1Z8TA

Structure of mutant pyrrolidone carboxyl peptidase (e192q) from a hyperthermophile, pyrococcus furiosus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
208
structure length
208
Chain Sequence
MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLSNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMSYEMQLEAVKVAIEVALEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Pyrrolidone-carboxylate peptidase
publication title Completely buried, non-ion-paired glutamic acid contributes favorably to the conformational stability of pyrrolidone carboxyl peptidases from hyperthermophiles.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 70
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 1z8tA00
1IOFA 1AUGA 1A2ZA 1Z8XA 1IU8A 1X10A 2DF5A 1Z8TA 3GIUA 2EBJA 4GXHA 1IOIA 3RNZA 1Z8WA 1X12A 3LACA 2EO8A 4HPSA 3RO0A
chains in the Genus database with same CATH superfamily
4ZY1A 2FCKA 3ISXA 4KUBA 4NGRA 3TFYA 3KZWA 3BJ7A 2CIJA 2Q7SA 4KORA 4M6IA 4E0AA 3PBBA 2ARHA 3D68A 2VI7A 3FXTA 4M6HA 4X2TA 3S6GA 4JJXA 1ZG8A 4F9VA 2G3AA 2NMTA 2V8DA 1N71A 3D3SA 4B6ZA 4HKFA 3EC4A 1XOVA 4NGNA 1IOIA 3DR8A 4X8IA 4UCNA 3KR5A 4B11A 2CNSA 2ZENA 1QQ9A 2AFOA 2JEWA 2ZW7A 2B4DA 3I3GA 4H6UA 2XEIA 4OKOA 3TO6A 1Z4RA 2EWBA 2GFQA 3WC7A 1IIDA 3F0AA 1PU9A 5A27A 3S9NA 1LAMA 2FIWA 4OADA 2I79A 1XEBA 2PJ7A 2I00A 2ZEHA 4YU9A 1F2PA 2G3TA 2R98A 2Z3PA 2ZEGA 3H8GA 2ZEPA 2ZW4A 3D7HA 4MFZA 1BPMA 1Z5RA 4JYWA 4MCPA 1LAPA 2PC1A 3JUWA 2CXAA 4FD5A 5EC4A 2FE7A 3VH9A 3GLJA 2C1CA 2PSWA 3JTKA 4Q7AA 2EBJA 2YNCC 3LODA 4E2AA 3TC8A 4JLYA 4MBUA 4R3LA 4QBJA 3VARA 4AVAA 1I12A 1MK4A 3IU1A 4C2XA 4CAVA 5BWAB 4CAWA 2WYRA 4UIBA 2RC4A 3IWWA 2AFZA 2CNTA 2DPTA 4UBRA 5H84A 2BCOA 4P4BA 2F5IA 2FXFA 1Q2CA 2H5MA 2O4HA 3GYAA 4MI4A 3H8FA 4WJBA 2REFA 3SJGA 2PJAA 3JRUA 4B13A 3R9GA 1R43A 4MHDA 1QMUA 1QSTA 3C26A 1OBRA 4KS9A 4KLWA 4YFJA 4H6ZA 4FD4A 4DJLA 3IEHA 4C2ZA 2PJ4A 4U9YA 3KL9A 5LYIA 4BD9A 3G8WA 4DNCA 3B3SA 1S7LA 2WUUA 1HEEA 2Z3OA 2YNCA 1Y9KA 2WSAA 4Y49C 2ZXVA 5LYFA 1MJAA 1MJBA 2PDOA 1KWMA 3D7DA 4LQ6A 4CGMA 4NGSA 3H4QA 3N7ZA 4K30A 2EUIA 4Y49B 1M4GA 2AFUA 2AFWA 2PJ0A 2PVVA 1FNOA 2Z3NA 4KZTA 3D2PA 1YLOA 4KOTA 4H2KA 2BOAA 4NSQA 5LRJA 2Z3MA 