1QSMA

Histone acetyltransferase hpa2 from saccharomyces cerevisiae in complex with acetyl coenzyme a
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
DNITVRFVTENDKEGWQRLWKSYQDFYEVSFPDDLDDFNFGRFLDPNIKMWAAVAVESSSEKIIGMINFFNHMTTWDFKDKIYINDLYVDENSRVKGAGGKLIQFVYDEADKLGTPSVYWCTDESNHRAQLLYVKVGYKAPKILYKRKGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HPA2 HISTONE ACETYLTRANSFERASE
publication title Crystal structure of the histone acetyltransferase Hpa2: A tetrameric member of the Gcn5-related N-acetyltransferase superfamily.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 43
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 1999-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1qsmA00
3GYAA 4GS4A 4II9A 2ARHA 2Z0ZA 4QVTA 1L0CA 4ORFA 1R57A 1B6BA 1YVOA 3F8KA 3E0KA 1M4DA 3DSBA 2I00A 3EY5A 4XPDC 2R98A 2K5TA 4MY0A 1V0CA 2PC1A 4H6ZA 3TT2A 4LX9A 2G0BA 2I79A 4JLYA 4H89A 5HMNA 1S7KA 2REEA 4R57A 4KOVA 3D2PA 4AB7A 3EXNA 2JEVA 4L8AA 3G3SA 1KUYA 2FS5A 2OZHA 2CY2A 1CJWA 2PR8A 4KVXA 3R9GA 4CAVA 4U9YA 2VZYA 2AJ6A 3T90A 4XNHB 4KVOE 4R3KA 2VZZA 4OAEA 1NE9A 3BLNA 4EVYA 1VHSA 2JLMA 3P2FA 1IB1E 2D4PA 2GIVA 4Y49C 1GHEA 2HUZA 4XNHC 5F49A 4AVAA 1BOBA 4U9ZA 1YGHA 2H5MA 4M85A 3LODA 4J3GA 3FNCA 1Q2YA 3D8PA 1Y9WA 4PK2A 4AVCA 5C82A 4KUBA 1PUAA 4NSQA 5JPHA 1ON0A 2Q44A 2QIRA 3SHPA 2X7BA 2FIAA 1TIQA 1Z4RA 2B4BA 3R96A 4FD7A 3BJ8A 4MY3A 2Y0MA 5F46A 5KTCA 5C88A 4KOXA 2B5GB 5DWMA 3S6KA 4HNWB 4IF5A 1NMTA 4AVBA 4PSWA 2OH1A 2P6EA 1M4IA 1QSRA 2B4DA 3F0AA 3R9FA 1LRZA 2R1IA 4KLWA 2P6FA 1S7FA 4R3LA 1P0HA 2ZXVA 2G3AA 3S6GA 5JQ4A 3R1KA 5FVJA 3N7ZA 4MBUA 5DWNA 3F5BA 3G8WA 1QSTA 1RXTA 3TOAA 3B8GA 1SQHA 2CNTA 1M44A 5IB0A 2BUEA 1I21A 5J8CA 4KOSA 1S7NA 3QAHA 2FIWA 3FBUA 2O28A 5EC4A 3S6FA 3PGPA 1MJAA 1RO5A 2G3TA 2VI7A 4B5PA 4KORA 2OB0A 4FD6A 4QBJA 1QSOA 4MHDA 4BMHA 3W6XA 3UY5A 1YR0A 3H4QA 4UWJA 4KVME 4CAXA 2REFA 2Q4YA 3CXSA 4CRZB 2Z11A 2PDOA 1YX0A 4FD4A 1I12A 3ZJ0A 4PSXA 4MI4A 4X5KA 1XMTA 3I3GA 2VEZA 4R87A 2JDCA 3BJ7A 4HNXB 4JD6A 3RYOA 3V8IA 3OWCA 4AG9A 1N71A 4JJXA 4M3SA 3DR8A 2Q7BA 3JVNA 4CS0B 2Q4VA 5CNPA 4U5YA 3CXQA 3TCVA 4MJ8A 5H86A 3TFYA 2VXKA 3R95A 3FXTA 2ZW6A 2PR1A 4E0AA 4PV6A 2P0WA 1IIDA 1U6MA 4F0YA 4H6UA 1Z4EA 2Q0YA 4QUSA 5IX3A 2OU2A 2WPWA 1M1DA 2HV2A 2VQYA 3NE7A 4JXRA 2BSWA 2GE3A 3R9EA 1IYKA 3DDDA 4E8OA 4HKFA 1QSNA 1IICA 2CNSA 3W91A 2A4NA 1S7LA 5F47A 2B3VA 3C26A 4AG7A 2F5IA 1VKCA 2RC4A 4XPKA 2B3UA 2R8VA 2ZW7A 2D4OA 2DXQA 2ZPAA 2GANA 3WR7A 2P6GA 2PRBA 2FXFA 4UWIA 3TTHA 4RS2A 1Q2DA 4KUAA 3KKWA 2B4DB 4XPLA 4UBRA 3EO4A 4NEXA 4KOYA 2FL4A 1IYLA 1XEBA 1XIXA 3P2HA 2OZGA 3I9SA 2J8MA 3PP9A 3S6HA 3TOBA 1M4GA 1YVKA 3TO6A 1B87A 2FE7A 2AE6A 5E96A 3LD2A 1Q2CA 1MJBA 1P4NA 4PK3A 3CXPA 5IV0A 1S5KA 4RI1A 2FCKA 1MK4A 1MJ9A 4B5PB 1KUXA 4DNCA 1I1DA 3FB3A 1K4JA 3EFAA 3W6SA 2PQ8A 1YREA 4KOTA 1XF8A 2EVNA 4YRHA 4YFJA 1YK3A 4KOWA 3SXOA 1CM0A 4B5OA 3MGDA 4R9MA 2VBQA 4UA3A 1KUVA 2PSWA 1J4JA 4NF1A 3FYNA 2C27A 3FRMA 1PU9A 1S3ZA 2OZUA 2R7HA 2J8NA 5KTAA 4QB9A 4FD5A 1UFHA 2QMLA 2WPXA 5I0CA 5EBVA 1KZFA 4ONUA 2Z10A 3QB8A 4IUSA 1S60A 1WK4A 4KLVA 4Y49B 4HNYB 1YLEA 1XE4A 3IGRA 3D2MA 4OADA 2Q04A 2FSRA 4CRYB 5J8FA 4QC6A 1Z9UA 2B58A 2J8RA 3JUWA 3VWEA 4E2AA 1BO4A 2ATRA 2NMTA 3T9YA 2HQYA 2BEIA 1OZPA 1NSLA 3IWGA 4L89A 2FT0A 5KTDA 2KCWA 2JDDA 5H84A 4KZTA 1WWZA 2ZW5A 5GCNA 4OLLA 3DNSA 1Y7RA 4KOUA 4YGOA 3GKRA 4NXYA 1Y9KA 5F48A 3GY9A 2B5GA 3K9UA 3SXNA 1FY7A 3TO7A 2IL4A 4K30A 2ZW4A 3DR6A 3VWDA 3EC4A 4F6AA 3ZZIA 4I49A 2EUIA 4ZBGA 4JWPA 4NCZA 3D3SA 5HH1A 4CAWA 2CNMA 5ISVA 3TO9A 3TE4A 3FIXA 2BL1A 2QECA 3PZJA 1QSMA 4LUAA 4XPDB 4JXQA
chains in the Genus database with same CATH superfamily
