1QSMA

Histone acetyltransferase hpa2 from saccharomyces cerevisiae in complex with acetyl coenzyme a
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
b'DNITVRFVTENDKEGWQRLWKSYQDFYEVSFPDDLDDFNFGRFLDPNIKMWAAVAVESSSEKIIGMINFFNHMTTWDFKDKIYINDLYVDENSRVKGAGGKLIQFVYDEADKLGTPSVYWCTDESNHRAQLLYVKVGYKAPKILYKRKGY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HPA2 HISTONE ACETYLTRANSFERASE
publication title Crystal structure of the histone acetyltransferase Hpa2: A tetrameric member of the Gcn5-related N-acetyltransferase superfamily.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 43
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 1999-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1qsmA00
1Y9WA 5KTDA 3F0AA 1RO5A 3P2FA 1S3ZA 1Y9KA 2H5MA 4KVOE 5E96A 3VWDA 3FNCA 1Q2YA 2Y0MA 2JDCA 2PRBA 1MJAA 2R7HA 2Z0ZA 4GS4A 4AVBA 3TE4A 1BOBA 1Q2DA 5JQ4A 2CNTA 3D3SA 4U9ZA 2G3AA 3FYNA 3B8GA 2FS5A 2Q4VA 3KKWA 4XNHB 1IYLA 4H6ZA 1QSNA 2CNMA 3UY5A 1S60A 4XNHC 5F47A 2FXFA 1QSRA 5C82A 2Q0YA 2CY2A 4PK2A 3DNSA 3S6HA 1FY7A 4PSWA 2NMTA 3H4QA 1U6MA 2P0WA 3TO7A 4H6UA 4NXYA 1M44A 4KUAA 2FT0A 1N71A 4II9A 4K30A 1M4DA 2PDOA 4LUAA 4IUSA 2FIWA 5J8FA 4YFJA 4UBRA 1YGHA 4XPLA 4NEXA 3DR8A 2REFA 4UWJA 3LODA 5F46A 5F49A 4FD5A 2GE3A 4AG9A 2FCKA 4HNWB 2Z10A 3W6XA 5EC4A 5J8CA 1CJWA 1M4GA 2B5GA 3TOBA 3BJ8A 2VZYA 4RI1A 4PK3A 2HQYA 3MGDA 4QC6A 3BLNA 4KVXA 5H84A 4AVCA 5DWNA 2FSRA 3ZZIA 1Z4RA 4MI4A 3F8KA 4JD6A 2JLMA 4XPDB 2VZZA 2P6FA 3R96A 4B5PB 2FL4A 4KOVA 1BO4A 5IV0A 1YREA 4R57A 1RXTA 1QSTA 2CNSA 4XPDC 3EO4A 1NSLA 4R3LA 4M3SA 3D2PA 3GKRA 2EVNA 3TCVA 2VXKA 3S6KA 4J3GA 3FIXA 3JVNA 5I0CA 2BUEA 4F6AA 2J8NA 1NE9A 4HNYB 4JXRA 4MBUA 3NE7A 2OZHA 4NSQA 4JLYA 4CAXA 4FD6A 2PR1A 4PV6A 2G3TA 4R9MA 4OAEA 3T90A 1IB1E 3TFYA 4KUBA 2BSWA 1YVOA 5HH1A 5DWMA 4R87A 3PZJA 1L0CA 3EY5A 4QBJA 3FXTA 4FD4A 1VHSA 5H86A 3IWGA 4I49A 2QECA 1Y7RA 2B4DA 1Z9UA 3R9FA 4AG7A 2OB0A 4B5OA 4F0YA 1PU9A 3F5BA 2VEZA 2J8RA 4MHDA 1S7LA 3LD2A 5JPHA 3S6GA 2ARHA 2VI7A 5GCNA 3PP9A 4M85A 3CXQA 4L89A 2BL1A 1QSOA 4KORA 4ONUA 2ZW7A 4KOYA 1KUXA 2AJ6A 2QIRA 1XEBA 3C26A 3FBUA 2FE7A 1I12A 3IGRA 3SHPA 1TIQA 4KVME 1S7NA 1SQHA 4MY0A 3TOAA 5IX3A 1IICA 1XMTA 3R95A 4E0AA 2D4PA 2PQ8A 1CM0A 2ZW6A 2HV2A 4HKFA 1ON0A 4R3KA 5KTAA 2OH1A 1YVKA 1UFHA 3OWCA 4CS0B 1KZFA 3K9UA 3SXNA 3VWEA 2B3UA 5HMNA 2J8MA 5ISVA 3FB3A 4H89A 1IIDA 3EFAA 3TO9A 1B87A 2O28A 2Z11A 4HNXB 3TT2A 3P2HA 1XIXA 2B58A 3I3GA 3CXPA 1R57A 4NF1A 4KLWA 4CAWA 3V8IA 2WPWA 3R1KA 4JXQA 1PUAA 3D2MA 2R1IA 3D8PA 4KLVA 3FRMA 3W6SA 2D4OA 3SXOA 2IL4A 2EUIA 2KCWA 4U9YA 3BJ7A 2F5IA 3G3SA 2PSWA 2GIVA 1MJBA 5CNPA 2K5TA 1XF8A 4MY3A 4QB9A 4ZBGA 5F48A 1YR0A 1IYKA 4RS2A 2B5GB 4CRZB 1YLEA 2JEVA 2Q7BA 4JJXA 2A4NA 3S6FA 2HUZA 3QAHA 1M4IA 3QB8A 5FVJA 4Y49B 2R98A 2OZUA 4IF5A 2R8VA 1S7KA 4YGOA 4Y49C 2OZGA 2G0BA 3TO6A 2VQYA 2AE6A 4X5KA 4U5YA 3WR7A 1QSMA 1KUVA 4CRYB 2ZW4A 2B3VA 3JUWA 4E8OA 4FD7A 1OZPA 4BMHA 3G8WA 3R9GA 1M1DA 4QVTA 2X7BA 4UWIA 1P4NA 4E2AA 3PGPA 3EXNA 2ZXVA 2FIAA 1B6BA 2Q4YA 3ZJ0A 2B4BA 3DDDA 2BEIA 4B5PA 4L8AA 2Q44A 3DSBA 4NCZA 3RYOA 4QUSA 2REEA 3TTHA 5EBVA 3CXSA 1P0HA 4UA3A 1GHEA 1YK3A 4LX9A 1KUYA 2P6GA 1YX0A 4OLLA 1WK4A 2PR8A 3I9SA 2JDDA 1LRZA 2RC4A 2WPXA 4AVAA 4JWPA 1S5KA 2OU2A 4MJ8A 4XPKA 2I79A 1S7FA 3R9EA 2DXQA 2I00A 3GY9A 4KOSA 2Q04A 4KOXA 1VKCA 4CAVA 3E0KA 1J4JA 2B4DB 4ORFA 1Z4EA 1K4JA 2ZPAA 3EC4A 2ATRA 2VBQA 4OADA 2QMLA 1MK4A 4KOTA 4KOWA 1V0CA 3GYAA 4PSXA 5C88A 2GANA 3T9YA 2P6EA 4YRHA 1I21A 4KOUA 5KTCA 3N7ZA 3W91A 4KZTA 1I1DA 3DR6A 2C27A 1Q2CA 2ZW5A 1NMTA 4AB7A 5IB0A 4DNCA 1XE4A 4EVYA 2PC1A 1MJ9A 1WWZA
chains in the Genus database with same CATH superfamily
