1Z8TA

Structure of mutant pyrrolidone carboxyl peptidase (e192q) from a hyperthermophile, pyrococcus furiosus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
208
structure length
208
Chain Sequence
MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLSNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMSYEMQLEAVKVAIEVALEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Completely buried, non-ion-paired glutamic acid contributes favorably to the conformational stability of pyrrolidone carboxyl peptidases from hyperthermophiles.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
molecule keywords Pyrrolidone-carboxylate peptidase
total genus 70
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 1z8tA00
2DF5A 1IU8A 4GXHA 3RNZA 1Z8TA 1IOIA 1Z8WA 3LACA 1IOFA 1X12A 2EO8A 4HPSA 3RO0A 2EBJA 1X10A 1Z8XA 1A2ZA 1AUGA 3GIUA
chains in the Genus database with same CATH superfamily
1YR0A 1IGBA 4B6ZA 1UFHA 2PJ1A 3PBBA 1XJOA 2WPXA 2Z3PA 2C1CA 3PB8X 2CTCA 2FT0A 4AG9A 1YW4A 3IJ3A 4ONWA 3WT4A 2AE6A 2CNSA 3KL9A 2RC4A 3TE4A 2F8HA 3IWGA 2K5TA 3P2FA 4GS4A 4QUSA 5FVJA 1LAMA 1PYTB 3G3SA 3EO4A 4OAEA 2J8NA 4KVOE 4OLLA 1MK4A 4PK2A 2ZEFA 1Z4EA 3H5ZA 3W6SA 4AG7A 4CGPA 5IB0A 2V8VA 1R43A 2CIJA 3KZWA 3JRUA 2WPWA 4AVBA 1N71A 1Z2LA 2I3CA 3L2NA 4XPKA 3GUXA 3V8IA 4FBEA 5F48A 1XBUA 4CYQA 3B3VA 1Z9UA 2ZW6A 4M6HA 1TF9A 1XFOA 2OZUA 2OR4A 4MHZA 2PJ7A 4MCSA 4KORA 4ZYQA 4MFJA 5CBMA 5H86A 4MJ8A 5J8FA 4R7MA 2CXAA 4U5YA 5F47A 4OC4A 2CY2A 2JLMA 4KSIA 4LQGA 4OIDA 4MFLA 4KLWA 4OC1A 1GHEA 1XMBA 2Q0YA 3PEIA 5JGFA 1I21A 2AFWA 2P6GA 1Q7LA 1M4DA 2PIYA 2FXFA 2WYRA 4H89A 4UWJA 3BI0A 1YK3A 3D7HA 4FD7A 2VEZA 4UCPA 1I1DA 2H5MA 3SXOA 1Y9KA 1AYEA 3D8PA 2JBKA 4RN7A 3TX8A 1F2PA 3NH5A 4KOWA 3PBEA 5CNPA 6CPAA 4OIWA 2Z11A 1VHOA 3ZZIA 4B13A 4FAIA 4A32A 5AG4A 3TCVA 5K8NA 1RO5A 4Y49C 2ZW5A 4A33A 3IWEA 1KUYA 1XIXA 1YREA 4PQAA 4X8IA 4MHDA 1YSJA 2PQ8A 4H6UA 2P6FA 1IB1E 1XRYA 4E2AA 3TT2A 2IJZA 1KWMA 1SQHA 4KOUA 1KUXA 2B3VA 1Y0YA 3NH8A 5JPHA 4AXVA 3K2KA 4CGNA 3RAMA 2PRBA 2PR1A 3FECA 4UEFA 5EBVA 4C68A 3B2YA 4OKOA 5D29A 2EBJA 1CJWA 1Y7EA 1ZG9A 5K8PA 2HUZA 3B8GA 3F0AA 1RXTA 1Z8WA 5DS0A 4DNCA 5LYFA 2PVVA 4A94A 3FBUA 2DPSA 