1YX0A

Solution structure of bacillus subtilis protein ysne: the northeast structural genomics consortium target sr220
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
151
structure length
151
Chain Sequence
MHIKIDDLTGRQVVSLVNEHLHSMTLMSPPESIHALGLEKLRGPEITFWSAWEGDELAGCGALKELDTRHGEIKSMRTSASHLRKGVAKQVLQHIIEEAEKRGYERLSLETGSMASFEPARKLYESFGFQYCEPFADYGEDPNSVFMTKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein ysnE
publication title Solution Structure of Bacillus subtilis Protein ysnE
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Structural genomics, unknown function
total genus 20
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yx0A00
1IIDA 3GY9A 3D8PA 3DSBA 2VXKA 5F48A 3P2HA 4JXQA 5H84A 2Z11A 2J8RA 1YX0A 2CNTA 4FD4A 4KUAA 4CS0B 1IICA 3MGDA 1QSNA 2QIRA 4JWPA 4R87A 1OZPA 2BEIA 4KOUA 3JVNA 4KVME 2B5GA 5EBVA 4K30A 5C88A 1M1DA 5F47A 2ZW4A 1RXTA 3KKWA 4M85A 1CJWA 1B6BA 3PGPA 4FD7A 2KCWA 4ZBGA 2Y0MA 2A4NA 4Y49C 4E2AA 2B3UA 3FRMA 5HH1A 2ZW6A 2P6FA 4F6AA 2HUZA 1XF8A 3F0AA 1TIQA 2Q04A 1M4GA 4ONUA 3B8GA 4CAWA 3G8WA 2P6GA 1SQHA 3W91A 4UBRA 2AJ6A 4AG7A 3EY5A 1PUAA 4FD5A 1M4IA 4UWIA 2B58A 2CY2A 3IGRA 5C82A 3VWDA 1QSTA 3W6SA 4OAEA 2F5IA 1KUXA 4KVOE 4QBJA 3DNSA 1I12A 4KVXA 1I1DA 4EVYA 2Z0ZA 4AVCA 2JLMA 1CM0A 2Q4VA 5I0CA 5CNPA 1VHSA 1LRZA 1YLEA 3BJ8A 4PSXA 4HNWB 5E96A 1RO5A 4B5PB 2REEA 3SXOA 4UA3A 4LX9A 1QSRA 4JJXA 4NXYA 2JEVA 4BMHA 5EC4A 2B3VA 3G3SA 4L89A 5H86A 2AE6A 5KTDA 4XPLA 3QAHA 3TOBA 3VWEA 2R7HA 2D4OA 3T9YA 2OZHA 4KOWA 2Q0YA 2IL4A 3H4QA 3T90A 2PC1A 4HNXB 3PP9A 4QVTA 5F46A 2I00A 4QUSA 3DR6A 3FB3A 1XIXA 5ISVA 4AVAA 2JDDA 4XPKA 2G3TA 5J8CA 1QSMA 2J8NA 2WPXA 1B87A 3LODA 4U9ZA 2RC4A 2VEZA 2ARHA 1BO4A 2JDCA 5HMNA 2P6EA 1NMTA 2PR1A 3WR7A 4IF5A 4U9YA 2QECA 2R1IA 3CXQA 3TO7A 1Q2CA 5DWNA 3BJ7A 2OZGA 2Q4YA 2D4PA 1XMTA 4ORFA 3V8IA 1U6MA 3EC4A 1Q2YA 1P4NA 4UWJA 4R57A 2VI7A 4RS2A 2B4BA 4KOXA 5F49A 3I3GA 4HKFA 4H89A 3F5BA 4OADA 4YRHA 4NSQA 1M4DA 3N7ZA 4KORA 5FVJA 4I49A 5IV0A 1M44A 1KZFA 1S5KA 4XPDB 2G0BA 2QMLA 2ZW7A 4KUBA 1L0CA 2FT0A 5KTCA 3IWGA 5KTAA 3R1KA 1J4JA 1XEBA 2Q44A 3K9UA 2PSWA 4DNCA 3D2PA 3ZJ0A 4B5OA 3PZJA 2HV2A 2P0WA 4B5PA 5JPHA 4NF1A 3OWCA 4NCZA 3EXNA 2OB0A 1FY7A 4R3KA 1WWZA 2REFA 1MK4A 2VZZA 3FXTA 4R3LA 3ZZIA 3D2MA 3EFAA 2GIVA 1NSLA 4MJ8A 1Y7RA 1S7KA 4L8AA 4MI4A 5GCNA 1S7NA 3GYAA 4CRZB 1XE4A 3TO6A 4LUAA 3TTHA 2J8MA 2ZXVA 2FIWA 4JLYA 3W6XA 2B4DB 4MHDA 3R96A 4R9MA 4KOSA 1YVOA 3GKRA 3E0KA 2PQ8A 1ON0A 4J3GA 3FBUA 2OZUA 1Q2DA 4AB7A 4KLVA 1P0HA 1S3ZA 2G3AA 3S6KA 4CAVA 4XPDC 1S7FA 4KZTA 4XNHB 3S6GA 3CXPA 4F0YA 4RI1A 2FSRA 1KUVA 1GHEA 1NE9A 1I21A 1WK4A 3FIXA 4MY3A 3C26A 2K5TA 3S6HA 1Z9UA 2FS5A 1Y9WA 2EUIA 2PDOA 1PU9A 4KOYA 2BUEA 2WPWA 1V0CA 2ZW5A 1S60A 3S6FA 4PSWA 1IYKA 3I9SA 1YREA 1N71A 1YVKA 4YGOA 4PK2A 4E8OA 3F8KA 3R9EA 2Q7BA 2Z10A 4JD6A 1YGHA 2FIAA 3SXNA 4AG9A 2EVNA 4GS4A 4H6ZA 3R9GA 2B5GB 2HQYA 2R98A 2BSWA 2FXFA 4CAXA 1IB1E 4KOTA 2X7BA 4MBUA 4YFJA 1BOBA 2PRBA 2ZPAA 2VZYA 1Z4RA 4QB9A 3EO4A 1R57A 2I79A 1MJ9A 3UY5A 2CNSA 4H6UA 4M3SA 2PR8A 4FD6A 1YK3A 4XNHC 4PV6A 4X5KA 4CRYB 2GANA 1KUYA 5IX3A 4OLLA 3NE7A 3R9FA 1YR0A 3TT2A 1IYLA 1QSOA 2VQYA 5DWMA 5JQ4A 1S7LA 3TOAA 3TO9A 2R8VA 4PK3A 1VKCA 4JXRA 1Y9KA 3LD2A 1MJBA 3CXSA 3JUWA 4E0AA 4MY0A 2OH1A 1MJAA 3P2FA 3FYNA 2GE3A 4HNYB 2NMTA 4KOVA 3SHPA 2FE7A 2B4DA 3DR8A 4U5YA 4KLWA 2FCKA 5J8FA 4NEXA 3QB8A 2ATRA 2FL4A 2BL1A 4II9A 4IUSA 2CNMA 2VBQA 4Y49B 3R95A 1UFHA 3TFYA 2DXQA 3BLNA 3TE4A 2OU2A 1K4JA 2O28A 2C27A 1Z4EA 5IB0A 4QC6A 3FNCA 3RYOA 4AVBA 2H5MA 3DDDA 3TCVA 3D3SA
chains in the Genus database with same CATH superfamily
