5FVJA

Crystal structure of tact (trna acetylating toxin) from salmonella
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
165
structure length
165
Chain Sequence
b'GPGGTMGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNMPDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFFIHHGFKSSQTQQRTLFLRLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE ACETYLTRANSFERASE
molecule tags Transferase
source organism Salmonella enterica subsp. enterica serovar typhimurium
publication title A Salmonella Toxin Promotes Persister Formation Through Acetylation of tRNA.
pubmed doi rcsb
total genus 44
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5fvjA00
3LODA 1VKCA 4NCZA 3D3SA 2P0WA 4KOYA 5KTDA 2PDOA 1Y9WA 4PSWA 4XPLA 3S6FA 3EY5A 1S5KA 1KUVA 1M4GA 1M4IA 1L0CA 4QBJA 1NSLA 2OZUA 3S6KA 3LD2A 3H4QA 3SXNA 2P6GA 3JVNA 2O28A 4KOSA 2HV2A 5F48A 4QB9A 2P6EA 2OB0A 5I0CA 1OZPA 2EVNA 2ZPAA 1Q2CA 3D2MA 1IYKA 4FD5A 1KUXA 3FXTA 1M4DA 2BUEA 3FYNA 3SXOA 4I49A 4AB7A 3D8PA 2EUIA 3ZJ0A 3QB8A 1NMTA 4Y49B 3PZJA 5HMNA 2G0BA 2JDDA 5F47A 3FIXA 1KZFA 5IV0A 2RC4A 3DNSA 1WK4A 3ZZIA 2PSWA 4MY3A 2DXQA 2D4OA 5JQ4A 4UBRA 4OADA 4KUBA 4LX9A 1M44A 2QECA 5DWMA 3N7ZA 4CS0B 3C26A 5J8FA 1GHEA 1IYLA 5KTCA 4B5PA 2Q4YA 5J8CA 4R3KA 4U9YA 2OZHA 1QSTA 2R8VA 4UA3A 4YGOA 1S7LA 5H84A 4PV6A 4IUSA 3T90A 3TOAA 1QSNA 4HNWB 4QVTA 1MK4A 4AG7A 4B5PB 2ZW4A 2Q44A 3IGRA 2OH1A 4F6AA 4ZBGA 2HQYA 2G3AA 2GANA 1KUYA 4BMHA 4UWIA 3T9YA 3QAHA 4HNYB 1XIXA 1MJ9A 2VQYA 4F0YA 2HUZA 1RXTA 3E0KA 4AG9A 3GKRA 4LUAA 2X7BA 2B3UA 4KLWA 3JUWA 3EXNA 3OWCA 2ZW7A 3NE7A 1I21A 3CXQA 4B5OA 4M85A 2ZXVA 3BJ8A 5CNPA 1XE4A 1I1DA 4KOTA 2CY2A 4MY0A 1V0CA 2IL4A 4DNCA 1S3ZA 3EFAA 1R57A 3S6GA 1YVKA 3F5BA 3B8GA 4QC6A 5F49A 1XMTA 3F0AA 3RYOA 5EBVA 5FVJA 2GIVA 4E2AA 4AVBA 4J3GA 2FIAA 3FNCA 2Z11A 4KVME 2Z10A 2GE3A 2Q4VA 1N71A 2FT0A 2A4NA 2B3VA 2BEIA 3WR7A 4KVOE 5ISVA 2ATRA 4OLLA 3GYAA 4U9ZA 2QIRA 5DWNA 4KOWA 2ARHA 4KOXA 1YK3A 1S7FA 2K5TA 3FBUA 3SHPA 3CXPA 2QMLA 2OU2A 1WWZA 3GY9A 2P6FA 3S6HA 4CRZB 4KOUA 4NSQA 3TOBA 4CAXA 3G8WA 5GCNA 4JJXA 4JLYA 4KOVA 2VXKA 4YFJA 1NE9A 4JWPA 1ON0A 4R9MA 2AE6A 2VI7A 3K9UA 2Y0MA 4X5KA 3DSBA 2I79A 3D2PA 2B5GB 4KORA 2FS5A 4HNXB 1Z9UA 2J8NA 2F5IA 2PRBA 4II9A 1YREA 1IICA 2PR1A 3UY5A 2JLMA 4H6UA 2R98A 3MGDA 1CM0A 3CXSA 1YLEA 4MHDA 4R3LA 4FD4A 4QUSA 4MJ8A 3BJ7A 4PK2A 2H5MA 4KLVA 4AVCA 1PUAA 4UWJA 2C27A 3G3SA 2VZYA 1QSRA 3TCVA 3TT2A 3W6XA 3PP9A 4E8OA 3EC4A 3I3GA 3TO9A 4RI1A 2FE7A 3W6SA 2FCKA 1Z4EA 4H6ZA 4FD6A 2PQ8A 1FY7A 2Q0YA 2VEZA 4H89A 5E96A 4KVXA 4OAEA 3TO6A 4R87A 3EO4A 4FD7A 4MBUA 5C82A 2B5GA 2JEVA 4KZTA 2FSRA 3TTHA 1TIQA 3P2FA 2R7HA 3IWGA 3KKWA 3P2HA 1Q2DA 4JXQA 4L8AA 3R9GA 4JXRA 1RO5A 2BL1A 1S60A 4EVYA 4PSXA 4XPKA 3VWEA 1QSMA 4PK3A 3PGPA 4XPDC 4NEXA 1P4NA 2D4PA 1P0HA 3W91A 5EC4A 4NXYA 2PR8A 3R96A 2JDCA 2J8RA 5HH1A 2AJ6A 1Y9KA 4XNHB 2B58A 4HKFA 1M1DA 4NF1A 2CNMA 5C88A 1LRZA 1IIDA 3TFYA 1MJBA 2WPXA 5IX3A 2B4DA 4M3SA 1XF8A 4XNHC 3TE4A 1YX0A 4ONUA 2ZW5A 1Z4RA 1BO4A 1K4JA 3R9EA 2FXFA 1YGHA 5KTAA 4U5YA 4XPDB 2NMTA 4MI4A 4K30A 2OZGA 3VWDA 5H86A 1UFHA 1Q2YA 3FB3A 5IB0A 1YR0A 2B4BA 2CNTA 4KUAA 3TO7A 2REFA 1S7NA 1U6MA 5F46A 4ORFA 3R95A 3R9FA 2J8MA 5JPHA 3BLNA 3DDDA 1B6BA 2B4DB 2G3TA 2I00A 2REEA 2CNSA 1CJWA 2R1IA 1BOBA 2Z0ZA 1IB1E 1SQHA 3V8IA 1MJAA 1B87A 4CRYB 1J4JA 1QSOA 4E0AA 1I12A 1VHSA 4YRHA 2ZW6A 3DR6A 3F8KA 1Y7RA 3FRMA 4GS4A 1YVOA 2Q04A 4JD6A 2Q7BA 2KCWA 4IF5A 2FL4A 1XEBA 3R1KA 2VBQA 4CAVA 2VZZA 1S7KA 3DR8A 2PC1A 1PU9A 2WPWA 3I9SA 2BSWA 4L89A 4R57A 4AVAA 4CAWA 2FIWA 4RS2A 4Y49C
chains in the Genus database with same CATH superfamily