4MMOA 4PSXA 4B5PA 2VZYA 2XEJA 4O23A 4JLYA 1S7LA 1ZO0A 5G21A 3LMSA 3TOAA 5J1QA 2PSWA 2KCWA 2VL1A 3KASA 2CF4A 4X3RA 2B3UA 2C27A 5AG7A 5DWMA 2A4NA 3H8FA 2IL4A 1CP7A 3EY5A 3P2HA 3HLPA 2EK9A 3NE8A 4YFJA 1YX0A 3H8EA 3CXPA 1HDQA 2ZEHA 2AFOA 4KUAA 2OZGA 3EXNA 4OMEA 4PXBA 4UIAA 3V38A 1CX8A 3FIXA 1Y9WA 1WWZA 1P4NA 4LQ6A 2QYVA 2HV2A 2OOTA 4A31A 1PUAA 3BI1A 5G1ZA 5HVHA 1ZLHA 4YGOA 2X7BA 5J8CA 2R98A 3K9TA 3R9EA 2FVGA 4OC5A 4UBRA 2PRQA 4QB9A 4A37A 1R57A 4NGMA 1S7KA 4OC2A 2XEGA 4WJBA 1VGYA 2HQYA 3LACA 4UCNA 4GM5A 4NJRA 3VARA 2POKA 4MXUA 1LOKA 1HEEA 1XEBA 2GE3A 2RB7A 2Z3LA 3TO9A 4A2ZA 4B5OA 2RFHA 2VQYA 3BLNA 3S6FA 4CAWA 2V8GA 1BAVA 1VKCA 4KOYA 4YWYA 1MJAA 1M4LA 4IUSA 2JEVA 4R3KA 2PJAA 5LYLA 5EC4A 4EMEA 4MY3A 4OC0A 3DDDA 1X12A 3VATA 2EVNA 3G8WA 1Q2DA 1QSOA 4K30A 1IOFA 3WABA 3SJFA 2NMTA 1BO4A 1YGHA 4P45A 2Q7BA 3R9FA 4BD9A 4A38A 4U9YA 2R1IA 3VWDA 4CAFA 1WK4A 1TIQA 2F7VA 2WZNA 3PP9A 3IU2A 3RO0A 3B3WA 2PCUA 3NFZA 5F09A 1I12A 2PJ4A 4G1PA 4KVME 2Z3KA 4UWIA 4C2XA 1CM0A 2QJ8A 3D3SA 2OU2A 2O53A 2PJ3A 1B87A 4QVTA 2HC9A 3B3TA 2V8DA 3QNVA 4PV6A 2Z3NA 5KTDA 5C88A 2CNMA 2ZEPA 5F49A 4CAVA 4ONUA 5JM6A 2PJ5A 2B4DA 4E0AA 3FF3A 3IU1A 2AFSA 2PC1A 3FJUA 4JZ0A 4CAEA 3MRUA 4MCQA 2GREA 2ZXVA 4ZI6A 1ZG8A 3IO1A 4HPSA 2YNDA 5BWAB 4A95A 4KLVA 2FCKA 4TWEA 5THWA 1Q2YA 2BL1A 4F0XA 2VZZA 3IWWA 5LRGA 4C7IA 7CPAA 1MJBA 3FB3A 4OP4A 3KQXA 4KOXA 3D7FA 4XPDC 2EK8A 1HDUA 4P4DA 4P6YA 2BUEA 4FUUA 4NGTA 4LX9A 4OC3A 3T90A 4MHPA 1V0CA 3KR4A 2XEIA 2BSWA 1IU8A 4EVYA 2ZPAA 1IYLA 3EFAA 3I3GA 3JUWA 2Q43A 3KQZA 4NFRA 1UWYA 5H84A 2PJ2A 1TXRA 4P4IA 2CNTA 2Q4ZA 1YLOA 3CDXA 3V7ZA 4YU9A 4DUKA 1FY7A 1ZG7A 2Q51A 2V8HA 4NEXA 3I1UA 4P44A 3H8GA 4P4BA 3VWEA 4CYPA 3VH9A 5F46A 3TOBA 4JD6A 1B6BA 3T9YA 3RBUA 2YNCC 5GCNA 2GFQA 4CGMA 2AFZA 8CPAA 4F8ZA 2YNCA 5IX3A 3DSBA 2D4OA 1PU9A 4C2ZA 2ZOGA 2R8VA 4ZX9A 4CRYB 3GYAA 3PRTA 5HVGA 3IGRA 3MN8A 5AGEA 4KS9A 4Q38A 1OBRA 2JBJA 4MFZA 4ZX8A 1IY7A 1H8LA 4XPLA 1ELLP 3RZAA 3GB0A 3H4QA 4Q36A 3KKWA 4R76A 1XF8A 4XNHB 1BPNA 2Z0ZA 1Z8TA 3PZJA 3WC7A 4Q7AA 2GIVA 1YMEA 3GIUA 3B3SA 2G9DA 3PFOA 4PXEA 1RTQA 2B5GB 4R9MA 4B14A 4QC6A 4R6TA 5DWNA 4II9A 1F2OA 3R95A 1IIDA 5K8MA 1YW6A 2O4HA 4KOTA 1QSMA 1TKJA 4QBJA 2EO8A 2G3AA 1NSLA 