4W9YA 3IEHA 1Y9WA 3FJUA 4MHZA 3I1UA 5KTDA 3F0AA 1RO5A 3P2FA 2DPTA 1S3ZA 2OR4A 1Y9KA 2XEIA 2H5MA 4KVOE 5E96A 4ZYQA 3CZXA 3RBUA 3VWDA 3FNCA 1Q2YA 2Y0MA 2JDCA 4O23A 2PRBA 3PFOA 3FEEA 1MJAA 2R7HA 2Z0ZA 3PEIA 4GS4A 1LFWA 1BOBA 1Q2DA 3CDXA 4LQ6A 2CIJA 4CYNA 3TE4A 5JQ4A 4ZY2A 2CNTA 3KL9A 4ZX9A 1ZG7A 1TXRA 3D3SA 5K8MA 4NGRA 4U9ZA 2G3AA 3FYNA 3B8GA 2FS5A 2Q4VA 3KKWA 4XNHB 5F09A 4MHPA 1F2PA 2BCOA 3PRTA 3PB6X 1IYLA 4H6ZA 1QSNA 3VARA 2CNMA 3UY5A 1S60A 3IWEA 4XNHC 5F47A 3KASA 2FXFA 2GLJA 2ZEMA 3V7ZA 2EWBA 1QSRA 5C82A 2JBKA 4PXBA 2Q0YA 1DE4C 2PCUA 4MFPA 2CY2A 4PK2A 3CPXA 3DNSA 3S6HA 1FY7A 3NH5A 3DLJA 4PSWA 1YQEA 3TC8A 1VGYA 1TKFA 4OKOA 7CPAA 2NMTA 4B10A 2Q43A 3H4QA 2PIZA 4WJBA 1U6MA 5A28A 4UCNA 3JTKA 4C2XA 4CYQA 2P0WA 3GB0A 3TO7A 4H6UA 3LMSA 4Q7AA 2Q4ZA 4NXYA 4OC1A 1Z8XA 1M44A 4KUAA 2FT0A 2V8DA 2XEFA 3WC6A 3D66A 4ZY0A 3KQZA 2QVPA 1N71A 4F9UA 4II9A 4K30A 1M4DA 2PDOA 4EMEA 3PBEA 4LUAA 4NGTA 1XMBA 4IUSA 2FIWA 3SI1A 5J8FA 3PFEA 4YFJA 5DS0A 4UBRA 5IB9A 1YGHA 3KHZA 3B35A 4XPLA 4C68A 1ZLIA 2AFZA 4NEXA 2PVVA 3DR8A 3IC1A 2REFA 2PVWA 4UWJA 2GFQA 1AMPA 4IAVA 5JGFA 3LODA 4DJLA 5F46A 5F49A 4UFVA 1M4LA 4FD5A 4CGNA 2GE3A 4AG9A 3WC5A 2FCKA 2PJ7A 2Z10A 4HNWB 4R7MA 3W6XA 5EC4A 3H8GA 5J8CA 4P4DA 4F9VA 1CJWA 1M4GA 2NSMA 4AXVA 2B5GA 3TOBA 3BJ8A 4P10A 2BO9A 2HB6A 2ZEHA 2VZYA 4RI1A 4PK3A 2G9DA 4A2ZA 4C7HA 2HQYA 3MGDA 1HDUA 2ZOGA 5ELYA 3K9TA 4MRIA 4QC6A 3BLNA 3B3VA 4KVXA 1YMEA 5H84A 4UIBA 1JQGA 3H8FA 5LYFA 4AVCA 4B11A 4IK2A 5DWNA 2FSRA 2Z3MA 3ZZIA 4OP4A 2XEJA 1Z4RA 4MI4A 3F8KA 4FBEA 3QNVA 4JD6A 2JLMA 4CGMA 2PJ9A 4XPDB 2Z3LA 2VZZA 2P6FA 3R96A 4B5PB 2FL4A 4KOVA 1BO4A 4UFXA 1YREA 4X2TA 1Y7EA 4R57A 5IV0A 5LYLA 1RXTA 2Z3OA 1IOFA 1QSTA 2CNSA 4XPDC 1NSAA 3EO4A 4MFQA 1NSLA 4R3LA 4M3SA 3D2PA 2C6PA 3GKRA 1TF8A 4A32A 5K8NA 2EVNA 3KR4A 3KQXA 3TCVA 2VXKA 3S6KA 4UEFA 4J3GA 3FIXA 2AFMA 3JVNA 4FWUA 5I0CA 4BBHA 3KR5A 5CPAA 3B3SA 2Z3KA 4KSAA 2OOTA 2BUEA 3BXMA 4F6AA 2J8NA 1Y0RA 1NE9A 3V38A 4PXDA 3ISXA 3NA6A 2O53A 4HNYB 4JXRA 4YWYA 2NYQA 3IU2A 4MBUA 3NE7A 1TKJA 1CBXA 2OZHA 4JZ0A 2EBJA 1BAVA 3MRUA 4NSQA 4JLYA 4CAXA 3NH8A 2PR1A 1F2OA 4FD6A 2VL1A 4MFLA 5G22A 4PV6A 2J9AA 2YNEA 2G3TA 3D7DA 1JWQA 4NGSA 1CPSA 4Q36A 2C1CA 2I3CA 1R3NA 3DGVA 4OAEA 4R9MA 4A33A 1HDQA 2IQ6A 3T90A 4OC2A 3GIUA 1IB1E 4UCPA 3TFYA 5AGEA 4NJRA 2PJ1A 4KUBA 2BSWA 4P4IA 4B6ZA 1YVOA 1X12A 4P4FA 5HH1A 4NGQA 2FVGA 2ZOFA 1CG2A 5DWMA 4K3NA 4R87A 2GLFA 2PJ5A 1BPMA 2C6CA 3PZJA 2YNDA 4TNUA 1L0CA 3EY5A 1XBUA 2WSAA 1CP7A 4CPAA 4OC4A 1Z8LA 5BWAB 5G20A 5JH9A 4QBJA 1DTDA 3FXTA 4FD4A 4IHMA 1VHSA 5H86A 4NGMA 2ZEEA 2GREA 3IWGA 4I49A 2QECA 1Y7RA 2B4DA 5G21A 1Z9UA 5EMIA 4YU9A 3R9FA 4AG7A 3BHXA 3CPAA 1R43A 2OB0A 4P44A 1XRYA 4B5OA 2GU2A 4MCPA 2PJ8A 4BD9A 4F0YA 1PU9A 3F5BA 1Y0YA 4M6GA 2AFSA 2VEZA 2J8RA 4MHDA 1S7LA 3KHXA 3LD2A 5JPHA 1TF9A 5HVHA 1AYEA 1RTQA 3FECA 2ARHA 5HVFA 2VI7A 5GCNA 3S6GA 3PP9A 1Q7LA 3WABA 3S9NA 2PJ4A 3CXQA 4L89A 4M85A 2QJ8A 2BL1A 4P6YA 2YNCA 1QSOA 4KORA 2XEGA 4ONUA 2ZW7A 4ZGYB 3H5ZA 4KOYA 4X8IA 1KUXA 1BLLE 4R8FA 2AJ6A 2QIRA 4FAIA 2PJCA 2WZNA 1XEBA 3C26A 1Z8WA 2ABZA 5LYIA 3FBUA 2FE7A 2JBJA 1I12A 2EO8A 3IGRA 3SHPA 4X3RA 1TIQA 2AFWA 4KVME 4CGOA 4ZI6A 1IOIA 1S7NA 3FX6A 1ZG9A 1SQHA 3KGQA 4MY0A 3TOAA 4AVBA 3D7GA 1IICA 4B12A 4DUKA 6CPAA 4C2YA 4UEEA 1XMTA 1ZLHA 5LRJA 5AG6A 5LRKA 2IJZA 1ARLA 3NE8A 2PJBA 1Z5RA 2PJ0A 3R95A 4OMEA 4E0AA 3B3WA 4EWTA 5JM6A 2D4PA 4OC3A 5D29A 2PQ8A 1CM0A 2O4HA 2ZW6A 3BI1A 3SI0A 2HV2A 5I4MA 4HKFA 4F0XA 1ON0A 3RZAA 2V8VA 4R3KA 2OH1A 1YVKA 4R6TA 1GYTA 5LYDA 5KTAA 1LOKA 1UFHA 1ZG8A 3OWCA 4A38A 4PQAA 4ONWA 5AG7A 2DEAA 3B3TA 4CS0B 3HLPA 1KZFA 3K9UA 3SXNA 1F57A 3D7FA 2HC9A 3VWEA 2B3UA 5HMNA 2J8MA 3RO0A 5ISVA 3HUVA 4B14A 3NFZA 1LAMA 3FB3A 2ZEDA 3FEDA 4H89A 1IIDA 3EFAA 3TO9A 1B87A 1PYTB 2ODFA 2DPSA 1YSJA 3RAMA 2O28A 2Z11A 4HNXB 2ZEFA 3S9MA 3TT2A 3P2HA 1XIXA 2B58A 3I3GA 2RB7A 4P4EA 5CBMA 3CXPA 4MCRA 1BPNA 1R57A 4RN7A 4LQGA 4NF1A 3IO1A 4KLWA 4ZX8A 4CAFA 4CAWA 3V8IA 2ZEOA 2WPWA 1LANA 1XFOA 2JEWA 3R1KA 4JXQA 1PUAA 1FT7A 2POKA 4OIWA 3D2MA 2R1IA 3D8PA 4KLVA 3FRMA 5AG4A 3W6SA 2D4OA 4DYOA 3SXOA 1X10A 3D68A 2V77A 4PXCA 2IL4A 2EUIA 2KCWA 2PRQA 3B2YA 4R76A 2ZENA 3PB9X 3CT9A 4GM5A 4U9YA 3BJ7A 4NGPA 2F5IA 4UEZA 2DF5A 2Q51A 3G3SA 2AFXA 2PSWA 2GIVA 1MJBA 4PXEA 5CNPA 2K5TA 1XF8A 1H8LA 1YLOA 4MY3A 4NGNA 4PPZA 4QB9A 2F7VA 4ZBGA 5F48A 1YR0A 3SJEA 3MN8A 1IYKA 4GXHA 2F8HA 4RS2A 2B5GB 1YW4A 4MCQA 2V8GA 4CRZB 3SJGA 2CXAA 3IJ3A 1YLEA 2CTCA 2JEVA 1Z8TA 4JJXA 2Q7BA 2A4NA 5AG5A 2HUZA 3S6FA 5HXDA 3QAHA 1M4IA 