1QSMA

Histone acetyltransferase hpa2 from saccharomyces cerevisiae in complex with acetyl coenzyme a
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
DNITVRFVTENDKEGWQRLWKSYQDFYEVSFPDDLDDFNFGRFLDPNIKMWAAVAVESSSEKIIGMINFFNHMTTWDFKDKIYINDLYVDENSRVKGAGGKLIQFVYDEADKLGTPSVYWCTDESNHRAQLLYVKVGYKAPKILYKRKGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HPA2 HISTONE ACETYLTRANSFERASE
publication title Crystal structure of the histone acetyltransferase Hpa2: A tetrameric member of the Gcn5-related N-acetyltransferase superfamily.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 43
structure length 150
sequence length 150
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 1999-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1qsmA00
1I1DA 4F0YA 2REEA 1NE9A 4ZBGA 3TCVA 2FSRA 1YLEA 2ZPAA 3C26A 1XEBA 4LX9A 2ATRA 3JVNA 2Z0ZA 3MGDA 2A4NA 4E2AA 5I0CA 3IGRA 2QIRA 1M1DA 4MJ8A 4MI4A 4NEXA 4KOVA 4PSXA 4NF1A 5F49A 3LODA 2Z10A 1IIDA 1MK4A 3F5BA 4L8AA 2I79A 4EVYA 1Z4EA 4M3SA 3S6GA 3N7ZA 4XPLA 1BOBA 1S3ZA 1Y9WA 2IL4A 2VQYA 2P6EA 1RO5A 2CNMA 3FNCA 4OAEA 1QSRA 1GHEA 2CNTA 4YGOA 1MJBA 1N71A 4QB9A 2BSWA 2OB0A 3I3GA 1XIXA 2JLMA 3T90A 1XMTA 3PP9A 4UBRA 4XPDB 2ZW7A 5C88A 3GYAA 4CS0B 3NE7A 4JLYA 5EC4A 3EY5A 4MBUA 4Y49B 2Q04A 2B3VA 4HKFA 4M85A 5JPHA 4L89A 4LUAA 3EXNA 5F48A 2G3TA 3DR8A 3EO4A 2R1IA 3DDDA 5E96A 1YR0A 2JDCA 4UA3A 3CXPA 4I49A 4RI1A 2QMLA 2VBQA 4MY3A 1IICA 1FY7A 5C82A 4ONUA 1M4IA 2OH1A 4B5OA 4DNCA 2Y0MA 4E8OA 1K4JA 2J8NA 2R7HA 4CRZB 5CNPA 4YRHA 4H6ZA 2P6GA 3FXTA 1YGHA 4E0AA 2C27A 2Z11A 3EC4A 4X5KA 4AB7A 4UWIA 4XNHB 2B3UA 2PDOA 4AG9A 5KTAA 3JUWA 1LRZA 1Q2CA 5ISVA 1QSTA 1S7FA 1YVOA 3DSBA 3F0AA 2VEZA 3CXQA 1XE4A 1TIQA 3OWCA 1YX0A 4F6AA 3VWDA 2Q44A 4IUSA 4PSWA 3P2FA 4KORA 4KOWA 3R9GA 4KLVA 3TO9A 2P6FA 4YFJA 2FIWA 5HMNA 5J8FA 4ORFA 1M4DA 2K5TA 3FB3A 2PC1A 2FIAA 1WK4A 3D2PA 2HQYA 2PR1A 5IB0A 1MJAA 1S7NA 5IV0A 5KTDA 2FXFA 4KVOE 2AJ6A 4JWPA 4QUSA 3TTHA 2WPXA 1M4GA 2ZXVA 3TFYA 2D4OA 4FD7A 2Q4VA 3FYNA 1P0HA 3EFAA 4KVXA 4FD5A 3V8IA 1NMTA 2B58A 4R3KA 2BL1A 4KOUA 4MHDA 1S5KA 4II9A 5GCNA 1I21A 4KLWA 3FBUA 2ZW5A 3BJ8A 2B4BA 3P2HA 1KUVA 2VXKA 1V0CA 2D4PA 2QECA 3IWGA 3SXNA 3VWEA 3ZZIA 4NCZA 2BUEA 1J4JA 4QVTA 2OZHA 3GY9A 2WPWA 3CXSA 1S60A 2FCKA 3RYOA 5F47A 4QC6A 3WR7A 3G8WA 4NXYA 3W6SA 4KUBA 2OU2A 4RS2A 2H5MA 2KCWA 3T9YA 3QB8A 4XPKA 5H84A 1Q2YA 3QAHA 5HH1A 4FD4A 1QSNA 2PR8A 5DWNA 4U9ZA 3SXOA 1MJ9A 4KUAA 1IYKA 2G3AA 1CM0A 2EVNA 1VKCA 1VHSA 5J8CA 3DNSA 2B4DA 4XNHC 4HNWB 2FE7A 4PK3A 1NSLA 4GS4A 5KTCA 5DWMA 3R9FA 2B5GA 2B4DB 3B8GA 5H86A 1Z9UA 3TO7A 3BLNA 1KZFA 2B5GB 1PU9A 2OZGA 4B5PA 3K9UA 4IF5A 3TO6A 3D3SA 1CJWA 3R95A 3FIXA 2O28A 3W91A 3S6FA 1QSMA 4B5PB 2J8RA 4JXQA 5JQ4A 1KUYA 3H4QA 1YVKA 2EUIA 4AVCA 4NSQA 1Y9KA 2FL4A 4JJXA 1SQHA 1B6BA 2CNSA 5FVJA 4AVBA 3R9EA 4CAWA 3BJ7A 1Z4RA 3G3SA 2FT0A 3R1KA 1OZPA 3UY5A 3TE4A 4HNYB 2FS5A 3DR6A 4AVAA 1WWZA 3E0KA 2J8MA 2R98A 4KZTA 1M44A 1RXTA 4HNXB 2AE6A 2VZYA 1U6MA 2OZUA 2ZW4A 2G0BA 3S6HA 1L0CA 4XPDC 4KOXA 2P0WA 2GE3A 3TOAA 1ON0A 4CRYB 4CAVA 4R57A 4Y49C 2HUZA 3TT2A 1IYLA 2DXQA 3I9SA 1Q2DA 3W6XA 3LD2A 4KOYA 1YK3A 2BEIA 4U5YA 3SHPA 4H89A 2REFA 4K30A 4KOSA 5IX3A 4PV6A 1S7KA 4AG7A 4PK2A 4UWJA 4CAXA 1PUAA 4U9YA 4QBJA 4R87A 2I00A 2HV2A 2Q7BA 1I12A 1YREA 2ARHA 2PSWA 2NMTA 3PGPA 2VI7A 3D2MA 2GIVA 3GKRA 4JXRA 4MY0A 1B87A 4BMHA 2F5IA 3F8KA 2ZW6A 3PZJA 3ZJ0A 2GANA 1XF8A 1Y7RA 2JEVA 1S7LA 2CY2A 2JDDA 1IB1E 4JD6A 2Q4YA 4H6UA 3S6KA 1UFHA 2VZZA 5F46A 2RC4A 3FRMA 3R96A 1R57A 3KKWA 1QSOA 4KOTA 2Q0YA 4R3LA 2X7BA 4FD6A 2PRBA 2PQ8A 1KUXA 1P4NA 3TOBA 3D8PA 1BO4A 4R9MA 4OADA 2R8VA 4KVME 4OLLA 5EBVA 4J3GA
chains in the Genus database with same CATH superfamily
