A 4M3SA 2OZHA 4KS9A 3VWEA 5A28A 3DNSA 3OWCA 1QSRA 3IGRA 2Q4YA 4AVAA 3FXTA 4CYPA 1CM0A 4PK3A 3BJ8A 3NE7A 4IUSA 2C27A 3DR8A 3W91A 5G1ZA 4DNCA 2I00A 4HNWB 2HV2A 1KUYA 4KZTA 4CGLA 3TT2A 4F0XA 1MK4A 1KZFA 4MFKA 2IL4A 2JDDA 2J8MA 2Z0ZA 4KORA 4CYNA 4B5PA 4PV6A 1IICA 5A27A 4EVYA 1UFHA 3P2HA 2F5IA 5JPHA 4H6ZA 3GY9A 4R3LA 2YNCA 4KVOE 1N71A 2OU2A 3B8GA 4HNYB 4GS4A 3ZJ0A 2ZXVA 3DSBA 2J8NA 3JVNA 4XNHC 2KCWA 4KUAA 1IIDA 3DR6A 4QVTA 2BL1A 1S3ZA 4CGNA 4B11A 2VEZA 3S6HA 4CYQA 4JXRA 2FIWA 4A31A 3CXSA 4KOXA 1QSMA 3R96A 3TCVA 4H89A 4B5PB 2AJ6A 1S5KA 5C88A 2YNEA 1M44A 4FD5A 4PSWA 5AG7A 3UY5A 4JJXA 2G3TA 1KUVA 2YNDA 1Y7RA 4UFXA 1V0CA 4RI1A 2EVNA 3N7ZA 2A4NA 2B4DA 2K5TA 2WPXA 2FS5A 1M4DA 4UCMA 4UCNA 2B4BA 3VWDA 1I21A 3G8WA 3W6SA 3CXQA 5AG5A 2PC1A 1VKCA 4JWPA 5GCNA 5BWAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HNX B;  2P6E A;  2CNM A;  1M1D A;  3FYN A;  2VXK A;  4PSX A;  4E0A A;  1S7F A;  1Z4R A;  4AG7 A;  4Y49 B;  1J4J A;  2JDC A;  2PR1 A;  1Z9U A;  4YGO A;  3LD2 A;  1L0C A;  1XMT A;  2B4D B;  5HH1 A;  4XPK A;  1YR0 A;  4NF1 A;  2OZG A;  3IWG A;  1YGH A;  2D4O A;  3G3S A;  3P2F A;  3I9S A;  5CNP A;  3WR7 A;  3FBU A;  4XPD C;  2VBQ A;  5DWM A;  2QIR A;  2Q0Y A;  4CRY B;  1R57 A;  1WK4 A;  4Y49 C;  1NMT A;  4R57 A;  2OB0 A;  4KOU A;  2Q4V A;  2ZW7 A;  3FNC A;  4MY3 A;  2Q44 A;  4BMH A;  1Q2C A;  4XNH B;  1Q2Y A;  2G3A A;  2PSW A;  2RC4 A;  1BO4 A;  4UWJ A;  1MJB A;  3EY5 A;  4NSQ A;  3EC4 A;  2FE7 A;  3D8P A;  5IV0 A;  2VI7 A;  5H86 A;  3R1K A;  4F0Y A;  3R95 A;  1Z4E A;  1P4N A;  1S7L A;  4AVC A;  2QML A;  4KLV A;  3PZJ A;  4QB9 A;  5F46 A;  2JLM A;  2Q7B A;  1IYL A;  4MBU A;  2J8R A;  5FVJ A;  3FRM A;  4I49 A;  1M4G A;  5DWN A;  1S60 A;  4UWI A;  2FSR A;  2BUE A;  2VQY A;  3K9U A;  5J8C A;  1WWZ A;  2PQ8 A;  1RO5 A;  3PGP A;  3S6G A;  1XIX A;  4FD6 A;  2R8V A;  1CJW A;  3SXO A;  2FL4 A;  3CXP A;  5ISV A;  1OZP A;  4F6A A;  4K30 A;  4R3K A;  3TE4 A;  1LRZ A;  4KOT A;  2GIV A;  1XEB A;  4XPL A;  2FT0 A;  4KLW A;  2P0W A;  2Q04 A;  4II9 A;  1SQH A;  3D2M A;  1M4I A;  2REE A;  1YLE A;  4QBJ A;  1QST A;  4KVX A;  3R9F A;  2ARH A;  4R87 A;  1NE9 A;  3S6F A;  4U9Y A;  4H6U A;  3FB3 A;  2FCK A;  3GKR A;  4ORF A;  2VZY A;  3BJ7 A;  1IYK A;  2D4P A;  4AVB A;  3JUW A;  3KKW A;  1U6M A;  4QC6 A;  3T9Y A;  1YK3 A;  5F49 A;  3SHP A;  3W6X A;  1XE4 A;  4XPD B;  5KTC A;  3DDD A;  3EO4 A;  5KTD A;  2ZW5 A;  4KOY A;  4YRH A;  3LOD A;  5JQ4 A;  1PU9 A;  2Z10 