5FVJA

Crystal structure of tact (trna acetylating toxin) from salmonella
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
165
structure length
165
Chain Sequence
GPGGTMGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNMPDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFFIHHGFKSSQTQQRTLFLRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE ACETYLTRANSFERASE
publication title A Salmonella Toxin Promotes Persister Formation Through Acetylation of tRNA.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Transferase
total genus 44
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5fvjA00
2P6GA 4FD7A 4U9YA 3LODA 1QSRA 3DDDA 2QIRA 4M85A 4R9MA 3KKWA 2PC1A 3P2FA 5KTAA 4CRZB 5HH1A 3G3SA 4M3SA 1YLEA 4II9A 1IYLA 4JWPA 1YX0A 4ZBGA 2R7HA 1IYKA 3S6KA 1NSLA 3R9FA 5H84A 3PZJA 1KUVA 1I1DA 4PK3A 3T90A 4AB7A 2PRBA 1Q2DA 2Q0YA 2FSRA 3QB8A 1IICA 2Q7BA 4AVAA 3TE4A 4XPDC 2ZPAA 4MY0A 1BOBA 2GANA 2ZW4A 1S7NA 4ONUA 1ON0A 1XIXA 4K30A 1FY7A 4RI1A 1XE4A 5EBVA 4E0AA 4NSQA 4Y49B 1Y7RA 4NXYA 2B4BA 3IWGA 4KUAA 4KVOE 4R87A 3I9SA 4YGOA 2Z10A 5KTCA 2ARHA 2JLMA 2AJ6A 2WPXA 2OZHA 3ZZIA 4XPDB 5F48A 2GIVA 2Q04A 3FXTA 3LD2A 1Z9UA 2G3AA 4YRHA 4XPLA 2R98A 4KOTA 2Q44A 2WPWA 3TO6A 1Y9WA 1VKCA 1S7LA 1KUYA 4XNHC 3S6GA 4HNWB 4L8AA 4XPKA 2ZW6A 2Q4YA 3BLNA 5EC4A 2PR8A 4HNYB 1MJAA 1M4DA 2FIWA 3D8PA 1YR0A 3E0KA 3B8GA 4U9ZA 4OADA 2VBQA 3TO9A 5F49A 4H6UA 2X7BA 5H86A 1IB1E 4KVME 3VWEA 2EUIA 3R9EA 1B6BA 2EVNA 1PU9A 4FD5A 2A4NA 4DNCA 2GE3A 5C82A 4NF1A 4XNHB 1V0CA 4QBJA 3TT2A 4KLWA 4YFJA 2PSWA 3TTHA 3SXOA 3WR7A 1M44A 1KUXA 1UFHA 1YGHA 4KVXA 2BUEA 5IX3A 2R8VA 1LRZA 1WK4A 1Q2CA 3G8WA 2FT0A 1S60A 2P0WA 1KZFA 2R1IA 4QC6A 3EFAA 3T9YA 4KUBA 1M4IA 2OU2A 4BMHA 1NMTA 2OH1A 2Z11A 2JDDA 1S7FA 4UWIA 4MY3A 5IB0A 4MHDA 3DR6A 3F8KA 2OZUA 1QSMA 4R57A 2FE7A 5E96A 3ZJ0A 3R1KA 3EC4A 4NEXA 3RYOA 2QMLA 2DXQA 3CXPA 2FS5A 5DWNA 2Q4VA 4PK2A 5J8CA 3JVNA 3D2MA 3R96A 2CNTA 4KORA 3QAHA 2ATRA 3JUWA 2HQYA 4E8OA 4PSWA 2HV2A 3FBUA 1B87A 3CXQA 2CNSA 2VEZA 3S6HA 4R3LA 5DWMA 3GYAA 4HNXB 3TOAA 3DR8A 3VWDA 2K5TA 3PGPA 4B5OA 1J4JA 4MI4A 1RXTA 1YVKA 3BJ7A 3MGDA 2ZW5A 5J8FA 3GKRA 1Q2YA 4E2AA 4LUAA 3K9UA 1RO5A 1MK4A 4CAWA 4MBUA 4QVTA 1MJ9A 2VZYA 5KTDA 1S3ZA 4LX9A 3W6SA 2OZGA 4RS2A 4UA3A 5JQ4A 1YREA 3TO7A 4AVBA 4GS4A 3PP9A 4MJ8A 4KOSA 4J3GA 4KOVA 3N7ZA 3UY5A 5ISVA 2PR1A 1Z4EA 2FL4A 2I00A 4KLVA 2B58A 3EY5A 2BL1A 1BO4A 2RC4A 2REFA 1K4JA 4NCZA 3TOBA 4KOYA 4EVYA 5JPHA 1Z4RA 4KOUA 2Z0ZA 3CXSA 3TFYA 3P2HA 1U6MA 1WWZA 4QB9A 4FD6A 1QSOA 4PSXA 2IL4A 2B4DA 5FVJA 3S6FA 5F47A 3FRMA 3FNCA 2G3TA 4FD4A 4JXRA 2QECA 4KOWA 4AG9A 3F5BA 2B5GB 5F46A 2D4PA 2VI7A 1N71A 2ZW7A 2OB0A 1L0CA 4IUSA 2P6FA 2G0BA 3H4QA 2P6EA 2VQYA 2PQ8A 4CAXA 3BJ8A 2JDCA 1I21A 2F5IA 1Y9KA 2JEVA 1PUAA 3NE7A 2AE6A 4JJXA 2C27A 4UWJA 3EXNA 5GCNA 1QSNA 2B5GA 5CNPA 4KZTA 4Y49C 2D4OA 1I12A 2FIAA 3EO4A 2J8MA 3W6XA 1TIQA 4H89A 4JLYA 1R57A 2CNMA 3OWCA 5HMNA 2HUZA 4U5YA 4OAEA 4X5KA 3F0AA 2I79A 1OZPA 4CAVA 4F0YA 1IIDA 2VZZA 1P0HA 1QSTA 2BSWA 4ORFA 2FXFA 1VHSA 3GY9A 1M1DA 2Y0MA 4L89A 4H6ZA 1CJWA 4B5PB 1S5KA 3V8IA 4QUSA 3IGRA 1CM0A 2ZXVA 1S7KA 1GHEA 3SXNA 2CY2A 4I49A 3R9GA 3DSBA 3TCVA 4R3KA 3W91A 1YK3A 5I0CA 1XEBA 2J8RA 4B5PA 4JD6A 1M4GA 3FYNA 4KOXA 4CS0B 2FCKA 1MJBA 3DNSA 4IF5A 3R95A 3D3SA 1P4NA 2KCWA 2H5MA 2B3VA 4F6AA 2BEIA 1YVOA 2B4DB 4AG7A 5C88A 2J8NA 4OLLA 4CRYB 2NMTA 3D2PA 1XF8A 1NE9A 4JXQA 2PDOA 1XMTA 3FIXA 3I3GA 4PV6A 2VXKA 3FB3A 1SQHA 4HKFA 3C26A 4AVCA 5IV0A 2REEA 2B3UA 3SHPA 4UBRA 2O28A
chains in the Genus database with same CATH superfamily