2QVPA 2O53A 2NYQA 3WABA 2O4HA 3LODA 1VKCA 1CP7A 2IQ6A 2Z3NA 4NCZA 4WJBA 2Q7SA 1GYTA 3WT4A 3D3SA 2P0WA 4KOYA 5KTDA 2PDOA 1Y9WA 4PSWA 4XPLA 3S6FA 3EY5A 2CIJA 1S5KA 4FAIA 1KUVA 1M4GA 1M4IA 1L0CA 4A32A 1NSAA 1IGBA 3V38A 4QBJA 1ELMP 1NSLA 2OZUA 3NH8A 5HXDA 4UFWA 2NSMA 5IB9A 5AG5A 3S6KA 2V8HA 3LD2A 1JQGA 4X8IA 3H4QA 3A9LA 3SXNA 1LAMA 2P6GA 3JVNA 2O28A 4KOSA 4NGRA 4OMEA 2HV2A 2V8DA 3H5ZA 2YGWA 5F48A 2C6GA 3RZAA 2AFMA 4QB9A 1Z8WA 3T8WA 2P6EA 1X10A 2OB0A 5I0CA 1F2OA 1OZPA 2EVNA 3BI1A 1XOVA 2ZPAA 3PB8X 2PRQA 1Q2CA 3D2MA 1IYKA 4FD5A 4MFPA 2PJ7A 3WC6A 1KUXA 3FXTA 1CPXA 1M4DA 2ZEGA 4CYNA 5K8PA 3KQXA 3B3CA 3FEEA 3K2KA 1R43A 5A27A 2BUEA 4OC0A 3D66A 2ZEEA 3FYNA 3SXOA 4C2ZA 4I49A 2CTCA 3D8PA 2EUIA 3ZJ0A 1X12A 4AB7A 4BD9A 1AUGA 3QB8A 4A30A 2PCUA 4K3NA 1NMTA 3NA6A 2I3CA 2AFOA 1ARLA 3PZJA 3QAYA 4MXUA 4Y49B 5HMNA 2G0BA 4O23A 4NJQA 4YWYA 4F9VA 3MN8A 4NGPA 1ZO0A 2JDDA 2PJBA 5F47A 1ZLHA 3PBEA 3FIXA 3IO1A 4ZY2A 1FT7A 1KZFA 5IV0A 5F09A 2RC4A 3IEHA 3DNSA 2Z3OA 1WK4A 3ZZIA 4MCSA 2PJ1A 3NFZA 2PSWA 4MY3A 2DXQA 4ONWA 4B12A 2D4OA 1LCPA 2RFHA 5JQ4A 5HVGA 4MCRA 4UBRA 3KI9A 4OADA 1YW6A 4CGLA 4KUBA 4LX9A 1M44A 2QECA 3V7ZA 5LRKA 1FNOA 5DWMA 4CYQA 3N7ZA 4CS0B 1ZG8A 3S9MA 3PEIA 3C26A 5J8FA 3B3TA 1GHEA 1IYLA 4LQGA 4B10A 5KTCA 4B5PA 2Q4YA 1Z8XA 4C2XA 1ZG9A 4R6TA 5J8CA 4R3KA 4U9YA 4P4DA 2OZHA 2ZOFA 1CBXA 2YNEA 4MHPA 1QSTA 3GIUA 2R8VA 4UA3A 4YGOA 1S7LA 5H84A 4DJLA 1H8LA 1LOKA 4A38A 4PV6A 4GM5A 4IUSA 3T90A 3TOAA 3LWUA 4P4BA 4C68A 1QSNA 3HLPA 4HNWB 4QVTA 1MK4A 4AG7A 5LYDA 4UFVA 2PJ3A 2Q44A 2ZW4A 3IGRA 4B5PB 2OH1A 1ELLP 4WWVA 4ZBGA 4UFXA 4A94A 4F6AA 1F57A 2HQYA 2G3AA 2GU2A 2GANA 1KUYA 4BMHA 4H2KA 4UWIA 4OIDA 1PCAA 3T9YA 3CT9A 3QAHA 4OC3A 5CPAA 4HNYB 4PQAA 1XIXA 1MJ9A 2VQYA 4F0YA 2HUZA 3KASA 1RXTA 3E0KA 4AG9A 3D67A 3GKRA 1CPSA 2GLJA 4LUAA 4B11A 4MFZA 1TXRA 2B3UA 2X7BA 4KLWA 5AGEA 3I1UA 4UCPA 3JUWA 3EXNA 4Q38A 3OWCA 2ZW7A 3IU2A 3D7DA 2C6PA 1I21A 3CXQA 3NE7A 5G1ZA 4B5OA 4CGNA 4M85A 4Z65A 2ZEMA 3WC7A 1KWMA 4MCPA 2XEIA 4B6ZA 2ZXVA 4OC4A 4IK2A 4RUHA 3BJ8A 3DLJA 2ZEHA 5CNPA 4JYWA 3HUVA 1XE4A 1I1DA 1QQ9A 4MHNA 4KOTA 2CY2A 4MY0A 1V0CA 2YNDA 2RB7A 5DS0A 2ZELA 2IL4A 2V8GA 4A95A 1VGYA 1R3NA 3FMCA 1S3ZA 4KSAA 4DNCA 3EFAA 1R57A 3S6GA 1YVKA 3F5BA 3B8GA 4QC6A 3KL9A 5F49A 3H8FA 4PXBA 4ZYQA 1XMTA 3TC8A 3F0AA 3RYOA 4PXDA 5LYLA 2AFXA 4OC5A 5D29A 5EBVA 3IJ3A 5FVJA 2JEWA 5HVFA 2GIVA 3FJUA 3FF3A 4E2AA 1HEEA 2PE3A 4AVBA 4A39A 4EWTA 4ZGYB 4ZI6A 4MRIA 3PFEA 4J3GA 1Y7EA 3FX6A 1DE4C 2FIAA 3FNCA 3KR4A 4B14A 4F9UA 2Z11A 4KVME 2Z10A 2GE3A 2Q4VA 3DGVA 1N71A 2FT0A 2XEFA 2A4NA 2B3VA 2BEIA 3WR7A 4OKOA 2XEJA 3PB6X 1YLOA 4KVOE 5ISVA 4NGSA 2ATRA 2AFSA 4F8ZA 4OLLA 3IFEA 3GYAA 4U9ZA 2QIRA 4MFJA 5DWNA 4ZY0A 4KOWA 2ARHA 2BOAA 4DUKA 2VL1A 3D68A 3PB9X 4KOXA 4IAVA 5D8NA 3KZWA 1YK3A 3NH5A 1S7FA 2K5TA 3B3WA 3FBUA 3SHPA 5G21A 5I4MA 3CXPA 4P4EA 2QMLA 2OU2A 1WWZA 1UWYA 2EBJA 3GY9A 1CP6A 2EWBA 5AG7A 2P6FA 4CAEA 4UIBA 4UEZA 4CGOA 4EFDA 4A37A 4R7MA 3S6HA 3WC5A 4CRZB 4R76A 4KOUA 1Y0YA 4NSQA 3TOBA 3PRTA 2OOTA 4CAXA 3G8WA 5GCNA 3D7FA 4JJXA 1XFOA 4JLYA 4KOVA 2VXKA 1VHEA 4YFJA 2Z3PA 1NE9A 3IWWA 1ON0A 4JWPA 4R9MA 2AE6A 2VI7A 5AG4A 1AMPA 4OP4A 4P44A 1HDUA 3K9UA 2Y0MA 4X5KA 3DSBA 2PIZA 2I79A 3GUXA 2DF5A 3D2PA 2B5GB 4KORA 4M6IA 5G22A 4FUUA 1JWQA 2PJ5A 2FS5A 1TF8A 4HNXB 1Z9UA 2J8NA 3SJGA 2F5IA 3TX8A 2PRBA 3D7GA 4II9A 2JBKA 1IICA 1LAPA 1YREA 3D4UA 2PR1A 4NGMA 4DYOA 3TO6A 6CPAA 3SJFA 3UY5A 2JLMA 4H6UA 2GLFA 2R98A 4MMOA 1TKFA 3MGDA 1CM0A 4Q36A 3CXSA 1YLEA 4MHDA 4R3LA 5LYFA 1XJOA 2PJ8A 2Q51A 4P4JA 4FD4A 2YNCC 2CXAA 4QUSA 4CPAA 1RTQA 2PVWA 4MJ8A 3H8EA 3BJ7A 3GB0A 4PK2A 2H5MA 3KHXA 4KLVA 2PIYA 2ZEOA 4AVCA 1BPNA 1PUAA 5K8MA 4UEEA 4UWJA 2WZNA 3S9NA 2C27A 3G3SA 2Z3LA 2V8VA 2VZYA 1ARMA 1QSRA 4UF4A 3TCVA 3TT2A 3W6XA 2WUUA 3PP9A 1IU8A 4MFKA 4E8OA 3N5FA 3EC4A 2GFQA 3I3GA 3TO9A 4G1PA 4R8FA 2F8HA 4RI1A 2FE7A 3RAMA 3W6SA 1VHOA 4EMEA 3QNVA 2AFUA 2FCKA 1ZLIA 1Z4EA 5BWAB 1A2ZA 4H6ZA 4FD6A 3VH9A 4P45A 4TNUA 5EMIA 2PQ8A 2Z3MA 2PJ2A 3IWEA 1FY7A 2Q0YA 2VEZA 3D7HA 4H89A 4KVXA 4OAEA 4PXEA 5E96A 3NH4A 1CX8A 4UEFA 4R87A 3EO4A 2PJAA 3L2NA 3FH4A 3IIBA 2AFZA 4NFRA 2ZENA 4FD7A 4FWUA 4P6YA 3CDXA 3IU1A 2PJCA 4MBUA 4OC2A 3SI2A 4UIAA 4ZY1A 2IMOA 2EK8A 2B5GA 4OC1A 2JEVA 3SI0A 4KZTA 5K8NA 1TKJA 2FSRA 1YW4A 3TTHA 3FVLA 2JBJA 2ODFA 1YQEA 1TIQA 3P2FA 3VATA 1PYTB 2R7HA 2ANPA 3IWGA 4IHMA 3KKWA 4C2YA 3P2HA 1EE3P 1Q2DA 2F7VA 4B13A 1IOFA 3FECA 1XRYA 4JXQA 2CF4A 4L8AA 3RO0A 3R9GA 4JXRA 1RO5A 2BL1A 1S60A 4MCQA 4EVYA 4Q7AA 4FBEA 2ABZA 4PSXA 4XPKA 3VWEA 2HB6A 3B3SA 3S9LA 1QSMA 1TKHA 4PK3A 