3QB8A 3SJXA 5LRKA 4K3NA 3PBEA 1S7KA 2Q4VA 4MXUA 3I9SA 2G0BA 1H8LA 2WZNA 4NJRA 5F46A 5J8FA 1TXRA 1YQEA 2V8GA 3KHXA 5K8PA 3G3SA 1PYTB 3R96A 2QMLA 4QVTA 4A39A 1Z8XA 3S9LA 2HUZA 2CTBA 2P6EA 3ZJ0A 4NEXA 4JWPA 1F57A 1YGHA 1I21A 1Z8TA 3SXOA 2PR1A 4AVBA 1ZLHA 2B3VA 1TKFA 1XJOA 4R9MA 4EWTA 1IYKA 3BI0A 3FRMA 2ZELA 4KOYA 4B12A 4UEZA 1DE4C 1YX0A 4PSXA 2ZEMA 1SQHA 1ZG9A 4MFPA 2PJ9A 5JPHA 1IICA 1TF8A 3HUVA 4FWUA 4G1PA 4OC5A 1LANA 2EVNA 2JEVA 3FIXA 1YR0A 3KI9A 2X7BA 3CXSA 3DSBA 2B58A 4C68A 5DWMA 4AB7A 1CM0A 4E8OA 2F7VA 5DWNA 1I1DA 3WC6A 2XEFA 4KVXA 4W9YA 5HH1A 2ZEFA 4KSFA 2R7HA 4P4FA 4PK3A 5C82A 2J8RA 6CPAA 3CPXA 4PXCA 3T90A 3GIUA 5ISVA 3P2FA 2ZEOA 1CP7A 4Q36A 4RS2A 2YGWA 4XNHC 1Z2LA 1LOKA 2PJ2A 5I4MA 4OLLA 1JQGA 2EK8A 5AG6A 3BLNA 3FNCA 4NFRA 1UFHA 4F8ZA 4LQGA 4FAIA 5G21A 1RTQA 3CZXA 4CS0B 2D4PA 3FEEA 4J3GA 2BSWA 3EXNA 4P4JA 2Q43A 4QC6A 2B4DB 1M4LA 2OZGA 5CNPA 1JWQA 3B3TA 3I1UA 3S6HA 3TO9A 4R7MA 4DYOA 5EMIA 3R95A 4B10A 2BEIA 1F2OA 1GHEA 4AVCA 4IF5A 5D29A 4KUAA 2C6GA 3PB6X 2BO9A 1KZFA 2O28A 2OH1A 4R87A 4XPLA 3EFAA 3WR7A 2O53A 5HVFA 4MCQA 2J9AA 5E96A 2JBJA 5F09A 4II9A 1AYEA 3RNZA 1ZO0A 2PJ8A 1RO5A 4KSIA 2VL1A 3TX8A 5G20A 2PRQA 4HNWB 4OC0A 5D8NA 2Y0MA 1IB1E 4RI1A 2RFHA 2VXKA 1Y9WA 3CDXA 2Z10A 4OIDA 3B3VA 1ZG7A 3PB8X 2VZYA 5G1ZA 5IB0A 1QSNA 4NGQA 1WWZA 3FYNA 1ELLP 1VGYA 4P4EA 1AUGA 4WWVA 1A2ZA 4UWIA 2CNMA 1P0HA 3TCVA 2DF5A 3FF3A 4R57A 2EK9A 2P6GA 2IJZA 3EO4A 4RN7A 2PIZA 2HQYA 5KTDA 3NH5A 1EE3P 1S7FA 4TNUA 2P6FA 3LACA 4O23A 4F6AA 4P4IA 4PSWA 3N5FA 3A9LA 1YSJA 1BPNA 4NF1A 3IO1A 3V8IA 1YMEA 1ZLIA 2PE3A 3NH4A 4UCMA 5JQ4A 4LUAA 3S6KA 2QECA 3SJFA 5JH9A 1XF8A 3KGQA 3DGVA 4MY3A 5IV0A 4KOUA 4PXBA 4OC2A 2Z3KA 2FS5A 2XEJA 1BO4A 1WK4A 4U9ZA 3TTHA 4EFDA 4ZI6A 4P44A 1L0CA 2GLFA 4A31A 4IHMA 4C7IA 5HXDA 4M3SA 2FT0A 4KOXA 4U5YA 3RAMA 3RYOA 1XBUA 4OC3A 4GXHA 4YRHA 3W6XA 3SI1A 3ZZIA 2PJBA 4L8AA 4EMEA 2V8VA 4NGMA 4ZBGA 3SHPA 4CGOA 1Z9UA 2C6PA 4UEEA 5IB9A 4PXEA 5CPAA 2PQ8A 1AMPA 1TKJA 1Y0RA 2PVWA 3QAYA 4KVOE 4MY0A 1BLLE 2PJ1A 5F48A 3NH8A 3PFOA 4FUUA 2ZOGA 4JXRA 7CPAA 1YW4A 3IGRA 2K5TA 2FIAA 4R3KA 2PJCA 4OP4A 1X10A 1S5KA 3RBUA 2G9DA 3PFEA 4CRYB 1YW6A 1IY7A 1TF9A 2CTCA 5THWA 3DR6A 1VIXA 2VQYA 4AG9A 4DUKA 