2BOAA 2P6GA 2PVVA 4FD7A 1FT7A 4JYWA 4U9YA 3LODA 1QSRA 3DDDA 4R8FA 1HDQA 5JGFA 1FNOA 2QIRA 4M85A 4R9MA 3KKWA 2NYQA 5DS0A 2PC1A 3P2FA 5KTAA 2IJZA 5CBMA 4CRZB 4W9YA 2DPTA 5HH1A 3FF3A 4FUUA 2C6GA 3G3SA 3ISZA 4M3SA 4HPSA 1YLEA 4MHNA 4II9A 3SJXA 1IYLA 3IFEA 2C6CA 1ZG9A 4JWPA 1YX0A 4DJLA 4ZBGA 2R7HA 4GM5A 2AFSA 1IYKA 3S6KA 3SJGA 1X12A 4OMEA 4UCNA 3BHXA 1NSLA 5HVFA 2XEIA 4NJRA 1TKFA 3R9FA 5H84A 4F8ZA 3NA6A 2ZEEA 1KUVA 3PZJA 1TKHA 1DE4C 4R76A 1PYTB 1I1DA 4PK3A 3T90A 3QAYA 4AB7A 1CBXA 2PRBA 5A28A 2V8VA 4OC0A 2EK9A 3KHXA 1XMBA 1Q2DA 2Q0YA 3BI0A 2GREA 3TX8A 2FSRA 3PRTA 3QB8A 1IICA 2Q7BA 4AVAA 3TE4A 4XPDC 4C7HA 2PJAA 4F9UA 5LRKA 4P45A 2ZPAA 4MY0A 5G21A 1IU8A 4MHZA 3IC1A 5F09A 1BOBA 3D68A 2GANA 2ZW4A 4IHMA 2EBJA 2PJCA 1S7NA 3FJUA 1YW6A 3B3VA 3FH4A 2Z3NA 4ONUA 4F0XA 1ON0A 2C6PA 2V77A 4TWEA 3PFOA 4CAEA 2ZOFA 1XIXA 4K30A 1FY7A 4LQGA 4UFXA 4ZY0A 4RI1A 1XE4A 3KASA 5EBVA 4NSQA 4Y49B 4E0AA 1Y7RA 4ZX8A 4NXYA 3VATA 2B4BA 3IWGA 1M4LA 4KUAA 4KVOE 2ZEHA 3I9SA 4R87A 1X10A 5AG5A 4A38A 3H5ZA 4RN7A 3GUXA 4A94A 4YGOA 2Z10A 5HVGA 2PJ4A 3NH4A 5KTCA 4B13A 2ARHA 2JLMA 1CX8A 2ZOGA 2AJ6A 2Z3KA 2WPXA 2DF5A 2OZHA 1ZLIA 3ZZIA 6CPAA 4XPDB 4Z65A 3IWEA 5BWAB 4OC1A 3FVLA 1XFOA 2GLJA 5F48A 4P6YA 2Z3LA 2GIVA 1Z8LA 2Q04A 2Q51A 3FXTA 3LD2A 1Z9UA 2FVGA 2G3AA 3CT9A 4KOWA 4A37A 4YRHA 1ZLHA 4C2ZA 3S9LA 3KI9A 4PXCA 1Z5RA 2IQ6A 4MFZA 4XPLA 3GLJA 4MFLA 2R98A 4KOTA 4M6GA 3V38A 4C2YA 4Q7AA 3B3SA 2Q44A 3IIBA 4EMEA 4BINA 1YQEA 2WPWA 4RUHA 2ODFA 2PJ0A 3TO6A 2PJ9A 4DYOA 1Y9WA 1VKCA 1S7LA 1KUYA 4R7MA 3NH5A 3ISXA 4XNHC 1CPXA 4HNWB 3S6GA 2AFOA 4L8AA 3VARA 8CPAA 4XPKA 2ZW6A 2Q4YA 5J1QA 3BLNA 4OC3A 5EC4A 4UFVA 2PR8A 4HNYB 1MJAA 2O53A 1M4DA 3KL9A 2FIWA 3PBBA 4MFPA 2GU2A 1YR0A 2V8GA 3D8PA 3D7FA 3E0KA 2RFHA 3B8GA 1Z8WA 1VHOA 4U9ZA 4P4EA 4OADA 2VBQA 4P4FA 3NFZA 3CDXA 2Q43A 3CZXA 1DTDA 3TO9A 5F49A 4H6UA 2X7BA 5H86A 1CPSA 4JXRA 1IB1E 4KVME 3VWEA 2EUIA 3R9EA 3RBUA 3TC8A 2CTBA 2OOTA 1B6BA 1XRYA 2EVNA 2ZELA 1PU9A 3L2NA 4FD5A 2A4NA 4UCMA 2GE3A 4DNCA 5C82A 2PJ3A 3KHZA 4NF1A 4XNHB 1V0CA 4QBJA 3TT2A 4KLWA 1QQ9A 4A2ZA 4YFJA 5LYIA 2PSWA 5D8NA 3TTHA 1F57A 1LAMA 3SXOA 1EE3P 3WR7A 1M44A 1KUXA 1UFHA 1YGHA 1Y7EA 4KVXA 2BUEA 4B14A 5IX3A 4CAFA 2R8VA 1LRZA 1WK4A 3S9MA 1Q2CA 3G8WA 2FT0A 5HXDA 1S60A 2P0WA 1KZFA 1VIXA 2R1IA 2XEJA 2HC9A 4QC6A 3EFAA 4IK2A 3T9YA 4KUBA 1M4IA 4UFWA 4MFKA 1H8LA 4H2KA 2OU2A 3V7ZA 2V8DA 4NGPA 3LACA 5G1ZA 4ZGYB 4BMHA 2JBKA 4KSIA 2J9AA 4KSAA 4OIDA 4PXBA 4X3RA 4C2XA 1NMTA 5LYLA 2EK8A 4MHYA 2BCOA 2OH1A 2Z11A 4ONWA 2CIJA 5CPAA 2JDDA 4A31A 1S7FA 4ZY2A 3IEHA 4UWIA 4MY3A 5IB0A 4MHDA 3KZWA 1PCAA 3DR6A 3F8KA 2OZUA 1QSMA 4R57A 4UF4A 5AG4A 3D7DA 1OBRA 2FE7A 2PJ6A 4CGPA 4MFQA 4YWYA 3MRUA 3T8WA 1TF9A 5E96A 3RNZA 3ZJ0A 4FBEA 3R1KA 3EC4A 4NEXA 3RYOA 2QMLA 3D4UA 3FEEA 2DXQA 3CXPA 3KQZA 4MXUA 2FS5A 4A30A 2QJ8A 5DWNA 2Q4VA 3B3TA 4MHPA 4PK2A 5J8CA 5AG6A 3JVNA 1A2ZA 2WSAA 2POKA 4CGLA 3D2MA 2PJ1A 4PPZA 3R96A 1R43A 2G9DA 2CNTA 3WC6A 2YNEA 1XOVA 4B12A 4KORA 1CG2A 3QAHA 2ATRA 5K8PA 3H8EA 3JUWA 2HQYA 2PCUA 5G20A 3B7IA 4IAVA 4E8OA 1AUGA 4PSWA 4OIWA 2HV2A 3FBUA 1B87A 1ZO0A 3IU1A 3CXQA 2I3CA 2CNSA 2VEZA 1TXRA 3S6HA 2ZEFA 4R3LA 2ZEDA 5DWMA 3RO0A 2QVPA 1CP6A 3GYAA 2EO8A 3B3CA 3KQXA 4HNXB 3TOAA 3DR8A 3VH9A 5G22A 3SI2A 3VWDA 2K5TA 3I1UA 3PGPA 4B5OA 1LCPA 1J4JA 2BO9A 4MI4A 5I4MA 1RXTA 1YVKA 3BJ7A 5K8MA 3MGDA 1YLOA 1ZG7A 2PJ8A 4NGNA 4NJQA 2ZW5A 5J8FA 1Z8TA 1Q2YA 3GKRA 4E2AA 4LUAA 3K9UA 3PFEA 2ZEOA 1RO5A 1MK4A 3IO1A 1BPNA 2IMOA 4CAWA 4MBUA 4QVTA 1MJ9A 1LAPA 1F2PA 4CYOA 2VZYA 2CF4A 2EWBA 5KTDA 1S3ZA 4FWUA 4MCRA 3QNVA 4NGSA 1YW4A 3PB9X 4LX9A 5AGEA 2WYRA 4PQAA 4M6HA 3W6SA 2OZGA 2XEFA 4MRIA 4A32A 4RS2A 4UA3A 3WC7A 1IGBA 1YREA 2HB6A 5JQ4A 3TO7A 2F7VA 4AVBA 2ABZA 4GS4A 3PP9A 4MJ8A 4Q38A 4KOSA 4J3GA 2RB7A 2PIZA 4F9VA 3N5FA 3GB0A 1YSJA 4OP4A 2JEWA 4KOVA 2AFZA 3B2YA 3N7ZA 1R3NA 4CPAA 2GFQA 2Q7SA 5JH9A 3UY5A 5ISVA 2WZNA 2PR1A 1Y0RA 5LRGA 1ELLP 4GXHA 3SJEA 4LQ6A 4DUKA 1Z4EA 2FL4A 2CTCA 2I00A 4KLVA 2B58A 3EY5A 5LYDA 3RZAA 2AFUA 2XEGA 1XBUA 4NGRA 2BL1A 1BO4A 2GLFA 2RC4A 5JM6A 1JWQA 4P4JA 2REFA 7CPAA 1K4JA 4UEFA 4NCZA 1AYEA 2C1CA 4UCPA 3TOBA 3IWWA 2PVWA 3MN8A 4KOYA 1BAVA 4EVYA 1Z4RA 5JPHA 4KOUA 3SI1A 2Z0ZA 3CXSA 4OKOA 4FAIA 3TFYA 3P2HA 3PB4X 2Z3OA 3FECA 1U6MA 2ZENA 2NSMA 4P4BA 1Y0YA 1WWZA 4QB9A 1ELMP 4FD6A 4JZ0A 4UEZA 2V8HA 3JRUA 1QSOA 4PSXA 1BLLE 4P4DA 4BD9A 2IL4A 3WT4A 2B4DA 5FVJA 3K2KA 3S6FA 5F47A 2PJBA 3IU2A 4PXEA 3FRMA 3FNCA 3JTKA 1GYTA 2G3TA 4FD4A 1Q7LA 1YMEA 2PRQA 2QECA 2QYVA 3F5BA 3NH8A 4MMOA 4AG9A 4P44A 4MCPA 2B5GB 2O4HA 5F46A 2D4PA 2VI7A 2YGWA 4O23A 2ZEPA 1N71A 4PXDA 4CYQA 