3GYAA 4GS4A 3D67A 5AG4A 2ARHA 2Z0ZA 5HXDA 4II9A 1XRYA 4QVTA 1L0CA 3DGVA 2OOTA 3H5ZA 4ORFA 1R57A 4NJQA 5HVGA 1B6BA 1YVOA 3FJUA 4PXCA 1OBRA 1CPXA 3D7DA 3F8KA 3NH4A 1CG2A 5LYLA 5ELYA 2QJ8A 5I4MA 3FEEA 3E0KA 3LACA 5G1ZA 1M4DA 3RBUA 3DSBA 3CDXA 2I00A 1IU8A 2JEWA 3EY5A 4XPDC 4NGTA 2R98A 2K5TA 4MY0A 5A28A 1V0CA 2PC1A 4R7MA 5THWA 4H6ZA 2J9AA 3NE8A 1LOKA 2V8HA 3TT2A 1X12A 2G0BA 2I79A 4JLYA 4H89A 4LX9A 5HMNA 4MHYA 1S7KA 2REEA 1FNOA 4UFVA 4R57A 2XEIA 4KOVA 3WC5A 3D2PA 4MCQA 3FECA 5LRGA 4AB7A 1AMPA 3EXNA 2JEVA 4L8AA 4ZYQA 1PYTB 4UFXA 4CGPA 3G3SA 1KUYA 5HVFA 2C1CA 2FS5A 1NSAA 2OZHA 4OP4A 4CPAA 2GREA 2CY2A 1XMBA 1CJWA 2PR8A 4KVXA 3PFEA 3R9GA 4A2ZA 4U9YA 4CAVA 5JM6A 1HDQA 1VHOA 2JBJA 4B11A 2VZYA 4LQGA 2AJ6A 1FT7A 1IY7A 3T90A 4XNHB 3D7GA 4KVOE 4NGRA 4CGOA 3NH5A 4R3KA 2I3CA 2VZZA 4OAEA 3V7ZA 1XFOA 4CYQA 1NE9A 2PJ7A 3D68A 4A37A 1Z5RA 3BLNA 4EVYA 1VHSA 2BCOA 5LRKA 2JLMA 3P2FA 4UEFA 1IB1E 7CPAA 5G22A 2D4PA 2GIVA 2V8DA 4Y49C 3KHXA 1Y0YA 3PFOA 1GHEA 2PJ8A 2HUZA 4XNHC 5LYDA 5F49A 3N5FA 4CAFA 3A9LA 1ELMP 5DS0A 4AVAA 3CPAA 4EFDA 1BOBA 2G9DA 2ZENA 4U9ZA 1YGHA 4W9YA 4EWTA 2H5MA 4M85A 3JTKA 2XEGA 2PJ1A 4A33A 3LODA 4J3GA 3FNCA 1Q2YA 3D8PA 2ZEEA 4NFRA 1Y9WA 4KSIA 2YGWA 4PK2A 4AVCA 4KUBA 4C2XA 5C82A 1PUAA 4NSQA 1Y7EA 5JPHA 1ON0A 2AFSA 2Q44A 4UFWA 4F9UA 2QIRA 3SHPA 4P45A 2X7BA 1CBXA 1TIQA 2FIAA 2IQ6A 1Z4RA 2B4BA 4P4BA 3R96A 3BI1A 3MN8A 2PRQA 1YSJA 4OC2A 4CGNA 3H8GA 1GYTA 4FD7A 3KR5A 3BJ8A 2C6CA 4MY3A 2PJ6A 4P4FA 2Y0MA 4F9VA 3NFZA 5F46A 5KTCA 3H8FA 1BAVA 2PVVA 3SI0A 5C88A 4KOXA 3S9NA 1TKFA 2B5GB 5DWMA 4OIWA 3S6KA 3TX8A 4B13A 1ZO0A 4HNWB 4IF5A 4A39A 1NMTA 4AVBA 4IAVA 4PSWA 4P4EA 1TF8A 2OH1A 2P6EA 1M4IA 4KSAA 1QSRA 2B4DA 3F0AA 3R9FA 4NGSA 1LRZA 4B6ZA 3WC6A 4MXUA 3RZAA 4P10A 2R1IA 4KLWA 2EO8A 2P6FA 3KGQA 1IOIA 4A31A 1S7FA 2GFQA 2ZEHA 2FVGA 3PB6X 4R3LA 1P0HA 2F7VA 1ZLHA 2ZXVA 1IOFA 1YW4A 2G3AA 1Z2LA 5AG5A 3S6GA 5JQ4A 2EBJA 3R1KA 3N7ZA 4MFLA 2Z3LA 4MBUA 5AG7A 5FVJA 5DWNA 3F5BA 4DJLA 1VGYA 3G8WA 1JQGA 1QSTA 3DLJA 1RXTA 4X3RA 3TOAA 3B8GA 1SQHA 2CNTA 1M44A 5IB0A 2BUEA 1Q7LA 1I21A 5J8CA 1DTDA 4KOSA 1S7NA 1CPSA 3QAHA 4C7IA 2FIWA 3FBUA 5JH9A 2O28A 3D7HA 5CPAA 5EC4A 3PB8X 3S6FA 3K2KA 3PGPA 1MJAA 1RO5A 2G3TA 2VI7A 3IJ3A 2PE3A 4B5PA 1Z8TA 4A38A 1XOVA 2OB0A 4FD6A 2C6GA 4KORA 4QBJA 2YNCC 5HVHA 1ARLA 1QSOA 2Q43A 4MHDA 4TNUA 3V38A 3RNZA 3IEHA 4B12A 4BMHA 1JWQA 3W6XA 2ZEMA 1F2OA 2PCUA 4ZGYB 4MFKA 3LMSA 3UY5A 4NJRA 3PEIA 2XEFA 4CGMA 4Z65A 1LAPA 4ZY0A 1YR0A 3H4QA 4UWJA 4BBHA 4HPSA 4KVME 2CTCA 3KL9A 4CAXA 2REFA 2Q4YA 3CXSA 2PIYA 3NA6A 4CRZB 2Z11A 3NH8A 4G1PA 4MCRA 2PDOA 3RO0A 5J1QA 1YX0A 3B7IA 4EMEA 1YLOA 1H8LA 4FD4A 1I12A 2AFMA 3ZJ0A 4PSXA 4MI4A 2AFXA 4X5KA 1XMTA 3I3GA 8CPAA 2O53A 4CYOA 4K3NA 2VEZA 4R87A 1Y0RA 4ZX8A 2JDCA 4B10A 3LWUA 1ZLIA 5EMIA 4MFQA 3BJ7A 4HNXB 4JD6A 2DEAA 4BINA 1PCAA 3I1UA 4OC4A 3RYOA 4F0XA 3IU1A 2DPSA 3KZWA 3V8IA 3OWCA 3PB9X 4YWYA 4AG9A 1N71A 1BPMA 4UIBA 4JJXA 3GUXA 4M3SA 5JGFA 3DR8A 5CBMA 2Q7BA 3JVNA 3H8EA 4CS0B 2Q4VA 4DUKA 2BO9A 5CNPA 3IWEA 4U5YA 3CXQA 3TCVA 4M6IA 4MHNA 4MJ8A 2PIZA 2VXKA 5D29A 5H86A 3TFYA 3R95A 4B14A 2CIJA 3FXTA 2ZW6A 1HDUA 3B35A 2PR1A 4C7HA 4E0AA 1TKHA 4JZ0A 1ZG7A 4PV6A 2P0WA 2PVWA 1IIDA 1ARMA 1UWYA 1U6MA 3CZXA 4F0YA 3B3TA 4H6UA 1Z4EA 2ZEFA 2Q0YA 4R6TA 4OC0A 4QUSA 5IX3A 1EE3P 2OU2A 2WPWA 4PXDA 1M1DA 2HV2A 2F8HA 2VQYA 3D7FA 3NE7A 4JXRA 2CTBA 2BSWA 2ZOGA 2GE3A 3BI0A 3R9EA 2Q51A 1IYKA 2AFWA 1ELLP 3DDDA 2CXAA 3PBEA 3SJFA 4CGLA 4UCNA 4E8OA 4HKFA 1QSNA 3FEDA 2V8GA 1IICA 2CNSA 2Z3PA 3VH9A 3W91A 1IGBA 5IB9A 3HUVA 2WUUA 2A4NA 1S7LA 2PJ9A 5F47A 2B3VA 3C26A 4AG7A 2F5IA 2RB7A 3B3SA 4WJBA 1VKCA 2RC4A 1R43A 2GU2A 4R76A 4XPKA 3SJXA 1F57A 1F2PA 2QYVA 2B3UA 3IU2A 3TC8A 2R8VA 4UEZA 3PB7X 2ZW7A 2D4OA 2DXQA 2ZPAA 2GANA 3WR7A 2P6GA 2PRBA 3VATA 1BPNA 2FXFA 4UWIA 3TTHA 4RS2A 3PBBA 1Q2DA 4KUAA 5G21A 5K8PA 3KKWA 3KQZA 4MHPA 2B4DB 2QVPA 4KSFA 4XPLA 4UBRA 3EO4A 4ZY2A 1YW6A 5K8OA 3VARA 4NEXA 4C68A 4KOYA 2FL4A 1IYLA 1XEBA 1XIXA 2PJ3A 3P2HA 2OZGA 3I9SA 2HC9A 4LQ6A 2NSMA 4Q36A 1LFWA 2RFHA 2CF4A 2Z3MA 2J8MA 3PP9A 2ZEGA 3S6HA 3TOBA 1M4GA 1YVKA 3MRUA 3TO6A 4YU9A 1B87A 2FE7A 4MFPA 3FMCA 2AE6A 5E96A 3LD2A 1Q2CA 2NYQA 2V77A 1MJBA 1P4NA 2Z3NA 2EK8A 3JRUA 4OIDA 2YNCA 4P4JA 4PK3A 3BHXA 1DE4C 3CXPA 5IV0A 1S5KA 4RI1A 4FAIA 4OC1A 4F8ZA 1CP6A 3K9TA 2FCKA 1MK4A 4IHMA 4NGQA 1MJ9A 2HB6A 4Q38A 4OMEA 3B3WA 4B5PB 1QMUA 2WZNA 4OKOA 1KUXA 4DNCA 4UF4A 1I1DA 3FB3A 2EWBA 1K4JA 2OR4A 4MHZA 3EFAA 3KHZA 3W6SA 3FX6A 1R3NA 5G20A 2PQ8A 4DYOA 1YREA 2PJ5A 5A27A 4UCPA 