1Z8TA

Structure of mutant pyrrolidone carboxyl peptidase (e192q) from a hyperthermophile, pyrococcus furiosus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
208
structure length
208
Chain Sequence
MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLSNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMSYEMQLEAVKVAIEVALEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrrolidone-carboxylate peptidase
publication title Completely buried, non-ion-paired glutamic acid contributes favorably to the conformational stability of pyrrolidone carboxyl peptidases from hyperthermophiles.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 70
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 1z8tA00
4HPSA 1Z8TA 2EO8A 2EBJA 3RNZA 1AUGA 3RO0A 3LACA 2DF5A 1IOFA 1Z8XA 1IOIA 1IU8A 1X10A 1A2ZA 1Z8WA 1X12A 3GIUA 4GXHA
chains in the Genus database with same CATH superfamily
4QC6A 4ZY1A 3D7HA 4TNUA 4CAEA 4F8ZA 1HDQA 4UIBA 4UA3A 1GYTA 2AFOA 2FCKA 4MCRA 4OC4A 4U9ZA 5G1ZA 5JGFA 1CPXA 4KVXA 2Z3PA 3GY9A 2J8NA 5CPAA 1VHOA 4J3GA 3FH4A 1IOFA 4F0XA 1M44A 3PBBA 3N7ZA 4HNXB 2V77A 4ONWA 5HVGA 1Z8XA 2ZEDA 3B3TA 3PBEA 2PJ4A 1YGHA 2ZPAA 4YWYA 5LRGA 5ELYA 5JQ4A 4KLWA 2R8VA 2G9DA 4CRZB 5LYLA 2HQYA 4LQGA 4W9YA 1RXTA 2Z11A 4LUAA 5GCNA 1ON0A 1F2PA 2CY2A 4AVCA 4QBJA 5F46A 2Z10A 5K8PA 2R1IA 4OC0A 4OKOA 4P4FA 5H86A 4A94A 2PVWA 5CBMA 1IGBA 5G22A 5E96A 1LAPA 2PR8A 3RYOA 2OU2A 3P2FA 4R8FA 3RO0A 3T90A 3H4QA 4CYOA 3W91A 2DF5A 2PJ3A 1J4JA 1IICA 1IIDA 4NFRA 4WJBA 5J1QA 4DJLA 1V0CA 6CPAA 4MBUA 4MFJA 4NGRA 4PV6A 4M6HA 3GLJA 2EUIA 3PFEA 1NSAA 2ABZA 4F0YA 3B3CA 4PXDA 4CGPA 2ZW7A 2QECA 1A2ZA 2F5IA 3S9MA 4CRYB 4AG7A 4A2ZA 4UEEA 4A95A 4BMHA 4AXVA 1IYLA 4GXHA 1CP7A 3KKWA 4MHPA 4CAFA 1LRZA 1YLEA 3NH5A 4NJRA 2CF4A 5AGEA 4P4EA 4B5PA 4X5KA 3WC6A 2PR1A 4P45A 4R9MA 2GANA 2JEWA 4KZTA 5LRKA 1IYKA 2C6PA 1Z5RA 1AUGA 2P6GA 4H89A 3SXOA 4GS4A 1HEEA 2PCUA 1AYEA 4UF4A 4JJXA 2PDOA 1VIXA 2HUZA 1MJ9A 1CG2A 1Z4EA 2ZW4A 2HC9A 1I1DA 4UBRA 1FT7A 3F5BA 1ARLA 4MY0A 5LYFA 3PZJA 3D7FA 2JDCA 4NGTA 3JRUA 2JBJA 3FXTA 3IWEA 2HB6A 1I21A 2Y0MA 3KQXA 4OIDA 2RB7A 4UWJA 5HH1A 4R57A 4CAVA 5J8FA 1BPNA 2ZXVA 2VQYA 3K9UA 4YGOA 2I3CA 3LMSA 