2ZW7A 4OC5A 4A33A 4MFJA 2PJ2A 2OB0A 3PB7X 1L0CA 4IUSA 2P6FA 2G0BA 3H4QA 2P6EA 2VQYA 2PQ8A 3S9NA 4CAXA 3BJ8A 2JDCA 4C68A 4WWVA 1I21A 1CP7A 2F5IA 2WUUA 3K9TA 4G1PA 2JBJA 1Y9KA 2JEVA 1PUAA 3B3WA 1KWMA 3NE7A 4NGTA 2AE6A 2ZEGA 4JJXA 4P10A 5D29A 2C27A 4UWJA 1UWYA 3EXNA 5GCNA 1QSNA 2B5GA 3KR4A 4KZTA 1ARMA 4Y49C 5CNPA 2D4OA 1I12A 2FIAA 3EO4A 2J8MA 3PB6X 3W6XA 1TIQA 4CGNA 4P4IA 3D7GA 4WJBA 4NGMA 4H89A 4JLYA 1QMUA 2YNDA 1R57A 4M6IA 1Z2LA 4NGQA 2CNMA 3BXMA 3OWCA 5HMNA 2HUZA 4U5YA 4OAEA 4X5KA 1ARLA 4CYNA 5K8OA 3F0AA 2I79A 1OZPA 4CAVA 2YNCC 3BI1A 2DEAA 3PB8X 1IIDA 4F0YA 3LMSA 2VZZA 3DLJA 1P0HA 4R6TA 1QSTA 3NE8A 2BSWA 4KSFA 1TF8A 4ORFA 2FXFA 3LWUA 3PBEA 3SI0A 3WC5A 1VHSA 3GY9A 1M1DA 1HDUA 4KS9A 2PIYA 2Q4ZA 1IY7A 2ZEMA 3H8FA 2VL1A 5ELYA 4B6ZA 2Y0MA 1IOFA 4L89A 4H6ZA 1CJWA 4MCSA 4B5PB 4EWTA 1S5KA 2PJ5A 3V8IA 2PE3A 5LRJA 3SJFA 4X8IA 1TKJA 4UIBA 4QUSA 4BBHA 3IGRA 1CM0A 2ZXVA 1S7KA 3FMCA 3A9LA 2F8HA 1GHEA 5AG7A 4ZX9A 2CY2A 3SXNA 1F2OA 4I49A 4A39A 1LFWA 2CXAA 4ZY1A 3GIUA 3R9GA 4ZI6A 3DSBA 3TCVA 3KGQA 4R3KA 1NSAA 4UEEA 5EMIA 4B10A 2AFMA 3W91A 5THWA 1YK3A 4NFRA 5I0CA 4ZYQA 1XEBA 2J8RA 4B5PA 3D7HA 4JD6A 1M4GA 3D67A 3FYNA 3HUVA 4KOXA 4CS0B 2FCKA 1LANA 1MJBA 3DNSA 4IF5A 1VHEA 3R95A 1IOIA 3D3SA 4B11A 4C7IA 3IJ3A 1P4NA 2KCWA 3DGVA 3H8GA 2H5MA 1VGYA 2B3VA 4AXVA 4F6AA 5K8NA 2YNCA 5IB9A 4MCQA 2BEIA 1ZG8A 3RAMA 3KR5A 1YVOA 2B4DB 4OC2A 2PJ7A 3FEDA 4AG7A 2J8NA 5C88A 2DPSA 4OLLA 5HVHA 1HEEA 4CRYB 2ANPA 2NMTA 3CPXA 2Z3PA 3WABA 4UIAA 1BPMA 3D2PA 3CPAA 1XJOA 1XF8A 1NE9A 2PDOA 1XMTA 1JQGA 3FIXA 3HLPA 2OR4A 3I3GA 4JXQA 4TNUA 2AFWA 4PV6A 4OC4A 2VXKA 2AFXA 4K3NA 1RTQA 3FB3A 4CYPA 1SQHA 5LYFA 1Z8XA 3B35A 3C26A 4HKFA 3D66A 4A95A 3FX6A 4AVCA 5IV0A 5A27A 2REEA 4CGMA 1AMPA 3PEIA 4X2TA 4CGOA 2B3UA 3SHPA 2Z3MA 4UBRA 1LOKA 4Q36A 4YU9A 2O28A 4EFDA
chains in the Genus database with same CATH topology
2P6GA 4FD7A 4U9YA 3LODA 1QSRA 3DDDA 2QIRA 4M85A 4R9MA 3KKWA 2PC1A 3P2FA 5KTAA 4CRZB 5HH1A 2DPTA 3G3SA 4M3SA 1YLEA 4II9A 1IYLA 4JWPA 1YX0A 4ZBGA 2R7HA 1IYKA 3S6KA 4UCNA 1NSLA 3R9FA 5H84A 3PZJA 1KUVA 1I1DA 4PK3A 3T90A 4AB7A 5A28A 2PRBA 1Q2DA 2Q0YA 2FSRA 3QB8A 1IICA 2Q7BA 4AVAA 3TE4A 4XPDC 4C7HA 2ZPAA 4MY0A 5G21A 1BOBA 2GANA 2ZW4A 1S7NA 4ONUA 2Z3NA 4F0XA 1ON0A 4CAEA 1XIXA 4K30A 1FY7A 4UFXA 4RI1A 1XE4A 5EBVA 4E0AA 4NSQA 4Y49B 1Y7RA 4NXYA 2B4BA 3IWGA 4KUAA 4KVOE 4R87A 3I9SA 5AG5A 3H5ZA 4YGOA 2Z10A 5KTCA 4B13A 2ARHA 2JLMA 2AJ6A 2Z3KA 2WPXA 2OZHA 3ZZIA 4XPDB 3IWEA 5BWAB 5F48A 2Z3LA 2GIVA 2Q04A 3FXTA 3LD2A 1Z9UA 2G3AA 4YRHA 4C2ZA 4XPLA 4MFZA 4C2YA 4MFLA 2R98A 4KOTA 2Q44A 2WPWA 3TO6A 1Y9WA 1VKCA 1S7LA 1KUYA 4XNHC 3S6GA 4HNWB 4L8AA 4XPKA 2ZW6A 2Q4YA 3BLNA 5EC4A 4UFVA 2PR8A 4HNYB 1MJAA 1M4DA 2FIWA 4MFPA 3D8PA 1YR0A 3E0KA 3B8GA 4U9ZA 4OADA 2VBQA 3TO9A 5F49A 4H6UA 2X7BA 5H86A 1IB1E 4KVME 3VWEA 2EUIA 3R9EA 1B6BA 2EVNA 1PU9A 4FD5A 2A4NA 4UCMA 2GE3A 4DNCA 5C82A 4NF1A 4XNHB 1V0CA 4QBJA 3TT2A 4KLWA 4A2ZA 4YFJA 2PSWA 3TTHA 3SXOA 3WR7A 1M44A 1KUXA 1UFHA 1YGHA 4KVXA 4B14A 2BUEA 5IX3A 4CAFA 2R8VA 1LRZA 1WK4A 1Q2CA 3G8WA 2FT0A 1S60A 2P0WA 1KZFA 2R1IA 4QC6A 3EFAA 3T9YA 4KUBA 1M4IA 4UFWA 4MFKA 2OU2A 5G1ZA 4ZGYB 4BMHA 4C2XA 4KSAA 1NMTA 2OH1A 2Z11A 2JDDA 4A31A 1S7FA 4UWIA 4MY3A 5IB0A 4MHDA 3DR6A 3F8KA 2OZUA 1QSMA 4R57A 5AG4A 2FE7A 4CGPA 4MFQA 5E96A 3ZJ0A 3R1KA 3EC4A 4NEXA 3RYOA 2QMLA 2DXQA 3CXPA 2FS5A 4A30A 5DWNA 2Q4VA 4PK2A 5J8CA 5AG6A 3JVNA 2WSAA 4CGLA 3D2MA 3R96A 2CNTA 2YNEA 4B12A 4KORA 3QAHA 2ATRA 3JUWA 2HQYA 5G20A 4E8OA 4PSWA 2HV2A 3FBUA 1B87A 1ZO0A 3IU1A 3CXQA 2CNSA 2VEZA 3S6HA 4R3LA 5DWMA 3GYAA 4HNXB 3TOAA 3DR8A 5G22A 3VWDA 2K5TA 3PGPA 4B5OA 1J4JA 4MI4A 1RXTA 1YVKA 3BJ7A 3MGDA 2ZW5A 5J8FA 3GKRA 1Q2YA 4E2AA 4LUAA 3K9UA 1RO5A 1MK4A 4CAWA 4MBUA 4QVTA 1MJ9A 4CYOA 2VZYA 5KTDA 1S3ZA 4LX9A 5AGEA 3W6SA 2OZGA 4A32A 4RS2A 4UA3A 5JQ4A 1YREA 3TO7A 4AVBA 4GS4A 3PP9A 4MJ8A 4Q38A 4KOSA 4J3GA 4KOVA 3N7ZA 3UY5A 5ISVA 2PR1A 1Z4EA 2FL4A 2I00A 4KLVA 2B58A 3EY5A 2BL1A 1BO4A 2RC4A 2REFA 1K4JA 4NCZA 4UCPA 3TOBA 4KOYA 4EVYA 5JPHA 1Z4RA 4KOUA 2Z0ZA 3CXSA 3TFYA 3P2HA 2Z3OA 1U6MA 1WWZA 4QB9A 