2EK9A 3KGQA 1IIDA 1VIXA 1ZG9A 4B6ZA 3D67A 3GY9A 4P45A 4NFRA 3D8PA 3DSBA 3IC1A 4F9VA 4OC3A 1DTDA 3SJGA 2VXKA 3SJEA 5AG6A 5F48A 1IGBA 3P2HA 2ZEPA 2PJ9A 5THWA 4BD9A 4JXQA 3SI1A 5H84A 2Z11A 2Z3LA 4MHNA 4UFWA 4P6YA 3KI9A 2IMOA 2J8RA 1Z8XA 1YX0A 2CNTA 4FD4A 4KUAA 4CS0B 1F57A 4F0XA 3S9LA 1IICA 3MGDA 1QSNA 1VHOA 1YMEA 2QIRA 4JWPA 4R87A 1OZPA 2BEIA 1TKHA 4KOUA 3TC8A 5LYIA 1ZG8A 1FT7A 3JVNA 4MFPA 5D8NA 4KVME 2GLJA 4OMEA 2B5GA 4MHYA 4BBHA 5EBVA 4K30A 5C88A 1M1DA 5F47A 4P44A 4RUHA 1TKFA 4MFKA 2ZW4A 1HEEA 1RXTA 3KKWA 4M85A 1F2OA 1ZLHA 4MFLA 1QQ9A 1CJWA 1B6BA 1NSAA 1UWYA 1ELLP 2KCWA 3HLPA 3PGPA 4FD7A 4ZBGA 2Y0MA 4OP4A 3RNZA 5HVHA 6CPAA 2GLFA 1Y7EA 2QYVA 4Z65A 2A4NA 3SI0A 4Y49C 4E2AA 2QVPA 1CX8A 2B3UA 3FRMA 5HH1A 1M4LA 2ZW6A 5G22A 4R8FA 2P6FA 4B12A 2WZNA 4F6AA 2HUZA 1XF8A 3F0AA 1TIQA 2Q04A 1M4GA 2Z3PA 1TF8A 1PCAA 4ONUA 2ZEGA 3B8GA 1XRYA 4CAWA 2OR4A 2V8DA 3G8WA 3I1UA 4MMOA 2AFZA 2P6GA 1SQHA 2YNEA 3W91A 4UBRA 4MFQA 2AJ6A 3BI0A 2WYRA 4CAFA 1XMBA 3B3CA 4AG7A 4A37A 3EY5A 1H8LA 1PUAA 4FD5A 4X3RA 1M4IA 3B7IA 4CGMA 2I3CA 4UWIA 2V77A 3GUXA 1PYTB 2B58A 2AFXA 2CY2A 4HPSA 4MHPA 3IGRA 3RO0A 1YLOA 2OOTA 5C82A 5A27A 3VWDA 5G20A 1QSTA 1TXRA 2BO9A 3W6SA 3QAYA 2J9AA 2Z3KA 2PJ7A 4OAEA 2ZEOA 2DPTA 2F5IA 4FBEA 1KUXA 4KVOE 4QBJA 3DNSA 2AFWA 1I12A 5CPAA 4KVXA 1I1DA 4EVYA 2GREA 2Z0ZA 2XEIA 4AVCA 2JLMA 4CYPA 1CM0A 1LAPA 2Q4VA 1F2PA 4CGOA 5I0CA 3D68A 4X8IA 5CNPA 1CP7A 4M6HA 2PCUA 1VHSA 4TNUA 1LRZA 3PBEA 3SI2A 1YLEA 3BJ8A 5K8OA 3V7ZA 3B2YA 4FUUA 2FVGA 3NH8A 4PSXA 4HNWB 2DPSA 5E96A 1RO5A 4B5PB 2REEA 2O4HA 3SXOA 4UA3A 3CT9A 3CDXA 4UEZA 4LX9A 1QSRA 3K9TA 4JJXA 4OC4A 3CPXA 3H8GA 4NXYA 4ZYQA 4F9UA 2JEVA 4BMHA 1EE3P 3BXMA 3FF3A 2V8VA 7CPAA 5EC4A 1BPNA 2PJ0A 2VL1A 2NYQA 3WC7A 1BAVA 4CGPA 3SJFA 2B3VA 3D66A 3G3SA 4L89A 5H86A 1YSJA 2AE6A 2IJZA 3V38A 5KTDA 4XPLA 2POKA 3QAHA 3TOBA 4Q38A 3KHXA 2JBKA 4NGTA 3LMSA 4PXCA 3VWEA 4A32A 4OIWA 2R7HA 5LRJA 2D4OA 3T9YA 2Q4ZA 4UFVA 2OZHA 5AG7A 4KOWA 2PIYA 2Q0YA 4PQAA 2XEGA 4UF4A 2IL4A 2QJ8A 3GIUA 1FNOA 3H4QA 4KSAA 3T90A 2PC1A 4HNXB 3PP9A 4OC5A 4QVTA 2I00A 3PB6X 4EFDA 2XEFA 5F46A 4QUSA 3DR6A 3FB3A 4P4BA 4WWVA 1XIXA 3PEIA 5BWAB 4A95A 3RAMA 4AVAA 5ISVA 4OIDA 2PJ1A 2JDDA 4R76A 3B3SA 1TKJA 2DF5A 2G3TA 4XPKA 4ZX9A 5J8CA 1QSMA 2J8NA 2WPXA 1B87A 2JBJA 1BLLE 2ZEHA 3LODA 1OBRA 3LACA 2WSAA 4CGNA 5LRKA 4U9ZA 4P4DA 3TX8A 2C1CA 2RC4A 3IEHA 2VEZA 2ARHA 1BO4A 2Q43A 4EWTA 2JDCA 1BPMA 2P6EA 5HMNA 1Y0YA 4MXUA 1NMTA 4CGLA 4CYOA 4IAVA 2PR1A 3WR7A 1XOVA 2V8GA 4IF5A 4BINA 3DGVA 3H8EA 4U9YA 2QECA 2R1IA 4KSFA 4LQGA 3CXQA 3TO7A 1Q2CA 2PVWA 2PJ8A 5DWNA 4ZY2A 3BJ7A 1XFOA 1Z8WA 3IWWA 4GM5A 2GU2A 2OZGA 4PXEA 2Q4YA 2D4PA 1XMTA 2Z3MA 3GB0A 4ORFA 3V8IA 1U6MA 4DYOA 4MHZA 5LRGA 1ZG7A 3EC4A 1Q2YA 4PXDA 4GXHA 1A2ZA 1P4NA 4UWJA 3NFZA 4A33A 1IOIA 4A94A 3BHXA 5LYLA 4R57A 2VI7A 4NGPA 2XEJA 3NH5A 4RS2A 4JYWA 2B4BA 2CF4A 4IHMA 4KOXA 5F49A 2ANPA 4M6GA 1Y0RA 3I3GA 4HKFA 3FX6A 4OC2A 4H89A 3B3TA 4CYNA 3B3VA 3F5BA 4P4FA 4MCSA 1IU8A 4OADA 4YRHA 2CIJA 5EMIA 4NSQA 1M4DA 3N7ZA 4KORA 4Q36A 5FVJA 3PFEA 4I49A 5IV0A 1VGYA 1M44A 1KZFA 2AFSA 2NSMA 2PJ5A 3IWEA 1AUGA 1S5KA 2IQ6A 4XPDB 2G0BA 2QMLA 2ZW7A 4KUBA 4UIAA 1L0CA 2FT0A 5KTCA 3IWGA 5IB9A 1IOFA 1DE4C 4B13A 5AG4A 3R1KA 5KTAA 2EO8A 1J4JA 1XEBA 4UCMA 2Q44A 3K9UA 3FECA 2EBJA 1RTQA 2PSWA 2ZOGA 3D2PA 5AG5A 3ZJ0A 4DNCA 4B5OA 2PIZA 4C2YA 2YNCC 3FH4A 2JEWA 3PZJA 2HV2A 2P0WA 4NGMA 4B5PA 5JPHA 4NF1A 3OWCA 4NCZA 4OKOA 3EXNA 4NJQA 5JH9A 4PXBA 3FJUA 1Z8TA 2OB0A 1FY7A 2PJ2A 4R3KA 1WWZA 4LQ6A 2REFA 1MK4A 2VZZA 3FXTA 3PB4X 4R3LA 3ZZIA 3D2MA 3PBBA 4UEFA 3EFAA 3KL9A 2GIVA 4DUKA 1NSLA 3CZXA 1ZO0A 4MJ8A 1Y7RA 1S7KA 4P4EA 5F09A 4L8AA 1Z8LA 4CAEA 1ARLA 3MN8A 4MI4A 4A2ZA 5GCNA 1S7NA 4MRIA 3GYAA 4CRZB 4CPAA 2PJAA 1XE4A 4R7MA 4X2TA 3TO6A 3VH9A 3H8FA 5HXDA 4LUAA 3TTHA 3KHZA 3LWUA 2J8MA 3FVLA 1HDQA 4ZY1A 2ZXVA 2FIWA 3IIBA 5JM6A 4JLYA 2Q7SA 4C2ZA 3IU1A 1R43A 1VHEA 5K8MA 4B11A 3W6XA 2B4DB 3H5ZA 5CBMA 4MHDA 3R96A 4MFZA 4DJLA 4R9MA 5HVGA 2HB6A 2Z3NA 4C7IA 4KOSA 1YVOA 3GKRA 3E0KA 3S9NA 4MCQA 2PQ8A 1ON0A 4J3GA 4A31A 3FBUA 4ZGYB 2OZUA 4YWYA 1LFWA 1Q2DA 3IU2A 4NGRA 3L2NA 3WC6A 4NGQA 4AB7A 4KSIA 4KLVA 2YNCA 1P0HA 1S3ZA 2G3AA 3S6KA 1HDUA 1ZLIA 4CAVA 3KR4A 3CPAA 1S7FA 2F8HA 3QNVA 4KZTA 4XPDC 3WABA 4F8ZA 4XNHB 3S6GA 3CXPA 4F0YA 4RI1A 2FSRA 3NE8A 1KUVA 1GHEA 3KZWA 1XBUA 1LANA 1NE9A 1I21A 1WK4A 4NGNA 4WJBA 5LYDA 3FIXA 4MY3A 4W9YA 4P4IA 3PB7X 1R3NA 3C26A 4K3NA 5D29A 2K5TA 4ZX8A 3PRTA 3S6HA 4UCPA 2Z3OA 3B35A 2BOAA 3PB8X 4P10A 4A38A 1Z9UA 2FS5A 1Y9WA 2AFMA 4C7HA 2EUIA 2O53A 2PDOA 4YU9A 1PU9A 2GFQA 