5FVJA

Crystal structure of tact (trna acetylating toxin) from salmonella
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
165
structure length
165
Chain Sequence
GPGGTMGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNMPDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFFIHHGFKSSQTQQRTLFLRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PUTATIVE ACETYLTRANSFERASE
publication title A Salmonella Toxin Promotes Persister Formation Through Acetylation of tRNA.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 44
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5fvjA00
3LD2A 4AG7A 2BL1A 4JXRA 3W91A 2D4OA 2WPXA 3G3SA 3TCVA 2A4NA 1PU9A 1M44A 1IICA 2R1IA 4KUBA 1QSOA 2VZZA 1OZPA 4KOYA 3FXTA 3JUWA 4II9A 2ZW6A 2J8RA 2CY2A 2ZW7A 2Q44A 4CRYB 3DR6A 5JQ4A 3DSBA 1XEBA 4KORA 4XPKA 4KOSA 3UY5A 1L0CA 2OZUA 3QAHA 4Y49B 2Q0YA 4XPDB 4IF5A 2JLMA 3EFAA 4FD6A 1MJ9A 3F8KA 4Y49C 5H84A 1BOBA 2I00A 3IWGA 3R96A 3EXNA 3CXPA 4E0AA 4I49A 2ZPAA 4UA3A 1WK4A 4U9YA 3FIXA 1B6BA 3TT2A 1YR0A 3GKRA 4KOWA 1XE4A 2ZW4A 3I9SA 4HNXB 2JEVA 4CS0B 1YVOA 3TTHA 4QVTA 3BJ8A 4OLLA 2Y0MA 5C82A 4HNYB 2VXKA 2CNSA 3FNCA 4NCZA 4JWPA 2REEA 2FSRA 1S7FA 3DDDA 3WR7A 3E0KA 5F47A 2OH1A 4R9MA 3EY5A 2B5GA 3TO9A 2X7BA 1CM0A 2PSWA 3TO7A 1M1DA 1MJAA 4R3KA 1QSNA 4H6ZA 1B87A 2OZGA 4X5KA 3EO4A 3K9UA 4U5YA 2GIVA 2R98A 2ZW5A 2JDDA 2KCWA 1RXTA 4FD5A 4CAXA 4YGOA 4H6UA 2HV2A 4E8OA 4KZTA 1CJWA 3R9GA 3SXOA 2WPWA 5KTDA 5ISVA 4U9ZA 3MGDA 4NXYA 2AJ6A 1Y9WA 2Q4YA 3ZJ0A 4MBUA 3VWEA 1LRZA 4HNWB 4KUAA 3RYOA 4JXQA 3DR8A 4KVME 3R1KA 5KTAA 4R3LA 4PSXA 2FE7A 5F46A 1YK3A 2R8VA 5IB0A 5IV0A 2FIWA 2D4PA 1KUYA 3OWCA 3VWDA 2G0BA 2B58A 4MHDA 4QUSA 2B3UA 3FRMA 3TOBA 3S6GA 1ON0A 2ATRA 5GCNA 2P6FA 1UFHA 1P4NA 4ORFA 2F5IA 2ZXVA 2ARHA 1P0HA 5KTCA 1BO4A 2CNMA 3CXQA 4M3SA 3KKWA 5I0CA 5DWNA 4MJ8A 2FS5A 2AE6A 4NF1A 4LX9A 3ZZIA 4AB7A 2OB0A 1YVKA 2P0WA 3PP9A 1R57A 1QSMA 4AVCA 5F48A 1XMTA 1S7KA 1GHEA 5C88A 2PR8A 4ZBGA 3B8GA 2VBQA 4M85A 1XF8A 2OZHA 3R95A 3FBUA 5CNPA 2K5TA 1IIDA 1IYKA 3C26A 2EVNA 4B5PB 4PV6A 3TO6A 2G3TA 2B4DB 2GANA 3TFYA 1YREA 2B4BA 3PGPA 2JDCA 2NMTA 2HUZA 4F6AA 2B3VA 1Q2CA 1NE9A 4RI1A 1NMTA 2FCKA 4UWIA 3TOAA 2QMLA 3S6KA 2P6GA 4MY3A 2PR1A 2IL4A 2P6EA 1U6MA 1NSLA 2QIRA 3IGRA 2VQYA 3FB3A 4K30A 3FYNA 4UBRA 3CXSA 2PRBA 4KVOE 5EC4A 5F49A 3SXNA 5IX3A 2H5MA 1K4JA 4MI4A 2Z10A 4XPLA 3BJ7A 4QBJA 1I21A 2FIAA 4KOUA 4J3GA 3H4QA 3G8WA 4KLWA 4LUAA 2CNTA 3T9YA 4QC6A 2GE3A 3EC4A 2Q4VA 4XNHC 2J8NA 3JVNA 1Y7RA 1VKCA 3F0AA 4QB9A 4PSWA 1TIQA 4AVAA 3W6XA 4YRHA 1YLEA 2BSWA 2FT0A 1S60A 4KOXA 1S7LA 1WWZA 1Q2DA 3F5BA 5DWMA 5HMNA 2PQ8A 5HH1A 3R9EA 5H86A 3SHPA 2J8MA 5J8CA 1IB1E 1IYLA 1MJBA 1S3ZA 4PK2A 1Z9UA 3P2FA 3D2PA 1S5KA 1S7NA 1V0CA 5E96A 4CAVA 4NSQA 2Z11A 4PK3A 3T90A 5JPHA 4F0YA 5J8FA 3LODA 3P2HA 2EUIA 3GYAA 1VHSA 2HQYA 1SQHA 4HKFA 4JJXA 3D3SA 4RS2A 1Q2YA 1M4IA 1QSTA 4XPDC 1MK4A 4KVXA 4DNCA 1KUXA 4L89A 1I12A 1N71A 4JD6A 2OU2A 1M4GA 4YFJA 1Z4RA 2QECA 2Z0ZA 3N7ZA 2VEZA 2R7HA 3V8IA 4BMHA 1M4DA 2I79A 1XIXA 2DXQA 3DNSA 1RO5A 2B5GB 4R87A 2C27A 4KLVA 2O28A 2FXFA 3S6HA 4NEXA 4GS4A 4L8AA 5EBVA 3BLNA 1PUAA 2Q7BA 1YGHA 4UWJA 4E2AA 2REFA 4ONUA 3TE4A 3D8PA 3PZJA 4OADA 4FD7A 1J4JA 3QB8A 2BUEA 2FL4A 2VI7A 1I1DA 2VZYA 4MY0A 4B5OA 1YX0A 4B5PA 1Z4EA 4AVBA 3I3GA 2B4DA 3GY9A 4KOVA 1FY7A 2RC4A 3D2MA 4KOTA 5FVJA 1QSRA 2PDOA 3R9FA 1Y9KA 3W6SA 4AG9A 4H89A 4CRZB 2BEIA 2G3AA 4OAEA 2PC1A 1KUVA 4IUSA 2Q04A 4R57A 4CAWA 4JLYA 3NE7A 4FD4A 4XNHB 3S6FA 4EVYA 1KZFA
chains in the Genus database with same CATH superfamily