3PGPA 4RN7A 4XPDC 4NEXA 1P4NA 5JH9A 1ZG7A 2D4PA 2PJ6A 2ZEDA 4CGPA 1P0HA 2XEGA 3W91A 4PXCA 3NE8A 5EC4A 3KHZA 4UCMA 3B3VA 4NXYA 4CYPA 2BCOA 2EO8A 5A28A 1AYEA 5G20A 2IJZA 2HC9A 2PR8A 3R96A 3PFOA 4MHZA 2JDCA 2J8RA 5HH1A 2AJ6A 1Y9KA 4X3RA 4XNHB 2B58A 4HKFA 4AXVA 1BAVA 3SJXA 5CBMA 1M1DA 4CYOA 3LACA 2CNMA 4NF1A 1BLLE 3FEDA 1LRZA 2PJ9A 5C88A 1IIDA 5AG6A 3TFYA 4BINA 2BO9A 4MFLA 1MJBA 2WPXA 4NGNA 3JRUA 4M6HA 1DTDA 4KSFA 5IX3A 2B4DA 4M3SA 1XF8A 4M6GA 2GREA 4W9YA 4PPZA 1IY7A 4XNHC 4KS9A 4X2TA 3TE4A 2FVGA 3B2YA 4CAFA 4BBHA 3IC1A 1XMBA 1LFWA 3H8GA 3LMSA 4GXHA 3ISXA 1VIXA 1YX0A 4ONUA 2ZW5A 1Z4RA 3CPAA 1BO4A 3PB4X 4LQ6A 3B7IA 4MFQA 4YU9A 1K4JA 4F0XA 2CTBA 3R9EA 4TWEA 2FXFA 5K8OA 1M4LA 1YGHA 2QJ8A 1OBRA 5KTAA 4U5YA 2ZEPA 4XPDB 2NMTA 4C7IA 2J9AA 4MI4A 4K30A 1XBUA 2OZGA 3VWDA 4A33A 3VARA 5ELYA 5H86A 1TF9A 1UFHA 2V77A 4NJRA 3BI0A 1Q2YA 3FB3A 4JZ0A 4C7HA 1YR0A 3ISZA 7CPAA 1HDQA 2B4BA 2CNTA 4KUAA 5IB0A 5C82A 3TO7A 1Z2LA 2REFA 2ZEFA 1S7NA 1U6MA 4OIWA 4ORFA 5F46A 2DPTA 3B35A 4P10A 3R9FA 2J8MA 3R95A 5JPHA 2AFWA 3BLNA 1YMEA 1Z5RA 3DDDA 2Q43A 1B6BA 2PVVA 4ZX9A 2B4DB 2G3TA 2I00A 4CGMA 3SJEA 2REEA 2CNSA 1CJWA 2OR4A 2DPSA 4A2ZA 2POKA 2R1IA 3JTKA 2DEAA 1BOBA 2Z0ZA 3BXMA 1IB1E 1SQHA 3V8IA 1LANA 2WSAA 3GLJA 1Z8LA 1MJAA 1B87A 5LRGA 2C1CA 1BPMA 4CRYB 1J4JA 1QSOA 4E0AA 3K9TA 3MRUA 3KR5A 1I12A 1VHSA 4YRHA 2ZW6A 5LRJA 3DR6A 4KSIA 3F8KA 4MHYA 1QMUA 2EK9A 1Y7RA 3FRMA 5JM6A 4GS4A 1YVOA 3RNZA 4A31A 2Q04A 2YNCA 5J1QA 2WYRA 4JD6A 2Q7BA 5HVHA 2G9DA 2PJ0A 4P4FA 1CG2A 2KCWA 4IF5A 2PJ4A 2FL4A 1XEBA 1IOIA 3CPXA 3R1KA 4HPSA 4ZX8A 5THWA 3SI1A 2VBQA 4CAVA 2VZZA 8CPAA 2C6CA 1Q7LA 3CZXA 4UCNA 1Z8TA 4NGQA 1S7KA 3DR8A 3PBBA 5JGFA 2PC1A 3RBUA 1PU9A 1F2PA 3KGQA 2WPWA 3I9SA 2BSWA 3BHXA 4L89A 4R57A 2Q4ZA 1Y0RA 1YSJA 3KQZA 4NGTA 4P4IA 2QYVA 5LYIA 3PB7X 4AVAA 4CAWA 2FIWA 4RS2A 2Z3KA 2ZOGA 4Y49C
chains in the Genus database with same CATH topology
3LODA 1VKCA 2Z3NA 4NCZA 3D3SA 2P0WA 4KOYA 5KTDA 2PDOA 1Y9WA 4PSWA 4XPLA 3S6FA 3EY5A 1S5KA 1KUVA 1M4GA 1M4IA 1L0CA 4A32A 4QBJA 1NSLA 2OZUA 4UFWA 5AG5A 3S6KA 3LD2A 3H4QA 3A9LA 3SXNA 2P6GA 3JVNA 2O28A 4KOSA 2HV2A 3H5ZA 2YGWA 5F48A 4QB9A 2P6EA 2OB0A 5I0CA 1OZPA 2EVNA 2ZPAA 4MFPA 1Q2CA 3D2MA 1IYKA 4FD5A 1KUXA 3FXTA 1M4DA 4CYNA 5A27A 2BUEA 3FYNA 3SXOA 4C2ZA 4I49A 4AB7A 3D8PA 2EUIA 3ZJ0A 3QB8A 4A30A 1NMTA 4Y49B 3PZJA 5HMNA 2G0BA 1ZO0A 2JDDA 5F47A 3FIXA 1KZFA 5IV0A 2RC4A 3DNSA 2Z3OA 1WK4A 3ZZIA 2PSWA 4MY3A 2DXQA 4B12A 2D4OA 5JQ4A 4UBRA 4OADA 4CGLA 4KUBA 4LX9A 1M44A 2QECA 5DWMA 4CYQA 3N7ZA 4CS0B 3C26A 5J8FA 1GHEA 1IYLA 4B10A 5KTCA 4B5PA 2Q4YA 4C2XA 5J8CA 4R3KA 4U9YA 2OZHA 2YNEA 1QSTA 2R8VA 4UA3A 4YGOA 1S7LA 5H84A 4PV6A 4IUSA 3T90A 3TOAA 4C68A 1QSNA 4HNWB 4QVTA 1MK4A 4AG7A 4UFVA 2ZW4A 2Q44A 4B5PB 3IGRA 2OH1A 4F6AA 4ZBGA 4UFXA 2HQYA 2G3AA 2GANA 1KUYA 4BMHA 4UWIA 3T9YA 3QAHA 4HNYB 1XIXA 1MJ9A 2VQYA 4F0YA 2HUZA 1RXTA 3E0KA 4AG9A 3GKRA 4LUAA 4B11A 4MFZA 2X7BA 2B3UA 4KLWA 5AGEA 4UCPA 3JUWA 3EXNA 4Q38A 3OWCA 2ZW7A 3IU2A 3NE7A 1I21A 3CXQA 5G1ZA 4B5OA 4CGNA 4M85A 2ZXVA 3BJ8A 5CNPA 1XE4A 1I1DA 4KOTA 2CY2A 4MY0A 1V0CA 2YNDA 2IL4A 4A95A 4DNCA 4KSAA 1S3ZA 3EFAA 1R57A 3S6GA 1YVKA 3F5BA 3B8GA 4QC6A 5F49A 1XMTA 3F0AA 3RYOA 5EBVA 5FVJA 2GIVA 4E2AA 4AVBA 4ZGYB 4J3GA 4B14A 2FIAA 3FNCA 2Z11A 4KVME 2Z10A 2GE3A 2Q4VA 1N71A 2FT0A 2A4NA 2B3VA 2BEIA 3WR7A 4KVOE 5ISVA 2ATRA 4OLLA 3GYAA 4U9ZA 2QIRA 4MFJA 5DWNA 4KOWA 2ARHA 4KOXA 1YK3A 1S7FA 2K5TA 3FBUA 3SHPA 5G21A 3CXPA 2QMLA 2OU2A 1WWZA 3GY9A 5AG7A 2P6FA 4CAEA 4CGOA 3S6HA 4CRZB 4KOUA 4NSQA 3TOBA 4CAXA 3G8WA 5GCNA 4JJXA 4JLYA 4KOVA 2VXKA 4YFJA 2Z3PA 1NE9A 4JWPA 1ON0A 4R9MA 2AE6A 2VI7A 5AG4A 3K9UA 2Y0MA 4X5KA 3DSBA 2I79A 3D2PA 2B5GB 4KORA 5G22A 2FS5A 4HNXB 1Z9UA 2J8NA 2F5IA 2PRBA 4II9A 1YREA 1IICA 2PR1A 3UY5A 2JLMA 4H6UA 2R98A 3MGDA 1CM0A 4Q36A 3CXSA 1YLEA 4MHDA 4R3LA 4FD4A 2YNCC 2CXAA 4QUSA 4MJ8A 3BJ7A 4PK2A 2H5MA 4KLVA 4AVCA 1PUAA 4UWJA 2C27A 3G3SA 2Z3LA 2VZYA 1QSRA 3TCVA 3TT2A 3W6XA 2WUUA 3PP9A 4MFKA 4E8OA 3EC4A 3I3GA 3TO9A 4RI1A 2FE7A 3W6SA 2FCKA 1Z4EA 5BWAB 4H6ZA 4FD6A 2PQ8A 2Z3MA 3IWEA 1FY7A 2Q0YA 