1VHSA 4UFWA 1LANA 1CJWA 3BI1A 4MXUA 1BOBA 3FIXA 1M1DA 2ZEOA 3W6XA 2J8RA 5I0CA 2GFQA 2V8HA 3I9SA 2Q04A 1TXRA 1Z8TA 2BEIA 2PJ6A 4MFQA 1DTDA 3RNZA 2ZEHA 1P0HA 2ZW6A 1S7KA 4QB9A 2C6GA 1KUXA 4XPDB 1F57A 1Y0RA 2PJ2A 4C7HA 3GB0A 4NCZA 4EMEA 2DEAA 1QSOA 2Q51A 4IAVA 2B4BA 3TO7A 4KORA 4CGMA 2PJCA 5K8MA 1MJBA 3ZJ0A 1CBXA 1X12A 1N71A 1UWYA 3IIBA 2ZELA 4KSIA 4UCNA 4TWEA 2C1CA 3QAHA 4FD4A 2CXAA 3N5FA 5F09A 4KSFA 4UEFA 4RI1A 4CPAA 4UEZA 2RFHA 4MHNA 5F48A 4MY3A 3VATA 5J8CA 2IMOA 4DYOA 2VZZA 4YU9A 2AFUA 2ZENA 4ORFA 3RAMA 3TT2A 1P4NA 3GKRA 2FVGA 2XEFA 3NFZA 2D4PA 4KOUA 5AG5A 4CYNA 4Q36A 1YVOA 3R1KA 5A27A 3KHXA 3SI2A 2PVVA 3W6SA 2WYRA 3GYAA 2I00A 3FMCA 3TX8A 3GIUA 3MGDA 5F49A 1M4IA 3SHPA 4JD6A 3CT9A 2ARHA 2VBQA 2VL1A 4IUSA 3WC5A 4HKFA 3PB9X 4EFDA 3FF3A 5JM6A 2B5GA 2D4OA 3LWUA 3TE4A 1OBRA 2XEJA 5IX3A 4A38A 4NJQA 3IGRA 2J8MA 2JLMA 4OC3A 5EBVA 4YFJA 2Q4ZA 4A31A 3IC1A 5FVJA 1UFHA 5K8OA 4R3KA 4AVBA 5AG6A 4ZYQA 1HDUA 2YNDA 2YNEA 4FBEA 4CGNA 2AJ6A 2BOAA 2G3TA 1NMTA 2XEIA 3K9TA 4UCPA 1XF8A 3SXNA 4F9VA 3TC8A 1KZFA 2BO9A 4C2XA 1WK4A 4MCPA 3H8EA 2PJAA 4Q7AA 4MFLA 3BXMA 4HNYB 4IK2A 3IFEA 3HLPA 3FJUA 2CNMA 4HPSA 4M3SA 2WSAA 4OP4A 1JWQA 1Z9UA 1KWMA 5EMIA 1ARMA 1VHEA 2REFA 4PXBA 5H84A 5DS0A 4MHZA 3SJXA 4KSAA 4MFKA 3QB8A 3OWCA 3TO6A 4BBHA 3FNCA 5IB0A 2PQ8A 4RN7A 1B87A 3JVNA 3H8FA 4B13A 4CS0B 1LAMA 3VH9A 4MFPA 3NE7A 4I49A 1QSMA 3D2PA 2B3VA 5CNPA 3D7GA 3KL9A 4P44A 1YW6A 1Q7LA 2IL4A 4OADA 2J9AA 3E0KA 1CM0A 4K30A 1ZG7A 2REEA 3R9FA 3JUWA 5IV0A 4K3NA 5D29A 1Y0YA 3IEHA 2PJ7A 4NGSA 4FAIA 2CNSA 1FY7A 3GUXA 2QMLA 4FWUA 2KCWA 4MHDA 5EC4A 3F0AA 3NA6A 4CGLA 3PB8X 4JXQA 3S9NA 1MJAA 5IB9A 4PK2A 3WABA 4A30A 3MRUA 3FEEA 3B3WA 2ODFA 2BCOA 4NEXA 3EO4A 3IWWA 3D4UA 3B35A 2JDDA 4ZY0A 1CX8A 1PYTB 1XMTA 2VEZA 2PJ8A 2FT0A 3DR8A 1MK4A 2BSWA 2VZYA 3PB6X 1CPSA 2PJ9A 2PJ0A 3ISXA 3IWGA 2GU2A 4BINA 2ZEEA 3FBUA 3NH4A 3BJ7A 1Z8WA 2RC4A 2CTBA 4UFXA 2A4NA 4M85A 3R96A 2IJZA 4II9A 1XFOA 2PJBA 3CZXA 4EVYA 1BAVA 1YREA 4ONUA 4X8IA 1WWZA 1XMBA 2ZEFA 4PXCA 2FSRA 1PUAA 2OB0A 5AG7A 4XPKA 3KASA 4KS9A 4JZ0A 4B11A 4IHMA 2F8HA 1TF9A 4XPDC 2QIRA 5BWAB 4QVTA 2P0WA 2YNCC 4P6YA 4RS2A 3G8WA 3NH8A 4U5YA 2P6EA 2AE6A 3B3VA 2FE7A 5DWMA 3ISZA 4UIAA 3ZZIA 