1KWMA 1TKFA 1I1DA 4F0YA 4B11A 2REEA 2ZEDA 1Y7EA 2PJ8A 1NE9A 1YSJA 2IQ6A 4ZBGA 3TCVA 4B6ZA 2FSRA 1YLEA 1Q7LA 4MFZA 2ZPAA 3FVLA 5G22A 3C26A 1XEBA 4LX9A 3KZWA 2ATRA 5BWAB 3JVNA 5LYDA 2Z3NA 3B35A 5LRGA 5LYLA 2Z0ZA 3MGDA 4NJRA 2A4NA 4CAEA 4E2AA 5I0CA 3IGRA 2QIRA 3IO1A 1M1DA 4MJ8A 3KQZA 3SI1A 1IY7A 2ZEOA 4MI4A 3NH8A 2V8HA 4NEXA 4KOVA 3B2YA 3VATA 4NGNA 4PSXA 3PB9X 1X10A 3KQXA 5K8PA 3NA6A 4NF1A 1GYTA 5F49A 2PJAA 3LODA 5LRKA 4A95A 2Z10A 1IIDA 1MK4A 3F5BA 2AFOA 2I79A 3FEEA 1ZO0A 4L8AA 4P6YA 2BO9A 4EVYA 1Z4EA 4M3SA 1Z8XA 3S6GA 3KGQA 4BBHA 3N7ZA 4ZY0A 4DUKA 1BLLE 4IK2A 4XPLA 1BOBA 4NGPA 1Z8WA 4B10A 4UIBA 4DYOA 3IWWA 4OC1A 4R7MA 4BD9A 1S3ZA 4NGRA 4FWUA 1Y9WA 4F0XA 2IL4A 2VQYA 1YW6A 5HVHA 4A2ZA 2P6EA 1FT7A 3TFYA 1ARMA 1RO5A 5THWA 3NFZA 2CNMA 3NE8A 3FNCA 4OAEA 2NSMA 1QSRA 1GHEA 5HXDA 2CNTA 3IWEA 4YGOA 4R8FA 1MJBA 1N71A 3KHXA 4C2YA 4QB9A 2BSWA 2OB0A 2VL1A 3I3GA 1XIXA 3B7IA 3SI0A 2JLMA 2XEIA 1QMUA 4X8IA 5AGEA 3T90A 1XMTA 2ZOGA 3PP9A 4KSIA 4UBRA 4XPDB 2ZW7A 2ANPA 4UIAA 3SJGA 5C88A 2BOAA 3GYAA 2ZOFA 4CS0B 1YQEA 2EK9A 4MFQA 4CGNA 1JQGA 3NE7A 1TF8A 4MXUA 4JLYA 4MHYA 5G21A 5EC4A 1YLOA 3EY5A 4MBUA 2YGWA 5K8OA 4X3RA 4OC4A 4Y49B 6CPAA 2Q04A 2B3VA 2C6PA 4HKFA 4M85A 5JPHA 4L89A 1M4LA 4A33A 2QYVA 5G20A 2WSAA 4LUAA 3EXNA 5F48A 3RNZA 2EBJA 2G3TA 3DR8A 3EO4A 2R1IA 3DDDA 1PYTB 1CPXA 1VHOA 2PJ9A 2ODFA 2GLFA 5E96A 3H8GA 1YR0A 3D67A 2J9AA 4YWYA 2JDCA 4UA3A 3CXPA 4I49A 3LACA 4RI1A 2QMLA 8CPAA 2VBQA 4MY3A 1IICA 4NGMA 1FY7A 1IGBA 5C82A 1ZG8A 4MCSA 4MCRA 1FNOA 2FVGA 4ONUA 4CAFA 1M4IA 2PJ0A 2C6GA 4ZY1A 4F9UA 4P4JA 3KHZA 2OH1A 1NSAA 4B5OA 4MHZA 2EK8A 2Y0MA 4DNCA 5I4MA 4E8OA 1K4JA 3IC1A 4EFDA 4OKOA 2J8NA 3H8FA 2R7HA 4CRZB 4ZGYB 1F57A 3B3SA 5CNPA 4YRHA 4H6ZA 4NJQA 4ZYQA 2P6GA 3WT4A 3FXTA 1HEEA 1LFWA 1YGHA 4E0AA 2ZEPA 4ONWA 4LQGA 3A9LA 2C27A 2Z3OA 2Z11A 3EC4A 4X5KA 4AB7A 4UWIA 4XNHB 2B3UA 2PDOA 2Q4ZA 2Z3PA 4MMOA 4PXDA 3WC5A 3D4UA 2DF5A 2JBKA 4AG9A 5KTAA 3CZXA 3FH4A 3DLJA 4F8ZA 1IOIA 2IMOA 2WUUA 4WWVA 4C7IA 1Z5RA 4K3NA 3JUWA 1LRZA 2F8HA 1Q2CA 5ISVA 1QSTA 1S7FA 1CP7A 3B3VA 1VGYA 1YVOA 3CPAA 3DSBA 3F0AA 2VEZA 3CXQA 3KR4A 2OOTA 1OBRA 1XE4A 1EE3P 5AG4A 1TIQA 1XJOA 3OWCA 3IEHA 1YX0A 4F6AA 4G1PA 5AG7A 2YNCA 2PJBA 4DJLA 1HDQA 3D7HA 3N5FA 3VWDA 2Q44A 4IUSA 4PSWA 2ZEFA 2F7VA 3KI9A 3P2FA 4KORA 3WABA 4KOWA 1JWQA 3R9GA 4KLVA 4OP4A 1LCPA 3TO9A 3V38A 1XFOA 2PJCA 2IJZA 4R76A 2C1CA 2P6FA 3GLJA 4C2XA 4C68A 2Z3MA 1TKJA 1TKHA 3CDXA 4YFJA 2FIWA 4A31A 2I3CA 4OIDA 5HMNA 5J8FA 5D29A 3NH4A 4ORFA 3D7GA 1M4DA 1X12A 4MFKA 3TX8A 2K5TA 5K8NA 3FJUA 3FB3A 3RZAA 2PC1A 2FIAA 1WK4A 3D2PA 3H5ZA 4UFVA 2HQYA 1AMPA 2PR1A 3I1UA 4KSFA 1BPNA 1MJAA 1S7NA 4ZX8A 4ZI6A 5IB0A 3PB8X 5IV0A 4CGOA 2Q51A 3S9MA 5KTDA 3WC7A 4FUUA 2FXFA 4F9VA 4KVOE 4OC5A 2AJ6A 4JWPA 1ZG7A 3QAYA 4QUSA 4A94A 1IU8A 2CF4A 2BCOA 3JTKA 3GB0A 4UFXA 2PIZA 3TTHA 2WPXA 1M4GA 4UEEA 4UFWA 3LMSA 2AFZA 4O23A 3HLPA 2ZXVA 3PB7X 2D4OA 2ABZA 2OR4A 2PJ1A 1ZLHA 2GLJA 4TNUA 3VARA 4FD7A 5G1ZA 2Q4VA 3FYNA 3RAMA 1P0HA 1CBXA 4UCMA 1VHEA 5HVFA 3EFAA 4A32A 4C2ZA 2Z3LA 4JZ0A 4KVXA 4C7HA 5A27A 4X2TA 4KS9A 2WZNA 4EMEA 4FD5A 3FX6A 3V8IA 1NMTA 3BXMA 2B58A 2V8GA 2Z3KA 3IFEA 3LWUA 4R3KA 2PJ5A 4IHMA 3IU2A 2BL1A 2PVWA 3PBBA 4KOUA 1S5KA 3FEDA 4MHDA 4MCQA 4II9A 4B14A 5GCNA 1XBUA 4CGMA 4EWTA 4P4FA 5JH9A 1I21A 4KLWA 1YW4A 3FBUA 5EBVA 3V7ZA 3MN8A 3T8WA 4Q38A 2ZW5A 1PCAA 3BJ8A 2B4BA 3P2HA 1KUVA 1XMBA 2VXKA 1V0CA 2D4PA 3HUVA 2PRQA 4OC3A 2QECA 3FECA 3IWGA 3L2NA 4BINA 3SXNA 4NGQA 3VWEA 2PCUA 1Y0RA 3ZZIA 2ZEMA 4NCZA 2BUEA 1J4JA 2DPTA 4UEZA 3H8EA 1CG2A 4MFLA 4QVTA 2OZHA 3SJXA 3GY9A 2WPWA 3CXSA 3RBUA 1S60A 2FCKA 4PXCA 4A39A 4MCPA 3RYOA 5F47A 4QC6A 3WR7A 3G8WA 3S9LA 2ZEEA 4NXYA 3W6SA 2AFWA 4AXVA 4KUBA 2OU2A 2PJ7A 4RS2A 4OMEA 2H5MA 2Q43A 2V8VA 2KCWA 3T9YA 3B3CA 3QB8A 4XPKA 5H84A 4UCNA 1Q2YA 2V77A 1Z2LA 3DGVA 3QAHA 4W9YA 4FD4A 5HH1A 1QSNA 2PR8A 2YNEA 2AFXA 3BHXA 4U9ZA 5DWNA 3IU1A 3SXOA 3TC8A 5F09A 1MJ9A 3FF3A 2AFUA 4KUAA 1IYKA 2PIYA 1XRYA 3QNVA 2XEGA 2G3AA 1LAPA 1CM0A 4CPAA 2EVNA 4FAIA 1VKCA 1A2ZA 3IIBA 1VHSA 5J8CA 1DE4C 3DNSA 4MFJA 2B4DA 1ELMP 4XNHC 4HNWB 2AFSA 2FE7A 2XEFA 4PK3A 1NSLA 2YNDA 4GS4A 3JRUA 2HB6A 2ZEHA 1ZG9A 2GU2A 5KTCA 5DWMA 3R9FA 4CYOA 2B5GA 2B4DB 3D68A 4UCPA 4Q36A 3B8GA 3K9TA 1Z9UA 5H86A 5CBMA 3ISXA 3TO7A 3BLNA 3B3TA 1KZFA 2B5GB 1PU9A 2OZGA 4WJBA 4B5PA 3KL9A 5CPAA 3K9UA 1XOVA 4IF5A 3D3SA 3TO6A 1CJWA 2RFHA 3R95A 3FIXA 4P4BA 4PPZA 2QVPA 2O28A 3W91A 5ELYA 5D8NA 3S6FA 1QSMA 2PJ4A 4GXHA 4A38A 2J8RA 4JXQA 4B5PB 3KR5A 