3LD2A 4AG7A 3PBBA 2YNCA 5G20A 2BL1A 1LCPA 4JXRA 4P4JA 1OBRA 4A38A 1X12A 4R7MA 2QJ8A 3W91A 2D4OA 2WPXA 2HB6A 3B2YA 2POKA 3D66A 3G3SA 2ABZA 3TC8A 3TCVA 3SJFA 2A4NA 2WUUA 1PU9A 3CPXA 1M44A 1ZO0A 5AG5A 1VHEA 3IU1A 4MFZA 4A32A 2Z3KA 1DE4C 1IICA 2R1IA 4KUBA 3SI0A 1QSOA 3VATA 5JGFA 3D67A 4PXEA 1ZLHA 4KSAA 2VZZA 4UIAA 5LYFA 1OZPA 2O53A 4KOYA 3T8WA 2DEAA 3IO1A 5IB9A 3FXTA 3JUWA 4ZY1A 2ZW6A 2F7VA 2J8RA 4CAEA 4II9A 2CY2A 7CPAA 3D4UA 4K3NA 2ZW7A 2JEWA 1AYEA 2Q44A 2PVVA 4X8IA 3DR6A 4CRYB 3IC1A 4Q38A 5JQ4A 3DSBA 2ZOFA 1XEBA 4KORA 1PYTB 4XPKA 4KOSA 5EMIA 3FEEA 3KZWA 1ZG7A 3UY5A 4Z65A 1L0CA 1IOIA 4A33A 2EO8A 4F9VA 2OZUA 3QAHA 1QMUA 3H8GA 3FX6A 4C68A 4Y49B 2Q0YA 4XPDB 4O23A 2C6CA 4IF5A 1CG2A 1M4LA 2JLMA 1ELLP 3EFAA 4FD6A 1A2ZA 1MJ9A 1JWQA 1YLOA 5G21A 3F8KA 3D7GA 5K8NA 4BINA 3CT9A 4Y49C 5H84A 3S9NA 1BOBA 3PRTA 4MHYA 1Z5RA 2I00A 3FEDA 3IWGA 2CTBA 1Y0YA 4PQAA 3R96A 3EXNA 1TKHA 4TNUA 3BI0A 3CXPA 1CP6A 3PB8X 1TXRA 5AGEA 4I49A 4E0AA 3PBEA 2ZPAA 2AFZA 2AFWA 2ZEEA 1WK4A 3DLJA 4UA3A 2XEJA 1NSAA 2JBJA 4U9YA 4A94A 4P4FA 3B3TA 4M6GA 3FIXA 1B6BA 2WYRA 3TT2A 1YR0A 3GKRA 2ZW4A 1XE4A 3I9SA 2Z3OA 3H8EA 4KOWA 4NGNA 3RNZA 3FMCA 2JEVA 4HNXB 4YWYA 4CS0B 5HVHA 1YVOA 3CPAA 3B3WA 3TTHA 4QVTA 4NFRA 3BJ8A 2ODFA 3GUXA 4OLLA 4OC1A 2Y0MA 4PXBA 3NA6A 5C82A 4JYWA 4HNYB 2VXKA 1ZLIA 2CNSA 1ZG9A 3FNCA 4NCZA 4JWPA 4MCRA 2REEA 4C7IA 3IFEA 3BHXA 1PCAA 4MHNA 2V8DA 3FVLA 4CGNA 2FSRA 1CPXA 1S7FA 3DDDA 2VL1A 2V8GA 3E0KA 3WR7A 3I1UA 4MFQA 5F47A 3NH5A 4FWUA 2OH1A 4R9MA 3EY5A 4P4BA 2B5GA 3TO9A 2X7BA 3KHXA 1CM0A 2YNEA 4UF4A 2PSWA 3JRUA 3PFOA 3TO7A 1M1DA 2Q7SA 1MJAA 4R3KA 1EE3P 1QSNA 2PJCA 3B3SA 1Z2LA 1VGYA 4ZY2A 4A39A 4C2ZA 4H6ZA 1B87A 1LANA 2OZGA 4MCPA 3EO4A 4X5KA 3K9UA 4U5YA 2V8VA 2ZOGA 2QYVA 2GIVA 2R98A 2ZW5A 2JDDA 2KCWA 2PJ9A 4P4DA 4EWTA 2GLFA 4UEEA 4A2ZA 4EFDA 1RXTA 3PB6X 4FD5A 3S9MA 4CAXA 4F9UA 4YGOA 4H6UA 2HV2A 2PJ3A 4RUHA 4OC4A 4E8OA 1LOKA 4KZTA 4NGRA 2PCUA 1CJWA 3LACA 3QNVA 4UEFA 4PPZA 4HPSA 4NJQA 1FT7A 4OIWA 3R9GA 3SXOA 2PJ1A 4MMOA 2WPWA 2ANPA 3ISZA 1YMEA 5KTDA 3PB7X 5ISVA 1Z8XA 4R8FA 4U9ZA 4AXVA 1F57A 2RB7A 3MGDA 4NXYA 4ONWA 1VHOA 2AJ6A 1R3NA 1Y9WA 2Q4YA 3RAMA 3KGQA 1AMPA 3ZJ0A 3D7FA 4FUUA 3FH4A 4MBUA 3WC6A 3VWEA 1Q7LA 3MN8A 4NGSA 2YNCC 1F2OA 4CGMA 2BCOA 1LRZA 4HNWB 4KUAA 4P4EA 4JXQA 3RYOA 4TWEA 4ZX9A 2ZEMA 3DR8A 4OC0A 2Z3MA 3D7HA 4UIBA 5JH9A 4KVME 2NYQA 5J1QA 4P4IA 3R1KA 5KTAA 3D68A 4W9YA 5HVFA 3S9LA 2ZEGA 3VH9A 2WSAA 4R3LA 3FF3A 3GLJA 1CPSA 2I3CA 1BPMA 4PSXA 1KWMA 2FE7A 4OIDA 4BBHA 1YK3A 5F46A 2PE3A 2PVWA 2R8VA 1IGBA 5IB0A 5THWA 5IV0A 2FIWA 2D4PA 4KSFA 3PEIA 1KUYA 3OWCA 4MFPA 4LQGA 2BO9A 3VWDA 1IY7A 2G0BA 4OC5A 2B58A 4MHDA 4QUSA 2B3UA 3FRMA 3CZXA 4M6IA 4PXCA 3TOBA 3S6GA 2OOTA 4B12A 4CYNA 1ON0A 1TF8A 2ATRA 5GCNA 4CPAA 2P6FA 4NGTA 1LFWA 1UFHA 1P4NA 1BAVA 4ORFA 2G9DA 4GXHA 2F5IA 2ZXVA 2Q51A 2ARHA 1Y0RA 1P0HA 4ZX8A 4ZYQA 1ELMP 5KTCA 1BO4A 2CNMA 2PJ0A 3BXMA 1HDUA 4RN7A 3CXQA 4LQ6A 4M3SA 4IHMA 5K8OA 3KKWA 2ZEDA 4G1PA 5F09A 3SJXA 4OC2A 4JZ0A 5I0CA 3KQZA 5DWNA 5LRGA 4MJ8A 4YU9A 3HUVA 2PJ4A 5G1ZA 3NE8A 3IJ3A 1RTQA 2AE6A 2FS5A 4NF1A 3FJUA 2NSMA 2Q4ZA 4LX9A 2BOAA 5LRJA 3ZZIA 4AB7A 2OB0A 1YVKA 2P0WA 3PP9A 1ZG8A 6CPAA 1R57A 1QSMA 5I4MA 2PJ5A 4AVCA 2YNDA 4UFXA 2GREA 1XMTA 5F48A 5LYDA 3KASA 1S7KA 1UWYA 3B35A 1GHEA 4R6TA 5C88A 2PR8A 3IIBA 4ZBGA 3B8GA 3WT4A 2EK8A 5LYLA 2VBQA 4MFKA 4C7HA 4M85A 1XF8A 2OZHA 1VIXA 3R95A 2XEGA 3FBUA 3WABA 5CNPA 3KL9A 2K5TA 4NGMA 1IIDA 3BI1A 3SJGA 1IYKA 3NH8A 3C26A 2EVNA 2HC9A 4KSIA 2EWBA 4X2TA 3PB4X 4UFVA 4B5PB 4PV6A 3TO6A 1DTDA 2G3TA 1YW4A 2B4DB 2GANA 3TFYA 1YREA 2B4BA 4NJRA 4DYOA 4EMEA 3PGPA 1Z8WA 2C6PA 2JDCA 2NMTA 3KQXA 2HUZA 4F6AA 2B3VA 4MFLA 4CAFA 4Q7AA 1Q2CA 3KI9A 1NE9A 4IK2A 4RI1A 1F2PA 1NMTA 2FCKA 4UWIA 2PJ2A 4CYOA 4H2KA 4MHPA 3TOAA 2QMLA 3S6KA 3KR5A 2AFUA 3IEHA 1CBXA 2P6GA 1YSJA 4OKOA 3MRUA 1TF9A 2AFOA 2XEFA 1Y7EA 4MY3A 5DS0A 2PR1A 2CXAA 5AG4A 2IL4A 3KHZA 2P6EA 1U6MA 2IQ6A 1NSLA 2QIRA 2EBJA 3IGRA 2VQYA 3FB3A 4K30A 3FYNA 3L2NA 3CXSA 2PRBA 4KVOE 4M6HA 4UBRA 5EC4A 3SXNA 5IX3A 2FVGA 2PIYA 2H5MA 1K4JA 4OMEA 3QAYA 4MI4A 3NFZA 4X3RA 4FAIA 2Z10A 1Z8TA 2OR4A 4XPLA 4P44A 3BJ7A 4MXUA 5ELYA 4P45A 4QBJA 1I21A 4MCSA 2FIAA 4KOUA 4J3GA 5JM6A 3H4QA 3HLPA 4NGPA 3G8WA 4KLWA 4CGLA 1R43A 4IAVA 2JBKA 4LUAA 1XMBA 2CNTA 1YQEA 4GM5A 3T9YA 4QC6A 5A28A 2GU2A 2GE3A 4UFWA 4B13A 1CP7A 2C1CA 4OC3A 3EC4A 2Q4VA 4XNHC 4MRIA 2J8NA 1ARLA 3JVNA 4ZY0A 2PJ7A 3CDXA 1YW6A 1GYTA 1VKCA 1Y7RA 2IMOA 4FBEA 5F49A 3F0AA 4QB9A 2PJ6A 4PSWA 2GLJA 1LAPA 3K2KA 2DPTA 1TIQA 3TX8A 4AVAA 4P6YA 4F8ZA 3W6XA 4YRHA 3H8FA 4A31A 4DUKA 1YLEA 2BSWA 4C2YA 2FT0A 1S60A 4KOXA 