4FD6A 1QSOA 4PSXA 2IL4A 2B4DA 5FVJA 3S6FA 5F47A 3FRMA 3FNCA 3JTKA 2G3TA 4FD4A 4JXRA 2QECA 4KOWA 4AG9A 3F5BA 2B5GB 5F46A 2D4PA 2VI7A 2YGWA 4CYQA 1N71A 2ZW7A 4A33A 4MFJA 2OB0A 1L0CA 4IUSA 2P6FA 2G0BA 3H4QA 2P6EA 2VQYA 2PQ8A 4CAXA 3BJ8A 2JDCA 4C68A 1I21A 2F5IA 2WUUA 1Y9KA 2JEVA 1PUAA 3NE7A 2AE6A 4JJXA 2C27A 4UWJA 3EXNA 5GCNA 1QSNA 2B5GA 5CNPA 4KZTA 4Y49C 2D4OA 1I12A 2FIAA 3EO4A 2J8MA 3W6XA 1TIQA 4CGNA 4H89A 4JLYA 2YNDA 1R57A 2CNMA 3OWCA 5HMNA 2HUZA 4U5YA 4OAEA 4X5KA 4CYNA 3F0AA 2I79A 1OZPA 4CAVA 2YNCC 4F0YA 1IIDA 2VZZA 1P0HA 1QSTA 2BSWA 4KSFA 4ORFA 2FXFA 1VHSA 3GY9A 1M1DA 4KS9A 2Y0MA 4L89A 4H6ZA 1CJWA 4B5PB 1S5KA 3V8IA 4QUSA 4BBHA 3IGRA 1CM0A 2ZXVA 1S7KA 3A9LA 1GHEA 5AG7A 3SXNA 2CY2A 4I49A 2CXAA 3R9GA 3DSBA 3TCVA 4R3KA 4B10A 3W91A 1YK3A 5I0CA 1XEBA 2J8RA 4B5PA 4JD6A 1M4GA 3FYNA 4KOXA 4CS0B 2FCKA 1MJBA 3DNSA 4IF5A 3R95A 3D3SA 4B11A 4C7IA 1P4NA 2KCWA 2H5MA 2B3VA 4F6AA 2YNCA 2BEIA 1YVOA 2B4DB 4AG7A 5C88A 2J8NA 2DPSA 4OLLA 4CRYB 2NMTA 2Z3PA 3D2PA 3IU2A 1XF8A 1NE9A 4JXQA 2PDOA 1XMTA 3FIXA 3I3GA 4PV6A 2VXKA 4CYPA 3FB3A 1SQHA 4HKFA 3C26A 4AVCA 4A95A 5IV0A 5A27A 2REEA 4CGMA 4CGOA 2B3UA 3SHPA 2Z3MA 4UBRA 4Q36A 2O28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6G A;  4FD7 A;  4U9Y A;  3LOD A;  1QSR A;  3DDD A;  2QIR A;  4M85 A;  4R9M A;  3KKW A;  2PC1 A;  3P2F A;  5KTA A;  4CRZ B;  5HH1 A;  3G3S A;  4M3S A;  1YLE A;  4II9 A;  1IYL A;  4JWP A;  1YX0 A;  4ZBG A;  2R7H A;  1IYK A;  3S6K A;  1NSL A;  3R9F A;  5H84 A;  3PZJ A;  1KUV A;  1I1D A;  4PK3 A;  3T90 A;  4AB7 A;  2PRB A;  1Q2D A;  2Q0Y A;  2FSR A;  3QB8 A;  1IIC A;  2Q7B A;  4AVA A;  3TE4 A;  4XPD C;  2ZPA A;  4MY0 A;  1BOB A;  2GAN A;  2ZW4 A;  1S7N A;  4ONU A;  1ON0 A;  1XIX A;  4K30 A;  1FY7 A;  4RI1 A;  1XE4 A;  5EBV A;  4E0A A;  4NSQ A;  4Y49 B;  1Y7R A;  4NXY A;  2B4B A;  3IWG A;  4KUA A;  4KVO E;  4R87 A;  3I9S A;  4YGO A;  2Z10 A;  5KTC A;  2ARH A;  2JLM A;  2AJ6 A;  2WPX A;  2OZH A;  3ZZI A;  4XPD B;  5F48 A;  2GIV A;  2Q04 A;  3FXT A;  3LD2 A;  1Z9U A;  2G3A A;  4YRH A;  4XPL A;  2R98 A;  4KOT A;  2Q44 A;  2WPW A;  3TO6 A;  1Y9W A;  1VKC A;  1S7L A;  1KUY A;  4XNH C;  3S6G A;  4HNW B;  4L8A A;  4XPK A;  2ZW6 A;  2Q4Y A;  3BLN A;  5EC4 A;  2PR8 A;  4HNY B;  1MJA A;  1M4D A;  2FIW A;  3D8P A;  1YR0 A;  3E0K A;  3B8G A;  4U9Z A;  4OAD A;  2VBQ A;  3TO9 A;  5F49 A;  4H6U A;  2X7B A;  5H86 A;  1IB1 E;  4KVM E;  3VWE A;  2EUI A;  3R9E A;  1B6B A;  2EVN A;  1PU9 A;  4FD5 A;  2A4N A;  4DNC A;  2GE3 A;  5C82 A;  4NF1 A;  4XNH B;  1V0C A;  4QBJ A;  3TT2 A;  4KLW A;  4YFJ A;  2PSW A;  3TTH A;  3SXO A;  3WR7 A;  1M44 A;  1KUX A;  1UFH A;  1YGH A;  4KVX A;  2BUE A;  5IX3 A;  2R8V A;  1LRZ A;  1WK4 A;  1Q2C A;  3G8W A;  2FT0 A;  1S60 A;  2P0W A;  1KZF A;  2R1I A;  4QC6 A;  3EFA A;  3T9Y A;  4KUB A;  1M4I A;  2OU2 A;  4BMH A;  1NMT A;  2OH1 A;  2Z11 A;  2JDD A;  1S7F A;  4UWI A;  4MY3 A;  5IB0 A;  4MHD A;  3DR6 A;  3F8K A;  2OZU A;  1QSM A;  4R57 A;  2FE7 A;  5E96 A;  3ZJ0 A;  3R1K A;  3EC4 A;  4NEX A;  3RYO A;  2QML A;  2DXQ A;  3CXP A;  2FS5 A;  5DWN A;  2Q4V A;  4PK2 A;  5J8C A;  3JVN A;  3D2M A;  3R96 A;  2CNT A;  4KOR A;  3QAH A;  2ATR A;  3JUW A;  2HQY A;  4E8O A;  4PSW A;  2HV2 A;  3FBU A;  1B87 A;  3CXQ A;  2CNS A;  2VEZ A;  3S6H A;  4R3L A;  5DWM A;  3GYA A;  4HNX B;  3TOA A;  3DR8 A;  3VWD A;  2K5T A;  3PGP A;  4B5O A;  1J4J A;  4MI4 A;  1RXT A;  1YVK A;  3BJ7 A;  3MGD A;  2ZW5 A;  5J8F A;  3GKR A;  1Q2Y A;  4E2A A;  4LUA A;  3K9U A;  1RO5 A;  1MK4 A;  4CAW A;  4MBU A;  4QVT A;  1MJ9 A;  2VZY A;  5KTD A;  1S3Z A;  4LX9 A;  3W6S A;  2OZG A;  4RS2 A;  4UA3 A;  5JQ4 A;  1YRE A;  3TO7 A;  4AVB A;  4GS4 A;  3PP9 A;  4MJ8 A;  4KOS A;  4J3G A;  4KOV A;  3N7Z A;  3UY5 A;  5ISV A;  2PR1 A;  1Z4E A;  2FL4 A;  2I00 A;  4KLV A;  2B58 A;  3EY5 A;  2BL1 A;  1BO4 A;  2RC4 A;  2REF A;  1K4J A;  4NCZ A;  3TOB A;  4KOY A;  4EVY A;  5JPH A;  1Z4R A;  4KOU A;  2Z0Z A;  3CXS A;  3TFY A;  3P2H A;  1U6M A;  1WWZ A;  4QB9 A;  4FD6 A;  1QSO A;  4PSX A;  2IL4 A;  