2ZOFA 5K8NA 4KOYA 3S9MA 4ZI6A 3PB9X 2BUEA 2WPWA 1V0CA 2ZW5A 1S60A 5A28A 2ZEEA 3S6FA 4PSWA 4OC0A 2C6CA 3ISZA 1IYKA 4CYQA 3I9SA 1YREA 4IK2A 2G9DA 2Q51A 1CPXA 4ONWA 3WC5A 3BI1A 2YGWA 1N71A 1YVKA 2PRQA 2RFHA 4PK2A 4YGOA 4E8OA 2ZEDA 2V8HA 2AFUA 3F8KA 3R9EA 2Q7BA 2Z10A 1X10A 2ODFA 4JD6A 1YGHA 4OC1A 2FIAA 3SXNA 8CPAA 2CTBA 2EVNA 2EWBA 3A9LA 2HC9A 2PJBA 4GS4A 4AG9A 3T8WA 4AXVA 3HUVA 4H6ZA 3R9GA 2B5GB 2HQYA 2R98A 2BSWA 3IFEA 1Z2LA 5DS0A 2FXFA 4CAXA 1CPSA 1IB1E 3KR5A 4H2KA 4Q7AA 4KOTA 5LYFA 2X7BA 4MBUA 4YFJA 1BOBA 2PRBA 2ZPAA 2VZYA 4B14A 2PE3A 1Z4RA 3MRUA 4QB9A 5AGEA 2ZEFA 2YNDA 3EO4A 3RZAA 1IY7A 1R57A 2I79A 1Z5RA 1MJ9A 1YW4A 3DLJA 3UY5A 2CNSA 1YW6A 1TF9A 2PJ4A 3JTKA 4H6UA 4M3SA 4B10A 3JRUA 5J1QA 2PR8A 2PJ3A 1X12A 1CG2A 4FD6A 1YK3A 4XNHC 2C6PA 2ABZA 3B3WA 4PV6A 4X5KA 4A30A 4CRYB 2GANA 1KUYA 5IX3A 1JWQA 2WUUA 4ZY0A 3KQXA 5G21A 3D7DA 3K2KA 5I4MA 3FMCA 3N5FA 4JZ0A 3NE7A 4OLLA 1YR0A 3R9FA 4UEEA 3TT2A 1AMPA 4PPZA 1IYLA 1QSOA 2VQYA 2EK8A 3D7HA 3IJ3A 5DWMA 3FEDA 5JQ4A 1S7LA 3GLJA 3TOAA 4UCNA 4TWEA 3TO9A 2R8VA 2AFOA 4PK3A 1VKCA 2CXAA 3D7GA 4JXRA 2PVVA 5ELYA 1Y9KA 2PJ6A 4FAIA 5K8PA 2ZENA 3KASA 3LD2A 1MJBA 3CXSA 3D4UA 1Q7LA 3JUWA 4E0AA 2ZEMA 1ARMA 4MCPA 4MY0A 2OH1A 2ZELA 1MJAA 3NA6A 3P2FA 3FYNA 2GE3A 4HNYB 2NMTA 4KOVA 4C68A 4NJRA 3SHPA 2FE7A 3NH4A 3VARA 4P4JA 2B4DA 3DR8A 4U5YA 4KLWA 4UFXA 1CP6A 3PFOA 2FCKA 4MFJA 4NEXA 3QB8A 5J8FA 1JQGA 2ATRA 3SJXA 4NGSA 1CBXA 3ISXA 4MCRA 2FL4A 2BL1A 3VATA 5G1ZA 4II9A 2RB7A 4EMEA 1QMUA 4FWUA 2CTCA 2C6GA 1YQEA 4RN7A 4IUSA 2CNMA 2VBQA 4Y49B 3R95A 1ELMP 2F7VA 3D7FA 1LAMA 5JGFA 1UFHA 1AYEA 3TFYA 4A39A 2DXQA 1GYTA 1XJOA 3BLNA 3TE4A 2OU2A 1K4JA 4R6TA 3KQZA 2O28A 3IO1A 2C27A 1KWMA 2BCOA 1Z4EA 4O23A 4UIBA 4QC6A 5IB0A 4KS9A 4C2XA 4G1PA 1LCPA 5HVFA 2PJCA 2DEAA 1LOKA 4M6IA 3FNCA 3RYOA 4AVBA 2H5MA 3DDDA 3TCVA 3D3SA 3FEEA 3WT4A 3RBUA
chains in the Genus database with same CATH topology
1IIDA 3GY9A 3D8PA 3DSBA 2VXKA 5AG6A 5F48A 3P2HA 4JXQA 5H84A 2Z11A 2Z3LA 4UFWA 2J8RA 1YX0A 2CNTA 4FD4A 4KUAA 4CS0B 4F0XA 1IICA 3MGDA 1QSNA 2QIRA 4JWPA 4R87A 1OZPA 2BEIA 4KOUA 3JVNA 4MFPA 4KVME 2B5GA 4BBHA 5EBVA 4K30A 5C88A 1M1DA 5F47A 4MFKA 2ZW4A 1RXTA 3KKWA 4M85A 4MFLA 1CJWA 1B6BA 3PGPA 4FD7A 2KCWA 4ZBGA 2Y0MA 2A4NA 4Y49C 4E2AA 2B3UA 3FRMA 5HH1A 2ZW6A 5G22A 2P6FA 4B12A 4F6AA 2HUZA 1XF8A 3F0AA 1TIQA 2Q04A 1M4GA 2Z3PA 4ONUA 3B8GA 4CAWA 3G8WA 2P6GA 1SQHA 2YNEA 3W91A 4UBRA 4MFQA 2AJ6A 4CAFA 4AG7A 3EY5A 1PUAA 4FD5A 1M4IA 4CGMA 4UWIA 2B58A 2CY2A 3IGRA 5C82A 5A27A 3VWDA 5G20A 1QSTA 3W6SA 4OAEA 2Z3KA 2DPTA 2F5IA 1KUXA 4KVOE 4QBJA 3DNSA 1I12A 4KVXA 1I1DA 4EVYA 2Z0ZA 4AVCA 2JLMA 4CYPA 1CM0A 2Q4VA 4CGOA 5I0CA 5CNPA 1VHSA 1LRZA 1YLEA 3BJ8A 4PSXA 4HNWB 2DPSA 5E96A 1RO5A 4B5PB 2REEA 3SXOA 4UA3A 4LX9A 1QSRA 4JJXA 4NXYA 2JEVA 4BMHA 5EC4A 4CGPA 2B3VA 3G3SA 4L89A 5H86A 2AE6A 5KTDA 4XPLA 3QAHA 3TOBA 4Q38A 3VWEA 4A32A 2R7HA 2D4OA 3T9YA 4UFVA 2OZHA 5AG7A 4KOWA 2Q0YA 2IL4A 3H4QA 4KSAA 3T90A 2PC1A 4HNXB 3PP9A 4QVTA 5F46A 2I00A 4QUSA 3DR6A 3FB3A 5BWAB 1XIXA 4A95A 5ISVA 4AVAA 2JDDA 4XPKA 2G3TA 5J8CA 1QSMA 2J8NA 2WPXA 1B87A 3LODA 4CGNA 2WSAA 4U9ZA 2RC4A 2VEZA 2ARHA 1BO4A 2JDCA 5HMNA 2P6EA 4CGLA 1NMTA 4CYOA 2PR1A 3WR7A 4IF5A 4U9YA 2QECA 2R1IA 4KSFA 3CXQA 3TO7A 1Q2CA 5DWNA 3BJ7A 2OZGA 2Q4YA 2D4PA 1XMTA 2Z3MA 4ORFA 3V8IA 1U6MA 3EC4A 1Q2YA 4A33A 1P4NA 4UWJA 4R57A 2VI7A 4RS2A 2B4BA 4KOXA 5F49A 3I3GA 4HKFA 4H89A 4CYNA 3F5BA 4OADA 4YRHA 4NSQA 1M4DA 3N7ZA 4KORA 4Q36A 5FVJA 4I49A 5IV0A 1M44A 1KZFA 3IWEA 1S5KA 4XPDB 2G0BA 2QMLA 2ZW7A 4KUBA 1L0CA 2FT0A 5KTCA 3IWGA 5KTAA 5AG4A 4B13A 3R1KA 1J4JA 1XEBA 4UCMA 2Q44A 3K9UA 2PSWA 5AG5A 3D2PA 4DNCA 3ZJ0A 4B5OA 4C2YA 2YNCC 3PZJA 2HV2A 2P0WA 4B5PA 5JPHA 4NF1A 3OWCA 4NCZA 3EXNA 2OB0A 1FY7A 4R3KA 1WWZA 2REFA 1MK4A 2VZZA 3FXTA 4R3LA 3ZZIA 3D2MA 3EFAA 2GIVA 1NSLA 1ZO0A 4MJ8A 1Y7RA 1S7KA 4L8AA 4CAEA 4MI4A 4A2ZA 5GCNA 1S7NA 3GYAA 4CRZB 1XE4A 3TO6A 4LUAA 3TTHA 2J8MA 2ZXVA 2FIWA 4JLYA 4C2ZA 3IU1A 4B11A 3W6XA 2B4DB 3H5ZA 4MHDA 3R96A 4MFZA 4R9MA 2Z3NA 4C7IA 4KOSA 1YVOA 3GKRA 3E0KA 2PQ8A 1ON0A 4J3GA 4A31A 3FBUA 4ZGYB 2OZUA 