1S7LA 1WWZA 3WC5A 3B3CA 1Q2DA 3DGVA 3F5BA 5DWMA 5HMNA 2PQ8A 3WC7A 5HH1A 3R9EA 1LAMA 5H86A 3SHPA 2J8MA 4MCQA 1XBUA 1IB1E 1Z8LA 5J8CA 1IYLA 2RFHA 1MJBA 1S3ZA 4PK2A 1Z9UA 2ZEFA 1CX8A 3IWEA 3P2FA 2DF5A 3SJEA 3D2PA 3RBUA 1S5KA 1S7NA 1V0CA 1FNOA 2ZELA 3JTKA 4UEZA 4NSQA 5E96A 4CAVA 2Z11A 4CYQA 5HXDA 5G22A 4PK3A 3GIUA 3SI2A 3T90A 5JPHA 3NH4A 4F0YA 5J8FA 3LODA 4BD9A 2ZENA 3P2HA 5K8PA 2EUIA 4NGQA 3GYAA 2WZNA 1VHSA 2HQYA 1SQHA 3PFEA 4HKFA 4JJXA 4Q36A 3D3SA 4RS2A 4UCNA 1Q2YA 5CPAA 1M4IA 1QSTA 4CYPA 2Z3LA 3KR4A 4XPDC 1MK4A 3RZAA 4KVXA 4C2XA 1ARMA 1KUXA 4DNCA 4L89A 1I12A 1N71A 1XFOA 2F8HA 4JD6A 2OU2A 3B7IA 1XJOA 1M4GA 4YFJA 2Z3NA 4B10A 4ZI6A 4PXDA 3GB0A 3N5FA 2DPSA 1Z4RA 2QECA 3D7DA 4MFJA 3IWWA 5HVGA 2Z0ZA 3N7ZA 4F0XA 1AUGA 2VEZA 2R7HA 3V8IA 4ZGYB 5D29A 4BMHA 1M4DA 2GFQA 2I79A 2XEIA 1BLLE 5CBMA 4R76A 1XIXA 3H5ZA 5AG6A 3V7ZA 5LRKA 2DXQA 2AFMA 4B11A 1IU8A 3DNSA 8CPAA 4CGOA 1RO5A 2B5GB 2QVPA 4R87A 2C27A 3RO0A 4KLVA 2O28A 4UCPA 2PJAA 2FXFA 3S6HA 4NEXA 4GS4A 4L8AA 4B14A 5EBVA 1X10A 3BLNA 3A9LA 1PUAA 2Q7BA 1YGHA 3LMSA 4UWJA 2REFA 4ONUA 4E2AA 3TE4A 3D8PA 2CIJA 3PZJA 4OADA 4FD7A 1J4JA 1HEEA 2ZEPA 3QB8A 2BUEA 2FL4A 2YGWA 3VARA 2VI7A 4KS9A 3V38A 1I1DA 2VZYA 4MY0A 4B5OA 1YX0A 3ISXA 3SI1A 2CTCA 1Z4EA 2PJBA 4B5PA 4OP4A 2PJ8A 4AVBA 5K8MA 3I3GA 3K9TA 1JQGA 2B4DA 2PIZA 4DJLA 3GY9A 4KOVA 1FY7A 1TKFA 1BPNA 2RC4A 2O4HA 3D2MA 4KOTA 3LWUA 1XRYA 3B3VA 1H8LA 5FVJA 1QSRA 2PDOA 3R9FA 2C6GA 2EK9A 2CF4A 4WJBA 2AFXA 1Y9KA 2ZEHA 3W6SA 4B6ZA 2V8HA 3FECA 1XOVA 4AG9A 5D8NA 4H89A 1IOFA 4A30A 4CRZB 4P10A 2BEIA 2Z3PA 2PRQA 2G3AA 2AFSA 2IJZA 4OAEA 2PC1A 4A37A 4UCMA 1KUVA 4IUSA 4MHZA 1TKJA 2Q04A 4R57A 4CGPA 2ZEOA 4CAWA 5AG7A 5BWAB 4JLYA 3NE7A 4FD4A 4WWVA 2J9AA 1QQ9A 3PB9X 4XNHB 5LYIA 3S6FA 4EVYA 4A95A 3IU2A 5A27A 1KZFA 2Q43A 2V77A 1HDQA
chains in the Genus database with same CATH topology
3LD2A 4AG7A 2YNCA 5G20A 2BL1A 4JXRA 3W91A 2D4OA 2WPXA 3G3SA 3TCVA 2A4NA 2WUUA 1PU9A 1M44A 1ZO0A 5AG5A 4A32A 3IU1A 4MFZA 2Z3KA 1IICA 2R1IA 4KUBA 1QSOA 4KSAA 2VZZA 1OZPA 4KOYA 3FXTA 3JUWA 4II9A 2ZW6A 2J8RA 4CAEA 2CY2A 2ZW7A 2Q44A 4CRYB 3DR6A 5JQ4A 4Q38A 3DSBA 1XEBA 4KORA 4XPKA 4KOSA 3UY5A 1L0CA 4A33A 2OZUA 3QAHA 4C68A 4Y49B 2Q0YA 4XPDB 4IF5A 2JLMA 3EFAA 4FD6A 1MJ9A 5G21A 3F8KA 4Y49C 5H84A 1BOBA 2I00A 3IWGA 3R96A 3EXNA 3CXPA 4E0AA 5AGEA 4I49A 2ZPAA 4UA3A 1WK4A 4U9YA 3FIXA 1B6BA 3TT2A 1YR0A 3GKRA 2ZW4A 1XE4A 3I9SA 2Z3OA 4KOWA 4HNXB 2JEVA 4CS0B 1YVOA 3TTHA 4QVTA 3BJ8A 4OLLA 2Y0MA 5C82A 4HNYB 2VXKA 2CNSA 3FNCA 4NCZA 4JWPA 2REEA 4C7IA 4CGNA 2FSRA 1S7FA 3DDDA 3WR7A 3E0KA 4MFQA 5F47A 2OH1A 4R9MA 3EY5A 2B5GA 3TO9A 2X7BA 1CM0A 2YNEA 2PSWA 3TO7A 1M1DA 1MJAA 4R3KA 1QSNA 4C2ZA 4H6ZA 1B87A 2OZGA 4X5KA 3EO4A 3K9UA 4U5YA 2GIVA 2R98A 2ZW5A 2JDDA 2KCWA 4A2ZA 1RXTA 4FD5A 4CAXA 4YGOA 4H6UA 2HV2A 4E8OA 4KZTA 1CJWA 3R9GA 3SXOA 2WPWA 5KTDA 5ISVA 4U9ZA 3MGDA 4NXYA 2AJ6A 1Y9WA 2Q4YA 3ZJ0A 4MBUA 3VWEA 2YNCC 4CGMA 1LRZA 4HNWB 4KUAA 3RYOA 4JXQA 3DR8A 2Z3MA 4KVME 3R1KA 5KTAA 2WSAA 4R3LA 4PSXA 2FE7A 4BBHA 1YK3A 5F46A 2R8VA 5IB0A 5IV0A 2FIWA 2D4PA 4KSFA 1KUYA 3OWCA 4MFPA 3VWDA 2G0BA 2B58A 4MHDA 4QUSA 2B3UA 3FRMA 3TOBA 3S6GA 4B12A 4CYNA 1ON0A 2ATRA 5GCNA 2P6FA 1UFHA 1P4NA 4ORFA 2F5IA 2ZXVA 2ARHA 1P0HA 5KTCA 1BO4A 2CNMA 3CXQA 4M3SA 3KKWA 5I0CA 5DWNA 4MJ8A 5G1ZA 2FS5A 2AE6A 4NF1A 4LX9A 3ZZIA 4AB7A 2OB0A 1YVKA 2P0WA 3PP9A 1R57A 1QSMA 4AVCA 2YNDA 4UFXA 5F48A 1XMTA 1S7KA 1GHEA 5C88A 2PR8A 4ZBGA 3B8GA 2VBQA 4MFKA 4C7HA 4M85A 1XF8A 2OZHA 3R95A 3FBUA 5CNPA 2K5TA 1IIDA 1IYKA 3C26A 2EVNA 4UFVA 4B5PB 4PV6A 3TO6A 2G3TA 2B4DB 2GANA 3TFYA 1YREA 2B4BA 3PGPA 2JDCA 2NMTA 2HUZA 4F6AA 2B3VA 4MFLA 4CAFA 1Q2CA 1NE9A 4RI1A 1NMTA 2FCKA 4UWIA 4CYOA 3TOAA 2QMLA 3S6KA 2P6GA 4MY3A 2PR1A 2CXAA 5AG4A 2IL4A 2P6EA 1U6MA 1NSLA 2QIRA 3IGRA 2VQYA 3FB3A 4K30A 3FYNA 4UBRA 3CXSA 2PRBA 4KVOE 5EC4A 5F49A 3SXNA 5IX3A 2H5MA 1K4JA 4MI4A 2Z10A 4XPLA 3BJ7A 4QBJA 1I21A 2FIAA 4KOUA 4J3GA 3H4QA 3G8WA 4KLWA 4CGLA 4LUAA 2CNTA 3T9YA 4QC6A 5A28A 2GE3A 4UFWA 4B13A 3EC4A 2Q4VA 4XNHC 2J8NA 3JVNA 1Y7RA 1VKCA 3F0AA 4QB9A 4PSWA 2DPTA 1TIQA 4AVAA 