5LRGA 3QB8A 1IGBA 1PCAA 5FVJA 2V8HA 4Y49B 2R98A 4EFDA 2OZUA 4IF5A 1IU8A 1LAPA 1YW6A 2EK8A 2R8VA 4KSIA 3T8WA 1S7KA 2Q7SA 5THWA 4YGOA 4Y49C 5K8OA 1VHOA 2Z3PA 4MHNA 2AFUA 2OZGA 3VATA 2G0BA 3TO6A 2VQYA 4RUHA 2AE6A 4F8ZA 4X5KA 4A37A 4U5YA 1OBRA 3GLJA 3WR7A 4C2ZA 1QSMA 1KUVA 4CRYB 2ZW4A 2B3VA 4G1PA 4MMOA 3JUWA 2Z3NA 4P45A 4E8OA 4FD7A 3PBBA 1OZPA 4BMHA 3G8WA 3R9GA 1QMUA 2QYVA 3KZWA 3SJXA 4BINA 1M1DA 3L2NA 4QVTA 3QAYA 4ZY1A 2X7BA 4UWIA 1P4NA 3NH4A 4E2AA 3FF3A 3PGPA 3FH4A 3EXNA 3WC7A 3GUXA 1XJOA 2ZXVA 4A31A 2FIAA 1B6BA 2Q4YA 3ZJ0A 5IX3A 2B4BA 3DDDA 1CPXA 2BEIA 4B5PA 4C7IA 4CGLA 4L8AA 2Q44A 2PJAA 3B7IA 1ELMP 1HEEA 1A2ZA 4KSFA 3DSBA 4NCZA 3RNZA 3RYOA 3FVLA 4QUSA 4A30A 3A9LA 2REEA 3TTHA 4H2KA 4OC0A 5EBVA 3CXSA 4Q38A 3LACA 1CX8A 1P0HA 1FNOA 3BI0A 1GHEA 3PB7X 4UA3A 3IU1A 3TX8A 1YK3A 4OC5A 3IFEA 1KWMA 4LX9A 1KUYA 4TWEA 8CPAA 2P6GA 1YX0A 4OLLA 4MXUA 1VIXA 4P4JA 3VH9A 1WK4A 2PR8A 3I9SA 2JDDA 4M6IA 1LRZA 2RC4A 1QQ9A 2WPXA 4A39A 4AVAA 2PJ2A 4JWPA 1S5KA 3KI9A 2PJ6A 1LCPA 2BOAA 2OU2A 2ZEPA 1XOVA 2ANPA 4MJ8A 2I79A 4XPKA 4KS9A 2RFHA 1S7FA 4MFZA 3R9EA 5G1ZA 4CYOA 2DXQA 4UF4A 2CTBA 2I00A 3GY9A 5K8PA 4KOSA 2Q04A 4KOXA 3IIBA 1VKCA 4CAVA 4Z65A 4MCSA 3E0KA 1J4JA 2B4DB 5J1QA 4WWVA 2IMOA 4MFKA 4ORFA 3SJFA 4JYWA 1Z4EA 2YGWA 1K4JA 1UWYA 3B3CA 3FMCA 2ZPAA 1VHEA 2PIYA 4OIDA 1TKHA 4P4BA 3EC4A 2ATRA 1EE3P 4UFWA 2EK9A 2VBQA 4OADA 2QMLA 3D4UA 4NFRA 5HVGA 1MK4A 4KOTA 4KOWA 1V0CA 2WYRA 3PB4X 4CYPA 3IWWA 3GYAA 4PSXA 4UCMA 5C88A 3WT4A 2GANA 1AUGA 3T9YA 3JRUA 2P6EA 2WUUA 4YRHA 1I21A 4A95A 2PE3A 3D7HA 4MHYA 2PJ3A 1ELLP 2ZEGA 3LWUA 2YNCC 4KOUA 3K2KA 5KTCA 4M6HA 3S9LA 2ZELA 3N7ZA 4FUUA 4CAEA 1CP6A 5D8NA 3H8EA 3W91A 4KZTA 1I1DA 3DR6A 2C27A 4B13A 1IY7A 1Q2CA 2ZW5A 3ISZA 4MFJA 3N5FA 1NMTA 1Z2LA 4AB7A 5IB0A 3D67A 4DNCA 1XE4A 3PB8X 4EVYA 4NJQA 2PC1A 3SI2A 1ZO0A 1MJ9A 1WWZA 2CF4A 1ARMA 2AFOA 2C6GA 4UIAA 5A27A 4CGPA 4A94A 4HPSA
chains in the Genus database with same CATH topology
1Y9WA 5KTDA 3F0AA 1RO5A 3P2FA 2DPTA 1S3ZA 1Y9KA 2H5MA 4KVOE 5E96A 3VWDA 3FNCA 1Q2YA 2Y0MA 2JDCA 2PRBA 1MJAA 2R7HA 2Z0ZA 4GS4A 4AVBA 3TE4A 1BOBA 1Q2DA 4CYNA 5JQ4A 2CNTA 3D3SA 4U9ZA 2G3AA 3FYNA 3B8GA 2FS5A 2Q4VA 3KKWA 4XNHB 1IYLA 4H6ZA 1QSNA 2CNMA 3UY5A 1S60A 3IWEA 4XNHC 5F47A 2FXFA 1QSRA 5C82A 2Q0YA 4MFPA 2CY2A 4PK2A 3DNSA 3S6HA 1FY7A 4PSWA 2NMTA 4B10A 3H4QA 1U6MA 5A28A 4UCNA 3JTKA 4C2XA 4CYQA 2P0WA 3TO7A 4H6UA 4NXYA 1M44A 4KUAA 2FT0A 1N71A 4II9A 4K30A 1M4DA 2PDOA 4LUAA 4IUSA 2FIWA 5J8FA 4YFJA 4UBRA 1YGHA 4XPLA 4C68A 4NEXA 3DR8A 2REFA 4UWJA 3LODA 5F46A 5F49A 4UFVA 4CGNA 4FD5A 2GE3A 4AG9A 2FCKA 4HNWB 2Z10A 3W6XA 5EC4A 5J8CA 1CJWA 1M4GA 2B5GA 3TOBA 3BJ8A 2VZYA 4RI1A 4PK3A 4A2ZA 4C7HA 2HQYA 3MGDA 4QC6A 3BLNA 4KVXA 5H84A 4AVCA 4B11A 5DWNA 2FSRA 2Z3MA 3ZZIA 1Z4RA 4MI4A 3F8KA 4CGMA 4JD6A 2JLMA 4XPDB 2Z3LA 2VZZA 2P6FA 3R96A 4B5PB 2FL4A 4KOVA 1BO4A 4UFXA 1YREA 5IV0A 4R57A 1RXTA 2Z3OA 1QSTA 2CNSA 4XPDC 3EO4A 4MFQA 1NSLA 4R3LA 4M3SA 3D2PA 3GKRA 4A32A 2EVNA 3TCVA 2VXKA 3S6KA 4J3GA 3FIXA 3JVNA 5I0CA 4BBHA 2Z3KA 4KSAA 2BUEA 4F6AA 2J8NA 1NE9A 4HNYB 4JXRA 3IU2A 4MBUA 3NE7A 2OZHA 4NSQA 4JLYA 4CAXA 4FD6A 2PR1A 4MFLA 5G22A 4PV6A 2YNEA 2G3TA 4Q36A 4R9MA 4OAEA 4A33A 3T90A 1IB1E 4UCPA 3TFYA 5AGEA 4KUBA 2BSWA 1YVOA 5HH1A 5DWMA 4R87A 3PZJA 2YNDA 1L0CA 3EY5A 2WSAA 5BWAB 5G20A 4QBJA 3FXTA 4FD4A 1VHSA 5H86A 3IWGA 4I49A 2QECA 1Y7RA 2B4DA 5G21A 1Z9UA 3R9FA 4AG7A 2OB0A 4B5OA 4F0YA 1PU9A 3F5BA 2VEZA 2J8RA 4MHDA 1S7LA 3LD2A 5JPHA 3S6GA 2ARHA 2VI7A 5GCNA 3PP9A 4M85A 3CXQA 4L89A 2BL1A 2YNCA 1QSOA 4KORA 4ONUA 2ZW7A 4ZGYB 3H5ZA 4KOYA 1KUXA 2AJ6A 2QIRA 1XEBA 3C26A 3FBUA 2FE7A 1I12A 3IGRA 3SHPA 1TIQA 4KVME 4CGOA 1S7NA 1SQHA 4MY0A 3TOAA 5IX3A 1IICA 4B12A 4C2YA 1XMTA 5AG6A 3R95A 4E0AA 2D4PA 2PQ8A 1CM0A 2ZW6A 2HV2A 4HKFA 4F0XA 1ON0A 4R3KA 5KTAA 2OH1A 1YVKA 1UFHA 3OWCA 5AG7A 4CS0B 1KZFA 3K9UA 3SXNA 3VWEA 2B3UA 5HMNA 2J8MA 5ISVA 4B14A 3FB3A 4H89A 1IIDA 3EFAA 3TO9A 1B87A 2DPSA 2O28A 2Z11A 4HNXB 3TT2A 3P2HA 1XIXA 2B58A 3I3GA 3CXPA 1R57A 4NF1A 4KLWA 4CAFA 4CAWA 3V8IA 2WPWA 3R1KA 4JXQA 1PUAA 3D2MA 2R1IA 3D8PA 4KLVA 3FRMA 5AG4A 