3FVLA 2B58A 1PU9A 3PB4X 4KOVA 2AFMA 2FL4A 3CXPA 3FEDA 4MMOA 4B6ZA 2XEGA 3UY5A 4JYWA 3MN8A 1TKJA 2B4DB 2Z0ZA 4MJ8A 3R95A 2PC1A 2V8VA 3FECA 1YMEA 3V38A 4A39A 2ANPA 2ATRA 4B10A 5C88A 2NMTA 2G0BA 4PK3A 4A37A 4M6IA 1VKCA 4A33A 1QSRA 2EO8A 2PIZA 4C2ZA 2YGWA 3KGQA 5C82A 7CPAA 3KZWA 4Y49B 2EVNA 1B6BA 1TF8A 2JEVA 1TKFA 2P6FA 3FB3A 4OMEA 3T8WA 3TOAA 8CPAA 4P10A 3LODA 4KVME 4ZY2A 3EC4A 4H2KA 1R3NA 1QQ9A 2Q44A 5LYDA 1LOKA 1XOVA 2PSWA 4GM5A 1YW4A 2GREA 1YLOA 3DDDA 5DWNA 5JPHA 3BLNA 1Y9WA 4KUAA 4AG9A 3EXNA 4CYPA 3P2HA 3D8PA 4EWTA 4KVOE 4JXRA 2BUEA 4UWIA 4JWPA 2Z3LA 2F7VA 4P4DA 5HVHA 3RBUA 2AFZA 4CYQA 1PCAA 1R57A 2PE3A 3LD2A 1S60A 2EWBA 3KR4A 5ISVA 4LX9A 1K4JA 2HV2A 3RZAA 3SJGA 2PJ5A 4G1PA 1F2OA 1S3ZA 1IY7A 5G21A 1I12A 4NXYA 1Z4RA 4OAEA 3VARA 1OZPA 4FD5A 3KR5A 3PP9A 1NE9A 2X7BA 1M4LA 1Q2DA 3PEIA 3S6FA 2DXQA 2QVPA 2GLJA 4KUBA 4XNHB 1S7NA 1XEBA 1XIXA 1GHEA 2YNCA 3D66A 4AB7A 2ZEMA 2QYVA 3CPAA 4KOYA 4PQAA 4ZGYB 2R7HA 3SI0A 1RO5A 2AFSA 4IF5A 1JQGA 3TOBA 4ZX8A 4HNWB 2I79A 4B5PB 2Q43A 1XRYA 2DPTA 2Q7BA 4F6AA 5KTAA 3CPXA 3L2NA 4E8OA 3PGPA 3IU1A 2EBJA 2Z3MA 3KQZA 4PPZA 2Q0YA 3D7DA 4ZX9A 3LACA 2Z3OA 3FX6A 4FD6A 3CDXA 2WPXA 4Z65A 3EY5A 2G3AA 2WPWA 1TKHA 2OZHA 5LRJA 4C7IA 4MHYA 4QUSA 4KOSA 1ZLIA 2NYQA 1YQEA 1S5KA 2PRQA 3QNVA 3SJEA 4R76A 3H8GA 5KTCA 3S6KA 4JLYA 4E2AA 5AG4A 2QJ8A 1QSTA 2EK9A 3D67A 1Q2YA 2V8DA 2JBKA 3DR6A 4MCQA 4B14A 3DSBA 3DLJA 4PSXA 5K8NA 4DNCA 1M4DA 3BI0A 3F8KA 4KLVA 4OIWA 2CIJA 2FIWA 4R6TA 2B3UA 4KOXA 5G20A 2PJ1A 1U6MA 1BO4A 2Q4VA 3DGVA 4L89A 4NGQA 2WZNA 3CXQA 2EK8A 4NGNA 1ZG8A 4WWVA 4YRHA 4B5OA 3V7ZA 4ZBGA 2IQ6A 4X2TA 3D2MA 3S6HA 3SI1A 3WC7A 1S7FA 5KTDA 4UCMA 5F47A 1FNOA 1Y9KA 4RUHA 3H5ZA 2V8GA 1YK3A 3EFAA 3HUVA 1IOIA 3TTHA 4C2YA 3PB7X 2DPSA 2POKA 3NE8A 1XJOA 3CXSA 2VXKA 1CP6A 2NSMA 4MCSA 2O53A 1R43A 3FYNA 3KHZA 1EE3P 1SQHA 1IB1E 3B2YA 1Z8LA 2O28A 5HMNA 2PIYA 4U9YA 4E0AA 3A9LA 2AFWA 3PFOA 2CTCA 3BJ8A 1L0CA 3B7IA 3K2KA 2OZUA 2ZOFA 3QAYA 4OLLA 3R9EA 2BL1A 3T9YA 1S7LA 2OH1A 3JTKA 4O23A 4H6UA 1LCPA 1QSNA 4NGPA 4UFVA 3S6GA 4LQ6A 4C68A 4FUUA 4B12A 3WR7A 4CGOA 2R98A 3BHXA 2Z3KA 4OC1A 4KOWA 3B8GA 4P4BA 3WT4A 4CAWA 3DNSA 1DE4C 4F9UA 1NSLA 1Y7RA 4CAXA 4PSWA 4H6ZA 4MI4A 2FIAA 2B5GB 