2VEZA 4H89A 5E96A 4KVXA 4OAEA 3TO6A 4A31A 4R87A 3EO4A 4FD7A 3IU1A 4MBUA 5C82A 2B5GA 2JEVA 4KZTA 2FSRA 3TTHA 1TIQA 3P2FA 2R7HA 3IWGA 3KKWA 4C2YA 3P2HA 1Q2DA 4B13A 4JXQA 4L8AA 3R9GA 4JXRA 1RO5A 2BL1A 1S60A 4EVYA 4PSXA 4XPKA 3VWEA 1QSMA 4PK3A 3PGPA 4XPDC 4NEXA 1P4NA 2D4PA 4CGPA 1P0HA 3W91A 5EC4A 4UCMA 4CYPA 4NXYA 5A28A 5G20A 2PR8A 3R96A 2JDCA 2J8RA 5HH1A 2AJ6A 1Y9KA 4XNHB 2B58A 4HKFA 1M1DA 4CYOA 4NF1A 2CNMA 5C88A 1LRZA 1IIDA 5AG6A 3TFYA 4MFLA 1MJBA 2WPXA 4KSFA 5IX3A 2B4DA 4M3SA 1XF8A 4XNHC 4KS9A 3TE4A 4CAFA 4BBHA 1YX0A 4ONUA 2ZW5A 1Z4RA 4MFQA 1BO4A 1K4JA 4F0XA 3R9EA 2FXFA 1YGHA 5KTAA 4U5YA 4XPDB 2NMTA 4C7IA 4MI4A 4K30A 2OZGA 3VWDA 4A33A 5H86A 1UFHA 1Q2YA 3FB3A 4C7HA 5IB0A 1YR0A 2B4BA 2CNTA 4KUAA 3TO7A 2REFA 1S7NA 1U6MA 5F46A 4ORFA 2DPTA 3R95A 3R9FA 2J8MA 5JPHA 3BLNA 3DDDA 1B6BA 2B4DB 2G3TA 2I00A 4CGMA 2REEA 2CNSA 1CJWA 2DPSA 4A2ZA 2R1IA 3JTKA 1BOBA 2Z0ZA 1IB1E 1SQHA 3V8IA 2WSAA 1MJAA 1B87A 4CRYB 1J4JA 1QSOA 4E0AA 1I12A 1VHSA 4YRHA 2ZW6A 3DR6A 3F8KA 1Y7RA 3FRMA 4GS4A 1YVOA 2Q04A 2YNCA 4JD6A 2Q7BA 2KCWA 4IF5A 2FL4A 1XEBA 3R1KA 2VBQA 4CAVA 2VZZA 4UCNA 1S7KA 3DR8A 2PC1A 1PU9A 2WPWA 3I9SA 2BSWA 4L89A 4R57A 4AVAA 4CAWA 2FIWA 4RS2A 2Z3KA 4Y49C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LOD A;  1VKC A;  4NCZ A;  3D3S A;  2P0W A;  4KOY A;  5KTD A;  2PDO A;  1Y9W A;  4PSW A;  4XPL A;  3S6F A;  3EY5 A;  1S5K A;  1KUV A;  1M4G A;  1M4I A;  1L0C A;  4QBJ A;  1NSL A;  2OZU A;  3S6K A;  3LD2 A;  3H4Q A;  3SXN A;  2P6G A;  3JVN A;  2O28 A;  4KOS A;  2HV2 A;  5F48 A;  4QB9 A;  2P6E A;  2OB0 A;  5I0C A;  1OZP A;  2EVN A;  2ZPA A;  1Q2C A;  3D2M A;  1IYK A;  4FD5 A;  1KUX A;  3FXT A;  1M4D A;  2BUE A;  3FYN A;  3SXO A;  4I49 A;  4AB7 A;  3D8P A;  2EUI A;  3ZJ0 A;  3QB8 A;  1NMT A;  4Y49 B;  3PZJ A;  5HMN A;  2G0B A;  2JDD A;  5F47 A;  3FIX A;  1KZF A;  5IV0 A;  2RC4 A;  3DNS A;  1WK4 A;  3ZZI A;  2PSW A;  4MY3 A;  2DXQ A;  2D4O A;  5JQ4 A;  4UBR A;  4OAD A;  4KUB A;  4LX9 A;  1M44 A;  2QEC A;  5DWM A;  3N7Z A;  4CS0 B;  3C26 A;  5J8F A;  1GHE A;  1IYL A;  5KTC A;  4B5P A;  2Q4Y A;  5J8C A;  4R3K A;  4U9Y A;  2OZH A;  1QST A;  2R8V A;  4UA3 A;  4YGO A;  1S7L A;  5H84 A;  4PV6 A;  4IUS A;  3T90 A;  3TOA A;  1QSN A;  4HNW B;  4QVT A;  1MK4 A;  4AG7 A;  4B5P B;  2ZW4 A;  2Q44 A;  3IGR A;  2OH1 A;  4F6A A;  4ZBG A;  2HQY A;  2G3A A;  2GAN A;  1KUY A;  4BMH A;  4UWI A;  3T9Y A;  3QAH A;  4HNY B;  1XIX A;  1MJ9 A;  2VQY A;  4F0Y A;  2HUZ A;  1RXT A;  3E0K A;  4AG9 A;  3GKR A;  4LUA A;  2X7B A;  2B3U A;  4KLW A;  3JUW A;  3EXN A;  3OWC A;  2ZW7 A;  3NE7 A;  1I21 A;  3CXQ A;  4B5O A;  4M85 A;  2ZXV A;  3BJ8 A;  5CNP A;  1XE4 A;  1I1D A;  4KOT A;  2CY2 A;  4MY0 A;  1V0C A;  2IL4 A;  4DNC A;  1S3Z A;  3EFA A;  1R57 A;  3S6G A;  1YVK A;  3F5B A;  3B8G A;  4QC6 A;  5F49 A;  1XMT A;  3F0A A;  3RYO A;  5EBV A;  5FVJ A;  2GIV A;  4E2A A;  4AVB A;  4J3G A;  2FIA A;  3FNC A;  2Z11 A;  4KVM E;  2Z10 A;  2GE3 A;  2Q4V A;  1N71 A;  2FT0 A;  2A4N A;  2B3V A;  2BEI A;  3WR7 A;  4KVO E;  5ISV A;  2ATR A;  4OLL A;  3GYA A;  4U9Z A;  2QIR A;  5DWN A;  4KOW A;  2ARH A;  4KOX A;  1YK3 A;  1S7F A;  2K5T A;  3FBU A;  3SHP A;  3CXP A;  2QML A;  2OU2 A;  1WWZ A;  3GY9 A;  2P6F A;  3S6H A;  4CRZ B;  4KOU A;  4NSQ A;  3TOB A;  4CAX A;  3G8W A;  5GCN A;  4JJX A;  4JLY A;  4KOV A;  2VXK A;  4YFJ A;  1NE9 A;  4JWP A;  1ON0 A;  4R9M A;  2AE6 A;  2VI7 A;  3K9U A;  2Y0M A;  4X5K A;  3DSB A;  2I79 A;  3D2P A;  2B5G B;  4KOR A;  2FS5 A;  4HNX B;  1Z9U A;  2J8N A;  2F5I A;  2PRB A;  4II9 A;  1YRE A;  1IIC A;  2PR1 A;  3UY5 A;  2JLM A;  4H6U A;  2R98 A;  3MGD A;  1CM0 A;  3CXS A;  1YLE A;  4MHD A;  4R3L A;  4FD4 A;  4QUS A;  4MJ8 A;  3BJ7 A;  4PK2 A;  2H5M A;  4KLV A;  4AVC A;  1PUA A;  4UWJ A;  2C27 A;  3G3S A;  2VZY A;  1QSR A;  3TCV A;  3TT2 A;  3W6X A;  3PP9 A;  4E8O A;  3EC4 A;  3I3G A;  3TO9 A;  4RI1 A;  2FE7 A;  3W6S A;  2FCK A;  1Z4E A;  4H6Z A;  4FD6 A;  2PQ8 A;  1FY7 A;  2Q0Y A;  2VEZ A;  4H89 A;  5E96 A;  4KVX A;  4OAE A;  3TO6 A;  4R87 A;  