4CAFA 2B4BA 4HNYB 4OC4A 3NE8A 4L89A 3GY9A 2IL4A 3KQXA 4X5KA 1YREA 1LFWA 1Z4EA 1QSMA 2GIVA 1VHSA 3WC5A 3V7ZA 5CBMA 4JZ0A 4YGOA 4CGNA 3H5ZA 1B6BA 3B2YA 3QNVA 1BAVA 4KOWA 4F0YA 5HVGA 3FVLA 3KQZA 2DPSA 1YVKA 2NSMA 3TOAA 1TKHA 2GANA 4B5PB 5J8CA 4MHYA 1U6MA 3LWUA 3LMSA 4YWYA 2R8VA 5H86A 2OZUA 4IAVA 2PJ6A 4UCPA 2XEGA 2VEZA 4ZY0A 3DDDA 2YNEA 3F5BA 3B8GA 4PXDA 3CPAA 4P45A 1M1DA 2PIYA 4CRZB 3UY5A 2ZEDA 4XNHB 4MMOA 3GB0A 2JDDA 4UF4A 5AG7A 2Q51A 4UWJA 1Q2YA 1J4JA 4CYQA 1HDQA 2WPWA 4H89A 5ELYA 4B5PA 3SXNA 3CXQA 2C27A 3WABA 8CPAA 3MN8A 5LYDA 2JBKA 4XPKA 4A33A 4B5OA 1B87A 4MCRA 4F9UA 2PRBA 3KHZA 4UEFA 2Q44A 3NFZA 1LCPA 5AGEA 3SI2A 4P6YA 3MRUA 1Y7RA 3ISZA 2VZZA 3PB4X 3BI1A 1PUAA 1M44A 1MJ9A 2V77A 4NGTA 1M4IA 3H8EA 1S3ZA 5JGFA 2PCUA 1Q7LA 2POKA 2REEA 4ZY2A 1Z8WA 2B5GA 4OIWA 3FBUA 4PV6A 3KKWA 4R8FA 4ZGYB 4R6TA 2ODFA 3DNSA 4A2ZA 5HVHA 2JLMA 5EBVA 2V8HA 5IX3A 3RO0A 3PEIA 4MRIA 1V0CA 4UFXA 5G22A 1XFOA 3D7FA 3NA6A 4MFLA 2C6CA 3V38A 5K8MA 1ARMA 2I3CA 4JXQA 4CGLA 3VWEA 2ZW5A 2J8NA 1YK3A 2DEAA 3GUXA 4QUSA 1YLEA 5LRGA 5F49A 3R9FA 2JDCA 5LYLA 4GS4A 2Q04A 5K8NA 4FD6A 4A32A 2GREA 4A95A 4P4DA 4CAEA 1RXTA 3K9TA 2AJ6A 3BXMA 5FVJA 2GE3A 2FVGA 2Q0YA 5AG5A 5F47A 3RZAA 4CGPA 4HPSA 4KOSA 4M85A 2ZEEA 1CP6A 3EY5A 1TIQA 3FECA 3PB9X 4ONWA 1FY7A 2QIRA 3PZJA 3VATA 1ON0A 3IJ3A 1DTDA 5DS0A 3IWGA 1IOFA 2OU2A 3WT4A 2BL1A 4C7HA 4JD6A 4KSAA 4NXYA 4I49A 1IU8A 5KTAA 3D67A 2P0WA 2ATRA 4PK2A 2BUEA 4R76A 1R3NA 4ZYQA 1S60A 4MHZA 2ZOFA 4OAEA 2D4OA 2QJ8A 3F8KA 4PPZA 3TT2A 2OOTA 4Z65A 3BHXA 3L2NA 4OC1A 1VHEA 2ABZA 3PP9A 1Y0YA 2ZPAA 1CPSA 3QAHA 2J8MA 3KASA 1XMTA 4MHNA 4ZX9A 1KUYA 2HB6A 2WPXA 2Z11A 3W6SA 4C2YA 2ZW6A 2Z0ZA 1K4JA 1XE4A 3GKRA 2CY2A 1LRZA 4LX9A 4UIAA 3S6FA 3FEDA 1R57A 4MFJA 2QYVA 3FMCA 3W91A 1OZPA 1Z8LA 2YNDA 2IQ6A 1XMBA 2HV2A 1BOBA 1XRYA 4HNXB 4FD7A 1KUVA 2Q7BA 4X3RA 3P2HA 2HC9A 2FL4A 2A4NA 5HMNA 3LD2A 1KUXA 4RUHA 5A28A 3T9YA 1PCAA 1CX8A 4ZX8A 4NJQA 4KVME 4MJ8A 1IGBA 4KOVA 3SI0A 2Q4YA 1CG2A 2Z3LA 3CT9A 1S7NA 4CYNA 1QSOA 2QVPA 1NSAA 2DXQA 2PR8A 3PGPA 4Q38A 2PJ5A 4XPDC 3IFEA 3TE4A 3B3WA 1Y7EA 3R9EA 4MCSA 3PRTA 3D4UA 4MFQA 4XPDB 1FT7A 4CPAA 4CYPA 2R1IA 4AXVA 3D8PA 3VWDA 5JM6A 4BINA 2CF4A 2KCWA 4ORFA 1HDUA 1GYTA 