A;  5I0C A;  4E2A A;  2WPW A;  4L89 A;  3F8K A;  2OH1 A;  1KUX A;  3TTH A;  1B87 A;  4J3G A;  4UA3 A;  1Q2D A;  2ATR A;  3T90 A;  4QUS A;  4KUB A;  3TOB A;  2G0B A;  1BOB A;  1MJA A;  3QB8 A;  2GAN A;  4KOW A;  3F0A A;  4OLL A;  2PR8 A;  4E8O A;  5HMN A;  4ONU A;  3D3S A;  1MJ9 A;  2ZW6 A;  1RXT A;  4M85 A;  3FIX A;  3EXN A;  3TO7 A;  5C82 A;  4CAW A;  2HQY A;  4HKF A;  2H5M A;  4ZBG A;  3ZZI A;  3R9G A;  2CNS A;  3TO6 A;  2I79 A;  1FY7 A;  1TIQ A;  1Y9W A;  4MI4 A;  3S6K A;  3C26 A;  4JLY A;  4AB7 A;  3F5B A;  4OAE A;  5E96 A;  2QEC A;  2B3V A;  4CAX A;  4PK2 A;  3V8I A;  2CY2 A;  4IF5 A;  2PRB A;  2B5G B;  2R7H A;  1YX0 A;  2CNT A;  4U5Y A;  1YVK A;  4AG9 A;  4RS2 A;  2DXQ A;  4NXY A;  3BLN A;  2NMT A;  4CRZ B;  4LX9 A;  1VHS A;  2REF A;  2ZW4 A;  4MHD A;  1B6B A;  3I3G A;  4NCZ A;  3TO9 A;  1YVO A;  1QSO A;  1S7N A;  2P6G A;  2EUI A;  2B3U A;  4FD7 A;  5EC4 A;  2ZPA A;  1I12 A;  4YFJ A;  1P0H A;  4KVM E;  3SXN A;  4JD6 A;  4KOS A;  5H84 A;  2AE6 A;  4LUA A;  3MGD A;  3D2P A;  3PP9 A;  2PDO A;  1YRE A;  2Z11 A;  3EFA A;  4B5O A;  1XF8 A;  4R9M A;  2JEV A;  5F47 A;  1I1D A;  4JXQ A;  4CAV A;  5F48 A;  2FXF A;  3R9E A;  2P6F A;  2R98 A;  3GYA A;  5EBV A;  3H4Q A;  3RYO A;  5IB0 A;  1S7K A;  1NSL A;  1ON0 A;  5J8F A;  2OZU A;  2Y0M A;  4L8A A;  4OAD A;  2GE3 A;  3TOA A;  2VZZ A;  2FIA A;  3QAH A;  1IB1 E;  4NEX A;  5IX3 A;  2R1I A;  4KOV A;  5KTA A;  4MY0 A;  1QSN A;  1PUA A;  4CS0 B;  4UBR A;  4MJ8 A;  4U9Z A;  2BEI A;  2HUZ A;  1GHE A;  2O28 A;  1Y9K A;  4X5K A;  2X7B A;  3E0K A;  2BSW A;  3TFY A;  4FD4 A;  1K4J A;  2B5G A;  2B58 A;  4M3S A;  2OZH A;  3VWE A;  3DNS A;  3OWC A;  1QSR A;  3IGR A;  2Q4Y A;  4AVA A;  3FXT A;  1CM0 A;  4PK3 A;  3BJ8 A;  3NE7 A;  4IUS A;  2C27 A;  3DR8 A;  3W91 A;  4DNC A;  2I00 A;  4HNW B;  2HV2 A;  1KUY A;  4KZT A;  3TT2 A;  1MK4 A;  1KZF A;  2IL4 A;  2JDD A;  2J8M A;  2Z0Z A;  4KOR A;  4B5P A;  4PV6 A;  1IIC A;  4EVY A;  1UFH A;  3P2H A;  2F5I A;  5JPH A;  4H6Z A;  3GY9 A;  4R3L A;  4KVO E;  1N71 A;  2OU2 A;  3B8G A;  4HNY B;  4GS4 A;  3ZJ0 A;  2ZXV A;  3DSB A;  2J8N A;  3JVN A;  4XNH C;  2KCW A;  4KUA A;  1IID A;  3DR6 A;  4QVT A;  2BL1 A;  1S3Z A;  2VEZ A;  3S6H A;  4JXR A;  2FIW A;  3CXS A;  4KOX A;  1QSM A;  3R96 A;  3TCV A;  4H89 A;  4B5P B;  2AJ6 A;  1S5K A;  5C88 A;  1M44 A;  4FD5 A;  4PSW A;  3UY5 A;  4JJX A;  2G3T A;  1KUV A;  1Y7R A;  1V0C A;  4RI1 A;  2EVN A;  3N7Z A;  2A4N A;  2B4D A;  2K5T A;  2WPX A;  2FS5 A;  1M4D A;  2B4B A;  3VWD A;  1I21 A;  3G8W A;  3W6S A;  3CXQ A;  2PC1 A;  1VKC A;  4JWP A;  5GCN A; 
