1YX0A

Solution structure of bacillus subtilis protein ysne: the northeast structural genomics consortium target sr220
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
151
structure length
151
Chain Sequence
MHIKIDDLTGRQVVSLVNEHLHSMTLMSPPESIHALGLEKLRGPEITFWSAWEGDELAGCGALKELDTRHGEIKSMRTSASHLRKGVAKQVLQHIIEEAEKRGYERLSLETGSMASFEPARKLYESFGFQYCEPFADYGEDPNSVFMTKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein ysnE
publication title Solution Structure of Bacillus subtilis Protein ysnE
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Structural genomics, unknown function
total genus 20
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1yx0A00
4KOSA 2G0BA 3EY5A 4DNCA 4R57A 4JD6A 1Z9UA 2CNTA 3R1KA 4LUAA 4E0AA 3T90A 3W91A 3CXPA 4UA3A 3BJ7A 4CAVA 2PR8A 2QIRA 4NF1A 4XPLA 3VWEA 2FIWA 4PSXA 4KORA 1R57A 1Y9KA 4JXQA 4MY0A 4CS0B 3TTHA 2HUZA 2Q0YA 1VKCA 3FBUA 2Z11A 4AVCA 1IYLA 4J3GA 3S6FA 3S6GA 1Y9WA 1WK4A 3S6HA 2P6EA 2ZPAA 1YLEA 2CNSA 4B5OA 4U9ZA 4HNYB 2FCKA 2H5MA 4MI4A 1YVKA 4HNXB 2ZW6A 3C26A 4HNWB 4R3LA 2A4NA 4H6ZA 4R9MA 5GCNA 1IB1E 1TIQA 2EUIA 3LD2A 5I0CA 1S3ZA 3R96A 3TFYA 3ZJ0A 5CNPA 2R1IA 2AE6A 4U5YA 3R9FA 1XIXA 1I21A 1IICA 3TT2A 4CRYB 3FB3A 1NMTA 1Q2CA 4QC6A 1IIDA 4BMHA 3I9SA 4E8OA 1BO4A 2QMLA 3CXQA 3QAHA 2VEZA 4K30A 2R98A 2Z10A 5KTAA 4NSQA 2FL4A 4KLVA 3FNCA 2KCWA 3KKWA 1B87A 2PQ8A 4AVBA 3F5BA 2CNMA 1YREA 1OZPA 4FD6A 5IX3A 1NSLA 4OADA 1YK3A 4KOXA 3SXOA 1N71A 3NE7A 4H89A 3DNSA 3FXTA 4MY3A 1YGHA 2BUEA 1KZFA 1P4NA 5H86A 2OZGA 3H4QA 3R9EA 4II9A 4KOVA 3BJ8A 1MJBA 1Q2YA 4NEXA 4MBUA 4QUSA 1YVOA 4F6AA 4ZBGA 2REFA 2J8MA 1XF8A 3DR8A 1FY7A 2Q04A 2JEVA 3SHPA 2OH1A 4IUSA 2ATRA 3PZJA 2G3AA 4ONUA 2B4DB 4EVYA 2GANA 5JQ4A 3K9UA 2ZW4A 3R95A 1SQHA 4UWJA 3DR6A 1XE4A 4AB7A 1KUYA 3JUWA 4X5KA 4KUBA 3N7ZA 4KLWA 3D2MA 1I12A 1PU9A 1QSOA 1KUVA 2VXKA 2PDOA 4UWIA 4KOTA 2B5GB 1Y7RA 1M4DA 1M4IA 5DWMA 4XPKA 2PRBA 1BOBA 2P0WA 1QSMA 3GKRA 2VBQA 2J8NA 2B58A 5EC4A 4FD7A 4CAXA 4PSWA 2OZHA 3FRMA 1LRZA 2FS5A 2F5IA 2Y0MA 4YGOA 2DXQA 5HH1A 2WPWA 4KOWA 1WWZA 1S5KA 5JPHA 2WPXA 3D2PA 3LODA 5KTCA 3QB8A 1KUXA 4LX9A 4YRHA 1YX0A 4FD5A 4PK3A 1QSRA 4GS4A 2EVNA 2HV2A 3PGPA 4RI1A 4F0YA 4ORFA 1QSNA 2Q7BA 4RS2A 3UY5A 4XNHC 1Q2DA 3F0AA 3EXNA 3W6XA 2REEA 4CAWA 3D3SA 1S7NA 4OAEA 5F49A 3F8KA 2VI7A 1L0CA 3RYOA 4L89A 4IF5A 1Z4RA 1M44A 4KVOE 3TOAA 4MJ8A 2O28A 5J8CA 1K4JA 2GE3A 4JXRA 1P0HA 2C27A 3CXSA 3V8IA 3T9YA 4CRZB 2X7BA 2B3VA 2FT0A 3B8GA 4AG9A 2I00A 4XNHB 3OWCA 2OZUA 2GIVA 4XPDB 2JLMA 3FIXA 2ARHA 1MK4A 1V0CA 2FE7A 2AJ6A 4B5PB 2OU2A 4B5PA 2QECA 1QSTA 2B4DA 2Q4VA 4AVAA 2P6GA 2RC4A 4KOUA 4JWPA 1M4GA 1NE9A 3IWGA 4H6UA 4JJXA 3TO9A 2VZYA 2D4PA 3DDDA 1ON0A 5DWNA 4M3SA 4KOYA 4Y49B 3R9GA 4KVXA 2R8VA 1CM0A 2VQYA 4JLYA 2IL4A 4L8AA 2B5GA 3G3SA 4R3KA 2ZXVA 1S60A 2JDCA 1PUAA 3EO4A 2PSWA 2VZZA 1M1DA 5F48A 1U6MA 3GY9A 1VHSA 4UBRA 4KUAA 1B6BA 2NMTA 4PV6A 3FYNA 3BLNA 3ZZIA 4AG7A 2FSRA 3EFAA 4NCZA 3W6SA 5F46A 4U9YA 1IYKA 2BL1A 3EC4A 4I49A 3G8WA 1I1DA 3S6KA 3D8PA 2B3UA 1MJ9A 2D4OA 4YFJA 4R87A 3JVNA 1XMTA 2CY2A 5IV0A 4M85A 3PP9A 4QBJA 5HMNA 1RXTA 1GHEA 3TO7A 4NXYA 1UFHA 3GYAA 3VWDA 1S7FA 4KVME 2HQYA 3TOBA 2PC1A 3TO6A 5H84A 4E2AA 3IGRA 5J8FA 4XPDC 3TE4A 3E0KA 5E96A 2P6FA 1J4JA 3P2HA 4KZTA 4MHDA 5C82A 3TCVA 4HKFA 2R7HA 2K5TA 4QVTA 2Z0ZA 1S7KA 1RO5A 3DSBA 1MJAA 4PK2A 3SXNA 3I3GA 5FVJA 2FIAA 5KTDA 2B4BA 3WR7A 1YR0A 2Q44A 2Q4YA 4Y49C 5C88A 5ISVA 2BEIA 1S7LA 1XEBA 4QB9A 5IB0A 1Z4EA 4OLLA 2I79A 2ZW5A 2J8RA 2OB0A 2BSWA 3MGDA 2PR1A 2G3TA 2JDDA 2ZW7A 1CJWA 3P2FA 2FXFA 5EBVA 4FD4A 5F47A
chains in the Genus database with same CATH superfamily