3IU2A 3NE7A 2AFSA 2VBQA 5C88A 3D66A 4NCZA 1ARLA 3KR4A 4P10A 4AG7A 3B3CA 3S9MA 1VHOA 1ELMP 2GU2A 1VKCA 1NE9A 3PB7X 3R1KA 3DLJA 1X12A 4ONUA 2AFXA 2PJ3A 4A38A 4UA3A 3E0KA 4QB9A 1P4NA 2Q4ZA 2B5GB 2GLJA 5I0CA 3CXPA 4MFKA 3FX6A 3IC1A 2AE6A 3K9UA 4IUSA 4OMEA 4EVYA 2F8HA 4A94A 1CJWA 5KTCA 3D2MA 4MHPA 5K8OA 4M6GA 4PQAA 4UFWA 3T8WA 3TO7A 2B3UA 2OR4A 4B14A 5AG4A 3JVNA 3FH4A 4KLVA 4A30A 4UFVA 3FJUA 3HLPA 4GM5A 2RB7A 3IIBA 1QSRA 3B35A 4BMHA 3FB3A 3SJEA 1M4DA 2AFMA 1NSLA 3BJ8A 1Q2DA 2NYQA 4FBEA 5J1QA 3D7GA 2FSRA 4A37A 4F0XA 4CAXA 3MGDA 2EO8A 1IYLA 3OWCA 1YVOA 2OB0A 4NGPA 1CBXA 5GCNA 4IK2A 1UWYA 2OZHA 3B7IA 4TWEA 1CPXA 4BBHA 4CYOA 3TOBA 1NMTA 3IWEA 2IMOA 3K2KA 1XIXA 2ANPA
chains in the Genus database with same CATH topology
1IOFA 1AUGA 1A2ZA 1Z8XA 1IU8A 1X10A 2DF5A 1Z8TA 3GIUA 2EBJA 4GXHA 1IOIA 3RNZA 1Z8WA 1X12A 3LACA 2EO8A 4HPSA 3RO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IOF A;  1AUG A;  1A2Z A;  1Z8X A;  1IU8 A;  1X10 A;  2DF5 A;  1Z8T A;  3GIU A;  2EBJ A;  4GXH A;  1IOI A;  3RNZ A;  1Z8W A;  1X12 A;  3LAC A;  2EO8 A;  4HPS A;  3RO0 A; 
#chains in the Genus database with same CATH topology
 4ZY1 A;  2FCK A;  3ISX A;  4KUB A;  4NGR A;  3TFY A;  3KZW A;  3BJ7 A;  2CIJ A;  2Q7S A;  4KOR A;  4M6I A;  4E0A A;  3PBB A;  2ARH A;  3D68 A;  2VI7 A;  3FXT A;  4M6H A;  4X2T A;  3S6G A;  4JJX A;  1ZG8 A;  4F9V A;  2G3A A;  2NMT A;  2V8D A;  1N71 A;  3D3S A;  4B6Z A;  4HKF A;  3EC4 A;  1XOV A;  4NGN A;  1IOI A;  3DR8 A;  4X8I A;  4UCN A;  3KR5 A;  4B11 A;  2CNS A;  2ZEN A;  1QQ9 A;  2AFO A;  2JEW A;  2ZW7 A;  2B4D A;  3I3G A;  4H6U A;  2XEI A;  4OKO A;  3TO6 A;  1Z4R A;  2EWB A;  2GFQ A;  3WC7 A;  1IID A;  3F0A A;  1PU9 A;  5A27 A;  3S9N A;  1LAM A;  2FIW A;  4OAD A;  2I79 A;  1XEB A;  2PJ7 A;  2I00 A;  2ZEH A;  4YU9 A;  1F2P A;  2G3T A;  2R98 A;  2Z3P A;  2ZEG A;  3H8G A;  2ZEP A;  2ZW4 A;  3D7H A;  4MFZ A;  1BPM A;  1Z5R A;  4JYW A;  4MCP A;  1LAP A;  2PC1 A;  3JUW A;  2CXA A;  4FD5 A;  5EC4 A;  2FE7 A;  3VH9 A;  3GLJ A;  2C1C A;  2PSW A;  3JTK A;  4Q7A A;  2EBJ A;  2YNC C;  3LOD A;  4E2A A;  3TC8 A;  4JLY A;  4MBU A;  4R3L A;  4QBJ A;  3VAR A;  4AVA A;  1I12 A;  1MK4 A;  3IU1 