1Z8TA

Structure of mutant pyrrolidone carboxyl peptidase (e192q) from a hyperthermophile, pyrococcus furiosus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
208
structure length
208
Chain Sequence
b'MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLSNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMSYEMQLEAVKVAIEVALEELL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrrolidone-carboxylate peptidase
publication title Completely buried, non-ion-paired glutamic acid contributes favorably to the conformational stability of pyrrolidone carboxyl peptidases from hyperthermophiles.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 70
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 1z8tA00
3RO0A 3RNZA 1X10A 1Z8WA 1Z8XA 1X12A 3GIUA 4HPSA 2DF5A 1Z8TA 1IOIA 2EBJA 3LACA 2EO8A 1AUGA 1IU8A 1A2ZA 1IOFA 4GXHA
chains in the Genus database with same CATH superfamily
4NSQA 1UWYA 4MY0A 2ZW7A 3ISXA 3KHXA 2Z0ZA 2Q4ZA 3FBUA 1KZFA 2IJZA 3D4UA 3PBBA 4CGOA 3V7ZA 2PQ8A 4I49A 1P4NA 1R3NA 3D7FA 2GLFA 2DXQA 3RNZA 3NE8A 3K9UA 4OC1A 5LYIA 2JBJA 2OU2A 4NGQA 3CXPA 1LAPA 4E2AA 1IGBA 1J4JA 1Z8WA 3D3SA 1Z8XA 1YR0A 1FY7A 2NSMA 1Y7EA 1IYLA 4KVOE 1PCAA 2QIRA 3N7ZA 4OLLA 2H5MA 1F2OA 1XEBA 3OWCA 2CXAA 4CYOA 4TNUA 2Z3LA 5F46A 3S9LA 3WC7A 4B6ZA 2Q0YA 4KSIA 2B4DB 3D7DA 1ZLIA 3FB3A 4B14A 3TTHA 2FE7A 2C6CA 2D4OA 2PJ6A 1NMTA 4M85A 1BPNA 2Z11A 3FNCA 3H5ZA 3KZWA 4A95A 4KOVA 1MJ9A 2R98A 4CGMA 3VARA 1PUAA 4MFLA 2K5TA 3CPXA 3DSBA 1Q7LA 4LX9A 4C2XA 4KOSA 2CNSA 4W9YA 3PGPA 4ZY1A 4IAVA 1ZG7A 4E0AA 2ZPAA 4YGOA 4JZ0A 4TWEA 2V8DA 3CXQA 3S9MA 2CNTA 1IIDA 3LACA 4UCNA 4FUUA 1K4JA 3PRTA 5DS0A 1QQ9A 2ODFA 5DWNA 4CAWA 1Y0YA 3HLPA 3RYOA 4A2ZA 4AVAA 4F8ZA 1KUXA 5CPAA 3BLNA 4L89A 1JQGA 2O28A 1TIQA 1B6BA 2Q51A 4UF4A 4JWPA 2DPTA 1CJWA 1TKJA 3KASA 3JUWA 4QVTA 4DYOA 3LMSA 3VWDA 4A37A 4AXVA 3IWEA 4MMOA 3QNVA 4KUBA 1KUYA 4PK2A 4F0XA 1CPXA 3FH4A 1ARMA 5AG6A 4KSAA 4NGRA 4AG9A 4XNHB 4RS2A 3IJ3A 3S6GA 4MCQA 4U9ZA 4FD4A 4LQ6A 2QMLA 3KGQA 3T90A 2PR1A 4C2ZA 2EWBA 3FXTA 2P6GA 4PXBA 2AFOA 5C82A 3E0KA 2B4BA 4G1PA 3LD2A 5JGFA 3B7IA 2OB0A 4M6IA 4A32A 1IU8A 3W91A 4B13A 2JBKA 3PZJA 3KQXA 4X3RA 2P6EA 5H84A 4NGNA 1IYKA 1AYEA 