4KOTA 1XF8A 2EVNA 2PJ4A 4PXEA 4YRHA 4NGPA 3RAMA 2ANPA 4YFJA 5K8MA 1YK3A 2C6PA 4KOWA 3SXOA 1CM0A 4ONWA 5AGEA 2PJ0A 3GLJA 4P44A 4B5OA 3MGDA 3KQXA 4PXBA 4R9MA 2VBQA 3T8WA 4PQAA 4UA3A 3S9LA 1LAMA 1KUVA 3D66A 2PSWA 2ZEPA 1J4JA 4NF1A 2Q4ZA 3FYNA 3KI9A 2C27A 3FRMA 1AUGA 1PU9A 1S3ZA 2JBKA 2OZUA 2R7HA 2J8NA 2WYRA 5KTAA 4QB9A 2DPTA 4FD5A 1UFHA 2QMLA 2WPXA 5I0CA 3L2NA 4PPZA 1TF9A 5EBVA 1KZFA 4ONUA 2YNEA 1VIXA 2IMOA 2Z10A 2ZEDA 4Q7AA 3KASA 3WT4A 3QB8A 4IUSA 3IC1A 4C2ZA 2Z3KA 3FVLA 4FBEA 1S60A 1WK4A 3GB0A 4KLVA 3IFEA 4Y49B 2PJ2A 4HNYB 3SI2A 4FWUA 4MCSA 1YLEA 6CPAA 3B3CA 4A94A 1XE4A 3FF3A 3IGRA 3D2MA 2PJBA 1BLLE 2Q04A 4OADA 5LYFA 1KWMA 4M6GA 1CP7A 3QAYA 2FSRA 4UEEA 4CRYB 4P4IA 5J8FA 2Z3OA 4FUUA 4QC6A 1Z9UA 1X10A 2B58A 2J8RA 2YNDA 3GIUA 3JUWA 3VWEA 4E2AA 1BO4A 2ATRA 2NMTA 2ZOFA 3T9YA 2HQYA 2BEIA 2AFOA 3PB4X 5LRJA 1OZPA 4A30A 4BD9A 5D8NA 2DF5A 4NGNA 1NSLA 4GXHA 4IK2A 2XEJA 3IWGA 2AFUA 4L89A 1RTQA 2FT0A 1AYEA 1XBUA 2ZELA 5BWAB 1M4LA 1XJOA 1LANA 2AFZA 2PJAA 2POKA 3CPXA 5KTDA 2KCWA 4M6HA 4C2YA 2JDDA 4KS9A 1HEEA 1QQ9A 5H84A 4NGMA 4MCPA 4KZTA 4RUHA 2GLJA 1WWZA 2ZW5A 4X2TA 3FH4A 3B3VA 5GCNA 4OLLA 1A2ZA 4OC3A 5F09A 3DNSA 1Y7RA 1VHEA 2PJCA 4KOUA 4UCMA 5LYIA 4YGOA 4A95A 3BXMA 3GKRA 4ZX9A 4NXYA 3SJGA 2WSAA 1Y9KA 4MRIA 5F48A 3GY9A 4MFJA 2ZEOA 2B5GA 3HLPA 5AG6A 2IJZA 4MMOA 3K9UA 3KR4A 4MFZA 3SXNA 1FY7A 4ZY1A 3PRTA 4P6YA 2BOAA 2EK9A 4X8IA 1ZG9A 4WWVA 1ZG8A 2O4HA 3TO7A 2Q7SA 2IL4A 1YQEA 4TWEA 2V8VA 4K30A 1Z8LA 2GLFA 2VL1A 2ZW4A 3DR6A 3QNVA 1TKJA 3VWDA 4O23A 4A32A 3EC4A 4JYWA 4F6AA 1Z8WA 3SI1A 3ZZIA 3ISZA 4I49A 4CYNA 1CX8A 2EUIA 4UIAA 4JWPA 4H2KA 4NCZA 2ABZA 4ZBGA 3D3SA 5HH1A 3ISXA 4GM5A 4CAWA 2CNMA 3CT9A 3SJEA 4CYPA 3WABA 4ZI6A 5ISVA 4OC5A 3TO9A 3TE4A 3FIXA 3IWWA 4P4DA 2BL1A 2QECA 3IO1A 3WC7A 3IIBA 1Z8XA 3PZJA 4CAEA 5K8NA 3S9MA 1QSMA 1TXRA 4LUAA 1YMEA 3D4UA 2ODFA 3B2YA 4R8FA 4AXVA 4XPDB 4JXQA 4RN7A 1LCPA
chains in the Genus database with same CATH topology
3GYAA 4GS4A 5AG4A 4II9A 2ARHA 2Z0ZA 4QVTA 1L0CA 3H5ZA 4ORFA 1R57A 1B6BA 1YVOA 3F8KA 3E0KA 5G1ZA 1M4DA 3DSBA 2I00A 3EY5A 4XPDC 2R98A 2K5TA 4MY0A 5A28A 1V0CA 2PC1A 4H6ZA 3TT2A 4LX9A 2G0BA 2I79A 4JLYA 4H89A 5HMNA 1S7KA 2REEA 4UFVA 4R57A 4KOVA 3D2PA 4AB7A 3EXNA 2JEVA 4L8AA 4UFXA 4CGPA 3G3SA 1KUYA 2FS5A 2OZHA 2CY2A 1CJWA 2PR8A 4KVXA 3R9GA 4A2ZA 4CAVA 4U9YA 2VZYA 2AJ6A 3T90A 4XNHB 4KVOE 4CGOA 4R3KA 2VZZA 4OAEA 4CYQA 1NE9A 3BLNA 4EVYA 1VHSA 2JLMA 3P2FA 1IB1E 5G22A 2D4PA 2GIVA 4Y49C 1GHEA 2HUZA 4XNHC 5F49A 4CAFA 3A9LA 4AVAA 1BOBA 4U9ZA 1YGHA 2H5MA 4M85A 3JTKA 4A33A 3LODA 4J3GA 3FNCA 1Q2YA 3D8PA 1Y9WA 2YGWA 4PK2A 4AVCA 4KUBA 4C2XA 5C82A 1PUAA 4NSQA 5JPHA 1ON0A 2Q44A 4UFWA 2QIRA 3SHPA 2X7BA 2FIAA 1TIQA 1Z4RA 2B4BA 3R96A 4CGNA 4FD7A 3BJ8A 4MY3A 2Y0MA 5F46A 5KTCA 5C88A 4KOXA 2B5GB 5DWMA 3S6KA 4B13A 1ZO0A 4HNWB 4IF5A 1NMTA 4AVBA 4PSWA 2OH1A 2P6EA 1M4IA 4KSAA 1QSRA 2B4DA 3F0AA 3R9FA 1LRZA 2R1IA 4KLWA 2P6FA 4A31A 1S7FA 4R3LA 1P0HA 2ZXVA 2G3AA 5AG5A 3S6GA 5JQ4A 3R1KA 4MFLA 3N7ZA 5AG7A 2Z3LA 4MBUA 5FVJA 5DWNA 3F5BA 3G8WA 1QSTA 1RXTA 3TOAA 3B8GA 1SQHA 2CNTA 1M44A 5IB0A 2BUEA 1I21A 5J8CA 4KOSA 1S7NA 3QAHA 4C7IA 2FIWA 3FBUA 2O28A 5EC4A 3S6FA 3PGPA 1MJAA 1RO5A 2G3TA 2VI7A 4B5PA 4KORA 2OB0A 4FD6A 4QBJA 2YNCC 1QSOA 4MHDA 4B12A 4BMHA 3W6XA 4ZGYB 4MFKA 3UY5A 4CGMA 1YR0A 3H4QA 4UWJA 4BBHA 4KVME 4CAXA 2REFA 2Q4YA 3CXSA 4CRZB 2Z11A 2PDOA 1YX0A 4FD4A 1I12A 3ZJ0A 4PSXA 4MI4A 4X5KA 1XMTA 3I3GA 4CYOA 2VEZA 4R87A 2JDCA 4B10A 4MFQA 3BJ7A 4HNXB 4JD6A 3RYOA 4F0XA 3IU1A 2DPSA 3V8IA 3OWCA 4AG9A 1N71A 4JJXA 4M3SA 3DR8A 2Q7BA 3JVNA 4CS0B 2Q4VA 5CNPA 3IWEA 4U5YA 3CXQA 3TCVA 4MJ8A 5H86A 3TFYA 2VXKA 3R95A 4B14A 3FXTA 2ZW6A 4C7HA 2PR1A 4E0AA 4PV6A 2P0WA 1IIDA 1U6MA 4F0YA 4H6UA 1Z4EA 2Q0YA 4QUSA 5IX3A 2OU2A 2WPWA 1M1DA 2HV2A 2VQYA 3NE7A 4JXRA 2BSWA 2GE3A 3R9EA 1IYKA 3DDDA 2CXAA 4E8OA 4CGLA 4UCNA 4HKFA 1QSNA 1IICA 2CNSA 2Z3PA 3W91A 2WUUA 2A4NA 1S7LA 5F47A 2B3VA 3C26A 4AG7A 2F5IA 1VKCA 2RC4A 4XPKA 2B3UA 3IU2A 2R8VA 2ZW7A 2D4OA 2DXQA 2ZPAA 2GANA 3WR7A 2P6GA 2PRBA 2FXFA 4UWIA 3TTHA 4RS2A 1Q2DA 4KUAA 5G21A 3KKWA 2B4DB 4KSFA 4XPLA 