1Q2DA 3IU2A 4AB7A 4KLVA 2YNCA 1P0HA 1S3ZA 2G3AA 3S6KA 4CAVA 4XPDC 1S7FA 4KZTA 4XNHB 3S6GA 3CXPA 4F0YA 4RI1A 2FSRA 1KUVA 1GHEA 1NE9A 1I21A 1WK4A 3FIXA 4MY3A 3C26A 2K5TA 3S6HA 4UCPA 2Z3OA 1Z9UA 2FS5A 1Y9WA 4C7HA 2EUIA 2PDOA 1PU9A 4KOYA 2BUEA 2WPWA 1V0CA 2ZW5A 1S60A 5A28A 3S6FA 4PSWA 4CYQA 1IYKA 3I9SA 1YREA 2YGWA 1N71A 1YVKA 4YGOA 4PK2A 4E8OA 3F8KA 3R9EA 2Q7BA 2Z10A 4JD6A 1YGHA 2FIAA 3SXNA 4AG9A 2EVNA 3A9LA 4GS4A 4H6ZA 3R9GA 2B5GB 2HQYA 2R98A 2BSWA 2FXFA 4CAXA 1IB1E 4KOTA 2X7BA 4MBUA 4YFJA 1BOBA 2PRBA 2ZPAA 2VZYA 4B14A 1Z4RA 4QB9A 5AGEA 2YNDA 3EO4A 1R57A 2I79A 1MJ9A 3UY5A 2CNSA 3JTKA 4H6UA 4M3SA 4B10A 2PR8A 4FD6A 1YK3A 4XNHC 4PV6A 4X5KA 4A30A 4CRYB 2GANA 1KUYA 5IX3A 2WUUA 5G21A 4OLLA 3NE7A 3R9FA 1YR0A 3TT2A 1IYLA 1QSOA 2VQYA 5DWMA 5JQ4A 1S7LA 3TOAA 4UCNA 3TO9A 2R8VA 4PK3A 1VKCA 2CXAA 4JXRA 1Y9KA 3LD2A 1MJBA 3CXSA 3JUWA 4E0AA 4MY0A 2OH1A 1MJAA 3P2FA 3FYNA 2GE3A 4HNYB 2NMTA 4KOVA 4C68A 3SHPA 2FE7A 2B4DA 3DR8A 4U5YA 4KLWA 4UFXA 4MFJA 2FCKA 5J8FA 4NEXA 3QB8A 2ATRA 2FL4A 2BL1A 5G1ZA 4II9A 4IUSA 2CNMA 2VBQA 4Y49B 3R95A 1UFHA 3TFYA 2DXQA 3BLNA 3TE4A 2OU2A 1K4JA 2O28A 2C27A 1Z4EA 5IB0A 4QC6A 4KS9A 4C2XA 3FNCA 3RYOA 4AVBA 2H5MA 3DDDA 3TCVA 3D3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IID A;  3GY9 A;  3D8P A;  3DSB A;  2VXK A;  5F48 A;  3P2H A;  4JXQ A;  5H84 A;  2Z11 A;  2J8R A;  1YX0 A;  2CNT A;  4FD4 A;  4KUA A;  4CS0 B;  1IIC A;  3MGD A;  1QSN A;  2QIR A;  4JWP A;  4R87 A;  1OZP A;  2BEI A;  4KOU A;  3JVN A;  4KVM E;  2B5G A;  5EBV A;  4K30 A;  5C88 A;  1M1D A;  5F47 A;  2ZW4 A;  1RXT A;  3KKW A;  4M85 A;  1CJW A;  1B6B A;  3PGP A;  4FD7 A;  2KCW A;  4ZBG A;  2Y0M A;  2A4N A;  4Y49 C;  4E2A A;  2B3U A;  3FRM A;  5HH1 A;  2ZW6 A;  2P6F A;  4F6A A;  2HUZ A;  1XF8 A;  3F0A A;  1TIQ A;  2Q04 A;  1M4G A;  4ONU A;  3B8G A;  4CAW A;  3G8W A;  2P6G A;  1SQH A;  3W91 A;  4UBR A;  2AJ6 A;  4AG7 A;  3EY5 A;  1PUA A;  4FD5 A;  1M4I A;  4UWI A;  2B58 A;  2CY2 A;  3IGR A;  5C82 A;  3VWD A;  1QST A;  3W6S A;  4OAE A;  2F5I A;  1KUX A;  4KVO E;  4QBJ A;  3DNS A;  1I12 A;  4KVX A;  1I1D A;  4EVY A;  2Z0Z A;  4AVC A;  2JLM A;  1CM0 A;  2Q4V A;  5I0C A;  5CNP A;  1VHS A;  1LRZ A;  1YLE A;  3BJ8 A;  4PSX A;  4HNW B;  5E96 A;  1RO5 A;  4B5P B;  2REE A;  3SXO A;  4UA3 A;  4LX9 A;  1QSR A;  4JJX A;  4NXY A;  2JEV A;  4BMH A;  5EC4 A;  2B3V A;  3G3S A;  4L89 A;  5H86 A;  2AE6 A;  5KTD A;  4XPL A;  3QAH A;  3TOB A;  3VWE A;  2R7H A;  2D4O A;  3T9Y A;  2OZH A;  4KOW A;  2Q0Y A;  2IL4 A;  3H4Q A;  3T90 A;  2PC1 A;  4HNX B;  3PP9 A;  4QVT A;  5F46 A;  2I00 A;  4QUS A;  3DR6 A;  3FB3 A;  1XIX A;  5ISV A;  4AVA A;  2JDD A;  4XPK A;  2G3T A;  5J8C A;  1QSM A;  2J8N A;  2WPX A;  1B87 A;  3LOD A;  4U9Z A;  2RC4 A;  2VEZ A;  2ARH A;  1BO4 A;  2JDC A;  5HMN A;  2P6E A;  1NMT A;  2PR1 A;  3WR7 A;  4IF5 A;  4U9Y A;  2QEC A;  2R1I A;  3CXQ A;  3TO7 A;  1Q2C A;  5DWN A;  3BJ7 A;  2OZG A;  2Q4Y A;  2D4P A;  1XMT A;  4ORF A;  3V8I A;  1U6M A;  3EC4 A;  1Q2Y A;  1P4N A;  4UWJ A;  4R57 A;  2VI7 A;  4RS2 A;  2B4B A;  4KOX A;  5F49 A;  3I3G A;  4HKF A;  4H89 A;  3F5B A;  4OAD A;  4YRH A;  4NSQ A;  1M4D A;  3N7Z A;  4KOR A;  5FVJ A;  4I49 A;  5IV0 A;  1M44 A;  1KZF A;  1S5K A;  4XPD B;  2G0B A;  2QML A;  2ZW7 A;  4KUB A;  1L0C A;  2FT0 A;  5KTC A;  3IWG A;  5KTA A;  3R1K A;  1J4J A;  1XEB A;  2Q44 A;  3K9U A;  2PSW A;  4DNC A;  3D2P A;  3ZJ0 A;  4B5O A;  3PZJ A;  2HV2 A;  2P0W A;  4B5P A;  5JPH A;  4NF1 A;  3OWC A;  4NCZ A;  3EXN A;  2OB0 A;  1FY7 A;  4R3K A;  1WWZ A;  2REF A;  1MK4 A;  2VZZ A;  3FXT A;  4R3L A;  3ZZI A;  3D2M A;  3EFA A;  2GIV A;  1NSL A;  4MJ8 A;  1Y7R A;  1S7K A;  4L8A A;  4MI4 A;  5GCN A;  1S7N A;  3GYA A;  4CRZ B;  1XE4 A;  3TO6 A;  4LUA A;  3TTH A;  2J8M A;  2ZXV A;  2FIW A;  4JLY A;  3W6X A;  2B4D B;  4MHD A;  3R96 A;  4R9M A;  4KOS A;  1YVO A;  3GKR A;  3E0K A;  2PQ8 A;  1ON0 A;  4J3G A;  3FBU A;  2OZU A;  1Q2D A;  4AB7 A;  4KLV A;  1P0H A;  1S3Z A;  2G3A A;  3S6K A;  4CAV A;  4XPD C;  1S7F A;  4KZT A;  4XNH B;  3S6G