3W6XA 4YRHA 4A31A 1YLEA 2BSWA 4C2YA 2FT0A 1S60A 4KOXA 1S7LA 1WWZA 1Q2DA 3F5BA 5DWMA 5HMNA 2PQ8A 5HH1A 3R9EA 5H86A 3SHPA 2J8MA 5J8CA 1IB1E 1IYLA 1MJBA 1S3ZA 4PK2A 1Z9UA 3IWEA 3P2FA 3D2PA 1S5KA 1S7NA 1V0CA 5E96A 4CAVA 3JTKA 4NSQA 4CYQA 2Z11A 5G22A 4PK3A 3T90A 5JPHA 4F0YA 5J8FA 3LODA 3P2HA 2EUIA 3GYAA 1VHSA 2HQYA 1SQHA 4HKFA 4JJXA 4Q36A 4CYPA 3D3SA 4RS2A 4UCNA 1Q2YA 1M4IA 1QSTA 2Z3LA 4XPDC 1MK4A 4KVXA 4C2XA 4DNCA 1KUXA 4L89A 1I12A 1N71A 4JD6A 2OU2A 1M4GA 4YFJA 2Z3NA 4B10A 2DPSA 1Z4RA 2QECA 4MFJA 2Z0ZA 3N7ZA 4F0XA 2VEZA 2R7HA 3V8IA 4ZGYB 4BMHA 1M4DA 2I79A 1XIXA 3H5ZA 5AG6A 2DXQA 4B11A 3DNSA 4CGOA 1RO5A 2B5GB 4R87A 2C27A 4KLVA 2O28A 4UCPA 2FXFA 3S6HA 4NEXA 4GS4A 4L8AA 4B14A 5EBVA 3BLNA 3A9LA 1PUAA 2Q7BA 1YGHA 4UWJA 4E2AA 2REFA 4ONUA 3TE4A 3D8PA 3PZJA 4OADA 4FD7A 1J4JA 3QB8A 2BUEA 2FL4A 2YGWA 2VI7A 4KS9A 1I1DA 2VZYA 4MY0A 4B5OA 1YX0A 4B5PA 1Z4EA 4AVBA 3I3GA 2B4DA 3GY9A 4KOVA 1FY7A 2RC4A 3D2MA 4KOTA 5FVJA 1QSRA 2PDOA 3R9FA 1Y9KA 3W6SA 4AG9A 4H89A 4A30A 4CRZB 2BEIA 2Z3PA 2G3AA 4OAEA 2PC1A 4UCMA 1KUVA 4IUSA 2Q04A 4R57A 4CGPA 4CAWA 5AG7A 5BWAB 4JLYA 3NE7A 4FD4A 4XNHB 3S6FA 4EVYA 4A95A 3IU2A 5A27A 1KZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LD2 A;  4AG7 A;  2BL1 A;  4JXR A;  3W91 A;  2D4O A;  2WPX A;  3G3S A;  3TCV A;  2A4N A;  1PU9 A;  1M44 A;  1IIC A;  2R1I A;  4KUB A;  1QSO A;  2VZZ A;  1OZP A;  4KOY A;  3FXT A;  3JUW A;  4II9 A;  2ZW6 A;  2J8R A;  2CY2 A;  2ZW7 A;  2Q44 A;  4CRY B;  3DR6 A;  5JQ4 A;  3DSB A;  1XEB A;  4KOR A;  4XPK A;  4KOS A;  3UY5 A;  1L0C A;  2OZU A;  3QAH A;  4Y49 B;  2Q0Y A;  4XPD B;  4IF5 A;  2JLM A;  3EFA A;  4FD6 A;  1MJ9 A;  3F8K A;  4Y49 C;  5H84 A;  1BOB A;  2I00 A;  3IWG A;  3R96 A;  3EXN A;  3CXP A;  4E0A A;  4I49 A;  2ZPA A;  4UA3 A;  1WK4 A;  4U9Y A;  3FIX A;  1B6B A;  3TT2 A;  1YR0 A;  3GKR A;  4KOW A;  1XE4 A;  2ZW4 A;  3I9S A;  4HNX B;  2JEV A;  4CS0 B;  1YVO A;  3TTH A;  4QVT A;  3BJ8 A;  4OLL A;  2Y0M A;  5C82 A;  4HNY B;  2VXK A;  2CNS A;  3FNC A;  4NCZ A;  4JWP A;  2REE A;  2FSR A;  1S7F A;  3DDD A;  3WR7 A;  3E0K A;  5F47 A;  2OH1 A;  4R9M A;  3EY5 A;  2B5G A;  3TO9 A;  2X7B A;  1CM0 A;  2PSW A;  3TO7 A;  1M1D A;  1MJA A;  4R3K A;  1QSN A;  4H6Z A;  1B87 A;  2OZG A;  4X5K A;  3EO4 A;  3K9U A;  4U5Y A;  2GIV A;  2R98 A;  2ZW5 A;  2JDD A;  2KCW A;  1RXT A;  4FD5 A;  4CAX A;  4YGO A;  4H6U A;  2HV2 A;  4E8O A;  4KZT A;  1CJW A;  3R9G A;  3SXO A;  2WPW A;  5KTD A;  5ISV A;  4U9Z A;  3MGD A;  4NXY A;  2AJ6 A;  1Y9W A;  2Q4Y A;  3ZJ0 A;  4MBU A;  3VWE A;  1LRZ A;  4HNW B;  4KUA A;  3RYO A;  4JXQ A;  3DR8 A;  4KVM E;  3R1K A;  5KTA A;  4R3L A;  4PSX A;  2FE7 A;  5F46 A;  1YK3 A;  2R8V A;  5IB0 A;  5IV0 A;  2FIW A;  2D4P A;  1KUY A;  3OWC A;  3VWD A;  2G0B A;  2B58 A;  4MHD A;  4QUS A;  2B3U A;  3FRM A;  3TOB A;  3S6G A;  1ON0 A;  2ATR A;  5GCN A;  2P6F A;  1UFH A;  1P4N A;  4ORF A;  2F5I A;  2ZXV A;  2ARH A;  1P0H A;  5KTC A;  1BO4 A;  2CNM A;  3CXQ A;  4M3S A;  3KKW A;  5I0C A;  5DWN A;  4MJ8 A;  2FS5 A;  2AE6 A;  4NF1 A;  4LX9 A;  3ZZI A;  4AB7 A;  2OB0 A;  1YVK A;  2P0W A;  3PP9 A;  1R57 A;  1QSM A;  4AVC A;  5F48 A;  1XMT A;  1S7K A;  1GHE A;  5C88 A;  2PR8 A;  4ZBG A;  3B8G A;  2VBQ A;  4M85 A;  1XF8 A;  2OZH A;  3R95 A;  3FBU A;  5CNP A;  2K5T A;  1IID A;  1IYK A;  3C26 A;  2EVN A;  4B5P B;  4PV6 A;  3TO6 A;  2G3T A;  2B4D B;  2GAN A;  3TFY A;  1YRE A;  2B4B A;  3PGP A;  2JDC A;  2NMT A;  2HUZ A;  4F6A A;  2B3V A;  1Q2C A;  1NE9 A;  4RI1 A;  1NMT A;  2FCK A;  4UWI A;  3TOA A;  2QML A;  3S6K A;  2P6G A;  4MY3 A;  2PR1 A;  2IL4 A;  2P6E A;  1U6M A;  1NSL A;  2QIR A;  3IGR A;  2VQY A;  3FB3 A;  4K30 A;  3FYN A;  4UBR A;  3CXS A;  2PRB A;  4KVO E;  5EC4 A;  5F49 A;  3SXN A;  5IX3 A;  2H5M A;  1K4J A;  4MI4 A;  2Z10 A;  4XPL A;  3BJ7 A;  4QBJ A;  1I21 A;  2FIA A;  4KOU A;  4J3G A;  3H4Q A;  3G8W A;  4KLW A;  4LUA A;  2CNT A;  3T9Y A;  4QC6 A;  2GE3 A;  3EC4 A;  2Q4V A;  4XNH C;  2J8N A;  3JVN A;  1Y7R A;  1VKC A;  3F0A A;  4QB9 A;  4PSW A;  1TIQ A;  