1DTDA 5JQ4A 5EMIA 4NFRA 1KUYA 2QJ8A 3H4QA 1YVKA 2EO8A 1CP6A 2YNCC 2DPSA 2EUIA 4P4EA 4AVCA 4NSQA 1Y9KA 2FL4A 4JJXA 5HVGA 1SQHA 1B6BA 4H2KA 4PQAA 5LRJA 1UWYA 4FBEA 2JBJA 2XEJA 2CNSA 5FVJA 4AVBA 3R9EA 3NH5A 4CAWA 4RN7A 3BJ7A 3SJEA 1Z4RA 3G3SA 2FT0A 3R1KA 5JGFA 1OZPA 3FMCA 3UY5A 4TWEA 3MRUA 4YU9A 3TE4A 2NYQA 2CXAA 4HNYB 2FS5A 5DS0A 2C6CA 2O53A 1ELLP 3WC6A 3DR6A 4NGSA 3VH9A 1YMEA 4AVAA 4OC0A 1WWZA 3E0KA 2ZEGA 4M6HA 4IAVA 2POKA 2J8MA 2R98A 4KZTA 4Q7AA 1M44A 1LOKA 1RXTA 1LANA 3CT9A 4HNXB 1F2OA 5AG5A 4CYPA 5K8MA 2AE6A 2VZYA 2GFQA 1U6MA 5JM6A 1VIXA 3S9NA 2OZUA 2ZW4A 4KSAA 2G0BA 3ISZA 1L0CA 3PB4X 4XPDC 3GIUA 1TXRA 4KOXA 3S6HA 2P0WA 2GE3A 3TOAA 1ON0A 4PXBA 4NGTA 4UEFA 1BPMA 3RO0A 4CRYB 3BI1A 4CAVA 4A37A 2PJ2A 3GUXA 2V8DA 2AFMA 3CPXA 4R57A 4Y49C 2HUZA 3TT2A 1IYLA 2DXQA 3I9SA 1Q2DA 3W6XA 3LD2A 4KOYA 1YK3A 7CPAA 2BEIA 4U5YA 3SHPA 4H89A 1Z8TA 2REFA 2RB7A 4K30A 3PFOA 1Z8LA 4KOSA 4CYNA 1HDUA 4RUHA 5IX3A 4PV6A 5J1QA 1ZLIA 3PBEA 1S7KA 4GM5A 4AG7A 4PK2A 4UWJA 4CAXA 4CGLA 4P4IA 1Y0YA 1TF9A 4P4DA 1PUAA 4U9YA 3PEIA 4LQ6A 4ZY2A 4QBJA 3KASA 4R87A 2I00A 2PJ3A 2EWBA 2HV2A 2O4HA 2CTBA 3PFEA 5LYIA 1RTQA 2G9DA 2Q7BA 2DEAA 1I12A 1R43A 1YREA 3SJFA 2WYRA 2ARHA 2PSWA 1QQ9A 4CGPA 2NMTA 3PGPA 2VI7A 1BAVA 3D2MA 1IOFA 2GIVA 3GKRA 4JXRA 4MY0A 1AUGA 4OIWA 1B87A 2CIJA 2HC9A 2F5IA 4BMHA 3F8KA 4MFPA 2ZW6A 3PZJA 4MHPA 3ZJ0A 2GANA 1XF8A 3SI2A 2PJ6A 1Y7RA 2JEVA 4M6IA 1AYEA 1S7LA 2CY2A 2JDDA 3BI0A 4A30A 1F2PA 3D7DA 4ZX9A 2PVVA 1IB1E 4MRIA 4JD6A 3IJ3A 2Q4YA 4H6UA 4P10A 1R3NA 1UFHA 3S6KA 2VZZA 5F46A 5IB9A 3PB6X 1CPSA 2RC4A 2ZENA 4P45A 4Z65A 5A28A 3K2KA 4M6GA 3FRMA 3R96A 4JYWA 4OC2A 4P44A 1H8LA 1R57A 3KKWA 1QSOA 3PRTA 4KOTA 2CTCA 2Q0YA 5LYFA 3B3WA 4R6TA 4R3LA 2ZELA 2X7BA 1ARLA 4FD6A 2PRBA 4B12A 2PQ8A 2PE3A 3D66A 1KUXA 1P4NA 3D7FA 3TOBA 4HPSA 3D8PA 1BO4A 4R9MA 2GREA 4PXEA 4B13A 1LAMA 4OADA 4MHNA 2R8VA 1CX8A 4KVME 2Q7SA 4CYQA 2JEWA 4OLLA 4UF4A 4J3GA 5AG6A
chains in the Genus database with same CATH topology
1I1DA 4F0YA 4B11A 2REEA 1NE9A 4ZBGA 3TCVA 2FSRA 1YLEA 4MFZA 2ZPAA 5G22A 3C26A 1XEBA 4LX9A 2ATRA 5BWAB 3JVNA 2Z3NA 2Z0ZA 3MGDA 2A4NA 4CAEA 4E2AA 5I0CA 3IGRA 2QIRA 1M1DA 4MJ8A 4MI4A 4NEXA 4KOVA 4PSXA 4NF1A 5F49A 3LODA 4A95A 2Z10A 1IIDA 1MK4A 3F5BA 4L8AA 2I79A 4EVYA 1ZO0A 1Z4EA 4M3SA 3S6GA 4BBHA 3N7ZA 4XPLA 1BOBA 4B10A 1S3ZA 1Y9WA 4F0XA 2IL4A 2VQYA 4A2ZA 2P6EA 1RO5A 2CNMA 3FNCA 4OAEA 1QSRA 1GHEA 2CNTA 3IWEA 4YGOA 1MJBA 1N71A 4C2YA 4QB9A 2BSWA 2OB0A 3I3GA 1XIXA 2JLMA 3T90A 5AGEA 1XMTA 3PP9A 4UBRA 4XPDB 2ZW7A 5C88A 3GYAA 4CS0B 4MFQA 4CGNA 3NE7A 4JLYA 5G21A 5EC4A 3EY5A 4MBUA 2YGWA 4Y49B 2Q04A 2B3VA 4HKFA 4M85A 5JPHA 4L89A 4A33A 5G20A 2WSAA 4LUAA 3EXNA 5F48A 2G3TA 3DR8A 3EO4A 2R1IA 3DDDA 5E96A 1YR0A 2JDCA 4UA3A 3CXPA 4I49A 4RI1A 2QMLA 2VBQA 4MY3A 1IICA 1FY7A 5C82A 4ONUA 4CAFA 1M4IA 2OH1A 4B5OA 4DNCA 2Y0MA 4E8OA 1K4JA 2J8NA 2R7HA 4CRZB 4ZGYB 5CNPA 4YRHA 4H6ZA 2P6GA 3FXTA 1YGHA 4E0AA 3A9LA 2C27A 2Z3OA 2Z11A 3EC4A 4X5KA 4AB7A 4UWIA 4XNHB 2B3UA 2PDOA 2Z3PA 4AG9A 5KTAA 2WUUA 4C7IA 3JUWA 1LRZA 1Q2CA 5ISVA 1QSTA 1S7FA 1YVOA 3DSBA 3F0AA 2VEZA 3CXQA 1XE4A 5AG4A 1TIQA 3OWCA 1YX0A 4F6AA 5AG7A 2YNCA 3VWDA 2Q44A 4IUSA 4PSWA 3P2FA 4KORA 4KOWA 3R9GA 4KLVA 3TO9A 2P6FA 4C2XA 4C68A 2Z3MA 4YFJA 2FIWA 4A31A 5HMNA 5J8FA 4ORFA 1M4DA 4MFKA 2K5TA 3FB3A 2PC1A 2FIAA 1WK4A 3D2PA 3H5ZA 4UFVA 2HQYA 2PR1A 4KSFA 5IB0A 1MJAA 1S7NA 5IV0A 4CGOA 5KTDA 2FXFA 4KVOE 2AJ6A 4JWPA 4QUSA 3JTKA 4UFXA 3TTHA 2WPXA 1M4GA 4UFWA 2ZXVA 3TFYA 2D4OA 4FD7A 5G1ZA 2Q4VA 3FYNA 1P0HA 4UCMA 4A32A 3EFAA 4C2ZA 2Z3LA 4C7HA 4KVXA 5A27A 4KS9A 4FD5A 3V8IA 1NMTA 2B58A 2Z3KA 4R3KA 3IU2A 2BL1A 4KOUA 4MHDA 1S5KA 4II9A 4B14A 5GCNA 4CGMA 1I21A 4KLWA 3FBUA 4Q38A 2ZW5A 3BJ8A 2B4BA 3P2HA 1KUVA 2VXKA 1V0CA 2D4PA 2QECA 3IWGA 3SXNA 3VWEA 3ZZIA 4NCZA 2BUEA 1J4JA 2DPTA 4MFLA 4QVTA 2OZHA 3GY9A 2WPWA 3CXSA 1S60A 2FCKA 3RYOA 5F47A 4QC6A 3WR7A 3G8WA 4NXYA 3W6SA 4KUBA 2OU2A 4RS2A 2H5MA 2KCWA 3T9YA 3QB8A 4XPKA 5H84A 4UCNA 1Q2YA 3QAHA 5HH1A 4FD4A 1QSNA 2PR8A 2YNEA 4U9ZA 5DWNA 3SXOA 3IU1A 1MJ9A 4KUAA 1IYKA 2G3AA 1CM0A 2EVNA 1VKCA 1VHSA 5J8CA 4MFJA 