2B4D A;  5FVJ A;  3S6F A;  5F47 A;  3FRM A;  3FNC A;  2G3T A;  4FD4 A;  4JXR A;  2QEC A;  4KOW A;  4AG9 A;  3F5B A;  2B5G B;  5F46 A;  2D4P A;  2VI7 A;  1N71 A;  2ZW7 A;  2OB0 A;  1L0C A;  4IUS A;  2P6F A;  2G0B A;  3H4Q A;  2P6E A;  2VQY A;  2PQ8 A;  4CAX A;  3BJ8 A;  2JDC A;  1I21 A;  2F5I A;  1Y9K A;  2JEV A;  1PUA A;  3NE7 A;  2AE6 A;  4JJX A;  2C27 A;  4UWJ A;  3EXN A;  5GCN A;  1QSN A;  2B5G A;  5CNP A;  4KZT A;  4Y49 C;  2D4O A;  1I12 A;  2FIA A;  3EO4 A;  2J8M A;  3W6X A;  1TIQ A;  4H89 A;  4JLY A;  1R57 A;  2CNM A;  3OWC A;  5HMN A;  2HUZ A;  4U5Y A;  4OAE A;  4X5K A;  3F0A A;  2I79 A;  1OZP A;  4CAV A;  4F0Y A;  1IID A;  2VZZ A;  1P0H A;  1QST A;  2BSW A;  4ORF A;  2FXF A;  1VHS A;  3GY9 A;  1M1D A;  2Y0M A;  4L89 A;  4H6Z A;  1CJW A;  4B5P B;  1S5K A;  3V8I A;  4QUS A;  3IGR A;  1CM0 A;  2ZXV A;  1S7K A;  1GHE A;  3SXN A;  2CY2 A;  4I49 A;  3R9G A;  3DSB A;  3TCV A;  4R3K A;  3W91 A;  1YK3 A;  5I0C A;  1XEB A;  2J8R A;  4B5P A;  4JD6 A;  1M4G A;  3FYN A;  4KOX A;  4CS0 B;  2FCK A;  1MJB A;  3DNS A;  4IF5 A;  3R95 A;  3D3S A;  1P4N A;  2KCW A;  2H5M A;  2B3V A;  4F6A A;  2BEI A;  1YVO A;  2B4D B;  4AG7 A;  5C88 A;  2J8N A;  4OLL A;  4CRY B;  2NMT A;  3D2P A;  1XF8 A;  1NE9 A;  4JXQ A;  2PDO A;  1XMT A;  3FIX A;  3I3G A;  4PV6 A;  2VXK A;  3FB3 A;  1SQH A;  4HKF A;  3C26 A;  4AVC A;  5IV0 A;  2REE A;  2B3U A;  3SHP A;  4UBR A;  2O28 A; 
#chains in the Genus database with same CATH topology
 2BOA A;  2P6G A;  2PVV A;  4FD7 A;  1FT7 A;  4JYW A;  4U9Y A;  3LOD A;  1QSR A;  3DDD A;  4R8F A;  1HDQ A;  5JGF A;  1FNO A;  2QIR A;  4M85 A;  4R9M A;  3KKW A;  2NYQ A;  5DS0 A;  2PC1 A;  3P2F A;  5KTA A;  2IJZ A;  5CBM A;  4CRZ B;  4W9Y A;  2DPT A;  5HH1 A;  3FF3 A;  4FUU A;  2C6G A;  3G3S A;  3ISZ A;  4M3S A;  4HPS A;  1YLE A;  4MHN A;  4II9 A;  3SJX A;  1IYL A;  3IFE A;  2C6C A;  1ZG9 A;  4JWP A;  1YX0 A;  4DJL A;  4ZBG A;  2R7H A;  4GM5 A;  2AFS A;  1IYK A;  3S6K A;  3SJG A;  1X12 A;  4OME A;  4UCN A;  3BHX A;  1NSL A;  5HVF A;  2XEI A;  4NJR A;  1TKF A;  3R9F A;  5H84 A;  4F8Z A;  3NA6 A;  2ZEE A;  1KUV A;  3PZJ A;  1TKH A;  1DE4 C;  4R76 A;  1PYT B;  1I1D A;  4PK3 A;  3T90 A;  3QAY A;  4AB7 A;  1CBX A;  2PRB A;  5A28 A;  2V8V A;  4OC0 A;  2EK9 A;  3KHX A;  1XMB A;  1Q2D A;  2Q0Y A;  3BI0 A;  2GRE A;  3TX8 A;  2FSR A;  3PRT A;  3QB8 A;  1IIC A;  2Q7B A;  4AVA A;  3TE4 A;  4XPD C;  4C7H A;  2PJA A;  4F9U A;  5LRK A;  4P45 A;  2ZPA A;  4MY0 A;  5G21 A;  1IU8 A;  4MHZ A;  3IC1 A;  5F09 A;  1BOB A;  3D68 A;  2GAN A;  2ZW4 A;  4IHM A;  2EBJ A;  2PJC A;  1S7N A;  3FJU A;  1YW6 A;  3B3V A;  3FH4 A;  2Z3N A;  4ONU A;  4F0X A;  1ON0 A;  2C6P A;  2V77 A;  4TWE A;  3PFO A;  4CAE A;  2ZOF A;  1XIX A;  4K30 A;  1FY7 A;  4LQG A;  4UFX A;  4ZY0 A;  4RI1 A;  1XE4 A;  3KAS A;  5EBV A;  4NSQ A;  4Y49 B;  4E0A A;  1Y7R A;  4ZX8 A;  4NXY A;  3VAT A;  2B4B A;  3IWG A;  1M4L A;  4KUA A;  4KVO E;  2ZEH A;  3I9S A;  4R87 A;  1X10 A;  5AG5 A;  4A38 A;  3H5Z A;  4RN7 A;  3GUX A;  4A94 A;  4YGO A;  2Z10 A;  5HVG A;  2PJ4 A;  3NH4 A;  5KTC A;  4B13 A;  2ARH A;  2JLM A;  1CX8 A;  2ZOG A;  2AJ6 A;  2Z3K A;  2WPX A;  2DF5 A;  2OZH A;  1ZLI A;  3ZZI A;  6CPA A;  4XPD B;  4Z65 A;  3IWE A;  5BWA B;  4OC1 A;  3FVL A;  1XFO A;  2GLJ A;  5F48 A;  4P6Y A;  2Z3L A;  2GIV A;  1Z8L A;  2Q04 A;  2Q51 A;  3FXT A;  3LD2 A;  1Z9U A;  2FVG A;  2G3A A;  3CT9 A;  4KOW A;  4A37 A;  4YRH A;  1ZLH A;  4C2Z A;  3S9L A;  3KI9 A;  4PXC A;  1Z5R A;  2IQ6 A;  4MFZ A;  4XPL A;  3GLJ A;  4MFL A;  2R98 A;  4KOT A;  4M6G A;  3V38 A;  4C2Y A;  4Q7A A;  3B3S A;  2Q44 A;  3IIB A;  4EME A;  4BIN A;  1YQE A;  2WPW A;  4RUH A;  2ODF A;  2PJ0 A;  3TO6 A;  2PJ9 A;  4DYO A;  1Y9W A;  1VKC A;  1S7L A;  1KUY A;  4R7M A;  3NH5 A;  3ISX A;  4XNH C;  1CPX A;  4HNW B;  3S6G A;  2AFO A;  4L8A A;  3VAR A;  8CPA A;  4XPK A;  2ZW6 A;  2Q4Y A;  5J1Q A;  3BLN A;  4OC3 A;  5EC4 A;  4UFV A;  2PR8 A;  4HNY B;  1MJA A;  2O53 A;  1M4D A;  3KL9 A;  2FIW A;  3PBB A;  4MFP A;  