3G3SA 3VWDA 5I4MA 1KUYA 3VWEA 3C26A 4Y49C 2ZOGA 4Q38A 3PRTA 4NGMA 1Y7EA 4OC5A 1TIQA 2C6CA 2FXFA 3IU2A 3V8IA 1XBUA 2O4HA 4MFZA 5A28A 3D68A 3TCVA 4R3LA 2ZEGA 1Z2LA 4MRIA 4XPLA 4AVAA 4DUKA 2GLFA 3R9GA 1YR0A 2OZGA 2CNTA 1X10A 4R7MA 2GE3A 2C27A 4P4JA 1LFWA 1AMPA 1ELLP 2ZW5A 2GIVA 4KOTA 2OOTA 2K5TA 2VI7A 3SJFA 1BPMA 1Q2CA 1RTQA 4X3RA 5D8NA 4BD9A 2ZEPA 3KI9A 1ELMP 1M4GA 3D3SA 3B3SA 4ZI6A 2H5MA 1XE4A 1KUVA 4OC2A 4NF1A 2AFXA 3TFYA 2PRBA 4M6GA 2Z3NA 5HXDA 1ZG9A 4R87A 1QMUA 2OR4A 5LYIA 2WUUA 4XNHC 1H8LA 2Q4YA 4P4IA 3IO1A 5JH9A 1VGYA 4FD7A 3I1UA 4PXEA 3S9LA 3TO9A 1IU8A 3FRMA 2Q7SA 4NSQA 3I3GA 3IJ3A 1YSJA 5HVFA 5THWA 1ZO0A 1ZLHA 2FS5A 1YX0A 1BLLE 4L8AA 4A32A 1YVKA 2B4DA
chains in the Genus database with same CATH topology
4HPSA 1Z8TA 2EO8A 2EBJA 3RNZA 1AUGA 3RO0A 3LACA 2DF5A 1IOFA 1Z8XA 1IOIA 1IU8A 1X10A 1A2ZA 1Z8WA 1X12A 3GIUA 4GXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HPS A;  1Z8T A;  2EO8 A;  2EBJ A;  3RNZ A;  1AUG A;  3RO0 A;  3LAC A;  2DF5 A;  1IOF A;  1Z8X A;  1IOI A;  1IU8 A;  1X10 A;  1A2Z A;  1Z8W A;  1X12 A;  3GIU A;  4GXH A; 
#chains in the Genus database with same CATH topology
 4QC6 A;  4ZY1 A;  3D7H A;  4TNU A;  4CAE A;  4F8Z A;  1HDQ A;  4UIB A;  4UA3 A;  1GYT A;  2AFO A;  2FCK A;  4MCR A;  4OC4 A;  4U9Z A;  5G1Z A;  5JGF A;  1CPX A;  4KVX A;  2Z3P A;  3GY9 A;  2J8N A;  5CPA A;  1VHO A;  4J3G A;  3FH4 A;  1IOF A;  4F0X A;  1M44 A;  3PBB A;  3N7Z A;  4HNX B;  2V77 A;  4ONW A;  5HVG A;  1Z8X A;  2ZED A;  3B3T A;  3PBE A;  2PJ4 A;  1YGH A;  2ZPA A;  4YWY A;  5LRG A;  5ELY A;  5JQ4 A;  4KLW A;  2R8V A;  2G9D A;  4CRZ B;  5LYL A;  2HQY A;  4LQG A;  4W9Y A;  1RXT A;  2Z11 A;  4LUA A;  5GCN A;  1ON0 A;  1F2P A;  2CY2 A;  4AVC A;  4QBJ A;  5F46 A;  2Z10 A;  5K8P A;  2R1I A;  4OC0 A;  4OKO A;  4P4F A;  5H86 A;  4A94 A;  2PVW A;  5CBM A;  1IGB A;  5G22 A;  5E96 A;  1LAP A;  2PR8 A;  3RYO A;  2OU2 A;  3P2F A;  4R8F A;  3RO0 A;  3T90 A;  3H4Q A;  4CYO A;  3W91 A;  2DF5 A;  2PJ3 A;  1J4J A;  1IIC A;  1IID A;  4NFR A;  4WJB A;  5J1Q A;  4DJL A;  1V0C A;  6CPA A;  4MBU A;  4MFJ A;  4NGR A;  4PV6 A;  4M6H A;  3GLJ A;  2EUI A;  3PFE A;  1NSA A;  2ABZ A;  4F0Y A;  3B3C