A;  4C2X A;  4CAV A;  5BWA B;  4CAW A;  2WYR A;  4UIB A;  2RC4 A;  3IWW A;  2AFZ A;  2CNT A;  2DPT A;  4UBR A;  5H84 A;  2BCO A;  4P4B A;  2F5I A;  2FXF A;  1Q2C A;  2H5M A;  2O4H A;  3GYA A;  4MI4 A;  3H8F A;  4WJB A;  2REF A;  3SJG A;  2PJA A;  3JRU A;  4B13 A;  3R9G A;  1R43 A;  4MHD A;  1QMU A;  1QST A;  3C26 A;  1OBR A;  4KS9 A;  4KLW A;  4YFJ A;  4H6Z A;  4FD4 A;  4DJL A;  3IEH A;  4C2Z A;  2PJ4 A;  4U9Y A;  3KL9 A;  5LYI A;  4BD9 A;  3G8W A;  4DNC A;  3B3S A;  1S7L A;  2WUU A;  1HEE A;  2Z3O A;  2YNC A;  1Y9K A;  2WSA A;  4Y49 C;  2ZXV A;  5LYF A;  1MJA A;  1MJB A;  2PDO A;  1KWM A;  3D7D A;  4LQ6 A;  4CGM A;  4NGS A;  3H4Q A;  3N7Z A;  4K30 A;  2EUI A;  4Y49 B;  1M4G A;  2AFU A;  2AFW A;  2PJ0 A;  2PVV A;  1FNO A;  2Z3N A;  4KZT A;  3D2P A;  1YLO A;  4KOT A;  4H2K A;  2BOA A;  4NSQ A;  5LRJ A;  2Z3M A;  3QB8 A;  3SJX A;  5LRK A;  4K3N A;  3PBE A;  1S7K A;  2Q4V A;  4MXU A;  3I9S A;  2G0B A;  1H8L A;  2WZN A;  4NJR A;  5F46 A;  5J8F A;  1TXR A;  1YQE A;  2V8G A;  3KHX A;  5K8P A;  3G3S A;  1PYT B;  3R96 A;  2QML A;  4QVT A;  4A39 A;  1Z8X A;  3S9L A;  2HUZ A;  2CTB A;  2P6E A;  3ZJ0 A;  4NEX A;  4JWP A;  1F57 A;  1YGH A;  1I21 A;  1Z8T A;  3SXO A;  2PR1 A;  4AVB A;  1ZLH A;  2B3V A;  1TKF A;  1XJO A;  4R9M A;  4EWT A;  1IYK A;  3BI0 A;  3FRM A;  2ZEL A;  4KOY A;  4B12 A;  4UEZ A;  1DE4 C;  1YX0 A;  4PSX A;  2ZEM A;  1SQH A;  1ZG9 A;  4MFP A;  2PJ9 A;  5JPH A;  1IIC A;  1TF8 A;  3HUV A;  4FWU A;  4G1P A;  4OC5 A;  1LAN A;  2EVN A;  2JEV A;  3FIX A;  1YR0 A;  3KI9 A;  2X7B A;  3CXS A;  3DSB A;  2B58 A;  4C68 A;  5DWM A;  4AB7 A;  1CM0 A;  4E8O A;  2F7V A;  5DWN A;  1I1D A;  3WC6 A;  2XEF A;  4KVX A;  4W9Y A;  5HH1 A;  2ZEF A;  4KSF A;  2R7H A;  4P4F A;  4PK3 A;  5C82 A;  2J8R A;  6CPA A;  3CPX A;  4PXC A;  3T90 A;  3GIU A;  5ISV A;  3P2F A;  2ZEO A;  1CP7 A;  4Q36 A;  4RS2 A;  2YGW A;  4XNH C;  1Z2L A;  1LOK A;  2PJ2 A;  5I4M A;  4OLL A;  1JQG A;  2EK8 A;  5AG6 A;  3BLN A;  3FNC A;  4NFR A;  1UFH A;  4F8Z A;  4LQG A;  4FAI A;  5G21 A;  1RTQ A;  3CZX A;  4CS0 B;  2D4P A;  3FEE A;  4J3G A;  2BSW A;  3EXN A;  4P4J A;  2Q43 A;  4QC6 A;  2B4D B;  1M4L A;  2OZG