2GU2 A;  1YR0 A;  2V8G A;  3D8P A;  3D7F A;  3E0K A;  2RFH A;  3B8G A;  1Z8W A;  1VHO A;  4U9Z A;  4P4E A;  4OAD A;  2VBQ A;  4P4F A;  3NFZ A;  3CDX A;  2Q43 A;  3CZX A;  1DTD A;  3TO9 A;  5F49 A;  4H6U A;  2X7B A;  5H86 A;  1CPS A;  4JXR A;  1IB1 E;  4KVM E;  3VWE A;  2EUI A;  3R9E A;  3RBU A;  3TC8 A;  2CTB A;  2OOT A;  1B6B A;  1XRY A;  2EVN A;  2ZEL A;  1PU9 A;  3L2N A;  4FD5 A;  2A4N A;  4UCM A;  2GE3 A;  4DNC A;  5C82 A;  2PJ3 A;  3KHZ A;  4NF1 A;  4XNH B;  1V0C A;  4QBJ A;  3TT2 A;  4KLW A;  1QQ9 A;  4A2Z A;  4YFJ A;  5LYI A;  2PSW A;  5D8N A;  3TTH A;  1F57 A;  1LAM A;  3SXO A;  1EE3 P;  3WR7 A;  1M44 A;  1KUX A;  1UFH A;  1YGH A;  1Y7E A;  4KVX A;  2BUE A;  4B14 A;  5IX3 A;  4CAF A;  2R8V A;  1LRZ A;  1WK4 A;  3S9M A;  1Q2C A;  3G8W A;  2FT0 A;  5HXD A;  1S60 A;  2P0W A;  1KZF A;  1VIX A;  2R1I A;  2XEJ A;  2HC9 A;  4QC6 A;  3EFA A;  4IK2 A;  3T9Y A;  4KUB A;  1M4I A;  4UFW A;  4MFK A;  1H8L A;  4H2K A;  2OU2 A;  3V7Z A;  2V8D A;  4NGP A;  3LAC A;  5G1Z A;  4ZGY B;  4BMH A;  2JBK A;  4KSI A;  2J9A A;  4KSA A;  4OID A;  4PXB A;  4X3R A;  4C2X A;  1NMT A;  5LYL A;  2EK8 A;  4MHY A;  2BCO A;  2OH1 A;  2Z11 A;  4ONW A;  2CIJ A;  5CPA A;  2JDD A;  4A31 A;  1S7F A;  4ZY2 A;  3IEH A;  4UWI A;  4MY3 A;  5IB0 A;  4MHD A;  3KZW A;  1PCA A;  3DR6 A;  3F8K A;  2OZU A;  1QSM A;  4R57 A;  4UF4 A;  5AG4 A;  3D7D A;  1OBR A;  2FE7 A;  2PJ6 A;  4CGP A;  4MFQ A;  4YWY A;  3MRU A;  3T8W A;  1TF9 A;  5E96 A;  3RNZ A;  3ZJ0 A;  4FBE A;  3R1K A;  3EC4 A;  4NEX A;  3RYO A;  2QML A;  3D4U A;  3FEE A;  2DXQ A;  3CXP A;  3KQZ A;  4MXU A;  2FS5 A;  4A30 A;  2QJ8 A;  5DWN A;  2Q4V A;  3B3T A;  4MHP A;  4PK2 A;  5J8C A;  5AG6 A;  3JVN A;  1A2Z A;  2WSA A;  2POK A;  4CGL A;  3D2M A;  2PJ1 A;  4PPZ A;  3R96 A;  1R43 A;  2G9D A;  2CNT A;  3WC6 A;  2YNE A;  1XOV A;  4B12 A;  4KOR A;  1CG2 A;  3QAH A;  2ATR A;  5K8P A;  3H8E A;  3JUW A;  2HQY A;  2PCU A;  5G20 A;  3B7I A;  4IAV A;  4E8O A;  1AUG A;  4PSW A;  4OIW A;  2HV2 A;  3FBU A;  1B87 A;  1ZO0 A;  3IU1 A;  3CXQ A;  2I3C A;  2CNS A;  2VEZ A;  1TXR A;  3S6H A;  2ZEF A;  4R3L A;  2ZED A;  5DWM A;  3RO0 A;  2QVP A;  1CP6 A;  3GYA A;  2EO8 A;  3B3C A;  3KQX A;  4HNX B;  3TOA A;  3DR8 A;  3VH9 A;  5G22 A;  3SI2 A;  3VWD A;  2K5T A;  3I1U A;  3PGP A;  4B5O A;  1LCP A;  1J4J A;  2BO9 A;  4MI4 A;  5I4M A;  1RXT A;  1YVK A;  3BJ7 A;  5K8M A;  3MGD A;  1YLO A;  1ZG7 A;  2PJ8 A;  4NGN A;  4NJQ A;  2ZW5 A;  5J8F A;  1Z8T A;  1Q2Y A;  3GKR A;  4E2A A;  4LUA A;  3K9U A;  3PFE A;  2ZEO A;  1RO5 A;  1MK4 A;  3IO1 A;  1BPN A;  2IMO A;  4CAW A;  4MBU A;  4QVT A;  1MJ9 A;  1LAP A;  1F2P A;  4CYO A;  2VZY A;  2CF4 A;  2EWB A;  5KTD A;  1S3Z A;  4FWU A;  4MCR A;  3QNV A;  4NGS A;  1YW4 A;  3PB9 X;  4LX9 A;  5AGE A;  2WYR A;  4PQA A;  4M6H A;  3W6S A;  2OZG A;  2XEF A;  4MRI A;  4A32 A;  4RS2 A;  4UA3 A;  3WC7 A;  1IGB A;  1YRE A;  2HB6 A;  5JQ4 A;  3TO7 A;  2F7V A;  4AVB A;  2ABZ A;  4GS4 A;  3PP9 A;  4MJ8 A;  4Q38 A;  4KOS A;  4J3G A;  2RB7 A;  2PIZ A;  4F9V A;  3N5F A;  3GB0 A;  1YSJ A;  4OP4 A;  2JEW A;  4KOV A;  2AFZ A;  3B2Y A;  3N7Z A;  1R3N A;  4CPA A;  2GFQ A;  2Q7S A;  5JH9 A;  3UY5 A;  5ISV A;  2WZN A;  2PR1 A;  1Y0R A;  5LRG A;  1ELL P;  4GXH A;  3SJE A;  4LQ6 A;  4DUK A;  1Z4E A;  2FL4 A;  2CTC A;  2I00 A;  4KLV A;  2B58 A;  3EY5 A;  5LYD A;  3RZA A;  2AFU A;  2XEG A;  1XBU A;  4NGR A;  2BL1 A;  1BO4 A;  2GLF A;  2RC4 A;  5JM6 A;  1JWQ A;  4P4J A;  2REF A;  7CPA A;  1K4J A;  4UEF A;  4NCZ A;  1AYE A;  2C1C A;  4UCP A;  3TOB A;  3IWW A;  2PVW A;  3MN8 A;  4KOY A;  1BAV A;  4EVY A;  1Z4R A;  5JPH A;  4KOU A;  3SI1 A;  2Z0Z A;  3CXS A;  4OKO A;  4FAI A;  3TFY A;  3P2H A;  3PB4 X;  2Z3O A;  3FEC A;  1U6M A;  2ZEN A;  2NSM A;  4P4B A;  1Y0Y A;  1WWZ A;  4QB9 A;  1ELM P;  4FD6 A;  4JZ0 A;  4UEZ A;  2V8H A;  3JRU A;  1QSO A;  4PSX A;  1BLL E;  4P4D A;  4BD9 A;  2IL4 A;  3WT4 A;  2B4D A;  5FVJ A;  3K2K A;  3S6F A;  5F47 A;  2PJB A;  3IU2 A;  4PXE A;  3FRM A;  3FNC A;  3JTK A;  1GYT