2VXKA

Structural comparison between aspergillus fumigatus and human gna1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
165
structure length
165
Chain Sequence
ENTPLFSPSLISPDVLAVLPADYTIRPLCRSDYKRGYLDVLRVLTTVGDINEEQWNSRYEWIRARSDEYYLLVVCDGEGRIVGTGSLVVERKFIHSLGMVGHIEDIAVEKGQQGKKLGLRIIQALDYVAEKVGCYKTILDCSEANEGFYIKCGFKRAGLEMAHYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLUCOSAMINE 6-PHOSPHATE ACETYLTRANSFERASE
publication title Structural and Kinetic Differences between Human and Aspergillus Fumigatus D-Glucosamine-6- Phosphate N-Acetyltransferase.
pubmed doi rcsb
source organism Aspergillus fumigatus
total genus 46
structure length 165
sequence length 165
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2008-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2vxkA01
3G3SA 3LODA 3IGRA 2X7BA 4CRYB 3EXNA 5IX3A 2Z10A 3S6HA 3ZJ0A 4QC6A 3OWCA 4LUAA 1IYLA 4U9YA 4XPLA 1S60A 2PC1A 2FIAA 3DDDA 4KORA 3W6XA 2NMTA 4MHDA 3W91A 4FD4A 4X5KA 4KOWA 2R1IA 4R3LA 1ON0A 5JPHA 4UWIA 4M85A 4EVYA 2QIRA 2B5GA 2PR8A 3T9YA 1M4DA 5F46A 4CAWA 4HNXB 4UBRA 1K4JA 3PP9A 4XPKA 3DSBA 4PSWA 3EFAA 1Q2DA 2G3AA 3I9SA 1WK4A 2OZGA 3PGPA 4R87A 2DXQA 3LD2A 3BJ8A 5HH1A 1XEBA 3TE4A 3FNCA 3FIXA 2CNMA 4FD7A 4NEXA 3UY5A 3WR7A 1KUVA 2ATRA 4L89A 1IB1E 5J8CA 3CXQA 2D4OA 2P6GA 3BLNA 4F6AA 2OH1A 1Y9WA 3D2PA 4F0YA 4OADA 4XNHC 1BO4A 1MK4A 2AE6A 4KUBA 2J8RA 4AVCA 4JJXA 4JD6A 1L0CA 2PDOA 2KCWA 3F0AA 4CAVA 4JLYA 4PSXA 2G3TA 3K9UA 1R57A 1I1DA 4H89A 5IV0A 2REEA 3FXTA 2RC4A 4LX9A 3VWEA 4YRHA 1Z4EA 4NCZA 2ZXVA 2CY2A 3S6KA 3R1KA 4MBUA 4BMHA 4QBJA 1KZFA 2GE3A 2REFA 3TTHA 5H86A 4JXQA 4AG7A 4R3KA 5KTAA 2I00A 2BEIA 4I49A 2FSRA 2EUIA 1BOBA 1S7FA 4IUSA 3QB8A 3DR8A 5I0CA 4NSQA 1P4NA 4NF1A 4AG9A 4KOXA 2K5TA 3B8GA 3DNSA 2Q7BA 1S7KA 5EBVA 2BUEA 4KVXA 3EY5A 4XNHB 2Q0YA 4ZBGA 3S6FA 3T90A 1MJAA 1MJBA 3JUWA 1KUYA 4HNYB 2BSWA 3I3GA 1YGHA 3TO9A 4UA3A 4QUSA 4AVAA 2JDDA 3FBUA 4KOVA 3SXNA 3MGDA 5C88A 2ZW6A 2H5MA 3TO6A 3CXPA 1N71A 3JVNA 2P6EA 3GY9A 2Z0ZA 5F48A 2JDCA 4KVOE 1YREA 2F5IA 3GKRA 3S6GA 5IB0A 4KUAA 1NMTA 4KOUA 2B58A 4MI4A 2WPXA 4YGOA 2FS5A 1TIQA 4R57A 3R9GA 4E2AA 1XF8A 4CS0B 2FCKA 5E96A 2CNTA 2J8NA 3TFYA 1QSMA 4PK3A 3SXOA 2JLMA 3P2HA 1QSNA 2QECA 2ZW4A 1YR0A 2FE7A 4MJ8A 1RXTA 4UWJA 1V0CA 1M44A 4IF5A 4CRZB 3GYAA 4MY3A 2VZZA 4JXRA 1VKCA 2FIWA 5HMNA 3E0KA 5DWMA 2B4BA 2VEZA 1QSTA 2FT0A 3R95A 1YK3A 2Z11A 1QSRA 2AJ6A 5J8FA 1YVKA 2G0BA 1S3ZA 2HV2A 3G8WA 4E0AA 2VBQA 5KTCA 4HNWB 4B5PB 1CJWA 3P2FA 3D3SA 4Y49C 2OZUA 5KTDA 2R98A 1Q2YA 4KOYA 4AB7A 2ZW5A 2B4DA 4H6UA 5JQ4A 2P6FA 2PR1A 4QVTA 2FL4A 2Y0MA 4XPDC 2J8MA 4DNCA 1NSLA 1I21A 3EO4A 1Y7RA 1RO5A 2HQYA 1J4JA 3V8IA 1S7NA 2EVNA 1U6MA 3VWDA 3FRMA 2ZPAA 3W6SA 3SHPA 3TT2A 3TO7A 5CNPA 5C82A 1B6BA 3CXSA 2R8VA 3RYOA 1WWZA 2BL1A 3TOBA 1LRZA 4J3GA 3EC4A 4CAXA 3C26A 2HUZA 3D2MA 4B5OA 1SQHA 