A;  5CNP A;  1JWQ A;  3B3T A;  3I1U A;  3S6H A;  3TO9 A;  4R7M A;  4DYO A;  5EMI A;  3R95 A;  4B10 A;  2BEI A;  1F2O A;  1GHE A;  4AVC A;  4IF5 A;  5D29 A;  4KUA A;  2C6G A;  3PB6 X;  2BO9 A;  1KZF A;  2O28 A;  2OH1 A;  4R87 A;  4XPL A;  3EFA A;  3WR7 A;  2O53 A;  5HVF A;  4MCQ A;  2J9A A;  5E96 A;  2JBJ A;  5F09 A;  4II9 A;  1AYE A;  3RNZ A;  1ZO0 A;  2PJ8 A;  1RO5 A;  4KSI A;  2VL1 A;  3TX8 A;  5G20 A;  2PRQ A;  4HNW B;  4OC0 A;  5D8N A;  2Y0M A;  1IB1 E;  4RI1 A;  2RFH A;  2VXK A;  1Y9W A;  3CDX A;  2Z10 A;  4OID A;  3B3V A;  1ZG7 A;  3PB8 X;  2VZY A;  5G1Z A;  5IB0 A;  1QSN A;  4NGQ A;  1WWZ A;  3FYN A;  1ELL P;  1VGY A;  4P4E A;  1AUG A;  4WWV A;  1A2Z A;  4UWI A;  2CNM A;  1P0H A;  3TCV A;  2DF5 A;  3FF3 A;  4R57 A;  2EK9 A;  2P6G A;  2IJZ A;  3EO4 A;  4RN7 A;  2PIZ A;  2HQY A;  5KTD A;  3NH5 A;  1EE3 P;  1S7F A;  4TNU A;  2P6F A;  3LAC A;  4O23 A;  4F6A A;  4P4I A;  4PSW A;  3N5F A;  3A9L A;  1YSJ A;  1BPN A;  4NF1 A;  3IO1 A;  3V8I A;  1YME A;  1ZLI A;  2PE3 A;  3NH4 A;  4UCM A;  5JQ4 A;  4LUA A;  3S6K A;  2QEC A;  3SJF A;  5JH9 A;  1XF8 A;  3KGQ A;  3DGV A;  4MY3 A;  5IV0 A;  4KOU A;  4PXB A;  4OC2 A;  2Z3K A;  2FS5 A;  2XEJ A;  1BO4 A;  1WK4 A;  4U9Z A;  3TTH A;  4EFD A;  4ZI6 A;  4P44 A;  1L0C A;  2GLF A;  4A31 A;  4IHM A;  4C7I A;  5HXD A;  4M3S A;  2FT0 A;  4KOX A;  4U5Y A;  3RAM A;  3RYO A;  1XBU A;  4OC3 A;  4GXH A;  4YRH A;  3W6X A;  3SI1 A;  3ZZI A;  2PJB A;  4L8A A;  4EME A;  2V8V A;  4NGM A;  4ZBG A;  3SHP A;  4CGO A;  1Z9U A;  2C6P A;  4UEE A;  5IB9 A;  4PXE A;  5CPA A;  2PQ8 A;  1AMP A;  1TKJ A;  1Y0R A;  2PVW A;  3QAY A;  4KVO E;  4MY0 A;  1BLL E;  2PJ1 A;  5F48 A;  3NH8 A;  3PFO A;  4FUU A;  2ZOG A;  4JXR A;  7CPA A;  1YW4 A;  3IGR A;  2K5T A;  2FIA A;  4R3K A;  2PJC A;  4OP4 A;  1X10 A;  1S5K A;  3RBU A;  2G9D A;  3PFE A;  4CRY B;  1YW6 A;  1IY7 A;  1TF9 A;  2CTC A;  5THW A;  3DR6 A;  1VIX A;  2VQY A;  4AG9 A;  4DUK A;  4CAF A;  2B4B A;  4HNY B;  4OC4 A;  3NE8 A;  4L89 A;  3GY9 A;  2IL4 A;  3KQX A;  4X5K A;  1YRE A;  1LFW A;  1Z4E A;  1QSM A;  2GIV A;  1VHS A;  3WC5 A;  3V7Z A;  5CBM A;  4JZ0 A;  4YGO A;  4CGN A;  3H5Z A;  1B6B A;  3B2Y A;  