#chains in the Genus database with same CATH topology
 4HNX B;  1IU8 A;  2P6E A;  2WZN A;  2CNM A;  2PJC A;  1M1D A;  4C68 A;  3FYN A;  2VXK A;  4PSX A;  4E0A A;  1S7F A;  3H8E A;  3IO1 A;  3NA6 A;  1Z4R A;  2RFH A;  3D4U A;  4K3N A;  4MHP A;  3S9L A;  1IOI A;  3SI2 A;  4AG7 A;  4UEZ A;  1KWM A;  1J4J A;  1VIX A;  2JDC A;  2JBK A;  3MRU A;  1TKH A;  4Y49 B;  4FAI A;  2PR1 A;  4Z65 A;  4MCS A;  8CPA A;  1Z9U A;  3CPA A;  2CTB A;  4YGO A;  2J9A A;  1LCP A;  2V8G A;  4JYW A;  3LD2 A;  1L0C A;  5G20 A;  1M4L A;  3RAM A;  1XMT A;  2B4D B;  5HH1 A;  1HDU A;  4RN7 A;  4XPK A;  4A30 A;  2VL1 A;  1YR0 A;  4NF1 A;  2OZG A;  2JBJ A;  3IWG A;  4ZX9 A;  1YGH A;  1TXR A;  5G22 A;  2D4O A;  3G3S A;  4CGM A;  1ELM P;  3P2F A;  3CPX A;  3I9S A;  5CNP A;  3WR7 A;  3FBU A;  4XPD C;  1LAM A;  1TKJ A;  3NFZ A;  4UEE A;  2NYQ A;  2VBQ A;  2OR4 A;  2PVV A;  3KQX A;  5DWM A;  2QIR A;  2Q0Y A;  4LQG A;  4CRY B;  2PJ2 A;  4A39 A;  1R57 A;  1CP6 A;  1WK4 A;  4CGP A;  5F09 A;  4OC4 A;  4Y49 C;  3D7D A;  4C2Z A;  1NMT A;  4R57 A;  2OB0 A;  4KOU A;  4B13 A;  2Q4V A;  1Y0Y A;  2ZW7 A;  3FNC A;  4MY3 A;  2DPS A;  5LRK A;  4AXV A;  2Q44 A;  2IQ6 A;  4W9Y A;  3GLJ A;  1ZO0 A;  4BMH A;  1Q2C A;  4XNH B;  1Q2Y A;  2ZOF A;  2G3A A;  2PSW A;  2RC4 A;  3SJE A;  3FEC A;  2DEA A;  1BO4 A;  2PE3 A;  4UWJ A;  1MJB A;  3EY5 A;  4MCP A;  4Q7A A;  4NSQ A;  3EC4 A;  5LRG A;  1F57 A;  3PB9 X;  4B12 A;  2FE7 A;  4IHM A;  2GFQ A;  3D8P A;  3WT4 A;  5IV0 A;  2VI7 A;  3RZA A;  5THW A;  5H86 A;  4X3R A;  3R1K A;  4F0Y A;  3CZX A;  1QMU A;  2QJ8 A;  1Z4E A;  3R95 A;  1P4N A;  1S7L A;  4AVC A;  2QML A;  4KLV A;  4DYO A;  3B2Y A;  3PZJ A;  3QAY A;  4QB9 A;  1XOV A;  4Q36 A;  4P10 A;  2Z3N A;  4GM5 A;  2JLM A;  5F46 A;  2Q7B A;  3PB6 X;  3JTK A;  1CPS A;  4B6Z A;  4C7H A;  1ARM A;  1IYL A;  4CAE A;  2AFS A;  2ZEF A;  4MBU A;  2WYR A;  4NGP A;  2J8R A;  1NSA A;  3FRM A;  5FVJ A;  4I49 A;  1M4G A;  2QVP A;  1Z8T A;  5DWN A;  1S60 A;  3D68 A;  4UWI A;  2FSR A;  2Z3O A;  2BUE A;  3IEH A;  4P4E A;  2VQY A;  4OID A;  3K9U A;  4OC5 A;  5J8C A;  1WWZ A;  2JEW A;  2PQ8 A;  1ZG8 A;  2PVW A;  1RO5 A;  2ZEG A;  5HVH A;  2CTC A;  1RTQ A;  4NGT A;  3PGP A;  3S6G A;  4MFP A;  1XIX A;  4FD6 A;  2R8V A;  1CJW A;  2FVG A;  3SXO A;  2FL4 A;  3CXP A;  3T8W A;  4A38 A;  5ISV