3IIBA 2YGWA 4KOSA 2G0BA 1Y0YA 3EY5A 4Z65A 4DNCA 4R57A 2DPSA 4JD6A 2QVPA 1CX8A 1IU8A 1Z9UA 2Q4ZA 1IOIA 2CNTA 3PBBA 3R1KA 1BAVA 1ARLA 2QJ8A 1YW4A 4LUAA 3T90A 4E0AA 3W91A 3CXPA 3NH4A 2ZEOA 4UA3A 4OIWA 1Y0RA 2C6PA 3BJ7A 4CAVA 2AFSA 1F2OA 2PJ5A 2RFHA 2PR8A 2QIRA 3BI1A 3IWWA 4H2KA 4NF1A 4NGTA 4XPLA 5AGEA 3VWEA 2FIWA 1TKFA 4PSXA 4KORA 1R57A 3D66A 3LACA 1Y9KA 4EWTA 4JXQA 4MY0A 4CS0B 2PIYA 2HUZA 3TTHA 2Q0YA 4R8FA 2ZENA 1CPXA 1VKCA 5HVGA 3FBUA 4R6TA 2Z11A 4UFVA 4AVCA 3CPXA 1IYLA 2AFWA 3KI9A 4J3GA 4OC2A 4TWEA 3FMCA 3S6FA 1LAMA 3S6GA 1OBRA 1AUGA 2CTCA 1ELMP 1Y9WA 1WK4A 3S6HA 2P6EA 4F8ZA 4UF4A 3RZAA 2WYRA 2ZPAA 1YLEA 1YW6A 2CNSA 4B5OA 4U9ZA 4HNYB 2FCKA 4CPAA 5AG4A 4B12A 5EMIA 2H5MA 4MI4A 1XJOA 3L2NA 1LFWA 4Q36A 1YVKA 4HNXB 2ZW6A 3C26A 1ZLIA 4HNWB 4MXUA 2VL1A 4ZY2A 1Z8XA 4MCQA 4R3LA 2A4NA 2O4HA 4H6ZA 2WUUA 6CPAA 1KWMA 4R9MA 5LRGA 5GCNA 2PRQA 3FEDA 3GB0A 3ISZA 2F7VA 1CG2A 3H8GA 1IB1E 1TIQA 2EUIA 3LD2A 1PCAA 5I0CA 4A39A 5K8MA 1S3ZA 2CTBA 3R96A 3TFYA 1A2ZA 2BCOA 2DF5A 3ZJ0A 3H5ZA 2CIJA 5CNPA 2R1IA 3S9LA 4C7IA 4MFLA 2AE6A 4A38A 1YLOA 4U5YA 3R9FA 1XIXA 1I21A 1IICA 3TT2A 3SI0A 3VARA 4CRYB 3FB3A 2POKA 2WZNA 1NSAA 1NMTA 4P4BA 1Q2CA 2PJ3A 4QC6A 3FEEA 4KSFA 1IIDA 3PFEA 4BMHA 3I9SA 3IFEA 4E8OA 1BO4A 2QMLA 3CXQA 3QAHA 1JQGA 1TKHA 2VEZA 3KZWA 2BOAA 5K8NA 4K30A 1LAPA 3LWUA 4FBEA 2R98A 2YNCC 4MMOA 2Z10A 5KTAA 4NSQA 5JM6A 5J1QA 2FL4A 4KLVA 1Z2LA 4FAIA 3FNCA 2Q51A 3SJFA 1TF9A 2KCWA 3KHXA 1QMUA 1X10A 1B87A 2PQ8A 3KKWA 4AVBA 3PFOA 2IJZA 3D7DA 4ZY0A 2PVVA 4P10A 3F5BA 2CNMA 1YREA 4MHYA 5LYIA 1OZPA 4FD6A 5IX3A 1XOVA 1NSLA 3NH8A 1CP7A 3BHXA 3N5FA 1Z8WA 2Z3PA 4OADA 4P4IA 1YK3A 2AFXA 4KOXA 2ZOFA 3SXOA 1N71A 3BXMA 3NE7A 4H89A 3DNSA 4UEEA 2ZEEA 4A33A 3FXTA 4MFPA 3TC8A 4NGRA 4YWYA 5LYLA 4MY3A 3IU1A 1IY7A 1H8LA 2AFMA 5LYFA 1YGHA 2BUEA 1VGYA 1KZFA 4YU9A 1P4NA 5H86A 2OZGA 4P4EA 2PJ9A 3H4QA 3IC1A 2CF4A 3R9EA 4II9A 3TX8A 4KOVA 2PJ6A 4BINA 3WC7A 3B3SA 4IK2A 2IQ6A 4NGSA 3D7FA 3PRTA 4MFZA 3SJEA 3BJ8A 1MJBA 5F09A 3D67A 4M6GA 4X2TA 2ABZA 1Q2YA 3IO1A 1ARMA 2YNCA 1YSJA 4NEXA 2EK8A 5HXDA 4HPSA 3GLJA 4CYQA 1F57A 4MBUA 1YVOA 4QUSA 4F6AA 4NGPA 3GUXA 4RN7A 4ZBGA 2REFA 2JEWA 2J8MA 5AG6A 1XF8A 3PB7X 3FECA 2C6CA 3DR8A 1FY7A 2Q04A 2JEVA 4P6YA 2OH1A 3SHPA 3SI2A 4IUSA 3K2KA 2ATRA 2PE3A 3PZJA 2G3AA 1IOFA 3V7ZA 4CGNA 4ONUA 2B4DB 1DE4C 2EK9A 2HB6A 3D7HA 2GANA 4OC1A 5HVFA 4B10A 1X12A 4CGLA 4EVYA 5JQ4A 7CPAA 2NSMA 5AG5A 3K9UA 4C2XA 3WC6A 1Z5RA 2ZW4A 3R95A 4A37A 1SQHA 2XEIA 2IMOA 4UWJA 3RO0A 3DR6A 1XE4A 2PIZA 5G1ZA 4AB7A 3B7IA 1KUYA 3JUWA 2ODFA 2PJ0A 4KS9A 4KUBA 4X5KA 4TNUA 3N7ZA 4KLWA 3D2MA 1I12A 4OP4A 1PU9A 4WWVA 1QSOA 5G21A 1KUVA 2VXKA 2PDOA 2I3CA 4UWIA 4KOTA 3QNVA 2B5GB 1Y7RA 4MHZA 1M4DA 4B13A 1M4IA 5A28A 2XEFA 1ZO0A 2Z3KA 4UIBA 5DWMA 5DS0A 4XPKA 5LRJA 1VHOA 2PRBA 4CGPA 1BOBA 2P0WA 1QSMA 3GKRA 2PJBA 3NFZA 4PPZA 2VBQA 2EO8A 5K8OA 2ZOGA 4NJQA 5A27A 2J8NA 1PYTB 2B58A 2PJCA 4PQAA 4CYPA 3H8FA 4KSIA 1LANA 4FD7A 5EC4A 2YNDA 4CAXA 4PSWA 2EWBA 2AFUA 5CPAA 3JTKA 4ZX8A 3FX6A 2OZHA 3FRMA 1LRZA 2FS5A 4CAEA 2GFQA 1CBXA 2PJ4A 1BPNA 3KR5A 2F5IA 4Q38A 2QYVA 4UEZA 2Y0MA 4YGOA 2OR4A 2DXQA 5HH1A 1FT7A 5HVHA 2WPWA 4KOWA 4BD9A 1WWZA 1AMPA 3WABA 4Q7AA 1S5KA 2EBJA 3IWEA 2PJ8A 5JPHA 3WT4A 1VHEA 1IGBA 2WPXA 3D2PA 3KL9A 3LODA 4FUUA 4ZGYB 4C7HA 1ELLP 5KTCA 2ANPA 3QB8A 3PB9X 4UIAA 1KUXA 2BO9A 4UCMA 5JGFA 2GREA 3S9NA 4OC0A 4LX9A 2ZEGA 1YX0A 4FD5A 4MFQA 4PK3A 1QSRA 3NE8A 4YRHA 1ZG8A 4MFKA 2V8VA 4GS4A 2EVNA 2HV2A 3PGPA 4RI1A 3PB4X 3RNZA 4F0YA 2YNEA 4X3RA 4ORFA 2GU2A 5IB9A 5ISVA 1QSNA 2Q7BA 4RS2A 1XMBA 3UY5A 2NYQA 4XNHC 1Q2DA 1Z8TA 3F0AA 3EXNA 3W6XA 2REEA 2JBKA 4CAWA 1R43A 3D3SA 1S7NA 4OAEA 4BBHA 4P45A 3ISXA 5F49A 3F8KA 2PVWA 2VI7A 1L0CA 2C6GA 3RYOA 3T8WA 4OIDA 4ONWA 2Q43A 4IF5A 4L89A 3JRUA 1Z4RA 4OKOA 1M44A 4KVOE 4MRIA 4MJ8A 1HEEA 4JYWA 3TOAA 5LRKA 2O28A 4R7MA 5J8CA 1K4JA 1DTDA 4CYOA 4A31A 2GE3A 4JXRA 2PJ1A 1HDQA 4A32A 4IAVA 1P0HA 2CXAA 3DGVA 4MCPA 2C27A 3PEIA 3HUVA 3CXSA 1VIXA 4IHMA 2DPTA 2O53A 3V8IA 3T9YA 2Z3LA 4CRZB 2X7BA 2B3VA 2J9AA 2Q7SA 3CT9A 2FT0A 3B8GA 4AG9A 2I00A 2ZEPA 2V77A 4B14A 4XNHB 4MFJA 2ZEDA 3OWCA 3D68A 4M6IA 4PXBA 2OZUA 2GIVA 4UFXA 4F0XA 4LQGA 4XPDB 2JLMA 3FIXA 4PXEA 3A9LA 2ARHA 3GIUA 3DLJA 3LMSA 1MK4A 1ZLHA 1V0CA 3VATA 2FE7A 2AJ6A 4W9YA 4F9VA 1XRYA 2ZEHA 4B5PB 1QQ9A 1HDUA 2XEJA 2OU2A 3HLPA 4EMEA 4B5PA 4CAFA 3FH4A 1GYTA 2QECA 1ZG9A 3KASA 1Q7LA 1QSTA 2Z3NA 2ZELA 2B4DA 2PCUA 2Q4VA 4PXCA 2P6GA 4AVAA 2RC4A 4CGMA 4KOUA 4OMEA 4JWPA 1M4GA 1NE9A 3IWGA 4H6UA 3KGQA 2Z3MA 4JJXA 2VZYA 2D4PA 3TO9A 3B3VA 4P4DA 4B6ZA 3DDDA 3FJUA 