3DDDA 3TC8A 5ISVA 4Y49B 2O4HA 2REFA 2WUUA 3SHPA 3FJUA 1BLLE 1M4DA 3LODA 3NFZA 4NCZA 5JH9A 2FT0A 4HNXB 2P6FA 1TXRA 3IFEA 5DWMA 2FXFA 1YLOA 2PSWA 3B35A 3SI1A 2ZELA 4KORA 4Q36A 2I3CA 3TO6A 5IB9A 1ELMP 1VHEA 2ATRA 4MFJA 1CBXA 4KOUA 4NF1A 3PFEA 1QSNA 3PB9X 4P4DA 4B5PA 3G3SA 2RB7A 1RO5A 2ZW6A 4AVBA 4C7IA 4JD6A 2HB6A 3DGVA 4EMEA 1CPSA 3CDXA 4NGMA 4XPLA 3N5FA 4A31A 4AB7A 2CF4A 4JXRA 3BI1A 4UWJA 2OZGA 1Z4EA 2J8NA 3A9LA 4YWYA 4ZY0A 4CYPA 4KOXA 5K8PA 2EK8A 1Y9KA 2XEFA 2I00A 2ZEPA 4MCRA 1PYTB 4OP4A 4R9MA 5AG5A 5EMIA 4FD7A 2J9AA 1XE4A 3GY9A 4OC0A 4RUHA 3DR8A 1NSAA 2VXKA 5LRJA 4ZBGA 3DNSA 2Z3MA 3I1UA 3T9YA 4P44A 4MHYA 4ZY2A 4UFVA 1Z8LA 3TCVA 1FT7A 2ZW5A 4B5PB 1MJBA 2WYRA 2V8VA 4CRYB 5G20A 3H4QA 2REEA 5FVJA 5LYDA 4CAVA 2G3AA 2D4PA 2PJ2A 3R96A 2HC9A 2Q4YA 3WC6A 4PSWA 4FBEA 3GUXA 3SXNA 1TKHA 2J8RA 4B11A 1LOKA 5A28A 5JPHA 1HDUA 4P4JA 1XIXA 1I1DA 5G22A 1X12A 4KSFA 4XPDC 1V0CA 1QMUA 4O23A 3F8KA 4MFQA 5LYFA 1JWQA 1R43A 3V8IA 1YSJA 4F9UA 2I79A 3W6XA 2WZNA 2BO9A 2V8GA 4CYNA 2FVGA 3PBEA 4J3GA 5C88A 2GFQA 3CPAA 2WSAA 2C6GA 2GREA 1F2PA 2BUEA 4M6GA 5F48A 3WC5A 2VBQA 4B5OA 4Z65A 2Z3KA 1CP7A 2ZW4A 5F09A 4X8IA 1LAMA 1S3ZA 3B8GA 3GYAA 3KR5A 3QB8A 1LCPA 7CPAA 4XPKA 5G21A 1S7FA 2AFSA 2OOTA 2PJ1A 4GS4A 1YQEA 1M4IA 3I3GA 4YU9A 4OIWA 5HVGA 1GYTA 2GLJA 2QECA 3D2PA 2PJ0A 3H8EA 5HVFA 4BINA 2CTCA 1Z9UA 2ZEEA 3IU1A 3D2MA 4P4BA 4R76A 3R9EA 4IK2A 3JTKA 2JLMA 2PJ9A 3KI9A 2AE6A 4CAFA 3ZZIA 3PEIA 1VKCA 4NGPA 1NE9A 4CGPA 5F49A 4AG7A 4H6UA 4MJ8A 4P4IA 5LRGA 4DJLA 1XFOA 4M3SA 4A30A 3D7GA 3D8PA 4CS0B 4JLYA 4X2TA 5LYLA 2EUIA 3IC1A 4K3NA 5IV0A 4H89A 2IQ6A 2ZOGA 2PE3A 3IEHA 4RI1A 1DE4C 1LRZA 4LUAA 3SJEA 3D7HA 3H8GA 4DNCA 2QVPA 3SJXA 4MCSA 3EC4A 1IY7A 2Q44A 2R1IA 2Z3PA 2ZEGA 1F57A 2PJCA 1EE3P 2Q43A 2CY2A 2G3TA 3B3WA 3QAHA 4R7MA 1WWZA 4UEEA 4NJQA 4CRZB 1SQHA 5K8MA 3GKRA 4HNWB 3DLJA 2ABZA 3FX6A 4A33A 2V77A 1YMEA 3NH5A 1RXTA 4PXDA 2F8HA 4BMHA 1NSLA 2YNDA 4C7HA 4UFXA 3S6FA 5K8OA 1HEEA 5THWA 3NH4A 4U5YA 2HUZA 2OZUA 5BWAB 1RTQA 2JDCA 1YGHA 1L0CA 2P0WA 2VL1A 1OBRA 5F47A 3SI2A 1X10A 4BBHA 4CGNA 4QBJA 1XBUA 2XEJA 4ZI6A 3LWUA 1Q2CA 1ON0A 2B5GA 1HDQA 2AFMA 3WR7A 5A27A 2EO8A 3L2NA 3QAYA 5EC4A 2GU2A 2EK9A 1YW4A 2ZENA 4P4FA 5AGEA 