1XIXA 1FY7A 4FD6A 2B3VA 1IYKA 3H4QA 2P0WA 2VXKA 2Q4YA 3R96A 4U9ZA 3FYNA 3N7ZA 3DR6A 4R9MA 4FD5A 1MJ9A 3R9EA 1M4GA 1NE9A 2WPWA 2CNSA 4OLLA 4KVME 4MY0A 4QB9A 2ARHA 1P0HA 2JEVA 4B5PA 3ZZIA 2B4DB 2VI7A 2IL4A 1IICA 2R7HA 5F47A 4KOTA 4KLWA 4PK2A 3QAHA 4Y49B 4PV6A 1PUAA 1YVOA 4KOSA 4M3SA 4K30A 4KZTA 1Y9KA 1Z9UA 2I79A 4GS4A 5FVJA 2Q04A 2C27A 1PU9A 5ISVA 3R9FA 4AVBA 2OU2A 3IWGA 3FB3A 4H6ZA 2ZW7A 1CM0A 2A4NA 3D8PA 1S5KA 1Z4RA 1YLEA 2OZHA 2D4PA 4OAEA 2PRBA 4XPDB 3F5BA 4RS2A 1VHSA 1GHEA 3NE7A 1KUXA 1M4IA 1M1DA 1QSOA 2VQYA 1YX0A 1XMTA 1OZPA 5EC4A 4II9A 1I12A 2Q4VA 1Q2CA 5DWNA 5H84A 4YFJA 3BJ7A 1S7LA 4E8OA 4NXYA 2PQ8A 2FXFA 2B5GB 4JWPA 4ONUA 2PSWA 5GCNA 4U5YA 2GANA 2QMLA 2Q44A 4HKFA 3TCVA 2OB0A 4ORFA 2B3UA 3F8KA 4KLVA 1IIDA 3PZJA 1B87A 2GIVA 4L8AA 3TOAA 3KKWA 2VZYA 4RI1A 2O28A 1XE4A 1UFHA 5F49A
chains in the Genus database with same CATH superfamily
3V38A 3G3SA 5G20A 3LODA 3IGRA 2ZEFA 4CGPA 2YNCC 2PJ7A 2X7BA 4NGQA 4CRYB 3EXNA 2PJ1A 2PJ0A 2GREA 2Z10A 5IX3A 2XEIA 3S6HA 1Z8WA 3TX8A 4QC6A 3OWCA 4LUAA 3ZJ0A 3KGQA 5LRGA 5AG4A 1IYLA 5THWA 5JGFA 4U9YA 4XPLA 1S60A 4A33A 3VH9A 2DEAA 3WABA 3B3TA 2PC1A 2FIAA 1TKJA 3LWUA 4CYPA 3PB8X 2XEJA 4C7IA 2GU2A 1TKHA 3DDDA 5F09A 2Z3PA 3LMSA 5G22A 4KORA 3PBEA 3W6XA 4Q7AA 2NMTA 4MHDA 3W91A 4FD4A 3D66A 4X5KA 4ZYQA 1ZG9A 4CAEA 4KOWA 2R1IA 2RFHA 3BHXA 1ON0A 4R3LA 4OC2A 5JPHA 4YU9A 2RB7A 4UWIA 4M85A 4EVYA 2QIRA 2B5GA 2EWBA 2PR8A 3T9YA 1M4DA 1F57A 2AFUA 1Z2LA 5F46A 4CAWA 4MHZA 4HNXB 4UBRA 1K4JA 3PP9A 4EFDA 2C1CA 4A39A 1IY7A 4XPKA 3DSBA 1CP6A 4BBHA 2PJ2A 4PSWA 1ARLA 3JTKA 4NGNA 3EFAA 1Q2DA 3FX6A 4MHYA 4MMOA 1Z5RA 5AG6A 2G3AA 4NGTA 4A37A 2JBJA 3I9SA 4R7MA 1WK4A 2OZGA 2AFWA 3PGPA 4R87A 2DXQA 1IU8A 3LD2A 3SI2A 1R43A 3S9MA 3BJ8A 5DS0A 5HH1A 4MCRA 2CTBA 1XEBA 3TE4A 3JRUA 3PB9X 4NFRA 2PIZA 3FNCA 3FIXA 5HVHA 3V7ZA 2CNMA 4X8IA 2Z3LA 2PJ4A 3KQXA 5K8OA 2QVPA 3IC1A 4FD7A 2EO8A 4A32A 4NEXA 3UY5A 3WR7A 1KUVA 2ATRA 4L89A 1IB1E 5J8CA 3CXQA 3HLPA 2D4OA 2P6GA 3BLNA 4F6AA 2OH1A 1Y9WA 3D2PA 3D7FA 5D8NA 3B2YA 4OADA 4F0YA 4F9VA 4XNHC 4ZY2A 1BO4A 4MHNA 1CG2A 1MK4A 1VIXA 4C7HA 3PEIA 4AXVA 3PB6X 4CGOA 4X2TA 1M4LA 3KHXA 2AE6A 2OR4A 4KUBA 2J8RA 4AVCA 4JJXA 4Z65A 4CGNA 4JD6A 1L0CA 5IB9A 2PDOA 4MCQA 3I1UA 2KCWA 3SJEA 1YSJA 3F0AA 3FH4A 5HVFA 4BINA 5HVGA 1XOVA 4CAVA 3FECA 4JLYA 4PSXA 2G3TA 3K9UA 3PBBA 3N5FA 4PXBA 1R57A 4NJQA 4NGRA 3WT4A 2DPSA 4F8ZA 5LYDA 8CPAA 1I1DA 4H89A 4B12A 4P4BA 1XFOA 2EK8A 4RN7A 2Z3MA 5IV0A 5K8NA 1QMUA 2REEA 3FXTA 1LOKA 4K3NA 2RC4A 4LX9A 3VWEA 4YRHA 5LYLA 1Z4EA 2YNEA 4NCZA 2ZXVA 4NGMA 2CY2A 3S6KA 3R1KA 4MBUA 4BMHA 4QBJA 3SI0A 1KZFA 1DE4C 4UCNA 4CAFA 3FF3A 3NH8A 2GE3A 4F0XA 2C6PA 2REFA 3TTHA 5H86A 4JXQA 4CPAA 4AG7A 5J1QA 1ARMA 2Q4ZA 3IIBA 4R3KA 5KTAA 2I00A 3ISXA 2BEIA 2I3CA 4YWYA 4KSFA 4I49A 2JEWA 3QNVA 3S9LA 1GYTA 2FSRA 4R6TA 2EUIA 1BOBA 1S7FA 4RUHA 3KR5A 2ZEDA 