3W6SA 2D4OA 3SXOA 2IL4A 2EUIA 2KCWA 4U9YA 3BJ7A 2F5IA 3G3SA 2PSWA 2GIVA 1MJBA 5CNPA 2K5TA 1XF8A 4MY3A 4QB9A 4ZBGA 5F48A 1YR0A 1IYKA 4RS2A 2B5GB 4CRZB 2CXAA 1YLEA 2JEVA 2Q7BA 4JJXA 2A4NA 5AG5A 2HUZA 3S6FA 3QAHA 1M4IA 3QB8A 5FVJA 4Y49B 2R98A 2OZUA 4IF5A 2R8VA 1S7KA 4YGOA 4Y49C 2Z3PA 2OZGA 2G0BA 3TO6A 2VQYA 2AE6A 4X5KA 4U5YA 3WR7A 4C2ZA 1QSMA 1KUVA 4CRYB 2ZW4A 2B3VA 3JUWA 2Z3NA 4E8OA 4FD7A 1OZPA 4BMHA 3G8WA 3R9GA 1M1DA 4QVTA 2X7BA 4UWIA 1P4NA 4E2AA 3PGPA 3EXNA 4A31A 2ZXVA 2FIAA 1B6BA 2Q4YA 3ZJ0A 2B4BA 3DDDA 2BEIA 4B5PA 4C7IA 4CGLA 4L8AA 2Q44A 4KSFA 3DSBA 4NCZA 3RYOA 4QUSA 4A30A 3A9LA 2REEA 3TTHA 5EBVA 3CXSA 4Q38A 1P0HA 4UA3A 1GHEA 3IU1A 1YK3A 4LX9A 1KUYA 2P6GA 1YX0A 4OLLA 1WK4A 2PR8A 3I9SA 2JDDA 1LRZA 2RC4A 2WPXA 4AVAA 4JWPA 1S5KA 2OU2A 4MJ8A 4XPKA 2I79A 4KS9A 1S7FA 4MFZA 3R9EA 5G1ZA 4CYOA 2DXQA 2I00A 3GY9A 4KOSA 2Q04A 4KOXA 1VKCA 4CAVA 3E0KA 1J4JA 2B4DB 4MFKA 4ORFA 1Z4EA 2YGWA 1K4JA 2ZPAA 3EC4A 2ATRA 4UFWA 2VBQA 4OADA 2QMLA 1MK4A 4KOTA 4KOWA 1V0CA 4CYPA 3GYAA 4PSXA 4UCMA 5C88A 2GANA 3T9YA 2P6EA 2WUUA 4YRHA 1I21A 4A95A 2YNCC 4KOUA 5KTCA 3N7ZA 4CAEA 3W91A 4KZTA 1I1DA 3DR6A 2C27A 4B13A 1Q2CA 2ZW5A 4MFJA 1NMTA 4AB7A 5IB0A 4DNCA 1XE4A 4EVYA 2PC1A 1ZO0A 1MJ9A 1WWZA 5A27A 4CGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y9W A;  5KTD A;  3F0A A;  1RO5 A;  3P2F A;  1S3Z A;  1Y9K A;  2H5M A;  4KVO E;  5E96 A;  3VWD A;  3FNC A;  1Q2Y A;  2Y0M A;  2JDC A;  2PRB A;  1MJA A;  2R7H A;  2Z0Z A;  4GS4 A;  4AVB A;  3TE4 A;  1BOB A;  1Q2D A;  5JQ4 A;  2CNT A;  3D3S A;  4U9Z A;  2G3A A;  3FYN A;  3B8G A;  2FS5 A;  2Q4V A;  3KKW A;  4XNH B;  1IYL A;  4H6Z A;  1QSN A;  2CNM A;  3UY5 A;  1S60 A;  4XNH C;  5F47 A;  2FXF A;  1QSR A;  5C82 A;  2Q0Y A;  2CY2 A;  4PK2 A;  3DNS A;  3S6H A;  1FY7 A;  4PSW A;  2NMT A;  3H4Q A;  1U6M A;  2P0W A;  3TO7 A;  4H6U A;  4NXY A;  1M44 A;  4KUA A;  2FT0 A;  1N71 A;  4II9 A;  4K30 A;  1M4D A;  2PDO A;  4LUA A;  4IUS A;  2FIW A;  5J8F A;  4YFJ A;  4UBR A;  1YGH A;  4XPL A;  4NEX A;  3DR8 A;  2REF A;  4UWJ A;  3LOD A;  5F46 A;  5F49 A;  4FD5 A;  2GE3 A;  4AG9 A;  2FCK A;  4HNW B;  2Z10 A;  3W6X A;  5EC4 A;  5J8C A;  1CJW A;  1M4G A;  2B5G A;  3TOB A;  3BJ8 A;  2VZY A;  4RI1 A;  4PK3 A;  2HQY A;  3MGD A;  4QC6 A;  3BLN A;  4KVX A;  5H84 A;  4AVC A;  5DWN A;  2FSR A;  3ZZI A;  1Z4R A;  4MI4 A;  3F8K A;  4JD6 A;  2JLM A;  4XPD B;  2VZZ A;  2P6F A;  3R96 A;  4B5P B;  2FL4 A;  4KOV A;  1BO4 A;  5IV0 A;  1YRE A;  4R57 A;  1RXT A;  1QST A;  2CNS A;  4XPD C;  3EO4 A;  1NSL A;  4R3L A;  4M3S A;  3D2P A;  3GKR A;  2EVN A;  3TCV A;  2VXK A;  3S6K A;  4J3G A;  3FIX A;  3JVN A;  5I0C A;  2BUE A;  4F6A A;  2J8N A;  1NE9 A;  4HNY B;  4JXR A;  4MBU A;  3NE7 A;  2OZH A;  4NSQ A;  4JLY A;  4CAX A;  4FD6 A;  2PR1 A;  4PV6 A;  2G3T A;  4R9M A;  4OAE A;  3T90 A;  1IB1 E;  3TFY A;  4KUB A;  2BSW A;  1YVO A;  5HH1 A;  5DWM A;  4R87 A;  3PZJ A;  1L0C A;  3EY5 A;  4QBJ A;  3FXT A;  4FD4 A;  1VHS A;  5H86 A;  3IWG A;  4I49 A;  2QEC A;  1Y7R A;  2B4D A;  1Z9U A;  3R9F A;  4AG7 A;  2OB0 A;  4B5O A;  4F0Y A;  1PU9 A;  3F5B A;  2VEZ A;  2J8R A;  4MHD A;  1S7L A;  3LD2 A;  5JPH A;  3S6G A;  2ARH A;  2VI7 A;  5GCN A;  3PP9 A;  4M85 A;  3CXQ A;  4L89 A;  2BL1 A;  1QSO A;  4KOR A;  4ONU A;  2ZW7 A;  4KOY A;  1KUX A;  2AJ6 A;  2QIR A;  1XEB A;  3C26 A;  3FBU A;  2FE7 A;  1I12 A;  3IGR A;  3SHP A;  1TIQ A;  4KVM E;  1S7N A;  1SQH A;  4MY0 A;  3TOA A;  5IX3 A;  1IIC A;  1XMT A;  3R95 A;  4E0A A;  2D4P A;  2PQ8 A;  1CM0 A;  2ZW6 A;  2HV2 A;  4HKF A;  1ON0 A;  4R3K A;  5KTA A;  2OH1 A;  1YVK A;  1UFH A;  3OWC A;  4CS0 B;  1KZF A;  3K9U A;  3SXN A;  3VWE A;  2B3U A;  5HMN A;  2J8M A;  5ISV A;  3FB3 A;  4H89 A;  1IID A;  3EFA A;  3TO9 A;  1B87 A;  2O28 A;  2Z11 A;  4HNX B;  3TT2 A;  3P2H A;  1XIX A;  2B58 A;  3I3G A;  3CXP A;  1R57 A;  4NF1 A;  4KLW A;  4CAW A;  3V8I A;  2WPW A;  3R1K A;  4JXQ A;  1PUA A;  3D2M A;  2R1I A;  3D8P A;  4KLV A;  3FRM A;  3W6S A;  2D4O A;  3SXO A;  2IL4 A;  2EUI A;  2KCW A;  4U9Y A;  3BJ7 A;  2F5I A;  3G3S