3SJXA 3W6XA 3QAYA 4X2TA 2QECA 4MI4A 1BOBA 4KSAA 3FEDA 4JXRA 4U9ZA 3S6HA 4MFQA 2O28A 3IEHA 4PSWA 4UEEA 2J8MA 3FNCA 1PCAA 3B7IA 2PJCA 3D7GA 4X5KA 1FT7A 3R96A 2GU2A 4L8AA 3WR7A 5G20A 1NE9A 4ZY1A 2ZEEA 3N5FA 2QIRA 1A2ZA 2ZW7A 2FL4A 2YGWA 4MHYA 4NGNA 3SI1A 4KOVA 5KTCA 2HB6A 3FX6A 2GANA 4UCMA 3HUVA 5D8NA 1AMPA 1M44A 1M4GA 1R3NA 2OB0A 2Z3MA 4A39A 2AFXA 3D4UA 3TO6A 1CG2A 4KUBA 5AG6A 4JYWA 4CS0B 3IIBA 3BHXA 1Z4RA 3S9MA 4UFVA 2DF5A 2C6CA 4FD4A 1Q2CA 1YQEA 3CPXA 4OADA 5A27A 2REFA 2I00A 2ZEOA 1DE4C 4FD6A 4PXCA 5CPAA 4F9VA 2VBQA 1ARMA 1TKHA 2ZEMA 4CPAA 3A9LA 2JDDA 1MJ9A 4XPDB 4KVXA 4YRHA 2Q7SA 4HNWB 4DJLA 4RUHA 1EE3P 1DTDA 1F57A 5KTAA 1YVKA 2FS5A 4CGLA 3BJ8A 2B5GA 4ZGYB 4LUAA 3TFYA 2FSRA 2ZEGA 3CXQA 3F5BA 1J4JA 1Y7RA 3N7ZA 2PDOA 4IAVA 4RS2A 4H2KA 3KR5A 3R1KA 4I49A 4AB7A 4KZTA 4UFWA 1Z8LA 1L0CA 4IF5A 3DLJA 3LD2A 2DEAA 4MBUA 5E96A 1S7FA 4ZY2A 4EWTA 3CT9A 3GY9A 4M85A 1NMTA 2WSAA 4NJQA 3ZJ0A 4B11A 3F8KA 1LRZA 1QMUA 3FMCA 1BPMA 2C6GA 2GLJA 2Q4VA 2XEFA 3WC5A 3DR8A 3CZXA 3FVLA 2B4DB 3SI0A 3FH4A 4NGSA 4NGRA 5A28A 4JJXA 3IC1A 3JTKA 4B5PB 3FYNA 5LYDA 2Q04A 4DYOA 1P0HA 3S9LA 2EWBA 1CBXA 2G3TA 2YNEA 3DGVA 3SXNA 3BXMA 4F6AA 5ELYA 2PJBA 3PB6X 3CPAA 3D68A 4GXHA 3WC6A 3KHZA 4FD5A 4R8FA 5IB9A 1QQ9A 1LFWA 1ARLA 1S7NA 1LCPA 1XOVA 4IK2A 3D67A 2Q4YA 4M3SA 2PIZA 1TF8A 4TNUA 4NGQA 2CTBA 2PJ8A 4ZY0A 4M6GA 1ELMP 1BLLE 2IMOA 3C26A 3LWUA 3LODA 4UFXA 5ISVA 4CRZB 1YLEA 3KHXA 1ON0A 4JXQA 1NSAA 3EC4A 2NYQA 2P0WA 2ATRA 5C82A 4ZBGA 4ORFA 1JWQA 4XNHC 1CP6A 1GYTA 2EUIA 2GLFA 4CYOA 3SHPA 2P6EA 3KI9A 3S6GA 4EFDA 4UEZA 3GKRA 2NSMA 1VHEA 1XMTA 3PB7X 4FWUA 4J3GA 5LYIA 1ZLIA 2AFMA 4MRIA 3T8WA 4IHMA 1YVOA 3PB9X 3QB8A 4MHNA 4UF4A 1M4IA 4AVCA 3B3CA 4M6IA 1Y0RA 2FIWA 2JEWA 4UIBA 1OZPA 4NF1A 1CPSA 3RNZA 5AG5A 4B10A 4UA3A 4Z65A 2V77A 1QSNA 3SI2A 2Q44A 5G22A 4HNXB 1VIXA 5JH9A 1CPXA 2DPTA 1Z5RA 1K4JA 1S3ZA 2ZENA 3SJGA 4F0YA 3RYOA 2ARHA 2Y0MA 3D66A 3IFEA 3PGPA 2BCOA 4MCPA 2I79A 2C6PA 4K3NA 4KOSA 1X10A 3B35A 3PB4X 2PVWA 2BEIA 2G0BA 4BINA 4W9YA 1S60A 3TO7A 3W91A 2JDCA 2ZW4A 2ZEDA 5HXDA 4C7HA 1KZFA 1JQGA 3GLJA 4R3LA 5EMIA 2PJ0A 2REEA 3NH4A 2PJ9A 2FIAA 4A30A 4CAXA 2AJ6A 2J8RA 4MFPA 2QMLA 4PK3A 4Y49B 2DXQA 3R9GA 4PXDA 1XE4A 5HMNA 