4OC5A 4A39A 2FL4A 1DTDA 2CNMA 1GHEA 2OH1A 2XEGA 4MHNA 4FAIA 4WWVA 5K8NA 4KVME 4YFJA 5IB0A 2VQYA 1TF8A 2WPWA 3R1KA 3S6KA 4R57A 1Z4RA 4ZGYB 2Q7SA 4EWTA 1QSMA 4ORFA 5I4MA 1IB1E 3TE4A 2WPXA 1ZO0A 3D66A 1M4LA 4KZTA 1UFHA 3B3TA 4FD5A 3KHZA 2PIZA 3NH8A 2BL1A 5J1QA 4MFZA 1S60A 3NE7A 3BJ7A 2B3UA 3VWEA 4OIDA 3NA6A 2ZEDA 2DPSA 3IO1A 3KL9A 5D8NA 1Q2YA 1Q2DA 2FIWA 3FIXA 4JXQA 3KKWA 1IOFA 4UCPA 4FD6A 1YLEA 4B12A 4Q7AA 2XEIA 2ZOFA 3B2YA 3KQZA 1BOBA 1LFWA 1P0HA 2FS5A 1Y7RA 2DEAA 2F5IA 3GB0A 4PSXA 4PXCA 2Z3NA 3VH9A 4F0YA 2PCUA 1Z2LA 4OADA 2HQYA 1ELLP 3P2HA 2AFWA 2AFXA 1KUVA 3W6SA 1ZG9A 4RN7A 4U9YA 5GCNA 1U6MA 1FNOA 2NMTA 1BPMA 3PP9A 4MI4A 3SJFA 1VHSA 3TT2A 2JEWA 4OAEA 1CP6A 3CXSA 3PFOA 2HV2A 2RFHA 4KS9A 4WJBA 3WABA 4ZYQA 2PJ5A 2Q4VA 5D29A 6CPAA 3S9NA 2BOAA 4ZX9A 2ZEOA 4YRHA 2V8HA 3IU2A 3SXOA 2OR4A 2PR8A 3BHXA 1AUGA 2ZEFA 2ZEMA 3DR6A 4GXHA 3EY5A 4AVCA 5JM6A 4KOTA 3TO7A 2QJ8A 3ISZA 3FMCA 3FEEA 3IWWA 4ONUA 5G1ZA 4XPDB 4MY3A 2B58A 2PJ4A 2G9DA 2GIVA 1TKFA 3TX8A 2VZYA 3D68A 1Y9WA 5H86A 3CT9A 3SI0A 5JQ4A 3TOAA 4QC6A 4K30A 4HPSA 2X7BA 2YNEA 3FEDA 2DF5A 4MHDA 2FCKA 3RBUA 4NXYA 4UEZA 5J8FA 4IUSA 4OKOA 4P45A 4P4EA 4ZX8A 1YVKA 4UCMA 4UIAA 3ZJ0A 2VEZA 2BEIA 5HVHA 4CPAA 1I12A 4KUAA 5EBVA 2RC4A 2R7HA 3F0AA 4KOWA 4EVYA 2ARHA 3KR4A 3B3VA 4QUSA 1ZLHA 5KTDA 3WT4A 4NGSA 3FRMA 1WK4A 1YVOA 8CPAA 3PB4X 3R9FA 2YNCA 4KLWA 4HKFA 1XJOA 2PRBA 2PJBA 2PRQA 2C1CA 2PC1A 1S7NA 2CIJA 4C68A 1Y0RA 2IMOA 2PIYA 1YX0A 3BJ8A 3HUVA 5HH1A 1IICA 4KLVA 1LANA 2ZEHA 2EBJA 3G8WA 3P2FA 4MHZA 4UIBA 4CAEA 4XNHC 3FECA 3C26A 4ONWA 2YNCC 4P6YA 2C6PA 2PJ8A 4JJXA 4R3KA 1Z5RA 1H8LA 4CAXA 1TF9A 2FIAA 2PJAA 4R6TA 3TOBA 3RO0A 3BXMA 1XRYA 3FYNA 4KOYA 4NJRA 3D67A 3VATA 3RAMA 1M4GA 2BSWA 2GANA 4R3LA 2A4NA 4C2YA 1M1DA 3B3CA 3S6HA 4X5KA 4MRIA 1ARLA 1OZPA 4LQGA 3MN8A 4PQAA 2AFZA 2PJ3A 5IX3A 4JYWA 1CM0A 4MHPA 3PB8X 1XOVA 4Y49C 3H8FA 2PVWA 4GM5A 1XMTA 2F7VA 3IGRA 2G0BA 3PB7X 4CGLA 3K9TA 1IOIA 2AJ6A 2R8VA 1QSRA 4E8OA 3MGDA 4F6AA 2POKA 2Y0MA 3JVNA 2KCWA 4Q38A 1VHOA 4NFRA 2PDOA 3FF3A 3IIBA 3PB6X 4B10A 4MFKA 1PU9A 4P10A 5HXDA 1YW6A 4UFWA 5KTCA 1S7LA 1MJAA 4NGTA 4UEFA 3CZXA 2IL4A 4MCPA 1R57A 5AG4A 2ZXVA 3GLJA 5ELYA 4IHMA 4A94A 1QSOA 4PV6A 5I0CA 4A38A 