A;  2PSW A;  2GIV A;  1MJB A;  5CNP A;  2K5T A;  1XF8 A;  4MY3 A;  4QB9 A;  4ZBG A;  5F48 A;  1YR0 A;  1IYK A;  4RS2 A;  2B5G B;  4CRZ B;  1YLE A;  2JEV A;  2Q7B A;  4JJX A;  2A4N A;  3S6F A;  2HUZ A;  3QAH A;  1M4I A;  3QB8 A;  5FVJ A;  4Y49 B;  2R98 A;  2OZU A;  4IF5 A;  2R8V A;  1S7K A;  4YGO A;  4Y49 C;  2OZG A;  2G0B A;  3TO6 A;  2VQY A;  2AE6 A;  4X5K A;  4U5Y A;  3WR7 A;  1QSM A;  1KUV A;  4CRY B;  2ZW4 A;  2B3V A;  3JUW A;  4E8O A;  4FD7 A;  1OZP A;  4BMH A;  3G8W A;  3R9G A;  1M1D A;  4QVT A;  2X7B A;  4UWI A;  1P4N A;  4E2A A;  3PGP A;  3EXN A;  2ZXV A;  2FIA A;  1B6B A;  2Q4Y A;  3ZJ0 A;  2B4B A;  3DDD A;  2BEI A;  4B5P A;  4L8A A;  2Q44 A;  3DSB A;  4NCZ A;  3RYO A;  4QUS A;  2REE A;  3TTH A;  5EBV A;  3CXS A;  1P0H A;  4UA3 A;  1GHE A;  1YK3 A;  4LX9 A;  1KUY A;  2P6G A;  1YX0 A;  4OLL A;  1WK4 A;  2PR8 A;  3I9S A;  2JDD A;  1LRZ A;  2RC4 A;  2WPX A;  4AVA A;  4JWP A;  1S5K A;  2OU2 A;  4MJ8 A;  4XPK A;  2I79 A;  1S7F A;  3R9E A;  2DXQ A;  2I00 A;  3GY9 A;  4KOS A;  2Q04 A;  4KOX A;  1VKC A;  4CAV A;  3E0K A;  1J4J A;  2B4D B;  4ORF A;  1Z4E A;  1K4J A;  2ZPA A;  3EC4 A;  2ATR A;  2VBQ A;  4OAD A;  2QML A;  1MK4 A;  4KOT A;  4KOW A;  1V0C A;  3GYA A;  4PSX A;  5C88 A;  2GAN A;  3T9Y A;  2P6E A;  4YRH A;  1I21 A;  4KOU A;  5KTC A;  3N7Z A;  3W91 A;  4KZT A;  1I1D A;  3DR6 A;  2C27 A;  1Q2C A;  2ZW5 A;  1NMT A;  4AB7 A;  5IB0 A;  4DNC A;  1XE4 A;  4EVY A;  2PC1 A;  1MJ9 A;  1WWZ A; 
#chains in the Genus database with same CATH topology
 4W9Y A;  3IEH A;  1Y9W A;  3FJU A;  4MHZ A;  3I1U A;  5KTD A;  3F0A A;  1RO5 A;  3P2F A;  2DPT A;  1S3Z A;  2OR4 A;  1Y9K A;  2XEI A;  2H5M A;  4KVO E;  5E96 A;  4ZYQ A;  3CZX A;  3RBU A;  3VWD A;  3FNC A;  1Q2Y A;  2Y0M A;  2JDC A;  4O23 A;  2PRB A;  3PFO A;  3FEE A;  1MJA A;  2R7H A;  2Z0Z A;  3PEI A;  4GS4 A;  1LFW A;  1BOB A;  1Q2D A;  3CDX A;  4LQ6 A;  2CIJ A;  4CYN A;  3TE4 A;  5JQ4 A;  4ZY2 A;  2CNT A;  3KL9 A;  4ZX9 A;  1ZG7 A;  1TXR A;  3D3S A;  5K8M A;  4NGR A;  4U9Z A;  2G3A A;  3FYN A;  3B8G A;  2FS5 A;  2Q4V A;  3KKW A;  4XNH B;  5F09 A;  4MHP A;  1F2P A;  2BCO A;  3PRT A;  3PB6 X;  1IYL A;  4H6Z A;  1QSN A;  3VAR A;  2CNM A;  3UY5 A;  1S60 A;  3IWE A;  4XNH C;  5F47 A;  3KAS A;  2FXF A;  2GLJ A;  2ZEM A;  3V7Z A;  2EWB A;  1QSR A;  5C82 A;  2JBK A;  4PXB A;  2Q0Y A;  1DE4 C;  2PCU A;  4MFP A;  2CY2 A;  4PK2 A;  3CPX A;  3DNS A;  3S6H A;  1FY7 A;  3NH5 A;  3DLJ A;  4PSW A;  1YQE A;  3TC8 A;  1VGY A;  1TKF A;  4OKO A;  7CPA A;  2NMT A;  4B10 A;  2Q43 A;  3H4Q A;  2PIZ A;  4WJB A;  1U6M A;  5A28 A;  4UCN A;  3JTK A;  4C2X A;  4CYQ A;  2P0W A;  3GB0 A;  3TO7 A;  4H6U A;  3LMS A;  4Q7A A;  2Q4Z A;  4NXY A;  4OC1 A;  1Z8X A;  1M44 A;  4KUA A;  2FT0 A;  2V8D A;  2XEF A;  3WC6 A;  3D66 A;  4ZY0 A;  3KQZ A;  2QVP A;  1N71 A;  4F9U A;  4II9 A;  4K30 A;  1M4D A;  2PDO A;  4EME A;  3PBE A;  4LUA A;  4NGT A;  1XMB A;  4IUS A;  2FIW A;  3SI1 A;  5J8F A;  3PFE A;  4YFJ A;  5DS0 A;  4UBR A;  5IB9 A;  1YGH A;  3KHZ A;  3B35 A;  4XPL A;  4C68 A;  1ZLI A;  2AFZ A;  4NEX A;  2PVV A;  3DR8 A;  3IC1 A;  2REF A;  2PVW A;  4UWJ A;  2GFQ A;  1AMP A;  4IAV A;  5JGF A;  3LOD A;  4DJL A;  5F46 A;  5F49 A;  4UFV A;  1M4L A;  4FD5 A;  4CGN A;  2GE3 A;  4AG9 A;  3WC5 A;  2FCK A;  2PJ7 A;  2Z10 A;  4HNW B;  4R7M A;  3W6X A;  5EC4 A;  3H8G A;  5J8C A;  4P4D A;  4F9V A;  1CJW A;  1M4G A;  2NSM A;  4AXV A;  2B5G A;  3TOB A;  3BJ8 A;  4P10 A;  2BO9 A;  2HB6 A;  2ZEH A;  2VZY A;  4RI1 A;  4PK3 A;  2G9D A;  4A2Z A;  4C7H A;  2HQY A;  3MGD A;  1HDU A;  2ZOG A;  5ELY A;  3K9T A;  4MRI A;  4QC6 A;  3BLN A;  3B3V A;  4KVX A;  1YME A;  5H84 A;  4UIB A;  1JQG A;  3H8F A;  5LYF A;  4AVC A;  4B11 A;  4IK2 A;  5DWN A;  2FSR A;  2Z3M A;  3ZZI A;  4OP4 A;  2XEJ A;  1Z4R A;  4MI4 A;  3F8K A;  4FBE A;  3QNV A;  4JD6 A;  2JLM A;  4CGM A;  2PJ9 A;  4XPD B;  2Z3L A;  2VZZ A;  2P6F A;  3R96 A;  4B5P B;  2FL4 A;  4KOV A;  1BO4 A;  4UFX A;  1YRE A;  4X2T A;  1Y7E A;  4R57 A;  5IV0 A;  5LYL A;  1RXT A;  