3DNSA 2B4DA 4XNHC 4HNWB 2FE7A 4PK3A 1NSLA 2YNDA 4GS4A 5KTCA 5DWMA 3R9FA 4CYOA 2B5GA 2B4DB 4UCPA 4Q36A 3B8GA 5H86A 1Z9UA 3TO7A 3BLNA 1KZFA 2B5GB 1PU9A 2OZGA 4B5PA 3K9UA 4IF5A 3TO6A 3D3SA 1CJWA 3R95A 3FIXA 2O28A 3W91A 3S6FA 1QSMA 4B5PB 2J8RA 4JXQA 5JQ4A 1KUYA 3H4QA 1YVKA 2YNCC 2DPSA 2EUIA 4AVCA 4NSQA 1Y9KA 2FL4A 4JJXA 1SQHA 1B6BA 2CNSA 5FVJA 4AVBA 3R9EA 4CAWA 3BJ7A 1Z4RA 3G3SA 2FT0A 3R1KA 1OZPA 3UY5A 3TE4A 2CXAA 4HNYB 2FS5A 3DR6A 4AVAA 1WWZA 3E0KA 2J8MA 2R98A 4KZTA 1M44A 1RXTA 4HNXB 5AG5A 4CYPA 2AE6A 2VZYA 1U6MA 2OZUA 2ZW4A 4KSAA 2G0BA 3S6HA 1L0CA 4XPDC 4KOXA 2P0WA 2GE3A 3TOAA 1ON0A 4CRYB 4CAVA 4R57A 4Y49C 2HUZA 3TT2A 1IYLA 2DXQA 3I9SA 1Q2DA 3W6XA 3LD2A 4KOYA 1YK3A 2BEIA 4U5YA 3SHPA 4H89A 2REFA 4K30A 4KOSA 4CYNA 5IX3A 4PV6A 1S7KA 4AG7A 4PK2A 4UWJA 4CAXA 4CGLA 1PUAA 4U9YA 4QBJA 4R87A 2I00A 2HV2A 2Q7BA 1I12A 1YREA 2ARHA 2PSWA 4CGPA 2NMTA 3PGPA 2VI7A 3D2MA 2GIVA 3GKRA 4JXRA 4MY0A 1B87A 4BMHA 2F5IA 3F8KA 4MFPA 2ZW6A 3PZJA 3ZJ0A 2GANA 1XF8A 1Y7RA 2JEVA 1S7LA 2CY2A 2JDDA 4A30A 1IB1E 4JD6A 2Q4YA 4H6UA 3S6KA 1UFHA 2VZZA 5F46A 2RC4A 5A28A 3FRMA 3R96A 1R57A 3KKWA 1QSOA 4KOTA 2Q0YA 4R3LA 2X7BA 4FD6A 2PRBA 4B12A 2PQ8A 1KUXA 1P4NA 3TOBA 3D8PA 1BO4A 4R9MA 4B13A 4OADA 2R8VA 4KVME 4CYQA 4OLLA 5EBVA 4J3GA 5AG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I1D A;  4F0Y A;  2REE A;  1NE9 A;  4ZBG A;  3TCV A;  2FSR A;  1YLE A;  2ZPA A;  3C26 A;  1XEB A;  4LX9 A;  2ATR A;  3JVN A;  2Z0Z A;  3MGD A;  2A4N A;  4E2A A;  5I0C A;  3IGR A;  2QIR A;  1M1D A;  4MJ8 A;  4MI4 A;  4NEX A;  4KOV A;  4PSX A;  4NF1 A;  5F49 A;  3LOD A;  2Z10 A;  1IID A;  1MK4 A;  3F5B A;  4L8A A;  2I79 A;  4EVY A;  1Z4E A;  4M3S A;  3S6G A;  3N7Z A;  4XPL A;  1BOB A;  1S3Z A;  1Y9W A;  2IL4 A;  2VQY A;  2P6E A;  1RO5 A;  2CNM A;  3FNC A;  4OAE A;  1QSR A;  1GHE A;  2CNT A;  4YGO A;  1MJB A;  1N71 A;  4QB9 A;  2BSW A;  2OB0 A;  3I3G A;  1XIX A;  2JLM A;  3T90 A;  1XMT A;  3PP9 A;  4UBR A;  4XPD B;  2ZW7 A;  5C88 A;  3GYA A;  4CS0 B;  3NE7 A;  4JLY A;  5EC4 A;  3EY5 A;  4MBU A;  4Y49 B;  2Q04 A;  2B3V A;  4HKF A;  4M85 A;  5JPH A;  4L89 A;  4LUA A;  3EXN A;  5F48 A;  2G3T A;  3DR8 A;  3EO4 A;  2R1I A;  3DDD A;  5E96 A;  1YR0 A;  2JDC A;  4UA3 A;  3CXP A;  4I49 A;  4RI1 A;  2QML A;  2VBQ A;  4MY3 A;  1IIC A;  1FY7 A;  5C82 A;  4ONU A;  1M4I A;  2OH1 A;  4B5O A;  4DNC A;  2Y0M A;  4E8O A;  1K4J A;  2J8N A;  2R7H A;  4CRZ B;  5CNP A;  4YRH A;  4H6Z A;  2P6G A;  3FXT A;  1YGH A;  4E0A A;  2C27 A;  2Z11 A;  3EC4 A;  4X5K A;  4AB7 A;  4UWI A;  4XNH B;  2B3U A;  2PDO A;  4AG9 A;  5KTA A;  3JUW A;  1LRZ A;  1Q2C A;  5ISV A;  1QST A;  1S7F A;  1YVO A;  3DSB A;  3F0A A;  2VEZ A;  3CXQ A;  1XE4 A;  1TIQ A;  3OWC A;  1YX0 A;  4F6A A;  3VWD A;  2Q44 A;  4IUS A;  4PSW A;  3P2F A;  4KOR A;  4KOW A;  3R9G A;  4KLV A;  3TO9 A;  2P6F A;  4YFJ A;  2FIW A;  5HMN A;  5J8F A;  4ORF A;  1M4D A;  2K5T A;  3FB3 A;  2PC1 A;  2FIA A;  1WK4 A;  3D2P A;  2HQY A;  2PR1 A;  5IB0 A;  1MJA A;  1S7N A;  5IV0 A;  5KTD A;  2FXF A;  4KVO E;  2AJ6 A;  4JWP A;  4QUS A;  3TTH A;  2WPX A;  1M4G A;  2ZXV A;  3TFY A;  2D4O A;  4FD7 A;  2Q4V A;  3FYN A;  1P0H A;  3EFA A;  4KVX A;  4FD5 A;  3V8I A;  1NMT A;  2B58 A;  4R3K A;  2BL1 A;  4KOU A;  4MHD A;  1S5K A;  4II9 A;  5GCN A;  1I21 A;  4KLW A;  3FBU A;  2ZW5 A;  3BJ8 A;  2B4B A;  3P2H A;  1KUV A;  2VXK A;  1V0C A;  2D4P A;  2QEC A;  3IWG A;  3SXN A;  3VWE A;  3ZZI A;  4NCZ A;  2BUE A;  1J4J A;  4QVT A;  2OZH A;  3GY9 A;  2WPW A;  3CXS A;  1S60 A;  2FCK A;  3RYO A;  5F47 A;  4QC6 A;  3WR7 A;  3G8W A;  4NXY A;  3W6S A;  4KUB A;  2OU2 A;  4RS2 A;  2H5M A;  2KCW A;  3T9Y A;  3QB8 A;  4XPK A;  5H84 A;  1Q2Y A;  3QAH A;  5HH1 A;  4FD4 A;  1QSN A;  2PR8 A;  5DWN A;  4U9Z A;  3SXO A;  1MJ9 A;  4KUA A;  1IYK A;  2G3A A;  1CM0 A;  2EVN A;  1VKC A;  1VHS A;  5J8C A;  3DNS A;  2B4D A;  4XNH C;  4HNW B;  2FE7 A;  4PK3 A;  1NSL A;  4GS4 A;  5KTC A;  5DWM A;  3R9F A;  2B5G A;  2B4D B;  3B8G A;  5H86 A;  1Z9U A;  3TO7 A;  3BLN A;  1KZF A;  2B5G B;  1PU9 A;  2OZG A;  