5I4MA 4R87A 2B4BA 2J9AA 1U6MA 3S6KA 2PE3A 3SJEA 4AVAA 4BBHA 3NA6A 5IV0A 2VI7A 4P4JA 4NCZA 5K8OA 2FE7A 4P4FA 2ZOFA 3I9SA 3K9UA 4MCRA 2PR8A 3TC8A 2PJ6A 4MY0A 1Z8XA 3NE7A 3PFEA 4H6ZA 4PPZA 1FNOA 1TKFA 4WWVA 2ABZA 4HKFA 5I0CA 2ZELA 3FEEA 2VXKA 1QSRA 1IYKA 2R7HA 3QAHA 4MFKA 5LRKA 1LANA 2Z3OA 3DR6A 3CXSA 2D4PA 3FRMA 4NGPA 3KGQA 4NXYA 4CYNA 2ODFA 3DNSA 1IICA 4RI1A 2OZHA 1S5KA 3D2PA 2IQ6A 4KSFA 2OH1A 1M1DA 4NSQA 1KUVA 2Z10A 5HVFA 1LAPA 3BJ7A 5LRJA 1AUGA 3JVNA 3UY5A 3OWCA 5JQ4A 2BOAA 4B12A 4E8OA 3S9NA 2F5IA 3FXTA 2QVPA 3ISZA 4JWPA 1QSTA 2B58A 3MGDA 3TTHA 3D2MA 4C2YA 3E0KA 3ISXA 4HNYB 4L89A 2BO9A 2WUUA 4F9UA 2ANPA 1IOIA 4P4EA 4R57A 4P10A 4BMHA 3D7DA 5HH1A 4CGOA 2AFUA 1VHSA
chains in the Genus database with same CATH topology
2DF5A 1IU8A 4GXHA 3RNZA 1Z8TA 1IOIA 1Z8WA 3LACA 1IOFA 1X12A 2EO8A 4HPSA 3RO0A 2EBJA 1X10A 1Z8XA 1A2ZA 1AUGA 3GIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DF5 A;  1IU8 A;  4GXH A;  3RNZ A;  1Z8T A;  1IOI A;  1Z8W A;  3LAC A;  1IOF A;  1X12 A;  2EO8 A;  4HPS A;  3RO0 A;  2EBJ A;  1X10 A;  1Z8X A;  1A2Z A;  1AUG A;  3GIU A; 
#chains in the Genus database with same CATH topology
 1YR0 A;  1IGB A;  4B6Z A;  1UFH A;  2PJ1 A;  3PBB A;  1XJO A;  2WPX A;  2Z3P A;  2C1C A;  3PB8 X;  2CTC A;  2FT0 A;  4AG9 A;  1YW4 A;  3IJ3 A;  4ONW A;  3WT4 A;  2AE6 A;  2CNS A;  3KL9 A;  2RC4 A;  3TE4 A;  2F8H A;  3IWG A;  2K5T A;  3P2F A;  4GS4 A;  4QUS A;  5FVJ A;  1LAM A;  1PYT B;  3G3S A;  3EO4 A;  4OAE A;  2J8N A;  4KVO E;  4OLL A;  1MK4 A;  4PK2 A;  2ZEF A;  1Z4E A;  3H5Z A;  3W6S A;  4AG7 A;  4CGP A;  5IB0 A;  2V8V A;  1R43 A;  2CIJ A;  3KZW A;  3JRU A;  2WPW A;  4AVB A;  1N71 A;  1Z2L A;  2I3C A;  3L2N A;  4XPK A;  3GUX A;  3V8I A;  4FBE A;  5F48 A;  1XBU A;  4CYQ A;  3B3V A;  1Z9U A;  2ZW6 A;  4M6H A;  1TF9 A;  1XFO A;  2OZU A;  2OR4 A;  4MHZ A;  2PJ7 A;  4MCS A;  4KOR A;  4ZYQ A;  4MFJ A;  5CBM A;  5H86 A;  4MJ8 A;  5J8F A;  4R7M A;  2CXA A;  4U5Y A;  5F47 A;  4OC4 A;  2CY2 A;  2JLM A;  4KSI A;  4LQG A;  4OID A;  4MFL A;  4KLW A;  4OC1 A;  1GHE A;  1XMB A;  2Q0Y A;  3PEI A;  5JGF A;  1I21 A;  2AFW A;  2P6G A;  1Q7L A;  1M4D A;  2PIY A;  2FXF A;  2WYR A;  4H89 