4MFPA 1VHOA 3L2NA 1HEEA 4IUSA 3K9TA 3QB8A 4ZX8A 4A94A 3DR8A 4NGSA 1F2OA 3FEEA 1LCPA 4PXCA 4OC5A 5I0CA 2AFXA 4NSQA 1P4NA 4NF1A 1DTDA 2ODFA 3NH4A 2ZELA 2HB6A 4AG9A 1PYTB 4KOXA 2K5TA 2PE3A 1R3NA 2HC9A 1FT7A 5JM6A 3B8GA 2JBKA 3DNSA 1S7KA 4O23A 2Q7BA 2J9AA 1TF8A 4ONWA 5A28A 5EBVA 2YNCA 2PCUA 2BUEA 4UIAA 4KVXA 3HUVA 4JYWA 2AFMA 3EY5A 4C2XA 4LQGA 4XNHB 3MN8A 3RAMA 5JH9A 2Q0YA 4UEFA 4ZBGA 1XMBA 1BAVA 5AG7A 1LAMA 3S6FA 2V8VA 4UF4A 3T8WA 3T90A 1MJAA 1MJBA 3JUWA 4OKOA 1KUYA 4HNYB 4IHMA 2BSWA 2CXAA 3I3GA 1AYEA 1YGHA 2Q51A 3TO9A 4EWTA 3GB0A 4UA3A 3DGVA 3NE8A 4MCSA 4QUSA 2YGWA 4AVAA 2JDDA 4ZY1A 3FBUA 4KOVA 4KS9A 1RTQA 3MGDA 3SXNA 1HDUA 4C68A 5C88A 1FNOA 4P44A 2ZW6A 4PXDA 1XJOA 4CYQA 4FBEA 2H5MA 3TO6A 1ZLHA 3CXPA 1N71A 3JVNA 4G1PA 1YLOA 3B3VA 3KL9A 4KSIA 2P6EA 3GY9A 4P4IA 2BO9A 5BWAB 2Z0ZA 5F48A 4B14A 3IWEA 4P4DA 2JDCA 4KVOE 1YREA 2CIJA 2OOTA 2F5IA 2IQ6A 2PJ5A 3GKRA 1CPXA 2PJBA 3S6GA 5IB0A 4UIBA 4KUAA 1NMTA 4MFKA 4PQAA 4KOUA 1ELMP 2B58A 4MI4A 4UEEA 1IOFA 2WPXA 4YGOA 2FS5A 4MFZA 2V77A 2Z3OA 1TIQA 4OP4A 3KZWA 4R57A 3R9GA 4E2AA 2ZEHA 2PIYA 4ZGYB 5D29A 4FWUA 4HPSA 1ZO0A 4OIDA 1XF8A 4CS0B 2FCKA 5E96A 2CNTA 2J8NA 3VATA 4EMEA 5K8PA 3TFYA 1VGYA 7CPAA 1QSMA 2VL1A 4F9UA 3A9LA 4PK3A 4UFXA 3SXOA 1CP7A 5LYFA 1YMEA 2JLMA 3P2HA 1QSNA 2QECA 2ZW4A 1YR0A 2FE7A 3FMCA 4ZX9A 4Q36A 1X10A 1Y0YA 4MJ8A 1RXTA 3IEHA 3MRUA 4UWJA 1CX8A 1V0CA 3B3SA 1M44A 4IF5A 1BPMA 3GYAA 4MY3A 5F49A 4CRZB 1YW6A 5A27A 1YW4A 2VZZA 4JXRA 3H8GA 2F8HA 1VKCA 2FIWA 5HMNA 3E0KA 2Z3KA 2B4BA 5DWMA 2VEZA 2DPTA 2CF4A 1QSTA 1JQGA 3GUXA 1BLLE 1Z8XA 1AUGA 2FT0A 3H8EA 3R95A 1YK3A 3PFOA 4GM5A 2IMOA 3QAYA 2WSAA 4OC3A 2Z11A 3D7HA 1XBUA 1QSRA 2AJ6A 3PB4X 3FJUA 5J8FA 4CYNA 4DYOA 1YVKA 2G0BA 4OC4A 1S3ZA 2HV2A 5G1ZA 3G8WA 4E0AA 3BI1A 2O4HA 4MCPA 4P4EA 2VBQA 1JWQA 3TC8A 3K2KA 2XEFA 5KTCA 4HNWB 4B5PB 2EK9A 1CJWA 3H8FA 3D3SA 3P2FA 1YQEA 2PJ3A 2V8HA 4Y49C 2OZUA 4UFWA 1H8LA 1OBRA 1BPNA 4P4FA 4ZI6A 6CPAA 5KTDA 4M6IA 2R98A 2O53A 2PRQA 2PJCA 2WZNA 2EBJA 4NJRA 1A2ZA 1Q2YA 4KOYA 4AB7A 2ZOGA 2NYQA 3SJFA 4OMEA 2ZW5A 2B4DA 4H6UA 5AGEA 4UEZA 3B35A 1TF9A 4DUKA 5JQ4A 1F2PA 2P6FA 2NSMA 4W9YA 1Y0RA 2PR1A 4OC1A 4QVTA 2FL4A 3DLJA 2ZEPA 2Y0MA 4XPDC 3GIUA 2J8MA 4DNCA 4FAIA 4B10A 1NSLA 1I21A 4B11A 1IOIA 3IJ3A 3EO4A 3WC5A 1Y7RA 1RO5A 4UCPA 2HQYA 3BI0A 1LFWA 1J4JA 1Q7LA 3V8IA 1S7NA 4DJLA 2EVNA 1U6MA 3VWDA 4B6ZA 3FRMA 4M6GA 5I4MA 2ZPAA 3IO1A 4TWEA 3W6SA 2ANPA 3SHPA 3TT2A 1EE3P 4OIWA 4C2ZA 1NSAA 1CBXA 4PPZA 3SI1A 3TO7A 2PJ6A 2PJ9A 4P4JA 5CNPA 1ZLIA 4A2ZA 5C82A 1B6BA 1X12A 2POKA 3CXSA 3FVLA 5HXDA 3NFZA 2PJ8A 4CGMA 2R8VA 3CZXA 4GXHA 3RYOA 1Y7EA 3B3CA 4A31A 1WWZA 4TNUA 2AFZA 2BL1A 2DF5A 1LRZA 4J3GA 4JZ0A 3EC4A 3RNZA 3TOBA 4CAXA 3H5ZA 3C26A 4M6HA 2HUZA 3D2MA 4BD9A 2ZEOA 3D67A 2Q43A 1QQ9A 4X3RA 4B5OA 1UWYA 1IGBA 5LRKA 5AG5A 1SQHA 4P45A 1LAPA 1XIXA 3IWWA 1FY7A 5ELYA 2ZENA 