4AVA A;  3W6X A;  4YRH A;  1YLE A;  2BSW A;  2FT0 A;  1S60 A;  4KOX A;  1S7L A;  1WWZ A;  1Q2D A;  3F5B A;  5DWM A;  5HMN A;  2PQ8 A;  5HH1 A;  3R9E A;  5H86 A;  3SHP A;  2J8M A;  5J8C A;  1IB1 E;  1IYL A;  1MJB A;  1S3Z A;  4PK2 A;  1Z9U A;  3P2F A;  3D2P A;  1S5K A;  1S7N A;  1V0C A;  5E96 A;  4CAV A;  4NSQ A;  2Z11 A;  4PK3 A;  3T90 A;  5JPH A;  4F0Y A;  5J8F A;  3LOD A;  3P2H A;  2EUI A;  3GYA A;  1VHS A;  2HQY A;  1SQH A;  4HKF A;  4JJX A;  3D3S A;  4RS2 A;  1Q2Y A;  1M4I A;  1QST A;  4XPD C;  1MK4 A;  4KVX A;  4DNC A;  1KUX A;  4L89 A;  1I12 A;  1N71 A;  4JD6 A;  2OU2 A;  1M4G A;  4YFJ A;  1Z4R A;  2QEC A;  2Z0Z A;  3N7Z A;  2VEZ A;  2R7H A;  3V8I A;  4BMH A;  1M4D A;  2I79 A;  1XIX A;  2DXQ A;  3DNS A;  1RO5 A;  2B5G B;  4R87 A;  2C27 A;  4KLV A;  2O28 A;  2FXF A;  3S6H A;  4NEX A;  4GS4 A;  4L8A A;  5EBV A;  3BLN A;  1PUA A;  2Q7B A;  1YGH A;  4UWJ A;  4E2A A;  2REF A;  4ONU A;  3TE4 A;  3D8P A;  3PZJ A;  4OAD A;  4FD7 A;  1J4J A;  3QB8 A;  2BUE A;  2FL4 A;  2VI7 A;  1I1D A;  2VZY A;  4MY0 A;  4B5O A;  1YX0 A;  4B5P A;  1Z4E A;  4AVB A;  3I3G A;  2B4D A;  3GY9 A;  4KOV A;  1FY7 A;  2RC4 A;  3D2M A;  4KOT A;  5FVJ A;  1QSR A;  2PDO A;  3R9F A;  1Y9K A;  3W6S A;  4AG9 A;  4H89 A;  4CRZ B;  2BEI A;  2G3A A;  4OAE A;  2PC1 A;  1KUV A;  4IUS A;  2Q04 A;  4R57 A;  4CAW A;  4JLY A;  3NE7 A;  4FD4 A;  4XNH B;  3S6F A;  4EVY A;  1KZF A; 
#chains in the Genus database with same CATH topology
 3LD2 A;  4AG7 A;  3PBB A;  2YNC A;  5G20 A;  2BL1 A;  1LCP A;  4JXR A;  4P4J A;  1OBR A;  4A38 A;  1X12 A;  4R7M A;  2QJ8 A;  3W91 A;  2D4O A;  2WPX A;  2HB6 A;  3B2Y A;  2POK A;  3D66 A;  3G3S A;  2ABZ A;  3TC8 A;  3TCV A;  3SJF A;  2A4N A;  2WUU A;  1PU9 A;  3CPX A;  1M44 A;  1ZO0 A;  5AG5 A;  1VHE A;  3IU1 A;  4MFZ A;  4A32 A;  2Z3K A;  1DE4 C;  1IIC A;  2R1I A;  4KUB A;  3SI0 A;  1QSO A;  3VAT A;  5JGF A;  3D67 A;  4PXE A;  1ZLH A;  4KSA A;  2VZZ A;  4UIA A;  5LYF A;  1OZP A;  2O53 A;  4KOY A;  3T8W A;  2DEA A;  3IO1 A;  5IB9 A;  3FXT A;  3JUW A;  4ZY1 A;  2ZW6 A;  2F7V A;  2J8R A;  4CAE A;  4II9 A;  2CY2 A;  7CPA A;  3D4U A;  4K3N A;  2ZW7 A;  2JEW A;  1AYE A;  2Q44 A;  2PVV A;  4X8I A;  3DR6 A;  4CRY B;  3IC1 A;  4Q38 A;  5JQ4 A;  3DSB A;  2ZOF A;  1XEB A;  4KOR A;  1PYT B;  4XPK A;  4KOS A;  5EMI A;  3FEE A;  3KZW A;  1ZG7 A;  3UY5 A;  4Z65 A;  1L0C A;  1IOI A;  4A33 A;  2EO8 A;  4F9V A;  2OZU A;  3QAH A;  1QMU A;  3H8G A;  3FX6 A;  4C68 A;  4Y49 B;  2Q0Y A;  4XPD B;  4O23 A;  2C6C A;  4IF5 A;  1CG2 A;  1M4L A;  2JLM A;  1ELL P;  3EFA A;  4FD6 A;  1A2Z A;  1MJ9 A;  1JWQ A;  1YLO A;  5G21 A;  3F8K A;  3D7G A;  5K8N A;  4BIN A;  3CT9 A;  4Y49 C;  5H84 A;  3S9N A;  1BOB A;  3PRT A;  4MHY A;  1Z5R A;  2I00 A;  3FED A;  3IWG A;  2CTB A;  1Y0Y A;  4PQA A;  3R96 A;  3EXN A;  1TKH A;  4TNU A;  3BI0 A;  3CXP A;  1CP6 A;  3PB8 X;  1TXR A;  5AGE A;  4I49 A;  4E0A A;  3PBE A;  2ZPA A;  2AFZ A;  2AFW A;  2ZEE A;  1WK4 A;  3DLJ A;  4UA3 A;  2XEJ A;  1NSA A;  2JBJ A;  4U9Y A;  4A94 A;  4P4F A;  3B3T A;  4M6G A;  3FIX A;  1B6B A;  2WYR A;  3TT2 A;  1YR0 A;  3GKR A;  2ZW4 A;  1XE4 A;  3I9S A;  2Z3O A;  3H8E A;  4KOW A;  4NGN A;  3RNZ A;  3FMC A;  2JEV A;  4HNX B;  4YWY A;  4CS0 B;  5HVH A;  1YVO A;  3CPA A;  3B3W A;  3TTH A;  4QVT A;  4NFR A;  3BJ8 A;  2ODF A;  3GUX A;  4OLL A;  4OC1 A;  2Y0M A;  4PXB A;  3NA6 A;  5C82 A;  4JYW A;  4HNY B;  2VXK A;  1ZLI A;  2CNS A;  1ZG9 A;  3FNC A;  4NCZ A;  4JWP A;  4MCR A;  2REE A;  4C7I A;  3IFE A;  3BHX A;  1PCA A;  4MHN A;  2V8D A;  3FVL A;  4CGN A;  2FSR A;  1CPX A;  1S7F A;  3DDD A;  2VL1 A;  2V8G A;  3E0K A;  3WR7 A;  3I1U A;  4MFQ A;  5F47 A;  3NH5 A;  4FWU A;  2OH1 A;  4R9M A;  3EY5 A;  4P4B A;  2B5G A;  3TO9 A;  2X7B A;  3KHX A;  1CM0 A;  2YNE A;  4UF4 A;  2PSW A;  3JRU A;  3PFO A;  3TO7 A;  1M1D A;  2Q7S A;  1MJA A;  4R3K A;  1EE3 P;  1QSN A;  2PJC A;  3B3S A;  1Z2L A;  1VGY A;  4ZY2 A;  4A39 A;  4C2Z A;  4H6Z A;  1B87 A;  1LAN A;  2OZG A;  4MCP A;  3EO4 A;  4X5K A;  