A;  1OZP A;  2EWB A;  2PIZ A;  4K30 A;  4F6A A;  4R3K A;  2ZEP A;  3TE4 A;  1LRZ A;  5K8O A;  4Q38 A;  4KOT A;  2F8H A;  2GIV A;  2ZEN A;  1XEB A;  3PFO A;  4P44 A;  4XPL A;  1PCA A;  2DPT A;  2FT0 A;  4KLW A;  4CPA A;  5K8M A;  1PYT B;  2P0W A;  3B3S A;  2Q04 A;  3KR4 A;  4II9 A;  1SQH A;  1Z8X A;  3D2M A;  1M4I A;  2REE A;  3PEI A;  4OME A;  1YLE A;  1CP7 A;  1QST A;  3WC6 A;  4QBJ A;  1Z2L A;  4KVX A;  4MHN A;  1JWQ A;  3NH4 A;  4MFJ A;  3R9F A;  2ARH A;  1DE4 C;  4R87 A;  1NE9 A;  3PRT A;  3IU1 A;  2V8V A;  4H6U A;  4PXE A;  3FB3 A;  4PXD A;  4U9Y A;  3S6F A;  1ELL P;  2FCK A;  1CBX A;  3KR5 A;  3GKR A;  3NE8 A;  4TNU A;  2ZEO A;  1VGY A;  2O53 A;  2XEF A;  4ORF A;  1FT7 A;  2GU2 A;  2VZY A;  4IAV A;  3WAB A;  1IGB A;  3BJ7 A;  1IYK A;  2D4P A;  4AVB A;  3JUW A;  2AFM A;  3KKW A;  1U6M A;  4QC6 A;  3T9Y A;  2ABZ A;  1YK3 A;  5F49 A;  1HDQ A;  3ISX A;  3SHP A;  2PJA A;  3KZW A;  3W6X A;  1XE4 A;  1TKF A;  2ZEL A;  4XPD B;  3PBE A;  5KTC A;  3DDD A;  3KL9 A;  3EO4 A;  2AFZ A;  3LWU A;  4F9V A;  5KTD A;  1YLO A;  2V8D A;  2ZW5 A;  4KOY A;  4YRH A;  2WSA A;  1ARL A;  2O4H A;  4M6G A;  3LOD A;  3IIB A;  5JQ4 A;  1PU9 A;  1Y0R A;  3LAC A;  3ISZ A;  2Z10 A;  1ZG7 A;  2PIY A;  4MCR A;  5CPA A;  2WPW A;  4E2A A;  5I0C A;  4L89 A;  4MXU A;  4LQ6 A;  3SI0 A;  3F8K A;  2OH1 A;  1KUX A;  2ZED A;  1EE3 P;  4PXC A;  3TTH A;  1B87 A;  2IMO A;  4J3G A;  4UA3 A;  1Q2D A;  2ATR A;  3KAS A;  5EMI A;  4EME A;  3T90 A;  3SJG A;  5K8P A;  2Q7S A;  4QUS A;  4WWV A;  4GXH A;  1LAN A;  4NJQ A;  4PXB A;  4KUB A;  3PBB A;  3TOB A;  3MN8 A;  3FVL A;  1CG2 A;  3A9L A;  4MFQ A;  4A32 A;  2G0B A;  4BBH A;  2PJ8 A;  5HVG A;  1BOB A;  3BI0 A;  1MJA A;  3QB8 A;  4R8F A;  2GAN A;  2PCU A;  2QYV A;  4KOW A;  4MFZ A;  1FNO A;  3KQZ A;  2Z3K A;  3S9M A;  2ZEE A;  3CT9 A;  3F0A A;  4OLL A;  2PR8 A;  5LYL A;  3PB7 X;  1BAV A;  3BHX A;  4E8O A;  3RNZ A;  4NGN A;  4C7I A;  3BXM A;  1ZLH A;  3FH4 A;  4ONU A;  2CXA A;  1TF9 A;  4P4F A;  3D3S A;  5IB9 A;  1LFW A;  2PJ0 A;  1MJ9 A;  2ZW6 A;  1RXT A;  5D8N A;  4M85 A;  3FIX A;  2Z3L A;  3EXN A;  3TO7 A;  2WUU A;  2GLF A;  3KHZ A;  5C82 A;  4CAW A;  2HQY A;  3IC1 A;  4HKF A;  4A37 A;  2C1C A;  2H5M A;  4R6T A;  4X8I A;  1QQ9 A;  2PJ9 A;  3S9N A;  1Q7L A;  4ZBG A;  1X10 A;  4MFL A;  3ZZI A;  5HXD A;  3R9G A;  4NGM A;  1CX8 A;  2CNS A;  4YWY A;  3TO6 A;  5D29 A;  2I79 A;  4P4J A;  4KSA A;  1FY7 A;  2Z3M A;  2AFX A;  2CIJ A;  