2Z3O A;  1IOF A;  1QST A;  2CNS A;  4XPD C;  1NSA A;  3EO4 A;  4MFQ A;  1NSL A;  4R3L A;  4M3S A;  3D2P A;  2C6P A;  3GKR A;  1TF8 A;  4A32 A;  5K8N A;  2EVN A;  3KR4 A;  3KQX A;  3TCV A;  2VXK A;  3S6K A;  4UEF A;  4J3G A;  3FIX A;  2AFM A;  3JVN A;  4FWU A;  5I0C A;  4BBH A;  3KR5 A;  5CPA A;  3B3S A;  2Z3K A;  4KSA A;  2OOT A;  2BUE A;  3BXM A;  4F6A A;  2J8N A;  1Y0R A;  1NE9 A;  3V38 A;  4PXD A;  3ISX A;  3NA6 A;  2O53 A;  4HNY B;  4JXR A;  4YWY A;  2NYQ A;  3IU2 A;  4MBU A;  3NE7 A;  1TKJ A;  1CBX A;  2OZH A;  4JZ0 A;  2EBJ A;  1BAV A;  3MRU A;  4NSQ A;  4JLY A;  4CAX A;  3NH8 A;  2PR1 A;  1F2O A;  4FD6 A;  2VL1 A;  4MFL A;  5G22 A;  4PV6 A;  2J9A A;  2YNE A;  2G3T A;  3D7D A;  1JWQ A;  4NGS A;  1CPS A;  4Q36 A;  2C1C A;  2I3C A;  1R3N A;  3DGV A;  4OAE A;  4R9M A;  4A33 A;  1HDQ A;  2IQ6 A;  3T90 A;  4OC2 A;  3GIU A;  1IB1 E;  4UCP A;  3TFY A;  5AGE A;  4NJR A;  2PJ1 A;  4KUB A;  2BSW A;  4P4I A;  4B6Z A;  1YVO A;  1X12 A;  4P4F A;  5HH1 A;  4NGQ A;  2FVG A;  2ZOF A;  1CG2 A;  5DWM A;  4K3N A;  4R87 A;  2GLF A;  2PJ5 A;  1BPM A;  2C6C A;  3PZJ A;  2YND A;  4TNU A;  1L0C A;  3EY5 A;  1XBU A;  2WSA A;  1CP7 A;  4CPA A;  4OC4 A;  1Z8L A;  5BWA B;  5G20 A;  5JH9 A;  4QBJ A;  1DTD A;  3FXT A;  4FD4 A;  4IHM A;  1VHS A;  5H86 A;  4NGM A;  2ZEE A;  2GRE A;  3IWG A;  4I49 A;  2QEC A;  1Y7R A;  2B4D A;  5G21 A;  1Z9U A;  5EMI A;  4YU9 A;  3R9F A;  4AG7 A;  3BHX A;  3CPA A;  1R43 A;  2OB0 A;  4P44 A;  1XRY A;  4B5O A;  2GU2 A;  4MCP A;  2PJ8 A;  4BD9 A;  4F0Y A;  1PU9 A;  3F5B A;  1Y0Y A;  4M6G A;  2AFS A;  2VEZ A;  2J8R A;  4MHD A;  1S7L A;  3KHX A;  3LD2 A;  5JPH A;  1TF9 A;  5HVH A;  1AYE A;  1RTQ A;  3FEC A;  2ARH A;  5HVF A;  2VI7 A;  5GCN A;  3S6G A;  3PP9 A;  1Q7L A;  3WAB A;  3S9N A;  2PJ4 A;  3CXQ A;  4L89 A;  4M85 A;  2QJ8 A;  2BL1 A;  4P6Y A;  2YNC A;  1QSO A;  4KOR A;  2XEG A;  4ONU A;  2ZW7 A;  4ZGY B;  3H5Z A;  4KOY A;  4X8I A;  1KUX A;  1BLL E;  4R8F A;  2AJ6 A;  2QIR A;  4FAI A;  2PJC A;  2WZN A;  1XEB A;  3C26 A;  1Z8W A;  2ABZ A;  5LYI A;  3FBU A;  2FE7 A;  2JBJ A;  1I12 A;  2EO8 A;  3IGR A;  3SHP A;  4X3R A;  1TIQ A;  2AFW A;  4KVM E;  4CGO A;  4ZI6 A;  1IOI A;  1S7N A;  3FX6 A;  1ZG9 A;  1SQH A;  3KGQ A;  4MY0 A;  3TOA A;  4AVB A;  3D7G A;  1IIC A;  4B12 A;  4DUK A;  6CPA A;  4C2Y A;  4UEE A;  1XMT A;  1ZLH A;  5LRJ A;  5AG6 A;  5LRK A;  2IJZ A;  1ARL A;  3NE8 A;  2PJB A;  1Z5R A;  2PJ0 A;  3R95 A;  4OME A;  4E0A A;  3B3W A;  4EWT A;  5JM6 A;  2D4P A;  4OC3 A;  5D29 A;  2PQ8 A;  1CM0 A;  2O4H A;  2ZW6 A;  3BI1 A;  3SI0 A;  2HV2 A;  5I4M A;  4HKF A;  4F0X A;  1ON0 A;  3RZA A;  2V8V A;  4R3K A;  2OH1 A;  1YVK A;  4R6T A;  1GYT A;  5LYD A;  5KTA A;  1LOK A;  1UFH A;  1ZG8 A;  3OWC A;  4A38 A;  4PQA A;  4ONW A;  5AG7 A;  2DEA A;  3B3T A;  4CS0 B;  3HLP A;  1KZF A;  3K9U A;  3SXN A;  1F57 A;  3D7F A;  2HC9 A;  3VWE A;  2B3U A;  5HMN A;  2J8M A;  3RO0 A;  5ISV A;  3HUV A;  4B14 A;  3NFZ A;  1LAM A;  3FB3 A;  2ZED A;  3FED A;  4H89 A;  1IID A;  3EFA A;  3TO9 A;  1B87 A;  1PYT B;  2ODF A;  2DPS A;  1YSJ A;  3RAM A;  2O28 A;  2Z11 A;  4HNX B;  2ZEF A;  3S9M A;  3TT2 A;  3P2H A;  1XIX A;  2B58 A;  3I3G A;  2RB7 A;  4P4E A;  5CBM A;  3CXP A;  4MCR A;  1BPN A;  1R57 A;  4RN7 A;  4LQG A;  4NF1 A;  3IO1 A;  4KLW A;  4ZX8 A;  4CAF A;  4CAW A;  3V8I A;  2ZEO A;  2WPW A;  1LAN A;  1XFO A;  2JEW A;  3R1K A;  4JXQ A;  1PUA A;  1FT7 A;  2POK A;  4OIW A;  3D2M A;  2R1I A;  3D8P A;  4KLV A;  3FRM A;  5AG4 A;  3W6S A;  2D4O A;  4DYO A;  3SXO A;  1X10 A;  3D68 A;  2V77 A;  4PXC A;  2IL4 A;  2EUI A;  2KCW A;  2PRQ A;  3B2Y A;  4R76 A;  2ZEN A;  3PB9 X;  3CT9 A;  4GM5 A;  4U9Y A;  3BJ7 A;  4NGP A;  2F5I A;  4UEZ A;  2DF5 A;  2Q51 A;  3G3S A;  2AFX A;  2PSW A;  2GIV A;  1MJB A;  4PXE A;  5CNP A;  2K5T A;  1XF8 A;  1H8L A;  1YLO A;  4MY3 A;  4NGN A;  4PPZ A;  4QB9 A;  2F7V A;  4ZBG A;  5F48 A;  1YR0 A;  3SJE A;  3MN8 A;  1IYK A;  4GXH A;  2F8H A;  4RS2 A;  2B5G B;  1YW4 A;  4MCQ A;  2V8G A;  4CRZ B;  3SJG A;  2CXA