A;  4PXD A;  4CGP A;  2ZW7 A;  2QEC A;  1A2Z A;  2F5I A;  3S9M A;  4CRY B;  4AG7 A;  4A2Z A;  4UEE A;  4A95 A;  4BMH A;  4AXV A;  1IYL A;  4GXH A;  1CP7 A;  3KKW A;  4MHP A;  4CAF A;  1LRZ A;  1YLE A;  3NH5 A;  4NJR A;  2CF4 A;  5AGE A;  4P4E A;  4B5P A;  4X5K A;  3WC6 A;  2PR1 A;  4P45 A;  4R9M A;  2GAN A;  2JEW A;  4KZT A;  5LRK A;  1IYK A;  2C6P A;  1Z5R A;  1AUG A;  2P6G A;  4H89 A;  3SXO A;  4GS4 A;  1HEE A;  2PCU A;  1AYE A;  4UF4 A;  4JJX A;  2PDO A;  1VIX A;  2HUZ A;  1MJ9 A;  1CG2 A;  1Z4E A;  2ZW4 A;  2HC9 A;  1I1D A;  4UBR A;  1FT7 A;  3F5B A;  1ARL A;  4MY0 A;  5LYF A;  3PZJ A;  3D7F A;  2JDC A;  4NGT A;  3JRU A;  2JBJ A;  3FXT A;  3IWE A;  2HB6 A;  1I21 A;  2Y0M A;  3KQX A;  4OID A;  2RB7 A;  4UWJ A;  5HH1 A;  4R57 A;  4CAV A;  5J8F A;  1BPN A;  2ZXV A;  2VQY A;  3K9U A;  4YGO A;  2I3C A;  3LMS A;  1VHS A;  4UFW A;  1LAN A;  1CJW A;  3BI1 A;  4MXU A;  1BOB A;  3FIX A;  1M1D A;  2ZEO A;  3W6X A;  2J8R A;  5I0C A;  2GFQ A;  2V8H A;  3I9S A;  2Q04 A;  1TXR A;  1Z8T A;  2BEI A;  2PJ6 A;  4MFQ A;  1DTD A;  3RNZ A;  2ZEH A;  1P0H A;  2ZW6 A;  1S7K A;  4QB9 A;  2C6G A;  1KUX A;  4XPD B;  1F57 A;  1Y0R A;  2PJ2 A;  4C7H A;  3GB0 A;  4NCZ A;  4EME A;  2DEA A;  1QSO A;  2Q51 A;  4IAV A;  2B4B A;  3TO7 A;  4KOR A;  4CGM A;  2PJC A;  5K8M A;  1MJB A;  3ZJ0 A;  1CBX A;  1X12 A;  1N71 A;  1UWY A;  3IIB A;  2ZEL A;  4KSI A;  4UCN A;  4TWE A;  2C1C A;  3QAH A;  4FD4 A;  2CXA A;  3N5F A;  5F09 A;  4KSF A;  4UEF A;  4RI1 A;  4CPA A;  4UEZ A;  2RFH A;  4MHN A;  5F48 A;  4MY3 A;  3VAT A;  5J8C A;  2IMO A;  4DYO A;  2VZZ A;  4YU9 A;  2AFU A;  2ZEN A;  4ORF A;  3RAM A;  3TT2 A;  1P4N A;  3GKR A;  2FVG A;  2XEF A;  3NFZ A;  2D4P A;  4KOU A;  5AG5 A;  4CYN A;  4Q36 A;  1YVO A;  3R1K A;  5A27 A;  3KHX A;  3SI2 A;  2PVV A;  3W6S A;  2WYR A;  3GYA A;  2I00 A;  3FMC A;  3TX8 A;  3GIU A;  3MGD A;  5F49 A;  1M4I A;  3SHP A;  4JD6 A;  3CT9 A;  2ARH A;  2VBQ A;  2VL1 A;  4IUS A;  3WC5 A;  4HKF A;  3PB9 X;  4EFD A;  3FF3 A;  5JM6 A;  2B5G A;  2D4O A;  3LWU A;  3TE4 A;  1OBR A;  2XEJ A;  5IX3 A;  4A38 A;  4NJQ A;  3IGR A;  2J8M A;  2JLM A;  4OC3 A;  5EBV A;  4YFJ A;  2Q4Z A;  4A31 