4B5P A;  3K9U A;  4IF5 A;  3TO6 A;  3D3S A;  1CJW A;  3R95 A;  3FIX A;  2O28 A;  3W91 A;  3S6F A;  1QSM A;  4B5P B;  2J8R A;  4JXQ A;  5JQ4 A;  1KUY A;  3H4Q A;  1YVK A;  2EUI A;  4AVC A;  4NSQ A;  1Y9K A;  2FL4 A;  4JJX A;  1SQH A;  1B6B A;  2CNS A;  5FVJ A;  4AVB A;  3R9E A;  4CAW A;  3BJ7 A;  1Z4R A;  3G3S A;  2FT0 A;  3R1K A;  1OZP A;  3UY5 A;  3TE4 A;  4HNY B;  2FS5 A;  3DR6 A;  4AVA A;  1WWZ A;  3E0K A;  2J8M A;  2R98 A;  4KZT A;  1M44 A;  1RXT A;  4HNX B;  2AE6 A;  2VZY A;  1U6M A;  2OZU A;  2ZW4 A;  2G0B A;  3S6H A;  1L0C A;  4XPD C;  4KOX A;  2P0W A;  2GE3 A;  3TOA A;  1ON0 A;  4CRY B;  4CAV A;  4R57 A;  4Y49 C;  2HUZ A;  3TT2 A;  1IYL A;  2DXQ A;  3I9S A;  1Q2D A;  3W6X A;  3LD2 A;  4KOY A;  1YK3 A;  2BEI A;  4U5Y A;  3SHP A;  4H89 A;  2REF A;  4K30 A;  4KOS A;  5IX3 A;  4PV6 A;  1S7K A;  4AG7 A;  4PK2 A;  4UWJ A;  4CAX A;  1PUA A;  4U9Y A;  4QBJ A;  4R87 A;  2I00 A;  2HV2 A;  2Q7B A;  1I12 A;  1YRE A;  2ARH A;  2PSW A;  2NMT A;  3PGP A;  2VI7 A;  3D2M A;  2GIV A;  3GKR A;  4JXR A;  4MY0 A;  1B87 A;  4BMH A;  2F5I A;  3F8K A;  2ZW6 A;  3PZJ A;  3ZJ0 A;  2GAN A;  1XF8 A;  1Y7R A;  2JEV A;  1S7L A;  2CY2 A;  2JDD A;  1IB1 E;  4JD6 A;  2Q4Y A;  4H6U A;  3S6K A;  1UFH A;  2VZZ A;  5F46 A;  2RC4 A;  3FRM A;  3R96 A;  1R57 A;  3KKW A;  1QSO A;  4KOT A;  2Q0Y A;  4R3L A;  2X7B A;  4FD6 A;  2PRB A;  2PQ8 A;  1KUX A;  1P4N A;  3TOB A;  3D8P A;  1BO4 A;  4R9M A;  4OAD A;  2R8V A;  4KVM E;  4OLL A;  5EBV A;  4J3G A; 
#chains in the Genus database with same CATH topology
 1KWM A;  1TKF A;  1I1D A;  4F0Y A;  4B11 A;  2REE A;  2ZED A;  1Y7E A;  2PJ8 A;  1NE9 A;  1YSJ A;  2IQ6 A;  4ZBG A;  3TCV A;  4B6Z A;  2FSR A;  1YLE A;  1Q7L A;  4MFZ A;  2ZPA A;  3FVL A;  5G22 A;  3C26 A;  1XEB A;  4LX9 A;  3KZW A;  2ATR A;  5BWA B;  3JVN A;  5LYD A;  2Z3N A;  3B35 A;  5LRG A;  5LYL A;  2Z0Z A;  3MGD A;  4NJR A;  2A4N A;  4CAE A;  4E2A A;  5I0C A;  3IGR A;  2QIR A;  3IO1 A;  1M1D A;  4MJ8 A;  3KQZ A;  3SI1 A;  1IY7 A;  2ZEO A;  4MI4 A;  3NH8 A;  2V8H A;  4NEX A;  4KOV A;  3B2Y A;  3VAT A;  4NGN A;  4PSX A;  3PB9 X;  1X10 A;  3KQX A;  5K8P A;  3NA6 A;  4NF1 A;  1GYT A;  5F49 A;  2PJA A;  3LOD A;  5LRK A;  4A95 A;  2Z10 A;  1IID A;  1MK4 A;  3F5B A;  2AFO A;  2I79 A;  3FEE A;  1ZO0 A;  4L8A A;  4P6Y A;  2BO9 A;  4EVY A;  1Z4E A;  4M3S A;  1Z8X A;  3S6G A;  3KGQ A;  4BBH A;  3N7Z A;  4ZY0 A;  4DUK A;  1BLL E;  4IK2 A;  4XPL A;  1BOB A;  4NGP A;  1Z8W A;  4B10 A;  4UIB A;  4DYO A;  3IWW A;  4OC1 A;  4R7M A;  4BD9 A;  1S3Z A;  4NGR A;  4FWU A;  1Y9W A;  4F0X A;  2IL4 A;  2VQY A;  1YW6 A;  5HVH A;  4A2Z A;  2P6E A;  1FT7 A;  3TFY A;  1ARM A;  1RO5 A;  5THW A;  3NFZ A;  2CNM A;  3NE8 A;  3FNC A;  4OAE A;  2NSM A;  1QSR A;  1GHE A;  5HXD A;  2CNT A;  3IWE A;  4YGO A;  4R8F A;  1MJB A;  1N71 A;  3KHX A;  4C2Y A;  4QB9 A;  2BSW A;  2OB0 A;  2VL1 A;  3I3G A;  1XIX A;  3B7I A;  3SI0 A;  2JLM A;  2XEI A;  1QMU A;  4X8I A;  5AGE A;  3T90 A;  1XMT A;  2ZOG A;  3PP9 A;  4KSI A;  4UBR A;  4XPD B;  2ZW7 A;  2ANP A;  4UIA A;  3SJG A;  5C88 A;  2BOA A;  3GYA A;  2ZOF A;  4CS0 B;  1YQE A;  2EK9 A;  4MFQ A;  4CGN A;  1JQG A;  3NE7 A;  1TF8 A;  4MXU A;  4JLY A;  4MHY A;  5G21 A;  5EC4 A;  1YLO A;  3EY5 A;  4MBU A;  2YGW A;  5K8O A;  4X3R A;  4OC4 A;  4Y49 B;  6CPA A;  2Q04 A;  2B3V A;  2C6P A;  4HKF A;  4M85 A;  5JPH A;  4L89 A;  1M4L A;  4A33 A;  2QYV A;  5G20 A;  2WSA A;  4LUA A;  3EXN A;  5F48 A;  3RNZ A;  2EBJ A;  2G3T A;  3DR8 A;  3EO4 A;  2R1I A;  3DDD A;  1PYT B;  1CPX A;  1VHO A;  2PJ9 A;  2ODF A;  2GLF A;  5E96 A;  3H8G A;  1YR0 A;  3D67 A;  2J9A A;  4YWY A;  2JDC A;  4UA3 A;  3CXP A;  4I49 A;  3LAC A;  4RI1 A;  2QML A;  8CPA A;  2VBQ A;  4MY3 A;  1IIC A;  4NGM A;  1FY7 A;  1IGB A;  5C82 A;  1ZG8 A;  4MCS A;  4MCR A;  1FNO A;  2FVG A;  4ONU A;  4CAF A;  1M4I A;  2PJ0 A;  2C6G A;  4ZY1 A;  4F9U A;  4P4J A;  3KHZ A;  2OH1 A;  1NSA A;  4B5O A;  4MHZ A;  2EK8 A;  2Y0M A;  4DNC A;  5I4M A;  4E8O A;  1K4J A;  3IC1 A;  4EFD A;  4OKO A;  2J8N A;  