A;  3IJ3 A;  1YLE A;  2CTC A;  2JEV A;  1Z8T A;  4JJX A;  2Q7B A;  2A4N A;  5AG5 A;  2HUZ A;  3S6F A;  5HXD A;  3QAH A;  1M4I A;  5LRG A;  3QB8 A;  1IGB A;  1PCA A;  5FVJ A;  2V8H A;  4Y49 B;  2R98 A;  4EFD A;  2OZU A;  4IF5 A;  1IU8 A;  1LAP A;  1YW6 A;  2EK8 A;  2R8V A;  4KSI A;  3T8W A;  1S7K A;  2Q7S A;  5THW A;  4YGO A;  4Y49 C;  5K8O A;  1VHO A;  2Z3P A;  4MHN A;  2AFU A;  2OZG A;  3VAT A;  2G0B A;  3TO6 A;  2VQY A;  4RUH A;  2AE6 A;  4F8Z A;  4X5K A;  4A37 A;  4U5Y A;  1OBR A;  3GLJ A;  3WR7 A;  4C2Z A;  1QSM A;  1KUV A;  4CRY B;  2ZW4 A;  2B3V A;  4G1P A;  4MMO A;  3JUW A;  2Z3N A;  4P45 A;  4E8O A;  4FD7 A;  3PBB A;  1OZP A;  4BMH A;  3G8W A;  3R9G A;  1QMU A;  2QYV A;  3KZW A;  3SJX A;  4BIN A;  1M1D A;  3L2N A;  4QVT A;  3QAY A;  4ZY1 A;  2X7B A;  4UWI A;  1P4N A;  3NH4 A;  4E2A A;  3FF3 A;  3PGP A;  3FH4 A;  3EXN A;  3WC7 A;  3GUX A;  1XJO A;  2ZXV A;  4A31 A;  2FIA A;  1B6B A;  2Q4Y A;  3ZJ0 A;  5IX3 A;  2B4B A;  3DDD A;  1CPX A;  2BEI A;  4B5P A;  4C7I A;  4CGL A;  4L8A A;  2Q44 A;  2PJA A;  3B7I A;  1ELM P;  1HEE A;  1A2Z A;  4KSF A;  3DSB A;  4NCZ A;  3RNZ A;  3RYO A;  3FVL A;  4QUS A;  4A30 A;  3A9L A;  2REE A;  3TTH A;  4H2K A;  4OC0 A;  5EBV A;  3CXS A;  4Q38 A;  3LAC A;  1CX8 A;  1P0H A;  1FNO A;  3BI0 A;  1GHE A;  3PB7 X;  4UA3 A;  3IU1 A;  3TX8 A;  1YK3 A;  4OC5 A;  3IFE A;  1KWM A;  4LX9 A;  1KUY A;  4TWE A;  8CPA A;  2P6G A;  1YX0 A;  4OLL A;  4MXU A;  1VIX A;  4P4J A;  3VH9 A;  1WK4 A;  2PR8 A;  3I9S A;  2JDD A;  4M6I A;  1LRZ A;  2RC4 A;  1QQ9 A;  2WPX A;  4A39 A;  4AVA A;  2PJ2 A;  4JWP A;  1S5K A;  3KI9 A;  2PJ6 A;  1LCP A;  2BOA A;  2OU2 A;  2ZEP A;  1XOV A;  2ANP A;  4MJ8 A;  2I79 A;  4XPK A;  4KS9 A;  2RFH A;  1S7F A;  4MFZ A;  3R9E A;  5G1Z A;  4CYO A;  2DXQ A;  4UF4 A;  2CTB A;  2I00 A;  3GY9 A;  5K8P A;  4KOS A;  2Q04 A;  4KOX A;  3IIB A;  1VKC A;  4CAV A;  4Z65 A;  4MCS A;  3E0K A;  1J4J A;  2B4D B;  5J1Q A;  4WWV A;  2IMO A;  4MFK A;  4ORF A;  3SJF A;  4JYW A;  1Z4E A;  2YGW A;  1K4J A;  1UWY A;  3B3C A;  3FMC A;  2ZPA A;  1VHE A;  2PIY A;  4OID A;  1TKH A;  4P4B A;  3EC4 A;  2ATR A;  1EE3 P;  4UFW A;  2EK9 A;  2VBQ A;  4OAD A;  2QML A;  3D4U A;  4NFR A;  5HVG A;  1MK4 A;  4KOT A;  4KOW A;  1V0C A;  2WYR A;  3PB4 X;  4CYP A;  3IWW A;  3GYA A;  4PSX A;  4UCM A;  5C88 A;  3WT4 A;  2GAN A;  1AUG A;  3T9Y A;  3JRU A;  2P6E A;  2WUU A;  4YRH A;  1I21 A;  4A95 A;  2PE3 A;  3D7H A;  4MHY A;  2PJ3 A;  1ELL P;  2ZEG A;  3LWU A;  2YNC C;  4KOU A;  3K2K A;  5KTC A;  4M6H A;  3S9L A;  2ZEL A;  3N7Z A;  4FUU A;  4CAE A;  1CP6 A;  5D8N A;  3H8E A;  3W91 A;  4KZT A;  1I1D A;  3DR6 A;  2C27 A;  4B13 A;  1IY7 A;  1Q2C A;  2ZW5 A;  3ISZ A;  4MFJ A;  3N5F A;  1NMT A;  1Z2L A;  4AB7 A;  5IB0 A;  3D67 A;  4DNC A;  1XE4 A;  3PB8 X;  4EVY A;  4NJQ A;  2PC1 A;  3SI2 A;  1ZO0 A;  1MJ9 A;  1WWZ A;  2CF4 A;  1ARM A;  2AFO A;  2C6G A;  4UIA A;  5A27 A;  4CGP A;  4A94 A;  4HPS A; 
#chains in the Genus database with same CATH homology
 1Y9W A;  5KTD A;  3F0A A;  1RO5 A;  3P2F A;  2DPT A;  1S3Z A;  1Y9K A;  2H5M A;  4KVO E;  5E96 A;  3VWD A;  3FNC A;  1Q2Y A;  2Y0M A;  2JDC A;  2PRB A;  1MJA A;  2R7H A;  2Z0Z A;  4GS4 A;  4AVB A;  3TE4 A;  1BOB A;  1Q2D A;  4CYN A;  5JQ4 A;  2CNT A;  3D3S A;  4U9Z A;  2G3A A;  3FYN A;  3B8G A;  2FS5 A;  2Q4V A;  3KKW A;  4XNH B;  1IYL A;  4H6Z A;  1QSN A;  2CNM A;  3UY5 A;  1S60 A;  3IWE A;  4XNH C;  5F47 A;  2FXF A;  1QSR A;  5C82 A;  2Q0Y A;  4MFP A;  2CY2 A;  4PK2 A;  3DNS A;  3S6H A;  1FY7 A;  4PSW A;  2NMT A;  4B10 A;  3H4Q A;  1U6M A;  5A28 A;  4UCN A;  3JTK A;  4C2X A;  4CYQ A;  2P0W A;  3TO7 A;  4H6U A;  4NXY A;  1M44 A;  4KUA A;  2FT0 A;  1N71 A;  4II9 A;  4K30 A;  1M4D A;  2PDO A;  4LUA A;  4IUS A;  2FIW A;  5J8F A;  4YFJ A;  4UBR A;  1YGH A;  4XPL A;  4C68 A;  4NEX A;  3DR8 A;  2REF A;  4UWJ A;  3LOD A;  5F46 A;  5F49 A;  4UFV A;  4CGN A;  4FD5 A;  2GE3 A;  4AG9 A;  2FCK A;  4HNW B;  2Z10 A;  3W6X A;  5EC4 A;  5J8C A;  1CJW A;  1M4G A;  2B5G A;  3TOB A;  