3K9U A;  4U5Y A;  2V8V A;  2ZOG A;  2QYV A;  2GIV A;  2R98 A;  2ZW5 A;  2JDD A;  2KCW A;  2PJ9 A;  4P4D A;  4EWT A;  2GLF A;  4UEE A;  4A2Z A;  4EFD A;  1RXT A;  3PB6 X;  4FD5 A;  3S9M A;  4CAX A;  4F9U A;  4YGO A;  4H6U A;  2HV2 A;  2PJ3 A;  4RUH A;  4OC4 A;  4E8O A;  1LOK A;  4KZT A;  4NGR A;  2PCU A;  1CJW A;  3LAC A;  3QNV A;  4UEF A;  4PPZ A;  4HPS A;  4NJQ A;  1FT7 A;  4OIW A;  3R9G A;  3SXO A;  2PJ1 A;  4MMO A;  2WPW A;  2ANP A;  3ISZ A;  1YME A;  5KTD A;  3PB7 X;  5ISV A;  1Z8X A;  4R8F A;  4U9Z A;  4AXV A;  1F57 A;  2RB7 A;  3MGD A;  4NXY A;  4ONW A;  1VHO A;  2AJ6 A;  1R3N A;  1Y9W A;  2Q4Y A;  3RAM A;  3KGQ A;  1AMP A;  3ZJ0 A;  3D7F A;  4FUU A;  3FH4 A;  4MBU A;  3WC6 A;  3VWE A;  1Q7L A;  3MN8 A;  4NGS A;  2YNC C;  1F2O A;  4CGM A;  2BCO A;  1LRZ A;  4HNW B;  4KUA A;  4P4E A;  4JXQ A;  3RYO A;  4TWE A;  4ZX9 A;  2ZEM A;  3DR8 A;  4OC0 A;  2Z3M A;  3D7H A;  4UIB A;  5JH9 A;  4KVM E;  2NYQ A;  5J1Q A;  4P4I A;  3R1K A;  5KTA A;  3D68 A;  4W9Y A;  5HVF A;  3S9L A;  2ZEG A;  3VH9 A;  2WSA A;  4R3L A;  3FF3 A;  3GLJ A;  1CPS A;  2I3C A;  1BPM A;  4PSX A;  1KWM A;  2FE7 A;  4OID A;  4BBH A;  1YK3 A;  5F46 A;  2PE3 A;  2PVW A;  2R8V A;  1IGB A;  5IB0 A;  5THW A;  5IV0 A;  2FIW A;  2D4P A;  4KSF A;  3PEI A;  1KUY A;  3OWC A;  4MFP A;  4LQG A;  2BO9 A;  3VWD A;  1IY7 A;  2G0B A;  4OC5 A;  2B58 A;  4MHD A;  4QUS A;  2B3U A;  3FRM A;  3CZX A;  4M6I A;  4PXC A;  3TOB A;  3S6G A;  2OOT A;  4B12 A;  4CYN A;  1ON0 A;  1TF8 A;  2ATR A;  5GCN A;  4CPA A;  2P6F A;  4NGT A;  1LFW A;  1UFH A;  1P4N A;  1BAV A;  4ORF A;  2G9D A;  4GXH A;  2F5I A;  2ZXV A;  2Q51 A;  2ARH A;  1Y0R A;  1P0H A;  4ZX8 A;  4ZYQ A;  1ELM P;  5KTC A;  1BO4 A;  2CNM A;  2PJ0 A;  3BXM A;  1HDU A;  4RN7 A;  3CXQ A;  4LQ6 A;  4M3S A;  4IHM A;  5K8O A;  3KKW A;  2ZED A;  4G1P A;  5F09 A;  3SJX A;  4OC2 A;  4JZ0 A;  5I0C A;  3KQZ A;  5DWN A;  5LRG A;  4MJ8 A;  4YU9 A;  3HUV A;  2PJ4 A;  5G1Z A;  3NE8 A;  3IJ3 A;  1RTQ A;  2AE6 A;  2FS5 A;  4NF1 A;  3FJU A;  2NSM A;  2Q4Z A;  4LX9 A;  2BOA A;  5LRJ A;  3ZZI A;  4AB7 A;  2OB0 A;  1YVK A;  2P0W A;  3PP9 A;  1ZG8 A;  6CPA A;  1R57 A;  1QSM A;  5I4M A;  2PJ5 A;  4AVC A;  2YND A;  4UFX A;  2GRE A;  1XMT A;  5F48 A;  5LYD A;  3KAS A;  1S7K A;  1UWY A;  3B35 A;  1GHE A;  4R6T A;  5C88 A;  2PR8 A;  3IIB A;  4ZBG A;  3B8G A;  3WT4 A;  2EK8 A;  5LYL A;  2VBQ A;  4MFK A;  4C7H A;  4M85 A;  1XF8 A;  2OZH A;  1VIX A;  3R95 A;  2XEG A;  3FBU A;  3WAB A;  5CNP A;  3KL9 A;  2K5T A;  4NGM A;  1IID A;  3BI1 A;  3SJG A;  1IYK A;  3NH8 A;  3C26 A;  2EVN A;  2HC9 A;  4KSI A;  2EWB A;  4X2T A;  3PB4 X;  4UFV A;  4B5P B;  4PV6 A;  3TO6 A;  1DTD A;  2G3T A;  1YW4 A;  2B4D B;  2GAN A;  3TFY A;  1YRE A;  2B4B A;  4NJR A;  4DYO A;  4EME A;  3PGP A;  1Z8W A;  2C6P A;  2JDC A;  2NMT A;  3KQX A;  2HUZ A;  4F6A A;  2B3V A;  4MFL A;  4CAF A;  4Q7A A;  1Q2C A;  3KI9 A;  1NE9 A;  4IK2 A;  4RI1 A;  1F2P A;  1NMT A;  2FCK A;  4UWI A;  2PJ2 A;  4CYO A;  4H2K A;  4MHP A;  3TOA A;  2QML A;  3S6K A;  3KR5 A;  2AFU A;  3IEH A;  1CBX A;  2P6G A;  1YSJ A;  4OKO A;  3MRU A;  1TF9 A;  2AFO A;  2XEF A;  1Y7E A;  4MY3 A;  5DS0 A;  2PR1 A;  2CXA A;  5AG4 A;  2IL4 A;  3KHZ A;  2P6E A;  1U6M A;  2IQ6 A;  1NSL A;  2QIR A;  2EBJ A;  3IGR A;  2VQY A;  3FB3 A;  4K30 A;  3FYN A;  3L2N A;  3CXS A;  2PRB A;  4KVO E;  4M6H A;  4UBR A;  5EC4 A;  3SXN A;  5IX3 A;  2FVG A;  2PIY A;  2H5M A;  1K4J A;  4OME A;  3QAY A;  4MI4 A;  3NFZ A;  4X3R A;  4FAI A;  2Z10 A;  1Z8T A;  2OR4 A;  4XPL A;  4P44 A;  3BJ7 A;  4MXU A;  5ELY A;  4P45 A;  4QBJ A;  1I21 A;  4MCS A;  2FIA A;  4KOU A;  4J3G A;  5JM6 A;  3H4Q A;  3HLP A;  4NGP A;  3G8W A;  4KLW A;  4CGL A;  1R43 A;  4IAV A;  2JBK A;  4LUA A;  1XMB A;  2CNT A;  1YQE A;  4GM5 A;  3T9Y A;  4QC6 A;  5A28 A;  2GU2 A;  2GE3 A;  4UFW A;  4B13 A;  1CP7 A;  2C1C A;  4OC3 A;  3EC4 A;  2Q4V A;  4XNH C;  4MRI A;  2J8N A;  1ARL A;  3JVN A;  4ZY0 A;  2PJ7 A;  3CDX A;  1YW6 A;  1GYT A;  1VKC A;  1Y7R A;  2IMO