A;  3IC1 A;  5FVJ A;  1UFH A;  5K8O A;  4R3K A;  4AVB A;  5AG6 A;  4ZYQ A;  1HDU A;  2YND A;  2YNE A;  4FBE A;  4CGN A;  2AJ6 A;  2BOA A;  2G3T A;  1NMT A;  2XEI A;  3K9T A;  4UCP A;  1XF8 A;  3SXN A;  4F9V A;  3TC8 A;  1KZF A;  2BO9 A;  4C2X A;  1WK4 A;  4MCP A;  3H8E A;  2PJA A;  4Q7A A;  4MFL A;  3BXM A;  4HNY B;  4IK2 A;  3IFE A;  3HLP A;  3FJU A;  2CNM A;  4HPS A;  4M3S A;  2WSA A;  4OP4 A;  1JWQ A;  1Z9U A;  1KWM A;  5EMI A;  1ARM A;  1VHE A;  2REF A;  4PXB A;  5H84 A;  5DS0 A;  4MHZ A;  3SJX A;  4KSA A;  4MFK A;  3QB8 A;  3OWC A;  3TO6 A;  4BBH A;  3FNC A;  5IB0 A;  2PQ8 A;  4RN7 A;  1B87 A;  3JVN A;  3H8F A;  4B13 A;  4CS0 B;  1LAM A;  3VH9 A;  4MFP A;  3NE7 A;  4I49 A;  1QSM A;  3D2P A;  2B3V A;  5CNP A;  3D7G A;  3KL9 A;  4P44 A;  1YW6 A;  1Q7L A;  2IL4 A;  4OAD A;  2J9A A;  3E0K A;  1CM0 A;  4K30 A;  1ZG7 A;  2REE A;  3R9F A;  3JUW A;  5IV0 A;  4K3N A;  5D29 A;  1Y0Y A;  3IEH A;  2PJ7 A;  4NGS A;  4FAI A;  2CNS A;  1FY7 A;  3GUX A;  2QML A;  4FWU A;  2KCW A;  4MHD A;  5EC4 A;  3F0A A;  3NA6 A;  4CGL A;  3PB8 X;  4JXQ A;  3S9N A;  1MJA A;  5IB9 A;  4PK2 A;  3WAB A;  4A30 A;  3MRU A;  3FEE A;  3B3W A;  2ODF A;  2BCO A;  4NEX A;  3EO4 A;  3IWW A;  3D4U A;  3B35 A;  2JDD A;  4ZY0 A;  1CX8 A;  1PYT B;  1XMT A;  2VEZ A;  2PJ8 A;  2FT0 A;  3DR8 A;  1MK4 A;  2BSW A;  2VZY A;  3PB6 X;  1CPS A;  2PJ9 A;  2PJ0 A;  3ISX A;  3IWG A;  2GU2 A;  4BIN A;  2ZEE A;  3FBU A;  3NH4 A;  3BJ7 A;  1Z8W A;  2RC4 A;  2CTB A;  4UFX A;  2A4N A;  4M85 A;  3R96 A;  2IJZ A;  4II9 A;  1XFO A;  2PJB A;  3CZX A;  4EVY A;  1BAV A;  1YRE A;  4ONU A;  4X8I A;  1WWZ A;  1XMB A;  2ZEF A;  4PXC A;  2FSR A;  1PUA A;  2OB0 A;  5AG7 A;  4XPK A;  3KAS A;  4KS9 A;  4JZ0 A;  4B11 A;  4IHM A;  2F8H A;  1TF9 A;  4XPD C;  2QIR A;  5BWA B;  4QVT A;  2P0W A;  2YNC C;  4P6Y A;  4RS2 A;  3G8W A;  3NH8 A;  4U5Y A;  2P6E A;  2AE6 A;  3B3V A;  2FE7 A;  5DWM A;  3ISZ A;  4UIA A;  3ZZI A;  3FVL A;  2B58 A;  1PU9 A;  3PB4 X;  4KOV A;  2AFM A;  2FL4 A;  3CXP A;  3FED A;  4MMO A;  4B6Z A;  2XEG A;  3UY5 A;  4JYW A;  3MN8 A;  1TKJ A;  2B4D B;  2Z0Z A;  4MJ8 A;  3R95 A;  2PC1 A;  2V8V A;  3FEC A;  1YME A;  3V38 A;  