2QYVA 3EXNA 1YREA 1BAVA 4MFPA 3F5BA 5HMNA 3IWGA 1XMBA 2Q04A 4L8AA 4UA3A 4MXUA 5CNPA 3V38A 5J8CA 3FVLA 1MK4A 1BO4A 3R95A 4BD9A 5CBMA 1Z8TA 4OMEA 2ANPA 4PPZA 3RZAA 2B5GB 4UBRA 1VIXA 1CX8A 1CG2A 4PK3A 1YK3A 2B3VA 1A2ZA 4M6HA 2GE3A 2CTBA 1VGYA 4FWUA 5KTAA 2C27A 4H6ZA 4R8FA 3SJGA 1N71A 3I9SA 4II9A 4F9VA 1AMPA 3TFYA 2VI7A 1QSTA 4OC4A 5LRKA 3EFAA 2JDDA 2FSRA 4EFDA 2EVNA 1KWMA 2O53A 3R9GA 5E96A 3K2KA 2JEVA 4KVXA 1S7KA 4IF5A 3JRUA 3MRUA 4R87A 1I21A 2PVVA 3GIUA 4H2KA 2Z3OA 4MBUA 3T8WA 2Q7BA 2YGWA 2NYQA 1ZG8A 1M44A 4QB9A 3TO9A 2OZHA 3EO4A 4HNYB 1B87A 4UWIA 2PJ7A 4NEXA 2B4DA 2J8MA 3BI0A 2AFUA 4OC2A 3B3SA 3UY5A 5AG7A 1XF8A 4PXEA 2BCOA 4OC3A 2VZZA 4DUKA 4CYQA 2Z10A 1S5KA
chains in the Genus database with same CATH topology
3RO0A 3RNZA 1X10A 1Z8WA 1Z8XA 1X12A 3GIUA 4HPSA 2DF5A 1Z8TA 1IOIA 2EBJA 3LACA 2EO8A 1AUGA 1IU8A 1A2ZA 1IOFA 4GXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RO0 A;  3RNZ A;  1X10 A;  1Z8W A;  1Z8X A;  1X12 A;  3GIU A;  4HPS A;  2DF5 A;  1Z8T A;  1IOI A;  2EBJ A;  3LAC A;  2EO8 A;  1AUG A;  1IU8 A;  1A2Z A;  1IOF A;  4GXH A; 
#chains in the Genus database with same CATH topology
 4NSQ A;  1UWY A;  4MY0 A;  2ZW7 A;  3ISX A;  3KHX A;  2Z0Z A;  2Q4Z A;  3FBU A;  1KZF A;  2IJZ A;  3D4U A;  3PBB A;  4CGO A;  3V7Z A;  2PQ8 A;  4I49 A;  1P4N A;  1R3N A;  3D7F A;  2GLF A;  2DXQ A;  3RNZ A;  3NE8 A;  3K9U A;  4OC1 A;  5LYI A;  2JBJ A;  2OU2 A;  4NGQ A;  3CXP A;  1LAP A;  4E2A A;  1IGB A;  1J4J A;  1Z8W A;  3D3S A;  1Z8X A;  1YR0 A;  1FY7 A;  2NSM A;  1Y7E A;  1IYL A;  4KVO E;  1PCA A;  2QIR A;  3N7Z A;  4OLL A;  2H5M A;  1F2O A;  1XEB A;  3OWC A;  2CXA A;  4CYO A;  4TNU A;  2Z3L A;  5F46 A;  3S9L A;  3WC7 A;  4B6Z A;  2Q0Y A;  4KSI A;  2B4D B;  3D7D A;  1ZLI A;  3FB3 A;  4B14 A;  3TTH A;  2FE7 A;  2C6C A;  2D4O A;  2PJ6 A;  1NMT A;  4M85 A;  1BPN A;  2Z11 A;  3FNC A;  3H5Z A;  3KZW A;  4A95 A;  4KOV A;  1MJ9 A;  2R98 A;  4CGM A;  3VAR A;  1PUA A;  4MFL A;  2K5T A;  3CPX A;  3DSB A;  1Q7L A;  4LX9 A;  4C2X A;  4KOS A;  2CNS A;  4W9Y A;  3PGP A;  4ZY1 A;  4IAV A;  1ZG7 A;  4E0A A;  2ZPA A;  4YGO A;  4JZ0 A;  4TWE A;  2V8D A;  3CXQ A;  3S9M A;  2CNT A;  1IID A;  