A;  4UWJ A;  3BI0 A;  1YK3 A;  3D7H A;  4FD7 A;  2VEZ A;  4UCP A;  1I1D A;  2H5M A;  3SXO A;  1Y9K A;  1AYE A;  3D8P A;  2JBK A;  4RN7 A;  3TX8 A;  1F2P A;  3NH5 A;  4KOW A;  3PBE A;  5CNP A;  6CPA A;  4OIW A;  2Z11 A;  1VHO A;  3ZZI A;  4B13 A;  4FAI A;  4A32 A;  5AG4 A;  3TCV A;  5K8N A;  1RO5 A;  4Y49 C;  2ZW5 A;  4A33 A;  3IWE A;  1KUY A;  1XIX A;  1YRE A;  4PQA A;  4X8I A;  4MHD A;  1YSJ A;  2PQ8 A;  4H6U A;  2P6F A;  1IB1 E;  1XRY A;  4E2A A;  3TT2 A;  2IJZ A;  1KWM A;  1SQH A;  4KOU A;  1KUX A;  2B3V A;  1Y0Y A;  3NH8 A;  5JPH A;  4AXV A;  3K2K A;  4CGN A;  3RAM A;  2PRB A;  2PR1 A;  3FEC A;  4UEF A;  5EBV A;  4C68 A;  3B2Y A;  4OKO A;  5D29 A;  2EBJ A;  1CJW A;  1Y7E A;  1ZG9 A;  5K8P A;  2HUZ A;  3B8G A;  3F0A A;  1RXT A;  1Z8W A;  5DS0 A;  4DNC A;  5LYF A;  2PVV A;  4A94 A;  3FBU A;  2DPS A;  4MMO A;  4PSX A;  4B5P A;  2VZY A;  2XEJ A;  4O23 A;  4JLY A;  1S7L A;  1ZO0 A;  5G21 A;  3LMS A;  3TOA A;  5J1Q A;  2PSW A;  2KCW A;  2VL1 A;  3KAS A;  2CF4 A;  4X3R A;  2B3U A;  2C27 A;  5AG7 A;  5DWM A;  2A4N A;  3H8F A;  2IL4 A;  1CP7 A;  3EY5 A;  3P2H A;  3HLP A;  2EK9 A;  3NE8 A;  4YFJ A;  1YX0 A;  3H8E A;  3CXP A;  1HDQ A;  2ZEH A;  2AFO A;  4KUA A;  2OZG A;  3EXN A;  4OME A;  4PXB A;  4UIA A;  3V38 A;  1CX8 A;  3FIX A;  1Y9W A;  1WWZ A;  1P4N A;  4LQ6 A;  2QYV A;  2HV2 A;  2OOT A;  4A31 A;  1PUA A;  3BI1 A;  5G1Z A;  5HVH A;  1ZLH A;  4YGO A;  2X7B A;  5J8C A;  2R98 A;  3K9T A;  3R9E A;  2FVG A;  4OC5 A;  4UBR A;  2PRQ A;  4QB9 A;  4A37 A;  1R57 A;  4NGM A;  1S7K A;  4OC2 A;  2XEG A;  4WJB A;  1VGY A;  2HQY A;  3LAC A;  4UCN A;  4GM5 A;  4NJR A;  3VAR A;  2POK A;  4MXU A;  1LOK A;  1HEE A;  1XEB A;  2GE3 A;  2RB7 A;  2Z3L A;  3TO9 A;  4A2Z A;  4B5O A;  2RFH A;  2VQY A;  3BLN A;  3S6F A;  4CAW A;  2V8G A;  1BAV A;  1VKC A;  4KOY A;  4YWY A;  1MJA A;  1M4L A;  4IUS A;  2JEV A;  4R3K A;  2PJA A;  5LYL A;  5EC4 A;  4EME A;  4MY3 A;  4OC0 A;  3DDD A;  1X12 A;  3VAT A;  2EVN A;  3G8W A;  1Q2D A;  1QSO A;  4K30 A;  1IOF A;  3WAB A;  3SJF A;  2NMT A;  1BO4 A;  1YGH A;  4P45 A;  2Q7B A;  3R9F A;  4BD9 A;  4A38 A;  4U9Y A;  2R1I A;  3VWD A;  4CAF A;  1WK4 A;  1TIQ A;  