A;  4FBE A;  5F49 A;  3F0A A;  4QB9 A;  2PJ6 A;  4PSW A;  2GLJ A;  1LAP A;  3K2K A;  2DPT A;  1TIQ A;  3TX8 A;  4AVA A;  4P6Y A;  4F8Z A;  3W6X A;  4YRH A;  3H8F A;  4A31 A;  4DUK A;  1YLE A;  2BSW A;  4C2Y A;  2FT0 A;  1S60 A;  4KOX A;  1S7L A;  1WWZ A;  3WC5 A;  3B3C A;  1Q2D A;  3DGV A;  3F5B A;  5DWM A;  5HMN A;  2PQ8 A;  3WC7 A;  5HH1 A;  3R9E A;  1LAM A;  5H86 A;  3SHP A;  2J8M A;  4MCQ A;  1XBU A;  1IB1 E;  1Z8L A;  5J8C A;  1IYL A;  2RFH A;  1MJB A;  1S3Z A;  4PK2 A;  1Z9U A;  2ZEF A;  1CX8 A;  3IWE A;  3P2F A;  2DF5 A;  3SJE A;  3D2P A;  3RBU A;  1S5K A;  1S7N A;  1V0C A;  1FNO A;  2ZEL A;  3JTK A;  4UEZ A;  4NSQ A;  5E96 A;  4CAV A;  2Z11 A;  4CYQ A;  5HXD A;  5G22 A;  4PK3 A;  3GIU A;  3SI2 A;  3T90 A;  5JPH A;  3NH4 A;  4F0Y A;  5J8F A;  3LOD A;  4BD9 A;  2ZEN A;  3P2H A;  5K8P A;  2EUI A;  4NGQ A;  3GYA A;  2WZN A;  1VHS A;  2HQY A;  1SQH A;  3PFE A;  4HKF A;  4JJX A;  4Q36 A;  3D3S A;  4RS2 A;  4UCN A;  1Q2Y A;  5CPA A;  1M4I A;  1QST A;  4CYP A;  2Z3L A;  3KR4 A;  4XPD C;  1MK4 A;  3RZA A;  4KVX A;  4C2X A;  1ARM A;  1KUX A;  4DNC A;  4L89 A;  1I12 A;  1N71 A;  1XFO A;  2F8H A;  4JD6 A;  2OU2 A;  3B7I A;  1XJO A;  1M4G A;  4YFJ A;  2Z3N A;  4B10 A;  4ZI6 A;  4PXD A;  3GB0 A;  3N5F A;  2DPS A;  1Z4R A;  2QEC A;  3D7D A;  4MFJ A;  3IWW A;  5HVG A;  2Z0Z A;  3N7Z A;  4F0X A;  1AUG A;  2VEZ A;  2R7H A;  3V8I A;  4ZGY B;  5D29 A;  4BMH A;  1M4D A;  2GFQ A;  2I79 A;  2XEI A;  1BLL E;  5CBM A;  4R76 A;  1XIX A;  3H5Z A;  5AG6 A;  3V7Z A;  5LRK A;  2DXQ A;  2AFM A;  4B11 A;  1IU8 A;  3DNS A;  8CPA A;  4CGO A;  1RO5 A;  2B5G B;  2QVP A;  4R87 A;  2C27 A;  3RO0 A;  4KLV A;  2O28 A;  4UCP A;  2PJA A;  2FXF A;  3S6H A;  4NEX A;  4GS4 A;  4L8A A;  4B14 A;  5EBV A;  1X10 A;  3BLN A;  3A9L A;  1PUA A;  2Q7B A;  1YGH A;  3LMS A;  4UWJ A;  2REF A;  4ONU A;  4E2A A;  3TE4 A;  3D8P A;  2CIJ A;  3PZJ A;  4OAD A;  4FD7 A;  1J4J A;  1HEE A;  2ZEP A;  3QB8 A;  2BUE A;  2FL4 A;  2YGW A;  3VAR A;  2VI7 A;  4KS9 A;  3V38 A;  1I1D A;  2VZY A;  4MY0 A;  4B5O A;  1YX0 A;  3ISX A;  3SI1 A;  2CTC A;  1Z4E A;  2PJB A;  4B5P A;  4OP4 A;  2PJ8 A;  4AVB A;  5K8M A;  3I3G A;  3K9T A;  1JQG A;  2B4D A;  2PIZ A;  4DJL A;  3GY9 A;  4KOV A;  1FY7 A;  1TKF A;  1BPN A;  2RC4 A;  2O4H A;  3D2M A;  4KOT A;  3LWU A;  1XRY A;  3B3V A;  1H8L A;  5FVJ A;  1QSR A;  2PDO A;  3R9F A;  2C6G A;  2EK9 A;  2CF4 A;  4WJB A;  2AFX A;  1Y9K A;  2ZEH A;  3W6S A;  4B6Z A;  2V8H A;  3FEC A;  1XOV A;  4AG9 A;  5D8N A;  4H89 A;  1IOF A;  4A30 A;  4CRZ B;  4P10 A;  2BEI A;  2Z3P A;  2PRQ A;  2G3A A;  2AFS A;  2IJZ A;  4OAE A;  2PC1 A;  4A37 A;  4UCM A;  1KUV A;  4IUS A;  4MHZ A;  1TKJ A;  2Q04 A;  4R57 A;  4CGP A;  2ZEO A;  4CAW A;  5AG7 A;  5BWA B;  4JLY A;  3NE7 A;  4FD4 A;  4WWV A;  2J9A A;  1QQ9 A;  3PB9 X;  4XNH B;  5LYI A;  3S6F A;  4EVY A;  4A95 A;  3IU2 A;  5A27 A;  1KZF A;  2Q43 A;  2V77 A;  1HDQ A; 
#chains in the Genus database with same CATH homology
 3LD2 A;  4AG7 A;  2YNC A;  5G20 A;  2BL1 A;  4JXR A;  3W91 A;  2D4O A;  2WPX A;  3G3S A;  3TCV A;  2A4N A;  2WUU A;  1PU9 A;  1M44 A;  1ZO0 A;  5AG5 A;  4A32 A;  3IU1 A;  4MFZ A;  2Z3K A;  1IIC A;  2R1I A;  4KUB A;  1QSO A;  4KSA A;  2VZZ A;  1OZP A;  4KOY A;  3FXT A;  3JUW A;  4II9 A;  2ZW6 A;  2J8R A;  4CAE A;  2CY2 A;  2ZW7 A;  2Q44 A;  4CRY B;  3DR6 A;  5JQ4 A;  4Q38 A;  3DSB A;  1XEB A;  4KOR A;  4XPK A;  4KOS A;  3UY5 A;  1L0C A;  4A33 A;  2OZU A;  3QAH A;  4C68 A;  4Y49 B;  2Q0Y A;  4XPD B;  4IF5 A;  2JLM A;  3EFA A;  4FD6 A;  1MJ9 A;  5G21 A;  3F8K A;  4Y49 C;  5H84 A;  1BOB A;  2I00 A;  3IWG A;  3R96 A;  3EXN A;  3CXP A;  4E0A A;  5AGE A;  4I49 A;  2ZPA A;  4UA3 A;  1WK4 A;  4U9Y A;  3FIX A;  1B6B A;  3TT2 A;  1YR0 A;  3GKR A;  2ZW4 A;  1XE4 A;  3I9S A;  2Z3O A;  4KOW A;  4HNX B;  2JEV A;  4CS0 B;  1YVO A;  3TTH A;  4QVT A;  3BJ8 A;  4OLL A;  2Y0M A;  5C82 A;  4HNY B;  2VXK A;  2CNS A;  3FNC A;  4NCZ A;  4JWP A;  2REE A;  4C7I A;  4CGN A;  2FSR A;  1S7F A;  3DDD A;  3WR7 