4FD6A 2B3VA 2GFQA 1IYKA 3H4QA 2P0WA 2VXKA 1XRYA 2Q4YA 4WWVA 5G21A 3R96A 2AFOA 3RZAA 2QJ8A 2AFSA 4U9ZA 3FYNA 3N7ZA 3DR6A 4R9MA 5LYIA 3D7GA 4FD5A 1MJ9A 3R9EA 1M4GA 1NE9A 2WPWA 3CT9A 2CNSA 3LACA 4OLLA 4KVME 4MY0A 3D4UA 2ARHA 2BOAA 4QB9A 1P0HA 1ZG7A 4R76A 2JEVA 3SJXA 4A38A 4B5PA 4LQ6A 2PVVA 3ZZIA 2C6GA 3NA6A 2B4DB 2VI7A 2IL4A 3CPAA 4OC0A 1IICA 2R7HA 4A95A 5F47A 3RBUA 4P6YA 4KOTA 4MFQA 3FEDA 5CPAA 4KLWA 3D68A 4PK2A 3QAHA 4Y49B 4PV6A 2PVWA 3WC7A 3PB7X 1PUAA 1YVOA 4KOSA 4P10A 2GLJA 3PRTA 2V8GA 4M3SA 4K30A 1Z8TA 2FVGA 3B3WA 4A30A 4MFLA 4KZTA 1Y9KA 1Z9UA 2Z3NA 2I79A 3KHZA 4GS4A 2Q04A 5FVJA 2C27A 1PU9A 3KQZA 5ISVA 4PXEA 2ZEGA 3R9FA 4WJBA 4AVBA 2OU2A 3IWGA 2V8DA 3FB3A 4H6ZA 1TXRA 2ZW7A 1CM0A 2A4NA 3D8PA 1S5KA 1TKFA 1Z4RA 1YLEA 2OZHA 3CDXA 2D4PA 4OAEA 2PRBA 4XPDB 1Z8LA 2YNDA 1VHEA 3F5BA 4RS2A 4UCMA 3NH5A 2C6CA 1VHSA 1GHEA 2ZEEA 4FUUA 3SJGA 2GLFA 4B13A 3KR4A 1KUXA 1M4IA 3NE7A 1M1DA 1QSOA 4MHPA 4IAVA 3IU1A 3B7IA 2Q7SA 2VQYA 1YX0A 4KSAA 4R8FA 2G9DA 4UFVA 3S9NA 1XMTA 2ZOFA 4Q38A 1OZPA 5EC4A 4II9A 1I12A 5CBMA 1PCAA 2Q4VA 3WC6A 1LANA 1Q2CA 5DWNA 5H84A 2WUUA 3D7DA 4YFJA 3BJ7A 2PJAA 2QYVA 1S7LA 3BXMA 4E8OA 3KASA 2PQ8A 4NXYA 2FXFA 2B5GB 3CPXA 4CGLA 4JWPA 2ZEMA 2PSWA 4ONUA 5GCNA 1ZG8A 4U5YA 2GANA 2IJZA 4ZY0A 2ABZA 1KWMA 2QMLA 3ISZA 3IFEA 3KI9A 2Q44A 3RO0A 3VARA 5K8MA 1AMPA 5EMIA 4HKFA 3TCVA 3GLJA 2OB0A 4ORFA 2B3UA 4H2KA 2F7VA 2XEGA 3F8KA 4KLVA 1IIDA 3IU2A 3PZJA 4C2YA 1B87A 1ELLP 4MXUA 5LRJA 2GIVA 1CPSA 4NGPA 4L8AA 4IK2A 3TOAA 3KKWA 2CTCA 1HDQA 2VZYA 4MFJA 4MRIA 4RI1A 2O28A 1XE4A 3PFEA 4CYOA 1UFHA 2BCOA 2WYRA
chains in the Genus database with same CATH topology
3G3SA 5G20A 3LODA 3IGRA 4CGPA 2YNCC 2X7BA 4CRYB 3EXNA 5IX3A 2Z10A 3S6HA 3ZJ0A 4QC6A 3OWCA 4LUAA 5AG4A 1IYLA 4U9YA 4XPLA 1S60A 4A33A 2PC1A 2FIAA 4CYPA 4C7IA 3DDDA 2Z3PA 5G22A 4KORA 3W6XA 2NMTA 4MHDA 3W91A 4FD4A 4X5KA 4CAEA 4KOWA 2R1IA 4R3LA 1ON0A 5JPHA 4UWIA 4M85A 4EVYA 2QIRA 2B5GA 2PR8A 3T9YA 1M4DA 5F46A 4CAWA 4HNXB 4UBRA 1K4JA 3PP9A 4XPKA 3DSBA 4BBHA 4PSWA 3JTKA 3EFAA 1Q2DA 5AG6A 2G3AA 3I9SA 1WK4A 2OZGA 3PGPA 4R87A 2DXQA 3LD2A 3BJ8A 5HH1A 1XEBA 3TE4A 3FNCA 3FIXA 2CNMA 2Z3LA 4FD7A 4A32A 4NEXA 3UY5A 3WR7A 1KUVA 2ATRA 4L89A 1IB1E 5J8CA 3CXQA 2D4OA 2P6GA 3BLNA 4F6AA 2OH1A 1Y9WA 3D2PA 4F0YA 4OADA 4XNHC 1BO4A 1MK4A 4C7HA 4CGOA 2AE6A 4KUBA 2J8RA 4AVCA 4JJXA 4CGNA 4JD6A 1L0CA 2PDOA 2KCWA 3F0AA 4CAVA 4JLYA 4PSXA 2G3TA 3K9UA 1R57A 2DPSA 1I1DA 4H89A 4B12A 5IV0A 2Z3MA 2REEA 3FXTA 2RC4A 4LX9A 3VWEA 4YRHA 1Z4EA 2YNEA 4NCZA 2ZXVA 2CY2A 3S6KA 3R1KA 4MBUA 4BMHA 4QBJA 1KZFA 4UCNA 4CAFA 2GE3A 4F0XA 2REFA 3TTHA 5H86A 4JXQA 4AG7A 4R3KA 5KTAA 2I00A 2BEIA 4KSFA 4I49A 2FSRA 2EUIA 1BOBA 1S7FA 4MFPA 4IUSA 3QB8A 3DR8A 5I0CA 4NSQA 1P4NA 4NF1A 4AG9A 4KOXA 2K5TA 3B8GA 3DNSA 2Q7BA 1S7KA 5A28A 5EBVA 2YNCA 2BUEA 4KVXA 3EY5A 4C2XA 4XNHB 2Q0YA 4ZBGA 5AG7A 