3LAC A;  4UCN A;  4FUU A;  1K4J A;  3PRT A;  5DS0 A;  1QQ9 A;  2ODF A;  5DWN A;  4CAW A;  1Y0Y A;  3HLP A;  3RYO A;  4A2Z A;  4AVA A;  4F8Z A;  1KUX A;  5CPA A;  3BLN A;  4L89 A;  1JQG A;  2O28 A;  1TIQ A;  1B6B A;  2Q51 A;  4UF4 A;  4JWP A;  2DPT A;  1CJW A;  1TKJ A;  3KAS A;  3JUW A;  4QVT A;  4DYO A;  3LMS A;  3VWD A;  4A37 A;  4AXV A;  3IWE A;  4MMO A;  3QNV A;  4KUB A;  1KUY A;  4PK2 A;  4F0X A;  1CPX A;  3FH4 A;  1ARM A;  5AG6 A;  4KSA A;  4NGR A;  4AG9 A;  4XNH B;  4RS2 A;  3IJ3 A;  3S6G A;  4MCQ A;  4U9Z A;  4FD4 A;  4LQ6 A;  2QML A;  3KGQ A;  3T90 A;  2PR1 A;  4C2Z A;  2EWB A;  3FXT A;  2P6G A;  4PXB A;  2AFO A;  5C82 A;  3E0K A;  2B4B A;  4G1P A;  3LD2 A;  5JGF A;  3B7I A;  2OB0 A;  4M6I A;  4A32 A;  1IU8 A;  3W91 A;  4B13 A;  2JBK A;  3PZJ A;  3KQX A;  4X3R A;  2P6E A;  5H84 A;  4NGN A;  1IYK A;  1AYE A;  3DDD A;  3TC8 A;  5ISV A;  4Y49 B;  2O4H A;  2REF A;  2WUU A;  3SHP A;  3FJU A;  1BLL E;  1M4D A;  3LOD A;  3NFZ A;  4NCZ A;  5JH9 A;  2FT0 A;  4HNX B;  2P6F A;  1TXR A;  3IFE A;  5DWM A;  2FXF A;  1YLO A;  2PSW A;  3B35 A;  3SI1 A;  2ZEL A;  4KOR A;  4Q36 A;  2I3C A;  3TO6 A;  5IB9 A;  1ELM P;  1VHE A;  2ATR A;  4MFJ A;  1CBX A;  4KOU A;  4NF1 A;  3PFE A;  1QSN A;  3PB9 X;  4P4D A;  4B5P A;  3G3S A;  2RB7 A;  1RO5 A;  2ZW6 A;  4AVB A;  4C7I A;  4JD6 A;  2HB6 A;  3DGV A;  4EME A;  1CPS A;  3CDX A;  4NGM A;  4XPL A;  3N5F A;  4A31 A;  4AB7 A;  2CF4 A;  4JXR A;  3BI1 A;  4UWJ A;  2OZG A;  1Z4E A;  2J8N A;  3A9L A;  4YWY A;  4ZY0 A;  4CYP A;  4KOX A;  5K8P A;  2EK8 A;  1Y9K A;  2XEF A;  2I00 A;  2ZEP A;  4MCR A;  1PYT B;  4OP4 A;  4R9M A;  5AG5 A;  5EMI A;  4FD7 A;  2J9A A;  1XE4 A;  3GY9 A;  4OC0 A;  4RUH A;  3DR8 A;  1NSA A;  2VXK A;  5LRJ A;  4ZBG A;  3DNS A;  2Z3M A;  3I1U A;  3T9Y A;  4P44 A;  4MHY A;  4ZY2 A;  4UFV A;  1Z8L A;  3TCV A;  1FT7 A;  2ZW5 A;  4B5P B;  1MJB A;  2WYR A;  2V8V A;  4CRY B;  5G20 A;  3H4Q A;  2REE A;  5FVJ A;  5LYD A;  4CAV A;  2G3A A;  2D4P A;  2PJ2 A;  3R96 A;  2HC9 A;  2Q4Y A;  3WC6 A;  4PSW A;  4FBE A;  3GUX A;  3SXN A;  1TKH A;  2J8R A;  4B11 A;  1LOK A;  5A28 A;  5JPH A;  1HDU A;  4P4J A;  1XIX A;  1I1D A;  5G22 A;  1X12 