3EO4 A;  4FD7 A;  4MBU A;  5C82 A;  2B5G A;  2JEV A;  4KZT A;  2FSR A;  3TTH A;  1TIQ A;  3P2F A;  2R7H A;  3IWG A;  3KKW A;  3P2H A;  1Q2D A;  4JXQ A;  4L8A A;  3R9G A;  4JXR A;  1RO5 A;  2BL1 A;  1S60 A;  4EVY A;  4PSX A;  4XPK A;  3VWE A;  1QSM A;  4PK3 A;  3PGP A;  4XPD C;  4NEX A;  1P4N A;  2D4P A;  1P0H A;  3W91 A;  5EC4 A;  4NXY A;  2PR8 A;  3R96 A;  2JDC A;  2J8R A;  5HH1 A;  2AJ6 A;  1Y9K A;  4XNH B;  2B58 A;  4HKF A;  1M1D A;  4NF1 A;  2CNM A;  5C88 A;  1LRZ A;  1IID A;  3TFY A;  1MJB A;  2WPX A;  5IX3 A;  2B4D A;  4M3S A;  1XF8 A;  4XNH C;  3TE4 A;  1YX0 A;  4ONU A;  2ZW5 A;  1Z4R A;  1BO4 A;  1K4J A;  3R9E A;  2FXF A;  1YGH A;  5KTA A;  4U5Y A;  4XPD B;  2NMT A;  4MI4 A;  4K30 A;  2OZG A;  3VWD A;  5H86 A;  1UFH A;  1Q2Y A;  3FB3 A;  5IB0 A;  1YR0 A;  2B4B A;  2CNT A;  4KUA A;  3TO7 A;  2REF A;  1S7N A;  1U6M A;  5F46 A;  4ORF A;  3R95 A;  3R9F A;  2J8M A;  5JPH A;  3BLN A;  3DDD A;  1B6B A;  2B4D B;  2G3T A;  2I00 A;  2REE A;  2CNS A;  1CJW A;  2R1I A;  1BOB A;  2Z0Z A;  1IB1 E;  1SQH A;  3V8I A;  1MJA A;  1B87 A;  4CRY B;  1J4J A;  1QSO A;  4E0A A;  1I12 A;  1VHS A;  4YRH A;  2ZW6 A;  3DR6 A;  3F8K A;  1Y7R A;  3FRM A;  4GS4 A;  1YVO A;  2Q04 A;  4JD6 A;  2Q7B A;  2KCW A;  4IF5 A;  2FL4 A;  1XEB A;  3R1K A;  2VBQ A;  4CAV A;  2VZZ A;  1S7K A;  3DR8 A;  2PC1 A;  1PU9 A;  2WPW A;  3I9S A;  2BSW A;  4L89 A;  4R57 A;  4AVA A;  4CAW A;  2FIW A;  4RS2 A;  4Y49 C; 
#chains in the Genus database with same CATH topology
 2QVP A;  2O53 A;  2NYQ A;  3WAB A;  2O4H A;  3LOD A;  1VKC A;  1CP7 A;  2IQ6 A;  2Z3N A;  4NCZ A;  4WJB A;  2Q7S A;  1GYT A;  3WT4 A;  3D3S A;  2P0W A;  4KOY A;  5KTD A;  2PDO A;  1Y9W A;  4PSW A;  4XPL A;  3S6F A;  3EY5 A;  2CIJ A;  1S5K A;  4FAI A;  1KUV A;  1M4G A;  1M4I A;  1L0C A;  4A32 A;  1NSA A;  1IGB A;  3V38 A;  4QBJ A;  1ELM P;  1NSL A;  2OZU A;  3NH8 A;  5HXD A;  4UFW A;  2NSM A;  5IB9 A;  5AG5 A;  3S6K A;  2V8H A;  3LD2 A;  1JQG A;  4X8I A;  3H4Q A;  3A9L A;  3SXN A;  1LAM A;  2P6G A;  3JVN A;  2O28 A;  4KOS A;  4NGR A;  4OME A;  2HV2 A;  2V8D A;  3H5Z A;  2YGW A;  5F48 A;  2C6G A;  3RZA A;  2AFM A;  4QB9 A;  1Z8W A;  3T8W A;  2P6E A;  1X10 A;  2OB0 A;  5I0C A;  1F2O A;  1OZP A;  2EVN A;  3BI1 A;  1XOV A;  2ZPA A;  3PB8 X;  2PRQ A;  1Q2C A;  3D2M A;  1IYK A;  4FD5 A;  4MFP A;  2PJ7 A;  3WC6 A;  1KUX A;  3FXT A;  1CPX A;  1M4D A;  2ZEG A;  4CYN A;  5K8P A;  3KQX A;  3B3C A;  3FEE A;  3K2K A;  1R43 A;  5A27 A;  2BUE A;  4OC0 A;  3D66 A;  2ZEE A;  3FYN A;  3SXO A;  4C2Z A;  4I49 A;  2CTC A;  3D8P A;  2EUI A;  3ZJ0 A;  1X12 A;  4AB7 A;  4BD9 A;  1AUG A;  3QB8 A;  4A30 A;  2PCU A;  4K3N A;  1NMT A;  3NA6 A;  2I3C A;  2AFO A;  1ARL A;  3PZJ A;  3QAY A;  4MXU A;  4Y49 B;  5HMN A;  2G0B A;  4O23 A;  4NJQ A;  4YWY A;  4F9V A;  3MN8 A;  4NGP A;  1ZO0 A;  2JDD A;  2PJB A;  5F47 A;  1ZLH A;  3PBE A;  3FIX A;  3IO1 A;  4ZY2 A;  1FT7 A;  1KZF A;  5IV0 A;  5F09 A;  2RC4 A;  3IEH A;  3DNS A;  2Z3O A;  1WK4 A;  3ZZI A;  4MCS A;  2PJ1 A;  3NFZ A;  2PSW A;  4MY3 A;  2DXQ A;  4ONW A;  4B12 A;  2D4O A;  1LCP A;  2RFH A;  5JQ4 A;  5HVG A;  4MCR A;  4UBR A;  3KI9 A;  4OAD A;  1YW6 A;  4CGL A;  4KUB A;  4LX9 A;  1M44 A;  2QEC A;  3V7Z A;  5LRK A;  1FNO A;  5DWM A;  4CYQ A;  3N7Z A;  4CS0 B;  1ZG8 A;  3S9M A;  3PEI A;  3C26 A;  5J8F A;  3B3T A;  1GHE A;  1IYL A;  4LQG A;  4B10 A;  5KTC A;  4B5P A;  2Q4Y A;  1Z8X A;  4C2X A;  1ZG9 A;  4R6T A;  5J8C A;  4R3K A;  4U9Y A;  4P4D A;  2OZH A;  2ZOF A;  1CBX A;  2YNE A;  4MHP A;  1QST A;  3GIU A;  2R8V A;  4UA3 A;  4YGO A;  1S7L A;  5H84 A;  4DJL A;  1H8L A;  1LOK A;  4A38 A;  4PV6 A;  4GM5 A;  4IUS A;  3T90 A;  3TOA A;  3LWU A;  4P4B A;  4C68 A;  1QSN A;  3HLP A;  4HNW B;  4QVT A;  1MK4 A;  4AG7 A;  5LYD A;  4UFV A;  2PJ3 A;  2Q44 A;  2ZW4 A;  3IGR A;  4B5P B;  2OH1 A;  1ELL P;  4WWV A;  4ZBG A;  4UFX A;  4A94 A;  4F6A A;  1F57 A;  2HQY A;  2G3A A;  2GU2 A;  2GAN A;  1KUY A;  4BMH A;  4H2K A;  4UWI A;  4OID A;  1PCA A;  3T9Y A;  3CT9 A;  3QAH A;  