4UBRA 3EO4A 4NEXA 4C68A 4KOYA 2FL4A 1IYLA 1XEBA 1XIXA 3P2HA 2OZGA 3I9SA 4Q36A 2Z3MA 2J8MA 3PP9A 3S6HA 3TOBA 1M4GA 1YVKA 3TO6A 1B87A 2FE7A 4MFPA 2AE6A 5E96A 3LD2A 1Q2CA 1MJBA 1P4NA 2Z3NA 2YNCA 4PK3A 3CXPA 5IV0A 1S5KA 4RI1A 2FCKA 1MK4A 1MJ9A 4Q38A 4B5PB 1KUXA 4DNCA 1I1DA 3FB3A 1K4JA 3EFAA 3W6SA 5G20A 2PQ8A 1YREA 5A27A 4UCPA 4KOTA 1XF8A 2EVNA 4YRHA 4YFJA 1YK3A 4KOWA 3SXOA 1CM0A 5AGEA 4B5OA 3MGDA 4R9MA 2VBQA 4UA3A 1KUVA 2PSWA 1J4JA 4NF1A 3FYNA 2C27A 3FRMA 1PU9A 1S3ZA 2OZUA 2R7HA 2J8NA 5KTAA 4QB9A 2DPTA 4FD5A 1UFHA 2QMLA 2WPXA 5I0CA 5EBVA 1KZFA 4ONUA 2YNEA 2Z10A 3QB8A 4IUSA 4C2ZA 2Z3KA 1S60A 1WK4A 4KLVA 4Y49B 4HNYB 1YLEA 1XE4A 3IGRA 3D2MA 4OADA 2Q04A 2FSRA 4CRYB 5J8FA 2Z3OA 4QC6A 1Z9UA 2B58A 2J8RA 2YNDA 3JUWA 3VWEA 4E2AA 1BO4A 2ATRA 2NMTA 3T9YA 2HQYA 2BEIA 4A30A 1OZPA 1NSLA 3IWGA 4L89A 2FT0A 5BWAB 5KTDA 2KCWA 4C2YA 2JDDA 4KS9A 5H84A 4KZTA 1WWZA 2ZW5A 5GCNA 4OLLA 3DNSA 1Y7RA 4KOUA 4UCMA 4YGOA 4A95A 3GKRA 4NXYA 2WSAA 1Y9KA 5F48A 3GY9A 4MFJA 2B5GA 5AG6A 3K9UA 4MFZA 3SXNA 1FY7A 3TO7A 2IL4A 4K30A 2ZW4A 3DR6A 3VWDA 4A32A 3EC4A 4F6AA 3ZZIA 4I49A 4CYNA 2EUIA 4ZBGA 4JWPA 4NCZA 3D3SA 5HH1A 4CAWA 2CNMA 4CYPA 5ISVA 3TO9A 3TE4A 3FIXA 2BL1A 2QECA 3PZJA 4CAEA 1QSMA 4LUAA 4B11A 4XPDB 4JXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYA A;  4GS4 A;  4II9 A;  2ARH A;  2Z0Z A;  4QVT A;  1L0C A;  4ORF A;  1R57 A;  1B6B A;  1YVO A;  3F8K A;  3E0K A;  1M4D A;  3DSB A;  2I00 A;  3EY5 A;  4XPD C;  2R98 A;  2K5T A;  4MY0 A;  1V0C A;  2PC1 A;  4H6Z A;  3TT2 A;  4LX9 A;  2G0B A;  2I79 A;  4JLY A;  4H89 A;  5HMN A;  1S7K A;  2REE A;  4R57 A;  4KOV A;  3D2P A;  4AB7 A;  3EXN A;  2JEV A;  4L8A A;  3G3S A;  1KUY A;  2FS5 A;  2OZH A;  2CY2 A;  1CJW A;  2PR8 A;  4KVX A;  3R9G A;  4CAV A;  4U9Y A;  2VZY A;  2AJ6 A;  3T90 A;  4XNH B;  4KVO E;  4R3K A;  2VZZ A;  4OAE A;  1NE9 A;  3BLN A;  4EVY A;  1VHS A;  2JLM A;  3P2F A;  1IB1 E;  2D4P A;  2GIV A;  4Y49 C;  1GHE A;  2HUZ A;  4XNH C;  5F49 A;  4AVA A;  1BOB A;  4U9Z A;  1YGH A;  2H5M A;  4M85 A;  3LOD A;  4J3G A;  3FNC A;  1Q2Y A;  3D8P A;  1Y9W A;  4PK2 A;  4AVC A;  5C82 A;  4KUB A;  1PUA A;  4NSQ A;  5JPH A;  1ON0 A;  2Q44 A;  2QIR A;  3SHP A;  2X7B A;  2FIA A;  1TIQ A;  1Z4R A;  2B4B A;  3R96 A;  4FD7 A;  3BJ8 A;  4MY3 A;  2Y0M A;  5F46 A;  5KTC A;  5C88 A;  4KOX A;  2B5G B;  5DWM A;  3S6K A;  4HNW B;  4IF5 A;  1NMT A;  4AVB A;  4PSW A;  2OH1 A;  2P6E A;  1M4I A;  1QSR A;  2B4D A;  3F0A A;  3R9F A;  1LRZ A;  2R1I A;  4KLW A;  2P6F A;  1S7F A;  4R3L A;  1P0H A;  2ZXV A;  2G3A A;  3S6G A;  5JQ4 A;  3R1K A;  5FVJ A;  3N7Z A;  4MBU A;  5DWN A;  3F5B A;  3G8W A;  1QST A;  1RXT A;  3TOA A;  3B8G A;  1SQH A;  2CNT A;  1M44 A;  5IB0 A;  2BUE A;  1I21 A;  5J8C A;  4KOS A;  1S7N A;  3QAH A;  2FIW A;  3FBU A;  2O28 A;  5EC4 A;  3S6F A;  3PGP A;  1MJA A;  1RO5 A;  2G3T A;  2VI7 A;  4B5P A;  4KOR A;  2OB0 A;  4FD6 A;  4QBJ A;  1QSO A;  4MHD A;  4BMH A;  3W6X A;  3UY5 A;  1YR0 A;  3H4Q A;  4UWJ A;  4KVM E;  4CAX A;  2REF A;  2Q4Y A;  3CXS A;  4CRZ B;  2Z11 A;  2PDO A;  1YX0 A;  4FD4 A;  1I12 A;  3ZJ0 A;  4PSX A;  4MI4 A;  4X5K A;  1XMT A;  3I3G A;  2VEZ A;  4R87 A;  2JDC A;  3BJ7 A;  4HNX B;  4JD6 A;  3RYO A;  3V8I A;  3OWC A;  4AG9 A;  1N71 A;  4JJX A;  4M3S A;  3DR8 A;  2Q7B A;  3JVN A;  4CS0 B;  2Q4V A;  5CNP A;  4U5Y A;  3CXQ A;  3TCV A;  4MJ8 A;  5H86 A;  3TFY A;  2VXK A;  3R95 A;  3FXT A;  2ZW6 A;  2PR1 A;  4E0A A;  4PV6 A;  2P0W A;  1IID A;  1U6M A;  4F0Y A;  4H6U A;  1Z4E A;  2Q0Y A;  4QUS A;  5IX3 A;  2OU2 A;  2WPW A;  1M1D A;  2HV2 A;  2VQY A;  3NE7 A;  4JXR A;  2BSW A;  2GE3 A;  3R9E A;  1IYK A;  3DDD A;  4E8O A;  4HKF A;  1QSN A;  1IIC A;  2CNS A;  3W91 A;  2A4N A;  1S7L A;  5F47 A;  2B3V A;  3C26 A;  4AG7 A;  2F5I A;  1VKC A;  2RC4 A;  4XPK A;  2B3U A;  2R8V A;  2ZW7 A;  2D4O A;  2DXQ A;  2ZPA A;  2GAN A;  3WR7 A;  2P6G A;  2PRB A;  2FXF A;  4UWI A;  3TTH A;  4RS2 A;  1Q2D A;  4KUA A;  3KKW A;  2B4D B;  4XPL A;  4UBR A;  3EO4 A;  4NEX A;  4KOY A;  2FL4 A;  1IYL A;  1XEB A;  1XIX A;  3P2H