3QNV A;  1BAV A;  4KOW A;  4F0Y A;  5HVG A;  3FVL A;  3KQZ A;  2DPS A;  1YVK A;  2NSM A;  3TOA A;  1TKH A;  2GAN A;  4B5P B;  5J8C A;  4MHY A;  1U6M A;  3LWU A;  3LMS A;  4YWY A;  2R8V A;  5H86 A;  2OZU A;  4IAV A;  2PJ6 A;  4UCP A;  2XEG A;  2VEZ A;  4ZY0 A;  3DDD A;  2YNE A;  3F5B A;  3B8G A;  4PXD A;  3CPA A;  4P45 A;  1M1D A;  2PIY A;  4CRZ B;  3UY5 A;  2ZED A;  4XNH B;  4MMO A;  3GB0 A;  2JDD A;  4UF4 A;  5AG7 A;  2Q51 A;  4UWJ A;  1Q2Y A;  1J4J A;  4CYQ A;  1HDQ A;  2WPW A;  4H89 A;  5ELY A;  4B5P A;  3SXN A;  3CXQ A;  2C27 A;  3WAB A;  8CPA A;  3MN8 A;  5LYD A;  2JBK A;  4XPK A;  4A33 A;  4B5O A;  1B87 A;  4MCR A;  4F9U A;  2PRB A;  3KHZ A;  4UEF A;  2Q44 A;  3NFZ A;  1LCP A;  5AGE A;  3SI2 A;  4P6Y A;  3MRU A;  1Y7R A;  3ISZ A;  2VZZ A;  3PB4 X;  3BI1 A;  1PUA A;  1M44 A;  1MJ9 A;  2V77 A;  4NGT A;  1M4I A;  3H8E A;  1S3Z A;  5JGF A;  2PCU A;  1Q7L A;  2POK A;  2REE A;  4ZY2 A;  1Z8W A;  2B5G A;  4OIW A;  3FBU A;  4PV6 A;  3KKW A;  4R8F A;  4ZGY B;  4R6T A;  2ODF A;  3DNS A;  4A2Z A;  5HVH A;  2JLM A;  5EBV A;  2V8H A;  5IX3 A;  3RO0 A;  3PEI A;  4MRI A;  1V0C A;  4UFX A;  5G22 A;  1XFO A;  3D7F A;  3NA6 A;  4MFL A;  2C6C A;  3V38 A;  5K8M A;  1ARM A;  2I3C A;  4JXQ A;  4CGL A;  3VWE A;  2ZW5 A;  2J8N A;  1YK3 A;  2DEA A;  3GUX A;  4QUS A;  1YLE A;  5LRG A;  5F49 A;  3R9F A;  2JDC A;  5LYL A;  4GS4 A;  2Q04 A;  5K8N A;  4FD6 A;  4A32 A;  2GRE A;  4A95 A;  4P4D A;  4CAE A;  1RXT A;  3K9T A;  2AJ6 A;  3BXM A;  5FVJ A;  2GE3 A;  2FVG A;  2Q0Y A;  5AG5 A;  5F47 A;  3RZA A;  4CGP A;  4HPS A;  4KOS A;  4M85 A;  2ZEE A;  1CP6 A;  3EY5 A;  1TIQ A;  3FEC A;  3PB9 X;  4ONW A;  1FY7 A;  2QIR A;  3PZJ A;  3VAT A;  1ON0 A;  3IJ3 A;  1DTD A;  5DS0 A;  3IWG A;  1IOF A;  2OU2 A;  3WT4 A;  2BL1 A;  4C7H A;  4JD6 A;  4KSA A;  4NXY A;  4I49 A;  1IU8 A;  5KTA A;  3D67 A;  2P0W A;  2ATR A;  4PK2 A;  2BUE A;  4R76 A;  1R3N A;  4ZYQ A;  1S60 A;  4MHZ A;  2ZOF A;  4OAE A;  2D4O A;  2QJ8 A;  3F8K A;  4PPZ A;  3TT2 A;  2OOT A;  4Z65 A;  3BHX A;  3L2N A;  4OC1 A;  1VHE A;  2ABZ A;  3PP9 A;  1Y0Y A;  2ZPA A;  1CPS A;  3QAH A;  2J8M A;  3KAS A;  1XMT A;  4MHN A;  4ZX9 A;  1KUY A;  2HB6 