3H8F A;  2R7H A;  4CRZ B;  4ZGY B;  1F57 A;  3B3S A;  5CNP A;  4YRH A;  4H6Z A;  4NJQ A;  4ZYQ A;  2P6G A;  3WT4 A;  3FXT A;  1HEE A;  1LFW A;  1YGH A;  4E0A A;  2ZEP A;  4ONW A;  4LQG A;  3A9L A;  2C27 A;  2Z3O A;  2Z11 A;  3EC4 A;  4X5K A;  4AB7 A;  4UWI A;  4XNH B;  2B3U A;  2PDO A;  2Q4Z A;  2Z3P A;  4MMO A;  4PXD A;  3WC5 A;  3D4U A;  2DF5 A;  2JBK A;  4AG9 A;  5KTA A;  3CZX A;  3FH4 A;  3DLJ A;  4F8Z A;  1IOI A;  2IMO A;  2WUU A;  4WWV A;  4C7I A;  1Z5R A;  4K3N A;  3JUW A;  1LRZ A;  2F8H A;  1Q2C A;  5ISV A;  1QST A;  1S7F A;  1CP7 A;  3B3V A;  1VGY A;  1YVO A;  3CPA A;  3DSB A;  3F0A A;  2VEZ A;  3CXQ A;  3KR4 A;  2OOT A;  1OBR A;  1XE4 A;  1EE3 P;  5AG4 A;  1TIQ A;  1XJO A;  3OWC A;  3IEH A;  1YX0 A;  4F6A A;  4G1P A;  5AG7 A;  2YNC A;  2PJB A;  4DJL A;  1HDQ A;  3D7H A;  3N5F A;  3VWD A;  2Q44 A;  4IUS A;  4PSW A;  2ZEF A;  2F7V A;  3KI9 A;  3P2F A;  4KOR A;  3WAB A;  4KOW A;  1JWQ A;  3R9G A;  4KLV A;  4OP4 A;  1LCP A;  3TO9 A;  3V38 A;  1XFO A;  2PJC A;  2IJZ A;  4R76 A;  2C1C A;  2P6F A;  3GLJ A;  4C2X A;  4C68 A;  2Z3M A;  1TKJ A;  1TKH A;  3CDX A;  4YFJ A;  2FIW A;  4A31 A;  2I3C A;  4OID A;  5HMN A;  5J8F A;  5D29 A;  3NH4 A;  4ORF A;  3D7G A;  1M4D A;  1X12 A;  4MFK A;  3TX8 A;  2K5T A;  5K8N A;  3FJU A;  3FB3 A;  3RZA A;  2PC1 A;  2FIA A;  1WK4 A;  3D2P A;  3H5Z A;  4UFV A;  2HQY A;  1AMP A;  2PR1 A;  3I1U A;  4KSF A;  1BPN A;  1MJA A;  1S7N A;  4ZX8 A;  4ZI6 A;  5IB0 A;  3PB8 X;  5IV0 A;  4CGO A;  2Q51 A;  3S9M A;  5KTD A;  3WC7 A;  4FUU A;  2FXF A;  4F9V A;  4KVO E;  4OC5 A;  2AJ6 A;  4JWP A;  1ZG7 A;  3QAY A;  4QUS A;  4A94 A;  1IU8 A;  2CF4 A;  2BCO A;  3JTK A;  3GB0 A;  4UFX A;  2PIZ A;  3TTH A;  2WPX A;  1M4G A;  4UEE A;  4UFW A;  3LMS A;  2AFZ A;  4O23 A;  3HLP A;  2ZXV A;  3PB7 X;  2D4O A;  2ABZ A;  2OR4 A;  2PJ1 A;  1ZLH A;  2GLJ A;  4TNU A;  3VAR A;  4FD7 A;  5G1Z A;  2Q4V A;  3FYN A;  3RAM A;  1P0H A;  1CBX A;  4UCM A;  1VHE A;  5HVF A;  3EFA A;  4A32 A;  4C2Z A;  2Z3L A;  4JZ0 A;  4KVX A;  4C7H A;  5A27 A;  4X2T A;  4KS9 A;  2WZN A;  4EME A;  4FD5 A;  3FX6 A;  3V8I A;  1NMT A;  3BXM A;  2B58 A;  2V8G A;  2Z3K A;  3IFE A;  3LWU A;  4R3K A;  2PJ5 A;  4IHM A;  3IU2 A;  2BL1 A;  2PVW A;  3PBB A;  4KOU A;  1S5K A;  3FED A;  4MHD A;  4MCQ A;  4II9 A;  4B14 A;  5GCN A;  1XBU A;  4CGM A;  4EWT A;  4P4F A;  5JH9 A;  1I21 A;  4KLW A;  1YW4 A;  3FBU A;  5EBV A;  3V7Z A;  3MN8 A;  3T8W A;  4Q38 A;  2ZW5 A;  1PCA A;  3BJ8 A;  2B4B A;  3P2H A;  1KUV A;  1XMB A;  2VXK A;  1V0C A;  2D4P A;  3HUV A;  2PRQ A;  4OC3 A;  2QEC A;  3FEC A;  3IWG A;  3L2N A;  4BIN A;  3SXN A;  4NGQ A;  3VWE A;  2PCU A;  1Y0R A;  3ZZI A;  2ZEM A;  4NCZ A;  2BUE A;  1J4J A;  2DPT A;  4UEZ A;  3H8E A;  1CG2 A;  4MFL A;  4QVT A;  2OZH A;  3SJX A;  3GY9 A;  2WPW A;  3CXS A;  3RBU A;  1S60 A;  2FCK A;  4PXC A;  4A39 A;  4MCP A;  3RYO A;  5F47 A;  4QC6 A;  3WR7 A;  3G8W A;  3S9L A;  2ZEE A;  4NXY A;  3W6S A;  2AFW A;  4AXV A;  4KUB A;  2OU2 A;  2PJ7 A;  4RS2 A;  4OME A;  2H5M A;  2Q43 A;  2V8V A;  2KCW A;  3T9Y A;  3B3C A;  3QB8 A;  4XPK A;  5H84 A;  4UCN A;  1Q2Y A;  2V77 A;  1Z2L A;  3DGV A;  3QAH A;  4W9Y A;  4FD4 A;  5HH1 A;  1QSN A;  2PR8 A;  2YNE A;  2AFX A;  3BHX A;  4U9Z A;  5DWN A;  3IU1 A;  3SXO A;  3TC8 A;  5F09 A;  1MJ9 A;  3FF3 A;  2AFU A;  4KUA A;  1IYK A;  2PIY A;  1XRY A;  3QNV A;  2XEG A;  2G3A A;  1LAP A;  1CM0 A;  4CPA A;  2EVN A;  4FAI A;  1VKC A;  1A2Z A;  3IIB A;  1VHS A;  5J8C A;  1DE4 C;  3DNS A;  4MFJ A;  2B4D A;  1ELM P;  4XNH C;  4HNW B;  2AFS A;  2FE7 A;  2XEF A;  4PK3 A;  1NSL A;  2YND A;  4GS4 A;  3JRU A;  2HB6 A;  2ZEH A;  1ZG9 A;  2GU2 A;  5KTC A;  5DWM A;  3R9F A;  4CYO A;  2B5G A;  2B4D B;  3D68 A;  4UCP A;  4Q36 A;  3B8G A;  3K9T A;  1Z9U A;  5H86 A;  5CBM A;  3ISX A;  3TO7 A;  3BLN A;  3B3T A;  1KZF A;  2B5G B;  1PU9 A;  2OZG A;  4WJB A;  4B5P A;  3KL9 A;  5CPA A;  3K9U A;  1XOV A;  4IF5 A;  3D3S A;  3TO6 A;  1CJW A;  2RFH A;  3R95 A;  3FIX A;  4P4B A;  4PPZ A;  2QVP A;  2O28 A;  3W91 A;  5ELY