4OC3 A;  5CPA A;  4HNY B;  4PQA A;  1XIX A;  1MJ9 A;  2VQY A;  4F0Y A;  2HUZ A;  3KAS A;  1RXT A;  3E0K A;  4AG9 A;  3D67 A;  3GKR A;  1CPS A;  2GLJ A;  4LUA A;  4B11 A;  4MFZ A;  1TXR A;  2B3U A;  2X7B A;  4KLW A;  5AGE A;  3I1U A;  4UCP A;  3JUW A;  3EXN A;  4Q38 A;  3OWC A;  2ZW7 A;  3IU2 A;  3D7D A;  2C6P A;  1I21 A;  3CXQ A;  3NE7 A;  5G1Z A;  4B5O A;  4CGN A;  4M85 A;  4Z65 A;  2ZEM A;  3WC7 A;  1KWM A;  4MCP A;  2XEI A;  4B6Z A;  2ZXV A;  4OC4 A;  4IK2 A;  4RUH A;  3BJ8 A;  3DLJ A;  2ZEH A;  5CNP A;  4JYW A;  3HUV A;  1XE4 A;  1I1D A;  1QQ9 A;  4MHN A;  4KOT A;  2CY2 A;  4MY0 A;  1V0C A;  2YND A;  2RB7 A;  5DS0 A;  2ZEL A;  2IL4 A;  2V8G A;  4A95 A;  1VGY A;  1R3N A;  3FMC A;  1S3Z A;  4KSA A;  4DNC A;  3EFA A;  1R57 A;  3S6G A;  1YVK A;  3F5B A;  3B8G A;  4QC6 A;  3KL9 A;  5F49 A;  3H8F A;  4PXB A;  4ZYQ A;  1XMT A;  3TC8 A;  3F0A A;  3RYO A;  4PXD A;  5LYL A;  2AFX A;  4OC5 A;  5D29 A;  5EBV A;  3IJ3 A;  5FVJ A;  2JEW A;  5HVF A;  2GIV A;  3FJU A;  3FF3 A;  4E2A A;  1HEE A;  2PE3 A;  4AVB A;  4A39 A;  4EWT A;  4ZGY B;  4ZI6 A;  4MRI A;  3PFE A;  4J3G A;  1Y7E A;  3FX6 A;  1DE4 C;  2FIA A;  3FNC A;  3KR4 A;  4B14 A;  4F9U A;  2Z11 A;  4KVM E;  2Z10 A;  2GE3 A;  2Q4V A;  3DGV A;  1N71 A;  2FT0 A;  2XEF A;  2A4N A;  2B3V A;  2BEI A;  3WR7 A;  4OKO A;  2XEJ A;  3PB6 X;  1YLO A;  4KVO E;  5ISV A;  4NGS A;  2ATR A;  2AFS A;  4F8Z A;  4OLL A;  3IFE A;  3GYA A;  4U9Z A;  2QIR A;  4MFJ A;  5DWN A;  4ZY0 A;  4KOW A;  2ARH A;  2BOA A;  4DUK A;  2VL1 A;  3D68 A;  3PB9 X;  4KOX A;  4IAV A;  5D8N A;  3KZW A;  1YK3 A;  3NH5 A;  1S7F A;  2K5T A;  3B3W A;  3FBU A;  3SHP A;  5G21 A;  5I4M A;  3CXP A;  4P4E A;  2QML A;  2OU2 A;  1WWZ A;  1UWY A;  2EBJ A;  3GY9 A;  1CP6 A;  2EWB A;  5AG7 A;  2P6F A;  4CAE A;  4UIB A;  4UEZ A;  4CGO A;  4EFD A;  4A37 A;  4R7M A;  3S6H A;  3WC5 A;  4CRZ B;  4R76 A;  4KOU A;  1Y0Y A;  4NSQ A;  3TOB A;  3PRT A;  2OOT A;  4CAX A;  3G8W A;  5GCN A;  3D7F A;  4JJX A;  1XFO A;  4JLY A;  4KOV A;  2VXK A;  1VHE A;  4YFJ A;  2Z3P A;  1NE9 A;  3IWW A;  1ON0 A;  4JWP A;  4R9M A;  2AE6 A;  2VI7 A;  5AG4 A;  1AMP A;  4OP4 A;  4P44 A;  1HDU A;  3K9U A;  2Y0M A;  4X5K A;  3DSB A;  2PIZ A;  2I79 A;  3GUX A;  2DF5 A;  3D2P A;  2B5G B;  4KOR A;  4M6I A;  5G22 A;  4FUU A;  1JWQ A;  2PJ5 A;  2FS5 A;  1TF8 A;  4HNX B;  1Z9U A;  2J8N A;  3SJG A;  2F5I A;  3TX8 A;  2PRB A;  3D7G A;  4II9 A;  2JBK A;  1IIC A;  1LAP A;  1YRE A;  3D4U A;  2PR1 A;  4NGM A;  4DYO A;  3TO6 A;  6CPA A;  3SJF A;  3UY5 A;  2JLM A;  4H6U A;  2GLF A;  2R98 A;  4MMO A;  1TKF A;  3MGD A;  1CM0 A;  4Q36 A;  3CXS A;  1YLE A;  4MHD A;  4R3L A;  5LYF A;  1XJO A;  2PJ8 A;  2Q51 A;  4P4J A;  4FD4 A;  2YNC C;  2CXA A;  4QUS A;  4CPA A;  1RTQ A;  2PVW A;  4MJ8 A;  3H8E A;  3BJ7 A;  3GB0 A;  4PK2 A;  2H5M A;  3KHX A;  4KLV A;  2PIY A;  2ZEO A;  4AVC A;  1BPN A;  1PUA A;  5K8M A;  4UEE A;  4UWJ A;  2WZN A;  3S9N A;  2C27 A;  3G3S A;  2Z3L A;  2V8V A;  2VZY A;  1ARM A;  1QSR A;  4UF4 A;  3TCV A;  3TT2 A;  3W6X A;  2WUU A;  3PP9 A;  1IU8 A;  4MFK A;  4E8O A;  3N5F A;  3EC4 A;  2GFQ A;  3I3G A;  3TO9 A;  4G1P A;  4R8F A;  2F8H A;  4RI1 A;  2FE7 A;  3RAM A;  3W6S A;  1VHO A;  4EME A;  3QNV A;  2AFU A;  2FCK A;  1ZLI A;  1Z4E A;  5BWA B;  1A2Z A;  4H6Z A;  4FD6 A;  3VH9 A;  4P45 A;  4TNU A;  5EMI A;  2PQ8 A;  2Z3M A;  2PJ2 A;  3IWE A;  1FY7 A;  2Q0Y A;  2VEZ A;  3D7H A;  4H89 A;  4KVX A;  4OAE A;  4PXE A;  5E96 A;  3NH4 A;  1CX8 A;  4UEF A;  4R87 A;  3EO4 A;  2PJA A;  3L2N A;  3FH4 A;  3IIB A;  2AFZ A;  4NFR A;  2ZEN A;  4FD7 A;  4FWU A;  4P6Y A;  3CDX A;  3IU1 A;  2PJC A;  4MBU A;  4OC2 A;  3SI2 A;  4UIA A;  4ZY1 A;  2IMO A;  2EK8 A;  2B5G A;  4OC1 A;  2JEV A;  3SI0 A;  4KZT A;  5K8N A;  1TKJ A;  2FSR A;  1YW4 A;  3TTH A;  3FVL A;  2JBJ A;  2ODF A;  1YQE A;  1TIQ A;  3P2F A;  3VAT A;  1PYT B;  2R7H A;  2ANP A;  3IWG A;  4IHM A;  3KKW A;  4C2Y A;  3P2H A;  1EE3 P;  1Q2D A;  2F7V A;  4B13 A;  1IOF A;  3FEC A;  1XRY A;  4JXQ A;  2CF4 A;  4L8A A;  