2F7V A;  2WZN A;  3PP9 A;  3IU2 A;  3RO0 A;  3B3W A;  2PCU A;  3NFZ A;  5F09 A;  1I12 A;  2PJ4 A;  4G1P A;  4KVM E;  2Z3K A;  4UWI A;  4C2X A;  1CM0 A;  2QJ8 A;  3D3S A;  2OU2 A;  2O53 A;  2PJ3 A;  1B87 A;  4QVT A;  2HC9 A;  3B3T A;  2V8D A;  3QNV A;  4PV6 A;  2Z3N A;  5KTD A;  5C88 A;  2CNM A;  2ZEP A;  5F49 A;  4CAV A;  4ONU A;  5JM6 A;  2PJ5 A;  2B4D A;  4E0A A;  3FF3 A;  3IU1 A;  2AFS A;  2PC1 A;  3FJU A;  4JZ0 A;  4CAE A;  3MRU A;  4MCQ A;  2GRE A;  2ZXV A;  4ZI6 A;  1ZG8 A;  3IO1 A;  4HPS A;  2YND A;  5BWA B;  4A95 A;  4KLV A;  2FCK A;  4TWE A;  5THW A;  1Q2Y A;  2BL1 A;  4F0X A;  2VZZ A;  3IWW A;  5LRG A;  4C7I A;  7CPA A;  1MJB A;  3FB3 A;  4OP4 A;  3KQX A;  4KOX A;  3D7F A;  4XPD C;  2EK8 A;  1HDU A;  4P4D A;  4P6Y A;  2BUE A;  4FUU A;  4NGT A;  4LX9 A;  4OC3 A;  3T90 A;  4MHP A;  1V0C A;  3KR4 A;  2XEI A;  2BSW A;  1IU8 A;  4EVY A;  2ZPA A;  1IYL A;  3EFA A;  3I3G A;  3JUW A;  2Q43 A;  3KQZ A;  4NFR A;  1UWY A;  5H84 A;  2PJ2 A;  1TXR A;  4P4I A;  2CNT A;  2Q4Z A;  1YLO A;  3CDX A;  3V7Z A;  4YU9 A;  4DUK A;  1FY7 A;  1ZG7 A;  2Q51 A;  2V8H A;  4NEX A;  3I1U A;  4P44 A;  3H8G A;  4P4B A;  3VWE A;  4CYP A;  3VH9 A;  5F46 A;  3TOB A;  4JD6 A;  1B6B A;  3T9Y A;  3RBU A;  2YNC C;  5GCN A;  2GFQ A;  4CGM A;  2AFZ A;  8CPA A;  4F8Z A;  2YNC A;  5IX3 A;  3DSB A;  2D4O A;  1PU9 A;  4C2Z A;  2ZOG A;  2R8V A;  4ZX9 A;  4CRY B;  3GYA A;  3PRT A;  5HVG A;  3IGR A;  3MN8 A;  5AGE A;  4KS9 A;  4Q38 A;  1OBR A;  2JBJ A;  4MFZ A;  4ZX8 A;  1IY7 A;  1H8L A;  4XPL A;  1ELL P;  3RZA A;  3GB0 A;  3H4Q A;  4Q36 A;  3KKW A;  4R76 A;  1XF8 A;  4XNH B;  1BPN A;  2Z0Z A;  1Z8T A;  3PZJ A;  3WC7 A;  4Q7A A;  2GIV A;  1YME A;  3GIU A;  3B3S A;  2G9D A;  3PFO A;  4PXE A;  1RTQ A;  2B5G B;  4R9M A;  4B14 A;  4QC6 A;  4R6T A;  5DWN A;  4II9 A;  1F2O A;  3R95 A;  1IID A;  5K8M A;  1YW6 A;  2O4H A;  4KOT A;  1QSM A;  1TKJ A;  4QBJ A;  2EO8 A;  2G3A A;  1NSL A;  3SJX A;  3W6X A;  3QAY A;  4X2T A;  2QEC A;  4MI4 A;  1BOB A;  4KSA A;  3FED A;  4JXR A;  4U9Z A;  3S6H A;  4MFQ A;  2O28 A;  3IEH A;  4PSW A;  4UEE A;  2J8M A;  3FNC A;  1PCA A;  3B7I A;  2PJC A;  3D7G A;  4X5K A;  1FT7 A;  3R96 