A;  4KSF A;  4XPD C;  1V0C A;  1QMU A;  4O23 A;  3F8K A;  4MFQ A;  5LYF A;  1JWQ A;  1R43 A;  3V8I A;  1YSJ A;  4F9U A;  2I79 A;  3W6X A;  2WZN A;  2BO9 A;  2V8G A;  4CYN A;  2FVG A;  3PBE A;  4J3G A;  5C88 A;  2GFQ A;  3CPA A;  2WSA A;  2C6G A;  2GRE A;  1F2P A;  2BUE A;  4M6G A;  5F48 A;  3WC5 A;  2VBQ A;  4B5O A;  4Z65 A;  2Z3K A;  1CP7 A;  2ZW4 A;  5F09 A;  4X8I A;  1LAM A;  1S3Z A;  3B8G A;  3GYA A;  3KR5 A;  3QB8 A;  1LCP A;  7CPA A;  4XPK A;  5G21 A;  1S7F A;  2AFS A;  2OOT A;  2PJ1 A;  4GS4 A;  1YQE A;  1M4I A;  3I3G A;  4YU9 A;  4OIW A;  5HVG A;  1GYT A;  2GLJ A;  2QEC A;  3D2P A;  2PJ0 A;  3H8E A;  5HVF A;  4BIN A;  2CTC A;  1Z9U A;  2ZEE A;  3IU1 A;  3D2M A;  4P4B A;  4R76 A;  3R9E A;  4IK2 A;  3JTK A;  2JLM A;  2PJ9 A;  3KI9 A;  2AE6 A;  4CAF A;  3ZZI A;  3PEI A;  1VKC A;  4NGP A;  1NE9 A;  4CGP A;  5F49 A;  4AG7 A;  4H6U A;  4MJ8 A;  4P4I A;  5LRG A;  4DJL A;  1XFO A;  4M3S A;  4A30 A;  3D7G A;  3D8P A;  4CS0 B;  4JLY A;  4X2T A;  5LYL A;  2EUI A;  3IC1 A;  4K3N A;  5IV0 A;  4H89 A;  2IQ6 A;  2ZOG A;  2PE3 A;  3IEH A;  4RI1 A;  1DE4 C;  1LRZ A;  4LUA A;  3SJE A;  3D7H A;  3H8G A;  4DNC A;  2QVP A;  3SJX A;  4MCS A;  3EC4 A;  1IY7 A;  2Q44 A;  2R1I A;  2Z3P A;  2ZEG A;  1F57 A;  2PJC A;  1EE3 P;  2Q43 A;  2CY2 A;  2G3T A;  3B3W A;  3QAH A;  4R7M A;  1WWZ A;  4UEE A;  4NJQ A;  4CRZ B;  1SQH A;  5K8M A;  3GKR A;  4HNW B;  3DLJ A;  2ABZ A;  3FX6 A;  4A33 A;  2V77 A;  1YME A;  3NH5 A;  1RXT A;  4PXD A;  2F8H A;  4BMH A;  1NSL A;  2YND A;  4C7H A;  4UFX A;  3S6F A;  5K8O A;  1HEE A;  5THW A;  3NH4 A;  4U5Y A;  2HUZ A;  2OZU A;  5BWA B;  1RTQ A;  2JDC A;  1YGH A;  1L0C A;  2P0W A;  2VL1 A;  1OBR A;  5F47 A;  3SI2 A;  1X10 A;  4BBH A;  4CGN A;  4QBJ A;  1XBU A;  2XEJ A;  4ZI6 A;  3LWU A;  1Q2C A;  1ON0 A;  2B5G A;  1HDQ A;  2AFM A;  3WR7 A;  5A27 A;  2EO8 A;  3L2N A;  3QAY A;  5EC4 A;  2GU2 A;  2EK9 A;  1YW4 A;  2ZEN A;  4P4F A;  5AGE A;  4OC5 A;  4A39 A;  2FL4 A;  1DTD A;  2CNM A;  1GHE A;  2OH1 A;  2XEG A;  4MHN A;  4FAI A;  4WWV A;  5K8N A;  4KVM E;  4YFJ A;  5IB0 A;  2VQY A;  1TF8 A;  2WPW A;  3R1K A;  3S6K A;  4R57 A;  1Z4R A;  4ZGY B;  2Q7S A;  4EWT A;  