5G21 A;  1TIQ A;  1Y9W A;  4O23 A;  3N5F A;  4MI4 A;  1HEE A;  2PJ5 A;  3S6K A;  2HC9 A;  4F8Z A;  3C26 A;  4JLY A;  4AB7 A;  3F5B A;  4OAE A;  6CPA A;  5E96 A;  2QEC A;  2B3V A;  2I3C A;  4CAX A;  4PK2 A;  3LMS A;  4OKO A;  4P6Y A;  2F7V A;  4MCQ A;  3KHX A;  3GB0 A;  3V8I A;  2DF5 A;  4ZGY B;  4ZI6 A;  2CY2 A;  4IF5 A;  2BOA A;  4B14 A;  2PRB A;  2B5G B;  2R7H A;  1YX0 A;  4P45 A;  2CNT A;  4U5Y A;  3FED A;  1YVK A;  4AG9 A;  4RS2 A;  2DXQ A;  2Q4Z A;  1XFO A;  2V8H A;  3FJU A;  4UIA A;  4NXY A;  3BLN A;  4A33 A;  2NMT A;  4F9U A;  5HMN A;  4ONW A;  1VHE A;  3H5Z A;  1YQE A;  4OC1 A;  2Z3P A;  4CRZ B;  4UFV A;  4LX9 A;  5JM6 A;  1VHS A;  2REF A;  2ZW4 A;  4UCP A;  1R3N A;  2AFO A;  2G9D A;  4MHD A;  4UIB A;  4TWE A;  1B6B A;  3I3G A;  4NCZ A;  3TO9 A;  3IFE A;  3IJ3 A;  4CYO A;  3GIU A;  1YVO A;  4JZ0 A;  2ZEH A;  1QSO A;  3GUX A;  1S7N A;  3V38 A;  2P6G A;  2EUI A;  4WJB A;  1CPX A;  1YSJ A;  2B3U A;  3JRU A;  4FD7 A;  1XBU A;  1TF8 A;  5EC4 A;  2ZPA A;  1I12 A;  3KGQ A;  1XRY A;  1R43 A;  4YFJ A;  1P0H A;  4OC0 A;  4KVM E;  4FBE A;  2OOT A;  4UF4 A;  4CGO A;  3CDX A;  3SXN A;  4M6I A;  2YGW A;  4JD6 A;  4KOS A;  3FEE A;  4P4I A;  5H84 A;  2AE6 A;  4LUA A;  1DTD A;  3MGD A;  3D2P A;  4MHY A;  3K9T A;  2XEI A;  3PP9 A;  2PDO A;  1YRE A;  2Z11 A;  3EFA A;  4B5O A;  1XF8 A;  4R9M A;  2JEV A;  5F47 A;  1I1D A;  3RBU A;  2HB6 A;  4JXQ A;  4CAV A;  3QNV A;  5LRJ A;  4CAF A;  5F48 A;  2BO9 A;  2FXF A;  4PPZ A;  3R9E A;  3TC8 A;  2P6F A;  3V7Z A;  2BCO A;  2R98 A;  3GYA A;  4NJR A;  3D7F A;  4UFW A;  5EBV A;  3H4Q A;  1OBR A;  4OP4 A;  2PJ1 A;  3RYO A;  5IB0 A;  3H8G A;  1F2P A;  1S7K A;  1NSL A;  1ON0 A;  5J8F A;  2OZU A;  3IWW A;  2Y0M A;  4L8A A;  4OAD A;  1BLL E;  3IWE A;  3D66 A;  4A94 A;  2EK9 A;  1BPM A;  2GE3 A;  3BI1 A;  3TOA A;  4KSF A;  2VZZ A;  5ELY A;  4C2Y A;  2FIA A;  3HLP A;  3QAH A;  1IB1 E;  4NEX A;  2XEJ A;  5IX3 A;  2R1I A;  4KOV A;  5KTA A;  4A2Z A;  4MY0 A;  2V77 A;  1A2Z A;  3VAT A;  1QSN A;  4H2K A;  3IU2 A;  1PUA A;  3VH9 A;  4R7M A;  4KSI A;  4NFR A;  4CS0 B;  4B10 A;  2EBJ A;  4M6H A;  4UBR A;  4MJ8 A;  3FX6 A;  4MHZ A;  4U9Z A;  2BEI A;  2HUZ A;  1GHE A;  2O28 A;  2YNC C;  3B3V A;  5AG4 A;  4C2X A;  1Y9K A;  4X5K A;  2AFU A;  1XJO A;  2X7B A;  5JH9 A;  1VHO A;  3RO0 A;  3WC5 A;  5LYI A;  3E0K A;  2BSW A;  3B3C A;  2CF4 A;  3TFY A;  3D67 A;  4FD4 A;  1K4J A;  4ZY1 A;  5AGE A;  4A95 A;  2B5G A;  1YW4 A;  