3RO0 A;  3R9G A;  4JXR A;  1RO5 A;  2BL1 A;  1S60 A;  4MCQ A;  4EVY A;  4Q7A A;  4FBE A;  2ABZ A;  4PSX A;  4XPK A;  3VWE A;  2HB6 A;  3B3S A;  3S9L A;  1QSM A;  1TKH A;  4PK3 A;  3PGP A;  4RN7 A;  4XPD C;  4NEX A;  1P4N A;  5JH9 A;  1ZG7 A;  2D4P A;  2PJ6 A;  2ZED A;  4CGP A;  1P0H A;  2XEG A;  3W91 A;  4PXC A;  3NE8 A;  5EC4 A;  3KHZ A;  4UCM A;  3B3V A;  4NXY A;  4CYP A;  2BCO A;  2EO8 A;  5A28 A;  1AYE A;  5G20 A;  2IJZ A;  2HC9 A;  2PR8 A;  3R96 A;  3PFO A;  4MHZ A;  2JDC A;  2J8R A;  5HH1 A;  2AJ6 A;  1Y9K A;  4X3R A;  4XNH B;  2B58 A;  4HKF A;  4AXV A;  1BAV A;  3SJX A;  5CBM A;  1M1D A;  4CYO A;  3LAC A;  2CNM A;  4NF1 A;  1BLL E;  3FED A;  1LRZ A;  2PJ9 A;  5C88 A;  1IID A;  5AG6 A;  3TFY A;  4BIN A;  2BO9 A;  4MFL A;  1MJB A;  2WPX A;  4NGN A;  3JRU A;  4M6H A;  1DTD A;  4KSF A;  5IX3 A;  2B4D A;  4M3S A;  1XF8 A;  4M6G A;  2GRE A;  4W9Y A;  4PPZ A;  1IY7 A;  4XNH C;  4KS9 A;  4X2T A;  3TE4 A;  2FVG A;  3B2Y A;  4CAF A;  4BBH A;  3IC1 A;  1XMB A;  1LFW A;  3H8G A;  3LMS A;  4GXH A;  3ISX A;  1VIX A;  1YX0 A;  4ONU A;  2ZW5 A;  1Z4R A;  3CPA A;  1BO4 A;  3PB4 X;  4LQ6 A;  3B7I A;  4MFQ A;  4YU9 A;  1K4J A;  4F0X A;  2CTB A;  3R9E A;  4TWE A;  2FXF A;  5K8O A;  1M4L A;  1YGH A;  2QJ8 A;  1OBR A;  5KTA A;  4U5Y A;  2ZEP A;  4XPD B;  2NMT A;  4C7I A;  2J9A A;  4MI4 A;  4K30 A;  1XBU A;  2OZG A;  3VWD A;  4A33 A;  3VAR A;  5ELY A;  5H86 A;  1TF9 A;  1UFH A;  2V77 A;  4NJR A;  3BI0 A;  1Q2Y A;  3FB3 A;  4JZ0 A;  4C7H A;  1YR0 A;  3ISZ A;  7CPA A;  1HDQ A;  2B4B A;  2CNT A;  4KUA A;  5IB0 A;  5C82 A;  3TO7 A;  1Z2L A;  2REF A;  2ZEF A;  1S7N A;  1U6M A;  4OIW A;  4ORF A;  5F46 A;  2DPT A;  3B35 A;  4P10 A;  3R9F A;  2J8M A;  3R95 A;  5JPH A;  2AFW A;  3BLN A;  1YME A;  1Z5R A;  3DDD A;  2Q43 A;  1B6B A;  2PVV A;  4ZX9 A;  2B4D B;  2G3T A;  2I00 A;  4CGM A;  3SJE A;  2REE A;  2CNS A;  1CJW A;  2OR4 A;  2DPS A;  4A2Z A;  2POK A;  2R1I A;  3JTK A;  2DEA A;  1BOB A;  2Z0Z A;  3BXM A;  1IB1 E;  1SQH A;  3V8I A;  1LAN A;  2WSA A;  3GLJ A;  1Z8L A;  1MJA A;  1B87 A;  5LRG A;  2C1C A;  1BPM A;  4CRY B;  1J4J A;  1QSO A;  4E0A A;  3K9T A;  3MRU A;  3KR5 A;  1I12 A;  1VHS A;  4YRH A;  2ZW6 A;  5LRJ A;  3DR6 A;  4KSI A;  3F8K A;  4MHY A;  1QMU A;  2EK9 A;  1Y7R A;  3FRM A;  5JM6 A;  4GS4 A;  1YVO A;  3RNZ A;  4A31 A;  2Q04 A;  2YNC A;  5J1Q A;  2WYR A;  4JD6 A;  2Q7B A;  5HVH A;  2G9D A;  2PJ0 A;  4P4F A;  1CG2 A;  2KCW A;  4IF5 A;  2PJ4 A;  2FL4 A;  1XEB A;  1IOI A;  3CPX A;  3R1K A;  4HPS A;  4ZX8 A;  5THW A;  3SI1 A;  2VBQ A;  4CAV A;  2VZZ A;  8CPA A;  2C6C A;  1Q7L A;  3CZX A;  4UCN A;  1Z8T A;  4NGQ A;  1S7K A;  3DR8 A;  3PBB A;  5JGF A;  2PC1 A;  3RBU A;  1PU9 A;  1F2P A;  3KGQ A;  2WPW A;  3I9S A;  2BSW A;  3BHX A;  4L89 A;  4R57 A;  2Q4Z A;  1Y0R A;  1YSJ A;  3KQZ A;  4NGT A;  4P4I A;  2QYV A;  5LYI A;  3PB7 X;  4AVA A;  4CAW A;  2FIW A;  4RS2 A;  2Z3K A;  2ZOG A;  4Y49 C; 
#chains in the Genus database with same CATH homology
 3LOD A;  1VKC A;  2Z3N A;  4NCZ A;  3D3S A;  2P0W A;  4KOY A;  5KTD A;  2PDO A;  1Y9W A;  4PSW A;  4XPL A;  3S6F A;  3EY5 A;  1S5K A;  1KUV A;  1M4G A;  1M4I A;  1L0C A;  4A32 A;  4QBJ A;  1NSL A;  2OZU A;  4UFW A;  5AG5 A;  3S6K A;  3LD2 A;  3H4Q A;  3A9L A;  3SXN A;  2P6G A;  3JVN A;  2O28 A;  4KOS A;  2HV2 A;  3H5Z A;  2YGW A;  5F48 A;  4QB9 A;  2P6E A;  2OB0 A;  5I0C A;  1OZP A;  2EVN A;  2ZPA A;  4MFP A;  1Q2C A;  3D2M A;  1IYK A;  4FD5 A;  1KUX A;  3FXT A;  1M4D A;  4CYN A;  5A27 A;  2BUE A;  3FYN A;  3SXO A;  4C2Z A;  4I49 A;  4AB7 A;  3D8P A;  2EUI A;  3ZJ0 A;  3QB8 A;  4A30 A;  1NMT A;  4Y49 B;  3PZJ A;  5HMN A;  2G0B A;  1ZO0 A;  2JDD A;  5F47 A;  3FIX A;  1KZF A;  5IV0 A;  2RC4 A;  3DNS A;  2Z3O A;  1WK4 A;  3ZZI A;  2PSW A;  4MY3 A;  2DXQ A;  4B12 A;  2D4O A;  5JQ4 A;  4UBR A;  4OAD A;  4CGL A;  4KUB A;  4LX9 A;  1M44 A;  2QEC A;  5DWM A;  4CYQ A;  3N7Z A;  4CS0 B;  3C26 A;  5J8F A;  1GHE A;  1IYL A;  4B10 A;  5KTC A;  4B5P A;  2Q4Y A;  4C2X A;  5J8C A;  4R3K A;  