5ELYA 1ON0A 2FVGA 5DWNA 4M3SA 4KOYA 4DJLA 1CP6A 1XBUA 1EE3P 3KHZA 4Y49B 4FWUA 3R9GA 1TXRA 4KVXA 2R8VA 1FNOA 3KQZA 1ZG7A 2Z3OA 2ZEFA 1CM0A 4OC4A 2VQYA 3QAYA 4C2YA 4JLYA 2IL4A 4L8AA 2B5GA 3G3SA 2V8HA 3IEHA 4R3KA 4R76A 5G20A 5I4MA 2ZXVA 4P4JA 3KR4A 1S60A 2JDCA 1PUAA 3EO4A 2PSWA 2VZZA 1M1DA 3SJGA 5F48A 1U6MA 3GY9A 1VHSA 4AXVA 4UBRA 4KUAA 2OOTA 4A2ZA 4DUKA 1B6BA 2NMTA 3B3WA 3D7GA 3PB6X 2AFZA 4MCRA 4UCNA 3IU2A 4NJRA 4PV6A 5THWA 3FYNA 2HC9A 3BLNA 2WSAA 3RAMA 3ZZIA 2FSRA 4AG7A 4PXDA 3EFAA 1AYEA 4NCZA 3W6SA 5F46A 1UWYA 1BLLE 1YMEA 4U9YA 4GM5A 5AG7A 1IYKA 2BL1A 2ZEMA 3EC4A 4I49A 4X8IA 3I1UA 3G8WA 4G1PA 4JZ0A 1BPMA 1I1DA 4M6HA 3B2YA 4O23A 3B3CA 3S6KA 3D8PA 2B3UA 1MJ9A 4K3NA 3NH5A 3S9MA 1R3NA 2D4OA 1JWQA 4YFJA 4R87A 4UCPA 3JVNA 1XMTA 2CY2A 1CPSA 5IV0A 3PB8X 1F2PA 1M4LA 4M85A 1LOKA 4WJBA 4NGQA 4CYNA 4MHPA 4OC5A 3PP9A 4QBJA 2PJ2A 1XFOA 4LQ6A 4UFWA 1LCPA 4P4FA 4ZYQA 3FVLA 5HMNA 3V38A 1RXTA 1GHEA 3TO7A 4NXYA 1UFHA 3GYAA 2AFOA 3VWDA 4ZX9A 3KQXA 1S7FA 2C1CA 4KVME 2HQYA 3TOBA 2PC1A 3TO6A 1RTQA 5CBMA 4A30A 5H84A 4E2AA 3IGRA 4DYOA 4XPDC 5J8FA 3NA6A 3CDXA 3TE4A 5LYDA 3B35A 4ZY1A 3RBUA 3E0KA 3PBEA 5E96A 2V8GA 4RUHA 2GLFA 4F9UA 2P6FA 1J4JA 3P2HA 4C2ZA 4KZTA 4A95A 4MHDA 5C82A 3TCVA 1TF8A 3B3TA 4NGNA 4A94A 3BI0A 4HKFA 5K8PA 2R7HA 1Y7EA 2K5TA 2JBJA 2RB7A 4QVTA 2Z0ZA 1S7KA 1RO5A 1TKJA 3CPAA 3DSBA 3FF3A 5G22A 5D8NA 4NGMA 1MJAA 3WC5A 2PJ7A 4PK2A 3SXNA 3I3GA 5D29A 2FIAA 4GXHA 5FVJA 4CGOA 2V8DA 5KTDA 2B4BA 3WR7A 1YR0A 2Q44A 2Q4YA 4Y49C 1YQEA 3CZXA 5C88A 2XEGA 4MHNA 4P44A 2BEIA 3K9TA 1S7LA 5BWAB 4NFRA 1XEBA 4QB9A 3H8EA 1Z4EA 4OLLA 5IB0A 3D4UA 2I79A 4UEFA 2ZW5A 4OC3A 2J8RA 4C68A 4ZI6A 2OB0A 2F8HA 4EFDA 4KSAA 3SI1A 8CPAA 5JH9A 2GLJA 2BSWA 3MGDA 3MRUA 2PR1A 1Z8LA 3SJXA 2G3TA 2G9DA 3VH9A 2DEAA 4MCSA 2PJAA 2JDDA 2ZW7A 3IJ3A 1CJWA 3P2FA 2FXFA 3MN8A 5EBVA 4B11A 4FD4A 5F47A
chains in the Genus database with same CATH topology
2YGWA 4KOSA 2G0BA 3EY5A 4DNCA 4R57A 2DPSA 4JD6A 1Z9UA 2CNTA 3R1KA 4LUAA 4E0AA 3T90A 3W91A 3CXPA 4UA3A 3BJ7A 4CAVA 2PR8A 2QIRA 5AGEA 4NF1A 4XPLA 3VWEA 2FIWA 4PSXA 4KORA 1R57A 1Y9KA 4JXQA 4MY0A 4CS0B 3TTHA 2HUZA 2Q0YA 1VKCA 3FBUA 2Z11A 4UFVA 4AVCA 1IYLA 4J3GA 3S6FA 3S6GA 1Y9WA 1WK4A 3S6HA 2P6EA 2ZPAA 1YLEA 2CNSA 4B5OA 4U9ZA 4HNYB 2FCKA 5AG4A 4B12A 2H5MA 4MI4A 4Q36A 1YVKA 4HNXB 2ZW6A 3C26A 4HNWB 4R3LA 2A4NA 4H6ZA 2WUUA 4R9MA 5GCNA 1IB1E 1TIQA 2EUIA 3LD2A 5I0CA 1S3ZA 3R96A 3TFYA 3ZJ0A 3H5ZA 5CNPA 2R1IA 4C7IA 4MFLA 2AE6A 4U5YA 3R9FA 1XIXA 1I21A 1IICA 3TT2A 4CRYB 3FB3A 1NMTA 1Q2CA 4QC6A 4KSFA 1IIDA 4BMHA 3I9SA 4E8OA 1BO4A 2QMLA 3CXQA 3QAHA 2VEZA 4K30A 2R98A 2YNCC 2Z10A 5KTAA 4NSQA 2FL4A 4KLVA 3FNCA 2KCWA 3KKWA 1B87A 2PQ8A 4AVBA 3F5BA 2CNMA 1YREA 1OZPA 4FD6A 5IX3A 1NSLA 5A28A 2Z3PA 4OADA 1YK3A 4KOXA 3SXOA 1N71A 3NE7A 4H89A 3DNSA 4A33A 3FXTA 4MFPA 4MY3A 3IU1A 1YGHA 2BUEA 1KZFA 1P4NA 5H86A 2OZGA 3H4QA 3R9EA 4II9A 4KOVA 4MFZA 3BJ8A 1MJBA 1Q2YA 2YNCA 4NEXA 4CYQA 4MBUA 4QUSA 1YVOA 4F6AA 4ZBGA 2REFA 2J8MA 5AG6A 1XF8A 3DR8A 1FY7A 2Q04A 2JEVA 3SHPA 2OH1A 4IUSA 2ATRA 3PZJA 2G3AA 4CGNA 4ONUA 2B4DB 4EVYA 2GANA 4B10A 4CGLA 5JQ4A 5AG5A 3K9UA 4C2XA 2ZW4A 3R95A 1SQHA 4UWJA 3DR6A 1XE4A 5G1ZA 4AB7A 1KUYA 3JUWA 4X5KA 4KS9A 4KUBA 3N7ZA 4KLWA 3D2MA 1I12A 1PU9A 1QSOA 5G21A 1KUVA 2VXKA 2PDOA 4UWIA 4KOTA 2B5GB 1Y7RA 1M4DA 4B13A 1M4IA 1ZO0A 2Z3KA 5DWMA 4XPKA 2PRBA 4CGPA 1BOBA 2P0WA 1QSMA 3GKRA 2VBQA 5A27A 2J8NA 2B58A 4CYPA 5EC4A 4FD7A 2YNDA 4CAXA 4PSWA 3JTKA 2OZHA 3FRMA 1LRZA 2FS5A 4CAEA 4Q38A 2F5IA 2Y0MA 4YGOA 2DXQA 5HH1A 2WPWA 4KOWA 1WWZA 1S5KA 3IWEA 5JPHA 2WPXA 3D2PA 3LODA 4ZGYB 4C7HA 5KTCA 3QB8A 1KUXA 4UCMA 4LX9A 4YRHA 1YX0A 4FD5A 4MFQA 4PK3A 1QSRA 4MFKA 4GS4A 2EVNA 2HV2A 3PGPA 4RI1A 4F0YA 2YNEA 4ORFA 1QSNA 2Q7BA 4RS2A 3UY5A 4XNHC 1Q2DA 3F0AA 3EXNA 3W6XA 2REEA 4CAWA 3D3SA 1S7NA 4OAEA 4BBHA 5F49A 3F8KA 2VI7A 1L0CA 3RYOA 4L89A 4IF5A 1Z4RA 1M44A 4KVOE 3TOAA 4MJ8A 2O28A 5J8CA 1K4JA 4CYOA 4A31A 2GE3A 4JXRA 4A32A 1P0HA 2CXAA 2C27A 3CXSA 2DPTA 3V8IA 3T9YA 2Z3LA 4CRZB 2X7BA 2B3VA 2FT0A 3B8GA 4AG9A 2I00A 4B14A 4XNHB 4MFJA 3OWCA 2OZUA 2GIVA 4UFXA 4F0XA 