3B3T A;  2B58 A;  5AG6 A;  4EWT A;  4M3S A;  2OZH A;  4KS9 A;  3VWE A;  5A28 A;  3DNS A;  3OWC A;  4OC3 A;  4ZY0 A;  1QSR A;  4OC2 A;  4PQA A;  3IGR A;  2Q4Y A;  4AVA A;  3FXT A;  3DGV A;  4FUU A;  2ZOG A;  3D7H A;  4CYP A;  4DJL A;  1CM0 A;  4PK3 A;  3BJ8 A;  4NGS A;  1H8L A;  2PJ3 A;  3NH8 A;  4HPS A;  2EK8 A;  3NE7 A;  1Z8W A;  1LAP A;  2PJB A;  4IUS A;  7CPA A;  4FWU A;  2C27 A;  4ZYQ A;  1X12 A;  1XMB A;  4R76 A;  2POK A;  4YU9 A;  3DR8 A;  3PB8 X;  3L2N A;  3PB4 X;  4MMO A;  3W91 A;  5G1Z A;  4DNC A;  2I00 A;  3DLJ A;  4HNW B;  5J1Q A;  4P4B A;  2ZEM A;  2HV2 A;  2EO8 A;  1KUY A;  3VAR A;  4KZT A;  3SJF A;  3TT2 A;  4CGL A;  4F0X A;  1MK4 A;  2GLJ A;  1KZF A;  1Z8L A;  2IL4 A;  4MFK A;  3HUV A;  2JDD A;  2IJZ A;  2J8M A;  5I4M A;  1ZLI A;  3I1U A;  2Z0Z A;  4KOR A;  4CYN A;  5JGF A;  4B5P A;  4PV6 A;  5CBM A;  2GRE A;  1IIC A;  5A27 A;  3FF3 A;  1Y7E A;  4EVY A;  5LYD A;  1UFH A;  3P2H A;  1Z5R A;  2Q43 A;  3SJX A;  3K2K A;  2PJ4 A;  2F5I A;  2Q51 A;  4BIN A;  5JPH A;  1JQG A;  4H6Z A;  3GY9 A;  4UEF A;  4R3L A;  2YNC A;  4KVO E;  1N71 A;  2OU2 A;  3B8G A;  4HNY B;  1YME A;  4GS4 A;  3ZJ0 A;  3D7G A;  4ZX8 A;  2ZXV A;  2PRQ A;  3DSB A;  2J8N A;  3JVN A;  4X2T A;  4XNH C;  4MRI A;  2KCW A;  1BPN A;  4KUA A;  1IID A;  3DR6 A;  2AFW A;  2BL1 A;  3B3W A;  3KI9 A;  4QVT A;  2ANP A;  1S3Z A;  4CGN A;  2PJ6 A;  4B11 A;  2VEZ A;  3S6H A;  4CYQ A;  4IK2 A;  2C6G A;  4JXR A;  4P4D A;  3TX8 A;  2FIW A;  4A31 A;  1GYT A;  3B35 A;  3CXS A;  1F2O A;  4KOX A;  1QSM A;  3R96 A;  4BD9 A;  3WC7 A;  4RUH A;  5K8N A;  3TCV A;  4H89 A;  4B5P B;  3SI1 A;  1AYE A;  2AJ6 A;  1S5K A;  2ODF A;  4NGR A;  5C88 A;  2YNE A;  1M44 A;  3B7I A;  4FD5 A;  4NGQ A;  4PSW A;  5AG7 A;  3UY5 A;  4JJX A;  1LOK A;  4ZY2 A;  2G3T A;  1KUV A;  5LYF A;  2YND A;  1ZG9 A;  1Y7R A;  2RB7 A;  5DS0 A;  1IOF A;  4G1P A;  1V0C A;  4UFX A;  3H8F A;  2PJ7 A;  4RI1 A;  3PFE A;  1AMP A;  2C6P A;  2EVN A;  3N7Z A;  2A4N A;  2B4D A;  2K5T A;  5HVF A;  2WPX A;  2FS5 A;  1M4D A;  3NH5 A;  4UCM A;  4UCN A;  2B4B A;  3VWD A;  4DUK A;  3FMC A;  4OIW A;  1I21 A;  1UWY A;  1YW6 A;  2XEG A;  2C6C A;  3G8W A;  1IY7 A;  3W6S A;  3CXQ A;  4EFD A;  5AG5 A;  2NSM A;  2PC1 A;  1VKC A;  4JWP A;  5GCN A;  1AUG A;  5BWA B; 
#chains in the Genus database with same CATH homology