A;  3CXP A;  4F0Y A;  4RI1 A;  2FSR A;  1KUV A;  1GHE A;  1NE9 A;  1I21 A;  1WK4 A;  3FIX A;  4MY3 A;  3C26 A;  2K5T A;  3S6H A;  1Z9U A;  2FS5 A;  1Y9W A;  2EUI A;  2PDO A;  1PU9 A;  4KOY A;  2BUE A;  2WPW A;  1V0C A;  2ZW5 A;  1S60 A;  3S6F A;  4PSW A;  1IYK A;  3I9S A;  1YRE A;  1N71 A;  1YVK A;  4YGO A;  4PK2 A;  4E8O A;  3F8K A;  3R9E A;  2Q7B A;  2Z10 A;  4JD6 A;  1YGH A;  2FIA A;  3SXN A;  4AG9 A;  2EVN A;  4GS4 A;  4H6Z A;  3R9G A;  2B5G B;  2HQY A;  2R98 A;  2BSW A;  2FXF A;  4CAX A;  1IB1 E;  4KOT A;  2X7B A;  4MBU A;  4YFJ A;  1BOB A;  2PRB A;  2ZPA A;  2VZY A;  1Z4R A;  4QB9 A;  3EO4 A;  1R57 A;  2I79 A;  1MJ9 A;  3UY5 A;  2CNS A;  4H6U A;  4M3S A;  2PR8 A;  4FD6 A;  1YK3 A;  4XNH C;  4PV6 A;  4X5K A;  4CRY B;  2GAN A;  1KUY A;  5IX3 A;  4OLL A;  3NE7 A;  3R9F A;  1YR0 A;  3TT2 A;  1IYL A;  1QSO A;  2VQY A;  5DWM A;  5JQ4 A;  1S7L A;  3TOA A;  3TO9 A;  2R8V A;  4PK3 A;  1VKC A;  4JXR A;  1Y9K A;  3LD2 A;  1MJB A;  3CXS A;  3JUW A;  4E0A A;  4MY0 A;  2OH1 A;  1MJA A;  3P2F A;  3FYN A;  2GE3 A;  4HNY B;  2NMT A;  4KOV A;  3SHP A;  2FE7 A;  2B4D A;  3DR8 A;  4U5Y A;  4KLW A;  2FCK A;  5J8F A;  4NEX A;  3QB8 A;  2ATR A;  2FL4 A;  2BL1 A;  4II9 A;  4IUS A;  2CNM A;  2VBQ A;  4Y49 B;  3R95 A;  1UFH A;  3TFY A;  2DXQ A;  3BLN A;  3TE4 A;  2OU2 A;  1K4J A;  2O28 A;  2C27 A;  1Z4E A;  5IB0 A;  4QC6 A;  3FNC A;  3RYO A;  4AVB A;  2H5M A;  3DDD A;  3TCV A;  3D3S A; 
#chains in the Genus database with same CATH topology
 2EK9 A;  3KGQ A;  1IID A;  1VIX A;  1ZG9 A;  4B6Z A;  3D67 A;  3GY9 A;  4P45 A;  4NFR A;  3D8P A;  3DSB A;  3IC1 A;  4F9V A;  4OC3 A;  1DTD A;  3SJG A;  2VXK A;  3SJE A;  5AG6 A;  5F48 A;  1IGB A;  3P2H A;  2ZEP A;  2PJ9 A;  5THW A;  4BD9 A;  4JXQ A;  3SI1 A;  5H84 A;  2Z11 A;  2Z3L A;  4MHN A;  4UFW A;  4P6Y A;  3KI9 A;  2IMO A;  2J8R A;  1Z8X A;  1YX0 A;  2CNT A;  4FD4 A;  4KUA A;  4CS0 B;  1F57 A;  4F0X A;  3S9L A;  1IIC A;  3MGD A;  1QSN A;  1VHO A;  1YME A;  2QIR A;  4JWP A;  4R87 A;  1OZP A;  2BEI A;  1TKH A;  4KOU A;  3TC8 A;  5LYI A;  1ZG8 A;  1FT7 A;  3JVN A;  4MFP A;  5D8N A;  4KVM E;  2GLJ A;  4OME A;  2B5G A;  4MHY A;  4BBH A;  5EBV A;  4K30 A;  5C88 A;  1M1D A;  5F47 A;  4P44 A;  4RUH A;  1TKF A;  4MFK A;  2ZW4 A;  1HEE A;  1RXT A;  3KKW A;  4M85 A;  1F2O A;  1ZLH A;  4MFL A;  1QQ9 A;  1CJW A;  1B6B A;  1NSA A;  1UWY A;  1ELL P;  2KCW A;  3HLP A;  3PGP A;  4FD7 A;  4ZBG A;  2Y0M A;  4OP4 A;  3RNZ A;  5HVH A;  6CPA A;  2GLF A;  1Y7E A;  2QYV A;  4Z65 A;  2A4N A;  3SI0 A;  4Y49 C;  4E2A A;  2QVP A;  1CX8 A;  2B3U A;  3FRM A;  5HH1 A;  1M4L A;  2ZW6 A;  5G22 A;  4R8F A;  2P6F A;  4B12 A;  2WZN A;  4F6A A;  2HUZ A;  1XF8 A;  3F0A A;  1TIQ A;  2Q04 A;  1M4G A;  2Z3P A;  1TF8 A;  1PCA A;  4ONU A;  2ZEG A;  3B8G A;  1XRY A;  4CAW A;  2OR4 A;  2V8D A;  3G8W A;  3I1U A;  4MMO A;  2AFZ A;  2P6G A;  1SQH A;  2YNE A;  3W91 A;  4UBR A;  4MFQ A;  2AJ6 A;  3BI0 A;  2WYR A;  4CAF A;  1XMB A;  3B3C A;  4AG7 A;  4A37 A;  3EY5 A;  1H8L A;  1PUA A;  4FD5 A;  4X3R A;  1M4I A;  3B7I A;  4CGM A;  2I3C A;  4UWI A;  2V77 A;  3GUX A;  1PYT B;  2B58 A;  2AFX A;  2CY2 A;  4HPS A;  4MHP A;  3IGR A;  3RO0 A;  1YLO A;  2OOT A;  5C82 A;  5A27 A;  3VWD A;  5G20 A;  1QST A;  1TXR A;  2BO9 A;  3W6S A;  3QAY A;  2J9A A;  2Z3K A;  2PJ7 A;  4OAE A;  2ZEO A;  2DPT A;  2F5I A;  4FBE A;  1KUX A;  4KVO E;  4QBJ A;  3DNS A;  2AFW A;  1I12 A;  5CPA A;  4KVX A;  1I1D A;  4EVY A;  2GRE A;  2Z0Z A;  2XEI A;  4AVC A;  2JLM A;  4CYP A;  1CM0 A;  1LAP A;  2Q4V A;  1F2P A;  4CGO A;  5I0C A;  3D68 A;  4X8I A;  5CNP A;  1CP7 A;  4M6H A;  2PCU A;  1VHS A;  4TNU A;  1LRZ A;  3PBE A;  3SI2 A;  1YLE A;  3BJ8 A;  5K8O A;  3V7Z A;  3B2Y A;  4FUU A;  2FVG A;  3NH8 A;  4PSX A;  4HNW B;  2DPS A;  5E96 A;  1RO5 A;  4B5P B;  2REE A;  2O4H A;  3SXO A;  4UA3 A;  3CT9 A;  3CDX A;  4UEZ A;  4LX9 A;  1QSR A;  3K9T A;  4JJX A;  4OC4 A;  3CPX A;  3H8G A;  4NXY A;  4ZYQ A;  4F9U A;  2JEV A;  4BMH A;  1EE3 P;  3BXM A;  3FF3 A;  2V8V A;  