4XPDB 2JLMA 3FIXA 3A9LA 2ARHA 1MK4A 1V0CA 2FE7A 2AJ6A 4B5PB 2OU2A 4B5PA 4CAFA 2QECA 1QSTA 2Z3NA 2B4DA 2Q4VA 4AVAA 4CGMA 2P6GA 2RC4A 4KOUA 4JWPA 4JJXA 1M4GA 1NE9A 3IWGA 4H6UA 2Z3MA 3TO9A 2VZYA 2D4PA 3DDDA 1ON0A 5DWNA 4M3SA 4KOYA 4Y49B 3R9GA 4KVXA 2R8VA 2Z3OA 1CM0A 2VQYA 4C2YA 4JLYA 2IL4A 4L8AA 2B5GA 3G3SA 4R3KA 5G20A 2ZXVA 1S60A 2JDCA 1PUAA 3EO4A 2PSWA 2VZZA 1M1DA 5F48A 1U6MA 3GY9A 1VHSA 4UBRA 4KUAA 4A2ZA 1B6BA 2NMTA 4UCNA 3IU2A 4PV6A 3FYNA 3BLNA 2WSAA 3ZZIA 4AG7A 2FSRA 3EFAA 4NCZA 3W6SA 5F46A 4U9YA 5AG7A 1IYKA 2BL1A 3EC4A 4I49A 3G8WA 1I1DA 3S6KA 3D8PA 2B3UA 1MJ9A 2D4OA 4YFJA 4R87A 4UCPA 3JVNA 1XMTA 2CY2A 5IV0A 4M85A 4CYNA 3PP9A 4QBJA 4UFWA 5HMNA 1RXTA 1GHEA 3TO7A 4NXYA 1UFHA 3GYAA 3VWDA 1S7FA 4KVME 2HQYA 3TOBA 2PC1A 3TO6A 4A30A 5H84A 4E2AA 3IGRA 5J8FA 4XPDC 3TE4A 3E0KA 5E96A 2P6FA 1J4JA 3P2HA 4C2ZA 4KZTA 4A95A 4MHDA 5C82A 3TCVA 4HKFA 2R7HA 2K5TA 4QVTA 2Z0ZA 1S7KA 1RO5A 3DSBA 5G22A 1MJAA 4PK2A 3SXNA 3I3GA 5FVJA 2FIAA 4CGOA 5KTDA 2B4BA 3WR7A 1YR0A 2Q44A 2Q4YA 4Y49C 5C88A 5ISVA 2BEIA 5BWAB 1S7LA 1XEBA 4QB9A 5IB0A 1Z4EA 4OLLA 2I79A 2ZW5A 2J8RA 4C68A 2OB0A 4KSAA 2BSWA 3MGDA 2PR1A 2G3TA 2JDDA 2ZW7A 1CJWA 3P2FA 2FXFA 5EBVA 4B11A 4FD4A 5F47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOS A;  2G0B A;  3EY5 A;  4DNC A;  4R57 A;  4JD6 A;  1Z9U A;  2CNT A;  3R1K A;  4LUA A;  4E0A A;  3T90 A;  3W91 A;  3CXP A;  4UA3 A;  3BJ7 A;  4CAV A;  2PR8 A;  2QIR A;  4NF1 A;  4XPL A;  3VWE A;  2FIW A;  4PSX A;  4KOR A;  1R57 A;  1Y9K A;  4JXQ A;  4MY0 A;  4CS0 B;  3TTH A;  2HUZ A;  2Q0Y A;  1VKC A;  3FBU A;  2Z11 A;  4AVC A;  1IYL A;  4J3G A;  3S6F A;  3S6G A;  1Y9W A;  1WK4 A;  3S6H A;  2P6E A;  2ZPA A;  1YLE A;  2CNS A;  4B5O A;  4U9Z A;  4HNY B;  2FCK A;  2H5M A;  4MI4 A;  1YVK A;  4HNX B;  2ZW6 A;  3C26 A;  4HNW B;  4R3L A;  2A4N A;  4H6Z A;  4R9M A;  5GCN A;  1IB1 E;  1TIQ A;  2EUI A;  3LD2 A;  5I0C A;  1S3Z A;  3R96 A;  3TFY A;  3ZJ0 A;  5CNP A;  2R1I A;  2AE6 A;  4U5Y A;  3R9F A;  1XIX A;  1I21 A;  1IIC A;  3TT2 A;  4CRY B;  3FB3 A;  1NMT A;  1Q2C A;  4QC6 A;  1IID A;  4BMH A;  3I9S A;  4E8O A;  1BO4 A;  2QML A;  3CXQ A;  3QAH A;  2VEZ A;  4K30 A;  2R98 A;  2Z10 A;  5KTA A;  4NSQ A;  2FL4 A;  4KLV A;  3FNC A;  2KCW A;  3KKW A;  1B87 A;  2PQ8 A;  4AVB A;  3F5B A;  2CNM A;  1YRE A;  1OZP A;  4FD6 A;  5IX3 A;  1NSL A;  4OAD A;  1YK3 A;  4KOX A;  3SXO A;  1N71 A;  3NE7 A;  4H89 A;  3DNS A;  3FXT A;  4MY3 A;  1YGH A;  2BUE A;  1KZF A;  1P4N A;  5H86 A;  2OZG A;  3H4Q A;  3R9E A;  4II9 A;  4KOV A;  3BJ8 A;  1MJB A;  1Q2Y A;  4NEX A;  4MBU A;  4QUS A;  1YVO A;  4F6A A;  4ZBG A;  2REF A;  2J8M A;  1XF8 A;  3DR8 A;  1FY7 A;  2Q04 A;  2JEV A;  3SHP A;  2OH1 A;  4IUS A;  2ATR A;  3PZJ A;  2G3A A;  4ONU A;  2B4D B;  4EVY A;  2GAN A;  5JQ4 A;  3K9U A;  2ZW4 A;  3R95 A;  1SQH A;  4UWJ A;  3DR6 A;  1XE4 A;  4AB7 A;  1KUY A;  3JUW A;  4X5K A;  4KUB A;  3N7Z A;  4KLW A;  3D2M A;  1I12 A;  1PU9 A;  1QSO A;  1KUV A;  2VXK A;  2PDO A;  4UWI A;  4KOT A;  2B5G B;  1Y7R A;  1M4D A;  1M4I A;  5DWM A;  4XPK A;  2PRB A;  1BOB A;  2P0W A;  1QSM A;  3GKR A;  2VBQ A;  2J8N A;  2B58 A;  5EC4 A;  4FD7 A;  4CAX A;  4PSW A;  2OZH A;  3FRM A;  1LRZ A;  2FS5 A;  2F5I A;  2Y0M A;  4YGO A;  2DXQ A;  5HH1 A;  2WPW A;  4KOW A;  1WWZ A;  1S5K A;  5JPH A;  2WPX A;  3D2P A;  3LOD A;  5KTC A;  3QB8 A;  1KUX A;  4LX9 A;  4YRH A;  1YX0 A;  4FD5 A;  4PK3 A;  1QSR A;  4GS4 A;  2EVN A;  2HV2 A;  3PGP A;  4RI1 A;  4F0Y A;  4ORF A;  1QSN A;  2Q7B A;  4RS2 A;  3UY5 A;  4XNH C;  1Q2D A;  3F0A A;  3EXN A;  3W6X A;  2REE A;  4CAW A;  3D3S A;  1S7N A;  4OAE A;  5F49 A;  3F8K A;  2VI7 A;  1L0C A;  3RYO A;  4L89 A;  4IF5 A;  1Z4R A;  1M44 A;  4KVO E;  3TOA A;  4MJ8 A;  2O28 A;  5J8C A;  1K4J A;  2GE3 A;  4JXR A;  1P0H A;  2C27 A;  3CXS A;  3V8I A;  3T9Y A;  4CRZ B;  2X7B A;  2B3V A;  2FT0 A;  3B8G A;  4AG9 A;  2I00 A;  4XNH B;  3OWC A;  2OZU A;  2GIV A;  4XPD B;  2JLM A;  3FIX A;  2ARH A;  1MK4 A;  1V0C A;  2FE7 A;  2AJ6 A;  4B5P B;  2OU2 A;  4B5P A;  2QEC A;  1QST