3S6FA 3T90A 1MJAA 1MJBA 3JUWA 1KUYA 4HNYB 2BSWA 2CXAA 3I3GA 1YGHA 3TO9A 4UA3A 4QUSA 2YGWA 4AVAA 2JDDA 3FBUA 4KOVA 4KS9A 3MGDA 3SXNA 4C68A 5C88A 2ZW6A 4CYQA 2H5MA 3TO6A 3CXPA 1N71A 3JVNA 2P6EA 3GY9A 5BWAB 2Z0ZA 5F48A 4B14A 3IWEA 2JDCA 4KVOE 1YREA 2F5IA 3GKRA 3S6GA 5IB0A 4KUAA 1NMTA 4MFKA 4KOUA 2B58A 4MI4A 2WPXA 4YGOA 2FS5A 4MFZA 2Z3OA 1TIQA 4R57A 3R9GA 4E2AA 4ZGYB 1ZO0A 1XF8A 4CS0B 2FCKA 5E96A 2CNTA 2J8NA 3TFYA 1QSMA 3A9LA 4PK3A 4UFXA 3SXOA 2JLMA 3P2HA 1QSNA 2QECA 2ZW4A 1YR0A 2FE7A 4Q36A 4MJ8A 1RXTA 4UWJA 1V0CA 1M44A 4IF5A 4CRZB 3GYAA 4MY3A 5A27A 2VZZA 4JXRA 1VKCA 2FIWA 5HMNA 3E0KA 2Z3KA 2B4BA 5DWMA 2VEZA 2DPTA 1QSTA 2FT0A 3R95A 1YK3A 2WSAA 2Z11A 1QSRA 2AJ6A 5J8FA 4CYNA 1YVKA 2G0BA 1S3ZA 2HV2A 3G8WA 4E0AA 2VBQA 5KTCA 4HNWB 4B5PB 1CJWA 3P2FA 3D3SA 4Y49C 2OZUA 4UFWA 5KTDA 2R98A 1Q2YA 4KOYA 4AB7A 2ZW5A 2B4DA 4H6UA 5AGEA 5JQ4A 2P6FA 2PR1A 4QVTA 2FL4A 2Y0MA 4XPDC 2J8MA 4DNCA 4B10A 1NSLA 1I21A 4B11A 3EO4A 1Y7RA 1RO5A 4UCPA 2HQYA 1J4JA 3V8IA 1S7NA 2EVNA 1U6MA 3VWDA 3FRMA 2ZPAA 3W6SA 3SHPA 3TT2A 4C2ZA 3TO7A 5CNPA 4A2ZA 5C82A 1B6BA 3CXSA 4CGMA 2R8VA 3RYOA 4A31A 1WWZA 2BL1A 3TOBA 1LRZA 4J3GA 3EC4A 4CAXA 3H5ZA 3C26A 2HUZA 3D2MA 4B5OA 5AG5A 1SQHA 1XIXA 1FY7A 4FD6A 2B3VA 1IYKA 3H4QA 2P0WA 2VXKA 2Q4YA 5G21A 3R96A 4U9ZA 3FYNA 3N7ZA 3DR6A 4R9MA 4FD5A 1MJ9A 3R9EA 1M4GA 1NE9A 2WPWA 2CNSA 4OLLA 4KVME 4MY0A 4QB9A 2ARHA 5G1ZA 1P0HA 2JEVA 4B5PA 3ZZIA 2B4DB 2VI7A 2IL4A 1IICA 2R7HA 4A95A 5F47A 4KOTA 4MFQA 4KLWA 4PK2A 3QAHA 4Y49B 4PV6A 1PUAA 1YVOA 4KOSA 4M3SA 4K30A 4A30A 4MFLA 4KZTA 1Y9KA 1Z9UA 2Z3NA 2I79A 4GS4A 5FVJA 2Q04A 2C27A 1PU9A 5ISVA 3R9FA 4AVBA 2OU2A 3IWGA 3FB3A 4H6ZA 2ZW7A 1CM0A 2A4NA 3D8PA 1S5KA 1Z4RA 1YLEA 2OZHA 2D4PA 4OAEA 2PRBA 4XPDB 3F5BA 2YNDA 4RS2A 4UCMA 1VHSA 1GHEA 4B13A 3NE7A 1KUXA 1M4IA 1M1DA 1QSOA 3IU1A 4KSAA 2VQYA 1YX0A 4UFVA 1XMTA 4Q38A 1OZPA 5EC4A 4II9A 1I12A 2Q4VA 1Q2CA 5DWNA 5H84A 2WUUA 4YFJA 3BJ7A 1S7LA 4E8OA 4NXYA 2PQ8A 2FXFA 2B5GB 4CGLA 4JWPA 4ONUA 2PSWA 5GCNA 4U5YA 2GANA 2QMLA 2Q44A 4HKFA 3TCVA 2OB0A 4ORFA 2B3UA 3F8KA 4KLVA 1IIDA 3IU2A 3PZJA 4C2YA 1B87A 2GIVA 4L8AA 3TOAA 3KKWA 4MFJA 2VZYA 4RI1A 2O28A 1XE4A 4CYOA 1UFHA 5F49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G3S A;  3LOD A;  3IGR A;  2X7B A;  4CRY B;  3EXN A;  5IX3 A;  2Z10 A;  3S6H A;  3ZJ0 A;  4QC6 A;  3OWC A;  4LUA A;  1IYL A;  4U9Y A;  4XPL A;  1S60 A;  2PC1 A;  2FIA A;  3DDD A;  4KOR A;  3W6X A;  2NMT A;  4MHD A;  3W91 A;  4FD4 A;  4X5K A;  4KOW A;  2R1I A;  4R3L A;  1ON0 A;  5JPH A;  4UWI A;  4M85 A;  4EVY A;  2QIR A;  2B5G A;  2PR8 A;  3T9Y A;  1M4D A;  5F46 A;  4CAW A;  4HNX B;  4UBR A;  1K4J A;  3PP9 A;  4XPK A;  3DSB A;  4PSW A;  3EFA A;  1Q2D A;  2G3A A;  3I9S A;  1WK4 A;  2OZG A;  3PGP A;  4R87 A;  2DXQ A;  3LD2 A;  3BJ8 A;  5HH1 A;  1XEB A;  3TE4 A;  3FNC A;  3FIX A;  2CNM A;  