A;  2OZG A;  3I9S A;  2J8M A;  3PP9 A;  3S6H A;  3TOB A;  1M4G A;  1YVK A;  3TO6 A;  1B87 A;  2FE7 A;  2AE6 A;  5E96 A;  3LD2 A;  1Q2C A;  1MJB A;  1P4N A;  4PK3 A;  3CXP A;  5IV0 A;  1S5K A;  4RI1 A;  2FCK A;  1MK4 A;  1MJ9 A;  4B5P B;  1KUX A;  4DNC A;  1I1D A;  3FB3 A;  1K4J A;  3EFA A;  3W6S A;  2PQ8 A;  1YRE A;  4KOT A;  1XF8 A;  2EVN A;  4YRH A;  4YFJ A;  1YK3 A;  4KOW A;  3SXO A;  1CM0 A;  4B5O A;  3MGD A;  4R9M A;  2VBQ A;  4UA3 A;  1KUV A;  2PSW A;  1J4J A;  4NF1 A;  3FYN A;  2C27 A;  3FRM A;  1PU9 A;  1S3Z A;  2OZU A;  2R7H A;  2J8N A;  5KTA A;  4QB9 A;  4FD5 A;  1UFH A;  2QML A;  2WPX A;  5I0C A;  5EBV A;  1KZF A;  4ONU A;  2Z10 A;  3QB8 A;  4IUS A;  1S60 A;  1WK4 A;  4KLV A;  4Y49 B;  4HNY B;  1YLE A;  1XE4 A;  3IGR A;  3D2M A;  4OAD A;  2Q04 A;  2FSR A;  4CRY B;  5J8F A;  4QC6 A;  1Z9U A;  2B58 A;  2J8R A;  3JUW A;  3VWE A;  4E2A A;  1BO4 A;  2ATR A;  2NMT A;  3T9Y A;  2HQY A;  2BEI A;  1OZP A;  1NSL A;  3IWG A;  4L89 A;  2FT0 A;  5KTD A;  2KCW A;  2JDD A;  5H84 A;  4KZT A;  1WWZ A;  2ZW5 A;  5GCN A;  4OLL A;  3DNS A;  1Y7R A;  4KOU A;  4YGO A;  3GKR A;  4NXY A;  1Y9K A;  5F48 A;  3GY9 A;  2B5G A;  3K9U A;  3SXN A;  1FY7 A;  3TO7 A;  2IL4 A;  4K30 A;  2ZW4 A;  3DR6 A;  3VWD A;  3EC4 A;  4F6A A;  3ZZI A;  4I49 A;  2EUI A;  4ZBG A;  4JWP A;  4NCZ A;  3D3S A;  5HH1 A;  4CAW A;  2CNM A;  5ISV A;  3TO9 A;  3TE4 A;  3FIX A;  2BL1 A;  2QEC A;  3PZJ A;  1QSM A;  4LUA A;  4XPD B;  4JXQ A; 
#chains in the Genus database with same CATH topology
 3GYA A;  4GS4 A;  3D67 A;  5AG4 A;  2ARH A;  2Z0Z A;  5HXD A;  4II9 A;  1XRY A;  4QVT A;  1L0C A;  3DGV A;  2OOT A;  3H5Z A;  4ORF A;  1R57 A;  4NJQ A;  5HVG A;  1B6B A;  1YVO A;  3FJU A;  4PXC A;  1OBR A;  1CPX A;  3D7D A;  3F8K A;  3NH4 A;  1CG2 A;  5LYL A;  5ELY A;  2QJ8 A;  5I4M A;  3FEE A;  3E0K A;  3LAC A;  5G1Z A;  1M4D A;  3RBU A;  3DSB A;  3CDX A;  2I00 A;  1IU8 A;  2JEW A;  3EY5 A;  4XPD C;  4NGT A;  2R98 A;  2K5T A;  4MY0 A;  5A28 A;  1V0C A;  2PC1 A;  4R7M A;  5THW A;  4H6Z A;  2J9A A;  3NE8 A;  1LOK A;  2V8H A;  3TT2 A;  1X12 A;  2G0B A;  2I79 A;  4JLY A;  4H89 A;  4LX9 A;  5HMN A;  4MHY A;  1S7K A;  2REE A;  1FNO A;  4UFV A;  4R57 A;  2XEI A;  4KOV A;  3WC5 A;  3D2P A;  4MCQ A;  3FEC A;  5LRG A;  4AB7 A;  1AMP A;  3EXN A;  2JEV A;  4L8A A;  4ZYQ A;  1PYT B;  4UFX A;  4CGP A;  3G3S A;  1KUY A;  5HVF A;  2C1C A;  2FS5 A;  1NSA A;  2OZH A;  4OP4 A;  4CPA A;  2GRE A;  2CY2 A;  1XMB A;  1CJW A;  2PR8 A;  4KVX A;  3PFE A;  3R9G A;  4A2Z A;  4U9Y A;  4CAV A;  5JM6 A;  1HDQ A;  1VHO A;  2JBJ A;  4B11 A;  2VZY A;  4LQG A;  2AJ6 A;  1FT7 A;  1IY7 A;  3T90 A;  4XNH B;  3D7G A;  4KVO E;  4NGR A;  4CGO A;  3NH5 A;  4R3K A;  2I3C A;  2VZZ A;  4OAE A;  3V7Z A;  1XFO A;  4CYQ A;  1NE9 A;  2PJ7 A;  3D68 A;  4A37 A;  1Z5R A;  3BLN A;  4EVY A;  1VHS A;  2BCO A;  5LRK A;  2JLM A;  3P2F A;  4UEF A;  1IB1 E;  7CPA A;  5G22 A;  2D4P A;  2GIV A;  2V8D A;  4Y49 C;  3KHX A;  1Y0Y A;  3PFO A;  1GHE A;  2PJ8 A;  2HUZ A;  4XNH C;  5LYD A;  5F49 A;  3N5F A;  4CAF A;  3A9L A;  1ELM P;  5DS0 A;  4AVA A;  3CPA A;  4EFD A;  1BOB A;  2G9D A;  2ZEN A;  4U9Z A;  1YGH A;  4W9Y A;  4EWT A;  2H5M A;  4M85 A;  3JTK A;  2XEG A;  2PJ1 A;  4A33 A;  3LOD A;  4J3G A;  3FNC A;  1Q2Y A;  3D8P A;  2ZEE A;  4NFR A;  1Y9W A;  4KSI A;  2YGW A;  4PK2 A;  4AVC A;  4KUB A;  4C2X A;  5C82 A;  1PUA A;  4NSQ A;  1Y7E A;  5JPH A;  1ON0 A;  2AFS A;  2Q44 A;  4UFW A;  4F9U A;  2QIR A;  3SHP A;  4P45 A;  2X7B A;  1CBX A;  1TIQ A;  2FIA A;  2IQ6 A;  1Z4R A;  2B4B A;  4P4B A;  3R96 A;  3BI1 A;  3MN8 A;  2PRQ A;  1YSJ A;  4OC2 A;  4CGN A;  3H8G A;  1GYT A;  4FD7 A;  3KR5 A;  3BJ8 A;  2C6C A;  4MY3 A;  2PJ6 A;  4P4F A;  2Y0M A;  4F9V A;  3NFZ A;  5F46 A;  5KTC A;  3H8F A;  1BAV A;  2PVV A;  3SI0 A;  5C88 A;  4KOX A;  3S9N A;  1TKF A;  2B5G B;  5DWM A;  4OIW A;  3S6K A;  3TX8 A;  4B13 A;  1ZO0 A;  4HNW B;  4IF5 A;  4A39 A;  1NMT A;  4AVB A;  4IAV A;  4PSW A;  4P4E A;  1TF8 A;  2OH1 A;  2P6E A;  1M4I A;  4KSA A;  1QSR A;  2B4D A;  3F0A A;  3R9F A;  4NGS A;  1LRZ A;  4B6Z A;  3WC6 A;  4MXU A;  3RZA A;  4P10 A;  2R1I A;  4KLW A;  2EO8 A;  2P6F A;  3KGQ A;  1IOI A;  4A31 A;  1S7F A;  2GFQ A;  2ZEH A;  2FVG A;  3PB6 X;  4R3L A;  1P0H A;  2F7V A;  1ZLH A;  2ZXV A;  1IOF A;  1YW4 A;  2G3A A;  1Z2L A;  5AG5 A;  3S6G A;  5JQ4 A;  2EBJ A;  3R1K A;  3N7Z A;  4MFL A;  2Z3L A;  4MBU A;  5AG7 A;  5FVJ A;  5DWN A;  3F5B A;  4DJL A;  1VGY A;  3G8W A;  1JQG A;  1QST A;  3DLJ A;  1RXT A;  4X3R A;  3TOA A;  3B8G A;  1SQH A;  2CNT A;  1M44 A;  5IB0 A;  2BUE A;  1Q7L A;  1I21 A;  5J8C A;  1DTD A;  4KOS A;  1S7N A;  1CPS A;  3QAH A;  4C7I A;  2FIW A;  3FBU A;  5JH9 A;  2O28 A;  3D7H A;  5CPA A;  5EC4 A;  3PB8 X;  3S6F A;  3K2K A;  3PGP A;  1MJA A;  1RO5 A;  2G3T A;  2VI7 A;  3IJ3 A;  2PE3 A;  4B5P A;  1Z8T A;  4A38 A;  1XOV A;  2OB0 A;  4FD6 A;  2C6G A;  4KOR A;  4QBJ A;  2YNC C;  5HVH A;  1ARL A;  1QSO A;  2Q43 A;  4MHD A;  4TNU A;  3V38 A;  3RNZ A;  3IEH A;  4B12 A;  4BMH A;  1JWQ A;  3W6X A;  2ZEM A;  1F2O A;  2PCU A;  4ZGY B;  4MFK A;  3LMS A;  3UY5 A;  4NJR A;  3PEI A;  2XEF A;  4CGM A;  4Z65 A;  1LAP A;  4ZY0 A;  1YR0 A;  3H4Q A;  4UWJ A;  4BBH A;  4HPS A;  4KVM E;  2CTC A;  3KL9 A;  4CAX A;  2REF A;  2Q4Y A;  3CXS A;  2PIY A;  3NA6 A;  4CRZ B;  2Z11 A;  3NH8 A;  4G1P A;  4MCR A;  2PDO A;  3RO0 A;  5J1Q A;  1YX0 A;  3B7I A;  4EME A;  1YLO A;  1H8L A;  4FD4 A;  1I12 A;  2AFM A;  3ZJ0 A;  4PSX A;  4MI4 A;  2AFX A;  4X5K A;  1XMT A;  3I3G A;  8CPA A;  2O53 A;  4CYO A;  4K3N A;  2VEZ A;  4R87 A;  1Y0R A;  4ZX8 A;  2JDC A;  4B10 A;  3LWU A;  1ZLI A;  5EMI A;  4MFQ A;  3BJ7 A;  4HNX B;  4JD6 A;  2DEA A;  4BIN A;  1PCA A;  3I1U A;  4OC4 A;  3RYO A;  4F0X A;  3IU1 A;  2DPS A;  3KZW A;  3V8I A;  3OWC A;  3PB9 X;  4YWY A;  4AG9 A;  1N71 A;  1BPM A;  4UIB A;  4JJX A;  3GUX A;  4M3S A;  5JGF A;  3DR8 A;  5CBM A;  2Q7B A;  3JVN A;  3H8E A;  4CS0 B;  2Q4V A;  4DUK A;  2BO9 A;  5CNP A;  3IWE A;  4U5Y A;  3CXQ A;  3TCV A;  4M6I A;  4MHN A;  4MJ8 A;  2PIZ A;  2VXK A;  5D29 A;  5H86 A;  3TFY A;  3R95 A;  4B14 A;  2CIJ A;  3FXT A;  2ZW6 A;  1HDU A;  3B35 A;  2PR1 A;  4C7H A;  4E0A A;  1TKH A;  4JZ0 A;  1ZG7 A;  4PV6 A;  2P0W A;  2PVW A;  1IID A;  1ARM A;  1UWY A;  1U6M A;  3CZX A;  4F0Y A;  3B3T A;  4H6U A;  1Z4E A;  2ZEF A;  2Q0Y A;  4R6T A;  4OC0 A;  4QUS A;  5IX3 A;  1EE3 P;  2OU2 A;  2WPW A;  4PXD A;  1M1D A;  2HV2 A;  2F8H A;  2VQY A;  3D7F A;  3NE7 A;  4JXR A;  2CTB A;  2BSW A;  2ZOG A;  2GE3 A;  3BI0 A;  3R9E A;  2Q51 A;  1IYK A;  2AFW A;  1ELL P;  3DDD A;  2CXA A;  3PBE A;  3SJF A;  4CGL A;  4UCN A;  4E8O A;  4HKF A;  1QSN A;  3FED A;  2V8G A;  1IIC A;  2CNS A;  2Z3P A;  3VH9 A;  3W91 A;  1IGB A;  5IB9 A;  3HUV A;  2WUU A;  2A4N A;  1S7L A;  2PJ9 A;  5F47 A;  2B3V A;  3C26 A;  4AG7 A;  2F5I A;  2RB7 A;  3B3S A;  4WJB A;  1VKC A;  2RC4 A;  1R43 A;  2GU2 A;  4R76 A;  4XPK A;  3SJX A;  1F57 A;  1F2P A;  2QYV A;  2B3U A;  3IU2 A;  3TC8 A;  2R8V A;  4UEZ A;  3PB7 X;  2ZW7 A;  2D4O A;  2DXQ A;  2ZPA A;  2GAN A;  3WR7 A;  2P6G A;  2PRB A;  3VAT A;  1BPN A;  2FXF A;  4UWI A;  3TTH A;  4RS2 A;  3PBB A;  1Q2D A;  4KUA A;  5G21 A;  5K8P A;  3KKW A;  3KQZ A;  4MHP A;  2B4D B;  2QVP A;  4KSF A;  4XPL A;  4UBR A;  3EO4 A;  4ZY2 A;  1YW6 A;  5K8O A;  3VAR A;  4NEX A;  4C68 A;  4KOY A;  2FL4 A;  1IYL A;  1XEB A;  1XIX A;  2PJ3 A;  3P2H A;  2OZG A;  3I9S A;  2HC9 A;  4LQ6 A;  2NSM A;  4Q36 A;  1LFW A;  2RFH A;  2CF4 A;  2Z3M A;  2J8M A;  3PP9 A;  2ZEG A;  3S6H A;  3TOB A;  1M4G A;  1YVK A;  3MRU A;  3TO6 A;  4YU9 A;  1B87 A;  2FE7 A;  4MFP A;  3FMC A;  2AE6 A;  5E96 A;  3LD2 A;  1Q2C A;  2NYQ A;  2V77 A;  1MJB A;  1P4N A;  2Z3N A;  2EK8 A;  3JRU A;  4OID A;  2YNC A;  4P4J A;  4PK3 A;  3BHX A;  1DE4 C;  3CXP A;  5IV0 A;  1S5K A;  4RI1 A;  4FAI A;  4OC1 A;  4F8Z A;  1CP6 A;  3K9T A;  2FCK A;  1MK4 A;  4IHM A;  4NGQ A;  1MJ9 A;  2HB6 A;  4Q38 A;  4OME A;  3B3W A;  4B5P B;  1QMU A;  2WZN A;  4OKO A;  1KUX A;  4DNC A;  4UF4 A;  1I1D A;  3FB3 A;  2EWB A;  1K4J