A;  5D8N A;  3S6F A;  1QSM A;  2PJ4 A;  4GXH A;  4A38 A;  2J8R A;  4JXQ A;  4B5P B;  3KR5 A;  1DTD A;  5JQ4 A;  5EMI A;  4NFR A;  1KUY A;  2QJ8 A;  3H4Q A;  1YVK A;  2EO8 A;  1CP6 A;  2YNC C;  2DPS A;  2EUI A;  4P4E A;  4AVC A;  4NSQ A;  1Y9K A;  2FL4 A;  4JJX A;  5HVG A;  1SQH A;  1B6B A;  4H2K A;  4PQA A;  5LRJ A;  1UWY A;  4FBE A;  2JBJ A;  2XEJ A;  2CNS A;  5FVJ A;  4AVB A;  3R9E A;  3NH5 A;  4CAW A;  4RN7 A;  3BJ7 A;  3SJE A;  1Z4R A;  3G3S A;  2FT0 A;  3R1K A;  5JGF A;  1OZP A;  3FMC A;  3UY5 A;  4TWE A;  3MRU A;  4YU9 A;  3TE4 A;  2NYQ A;  2CXA A;  4HNY B;  2FS5 A;  5DS0 A;  2C6C A;  2O53 A;  1ELL P;  3WC6 A;  3DR6 A;  4NGS A;  3VH9 A;  1YME A;  4AVA A;  4OC0 A;  1WWZ A;  3E0K A;  2ZEG A;  4M6H A;  4IAV A;  2POK A;  2J8M A;  2R98 A;  4KZT A;  4Q7A A;  1M44 A;  1LOK A;  1RXT A;  1LAN A;  3CT9 A;  4HNX B;  1F2O A;  5AG5 A;  4CYP A;  5K8M A;  2AE6 A;  2VZY A;  2GFQ A;  1U6M A;  5JM6 A;  1VIX A;  3S9N A;  2OZU A;  2ZW4 A;  4KSA A;  2G0B A;  3ISZ A;  1L0C A;  3PB4 X;  4XPD C;  3GIU A;  1TXR A;  4KOX A;  3S6H A;  2P0W A;  2GE3 A;  3TOA A;  1ON0 A;  4PXB A;  4NGT A;  4UEF A;  1BPM A;  3RO0 A;  4CRY B;  3BI1 A;  4CAV A;  4A37 A;  2PJ2 A;  3GUX A;  2V8D A;  2AFM A;  3CPX A;  4R57 A;  4Y49 C;  2HUZ A;  3TT2 A;  1IYL A;  2DXQ A;  3I9S A;  1Q2D A;  3W6X A;  3LD2 A;  4KOY A;  1YK3 A;  7CPA A;  2BEI A;  4U5Y A;  3SHP A;  4H89 A;  1Z8T A;  2REF A;  2RB7 A;  4K30 A;  3PFO A;  1Z8L A;  4KOS A;  4CYN A;  1HDU A;  4RUH A;  5IX3 A;  4PV6 A;  5J1Q A;  1ZLI A;  3PBE A;  1S7K A;  4GM5 A;  4AG7 A;  4PK2 A;  4UWJ A;  4CAX A;  4CGL A;  4P4I A;  1Y0Y A;  1TF9 A;  4P4D A;  1PUA A;  4U9Y A;  3PEI A;  4LQ6 A;  4ZY2 A;  4QBJ A;  3KAS A;  4R87 A;  2I00 A;  2PJ3 A;  2EWB A;  2HV2 A;  2O4H A;  2CTB A;  3PFE A;  5LYI A;  1RTQ A;  2G9D A;  2Q7B A;  2DEA A;  1I12 A;  1R43 A;  1YRE A;  3SJF A;  2WYR A;  2ARH A;  2PSW A;  1QQ9 A;  4CGP A;  2NMT A;  3PGP A;  2VI7 A;  1BAV A;  3D2M A;  1IOF A;  2GIV A;  3GKR A;  4JXR A;  4MY0 A;  1AUG A;  4OIW A;  1B87 A;  2CIJ A;  2HC9 A;  2F5I A;  4BMH A;  3F8K A;  4MFP A;  2ZW6 A;  3PZJ A;  4MHP A;  3ZJ0 A;  2GAN A;  1XF8 A;  3SI2 A;  2PJ6 A;  1Y7R A;  2JEV A;  4M6I A;  1AYE A;  1S7L A;  2CY2 A;  2JDD A;  3BI0 A;  4A30 A;  1F2P A;  3D7D A;  4ZX9 A;  2PVV A;  1IB1 E;  4MRI A;  4JD6 A;  3IJ3 A;  2Q4Y A;  4H6U A;  4P10 A;  1R3N A;  1UFH A;  3S6K A;  2VZZ A;  5F46 A;  5IB9 A;  3PB6 X;  1CPS A;  2RC4 A;  2ZEN A;  4P45 A;  4Z65 A;  5A28 A;  3K2K A;  4M6G A;  3FRM A;  3R96 A;  4JYW A;  4OC2 A;  4P44 A;  1H8L A;  1R57 A;  3KKW A;  1QSO A;  3PRT A;  4KOT A;  2CTC A;  2Q0Y A;  5LYF A;  3B3W A;  4R6T A;  4R3L A;  2ZEL A;  2X7B A;  1ARL A;  4FD6 A;  2PRB A;  4B12 A;  2PQ8 A;  2PE3 A;  3D66 A;  1KUX A;  1P4N A;  3D7F A;  3TOB A;  4HPS A;  3D8P A;  1BO4 A;  4R9M A;  2GRE A;  4PXE A;  4B13 A;  1LAM A;  4OAD A;  4MHN A;  2R8V A;  1CX8 A;  4KVM E;  2Q7S A;  4CYQ A;  2JEW A;  4OLL A;  4UF4 A;  4J3G A;  5AG6 A; 
#chains in the Genus database with same CATH homology
 1I1D A;  4F0Y A;  4B11 A;  2REE A;  1NE9 A;  4ZBG A;  3TCV A;  2FSR A;  1YLE A;  4MFZ A;  2ZPA A;  5G22 A;  3C26 A;  1XEB A;  4LX9 A;  2ATR A;  5BWA B;  3JVN A;  2Z3N A;  2Z0Z A;  3MGD A;  2A4N A;  4CAE A;  4E2A A;  5I0C A;  3IGR A;  2QIR A;  1M1D A;  4MJ8 A;  4MI4 A;  4NEX A;  4KOV A;  4PSX A;  4NF1 A;  5F49 A;  3LOD A;  4A95 A;  2Z10 A;  1IID A;  1MK4 A;  3F5B A;  4L8A A;  2I79 A;  4EVY A;  1ZO0 A;  1Z4E A;  4M3S A;  3S6G A;  4BBH A;  3N7Z A;  4XPL A;  1BOB A;  4B10 A;  1S3Z A;  1Y9W A;  4F0X A;  2IL4 A;  2VQY A;  4A2Z A;  2P6E A;  1RO5 A;  2CNM A;  3FNC A;  4OAE A;  1QSR A;  1GHE A;  2CNT A;  3IWE A;  4YGO A;  1MJB A;  1N71 A;  4C2Y A;  4QB9 A;  2BSW A;  2OB0 A;  3I3G A;  1XIX A;  2JLM A;  3T90 A;  5AGE A;  1XMT A;  3PP9 A;  4UBR A;  4XPD B;  2ZW7 A;  5C88 A;  3GYA A;  4CS0 B;  4MFQ A;  4CGN A;  3NE7 A;  4JLY A;  5G21 A;  5EC4 A;  3EY5 A;  4MBU A;  2YGW A;  4Y49 B;  2Q04 A;  2B3V A;  4HKF A;  4M85 A;  5JPH A;  4L89 A;  4A33 A;  5G20 A;  2WSA A;  4LUA A;  3EXN