A;  2G3T A;  4FD4 A;  1Q7L A;  1YME A;  2PRQ A;  2QEC A;  2QYV A;  3F5B A;  3NH8 A;  4MMO A;  4AG9 A;  4P44 A;  4MCP A;  2B5G B;  2O4H A;  5F46 A;  2D4P A;  2VI7 A;  2YGW A;  4O23 A;  2ZEP A;  1N71 A;  4PXD A;  4CYQ A;  2ZW7 A;  4OC5 A;  4A33 A;  4MFJ A;  2PJ2 A;  2OB0 A;  3PB7 X;  1L0C A;  4IUS A;  2P6F A;  2G0B A;  3H4Q A;  2P6E A;  2VQY A;  2PQ8 A;  3S9N A;  4CAX A;  3BJ8 A;  2JDC A;  4C68 A;  4WWV A;  1I21 A;  1CP7 A;  2F5I A;  2WUU A;  3K9T A;  4G1P A;  2JBJ A;  1Y9K A;  2JEV A;  1PUA A;  3B3W A;  1KWM A;  3NE7 A;  4NGT A;  2AE6 A;  2ZEG A;  4JJX A;  4P10 A;  5D29 A;  2C27 A;  4UWJ A;  1UWY A;  3EXN A;  5GCN A;  1QSN A;  2B5G A;  3KR4 A;  4KZT A;  1ARM A;  4Y49 C;  5CNP A;  2D4O A;  1I12 A;  2FIA A;  3EO4 A;  2J8M A;  3PB6 X;  3W6X A;  1TIQ A;  4CGN A;  4P4I A;  3D7G A;  4WJB A;  4NGM A;  4H89 A;  4JLY A;  1QMU A;  2YND A;  1R57 A;  4M6I A;  1Z2L A;  4NGQ A;  2CNM A;  3BXM A;  3OWC A;  5HMN A;  2HUZ A;  4U5Y A;  4OAE A;  4X5K A;  1ARL A;  4CYN A;  5K8O A;  3F0A A;  2I79 A;  1OZP A;  4CAV A;  2YNC C;  3BI1 A;  2DEA A;  3PB8 X;  1IID A;  4F0Y A;  3LMS A;  2VZZ A;  3DLJ A;  1P0H A;  4R6T A;  1QST A;  3NE8 A;  2BSW A;  4KSF A;  1TF8 A;  4ORF A;  2FXF A;  3LWU A;  3PBE A;  3SI0 A;  3WC5 A;  1VHS A;  3GY9 A;  1M1D A;  1HDU A;  4KS9 A;  2PIY A;  2Q4Z A;  1IY7 A;  2ZEM A;  3H8F A;  2VL1 A;  5ELY A;  4B6Z A;  2Y0M A;  1IOF A;  4L89 A;  4H6Z A;  1CJW A;  4MCS A;  4B5P B;  4EWT A;  1S5K A;  2PJ5 A;  3V8I A;  2PE3 A;  5LRJ A;  3SJF A;  4X8I A;  1TKJ A;  4UIB A;  4QUS A;  4BBH A;  3IGR A;  1CM0 A;  2ZXV A;  1S7K A;  3FMC A;  3A9L A;  2F8H A;  1GHE A;  5AG7 A;  4ZX9 A;  2CY2 A;  3SXN A;  1F2O A;  4I49 A;  4A39 A;  1LFW A;  2CXA A;  4ZY1 A;  3GIU A;  3R9G A;  4ZI6 A;  3DSB A;  3TCV A;  3KGQ A;  4R3K A;  1NSA A;  4UEE A;  5EMI A;  4B10 A;  2AFM A;  3W91 A;  5THW A;  1YK3 A;  4NFR A;  5I0C A;  4ZYQ A;  1XEB A;  2J8R A;  4B5P A;  3D7H A;  4JD6 A;  1M4G A;  3D67 A;  3FYN A;  3HUV A;  4KOX A;  4CS0 B;  2FCK A;  1LAN A;  1MJB A;  3DNS A;  4IF5 A;  1VHE A;  3R95 A;  1IOI A;  3D3S A;  4B11 A;  4C7I A;  3IJ3 A;  1P4N A;  2KCW A;  3DGV A;  3H8G A;  2H5M A;  1VGY A;  2B3V A;  4AXV A;  4F6A A;  5K8N A;  2YNC A;  5IB9 A;  4MCQ A;  2BEI A;  1ZG8 A;  3RAM A;  3KR5 A;  1YVO A;  2B4D B;  4OC2 A;  2PJ7 A;  3FED A;  4AG7 A;  2J8N A;  5C88 A;  2DPS A;  4OLL A;  5HVH A;  1HEE A;  4CRY B;  2ANP A;  2NMT A;  3CPX A;  2Z3P A;  3WAB A;  4UIA A;  1BPM A;  3D2P A;  3CPA A;  1XJO A;  1XF8 A;  1NE9 A;  2PDO A;  1XMT A;  1JQG A;  3FIX A;  3HLP A;  2OR4 A;  3I3G A;  4JXQ A;  4TNU A;  2AFW A;  4PV6 A;  4OC4 A;  2VXK A;  2AFX A;  4K3N A;  1RTQ A;  3FB3 A;  4CYP A;  1SQH A;  5LYF A;  1Z8X A;  3B35 A;  3C26 A;  4HKF A;  3D66 A;  4A95 A;  3FX6 A;  4AVC A;  5IV0 A;  5A27 A;  2REE A;  4CGM A;  1AMP A;  3PEI A;  4X2T A;  4CGO A;  2B3U A;  3SHP A;  2Z3M A;  4UBR A;  1LOK A;  4Q36 A;  4YU9 A;  2O28 A;  4EFD A; 
#chains in the Genus database with same CATH homology
 2P6G A;  4FD7 A;  4U9Y A;  3LOD A;  1QSR A;  3DDD A;  2QIR A;  4M85 A;  4R9M A;  3KKW A;  2PC1 A;  3P2F A;  5KTA A;  4CRZ B;  5HH1 A;  2DPT A;  3G3S A;  4M3S A;  1YLE A;  4II9 A;  1IYL A;  4JWP A;  1YX0 A;  4ZBG A;  2R7H A;  1IYK A;  3S6K A;  4UCN A;  1NSL A;  3R9F A;  5H84 A;  3PZJ A;  1KUV A;  1I1D A;  4PK3 A;  3T90 A;  4AB7 A;  5A28 A;  2PRB A;  1Q2D A;  2Q0Y A;  2FSR A;  3QB8 A;  1IIC A;  2Q7B A;  4AVA A;  3TE4 A;  4XPD C;  4C7H A;  2ZPA A;  4MY0 A;  5G21 A;  1BOB A;  2GAN A;  2ZW4 A;  1S7N A;  4ONU A;  2Z3N A;  4F0X A;  1ON0 A;  4CAE A;  1XIX A;  4K30 A;  1FY7 A;  4UFX A;  4RI1 A;  1XE4 A;  5EBV A;  4E0A A;  4NSQ A;  4Y49 B;  1Y7R A;  4NXY A;  2B4B A;  3IWG A;  4KUA A;  4KVO E;  4R87 A;  3I9S A;  5AG5 A;  3H5Z A;  4YGO A;  2Z10 A;  5KTC A;  4B13 A;  2ARH A;  2JLM A;  2AJ6 A;  2Z3K A;  2WPX A;  2OZH A;  3ZZI A;  4XPD B;  3IWE A;  5BWA B;  5F48 A;  2Z3L A;  2GIV A;  2Q04 A;  3FXT A;  3LD2 A;  1Z9U A;  2G3A A;  4YRH A;  4C2Z A;  4XPL A;  4MFZ A;  4C2Y A;  4MFL A;  2R98 A;  4KOT