4A39 A;  2ANP A;  2ATR A;  4B10 A;  5C88 A;  2NMT A;  2G0B A;  4PK3 A;  4A37 A;  4M6I A;  1VKC A;  4A33 A;  1QSR A;  2EO8 A;  2PIZ A;  4C2Z A;  2YGW A;  3KGQ A;  5C82 A;  7CPA A;  3KZW A;  4Y49 B;  2EVN A;  1B6B A;  1TF8 A;  2JEV A;  1TKF A;  2P6F A;  3FB3 A;  4OME A;  3T8W A;  3TOA A;  8CPA A;  4P10 A;  3LOD A;  4KVM E;  4ZY2 A;  3EC4 A;  4H2K A;  1R3N A;  1QQ9 A;  2Q44 A;  5LYD A;  1LOK A;  1XOV A;  2PSW A;  4GM5 A;  1YW4 A;  2GRE A;  1YLO A;  3DDD A;  5DWN A;  5JPH A;  3BLN A;  1Y9W A;  4KUA A;  4AG9 A;  3EXN A;  4CYP A;  3P2H A;  3D8P A;  4EWT A;  4KVO E;  4JXR A;  2BUE A;  4UWI A;  4JWP A;  2Z3L A;  2F7V A;  4P4D A;  5HVH A;  3RBU A;  2AFZ A;  4CYQ A;  1PCA A;  1R57 A;  2PE3 A;  3LD2 A;  1S60 A;  2EWB A;  3KR4 A;  5ISV A;  4LX9 A;  1K4J A;  2HV2 A;  3RZA A;  3SJG A;  2PJ5 A;  4G1P A;  1F2O A;  1S3Z A;  1IY7 A;  5G21 A;  1I12 A;  4NXY A;  1Z4R A;  4OAE A;  3VAR A;  1OZP A;  4FD5 A;  3KR5 A;  3PP9 A;  1NE9 A;  2X7B A;  1M4L A;  1Q2D A;  3PEI A;  3S6F A;  2DXQ A;  2QVP A;  2GLJ A;  4KUB A;  4XNH B;  1S7N A;  1XEB A;  1XIX A;  1GHE A;  2YNC A;  3D66 A;  4AB7 A;  2ZEM A;  2QYV A;  3CPA A;  4KOY A;  4PQA A;  4ZGY B;  2R7H A;  3SI0 A;  1RO5 A;  2AFS A;  4IF5 A;  1JQG A;  3TOB A;  4ZX8 A;  4HNW B;  2I79 A;  4B5P B;  2Q43 A;  1XRY A;  2DPT A;  2Q7B A;  4F6A A;  5KTA A;  3CPX A;  3L2N A;  4E8O A;  3PGP A;  3IU1 A;  2EBJ A;  2Z3M A;  3KQZ A;  4PPZ A;  2Q0Y A;  3D7D A;  4ZX9 A;  3LAC A;  2Z3O A;  3FX6 A;  4FD6 A;  3CDX A;  2WPX A;  4Z65 A;  3EY5 A;  2G3A A;  2WPW A;  1TKH A;  2OZH A;  5LRJ A;  4C7I A;  4MHY A;  4QUS A;  4KOS A;  1ZLI A;  2NYQ A;  1YQE A;  1S5K A;  2PRQ A;  3QNV A;  3SJE A;  4R76 A;  3H8G A;  5KTC A;  3S6K A;  4JLY A;  4E2A A;  5AG4 A;  2QJ8 A;  1QST A;  2EK9 A;  3D67 A;  1Q2Y A;  2V8D A;  2JBK A;  3DR6 A;  4MCQ A;  4B14 A;  3DSB A;  3DLJ A;  4PSX A;  5K8N A;  4DNC A;  1M4D A;  3BI0 A;  3F8K A;  4KLV A;  4OIW A;  2CIJ A;  2FIW A;  4R6T A;  2B3U A;  4KOX A;  5G20 A;  2PJ1 A;  1U6M A;  1BO4 A;  2Q4V A;  3DGV A;  4L89 A;  4NGQ A;  2WZN A;  3CXQ A;  2EK8 A;  4NGN A;  1ZG8 A;  4WWV A;  4YRH A;  4B5O A;  3V7Z A;  4ZBG A;  2IQ6 A;  4X2T A;  3D2M A;  3S6H A;  3SI1 