3BJ8 A;  2VZY A;  4RI1 A;  4PK3 A;  4A2Z A;  4C7H A;  2HQY A;  3MGD A;  4QC6 A;  3BLN A;  4KVX A;  5H84 A;  4AVC A;  4B11 A;  5DWN A;  2FSR A;  2Z3M A;  3ZZI A;  1Z4R A;  4MI4 A;  3F8K A;  4CGM A;  4JD6 A;  2JLM A;  4XPD B;  2Z3L A;  2VZZ A;  2P6F A;  3R96 A;  4B5P B;  2FL4 A;  4KOV A;  1BO4 A;  4UFX A;  1YRE A;  5IV0 A;  4R57 A;  1RXT A;  2Z3O A;  1QST A;  2CNS A;  4XPD C;  3EO4 A;  4MFQ A;  1NSL A;  4R3L A;  4M3S A;  3D2P A;  3GKR A;  4A32 A;  2EVN A;  3TCV A;  2VXK A;  3S6K A;  4J3G A;  3FIX A;  3JVN A;  5I0C A;  4BBH A;  2Z3K A;  4KSA A;  2BUE A;  4F6A A;  2J8N A;  1NE9 A;  4HNY B;  4JXR A;  3IU2 A;  4MBU A;  3NE7 A;  2OZH A;  4NSQ A;  4JLY A;  4CAX A;  4FD6 A;  2PR1 A;  4MFL A;  5G22 A;  4PV6 A;  2YNE A;  2G3T A;  4Q36 A;  4R9M A;  4OAE A;  4A33 A;  3T90 A;  1IB1 E;  4UCP A;  3TFY A;  5AGE A;  4KUB A;  2BSW A;  1YVO A;  5HH1 A;  5DWM A;  4R87 A;  3PZJ A;  2YND A;  1L0C A;  3EY5 A;  2WSA A;  5BWA B;  5G20 A;  4QBJ A;  3FXT A;  4FD4 A;  1VHS A;  5H86 A;  3IWG A;  4I49 A;  2QEC A;  1Y7R A;  2B4D A;  5G21 A;  1Z9U A;  3R9F A;  4AG7 A;  2OB0 A;  4B5O A;  4F0Y A;  1PU9 A;  3F5B A;  2VEZ A;  2J8R A;  4MHD A;  1S7L A;  3LD2 A;  5JPH A;  3S6G A;  2ARH A;  2VI7 A;  5GCN A;  3PP9 A;  4M85 A;  3CXQ A;  4L89 A;  2BL1 A;  2YNC A;  1QSO A;  4KOR A;  4ONU A;  2ZW7 A;  4ZGY B;  3H5Z A;  4KOY A;  1KUX A;  2AJ6 A;  2QIR A;  1XEB A;  3C26 A;  3FBU A;  2FE7 A;  1I12 A;  3IGR A;  3SHP A;  1TIQ A;  4KVM E;  4CGO A;  1S7N A;  1SQH A;  4MY0 A;  3TOA A;  5IX3 A;  1IIC A;  4B12 A;  4C2Y A;  1XMT A;  5AG6 A;  3R95 A;  4E0A A;  2D4P A;  2PQ8 A;  1CM0 A;  2ZW6 A;  2HV2 A;  4HKF A;  4F0X A;  1ON0 A;  4R3K A;  5KTA A;  2OH1 A;  1YVK A;  1UFH A;  3OWC A;  5AG7 A;  4CS0 B;  1KZF A;  3K9U A;  3SXN A;  3VWE A;  2B3U A;  5HMN A;  2J8M A;  5ISV A;  4B14 A;  3FB3 A;  4H89 A;  1IID A;  3EFA A;  3TO9 A;  1B87 A;  2DPS A;  2O28 A;  2Z11 A;  4HNX B;  3TT2 A;  3P2H A;  1XIX A;  2B58 A;  3I3G A;  3CXP A;  1R57 A;  4NF1 A;  4KLW A;  4CAF A;  4CAW A;  3V8I A;  2WPW A;  3R1K A;  4JXQ A;  1PUA A;  3D2M A;  2R1I A;  3D8P A;  4KLV A;  3FRM A;  5AG4 A;  3W6S A;  2D4O A;  3SXO A;  2IL4 A;  2EUI A;  2KCW A;  4U9Y A;  3BJ7 A;  2F5I A;  3G3S A;  2PSW A;  2GIV A;  1MJB A;  5CNP A;  2K5T A;  1XF8 A;  4MY3 A;  4QB9 A;  4ZBG A;  5F48 A;  1YR0 A;  1IYK A;  4RS2 A;  2B5G B;  4CRZ B;  2CXA A;  1YLE A;  2JEV A;  2Q7B A;  4JJX A;  2A4N A;  5AG5 A;  2HUZ A;  3S6F A;  3QAH A;  1M4I A;  3QB8 A;  5FVJ A;  4Y49 B;  2R98 A;  2OZU A;  4IF5 A;  2R8V A;  1S7K A;  4YGO A;  4Y49 C;  2Z3P A;  2OZG A;  2G0B A;  3TO6 A;  2VQY A;  2AE6 A;  4X5K A;  4U5Y A;  3WR7 A;  4C2Z A;  1QSM A;  1KUV A;  4CRY B;  2ZW4 A;  2B3V A;  3JUW A;  2Z3N A;  4E8O A;  4FD7 A;  1OZP A;  4BMH A;  3G8W A;  3R9G A;  1M1D A;  4QVT A;  2X7B A;  4UWI A;  1P4N A;  4E2A A;  3PGP A;  3EXN A;  4A31 A;  2ZXV A;  2FIA A;  1B6B A;  2Q4Y A;  3ZJ0 A;  2B4B A;  3DDD A;  2BEI A;  4B5P A;  4C7I A;  4CGL A;  4L8A A;  2Q44 A;  4KSF A;  3DSB A;  4NCZ A;  3RYO A;  4QUS A;  4A30 A;  3A9L A;  2REE A;  3TTH A;  5EBV A;  3CXS A;  4Q38 A;  1P0H A;  4UA3 A;  1GHE A;  3IU1 A;  1YK3 A;  4LX9 A;  1KUY A;  2P6G A;  1YX0 A;  4OLL A;  1WK4 A;  2PR8 A;  3I9S A;  2JDD A;  1LRZ A;  2RC4 A;  2WPX A;  4AVA A;  4JWP A;  1S5K A;  2OU2 A;  4MJ8 A;  4XPK A;  2I79 A;  4KS9 A;  1S7F A;  4MFZ A;  3R9E A;  5G1Z A;  4CYO A;  2DXQ A;  2I00 A;  3GY9 A;  4KOS A;  2Q04 A;  4KOX A;  1VKC A;  4CAV A;  3E0K A;  1J4J A;  2B4D B;  4MFK A;  4ORF A;  1Z4E A;  2YGW A;  1K4J A;  2ZPA A;  3EC4 A;  2ATR A;  4UFW A;  2VBQ A;  4OAD A;  2QML A;  1MK4 A;  4KOT A;  4KOW A;  1V0C A;  4CYP A;  3GYA A;  4PSX A;  4UCM A;  5C88 A;  2GAN A;  3T9Y A;  2P6E A;  2WUU A;  4YRH A;  1I21 A;  4A95 A;  2YNC C;  4KOU A;  5KTC A;  3N7Z A;  4CAE A;  3W91 A;  4KZT A;  1I1D A;  3DR6 A;  2C27 A;  4B13 A;  1Q2C A;  2ZW5 A;  4MFJ A;  1NMT A;  4AB7 A;  5IB0 A;  4DNC A;  1XE4 A;  4EVY A;  2PC1 A;  1ZO0 A;  1MJ9 A;  1WWZ A;  5A27 A;  4CGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...