A;  2Q44 A;  2WPW A;  3TO6 A;  1Y9W A;  1VKC A;  1S7L A;  1KUY A;  4XNH C;  3S6G A;  4HNW B;  4L8A A;  4XPK A;  2ZW6 A;  2Q4Y A;  3BLN A;  5EC4 A;  4UFV A;  2PR8 A;  4HNY B;  1MJA A;  1M4D A;  2FIW A;  4MFP A;  3D8P A;  1YR0 A;  3E0K A;  3B8G A;  4U9Z A;  4OAD A;  2VBQ A;  3TO9 A;  5F49 A;  4H6U A;  2X7B A;  5H86 A;  1IB1 E;  4KVM E;  3VWE A;  2EUI A;  3R9E A;  1B6B A;  2EVN A;  1PU9 A;  4FD5 A;  2A4N A;  4UCM A;  2GE3 A;  4DNC A;  5C82 A;  4NF1 A;  4XNH B;  1V0C A;  4QBJ A;  3TT2 A;  4KLW A;  4A2Z A;  4YFJ A;  2PSW A;  3TTH A;  3SXO A;  3WR7 A;  1M44 A;  1KUX A;  1UFH A;  1YGH A;  4KVX A;  4B14 A;  2BUE A;  5IX3 A;  4CAF A;  2R8V A;  1LRZ A;  1WK4 A;  1Q2C A;  3G8W A;  2FT0 A;  1S60 A;  2P0W A;  1KZF A;  2R1I A;  4QC6 A;  3EFA A;  3T9Y A;  4KUB A;  1M4I A;  4UFW A;  4MFK A;  2OU2 A;  5G1Z A;  4ZGY B;  4BMH A;  4C2X A;  4KSA A;  1NMT A;  2OH1 A;  2Z11 A;  2JDD A;  4A31 A;  1S7F A;  4UWI A;  4MY3 A;  5IB0 A;  4MHD A;  3DR6 A;  3F8K A;  2OZU A;  1QSM A;  4R57 A;  5AG4 A;  2FE7 A;  4CGP A;  4MFQ A;  5E96 A;  3ZJ0 A;  3R1K A;  3EC4 A;  4NEX A;  3RYO A;  2QML A;  2DXQ A;  3CXP A;  2FS5 A;  4A30 A;  5DWN A;  2Q4V A;  4PK2 A;  5J8C A;  5AG6 A;  3JVN A;  2WSA A;  4CGL A;  3D2M A;  3R96 A;  2CNT A;  2YNE A;  4B12 A;  4KOR A;  3QAH A;  2ATR A;  3JUW A;  2HQY A;  5G20 A;  4E8O A;  4PSW A;  2HV2 A;  3FBU A;  1B87 A;  1ZO0 A;  3IU1 A;  3CXQ A;  2CNS A;  2VEZ A;  3S6H A;  4R3L A;  5DWM A;  3GYA A;  4HNX B;  3TOA A;  3DR8 A;  5G22 A;  3VWD A;  2K5T A;  3PGP A;  4B5O A;  1J4J A;  4MI4 A;  1RXT A;  1YVK A;  3BJ7 A;  3MGD A;  2ZW5 A;  5J8F A;  3GKR A;  1Q2Y A;  4E2A A;  4LUA A;  3K9U A;  1RO5 A;  1MK4 A;  4CAW A;  4MBU A;  4QVT A;  1MJ9 A;  4CYO A;  2VZY A;  5KTD A;  1S3Z A;  4LX9 A;  5AGE A;  3W6S A;  2OZG A;  4A32 A;  4RS2 A;  4UA3 A;  5JQ4 A;  1YRE A;  3TO7 A;  4AVB A;  4GS4 A;  3PP9 A;  4MJ8 A;  4Q38 A;  4KOS A;  4J3G A;  4KOV A;  3N7Z A;  3UY5 A;  5ISV A;  2PR1 A;  1Z4E A;  2FL4 A;  2I00 A;  4KLV A;  2B58 A;  3EY5 A;  2BL1 A;  1BO4 A;  2RC4 A;  2REF A;  1K4J A;  4NCZ A;  4UCP A;  3TOB A;  4KOY A;  4EVY A;  5JPH A;  1Z4R A;  4KOU A;  2Z0Z A;  3CXS A;  3TFY A;  3P2H A;  2Z3O A;  1U6M A;  1WWZ A;  4QB9 A;  4FD6 A;  1QSO A;  4PSX A;  2IL4 A;  2B4D A;  5FVJ A;  3S6F A;  5F47 A;  3FRM A;  3FNC A;  3JTK A;  2G3T A;  4FD4 A;  4JXR A;  2QEC A;  4KOW A;  4AG9 A;  3F5B A;  2B5G B;  5F46 A;  2D4P A;  2VI7 A;  2YGW A;  4CYQ A;  1N71 A;  2ZW7 A;  4A33 A;  4MFJ A;  2OB0 A;  1L0C A;  4IUS A;  2P6F A;  2G0B A;  3H4Q A;  2P6E A;  2VQY A;  2PQ8 A;  4CAX A;  3BJ8 A;  2JDC A;  4C68 A;  1I21 A;  2F5I A;  2WUU A;  1Y9K A;  2JEV A;  1PUA A;  3NE7 A;  2AE6 A;  4JJX A;  2C27 A;  4UWJ A;  3EXN A;  5GCN A;  1QSN A;  2B5G A;  5CNP A;  4KZT A;  4Y49 C;  2D4O A;  1I12 A;  2FIA A;  3EO4 A;  2J8M A;  3W6X A;  1TIQ A;  4CGN A;  4H89 A;  4JLY A;  2YND A;  1R57 A;  2CNM A;  3OWC A;  5HMN A;  2HUZ A;  4U5Y A;  4OAE A;  4X5K A;  4CYN A;  3F0A A;  2I79 A;  1OZP A;  4CAV A;  2YNC C;  4F0Y A;  1IID A;  2VZZ A;  1P0H A;  1QST A;  2BSW A;  4KSF A;  4ORF A;  2FXF A;  1VHS A;  3GY9 A;  1M1D A;  4KS9 A;  2Y0M A;  4L89 A;  4H6Z A;  1CJW A;  4B5P B;  1S5K A;  3V8I A;  4QUS A;  4BBH A;  3IGR A;  1CM0 A;  2ZXV A;  1S7K A;  3A9L A;  1GHE A;  5AG7 A;  3SXN A;  2CY2 A;  4I49 A;  2CXA A;  3R9G A;  3DSB A;  3TCV A;  4R3K A;  4B10 A;  3W91 A;  1YK3 A;  5I0C A;  1XEB A;  2J8R A;  4B5P A;  4JD6 A;  1M4G A;  3FYN A;  4KOX A;  4CS0 B;  2FCK A;  1MJB A;  3DNS A;  4IF5 A;  3R95 A;  3D3S A;  4B11 A;  4C7I A;  1P4N A;  2KCW A;  2H5M A;  2B3V A;  4F6A A;  2YNC A;  2BEI A;  1YVO A;  2B4D B;  4AG7 A;  5C88 A;  2J8N A;  2DPS A;  4OLL A;  4CRY B;  2NMT A;  2Z3P A;  3D2P A;  3IU2 A;  1XF8 A;  1NE9 A;  4JXQ A;  2PDO A;  1XMT A;  3FIX A;  3I3G A;  4PV6 A;  2VXK A;  4CYP A;  3FB3 A;  1SQH A;  4HKF A;  3C26 A;  4AVC A;  4A95 A;  5IV0 A;  5A27 A;  2REE A;  4CGM A;  4CGO A;  2B3U A;  3SHP A;  2Z3M A;  4UBR A;  4Q36 A;  2O28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...