A;  2B4D A;  2Q4V A;  4AVA A;  2P6G A;  2RC4 A;  4KOU A;  4JWP A;  1M4G A;  1NE9 A;  3IWG A;  4H6U A;  4JJX A;  3TO9 A;  2VZY A;  2D4P A;  3DDD A;  1ON0 A;  5DWN A;  4M3S A;  4KOY A;  4Y49 B;  3R9G A;  4KVX A;  2R8V A;  1CM0 A;  2VQY A;  4JLY A;  2IL4 A;  4L8A A;  2B5G A;  3G3S A;  4R3K A;  2ZXV A;  1S60 A;  2JDC A;  1PUA A;  3EO4 A;  2PSW A;  2VZZ A;  1M1D A;  5F48 A;  1U6M A;  3GY9 A;  1VHS A;  4UBR A;  4KUA A;  1B6B A;  2NMT A;  4PV6 A;  3FYN A;  3BLN A;  3ZZI A;  4AG7 A;  2FSR A;  3EFA A;  4NCZ A;  3W6S A;  5F46 A;  4U9Y A;  1IYK A;  2BL1 A;  3EC4 A;  4I49 A;  3G8W A;  1I1D A;  3S6K A;  3D8P A;  2B3U A;  1MJ9 A;  2D4O A;  4YFJ A;  4R87 A;  3JVN A;  1XMT A;  2CY2 A;  5IV0 A;  4M85 A;  3PP9 A;  4QBJ A;  5HMN A;  1RXT A;  1GHE A;  3TO7 A;  4NXY A;  1UFH A;  3GYA A;  3VWD A;  1S7F A;  4KVM E;  2HQY A;  3TOB A;  2PC1 A;  3TO6 A;  5H84 A;  4E2A A;  3IGR A;  5J8F A;  4XPD C;  3TE4 A;  3E0K A;  5E96 A;  2P6F A;  1J4J A;  3P2H A;  4KZT A;  4MHD A;  5C82 A;  3TCV A;  4HKF A;  2R7H A;  2K5T A;  4QVT A;  2Z0Z A;  1S7K A;  1RO5 A;  3DSB A;  1MJA A;  4PK2 A;  3SXN A;  3I3G A;  5FVJ A;  2FIA A;  5KTD A;  2B4B A;  3WR7 A;  1YR0 A;  2Q44 A;  2Q4Y A;  4Y49 C;  5C88 A;  5ISV A;  2BEI A;  1S7L A;  1XEB A;  4QB9 A;  5IB0 A;  1Z4E A;  4OLL A;  2I79 A;  2ZW5 A;  2J8R A;  2OB0 A;  2BSW A;  3MGD A;  2PR1 A;  2G3T A;  2JDD A;  2ZW7 A;  1CJW A;  3P2F A;  2FXF A;  5EBV A;  4FD4 A;  5F47 A; 
#chains in the Genus database with same CATH topology
 3IIB A;  2YGW A;  4KOS A;  2G0B A;  1Y0Y A;  3EY5 A;  4Z65 A;  4DNC A;  4R57 A;  2DPS A;  4JD6 A;  2QVP A;  1CX8 A;  1IU8 A;  1Z9U A;  2Q4Z A;  1IOI A;  2CNT A;  3PBB A;  3R1K A;  1BAV A;  1ARL A;  2QJ8 A;  1YW4 A;  4LUA A;  3T90 A;  4E0A A;  3W91 A;  3CXP A;  3NH4 A;  2ZEO A;  4UA3 A;  4OIW A;  1Y0R A;  2C6P A;  3BJ7 A;  4CAV A;  2AFS A;  1F2O A;  2PJ5 A;  2RFH A;  2PR8 A;  2QIR A;  3BI1 A;  3IWW A;  4H2K A;  4NF1 A;  4NGT A;  4XPL A;  5AGE A;  3VWE A;  2FIW A;  1TKF A;  4PSX A;  4KOR A;  1R57 A;  3D66 A;  3LAC A;  1Y9K A;  4EWT A;  4JXQ A;  4MY0 A;  4CS0 B;  2PIY A;  2HUZ A;  3TTH A;  2Q0Y A;  4R8F A;  2ZEN A;  1CPX A;  1VKC A;  5HVG A;  3FBU A;  4R6T A;  2Z11 A;  4UFV A;  4AVC A;  3CPX A;  1IYL A;  2AFW A;  3KI9 A;  4J3G A;  4OC2 A;  4TWE A;  3FMC A;  3S6F A;  1LAM A;  3S6G A;  1OBR A;  1AUG A;  2CTC A;  1ELM P;  1Y9W A;  1WK4 A;  3S6H A;  2P6E A;  4F8Z A;  4UF4 A;  3RZA A;  2WYR A;  2ZPA A;  1YLE A;  1YW6 A;  2CNS A;  4B5O A;  4U9Z A;  4HNY B;  2FCK A;  4CPA A;  5AG4 A;  4B12 A;  5EMI A;  2H5M A;  4MI4 A;  1XJO A;  3L2N A;  1LFW A;  4Q36 A;  1YVK A;  4HNX B;  2ZW6 A;  3C26 A;  1ZLI A;  4HNW B;  4MXU A;  2VL1 A;  4ZY2 A;  1Z8X A;  4MCQ A;  4R3L A;  2A4N A;  2O4H A;  4H6Z A;  2WUU A;  6CPA A;  1KWM A;  4R9M A;  5LRG A;  5GCN A;  2PRQ A;  3FED A;  3GB0 A;  3ISZ A;  2F7V A;  1CG2 A;  3H8G A;  1IB1 E;  1TIQ A;  2EUI A;  3LD2 A;  1PCA A;  5I0C A;  4A39 A;  5K8M A;  1S3Z A;  2CTB A;  3R96 A;  3TFY A;  1A2Z A;  2BCO A;  2DF5 A;  3ZJ0 A;  3H5Z A;  2CIJ A;  5CNP A;  2R1I A;  3S9L A;  4C7I A;  4MFL A;  2AE6 A;  4A38 A;  1YLO A;  4U5Y A;  3R9F A;  1XIX A;  1I21 A;  1IIC A;  3TT2 A;  3SI0 A;  3VAR A;  4CRY B;  3FB3 A;  2POK A;  2WZN A;  1NSA A;  1NMT A;  4P4B A;  1Q2C A;  2PJ3 A;  4QC6 A;  3FEE A;  4KSF A;  1IID A;  3PFE A;  4BMH A;  3I9S A;  3IFE A;  4E8O A;  1BO4 A;  2QML A;  3CXQ A;  3QAH A;  1JQG A;  1TKH A;  2VEZ A;  3KZW A;  2BOA A;  5K8N A;  4K30 A;  1LAP A;  3LWU A;  4FBE A;  2R98 A;  2YNC C;  4MMO A;  2Z10 A;  5KTA A;  4NSQ A;  5JM6 A;  5J1Q A;  2FL4 A;  4KLV A;  1Z2L A;  4FAI A;  3FNC A;  2Q51 A;  3SJF A;  1TF9 A;  2KCW A;  3KHX A;  1QMU A;  1X10 A;  1B87 A;  2PQ8 A;  3KKW A;  4AVB A;  3PFO A;  2IJZ A;  3D7D A;  4ZY0 A;  2PVV A;  4P10 A;  3F5B A;  2CNM A;  1YRE A;  4MHY A;  5LYI A;  1OZP A;  4FD6 A;  5IX3 A;  1XOV A;  1NSL A;  3NH8 A;  1CP7 A;  3BHX A;  3N5F A;  1Z8W A;  2Z3P A;  4OAD A;  4P4I A;  1YK3 A;  2AFX A;  4KOX A;  2ZOF A;  3SXO A;  1N71 A;  3BXM A;  3NE7 A;  4H89 A;  