A;  2GU2 A;  4L8A A;  3WR7 A;  5G20 A;  1NE9 A;  4ZY1 A;  2ZEE A;  3N5F A;  2QIR A;  1A2Z A;  2ZW7 A;  2FL4 A;  2YGW A;  4MHY A;  4NGN A;  3SI1 A;  4KOV A;  5KTC A;  2HB6 A;  3FX6 A;  2GAN A;  4UCM A;  3HUV A;  5D8N A;  1AMP A;  1M44 A;  1M4G A;  1R3N A;  2OB0 A;  2Z3M A;  4A39 A;  2AFX A;  3D4U A;  3TO6 A;  1CG2 A;  4KUB A;  5AG6 A;  4JYW A;  4CS0 B;  3IIB A;  3BHX A;  1Z4R A;  3S9M A;  4UFV A;  2DF5 A;  2C6C A;  4FD4 A;  1Q2C A;  1YQE A;  3CPX A;  4OAD A;  5A27 A;  2REF A;  2I00 A;  2ZEO A;  1DE4 C;  4FD6 A;  4PXC A;  5CPA A;  4F9V A;  2VBQ A;  1ARM A;  1TKH A;  2ZEM A;  4CPA A;  3A9L A;  2JDD A;  1MJ9 A;  4XPD B;  4KVX A;  4YRH A;  2Q7S A;  4HNW B;  4DJL A;  4RUH A;  1EE3 P;  1DTD A;  1F57 A;  5KTA A;  1YVK A;  2FS5 A;  4CGL A;  3BJ8 A;  2B5G A;  4ZGY B;  4LUA A;  3TFY A;  2FSR A;  2ZEG A;  3CXQ A;  3F5B A;  1J4J A;  1Y7R A;  3N7Z A;  2PDO A;  4IAV A;  4RS2 A;  4H2K A;  3KR5 A;  3R1K A;  4I49 A;  4AB7 A;  4KZT A;  4UFW A;  1Z8L A;  1L0C A;  4IF5 A;  3DLJ A;  3LD2 A;  2DEA A;  4MBU A;  5E96 A;  1S7F A;  4ZY2 A;  4EWT A;  3CT9 A;  3GY9 A;  4M85 A;  1NMT A;  2WSA A;  4NJQ A;  3ZJ0 A;  4B11 A;  3F8K A;  1LRZ A;  1QMU A;  3FMC A;  1BPM A;  2C6G A;  2GLJ A;  2Q4V A;  2XEF A;  3WC5 A;  3DR8 A;  3CZX A;  3FVL A;  2B4D B;  3SI0 A;  3FH4 A;  4NGS A;  4NGR A;  5A28 A;  4JJX A;  3IC1 A;  3JTK A;  4B5P B;  3FYN A;  5LYD A;  2Q04 A;  4DYO A;  1P0H A;  3S9L A;  2EWB A;  1CBX A;  2G3T A;  2YNE A;  3DGV A;  3SXN A;  3BXM A;  4F6A A;  5ELY A;  2PJB A;  3PB6 X;  3CPA A;  3D68 A;  4GXH A;  3WC6 A;  3KHZ A;  4FD5 A;  4R8F A;  5IB9 A;  1QQ9 A;  1LFW A;  1ARL A;  1S7N A;  1LCP A;  1XOV A;  4IK2 A;  3D67 A;  2Q4Y A;  4M3S A;  2PIZ A;  1TF8 A;  4TNU A;  4NGQ A;  2CTB A;  2PJ8 A;  4ZY0 A;  4M6G A;  1ELM P;  1BLL E;  2IMO A;  3C26 A;  3LWU A;  3LOD A;  4UFX A;  5ISV A;  4CRZ B;  1YLE A;  3KHX A;  1ON0 A;  4JXQ A;  1NSA A;  3EC4 A;  2NYQ A;  2P0W A;  2ATR A;  5C82 A;  4ZBG A;  4ORF A;  1JWQ A;  4XNH C;  1CP6 A;  1GYT A;  2EUI A;  2GLF A;  4CYO A;  3SHP A;  2P6E A;  3KI9 A;  3S6G A;  4EFD A;  4UEZ A;  3GKR A;  2NSM A;  1VHE A;  1XMT A;  3PB7 X;  4FWU A;  4J3G A;  5LYI A;  1ZLI A;  2AFM A;  