A;  3WC7 A;  1S7F A;  5KTD A;  4UCM A;  5F47 A;  1FNO A;  1Y9K A;  4RUH A;  3H5Z A;  2V8G A;  1YK3 A;  3EFA A;  3HUV A;  1IOI A;  3TTH A;  4C2Y A;  3PB7 X;  2DPS A;  2POK A;  3NE8 A;  1XJO A;  3CXS A;  2VXK A;  1CP6 A;  2NSM A;  4MCS A;  2O53 A;  1R43 A;  3FYN A;  3KHZ A;  1EE3 P;  1SQH A;  1IB1 E;  3B2Y A;  1Z8L A;  2O28 A;  5HMN A;  2PIY A;  4U9Y A;  4E0A A;  3A9L A;  2AFW A;  3PFO A;  2CTC A;  3BJ8 A;  1L0C A;  3B7I A;  3K2K A;  2OZU A;  2ZOF A;  3QAY A;  4OLL A;  3R9E A;  2BL1 A;  3T9Y A;  1S7L A;  2OH1 A;  3JTK A;  4O23 A;  4H6U A;  1LCP A;  1QSN A;  4NGP A;  4UFV A;  3S6G A;  4LQ6 A;  4C68 A;  4FUU A;  4B12 A;  3WR7 A;  4CGO A;  2R98 A;  3BHX A;  2Z3K A;  4OC1 A;  4KOW A;  3B8G A;  4P4B A;  3WT4 A;  4CAW A;  3DNS A;  1DE4 C;  4F9U A;  1NSL A;  1Y7R A;  4CAX A;  4PSW A;  4H6Z A;  4MI4 A;  2FIA A;  2B5G B;  3G3S A;  3VWD A;  5I4M A;  1KUY A;  3VWE A;  3C26 A;  4Y49 C;  2ZOG A;  4Q38 A;  3PRT A;  4NGM A;  1Y7E A;  4OC5 A;  1TIQ A;  2C6C A;  2FXF A;  3IU2 A;  3V8I A;  1XBU A;  2O4H A;  4MFZ A;  5A28 A;  3D68 A;  3TCV A;  4R3L A;  2ZEG A;  1Z2L A;  4MRI A;  4XPL A;  4AVA A;  4DUK A;  2GLF A;  3R9G A;  1YR0 A;  2OZG A;  2CNT A;  1X10 A;  4R7M A;  2GE3 A;  2C27 A;  4P4J A;  1LFW A;  1AMP A;  1ELL P;  2ZW5 A;  2GIV A;  4KOT A;  2OOT A;  2K5T A;  2VI7 A;  3SJF A;  1BPM A;  1Q2C A;  1RTQ A;  4X3R A;  5D8N A;  4BD9 A;  2ZEP A;  3KI9 A;  1ELM P;  1M4G A;  3D3S A;  3B3S A;  4ZI6 A;  2H5M A;  1XE4 A;  1KUV A;  4OC2 A;  4NF1 A;  2AFX A;  3TFY A;  2PRB A;  4M6G A;  2Z3N A;  5HXD A;  1ZG9 A;  4R87 A;  1QMU A;  2OR4 A;  5LYI A;  2WUU A;  4XNH C;  1H8L A;  2Q4Y A;  4P4I A;  3IO1 A;  5JH9 A;  1VGY A;  4FD7 A;  3I1U A;  4PXE A;  3S9L A;  3TO9 A;  1IU8 A;  3FRM A;  2Q7S A;  4NSQ A;  3I3G A;  3IJ3 A;  1YSJ A;  5HVF A;  5THW A;  1ZO0 A;  1ZLH A;  2FS5 A;  1YX0 A;  1BLL E;  4L8A A;  4A32 A;  1YVK A;  2B4D A; 
#chains in the Genus database with same CATH homology
 4HPS A;  1Z8T A;  2EO8 A;  2EBJ A;  3RNZ A;  1AUG A;  3RO0 A;  3LAC A;  2DF5 A;  1IOF A;  1Z8X A;  1IOI A;  1IU8 A;  1X10 A;  1A2Z A;  1Z8W A;  1X12 A;  3GIU A;  4GXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...