A;  5F48 A;  2G3T A;  3DR8 A;  3EO4 A;  2R1I A;  3DDD A;  5E96 A;  1YR0 A;  2JDC A;  4UA3 A;  3CXP A;  4I49 A;  4RI1 A;  2QML A;  2VBQ A;  4MY3 A;  1IIC A;  1FY7 A;  5C82 A;  4ONU A;  4CAF A;  1M4I A;  2OH1 A;  4B5O A;  4DNC A;  2Y0M A;  4E8O A;  1K4J A;  2J8N A;  2R7H A;  4CRZ B;  4ZGY B;  5CNP A;  4YRH A;  4H6Z A;  2P6G A;  3FXT A;  1YGH A;  4E0A A;  3A9L A;  2C27 A;  2Z3O A;  2Z11 A;  3EC4 A;  4X5K A;  4AB7 A;  4UWI A;  4XNH B;  2B3U A;  2PDO A;  2Z3P A;  4AG9 A;  5KTA A;  2WUU A;  4C7I A;  3JUW A;  1LRZ A;  1Q2C A;  5ISV A;  1QST A;  1S7F A;  1YVO A;  3DSB A;  3F0A A;  2VEZ A;  3CXQ A;  1XE4 A;  5AG4 A;  1TIQ A;  3OWC A;  1YX0 A;  4F6A A;  5AG7 A;  2YNC A;  3VWD A;  2Q44 A;  4IUS A;  4PSW A;  3P2F A;  4KOR A;  4KOW A;  3R9G A;  4KLV A;  3TO9 A;  2P6F A;  4C2X A;  4C68 A;  2Z3M A;  4YFJ A;  2FIW A;  4A31 A;  5HMN A;  5J8F A;  4ORF A;  1M4D A;  4MFK A;  2K5T A;  3FB3 A;  2PC1 A;  2FIA A;  1WK4 A;  3D2P A;  3H5Z A;  4UFV A;  2HQY A;  2PR1 A;  4KSF A;  5IB0 A;  1MJA A;  1S7N A;  5IV0 A;  4CGO A;  5KTD A;  2FXF A;  4KVO E;  2AJ6 A;  4JWP A;  4QUS A;  3JTK A;  4UFX A;  3TTH A;  2WPX A;  1M4G A;  4UFW A;  2ZXV A;  3TFY A;  2D4O A;  4FD7 A;  5G1Z A;  2Q4V A;  3FYN A;  1P0H A;  4UCM A;  4A32 A;  3EFA A;  4C2Z A;  2Z3L A;  4C7H A;  4KVX A;  5A27 A;  4KS9 A;  4FD5 A;  3V8I A;  1NMT A;  2B58 A;  2Z3K A;  4R3K A;  3IU2 A;  2BL1 A;  4KOU A;  4MHD A;  1S5K A;  4II9 A;  4B14 A;  5GCN A;  4CGM A;  1I21 A;  4KLW A;  3FBU A;  4Q38 A;  2ZW5 A;  3BJ8 A;  2B4B A;  3P2H A;  1KUV A;  2VXK A;  1V0C A;  2D4P A;  2QEC A;  3IWG A;  3SXN A;  3VWE A;  3ZZI A;  4NCZ A;  2BUE A;  1J4J A;  2DPT A;  4MFL A;  4QVT A;  2OZH A;  3GY9 A;  2WPW A;  3CXS A;  1S60 A;  2FCK A;  3RYO A;  5F47 A;  4QC6 A;  3WR7 A;  3G8W A;  4NXY A;  3W6S A;  4KUB A;  2OU2 A;  4RS2 A;  2H5M A;  2KCW A;  3T9Y A;  3QB8 A;  4XPK A;  5H84 A;  4UCN A;  1Q2Y A;  3QAH A;  5HH1 A;  4FD4 A;  1QSN A;  2PR8 A;  2YNE A;  4U9Z A;  5DWN A;  3SXO A;  3IU1 A;  1MJ9 A;  4KUA A;  1IYK A;  2G3A A;  1CM0 A;  2EVN A;  1VKC A;  1VHS A;  5J8C A;  4MFJ A;  3DNS A;  2B4D A;  4XNH C;  4HNW B;  2FE7 A;  4PK3 A;  1NSL A;  2YND A;  4GS4 A;  5KTC A;  5DWM A;  3R9F A;  4CYO A;  2B5G A;  2B4D B;  4UCP A;  4Q36 A;  3B8G A;  5H86 A;  1Z9U A;  3TO7 A;  3BLN A;  1KZF A;  2B5G B;  1PU9 A;  2OZG A;  4B5P A;  3K9U A;  4IF5 A;  3TO6 A;  3D3S A;  1CJW A;  3R95 A;  3FIX A;  2O28 A;  3W91 A;  3S6F A;  1QSM A;  4B5P B;  2J8R A;  4JXQ A;  5JQ4 A;  1KUY A;  3H4Q A;  1YVK A;  2YNC C;  2DPS A;  2EUI A;  4AVC A;  4NSQ A;  1Y9K A;  2FL4 A;  4JJX A;  1SQH A;  1B6B A;  2CNS A;  5FVJ A;  4AVB A;  3R9E A;  4CAW A;  3BJ7 A;  1Z4R A;  3G3S A;  2FT0 A;  3R1K A;  1OZP A;  3UY5 A;  3TE4 A;  2CXA A;  4HNY B;  2FS5 A;  3DR6 A;  4AVA A;  1WWZ A;  3E0K A;  2J8M A;  2R98 A;  4KZT A;  1M44 A;  1RXT A;  4HNX B;  5AG5 A;  4CYP A;  2AE6 A;  2VZY A;  1U6M A;  2OZU A;  2ZW4 A;  4KSA A;  2G0B A;  3S6H A;  1L0C A;  4XPD C;  4KOX A;  2P0W A;  2GE3 A;  3TOA A;  1ON0 A;  4CRY B;  4CAV A;  4R57 A;  4Y49 C;  2HUZ A;  3TT2 A;  1IYL A;  2DXQ A;  3I9S A;  1Q2D A;  3W6X A;  3LD2 A;  4KOY A;  1YK3 A;  2BEI A;  4U5Y A;  3SHP A;  4H89 A;  2REF A;  4K30 A;  4KOS A;  4CYN A;  5IX3 A;  4PV6 A;  1S7K A;  4AG7 A;  4PK2 A;  4UWJ A;  4CAX A;  4CGL A;  1PUA A;  4U9Y A;  4QBJ A;  4R87 A;  2I00 A;  2HV2 A;  2Q7B A;  1I12 A;  1YRE A;  2ARH A;  2PSW A;  4CGP A;  2NMT A;  3PGP A;  2VI7 A;  3D2M A;  2GIV A;  3GKR A;  4JXR A;  4MY0 A;  1B87 A;  4BMH A;  2F5I A;  3F8K A;  4MFP A;  2ZW6 A;  3PZJ A;  3ZJ0 A;  2GAN A;  1XF8 A;  1Y7R A;  2JEV A;  1S7L A;  2CY2 A;  2JDD A;  4A30 A;  1IB1 E;  4JD6 A;  2Q4Y A;  4H6U A;  3S6K A;  1UFH A;  2VZZ A;  5F46 A;  2RC4 A;  5A28 A;  3FRM A;  3R96 A;  1R57 A;  3KKW A;  1QSO A;  4KOT A;  2Q0Y A;  4R3L A;  2X7B A;  4FD6 A;  2PRB A;  4B12 A;  2PQ8 A;  1KUX A;  1P4N A;  3TOB A;  3D8P A;  1BO4 A;  4R9M A;  4B13 A;  4OAD A;  2R8V A;  4KVM E;  4CYQ A;  4OLL A;  5EBV A;  4J3G A;  5AG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...