7CPA A;  5EC4 A;  1BPN A;  2PJ0 A;  2VL1 A;  2NYQ A;  3WC7 A;  1BAV A;  4CGP A;  3SJF A;  2B3V A;  3D66 A;  3G3S A;  4L89 A;  5H86 A;  1YSJ A;  2AE6 A;  2IJZ A;  3V38 A;  5KTD A;  4XPL A;  2POK A;  3QAH A;  3TOB A;  4Q38 A;  3KHX A;  2JBK A;  4NGT A;  3LMS A;  4PXC A;  3VWE A;  4A32 A;  4OIW A;  2R7H A;  5LRJ A;  2D4O A;  3T9Y A;  2Q4Z A;  4UFV A;  2OZH A;  5AG7 A;  4KOW A;  2PIY A;  2Q0Y A;  4PQA A;  2XEG A;  4UF4 A;  2IL4 A;  2QJ8 A;  3GIU A;  1FNO A;  3H4Q A;  4KSA A;  3T90 A;  2PC1 A;  4HNX B;  3PP9 A;  4OC5 A;  4QVT A;  2I00 A;  3PB6 X;  4EFD A;  2XEF A;  5F46 A;  4QUS A;  3DR6 A;  3FB3 A;  4P4B A;  4WWV A;  1XIX A;  3PEI A;  5BWA B;  4A95 A;  3RAM A;  4AVA A;  5ISV A;  4OID A;  2PJ1 A;  2JDD A;  4R76 A;  3B3S A;  1TKJ A;  2DF5 A;  2G3T A;  4XPK A;  4ZX9 A;  5J8C A;  1QSM A;  2J8N A;  2WPX A;  1B87 A;  2JBJ A;  1BLL E;  2ZEH A;  3LOD A;  1OBR A;  3LAC A;  2WSA A;  4CGN A;  5LRK A;  4U9Z A;  4P4D A;  3TX8 A;  2C1C A;  2RC4 A;  3IEH A;  2VEZ A;  2ARH A;  1BO4 A;  2Q43 A;  4EWT A;  2JDC A;  1BPM A;  2P6E A;  5HMN A;  1Y0Y A;  4MXU A;  1NMT A;  4CGL A;  4CYO A;  4IAV A;  2PR1 A;  3WR7 A;  1XOV A;  2V8G A;  4IF5 A;  4BIN A;  3DGV A;  3H8E A;  4U9Y A;  2QEC A;  2R1I A;  4KSF A;  4LQG A;  3CXQ A;  3TO7 A;  1Q2C A;  2PVW A;  2PJ8 A;  5DWN A;  4ZY2 A;  3BJ7 A;  1XFO A;  1Z8W A;  3IWW A;  4GM5 A;  2GU2 A;  2OZG A;  4PXE A;  2Q4Y A;  2D4P A;  1XMT A;  2Z3M A;  3GB0 A;  4ORF A;  3V8I A;  1U6M A;  4DYO A;  4MHZ A;  5LRG A;  1ZG7 A;  3EC4 A;  1Q2Y A;  4PXD A;  4GXH A;  1A2Z A;  1P4N A;  4UWJ A;  3NFZ A;  4A33 A;  1IOI A;  4A94 A;  3BHX A;  5LYL A;  4R57 A;  2VI7 A;  4NGP A;  2XEJ A;  3NH5 A;  4RS2 A;  4JYW A;  2B4B A;  2CF4 A;  4IHM A;  4KOX A;  5F49 A;  2ANP A;  4M6G A;  1Y0R A;  3I3G A;  4HKF A;  3FX6 A;  4OC2 A;  4H89 A;  3B3T A;  4CYN A;  3B3V A;  3F5B A;  4P4F A;  4MCS A;  1IU8 A;  4OAD A;  4YRH A;  2CIJ A;  5EMI A;  4NSQ A;  1M4D A;  3N7Z A;  4KOR A;  4Q36 A;  5FVJ A;  3PFE A;  4I49 A;  5IV0 A;  1VGY A;  1M44 A;  1KZF A;  2AFS A;  2NSM A;  2PJ5 A;  3IWE A;  1AUG A;  1S5K A;  2IQ6 A;  4XPD B;  2G0B A;  2QML A;  2ZW7 A;  4KUB A;  4UIA A;  1L0C A;  2FT0 A;  5KTC A;  3IWG A;  5IB9 A;  1IOF A;  1DE4 C;  4B13 A;  5AG4 A;  3R1K A;  5KTA A;  2EO8 A;  1J4J A;  1XEB A;  4UCM A;  2Q44 A;  3K9U A;  3FEC A;  2EBJ A;  1RTQ A;  2PSW A;  2ZOG A;  3D2P A;  5AG5 A;  3ZJ0 A;  4DNC A;  4B5O A;  2PIZ A;  4C2Y A;  2YNC C;  3FH4 A;  2JEW A;  3PZJ A;  2HV2 A;  2P0W A;  4NGM A;  4B5P A;  5JPH A;  4NF1 A;  3OWC A;  4NCZ A;  4OKO A;  3EXN A;  4NJQ A;  5JH9 A;  4PXB A;  3FJU A;  1Z8T A;  2OB0 A;  1FY7 A;  2PJ2 A;  4R3K A;  1WWZ A;  4LQ6 A;  2REF A;  1MK4 A;  2VZZ A;  3FXT A;  3PB4 X;  4R3L A;  3ZZI A;  3D2M A;  3PBB A;  4UEF A;  3EFA A;  3KL9 A;  2GIV A;  4DUK A;  1NSL A;  3CZX A;  1ZO0 A;  4MJ8 A;  1Y7R A;  1S7K A;  4P4E A;  5F09 A;  4L8A A;  1Z8L A;  4CAE A;  1ARL A;  3MN8 A;  4MI4 A;  4A2Z A;  5GCN A;  1S7N A;  4MRI A;  3GYA A;  4CRZ B;  4CPA A;  2PJA A;  1XE4 A;  4R7M A;  4X2T A;  3TO6 A;  3VH9 A;  3H8F A;  5HXD A;  4LUA A;  3TTH A;  3KHZ A;  3LWU A;  2J8M A;  3FVL A;  1HDQ A;  4ZY1 A;  2ZXV A;  2FIW A;  3IIB A;  5JM6 A;  4JLY A;  2Q7S A;  4C2Z A;  3IU1 A;  1R43 A;  1VHE A;  5K8M A;  4B11 A;  3W6X A;  2B4D B;  3H5Z A;  5CBM A;  4MHD A;  3R96 A;  4MFZ A;  4DJL A;  4R9M A;  5HVG A;  2HB6 A;  2Z3N A;  4C7I A;  4KOS A;  1YVO A;  3GKR A;  3E0K A;  3S9N A;  4MCQ A;  2PQ8 A;  1ON0 A;  4J3G A;  4A31 A;  3FBU A;  4ZGY B;  2OZU A;  4YWY A;  1LFW A;  1Q2D A;  3IU2 A;  4NGR A;  3L2N A;  3WC6 A;  4NGQ A;  4AB7 A;  4KSI A;  4KLV A;  2YNC A;  1P0H A;  1S3Z A;  2G3A A;  3S6K A;  1HDU A;  1ZLI A;  4CAV A;  3KR4 A;  3CPA A;  1S7F A;  2F8H A;  3QNV A;  4KZT A;  4XPD C;  3WAB A;  4F8Z A;  4XNH B;  3S6G A;  3CXP A;  4F0Y A;  4RI1 A;  2FSR A;  3NE8 A;  1KUV A;  1GHE A;  3KZW A;  1XBU A;  1LAN A;  1NE9 A;  1I21 A;  1WK4 A;  4NGN A;  4WJB A;  5LYD A;  3FIX A;  4MY3 A;  4W9Y A;  4P4I A;  3PB7 X;  1R3N A;  3C26 A;  4K3N A;  5D29 A;  2K5T A;  4ZX8 A;  