3DNS A;  4UEE A;  2ZEE A;  4A33 A;  3FXT A;  4MFP A;  3TC8 A;  4NGR A;  4YWY A;  5LYL A;  4MY3 A;  3IU1 A;  1IY7 A;  1H8L A;  2AFM A;  5LYF A;  1YGH A;  2BUE A;  1VGY A;  1KZF A;  4YU9 A;  1P4N A;  5H86 A;  2OZG A;  4P4E A;  2PJ9 A;  3H4Q A;  3IC1 A;  2CF4 A;  3R9E A;  4II9 A;  3TX8 A;  4KOV A;  2PJ6 A;  4BIN A;  3WC7 A;  3B3S A;  4IK2 A;  2IQ6 A;  4NGS A;  3D7F A;  3PRT A;  4MFZ A;  3SJE A;  3BJ8 A;  1MJB A;  5F09 A;  3D67 A;  4M6G A;  4X2T A;  2ABZ A;  1Q2Y A;  3IO1 A;  1ARM A;  2YNC A;  1YSJ A;  4NEX A;  2EK8 A;  5HXD A;  4HPS A;  3GLJ A;  4CYQ A;  1F57 A;  4MBU A;  1YVO A;  4QUS A;  4F6A A;  4NGP A;  3GUX A;  4RN7 A;  4ZBG A;  2REF A;  2JEW A;  2J8M A;  5AG6 A;  1XF8 A;  3PB7 X;  3FEC A;  2C6C A;  3DR8 A;  1FY7 A;  2Q04 A;  2JEV A;  4P6Y A;  2OH1 A;  3SHP A;  3SI2 A;  4IUS A;  3K2K A;  2ATR A;  2PE3 A;  3PZJ A;  2G3A A;  1IOF A;  3V7Z A;  4CGN A;  4ONU A;  2B4D B;  1DE4 C;  2EK9 A;  2HB6 A;  3D7H A;  2GAN A;  4OC1 A;  5HVF A;  4B10 A;  1X12 A;  4CGL A;  4EVY A;  5JQ4 A;  7CPA A;  2NSM A;  5AG5 A;  3K9U A;  4C2X A;  3WC6 A;  1Z5R A;  2ZW4 A;  3R95 A;  4A37 A;  1SQH A;  2XEI A;  2IMO A;  4UWJ A;  3RO0 A;  3DR6 A;  1XE4 A;  2PIZ A;  5G1Z A;  4AB7 A;  3B7I A;  1KUY A;  3JUW A;  2ODF A;  2PJ0 A;  4KS9 A;  4KUB A;  4X5K A;  4TNU A;  3N7Z A;  4KLW A;  3D2M A;  1I12 A;  4OP4 A;  1PU9 A;  4WWV A;  1QSO A;  5G21 A;  1KUV A;  2VXK A;  2PDO A;  2I3C A;  4UWI A;  4KOT A;  3QNV A;  2B5G B;  1Y7R A;  4MHZ A;  1M4D A;  4B13 A;  1M4I A;  5A28 A;  2XEF A;  1ZO0 A;  2Z3K A;  4UIB A;  5DWM A;  5DS0 A;  4XPK A;  5LRJ A;  1VHO A;  2PRB A;  4CGP A;  1BOB A;  2P0W A;  1QSM A;  3GKR A;  2PJB A;  3NFZ A;  4PPZ A;  2VBQ A;  2EO8 A;  5K8O A;  2ZOG A;  4NJQ A;  5A27 A;  2J8N A;  1PYT B;  2B58 A;  2PJC A;  4PQA A;  4CYP A;  3H8F A;  4KSI A;  1LAN A;  4FD7 A;  5EC4 A;  2YND A;  4CAX A;  4PSW A;  2EWB A;  2AFU A;  5CPA A;  3JTK A;  4ZX8 A;  3FX6 A;  2OZH A;  3FRM A;  1LRZ A;  2FS5 A;  4CAE A;  2GFQ A;  1CBX A;  2PJ4 A;  1BPN A;  3KR5 A;  2F5I A;  4Q38 A;  2QYV A;  4UEZ A;  2Y0M A;  4YGO A;  2OR4 A;  2DXQ A;  5HH1 A;  1FT7 A;  5HVH A;  2WPW A;  4KOW A;  4BD9 A;  1WWZ A;  1AMP A;  3WAB A;  4Q7A A;  1S5K A;  2EBJ A;  3IWE A;  2PJ8 A;  5JPH A;  3WT4 A;  1VHE A;  1IGB A;  2WPX A;  3D2P A;  3KL9 A;  3LOD A;  4FUU A;  4ZGY B;  4C7H A;  1ELL P;  5KTC A;  2ANP A;  3QB8 A;  3PB9 X;  4UIA A;  1KUX A;  2BO9 A;  4UCM A;  5JGF A;  2GRE A;  3S9N A;  4OC0 A;  4LX9 A;  2ZEG A;  1YX0 A;  4FD5 A;  4MFQ A;  4PK3 A;  1QSR A;  3NE8 A;  4YRH A;  1ZG8 A;  4MFK A;  2V8V A;  4GS4 A;  2EVN A;  2HV2 A;  3PGP A;  4RI1 A;  3PB4 X;  3RNZ A;  4F0Y A;  2YNE A;  4X3R A;  4ORF A;  2GU2 A;  5IB9 A;  5ISV A;  1QSN A;  2Q7B A;  4RS2 A;  1XMB A;  3UY5 A;  2NYQ A;  4XNH C;  1Q2D A;  1Z8T A;  3F0A A;  3EXN A;  3W6X A;  2REE A;  2JBK A;  4CAW A;  1R43 A;  3D3S A;  1S7N A;  4OAE A;  4BBH A;  4P45 A;  3ISX A;  5F49 A;  3F8K A;  2PVW A;  2VI7 A;  1L0C A;  2C6G A;  3RYO A;  3T8W A;  4OID A;  4ONW A;  2Q43 A;  4IF5 A;  4L89 A;  3JRU A;  1Z4R A;  4OKO A;  1M44 A;  4KVO E;  4MRI A;  4MJ8 A;  1HEE A;  4JYW A;  3TOA A;  5LRK A;  2O28 A;  4R7M A;  5J8C A;  1K4J A;  1DTD A;  4CYO A;  4A31 A;  2GE3 A;  4JXR A;  2PJ1 A;  1HDQ A;  4A32 A;  4IAV A;  1P0H A;  2CXA A;  3DGV A;  4MCP A;  2C27 A;  3PEI A;  3HUV A;  3CXS A;  1VIX A;  4IHM A;  2DPT A;  2O53 A;  3V8I A;  3T9Y A;  2Z3L A;  4CRZ B;  2X7B A;  2B3V A;  2J9A A;  2Q7S A;  3CT9 A;  2FT0 A;  3B8G A;  4AG9 A;  2I00 A;  2ZEP A;  2V77 A;  4B14 A;  4XNH B;  4MFJ A;  2ZED A;  3OWC A;  3D68 A;  4M6I A;  4PXB A;  2OZU A;  2GIV A;  4UFX A;  4F0X A;  4LQG A;  4XPD B;  2JLM A;  3FIX A;  4PXE A;  3A9L A;  2ARH A;  3GIU A;  3DLJ A;  3LMS A;  1MK4 A;  1ZLH A;  1V0C A;  3VAT A;  2FE7 A;  2AJ6 A;  4W9Y A;  4F9V A;  1XRY A;  2ZEH A;  4B5P B;  1QQ9 A;  1HDU A;  2XEJ A;  2OU2 A;  3HLP A;  4EME A;  4B5P A;  4CAF A;  3FH4 A;  1GYT A;  2QEC A;  1ZG9 A;  3KAS A;  1Q7L A;  1QST A;  2Z3N A;  2ZEL A;  2B4D A;  2PCU A;  2Q4V A;  4PXC A;  2P6G A;  4AVA A;  