A;  2OR4 A;  4MHZ A;  3EFA A;  3KHZ A;  3W6S A;  3FX6 A;  1R3N A;  5G20 A;  2PQ8 A;  4DYO A;  1YRE A;  2PJ5 A;  5A27 A;  4UCP A;  4KOT A;  1XF8 A;  2EVN A;  2PJ4 A;  4PXE A;  4YRH A;  4NGP A;  3RAM A;  2ANP A;  4YFJ A;  5K8M A;  1YK3 A;  2C6P A;  4KOW A;  3SXO A;  1CM0 A;  4ONW A;  5AGE A;  2PJ0 A;  3GLJ A;  4P44 A;  4B5O A;  3MGD A;  3KQX A;  4PXB A;  4R9M A;  2VBQ A;  3T8W A;  4PQA A;  4UA3 A;  3S9L A;  1LAM A;  1KUV A;  3D66 A;  2PSW A;  2ZEP A;  1J4J A;  4NF1 A;  2Q4Z A;  3FYN A;  3KI9 A;  2C27 A;  3FRM A;  1AUG A;  1PU9 A;  1S3Z A;  2JBK A;  2OZU A;  2R7H A;  2J8N A;  2WYR A;  5KTA A;  4QB9 A;  2DPT A;  4FD5 A;  1UFH A;  2QML A;  2WPX A;  5I0C A;  3L2N A;  4PPZ A;  1TF9 A;  5EBV A;  1KZF A;  4ONU A;  2YNE A;  1VIX A;  2IMO A;  2Z10 A;  2ZED A;  4Q7A A;  3KAS A;  3WT4 A;  3QB8 A;  4IUS A;  3IC1 A;  4C2Z A;  2Z3K A;  3FVL A;  4FBE A;  1S60 A;  1WK4 A;  3GB0 A;  4KLV A;  3IFE A;  4Y49 B;  2PJ2 A;  4HNY B;  3SI2 A;  4FWU A;  4MCS A;  1YLE A;  6CPA A;  3B3C A;  4A94 A;  1XE4 A;  3FF3 A;  3IGR A;  3D2M A;  2PJB A;  1BLL E;  2Q04 A;  4OAD A;  5LYF A;  1KWM A;  4M6G A;  1CP7 A;  3QAY A;  2FSR A;  4UEE A;  4CRY B;  4P4I A;  5J8F A;  2Z3O A;  4FUU A;  4QC6 A;  1Z9U A;  1X10 A;  2B58 A;  2J8R A;  2YND A;  3GIU A;  3JUW A;  3VWE A;  4E2A A;  1BO4 A;  2ATR A;  2NMT A;  2ZOF A;  3T9Y A;  2HQY A;  2BEI A;  2AFO A;  3PB4 X;  5LRJ A;  1OZP A;  4A30 A;  4BD9 A;  5D8N A;  2DF5 A;  4NGN A;  1NSL A;  4GXH A;  4IK2 A;  2XEJ A;  3IWG A;  2AFU A;  4L89 A;  1RTQ A;  2FT0 A;  1AYE A;  1XBU A;  2ZEL A;  5BWA B;  1M4L A;  1XJO A;  1LAN A;  2AFZ A;  2PJA A;  2POK A;  3CPX A;  5KTD A;  2KCW A;  4M6H A;  4C2Y A;  2JDD A;  4KS9 A;  1HEE A;  1QQ9 A;  5H84 A;  4NGM A;  4MCP A;  4KZT A;  4RUH A;  2GLJ A;  1WWZ A;  2ZW5 A;  4X2T A;  3FH4 A;  3B3V A;  5GCN A;  4OLL A;  1A2Z A;  4OC3 A;  5F09 A;  3DNS A;  1Y7R A;  1VHE A;  2PJC A;  4KOU A;  4UCM A;  5LYI A;  4YGO A;  4A95 A;  3BXM A;  3GKR A;  4ZX9 A;  4NXY A;  3SJG A;  2WSA A;  1Y9K A;  4MRI A;  5F48 A;  3GY9 A;  4MFJ A;  2ZEO A;  2B5G A;  3HLP A;  5AG6 A;  2IJZ A;  4MMO A;  3K9U A;  3KR4 A;  4MFZ A;  3SXN A;  1FY7 A;  4ZY1 A;  3PRT A;  4P6Y A;  2BOA A;  2EK9 A;  4X8I A;  1ZG9 A;  4WWV A;  1ZG8 A;  2O4H A;  3TO7 A;  2Q7S A;  2IL4 A;  1YQE A;  4TWE A;  2V8V A;  4K30 A;  1Z8L A;  2GLF A;  2VL1 A;  2ZW4 A;  3DR6 A;  3QNV A;  1TKJ A;  3VWD A;  4O23 A;  4A32 A;  3EC4 A;  4JYW A;  4F6A A;  1Z8W A;  3SI1 A;  3ZZI A;  3ISZ A;  4I49 A;  4CYN A;  1CX8 A;  2EUI A;  4UIA A;  4JWP A;  4H2K A;  4NCZ A;  2ABZ A;  4ZBG A;  3D3S A;  5HH1 A;  3ISX A;  4GM5 A;  4CAW A;  2CNM A;  3CT9 A;  3SJE A;  4CYP A;  3WAB A;  4ZI6 A;  5ISV A;  4OC5 A;  3TO9 A;  3TE4 A;  3FIX A;  3IWW A;  4P4D A;  2BL1 A;  2QEC A;  3IO1 A;  3WC7 A;  3IIB A;  1Z8X A;  3PZJ A;  4CAE A;  5K8N A;  3S9M A;  1QSM A;  1TXR A;  4LUA A;  1YME A;  3D4U A;  2ODF A;  3B2Y A;  4R8F A;  4AXV A;  4XPD B;  4JXQ A;  4RN7 A;  1LCP A; 
#chains in the Genus database with same CATH homology
 3GYA A;  4GS4 A;  5AG4 A;  4II9 A;  2ARH A;  2Z0Z A;  4QVT A;  1L0C A;  3H5Z A;  4ORF A;  1R57 A;  1B6B A;  1YVO A;  3F8K A;  3E0K A;  5G1Z A;  1M4D A;  3DSB A;  2I00 A;  3EY5 A;  4XPD C;  2R98 A;  2K5T A;  4MY0 A;  5A28 A;  1V0C A;  2PC1 A;  4H6Z A;  3TT2 A;  4LX9 A;  2G0B A;  2I79 A;  4JLY A;  4H89 A;  5HMN A;  1S7K A;  2REE A;  4UFV A;  4R57 A;  4KOV A;  3D2P A;  4AB7 A;  3EXN A;  2JEV A;  4L8A A;  4UFX A;  4CGP A;  3G3S A;  1KUY A;  2FS5 A;  2OZH A;  2CY2 A;  1CJW A;  2PR8 A;  4KVX A;  3R9G A;  4A2Z A;  4CAV A;  4U9Y A;  2VZY A;  2AJ6 A;  3T90 A;  4XNH B;  4KVO E;  4CGO A;  4R3K A;  2VZZ A;  4OAE A;  4CYQ A;  1NE9 A;  3BLN A;  4EVY A;  1VHS A;  2JLM A;  3P2F A;  1IB1 E;  5G22 A;  2D4P A;  2GIV A;  4Y49 C;  1GHE A;  2HUZ A;  4XNH C;  5F49 A;  4CAF A;  3A9L A;  4AVA A;  1BOB A;  4U9Z A;  1YGH A;  2H5M A;  4M85 A;  3JTK A;  4A33 A;  3LOD A;  4J3G A;  3FNC A;  1Q2Y A;  3D8P A;  1Y9W A;  2YGW A;  4PK2 A;  4AVC A;  4KUB A;  4C2X A;  5C82 A;  1PUA A;  4NSQ A;  5JPH A;  