3PRT A;  3S6H A;  4UCP A;  2Z3O A;  3B35 A;  2BOA A;  3PB8 X;  4P10 A;  4A38 A;  1Z9U A;  2FS5 A;  1Y9W A;  2AFM A;  4C7H A;  2EUI A;  2O53 A;  2PDO A;  4YU9 A;  1PU9 A;  2GFQ A;  2ZOF A;  5K8N A;  4KOY A;  3S9M A;  4ZI6 A;  3PB9 X;  2BUE A;  2WPW A;  1V0C A;  2ZW5 A;  1S60 A;  5A28 A;  2ZEE A;  3S6F A;  4PSW A;  4OC0 A;  2C6C A;  3ISZ A;  1IYK A;  4CYQ A;  3I9S A;  1YRE A;  4IK2 A;  2G9D A;  2Q51 A;  1CPX A;  4ONW A;  3WC5 A;  3BI1 A;  2YGW A;  1N71 A;  1YVK A;  2PRQ A;  2RFH A;  4PK2 A;  4YGO A;  4E8O A;  2ZED A;  2V8H A;  2AFU A;  3F8K A;  3R9E A;  2Q7B A;  2Z10 A;  1X10 A;  2ODF A;  4JD6 A;  1YGH A;  4OC1 A;  2FIA A;  3SXN A;  8CPA A;  2CTB A;  2EVN A;  2EWB A;  3A9L A;  2HC9 A;  2PJB A;  4GS4 A;  4AG9 A;  3T8W A;  4AXV A;  3HUV A;  4H6Z A;  3R9G A;  2B5G B;  2HQY A;  2R98 A;  2BSW A;  3IFE A;  1Z2L A;  5DS0 A;  2FXF A;  4CAX A;  1CPS A;  1IB1 E;  3KR5 A;  4H2K A;  4Q7A A;  4KOT A;  5LYF A;  2X7B A;  4MBU A;  4YFJ A;  1BOB A;  2PRB A;  2ZPA A;  2VZY A;  4B14 A;  2PE3 A;  1Z4R A;  3MRU A;  4QB9 A;  5AGE A;  2ZEF A;  2YND A;  3EO4 A;  3RZA A;  1IY7 A;  1R57 A;  2I79 A;  1Z5R A;  1MJ9 A;  1YW4 A;  3DLJ A;  3UY5 A;  2CNS A;  1YW6 A;  1TF9 A;  2PJ4 A;  3JTK A;  4H6U A;  4M3S A;  4B10 A;  3JRU A;  5J1Q A;  2PR8 A;  2PJ3 A;  1X12 A;  1CG2 A;  4FD6 A;  1YK3 A;  4XNH C;  2C6P A;  2ABZ A;  3B3W A;  4PV6 A;  4X5K A;  4A30 A;  4CRY B;  2GAN A;  1KUY A;  5IX3 A;  1JWQ A;  2WUU A;  4ZY0 A;  3KQX A;  5G21 A;  3D7D A;  3K2K A;  5I4M A;  3FMC A;  3N5F A;  4JZ0 A;  3NE7 A;  4OLL A;  1YR0 A;  3R9F A;  4UEE A;  3TT2 A;  1AMP A;  4PPZ A;  1IYL A;  1QSO A;  2VQY A;  2EK8 A;  3D7H A;  3IJ3 A;  5DWM A;  3FED A;  5JQ4 A;  1S7L A;  3GLJ A;  3TOA A;  4UCN A;  4TWE A;  3TO9 A;  2R8V A;  2AFO A;  4PK3 A;  1VKC A;  2CXA A;  3D7G A;  4JXR A;  2PVV A;  5ELY A;  1Y9K A;  2PJ6 A;  4FAI A;  5K8P A;  2ZEN A;  3KAS A;  3LD2 A;  1MJB A;  3CXS A;  3D4U A;  1Q7L A;  3JUW A;  4E0A A;  2ZEM A;  1ARM A;  4MCP A;  4MY0 A;  2OH1 A;  2ZEL A;  1MJA A;  3NA6 A;  3P2F A;  3FYN A;  2GE3 A;  4HNY B;  2NMT A;  4KOV A;  4C68 A;  4NJR A;  3SHP A;  2FE7 A;  3NH4 A;  3VAR A;  4P4J A;  2B4D A;  3DR8 A;  4U5Y A;  4KLW A;  4UFX A;  1CP6 A;  3PFO A;  2FCK A;  4MFJ A;  4NEX A;  3QB8 A;  5J8F A;  1JQG A;  2ATR A;  3SJX A;  4NGS A;  1CBX A;  3ISX A;  4MCR A;  2FL4 A;  2BL1 A;  3VAT A;  5G1Z A;  4II9 A;  2RB7 A;  4EME A;  1QMU A;  4FWU A;  2CTC A;  2C6G A;  1YQE A;  4RN7 A;  4IUS A;  2CNM A;  2VBQ A;  4Y49 B;  3R95 A;  1ELM P;  2F7V A;  3D7F A;  1LAM A;  5JGF A;  1UFH A;  1AYE A;  3TFY A;  4A39 A;  2DXQ A;  1GYT A;  1XJO A;  3BLN A;  3TE4 A;  2OU2 A;  1K4J A;  4R6T A;  3KQZ A;  2O28 A;  3IO1 A;  2C27 A;  1KWM A;  2BCO A;  1Z4E A;  4O23 A;  4UIB A;  4QC6 A;  5IB0 A;  4KS9 A;  4C2X A;  4G1P A;  1LCP A;  5HVF A;  2PJC A;  2DEA A;  1LOK A;  4M6I A;  3FNC A;  3RYO A;  4AVB A;  2H5M A;  3DDD A;  3TCV A;  3D3S A;  3FEE A;  3WT4 A;  3RBU A; 
#chains in the Genus database with same CATH homology
 1IID A;  3GY9 A;  3D8P A;  3DSB A;  2VXK A;  5AG6 A;  5F48 A;  3P2H A;  4JXQ A;  5H84 A;  2Z11 A;  2Z3L A;  4UFW A;  2J8R A;  1YX0 A;  2CNT A;  4FD4 A;  4KUA A;  4CS0 B;  4F0X A;  1IIC A;  3MGD A;  1QSN A;  2QIR A;  4JWP A;  4R87 A;  1OZP A;  2BEI A;  4KOU A;  3JVN A;  4MFP A;  4KVM E;  2B5G A;  4BBH A;  5EBV A;  4K30 A;  5C88 A;  1M1D A;  5F47 A;  4MFK A;  2ZW4 A;  1RXT A;  3KKW A;  4M85 A;  4MFL A;  1CJW A;  1B6B A;  3PGP A;  4FD7 A;  2KCW A;  4ZBG A;  2Y0M A;  2A4N A;  4Y49 C;  4E2A A;  2B3U A;  3FRM A;  5HH1 A;  2ZW6 A;  5G22 A;  2P6F A;  4B12 A;  4F6A A;  2HUZ A;  1XF8 A;  3F0A A;  1TIQ A;  2Q04 A;  1M4G A;  2Z3P A;  4ONU A;  3B8G A;  4CAW A;  3G8W A;  2P6G A;  1SQH A;  2YNE A;  3W91 A;  4UBR A;  4MFQ A;  2AJ6 A;  4CAF A;  4AG7 A;  3EY5 A;  1PUA A;  4FD5 A;  1M4I A;  4CGM A;  4UWI A;  2B58 A;  2CY2 A;  3IGR A;  5C82 A;  5A27 A;  3VWD A;  5G20 A;  1QST A;  3W6S A;  4OAE A;  2Z3K A;  2DPT A;  2F5I A;  1KUX A;  4KVO E;  4QBJ A;  3DNS A;  1I12 A;  4KVX A;  1I1D A;  4EVY