A;  2WPX A;  2Z11 A;  3W6S A;  4C2Y A;  2ZW6 A;  2Z0Z A;  1K4J A;  1XE4 A;  3GKR A;  2CY2 A;  1LRZ A;  4LX9 A;  4UIA A;  3S6F A;  3FED A;  1R57 A;  4MFJ A;  2QYV A;  3FMC A;  3W91 A;  1OZP A;  1Z8L A;  2YND A;  2IQ6 A;  1XMB A;  2HV2 A;  1BOB A;  1XRY A;  4HNX B;  4FD7 A;  1KUV A;  2Q7B A;  4X3R A;  3P2H A;  2HC9 A;  2FL4 A;  2A4N A;  5HMN A;  3LD2 A;  1KUX A;  4RUH A;  5A28 A;  3T9Y A;  1PCA A;  1CX8 A;  4ZX8 A;  4NJQ A;  4KVM E;  4MJ8 A;  1IGB A;  4KOV A;  3SI0 A;  2Q4Y A;  1CG2 A;  2Z3L A;  3CT9 A;  1S7N A;  4CYN A;  1QSO A;  2QVP A;  1NSA A;  2DXQ A;  2PR8 A;  3PGP A;  4Q38 A;  2PJ5 A;  4XPD C;  3IFE A;  3TE4 A;  3B3W A;  1Y7E A;  3R9E A;  4MCS A;  3PRT A;  3D4U A;  4MFQ A;  4XPD B;  1FT7 A;  4CPA A;  4CYP A;  2R1I A;  4AXV A;  3D8P A;  3VWD A;  5JM6 A;  4BIN A;  2CF4 A;  2KCW A;  4ORF A;  1HDU A;  1GYT A;  3IU2 A;  3NE7 A;  2AFS A;  2VBQ A;  5C88 A;  3D66 A;  4NCZ A;  1ARL A;  3KR4 A;  4P10 A;  4AG7 A;  3B3C A;  3S9M A;  1VHO A;  1ELM P;  2GU2 A;  1VKC A;  1NE9 A;  3PB7 X;  3R1K A;  3DLJ A;  1X12 A;  4ONU A;  2AFX A;  2PJ3 A;  4A38 A;  4UA3 A;  3E0K A;  4QB9 A;  1P4N A;  2Q4Z A;  2B5G B;  2GLJ A;  5I0C A;  3CXP A;  4MFK A;  3FX6 A;  3IC1 A;  2AE6 A;  3K9U A;  4IUS A;  4OME A;  4EVY A;  2F8H A;  4A94 A;  1CJW A;  5KTC A;  3D2M A;  4MHP A;  5K8O A;  4M6G A;  4PQA A;  4UFW A;  3T8W A;  3TO7 A;  2B3U A;  2OR4 A;  4B14 A;  5AG4 A;  3JVN A;  3FH4 A;  4KLV A;  4A30 A;  4UFV A;  3FJU A;  3HLP A;  4GM5 A;  2RB7 A;  3IIB A;  1QSR A;  3B35 A;  4BMH A;  3FB3 A;  3SJE A;  1M4D A;  2AFM A;  1NSL A;  3BJ8 A;  1Q2D A;  2NYQ A;  4FBE A;  5J1Q A;  3D7G A;  2FSR A;  4A37 A;  4F0X A;  4CAX A;  3MGD A;  2EO8 A;  1IYL A;  3OWC A;  1YVO A;  2OB0 A;  4NGP A;  1CBX A;  5GCN A;  4IK2 A;  1UWY A;  2OZH A;  3B7I A;  4TWE A;  1CPX A;  4BBH A;  4CYO A;  3TOB A;  1NMT A;  3IWE A;  2IMO A;  3K2K A;  1XIX A;  2ANP A; 
#chains in the Genus database with same CATH homology
 1IOF A;  1AUG A;  1A2Z A;  1Z8X A;  1IU8 A;  1X10 A;  2DF5 A;  1Z8T A;  3GIU A;  2EBJ A;  4GXH A;  1IOI A;  3RNZ A;  1Z8W A;  1X12 A;  3LAC A;  2EO8 A;  4HPS A;  3RO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...