1ON0 A;  2Q44 A;  4UFW A;  2QIR A;  3SHP A;  2X7B A;  2FIA A;  1TIQ A;  1Z4R A;  2B4B A;  3R96 A;  4CGN A;  4FD7 A;  3BJ8 A;  4MY3 A;  2Y0M A;  5F46 A;  5KTC A;  5C88 A;  4KOX A;  2B5G B;  5DWM A;  3S6K A;  4B13 A;  1ZO0 A;  4HNW B;  4IF5 A;  1NMT A;  4AVB A;  4PSW A;  2OH1 A;  2P6E A;  1M4I A;  4KSA A;  1QSR A;  2B4D A;  3F0A A;  3R9F A;  1LRZ A;  2R1I A;  4KLW A;  2P6F A;  4A31 A;  1S7F A;  4R3L A;  1P0H A;  2ZXV A;  2G3A A;  5AG5 A;  3S6G A;  5JQ4 A;  3R1K A;  4MFL A;  3N7Z A;  5AG7 A;  2Z3L A;  4MBU A;  5FVJ A;  5DWN A;  3F5B A;  3G8W A;  1QST A;  1RXT A;  3TOA A;  3B8G A;  1SQH A;  2CNT A;  1M44 A;  5IB0 A;  2BUE A;  1I21 A;  5J8C A;  4KOS A;  1S7N A;  3QAH A;  4C7I A;  2FIW A;  3FBU A;  2O28 A;  5EC4 A;  3S6F A;  3PGP A;  1MJA A;  1RO5 A;  2G3T A;  2VI7 A;  4B5P A;  4KOR A;  2OB0 A;  4FD6 A;  4QBJ A;  2YNC C;  1QSO A;  4MHD A;  4B12 A;  4BMH A;  3W6X A;  4ZGY B;  4MFK A;  3UY5 A;  4CGM A;  1YR0 A;  3H4Q A;  4UWJ A;  4BBH A;  4KVM E;  4CAX A;  2REF A;  2Q4Y A;  3CXS A;  4CRZ B;  2Z11 A;  2PDO A;  1YX0 A;  4FD4 A;  1I12 A;  3ZJ0 A;  4PSX A;  4MI4 A;  4X5K A;  1XMT A;  3I3G A;  4CYO A;  2VEZ A;  4R87 A;  2JDC A;  4B10 A;  4MFQ A;  3BJ7 A;  4HNX B;  4JD6 A;  3RYO A;  4F0X A;  3IU1 A;  2DPS A;  3V8I A;  3OWC A;  4AG9 A;  1N71 A;  4JJX A;  4M3S A;  3DR8 A;  2Q7B A;  3JVN A;  4CS0 B;  2Q4V A;  5CNP A;  3IWE A;  4U5Y A;  3CXQ A;  3TCV A;  4MJ8 A;  5H86 A;  3TFY A;  2VXK A;  3R95 A;  4B14 A;  3FXT A;  2ZW6 A;  4C7H A;  2PR1 A;  4E0A A;  4PV6 A;  2P0W A;  1IID A;  1U6M A;  4F0Y A;  4H6U A;  1Z4E A;  2Q0Y A;  4QUS A;  5IX3 A;  2OU2 A;  2WPW A;  1M1D A;  2HV2 A;  2VQY A;  3NE7 A;  4JXR A;  2BSW A;  2GE3 A;  3R9E A;  1IYK A;  3DDD A;  2CXA A;  4E8O A;  4CGL A;  4UCN A;  4HKF A;  1QSN A;  1IIC A;  2CNS A;  2Z3P A;  3W91 A;  2WUU A;  2A4N A;  1S7L A;  5F47 A;  2B3V A;  3C26 A;  4AG7 A;  2F5I A;  1VKC A;  2RC4 A;  4XPK A;  2B3U A;  3IU2 A;  2R8V A;  2ZW7 A;  2D4O A;  2DXQ A;  2ZPA A;  2GAN A;  3WR7 A;  2P6G A;  2PRB A;  2FXF A;  4UWI A;  3TTH A;  4RS2 A;  1Q2D A;  4KUA A;  5G21 A;  3KKW A;  2B4D B;  4KSF A;  4XPL A;  4UBR A;  3EO4 A;  4NEX A;  4C68 A;  4KOY A;  2FL4 A;  1IYL A;  1XEB A;  1XIX A;  3P2H A;  2OZG A;  3I9S A;  4Q36 A;  2Z3M A;  2J8M A;  3PP9 A;  3S6H A;  3TOB A;  1M4G A;  1YVK A;  3TO6 A;  1B87 A;  2FE7 A;  4MFP A;  2AE6 A;  5E96 A;  3LD2 A;  1Q2C A;  1MJB A;  1P4N A;  2Z3N A;  2YNC A;  4PK3 A;  3CXP A;  5IV0 A;  1S5K A;  4RI1 A;  2FCK A;  1MK4 A;  1MJ9 A;  4Q38 A;  4B5P B;  1KUX A;  4DNC A;  1I1D A;  3FB3 A;  1K4J A;  3EFA A;  3W6S A;  5G20 A;  2PQ8 A;  1YRE A;  5A27 A;  4UCP A;  4KOT A;  1XF8 A;  2EVN A;  4YRH A;  4YFJ A;  1YK3 A;  4KOW A;  3SXO A;  1CM0 A;  5AGE A;  4B5O A;  3MGD A;  4R9M A;  2VBQ A;  4UA3 A;  1KUV A;  2PSW A;  1J4J A;  4NF1 A;  3FYN A;  2C27 A;  3FRM A;  1PU9 A;  1S3Z A;  2OZU A;  2R7H A;  2J8N A;  5KTA A;  4QB9 A;  2DPT A;  4FD5 A;  1UFH A;  2QML A;  2WPX A;  5I0C A;  5EBV A;  1KZF A;  4ONU A;  2YNE A;  2Z10 A;  3QB8 A;  4IUS A;  4C2Z A;  2Z3K A;  1S60 A;  1WK4 A;  4KLV A;  4Y49 B;  4HNY B;  1YLE A;  1XE4 A;  3IGR A;  3D2M A;  4OAD A;  2Q04 A;  2FSR A;  4CRY B;  5J8F A;  2Z3O A;  4QC6 A;  1Z9U A;  2B58 A;  2J8R A;  2YND A;  3JUW A;  3VWE A;  4E2A A;  1BO4 A;  2ATR A;  2NMT A;  3T9Y A;  2HQY A;  2BEI A;  4A30 A;  1OZP A;  1NSL A;  3IWG A;  4L89 A;  2FT0 A;  5BWA B;  5KTD A;  2KCW A;  4C2Y A;  2JDD A;  4KS9 A;  5H84 A;  4KZT A;  1WWZ A;  2ZW5 A;  5GCN A;  4OLL A;  3DNS A;  1Y7R A;  4KOU A;  4UCM A;  4YGO A;  4A95 A;  3GKR A;  4NXY A;  2WSA A;  1Y9K A;  5F48 A;  3GY9 A;  4MFJ A;  2B5G A;  5AG6 A;  3K9U A;  4MFZ A;  3SXN A;  1FY7 A;  3TO7 A;  2IL4 A;  4K30 A;  2ZW4 A;  3DR6 A;  3VWD A;  4A32 A;  3EC4 A;  4F6A A;  3ZZI A;  4I49 A;  4CYN A;  2EUI A;  4ZBG A;  4JWP A;  4NCZ A;  3D3S A;  5HH1 A;  4CAW A;  2CNM A;  4CYP A;  5ISV A;  3TO9 A;  3TE4 A;  3FIX A;  2BL1 A;  2QEC A;  3PZJ A;  4CAE A;  1QSM A;  4LUA A;  4B11 A;  4XPD B;  4JXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...