A;  2Z0Z A;  4AVC A;  2JLM A;  4CYP A;  1CM0 A;  2Q4V A;  4CGO A;  5I0C A;  5CNP A;  1VHS A;  1LRZ A;  1YLE A;  3BJ8 A;  4PSX A;  4HNW B;  2DPS A;  5E96 A;  1RO5 A;  4B5P B;  2REE A;  3SXO A;  4UA3 A;  4LX9 A;  1QSR A;  4JJX A;  4NXY A;  2JEV A;  4BMH A;  5EC4 A;  4CGP A;  2B3V A;  3G3S A;  4L89 A;  5H86 A;  2AE6 A;  5KTD A;  4XPL A;  3QAH A;  3TOB A;  4Q38 A;  3VWE A;  4A32 A;  2R7H A;  2D4O A;  3T9Y A;  4UFV A;  2OZH A;  5AG7 A;  4KOW A;  2Q0Y A;  2IL4 A;  3H4Q A;  4KSA A;  3T90 A;  2PC1 A;  4HNX B;  3PP9 A;  4QVT A;  5F46 A;  2I00 A;  4QUS A;  3DR6 A;  3FB3 A;  5BWA B;  1XIX A;  4A95 A;  5ISV A;  4AVA A;  2JDD A;  4XPK A;  2G3T A;  5J8C A;  1QSM A;  2J8N A;  2WPX A;  1B87 A;  3LOD A;  4CGN A;  2WSA A;  4U9Z A;  2RC4 A;  2VEZ A;  2ARH A;  1BO4 A;  2JDC A;  5HMN A;  2P6E A;  4CGL A;  1NMT A;  4CYO A;  2PR1 A;  3WR7 A;  4IF5 A;  4U9Y A;  2QEC A;  2R1I A;  4KSF A;  3CXQ A;  3TO7 A;  1Q2C A;  5DWN A;  3BJ7 A;  2OZG A;  2Q4Y A;  2D4P A;  1XMT A;  2Z3M A;  4ORF A;  3V8I A;  1U6M A;  3EC4 A;  1Q2Y A;  4A33 A;  1P4N A;  4UWJ A;  4R57 A;  2VI7 A;  4RS2 A;  2B4B A;  4KOX A;  5F49 A;  3I3G A;  4HKF A;  4H89 A;  4CYN A;  3F5B A;  4OAD A;  4YRH A;  4NSQ A;  1M4D A;  3N7Z A;  4KOR A;  4Q36 A;  5FVJ A;  4I49 A;  5IV0 A;  1M44 A;  1KZF A;  3IWE A;  1S5K A;  4XPD B;  2G0B A;  2QML A;  2ZW7 A;  4KUB A;  1L0C A;  2FT0 A;  5KTC A;  3IWG A;  5KTA A;  5AG4 A;  4B13 A;  3R1K A;  1J4J A;  1XEB A;  4UCM A;  2Q44 A;  3K9U A;  2PSW A;  5AG5 A;  3D2P A;  4DNC A;  3ZJ0 A;  4B5O A;  4C2Y A;  2YNC C;  3PZJ A;  2HV2 A;  2P0W A;  4B5P A;  5JPH A;  4NF1 A;  3OWC A;  4NCZ A;  3EXN A;  2OB0 A;  1FY7 A;  4R3K A;  1WWZ A;  2REF A;  1MK4 A;  2VZZ A;  3FXT A;  4R3L A;  3ZZI A;  3D2M A;  3EFA A;  2GIV A;  1NSL A;  1ZO0 A;  4MJ8 A;  1Y7R A;  1S7K A;  4L8A A;  4CAE A;  4MI4 A;  4A2Z A;  5GCN A;  1S7N A;  3GYA A;  4CRZ B;  1XE4 A;  3TO6 A;  4LUA A;  3TTH A;  2J8M A;  2ZXV A;  2FIW A;  4JLY A;  4C2Z A;  3IU1 A;  4B11 A;  3W6X A;  2B4D B;  3H5Z A;  4MHD A;  3R96 A;  4MFZ A;  4R9M A;  2Z3N A;  4C7I A;  4KOS A;  1YVO A;  3GKR A;  3E0K A;  2PQ8 A;  1ON0 A;  4J3G A;  4A31 A;  3FBU A;  4ZGY B;  2OZU A;  1Q2D A;  3IU2 A;  4AB7 A;  4KLV A;  2YNC A;  1P0H A;  1S3Z A;  2G3A A;  3S6K A;  4CAV A;  4XPD C;  1S7F A;  4KZT A;  4XNH B;  3S6G A;  3CXP A;  4F0Y A;  4RI1 A;  2FSR A;  1KUV A;  1GHE A;  1NE9 A;  1I21 A;  1WK4 A;  3FIX A;  4MY3 A;  3C26 A;  2K5T A;  3S6H A;  4UCP A;  2Z3O A;  1Z9U A;  2FS5 A;  1Y9W A;  4C7H A;  2EUI A;  2PDO A;  1PU9 A;  4KOY A;  2BUE A;  2WPW A;  1V0C A;  2ZW5 A;  1S60 A;  5A28 A;  3S6F A;  4PSW A;  4CYQ A;  1IYK A;  3I9S A;  1YRE A;  2YGW A;  1N71 A;  1YVK A;  4YGO A;  4PK2 A;  4E8O A;  3F8K A;  3R9E A;  2Q7B A;  2Z10 A;  4JD6 A;  1YGH A;  2FIA A;  3SXN A;  4AG9 A;  2EVN A;  3A9L A;  4GS4 A;  4H6Z A;  3R9G A;  2B5G B;  2HQY A;  2R98 A;  2BSW A;  2FXF A;  4CAX A;  1IB1 E;  4KOT A;  2X7B A;  4MBU A;  4YFJ A;  1BOB A;  2PRB A;  2ZPA A;  2VZY A;  4B14 A;  1Z4R A;  4QB9 A;  5AGE A;  2YND A;  3EO4 A;  1R57 A;  2I79 A;  1MJ9 A;  3UY5 A;  2CNS A;  3JTK A;  4H6U A;  4M3S A;  4B10 A;  2PR8 A;  4FD6 A;  1YK3 A;  4XNH C;  4PV6 A;  4X5K A;  4A30 A;  4CRY B;  2GAN A;  1KUY A;  5IX3 A;  2WUU A;  5G21 A;  4OLL A;  3NE7 A;  3R9F A;  1YR0 A;  3TT2 A;  1IYL A;  1QSO A;  2VQY A;  5DWM A;  5JQ4 A;  1S7L A;  3TOA A;  4UCN A;  3TO9 A;  2R8V A;  4PK3 A;  1VKC A;  2CXA A;  4JXR A;  1Y9K A;  3LD2 A;  1MJB A;  3CXS A;  3JUW A;  4E0A A;  4MY0 A;  2OH1 A;  1MJA A;  3P2F A;  3FYN A;  2GE3 A;  4HNY B;  2NMT A;  4KOV A;  4C68 A;  3SHP A;  2FE7 A;  2B4D A;  3DR8 A;  4U5Y A;  4KLW A;  4UFX A;  4MFJ A;  2FCK A;  5J8F A;  4NEX A;  3QB8 A;  2ATR A;  2FL4 A;  2BL1 A;  5G1Z A;  4II9 A;  4IUS A;  2CNM A;  2VBQ A;  4Y49 B;  3R95 A;  1UFH A;  3TFY A;  2DXQ A;  3BLN A;  3TE4 A;  2OU2 A;  1K4J A;  2O28 A;  2C27 A;  1Z4E A;  5IB0 A;  4QC6 A;  4KS9 A;  4C2X A;  3FNC A;  3RYO A;  4AVB A;  2H5M A;  3DDD A;  3TCV A;  3D3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...