4U9Y A;  2OZH A;  2YNE A;  1QST A;  2R8V A;  4UA3 A;  4YGO A;  1S7L A;  5H84 A;  4PV6 A;  4IUS A;  3T90 A;  3TOA A;  4C68 A;  1QSN A;  4HNW B;  4QVT A;  1MK4 A;  4AG7 A;  4UFV A;  2ZW4 A;  2Q44 A;  4B5P B;  3IGR A;  2OH1 A;  4F6A A;  4ZBG A;  4UFX A;  2HQY A;  2G3A A;  2GAN A;  1KUY A;  4BMH A;  4UWI A;  3T9Y A;  3QAH A;  4HNY B;  1XIX A;  1MJ9 A;  2VQY A;  4F0Y A;  2HUZ A;  1RXT A;  3E0K A;  4AG9 A;  3GKR A;  4LUA A;  4B11 A;  4MFZ A;  2X7B A;  2B3U A;  4KLW A;  5AGE A;  4UCP A;  3JUW A;  3EXN A;  4Q38 A;  3OWC A;  2ZW7 A;  3IU2 A;  3NE7 A;  1I21 A;  3CXQ A;  5G1Z A;  4B5O A;  4CGN A;  4M85 A;  2ZXV A;  3BJ8 A;  5CNP A;  1XE4 A;  1I1D A;  4KOT A;  2CY2 A;  4MY0 A;  1V0C A;  2YND A;  2IL4 A;  4A95 A;  4DNC A;  4KSA A;  1S3Z A;  3EFA A;  1R57 A;  3S6G A;  1YVK A;  3F5B A;  3B8G A;  4QC6 A;  5F49 A;  1XMT A;  3F0A A;  3RYO A;  5EBV A;  5FVJ A;  2GIV A;  4E2A A;  4AVB A;  4ZGY B;  4J3G A;  4B14 A;  2FIA A;  3FNC A;  2Z11 A;  4KVM E;  2Z10 A;  2GE3 A;  2Q4V A;  1N71 A;  2FT0 A;  2A4N A;  2B3V A;  2BEI A;  3WR7 A;  4KVO E;  5ISV A;  2ATR A;  4OLL A;  3GYA A;  4U9Z A;  2QIR A;  4MFJ A;  5DWN A;  4KOW A;  2ARH A;  4KOX A;  1YK3 A;  1S7F A;  2K5T A;  3FBU A;  3SHP A;  5G21 A;  3CXP A;  2QML A;  2OU2 A;  1WWZ A;  3GY9 A;  5AG7 A;  2P6F A;  4CAE A;  4CGO A;  3S6H A;  4CRZ B;  4KOU A;  4NSQ A;  3TOB A;  4CAX A;  3G8W A;  5GCN A;  4JJX A;  4JLY A;  4KOV A;  2VXK A;  4YFJ A;  2Z3P A;  1NE9 A;  4JWP A;  1ON0 A;  4R9M A;  2AE6 A;  2VI7 A;  5AG4 A;  3K9U A;  2Y0M A;  4X5K A;  3DSB A;  2I79 A;  3D2P A;  2B5G B;  4KOR A;  5G22 A;  2FS5 A;  4HNX B;  1Z9U A;  2J8N A;  2F5I A;  2PRB A;  4II9 A;  1YRE A;  1IIC A;  2PR1 A;  3UY5 A;  2JLM A;  4H6U A;  2R98 A;  3MGD A;  1CM0 A;  4Q36 A;  3CXS A;  1YLE A;  4MHD A;  4R3L A;  4FD4 A;  2YNC C;  2CXA A;  4QUS A;  4MJ8 A;  3BJ7 A;  4PK2 A;  2H5M A;  4KLV A;  4AVC A;  1PUA A;  4UWJ A;  2C27 A;  3G3S A;  2Z3L A;  2VZY A;  1QSR A;  3TCV A;  3TT2 A;  3W6X A;  2WUU A;  3PP9 A;  4MFK A;  4E8O A;  3EC4 A;  3I3G A;  3TO9 A;  4RI1 A;  2FE7 A;  3W6S A;  2FCK A;  1Z4E A;  5BWA B;  4H6Z A;  4FD6 A;  2PQ8 A;  2Z3M A;  3IWE A;  1FY7 A;  2Q0Y A;  2VEZ A;  4H89 A;  5E96 A;  4KVX A;  4OAE A;  3TO6 A;  4A31 A;  4R87 A;  3EO4 A;  4FD7 A;  3IU1 A;  4MBU A;  5C82 A;  2B5G A;  2JEV A;  4KZT A;  2FSR A;  3TTH A;  1TIQ A;  3P2F A;  2R7H A;  3IWG A;  3KKW A;  4C2Y A;  3P2H A;  1Q2D A;  4B13 A;  4JXQ A;  4L8A A;  3R9G A;  4JXR A;  1RO5 A;  2BL1 A;  1S60 A;  4EVY A;  4PSX A;  4XPK A;  3VWE A;  1QSM A;  4PK3 A;  3PGP A;  4XPD C;  4NEX A;  1P4N A;  2D4P A;  4CGP A;  1P0H A;  3W91 A;  5EC4 A;  4UCM A;  4CYP A;  4NXY A;  5A28 A;  5G20 A;  2PR8 A;  3R96 A;  2JDC A;  2J8R A;  5HH1 A;  2AJ6 A;  1Y9K A;  4XNH B;  2B58 A;  4HKF A;  1M1D A;  4CYO A;  4NF1 A;  2CNM A;  5C88 A;  1LRZ A;  1IID A;  5AG6 A;  3TFY A;  4MFL A;  1MJB A;  2WPX A;  4KSF A;  5IX3 A;  2B4D A;  4M3S A;  1XF8 A;  4XNH C;  4KS9 A;  3TE4 A;  4CAF A;  4BBH A;  1YX0 A;  4ONU A;  2ZW5 A;  1Z4R A;  4MFQ A;  1BO4 A;  1K4J A;  4F0X A;  3R9E A;  2FXF A;  1YGH A;  5KTA A;  4U5Y A;  4XPD B;  2NMT A;  4C7I A;  4MI4 A;  4K30 A;  2OZG A;  3VWD A;  4A33 A;  5H86 A;  1UFH A;  1Q2Y A;  3FB3 A;  4C7H A;  5IB0 A;  1YR0 A;  2B4B A;  2CNT A;  4KUA A;  3TO7 A;  2REF A;  1S7N A;  1U6M A;  5F46 A;  4ORF A;  2DPT A;  3R95 A;  3R9F A;  2J8M A;  5JPH A;  3BLN A;  3DDD A;  1B6B A;  2B4D B;  2G3T A;  2I00 A;  4CGM A;  2REE A;  2CNS A;  1CJW A;  2DPS A;  4A2Z A;  2R1I A;  3JTK A;  1BOB A;  2Z0Z A;  1IB1 E;  1SQH A;  3V8I A;  2WSA A;  1MJA A;  1B87 A;  4CRY B;  1J4J A;  1QSO A;  4E0A A;  1I12 A;  1VHS A;  4YRH A;  2ZW6 A;  3DR6 A;  3F8K A;  1Y7R A;  3FRM A;  4GS4 A;  1YVO A;  2Q04 A;  2YNC A;  4JD6 A;  2Q7B A;  2KCW A;  4IF5 A;  2FL4 A;  1XEB A;  3R1K A;  2VBQ A;  4CAV A;  2VZZ A;  4UCN A;  1S7K A;  3DR8 A;  2PC1 A;  1PU9 A;  2WPW A;  3I9S A;  2BSW A;  4L89 A;  4R57 A;  4AVA A;  4CAW A;  2FIW A;  4RS2 A;  2Z3K A;  4Y49 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...