2RC4 A;  4CGM A;  4KOU A;  4OME A;  4JWP A;  1M4G A;  1NE9 A;  3IWG A;  4H6U A;  3KGQ A;  2Z3M A;  4JJX A;  2VZY A;  2D4P A;  3TO9 A;  3B3V A;  4P4D A;  4B6Z A;  3DDD A;  3FJU A;  5ELY A;  1ON0 A;  2FVG A;  5DWN A;  4M3S A;  4KOY A;  4DJL A;  1CP6 A;  1XBU A;  1EE3 P;  3KHZ A;  4Y49 B;  4FWU A;  3R9G A;  1TXR A;  4KVX A;  2R8V A;  1FNO A;  3KQZ A;  1ZG7 A;  2Z3O A;  2ZEF A;  1CM0 A;  4OC4 A;  2VQY A;  3QAY A;  4C2Y A;  4JLY A;  2IL4 A;  4L8A A;  2B5G A;  3G3S A;  2V8H A;  3IEH A;  4R3K A;  4R76 A;  5G20 A;  5I4M A;  2ZXV A;  4P4J A;  3KR4 A;  1S60 A;  2JDC A;  1PUA A;  3EO4 A;  2PSW A;  2VZZ A;  1M1D A;  3SJG A;  5F48 A;  1U6M A;  3GY9 A;  1VHS A;  4AXV A;  4UBR A;  4KUA A;  2OOT A;  4A2Z A;  4DUK A;  1B6B A;  2NMT A;  3B3W A;  3D7G A;  3PB6 X;  2AFZ A;  4MCR A;  4UCN A;  3IU2 A;  4NJR A;  4PV6 A;  5THW A;  3FYN A;  2HC9 A;  3BLN A;  2WSA A;  3RAM A;  3ZZI A;  2FSR A;  4AG7 A;  4PXD A;  3EFA A;  1AYE A;  4NCZ A;  3W6S A;  5F46 A;  1UWY A;  1BLL E;  1YME A;  4U9Y A;  4GM5 A;  5AG7 A;  1IYK A;  2BL1 A;  2ZEM A;  3EC4 A;  4I49 A;  4X8I A;  3I1U A;  3G8W A;  4G1P A;  4JZ0 A;  1BPM A;  1I1D A;  4M6H A;  3B2Y A;  4O23 A;  3B3C A;  3S6K A;  3D8P A;  2B3U A;  1MJ9 A;  4K3N A;  3NH5 A;  3S9M A;  1R3N A;  2D4O A;  1JWQ A;  4YFJ A;  4R87 A;  4UCP A;  3JVN A;  1XMT A;  2CY2 A;  1CPS A;  5IV0 A;  3PB8 X;  1F2P A;  1M4L A;  4M85 A;  1LOK A;  4WJB A;  4NGQ A;  4CYN A;  4MHP A;  4OC5 A;  3PP9 A;  4QBJ A;  2PJ2 A;  1XFO A;  4LQ6 A;  4UFW A;  1LCP A;  4P4F A;  4ZYQ A;  3FVL A;  5HMN A;  3V38 A;  1RXT A;  1GHE A;  3TO7 A;  4NXY A;  1UFH A;  3GYA A;  2AFO A;  3VWD A;  4ZX9 A;  3KQX A;  1S7F A;  2C1C A;  4KVM E;  2HQY A;  3TOB A;  2PC1 A;  3TO6 A;  1RTQ A;  5CBM A;  4A30 A;  5H84 A;  4E2A A;  3IGR A;  4DYO A;  4XPD C;  5J8F A;  3NA6 A;  3CDX A;  3TE4 A;  5LYD A;  3B35 A;  4ZY1 A;  3RBU A;  3E0K A;  3PBE A;  5E96 A;  2V8G A;  4RUH A;  2GLF A;  4F9U A;  2P6F A;  1J4J A;  3P2H A;  4C2Z A;  4KZT A;  4A95 A;  4MHD A;  5C82 A;  3TCV A;  1TF8 A;  3B3T A;  4NGN A;  4A94 A;  3BI0 A;  4HKF A;  5K8P A;  2R7H A;  1Y7E A;  2K5T A;  2JBJ A;  2RB7 A;  4QVT A;  2Z0Z A;  1S7K A;  1RO5 A;  1TKJ A;  3CPA A;  3DSB A;  3FF3 A;  5G22 A;  5D8N A;  4NGM A;  1MJA A;  3WC5 A;  2PJ7 A;  4PK2 A;  3SXN A;  3I3G A;  5D29 A;  2FIA A;  4GXH A;  5FVJ A;  4CGO A;  2V8D A;  5KTD A;  2B4B A;  3WR7 A;  1YR0 A;  2Q44 A;  2Q4Y A;  4Y49 C;  1YQE A;  3CZX A;  5C88 A;  2XEG A;  4MHN A;  4P44 A;  2BEI A;  3K9T A;  1S7L A;  5BWA B;  4NFR A;  1XEB A;  4QB9 A;  3H8E A;  1Z4E A;  4OLL A;  5IB0 A;  3D4U A;  2I79 A;  4UEF A;  2ZW5 A;  4OC3 A;  2J8R A;  4C68 A;  4ZI6 A;  2OB0 A;  2F8H A;  4EFD A;  4KSA A;  3SI1 A;  8CPA A;  5JH9 A;  2GLJ A;  2BSW A;  3MGD A;  3MRU A;  2PR1 A;  1Z8L A;  3SJX A;  2G3T A;  2G9D A;  3VH9 A;  2DEA A;  4MCS A;  2PJA A;  2JDD A;  2ZW7 A;  3IJ3 A;  1CJW A;  3P2F A;  2FXF A;  3MN8 A;  5EBV A;  4B11 A;  4FD4 A;  5F47 A; 
#chains in the Genus database with same CATH homology
 2YGW A;  4KOS A;  2G0B A;  3EY5 A;  4DNC A;  4R57 A;  2DPS A;  4JD6 A;  1Z9U A;  2CNT A;  3R1K A;  4LUA A;  4E0A A;  3T90 A;  3W91 A;  3CXP A;  4UA3 A;  3BJ7 A;  4CAV A;  2PR8 A;  2QIR A;  5AGE A;  4NF1 A;  4XPL A;  3VWE A;  2FIW A;  4PSX A;  4KOR A;  1R57 A;  1Y9K A;  4JXQ A;  4MY0 A;  4CS0 B;  3TTH A;  2HUZ A;  2Q0Y A;  1VKC A;  3FBU A;  2Z11 A;  4UFV A;  4AVC A;  1IYL A;  4J3G A;  3S6F A;  3S6G A;  1Y9W A;  1WK4 A;  3S6H A;  2P6E A;  2ZPA A;  1YLE A;  2CNS A;  4B5O A;  4U9Z A;  4HNY B;  2FCK A;  5AG4 A;  4B12 A;  2H5M A;  4MI4 A;  4Q36 A;  1YVK A;  4HNX B;  2ZW6 A;  3C26 A;  4HNW B;  4R3L A;  2A4N A;  4H6Z A;  2WUU A;  4R9M A;  5GCN A;  1IB1 E;  1TIQ A;  2EUI A;  3LD2 A;  5I0C A;  1S3Z A;  3R96 A;  3TFY A;  3ZJ0 A;  3H5Z A;  5CNP A;  2R1I A;  4C7I A;  4MFL A;  2AE6 A;  4U5Y A;  3R9F A;  1XIX A;  1I21 A;  1IIC A;  3TT2 A;  4CRY B;  3FB3 A;  1NMT A;  1Q2C A;  4QC6 A;  4KSF A;  1IID A;  4BMH A;  3I9S A;  4E8O A;  1BO4 A;  2QML A;  3CXQ A;  3QAH A;  2VEZ A;  4K30 A;  2R98 A;  