A;  3E0K A;  4MFQ A;  5F47 A;  2OH1 A;  4R9M A;  3EY5 A;  2B5G A;  3TO9 A;  2X7B A;  1CM0 A;  2YNE A;  2PSW A;  3TO7 A;  1M1D A;  1MJA A;  4R3K A;  1QSN A;  4C2Z A;  4H6Z A;  1B87 A;  2OZG A;  4X5K A;  3EO4 A;  3K9U A;  4U5Y A;  2GIV A;  2R98 A;  2ZW5 A;  2JDD A;  2KCW A;  4A2Z A;  1RXT A;  4FD5 A;  4CAX A;  4YGO A;  4H6U A;  2HV2 A;  4E8O A;  4KZT A;  1CJW A;  3R9G A;  3SXO A;  2WPW A;  5KTD A;  5ISV A;  4U9Z A;  3MGD A;  4NXY A;  2AJ6 A;  1Y9W A;  2Q4Y A;  3ZJ0 A;  4MBU A;  3VWE A;  2YNC C;  4CGM A;  1LRZ A;  4HNW B;  4KUA A;  3RYO A;  4JXQ A;  3DR8 A;  2Z3M A;  4KVM E;  3R1K A;  5KTA A;  2WSA A;  4R3L A;  4PSX A;  2FE7 A;  4BBH A;  1YK3 A;  5F46 A;  2R8V A;  5IB0 A;  5IV0 A;  2FIW A;  2D4P A;  4KSF A;  1KUY A;  3OWC A;  4MFP A;  3VWD A;  2G0B A;  2B58 A;  4MHD A;  4QUS A;  2B3U A;  3FRM A;  3TOB A;  3S6G A;  4B12 A;  4CYN A;  1ON0 A;  2ATR A;  5GCN A;  2P6F A;  1UFH A;  1P4N A;  4ORF A;  2F5I A;  2ZXV A;  2ARH A;  1P0H A;  5KTC A;  1BO4 A;  2CNM A;  3CXQ A;  4M3S A;  3KKW A;  5I0C A;  5DWN A;  4MJ8 A;  5G1Z A;  2FS5 A;  2AE6 A;  4NF1 A;  4LX9 A;  3ZZI A;  4AB7 A;  2OB0 A;  1YVK A;  2P0W A;  3PP9 A;  1R57 A;  1QSM A;  4AVC A;  2YND A;  4UFX A;  5F48 A;  1XMT A;  1S7K A;  1GHE A;  5C88 A;  2PR8 A;  4ZBG A;  3B8G A;  2VBQ A;  4MFK A;  4C7H A;  4M85 A;  1XF8 A;  2OZH A;  3R95 A;  3FBU A;  5CNP A;  2K5T A;  1IID A;  1IYK A;  3C26 A;  2EVN A;  4UFV A;  4B5P B;  4PV6 A;  3TO6 A;  2G3T A;  2B4D B;  2GAN A;  3TFY A;  1YRE A;  2B4B A;  3PGP A;  2JDC A;  2NMT A;  2HUZ A;  4F6A A;  2B3V A;  4MFL A;  4CAF A;  1Q2C A;  1NE9 A;  4RI1 A;  1NMT A;  2FCK A;  4UWI A;  4CYO A;  3TOA A;  2QML A;  3S6K A;  2P6G A;  4MY3 A;  2PR1 A;  2CXA A;  5AG4 A;  2IL4 A;  2P6E A;  1U6M A;  1NSL A;  2QIR A;  3IGR A;  2VQY A;  3FB3 A;  4K30 A;  3FYN A;  4UBR A;  3CXS A;  2PRB A;  4KVO E;  5EC4 A;  5F49 A;  3SXN A;  5IX3 A;  2H5M A;  1K4J A;  4MI4 A;  2Z10 A;  4XPL A;  3BJ7 A;  4QBJ A;  1I21 A;  2FIA A;  4KOU A;  4J3G A;  3H4Q A;  3G8W A;  4KLW A;  4CGL A;  4LUA A;  2CNT A;  3T9Y A;  4QC6 A;  5A28 A;  2GE3 A;  4UFW A;  4B13 A;  3EC4 A;  2Q4V A;  4XNH C;  2J8N A;  3JVN A;  1Y7R A;  1VKC A;  3F0A A;  4QB9 A;  4PSW A;  2DPT A;  1TIQ A;  4AVA A;  3W6X A;  4YRH A;  4A31 A;  1YLE A;  2BSW A;  4C2Y A;  2FT0 A;  1S60 A;  4KOX A;  1S7L A;  1WWZ A;  1Q2D A;  3F5B A;  5DWM A;  5HMN A;  2PQ8 A;  5HH1 A;  3R9E A;  5H86 A;  3SHP A;  2J8M A;  5J8C A;  1IB1 E;  1IYL A;  1MJB A;  1S3Z A;  4PK2 A;  1Z9U A;  3IWE A;  3P2F A;  3D2P A;  1S5K A;  1S7N A;  1V0C A;  5E96 A;  4CAV A;  3JTK A;  4NSQ A;  4CYQ A;  2Z11 A;  5G22 A;  4PK3 A;  3T90 A;  5JPH A;  4F0Y A;  5J8F A;  3LOD A;  3P2H A;  2EUI A;  3GYA A;  1VHS A;  2HQY A;  1SQH A;  4HKF A;  4JJX A;  4Q36 A;  4CYP A;  3D3S A;  4RS2 A;  4UCN A;  1Q2Y A;  1M4I A;  1QST A;  2Z3L A;  4XPD C;  1MK4 A;  4KVX A;  4C2X A;  4DNC A;  1KUX A;  4L89 A;  1I12 A;  1N71 A;  4JD6 A;  2OU2 A;  1M4G A;  4YFJ A;  2Z3N A;  4B10 A;  2DPS A;  1Z4R A;  2QEC A;  4MFJ A;  2Z0Z A;  3N7Z A;  4F0X A;  2VEZ A;  2R7H A;  3V8I A;  4ZGY B;  4BMH A;  1M4D A;  2I79 A;  1XIX A;  3H5Z A;  5AG6 A;  2DXQ A;  4B11 A;  3DNS A;  4CGO A;  1RO5 A;  2B5G B;  4R87 A;  2C27 A;  4KLV A;  2O28 A;  4UCP A;  2FXF A;  3S6H A;  4NEX A;  4GS4 A;  4L8A A;  4B14 A;  5EBV A;  3BLN A;  3A9L A;  1PUA A;  2Q7B A;  1YGH A;  4UWJ A;  4E2A A;  2REF A;  4ONU A;  3TE4 A;  3D8P A;  3PZJ A;  4OAD A;  4FD7 A;  1J4J A;  3QB8 A;  2BUE A;  2FL4 A;  2YGW A;  2VI7 A;  4KS9 A;  1I1D A;  2VZY A;  4MY0 A;  4B5O A;  1YX0 A;  4B5P A;  1Z4E A;  4AVB A;  3I3G A;  2B4D A;  3GY9 A;  4KOV A;  1FY7 A;  2RC4 A;  3D2M A;  4KOT A;  5FVJ A;  1QSR A;  2PDO A;  3R9F A;  1Y9K A;  3W6S A;  4AG9 A;  4H89 A;  4A30 A;  4CRZ B;  2BEI A;  2Z3P A;  2G3A A;  4OAE A;  2PC1 A;  4UCM A;  1KUV A;  4IUS A;  2Q04 A;  4R57 A;  4CGP A;  4CAW A;  5AG7 A;  5BWA B;  4JLY A;  3NE7 A;  4FD4 A;  4XNH B;  3S6F A;  4EVY A;  4A95 A;  3IU2 A;  5A27 A;  1KZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...