 4HNX B;  2P6E A;  4C68 A;  2CNM A;  1M1D A;  3FYN A;  2VXK A;  4PSX A;  4E0A A;  1S7F A;  1Z4R A;  4AG7 A;  4Y49 B;  1J4J A;  2JDC A;  2PR1 A;  1Z9U A;  4YGO A;  3LD2 A;  1L0C A;  5G20 A;  1XMT A;  2B4D B;  5HH1 A;  4XPK A;  4A30 A;  1YR0 A;  4NF1 A;  2OZG A;  3IWG A;  1YGH A;  5G22 A;  2D4O A;  3G3S A;  4CGM A;  3P2F A;  3I9S A;  5CNP A;  3WR7 A;  3FBU A;  4XPD C;  2VBQ A;  5DWM A;  2QIR A;  2Q0Y A;  4CRY B;  1R57 A;  4CGP A;  1WK4 A;  4Y49 C;  4C2Z A;  1NMT A;  4R57 A;  2OB0 A;  4KOU A;  4B13 A;  2Q4V A;  2ZW7 A;  3FNC A;  4MY3 A;  2DPS A;  2Q44 A;  1ZO0 A;  4BMH A;  1Q2C A;  4XNH B;  1Q2Y A;  2G3A A;  2PSW A;  2RC4 A;  1BO4 A;  4UWJ A;  1MJB A;  3EY5 A;  4NSQ A;  3EC4 A;  4B12 A;  2FE7 A;  3D8P A;  5IV0 A;  2VI7 A;  5H86 A;  3R1K A;  4F0Y A;  3R95 A;  1Z4E A;  1P4N A;  1S7L A;  4AVC A;  2QML A;  4KLV A;  3PZJ A;  4QB9 A;  4Q36 A;  2Z3N A;  5F46 A;  2JLM A;  2Q7B A;  3JTK A;  4C7H A;  1IYL A;  4CAE A;  4MBU A;  2J8R A;  5FVJ A;  3FRM A;  4I49 A;  1M4G A;  5DWN A;  1S60 A;  4UWI A;  2FSR A;  2Z3O A;  2BUE A;  2VQY A;  3K9U A;  5J8C A;  1WWZ A;  2PQ8 A;  1RO5 A;  3PGP A;  3S6G A;  4MFP A;  1XIX A;  4FD6 A;  2R8V A;  1CJW A;  3SXO A;  2FL4 A;  3CXP A;  5ISV A;  1OZP A;  4F6A A;  4K30 A;  4R3K A;  3TE4 A;  1LRZ A;  4Q38 A;  4KOT A;  2GIV A;  1XEB A;  4XPL A;  2DPT A;  2FT0 A;  4KLW A;  2P0W A;  2Q04 A;  4II9 A;  1SQH A;  3D2M A;  1M4I A;  2REE A;  1YLE A;  4QBJ A;  1QST A;  4KVX A;  3R9F A;  4MFJ A;  2ARH A;  4R87 A;  1NE9 A;  3S6F A;  3IU1 A;  4U9Y A;  4H6U A;  3FB3 A;  2FCK A;  3GKR A;  4ORF A;  2VZY A;  3BJ7 A;  1IYK A;  2D4P A;  4AVB A;  3JUW A;  3KKW A;  1U6M A;  4QC6 A;  3T9Y A;  1YK3 A;  5F49 A;  3SHP A;  3W6X A;  1XE4 A;  4XPD B;  5KTC A;  3DDD A;  3EO4 A;  5KTD A;  2ZW5 A;  4KOY A;  4YRH A;  2WSA A;  3LOD A;  5JQ4 A;  1PU9 A;  2Z10 A;  5I0C A;  4E2A A;  2WPW A;  4L89 A;  3F8K A;  2OH1 A;  1KUX A;  3TTH A;  1B87 A;  4J3G A;  4UA3 A;  1Q2D A;  2ATR A;  3T90 A;  4QUS A;  4KUB A;  3TOB A;  4MFQ A;  3A9L A;  4A32 A;  2G0B A;  4BBH A;  1BOB A;  1MJA A;  3QB8 A;  2GAN A;  4KOW A;  4MFZ A;  2Z3K A;  3F0A A;  4OLL A;  2PR8 A;  4E8O A;  5HMN A;  4C7I A;  4ONU A;  2CXA A;  3D3S A;  1MJ9 A;  2ZW6 A;  1RXT A;  4M85 A;  3FIX A;  2Z3L A;  3EXN A;  3TO7 A;  2WUU A;  5C82 A;  4CAW A;  2HQY A;  4HKF A;  2H5M A;  4ZBG A;  4MFL A;  3ZZI A;  3R9G A;  2CNS A;  3TO6 A;  2I79 A;  4KSA A;  1FY7 A;  2Z3M A;  5G21 A;  1TIQ A;  1Y9W A;  4MI4 A;  3S6K A;  3C26 A;  4JLY A;  4AB7 A;  3F5B A;  4OAE A;  5E96 A;  2QEC A;  2B3V A;  4CAX A;  4PK2 A;  3V8I A;  4ZGY B;  2CY2 