1QSM A;  4ORF A;  5I4M A;  1IB1 E;  3TE4 A;  2WPX A;  1ZO0 A;  3D66 A;  1M4L A;  4KZT A;  1UFH A;  3B3T A;  4FD5 A;  3KHZ A;  2PIZ A;  3NH8 A;  2BL1 A;  5J1Q A;  4MFZ A;  1S60 A;  3NE7 A;  3BJ7 A;  2B3U A;  3VWE A;  4OID A;  3NA6 A;  2ZED A;  2DPS A;  3IO1 A;  3KL9 A;  5D8N A;  1Q2Y A;  1Q2D A;  2FIW A;  3FIX A;  4JXQ A;  3KKW A;  1IOF A;  4UCP A;  4FD6 A;  1YLE A;  4B12 A;  4Q7A A;  2XEI A;  2ZOF A;  3B2Y A;  3KQZ A;  1BOB A;  1LFW A;  1P0H A;  2FS5 A;  1Y7R A;  2DEA A;  2F5I A;  3GB0 A;  4PSX A;  4PXC A;  2Z3N A;  3VH9 A;  4F0Y A;  2PCU A;  1Z2L A;  4OAD A;  2HQY A;  1ELL P;  3P2H A;  2AFW A;  2AFX A;  1KUV A;  3W6S A;  1ZG9 A;  4RN7 A;  4U9Y A;  5GCN A;  1U6M A;  1FNO A;  2NMT A;  1BPM A;  3PP9 A;  4MI4 A;  3SJF A;  1VHS A;  3TT2 A;  2JEW A;  4OAE A;  1CP6 A;  3CXS A;  3PFO A;  2HV2 A;  2RFH A;  4KS9 A;  4WJB A;  3WAB A;  4ZYQ A;  2PJ5 A;  2Q4V A;  5D29 A;  6CPA A;  3S9N A;  2BOA A;  4ZX9 A;  2ZEO A;  4YRH A;  2V8H A;  3IU2 A;  3SXO A;  2OR4 A;  2PR8 A;  3BHX A;  1AUG A;  2ZEF A;  2ZEM A;  3DR6 A;  4GXH A;  3EY5 A;  4AVC A;  5JM6 A;  4KOT A;  3TO7 A;  2QJ8 A;  3ISZ A;  3FMC A;  3FEE A;  3IWW A;  4ONU A;  5G1Z A;  4XPD B;  4MY3 A;  2B58 A;  2PJ4 A;  2G9D A;  2GIV A;  1TKF A;  3TX8 A;  2VZY A;  3D68 A;  1Y9W A;  5H86 A;  3CT9 A;  3SI0 A;  5JQ4 A;  3TOA A;  4QC6 A;  4K30 A;  4HPS A;  2X7B A;  2YNE A;  3FED A;  2DF5 A;  4MHD A;  2FCK A;  3RBU A;  4NXY A;  4UEZ A;  5J8F A;  4IUS A;  4OKO A;  4P45 A;  4P4E A;  4ZX8 A;  1YVK A;  4UCM A;  4UIA A;  3ZJ0 A;  2VEZ A;  2BEI A;  5HVH A;  4CPA A;  1I12 A;  4KUA A;  5EBV A;  2RC4 A;  2R7H A;  3F0A A;  4KOW A;  4EVY A;  2ARH A;  3KR4 A;  3B3V A;  4QUS A;  1ZLH A;  5KTD A;  3WT4 A;  4NGS A;  3FRM A;  1WK4 A;  1YVO A;  8CPA A;  3PB4 X;  3R9F A;  2YNC A;  4KLW A;  4HKF A;  1XJO A;  2PRB A;  2PJB A;  2PRQ A;  2C1C A;  2PC1 A;  1S7N A;  2CIJ A;  4C68 A;  1Y0R A;  2IMO A;  2PIY A;  1YX0 A;  3BJ8 A;  3HUV A;  5HH1 A;  1IIC A;  4KLV A;  1LAN A;  2ZEH A;  2EBJ A;  3G8W A;  3P2F A;  4MHZ A;  4UIB A;  4CAE A;  4XNH C;  3FEC A;  3C26 A;  4ONW A;  2YNC C;  4P6Y A;  2C6P A;  2PJ8 A;  4JJX A;  4R3K A;  1Z5R A;  1H8L A;  4CAX A;  1TF9 A;  2FIA