4FD7 A;  4NEX A;  3UY5 A;  3WR7 A;  1KUV A;  2ATR A;  4L89 A;  1IB1 E;  5J8C A;  3CXQ A;  2D4O A;  2P6G A;  3BLN A;  4F6A A;  2OH1 A;  1Y9W A;  3D2P A;  4F0Y A;  4OAD A;  4XNH C;  1BO4 A;  1MK4 A;  2AE6 A;  4KUB A;  2J8R A;  4AVC A;  4JJX A;  4JD6 A;  1L0C A;  2PDO A;  2KCW A;  3F0A A;  4CAV A;  4JLY A;  4PSX A;  2G3T A;  3K9U A;  1R57 A;  1I1D A;  4H89 A;  5IV0 A;  2REE A;  3FXT A;  2RC4 A;  4LX9 A;  3VWE A;  4YRH A;  1Z4E A;  4NCZ A;  2ZXV A;  2CY2 A;  3S6K A;  3R1K A;  4MBU A;  4BMH A;  4QBJ A;  1KZF A;  2GE3 A;  2REF A;  3TTH A;  5H86 A;  4JXQ A;  4AG7 A;  4R3K A;  5KTA A;  2I00 A;  2BEI A;  4I49 A;  2FSR A;  2EUI A;  1BOB A;  1S7F A;  4IUS A;  3QB8 A;  3DR8 A;  5I0C A;  4NSQ A;  1P4N A;  4NF1 A;  4AG9 A;  4KOX A;  2K5T A;  3B8G A;  3DNS A;  2Q7B A;  1S7K A;  5EBV A;  2BUE A;  4KVX A;  3EY5 A;  4XNH B;  2Q0Y A;  4ZBG A;  3S6F A;  3T90 A;  1MJA A;  1MJB A;  3JUW A;  1KUY A;  4HNY B;  2BSW A;  3I3G A;  1YGH A;  3TO9 A;  4UA3 A;  4QUS A;  4AVA A;  2JDD A;  3FBU A;  4KOV A;  3SXN A;  3MGD A;  5C88 A;  2ZW6 A;  2H5M A;  3TO6 A;  3CXP A;  1N71 A;  3JVN A;  2P6E A;  3GY9 A;  2Z0Z A;  5F48 A;  2JDC A;  4KVO E;  1YRE A;  2F5I A;  3GKR A;  3S6G A;  5IB0 A;  4KUA A;  1NMT A;  4KOU A;  2B58 A;  4MI4 A;  2WPX A;  4YGO A;  2FS5 A;  1TIQ A;  4R57 A;  3R9G A;  4E2A A;  1XF8 A;  4CS0 B;  2FCK A;  5E96 A;  2CNT A;  2J8N A;  3TFY A;  1QSM A;  4PK3 A;  3SXO A;  2JLM A;  3P2H A;  1QSN A;  2QEC A;  2ZW4 A;  1YR0 A;  2FE7 A;  4MJ8 A;  1RXT A;  4UWJ A;  1V0C A;  1M44 A;  4IF5 A;  4CRZ B;  3GYA A;  4MY3 A;  2VZZ A;  4JXR A;  1VKC A;  2FIW A;  5HMN A;  3E0K A;  5DWM A;  2B4B A;  2VEZ A;  1QST A;  2FT0 A;  3R95 A;  1YK3 A;  2Z11 A;  1QSR A;  2AJ6 A;  5J8F A;  1YVK A;  2G0B A;  1S3Z A;  2HV2 A;  3G8W A;  4E0A A;  2VBQ A;  5KTC A;  4HNW B;  4B5P B;  1CJW A;  3P2F A;  3D3S A;  4Y49 C;  2OZU A;  5KTD A;  2R98 A;  1Q2Y A;  4KOY A;  4AB7 A;  2ZW5 A;  2B4D A;  4H6U A;  5JQ4 A;  2P6F A;  2PR1 A;  4QVT A;  2FL4 A;  2Y0M A;  4XPD C;  2J8M A;  4DNC A;  1NSL A;  1I21 A;  3EO4 A;  1Y7R A;  1RO5 A;  2HQY A;  1J4J A;  3V8I A;  1S7N A;  2EVN A;  1U6M A;  3VWD A;  3FRM A;  2ZPA A;  3W6S A;  3SHP A;  3TT2 A;  3TO7 A;  5CNP A;  5C82 A;  1B6B A;  3CXS A;  2R8V A;  3RYO A;  1WWZ A;  2BL1 A;  3TOB A;  1LRZ A;  4J3G A;  3EC4 A;  4CAX A;  3C26 A;  2HUZ A;  3D2M A;  4B5O A;  1SQH A;  1XIX A;  1FY7 A;  4FD6 A;  2B3V A;  1IYK A;  3H4Q A;  2P0W A;  2VXK A;  2Q4Y A;  3R96 A;  4U9Z A;  3FYN A;  3N7Z A;  3DR6 A;  4R9M A;  4FD5 A;  1MJ9 A;  3R9E A;  1M4G A;  1NE9 A;  2WPW A;  2CNS A;  4OLL A;  4KVM E;  4MY0 A;  4QB9 A;  2ARH A;  1P0H A;  2JEV A;  4B5P A;  3ZZI A;  2B4D B;  2VI7 A;  2IL4 A;  1IIC A;  2R7H A;  5F47 A;  4KOT A;  4KLW A;  4PK2 A;  3QAH A;  4Y49 B;  4PV6 A;  1PUA A;  1YVO A;  4KOS A;  4M3S A;  4K30 