A;  4IF5 A;  4B14 A;  2PRB A;  2B5G B;  2R7H A;  1YX0 A;  2CNT A;  4U5Y A;  1YVK A;  4AG9 A;  4RS2 A;  2DXQ A;  4NXY A;  3BLN A;  4A33 A;  2NMT A;  3H5Z A;  2Z3P A;  4CRZ B;  4UFV A;  4LX9 A;  1VHS A;  2REF A;  2ZW4 A;  4UCP A;  5AG6 A;  4MHD A;  1B6B A;  3I3G A;  4NCZ A;  3TO9 A;  4CYO A;  1YVO A;  1QSO A;  1S7N A;  2P6G A;  2EUI A;  2B3U A;  4FD7 A;  5EC4 A;  2ZPA A;  1I12 A;  4YFJ A;  1P0H A;  4KVM E;  4CGO A;  3SXN A;  2YGW A;  4JD6 A;  4KOS A;  5H84 A;  2AE6 A;  4LUA A;  3MGD A;  3D2P A;  3PP9 A;  2PDO A;  1YRE A;  2Z11 A;  3EFA A;  4B5O A;  1XF8 A;  4R9M A;  2JEV A;  5F47 A;  1I1D A;  4JXQ A;  4CAV A;  4CAF A;  5F48 A;  2FXF A;  3R9E A;  2P6F A;  2R98 A;  3GYA A;  4UFW A;  5EBV A;  3H4Q A;  3RYO A;  5IB0 A;  1S7K A;  1NSL A;  1ON0 A;  5J8F A;  2OZU A;  2Y0M A;  4L8A A;  4OAD A;  3IWE A;  2GE3 A;  3TOA A;  4KSF A;  2VZZ A;  4C2Y A;  2FIA A;  3QAH A;  1IB1 E;  4NEX A;  5IX3 A;  2R1I A;  4KOV A;  5KTA A;  4A2Z A;  4MY0 A;  1QSN A;  3IU2 A;  1PUA A;  4CS0 B;  4B10 A;  4UBR A;  4MJ8 A;  4U9Z A;  5AG4 A;  2BEI A;  2HUZ A;  1GHE A;  2O28 A;  2YNC C;  4C2X A;  1Y9K A;  4X5K A;  2X7B A;  3E0K A;  2BSW A;  3TFY A;  4FD4 A;  1K4J A;  5AGE A;  4A95 A;  2B5G A;  2B58 A;  4M3S A;  2OZH A;  4KS9 A;  3VWE A;  5A28 A;  3DNS A;  3OWC A;  1QSR A;  3IGR A;  2Q4Y A;  4AVA A;  3FXT A;  4CYP A;  1CM0 A;  4PK3 A;  3BJ8 A;  3NE7 A;  4IUS A;  2C27 A;  3DR8 A;  3W91 A;  5G1Z A;  4DNC A;  2I00 A;  4HNW B;  2HV2 A;  1KUY A;  4KZT A;  4CGL A;  3TT2 A;  4F0X A;  1MK4 A;  1KZF A;  4MFK A;  2IL4 A;  2JDD A;  2J8M A;  2Z0Z A;  4KOR A;  4CYN A;  4B5P A;  4PV6 A;  1IIC A;  5A27 A;  4EVY A;  1UFH A;  3P2H A;  2F5I A;  5JPH A;  4H6Z A;  3GY9 A;  4R3L A;  2YNC A;  4KVO E;  1N71 A;  2OU2 A;  3B8G A;  4HNY B;  4GS4 A;  3ZJ0 A;  2ZXV A;  3DSB A;  2J8N A;  3JVN A;  4XNH C;  2KCW A;  4KUA A;  1IID A;  3DR6 A;  4QVT A;  2BL1 A;  1S3Z A;  4CGN A;  4B11 A;  2VEZ A;  3S6H A;  4CYQ A;  4JXR A;  2FIW A;  4A31 A;  3CXS A;  4KOX A;  1QSM A;  3R96 A;  3TCV A;  4H89 A;  4B5P B;  2AJ6 A;  1S5K A;  5C88 A;  2YNE A;  1M44 A;  4FD5 A;  4PSW A;  5AG7 A;  3UY5 A;  4JJX A;  2G3T A;  1KUV A;  2YND A;  1Y7R A;  4UFX A;  1V0C A;  4RI1 A;  2EVN A;  3N7Z A;  2A4N A;  2B4D A;  2K5T A;  2WPX A;  2FS5 A;  1M4D A;  4UCM A;  4UCN A;  2B4B A;  3VWD A;  1I21 A;  3G8W A;  3W6S A;  3CXQ A;  5AG5 A;  2PC1 A;  1VKC A;  4JWP A;  5GCN A;  5BWA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...