A;  2PJA A;  4R6T A;  3TOB A;  3RO0 A;  3BXM A;  1XRY A;  3FYN A;  4KOY A;  4NJR A;  3D67 A;  3VAT A;  3RAM A;  1M4G A;  2BSW A;  2GAN A;  4R3L A;  2A4N A;  4C2Y A;  1M1D A;  3B3C A;  3S6H A;  4X5K A;  4MRI A;  1ARL A;  1OZP A;  4LQG A;  3MN8 A;  4PQA A;  2AFZ A;  2PJ3 A;  5IX3 A;  4JYW A;  1CM0 A;  4MHP A;  3PB8 X;  1XOV A;  4Y49 C;  3H8F A;  2PVW A;  4GM5 A;  1XMT A;  2F7V A;  3IGR A;  2G0B A;  3PB7 X;  4CGL A;  3K9T A;  1IOI A;  2AJ6 A;  2R8V A;  1QSR A;  4E8O A;  3MGD A;  4F6A A;  2POK A;  2Y0M A;  3JVN A;  2KCW A;  4Q38 A;  1VHO A;  4NFR A;  2PDO A;  3FF3 A;  3IIB A;  3PB6 X;  4B10 A;  4MFK A;  1PU9 A;  4P10 A;  5HXD A;  1YW6 A;  4UFW A;  5KTC A;  1S7L A;  1MJA A;  4NGT A;  4UEF A;  3CZX A;  2IL4 A;  4MCP A;  1R57 A;  5AG4 A;  2ZXV A;  3GLJ A;  5ELY A;  4IHM A;  4A94 A;  1QSO A;  4PV6 A;  5I0C A;  4A38 A;  2QYV A;  3EXN A;  1YRE A;  1BAV A;  4MFP A;  3F5B A;  5HMN A;  3IWG A;  1XMB A;  2Q04 A;  4L8A A;  4UA3 A;  4MXU A;  5CNP A;  3V38 A;  5J8C A;  3FVL A;  1MK4 A;  1BO4 A;  3R95 A;  4BD9 A;  5CBM A;  1Z8T A;  4OME A;  2ANP A;  4PPZ A;  3RZA A;  2B5G B;  4UBR A;  1VIX A;  1CX8 A;  1CG2 A;  4PK3 A;  1YK3 A;  2B3V A;  1A2Z A;  4M6H A;  2GE3 A;  2CTB A;  1VGY A;  4FWU A;  5KTA A;  2C27 A;  4H6Z A;  4R8F A;  3SJG A;  1N71 A;  3I9S A;  4II9 A;  4F9V A;  1AMP A;  3TFY A;  2VI7 A;  1QST A;  4OC4 A;  5LRK A;  3EFA A;  2JDD A;  2FSR A;  4EFD A;  2EVN A;  1KWM A;  2O53 A;  3R9G A;  5E96 A;  3K2K A;  2JEV A;  4KVX A;  1S7K A;  4IF5 A;  3JRU A;  3MRU A;  4R87 A;  1I21 A;  2PVV A;  3GIU A;  4H2K A;  2Z3O A;  4MBU A;  3T8W A;  2Q7B A;  2YGW A;  2NYQ A;  1ZG8 A;  1M44 A;  4QB9 A;  3TO9 A;  2OZH A;  3EO4 A;  4HNY B;  1B87 A;  4UWI A;  2PJ7 A;  4NEX A;  2B4D A;  2J8M A;  3BI0 A;  2AFU A;  4OC2 A;  3B3S A;  3UY5 A;  5AG7 A;  1XF8 A;  4PXE A;  2BCO A;  4OC3 A;  2VZZ A;  4DUK A;  4CYQ A;  2Z10 A;  1S5K A; 
#chains in the Genus database with same CATH homology
 3RO0 A;  3RNZ A;  1X10 A;  1Z8W A;  1Z8X A;  1X12 A;  3GIU A;  4HPS A;  2DF5 A;  1Z8T A;  1IOI A;  2EBJ A;  3LAC A;  2EO8 A;  1AUG A;  1IU8 A;  1A2Z A;  1IOF A;  4GXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...