2YNC C;  2Z10 A;  5KTA A;  4NSQ A;  2FL4 A;  4KLV A;  3FNC A;  2KCW A;  3KKW A;  1B87 A;  2PQ8 A;  4AVB A;  3F5B A;  2CNM A;  1YRE A;  1OZP A;  4FD6 A;  5IX3 A;  1NSL A;  5A28 A;  2Z3P A;  4OAD A;  1YK3 A;  4KOX A;  3SXO A;  1N71 A;  3NE7 A;  4H89 A;  3DNS A;  4A33 A;  3FXT A;  4MFP A;  4MY3 A;  3IU1 A;  1YGH A;  2BUE A;  1KZF A;  1P4N A;  5H86 A;  2OZG A;  3H4Q A;  3R9E A;  4II9 A;  4KOV A;  4MFZ A;  3BJ8 A;  1MJB A;  1Q2Y A;  2YNC A;  4NEX A;  4CYQ A;  4MBU A;  4QUS A;  1YVO A;  4F6A A;  4ZBG A;  2REF A;  2J8M A;  5AG6 A;  1XF8 A;  3DR8 A;  1FY7 A;  2Q04 A;  2JEV A;  3SHP A;  2OH1 A;  4IUS A;  2ATR A;  3PZJ A;  2G3A A;  4CGN A;  4ONU A;  2B4D B;  4EVY A;  2GAN A;  4B10 A;  4CGL A;  5JQ4 A;  5AG5 A;  3K9U A;  4C2X A;  2ZW4 A;  3R95 A;  1SQH A;  4UWJ A;  3DR6 A;  1XE4 A;  5G1Z A;  4AB7 A;  1KUY A;  3JUW A;  4X5K A;  4KS9 A;  4KUB A;  3N7Z A;  4KLW A;  3D2M A;  1I12 A;  1PU9 A;  1QSO A;  5G21 A;  1KUV A;  2VXK A;  2PDO A;  4UWI A;  4KOT A;  2B5G B;  1Y7R A;  1M4D A;  4B13 A;  1M4I A;  1ZO0 A;  2Z3K A;  5DWM A;  4XPK A;  2PRB A;  4CGP A;  1BOB A;  2P0W A;  1QSM A;  3GKR A;  2VBQ A;  5A27 A;  2J8N A;  2B58 A;  4CYP A;  5EC4 A;  4FD7 A;  2YND A;  4CAX A;  4PSW A;  3JTK A;  2OZH A;  3FRM A;  1LRZ A;  2FS5 A;  4CAE A;  4Q38 A;  2F5I A;  2Y0M A;  4YGO A;  2DXQ A;  5HH1 A;  2WPW A;  4KOW A;  1WWZ A;  1S5K A;  3IWE A;  5JPH A;  2WPX A;  3D2P A;  3LOD A;  4ZGY B;  4C7H A;  5KTC A;  3QB8 A;  1KUX A;  4UCM A;  4LX9 A;  4YRH A;  1YX0 A;  4FD5 A;  4MFQ A;  4PK3 A;  1QSR A;  4MFK A;  4GS4 A;  2EVN A;  2HV2 A;  3PGP A;  4RI1 A;  4F0Y A;  2YNE A;  4ORF A;  1QSN A;  2Q7B A;  4RS2 A;  3UY5 A;  4XNH C;  1Q2D A;  3F0A A;  3EXN A;  3W6X A;  2REE A;  4CAW A;  3D3S A;  1S7N A;  4OAE A;  4BBH A;  5F49 A;  3F8K A;  2VI7 A;  1L0C A;  3RYO A;  4L89 A;  4IF5 A;  1Z4R A;  1M44 A;  4KVO E;  3TOA A;  4MJ8 A;  2O28 A;  5J8C A;  1K4J A;  4CYO A;  4A31 A;  2GE3 A;  4JXR A;  4A32 A;  1P0H A;  2CXA A;  2C27 A;  3CXS A;  2DPT A;  3V8I A;  3T9Y A;  2Z3L A;  4CRZ B;  2X7B A;  2B3V A;  2FT0 A;  3B8G A;  4AG9 A;  2I00 A;  4B14 A;  4XNH B;  4MFJ A;  3OWC A;  2OZU A;  2GIV A;  4UFX A;  4F0X A;  4XPD B;  2JLM A;  3FIX A;  3A9L A;  2ARH A;  1MK4 A;  1V0C A;  2FE7 A;  2AJ6 A;  4B5P B;  2OU2 A;  4B5P A;  4CAF A;  2QEC A;  1QST A;  2Z3N A;  2B4D A;  2Q4V A;  4AVA A;  4CGM A;  2P6G A;  2RC4 A;  4KOU A;  4JWP A;  4JJX A;  1M4G A;  1NE9 A;  3IWG A;  4H6U A;  2Z3M A;  3TO9 A;  2VZY A;  2D4P A;  3DDD A;  1ON0 A;  5DWN A;  4M3S A;  4KOY A;  4Y49 B;  3R9G A;  4KVX A;  2R8V A;  2Z3O A;  1CM0 A;  2VQY A;  4C2Y A;  4JLY A;  2IL4 A;  4L8A A;  2B5G A;  3G3S A;  4R3K A;  5G20 A;  2ZXV A;  1S60 A;  2JDC A;  1PUA A;  3EO4 A;  2PSW A;  2VZZ A;  1M1D A;  5F48 A;  1U6M A;  3GY9 A;  1VHS A;  4UBR A;  4KUA A;  4A2Z A;  1B6B A;  2NMT A;  4UCN A;  3IU2 A;  4PV6 A;  3FYN A;  3BLN A;  2WSA A;  3ZZI A;  4AG7 A;  2FSR A;  3EFA A;  4NCZ A;  3W6S A;  5F46 A;  4U9Y A;  5AG7 A;  1IYK A;  2BL1 A;  3EC4 A;  4I49 A;  3G8W A;  1I1D A;  3S6K A;  3D8P A;  2B3U A;  1MJ9 A;  2D4O A;  4YFJ A;  4R87 A;  4UCP A;  3JVN A;  1XMT A;  2CY2 A;  5IV0 A;  4M85 A;  4CYN A;  3PP9 A;  4QBJ A;  4UFW A;  5HMN A;  1RXT A;  1GHE A;  3TO7 A;  4NXY A;  1UFH A;  3GYA A;  3VWD A;  1S7F A;  4KVM E;  2HQY A;  3TOB A;  2PC1 A;  3TO6 A;  4A30 A;  5H84 A;  4E2A A;  3IGR A;  5J8F A;  4XPD C;  3TE4 A;  3E0K A;  5E96 A;  2P6F A;  1J4J A;  3P2H A;  4C2Z A;  4KZT A;  4A95 A;  4MHD A;  5C82 A;  3TCV A;  4HKF A;  2R7H A;  2K5T A;  4QVT A;  2Z0Z A;  1S7K A;  1RO5 A;  3DSB A;  5G22 A;  1MJA A;  4PK2 A;  3SXN A;  3I3G A;  5FVJ A;  2FIA A;  4CGO A;  5KTD A;  2B4B A;  3WR7 A;  1YR0 A;  2Q44 A;  2Q4Y A;  4Y49 C;  5C88 A;  5ISV A;  2BEI A;  5BWA B;  1S7L A;  1XEB A;  4QB9 A;  5IB0 A;  1Z4E A;  4OLL A;  2I79 A;  2ZW5 A;  2J8R A;  4C68 A;  2OB0 A;  4KSA A;  2BSW A;  3MGD A;  2PR1 A;  2G3T A;  2JDD A;  2ZW7 A;  1CJW A;  3P2F A;  2FXF A;  5EBV A;  4B11 A;  4FD4 A;  5F47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...