4MRI A;  3T8W A;  4IHM A;  1YVO A;  3PB9 X;  3QB8 A;  4MHN A;  4UF4 A;  1M4I A;  4AVC A;  3B3C A;  4M6I A;  1Y0R A;  2FIW A;  2JEW A;  4UIB A;  1OZP A;  4NF1 A;  1CPS A;  3RNZ A;  5AG5 A;  4B10 A;  4UA3 A;  4Z65 A;  2V77 A;  1QSN A;  3SI2 A;  2Q44 A;  5G22 A;  4HNX B;  1VIX A;  5JH9 A;  1CPX A;  2DPT A;  1Z5R A;  1K4J A;  1S3Z A;  2ZEN A;  3SJG A;  4F0Y A;  3RYO A;  2ARH A;  2Y0M A;  3D66 A;  3IFE A;  3PGP A;  2BCO A;  4MCP A;  2I79 A;  2C6P A;  4K3N A;  4KOS A;  1X10 A;  3B35 A;  3PB4 X;  2PVW A;  2BEI A;  2G0B A;  4BIN A;  4W9Y A;  1S60 A;  3TO7 A;  3W91 A;  2JDC A;  2ZW4 A;  2ZED A;  5HXD A;  4C7H A;  1KZF A;  1JQG A;  3GLJ A;  4R3L A;  5EMI A;  2PJ0 A;  2REE A;  3NH4 A;  2PJ9 A;  2FIA A;  4A30 A;  4CAX A;  2AJ6 A;  2J8R A;  4MFP A;  2QML A;  4PK3 A;  4Y49 B;  2DXQ A;  3R9G A;  4PXD A;  1XE4 A;  5HMN A;  5I4M A;  4R87 A;  2B4B A;  2J9A A;  1U6M A;  3S6K A;  2PE3 A;  3SJE A;  4AVA A;  4BBH A;  3NA6 A;  5IV0 A;  2VI7 A;  4P4J A;  4NCZ A;  5K8O A;  2FE7 A;  4P4F A;  2ZOF A;  3I9S A;  3K9U A;  4MCR A;  2PR8 A;  3TC8 A;  2PJ6 A;  4MY0 A;  1Z8X A;  3NE7 A;  3PFE A;  4H6Z A;  4PPZ A;  1FNO A;  1TKF A;  4WWV A;  2ABZ A;  4HKF A;  5I0C A;  2ZEL A;  3FEE A;  2VXK A;  1QSR A;  1IYK A;  2R7H A;  3QAH A;  4MFK A;  5LRK A;  1LAN A;  2Z3O A;  3DR6 A;  3CXS A;  2D4P A;  3FRM A;  4NGP A;  3KGQ A;  4NXY A;  4CYN A;  2ODF A;  3DNS A;  1IIC A;  4RI1 A;  2OZH A;  1S5K A;  3D2P A;  2IQ6 A;  4KSF A;  2OH1 A;  1M1D A;  4NSQ A;  1KUV A;  2Z10 A;  5HVF A;  1LAP A;  3BJ7 A;  5LRJ A;  1AUG A;  3JVN A;  3UY5 A;  3OWC A;  5JQ4 A;  2BOA A;  4B12 A;  4E8O A;  3S9N A;  2F5I A;  3FXT A;  2QVP A;  3ISZ A;  4JWP A;  1QST A;  2B58 A;  3MGD A;  3TTH A;  3D2M A;  4C2Y A;  3E0K A;  3ISX A;  4HNY B;  4L89 A;  2BO9 A;  2WUU A;  4F9U A;  2ANP A;  1IOI A;  4P4E A;  4R57 A;  4P10 A;  4BMH A;  3D7D A;  5HH1 A;  4CGO A;  2AFU A;  1VHS A; 
#chains in the Genus database with same CATH homology
 2DF5 A;  1IU8 A;  4GXH A;  3RNZ A;  1Z8T A;  1IOI A;  1Z8W A;  3LAC A;  1IOF A;  1X12 A;  2EO8 A;  4HPS A;  3RO0 A;  2EBJ A;  1X10 A;  1Z8X A;  1A2Z A;  1AUG A;  3GIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...