A;  4KZT A;  1Y9K A;  1Z9U A;  2I79 A;  4GS4 A;  5FVJ A;  2Q04 A;  2C27 A;  1PU9 A;  5ISV A;  3R9F A;  4AVB A;  2OU2 A;  3IWG A;  3FB3 A;  4H6Z A;  2ZW7 A;  1CM0 A;  2A4N A;  3D8P A;  1S5K A;  1Z4R A;  1YLE A;  2OZH A;  2D4P A;  4OAE A;  2PRB A;  4XPD B;  3F5B A;  4RS2 A;  1VHS A;  1GHE A;  3NE7 A;  1KUX A;  1M4I A;  1M1D A;  1QSO A;  2VQY A;  1YX0 A;  1XMT A;  1OZP A;  5EC4 A;  4II9 A;  1I12 A;  2Q4V A;  1Q2C A;  5DWN A;  5H84 A;  4YFJ A;  3BJ7 A;  1S7L A;  4E8O A;  4NXY A;  2PQ8 A;  2FXF A;  2B5G B;  4JWP A;  4ONU A;  2PSW A;  5GCN A;  4U5Y A;  2GAN A;  2QML A;  2Q44 A;  4HKF A;  3TCV A;  2OB0 A;  4ORF A;  2B3U A;  3F8K A;  4KLV A;  1IID A;  3PZJ A;  1B87 A;  2GIV A;  4L8A A;  3TOA A;  3KKW A;  2VZY A;  4RI1 A;  2O28 A;  1XE4 A;  1UFH A;  5F49 A; 
#chains in the Genus database with same CATH topology
 3V38 A;  3G3S A;  5G20 A;  3LOD A;  3IGR A;  2ZEF A;  4CGP A;  2YNC C;  2PJ7 A;  2X7B A;  4NGQ A;  4CRY B;  3EXN A;  2PJ1 A;  2PJ0 A;  2GRE A;  2Z10 A;  5IX3 A;  2XEI A;  3S6H A;  1Z8W A;  3TX8 A;  4QC6 A;  3OWC A;  4LUA A;  3ZJ0 A;  3KGQ A;  5LRG A;  5AG4 A;  1IYL A;  5THW A;  5JGF A;  4U9Y A;  4XPL A;  1S60 A;  4A33 A;  3VH9 A;  2DEA A;  3WAB A;  3B3T A;  2PC1 A;  2FIA A;  1TKJ A;  3LWU A;  4CYP A;  3PB8 X;  2XEJ A;  4C7I A;  2GU2 A;  1TKH A;  3DDD A;  5F09 A;  2Z3P A;  3LMS A;  5G22 A;  4KOR A;  3PBE A;  3W6X A;  4Q7A A;  2NMT A;  4MHD A;  3W91 A;  4FD4 A;  3D66 A;  4X5K A;  4ZYQ A;  1ZG9 A;  4CAE A;  4KOW A;  2R1I A;  2RFH A;  3BHX A;  1ON0 A;  4R3L A;  4OC2 A;  5JPH A;  4YU9 A;  2RB7 A;  4UWI A;  4M85 A;  4EVY A;  2QIR A;  2B5G A;  2EWB A;  2PR8 A;  3T9Y A;  1M4D A;  1F57 A;  2AFU A;  1Z2L A;  5F46 A;  4CAW A;  4MHZ A;  4HNX B;  4UBR A;  1K4J A;  3PP9 A;  4EFD A;  2C1C A;  4A39 A;  1IY7 A;  4XPK A;  3DSB A;  1CP6 A;  4BBH A;  2PJ2 A;  4PSW A;  1ARL A;  3JTK A;  4NGN A;  3EFA A;  1Q2D A;  3FX6 A;  4MHY A;  4MMO A;  1Z5R A;  5AG6 A;  2G3A A;  4NGT A;  4A37 A;  2JBJ A;  3I9S A;  4R7M A;  1WK4 A;  2OZG A;  2AFW A;  3PGP A;  4R87 A;  2DXQ A;  1IU8 A;  3LD2 A;  3SI2 A;  1R43 A;  3S9M A;  3BJ8 A;  5DS0 A;  5HH1 A;  4MCR A;  2CTB A;  1XEB A;  3TE4 A;  3JRU A;  3PB9 X;  4NFR A;  2PIZ A;  3FNC A;  3FIX A;  5HVH A;  3V7Z A;  2CNM A;  4X8I A;  2Z3L A;  2PJ4 A;  3KQX A;  5K8O A;  2QVP A;  3IC1 A;  4FD7 A;  2EO8 A;  4A32 A;  4NEX A;  3UY5 A;  3WR7 A;  1KUV A;  2ATR A;  4L89 A;  1IB1 E;  5J8C A;  3CXQ A;  3HLP A;  2D4O A;  2P6G A;  3BLN A;  4F6A A;  2OH1 A;  1Y9W A;  3D2P A;  3D7F A;  5D8N A;  3B2Y A;  4OAD A;  4F0Y A;  4F9V A;  4XNH C;  4ZY2 A;  1BO4 A;  4MHN A;  1CG2 A;  1MK4 A;  1VIX A;  4C7H A;  3PEI A;  4AXV A;  3PB6 X;  4CGO A;  4X2T A;  1M4L A;  3KHX A;  2AE6 A;  2OR4 A;  4KUB A;  2J8R A;  4AVC A;  4JJX A;  4Z65 A;  4CGN A;  4JD6 A;  1L0C A;  5IB9 A;  2PDO A;  4MCQ A;  3I1U A;  2KCW A;  3SJE A;  1YSJ A;  3F0A A;  3FH4 A;  5HVF A;  4BIN A;  5HVG A;  1XOV A;  4CAV A;  3FEC A;  4JLY A;  4PSX A;  2G3T A;  3K9U A;  3PBB A;  3N5F A;  4PXB A;  1R57 A;  4NJQ A;  4NGR A;  3WT4 A;  2DPS A;  4F8Z A;  5LYD A;  8CPA A;  1I1D A;  4H89 A;  4B12 A;  4P4B A;  1XFO A;  2EK8 A;  4RN7 A;  2Z3M A;  5IV0 A;  5K8N A;  1QMU A;  2REE A;  3FXT A;  1LOK A;  4K3N A;  2RC4 A;  4LX9 A;  3VWE A;  4YRH A;  5LYL A;  1Z4E A;  2YNE A;  4NCZ A;  2ZXV A;  4NGM A;  2CY2 A;  3S6K A;  3R1K A;  4MBU A;  4BMH A;  4QBJ A;  3SI0 A;  1KZF A;  1DE4 C;  4UCN A;  4CAF A;  3FF3 A;  3NH8 A;  2GE3 A;  4F0X A;  2C6P A;  2REF A;  3TTH A;  5H86 A;  4JXQ A;  4CPA A;  4AG7 A;  5J1Q A;  1ARM A;  2Q4Z A;  3IIB A;  4R3K A;  5KTA A;  2I00 A;  3ISX A;  2BEI A;  2I3C A;  4YWY A;  4KSF A;  4I49 A;  2JEW A;  3QNV A;  3S9L A;  1GYT A;  2FSR A;  4R6T A;  2EUI A;  1BOB A;  1S7F A;  4RUH A;  3KR5 A;  2ZED A;  4MFP A;  1VHO A;  3L2N A;  1HEE A;  4IUS A;  3K9T A;  3QB8 A;  4ZX8 A;  4A94 A;  3DR8 A;  4NGS A;  1F2O A;  3FEE A;  1LCP A;  4PXC A;  4OC5 A;  5I0C A;  2AFX A;  4NSQ A;  1P4N A;  4NF1 A;  1DTD A;  2ODF A;  3NH4 A;  2ZEL A;  2HB6 A;  4AG9 A;  1PYT B;  4KOX A;  2K5T A;  2PE3 A;  1R3N A;  2HC9 A;  1FT7 A;  5JM6 A;  3B8G A;  2JBK A;  3DNS A;  1S7K A;  4O23 A;  2Q7B A;  2J9A A;  1TF8 A;  4ONW A;  5A28 A;  5EBV A;  2YNC A;  2PCU A;  2BUE A;  4UIA A;  4KVX A;  3HUV A;  4JYW A;  2AFM A;  3EY5 A;  4C2X A;  4LQG A;  4XNH B;  3MN8 A;  3RAM A;  5JH9 A;  2Q0Y A;  4UEF A;  4ZBG A;  1XMB A;  1BAV A;  5AG7 A;  1LAM A;  3S6F A;  2V8V A;  4UF4 A;  3T8W A;  3T90 A;  1MJA A;  1MJB A;  3JUW A;  4OKO A;  1KUY A;  4HNY B;  4IHM A;  2BSW A;  2CXA A;  3I3G A;  1AYE A;  1YGH A;  2Q51 A;  3TO9 A;  4EWT A;  3GB0 A;  4UA3 A;  3DGV A;  3NE8 A;  4MCS A;  4QUS A;  2YGW A;  4AVA A;  2JDD A;  4ZY1 A;  3FBU A;  4KOV A;  4KS9 A;  1RTQ A;  3MGD A;  3SXN A;  1HDU A;  4C68 A;  5C88 A;  1FNO A;  4P44 A;  2ZW6 A;  4PXD A;  1XJO A;  4CYQ A;  4FBE A;  2H5M A;  3TO6 A;  1ZLH A;  3CXP A;  1N71 A;  3JVN A;  4G1P A;  1YLO A;  3B3V A;  3KL9 A;  4KSI A;  2P6E A;  3GY9 A;  4P4I A;  2BO9 A;  5BWA B;  2Z0Z A;  5F48 A;  4B14 A;  3IWE A;  4P4D A;  2JDC A;  4KVO E;  1YRE A;  2CIJ A;  2OOT A;  2F5I A;  2IQ6 A;  2PJ5 A;  3GKR A;  1CPX A;  2PJB A;  3S6G A;  5IB0 A;  4UIB A;  4KUA A;  1NMT A;  4MFK A;  4PQA A;  4KOU A;  1ELM P;  2B58 A;  4MI4 A;  4UEE A;  1IOF A;  2WPX A;  4YGO A;  2FS5 A;  4MFZ A;  2V77 A;  2Z3O A;  1TIQ A;  4OP4 A;  3KZW A;  4R57 A;  3R9G A;  4E2A A;  2ZEH A;  2PIY A;  4ZGY B;  5D29 A;  4FWU A;  4HPS A;  1ZO0 A;  4OID A;  1XF8 A;  4CS0 B;  2FCK A;  5E96 A;  2CNT A;  2J8N A;  3VAT A;  4EME A;  5K8P A;  3TFY A;  1VGY A;  7CPA A;  1QSM A;  2VL1 A;  4F9U A;  3A9L A;  4PK3 A;  4UFX A;  3SXO A;  1CP7 A;  5LYF A;  1YME A;  2JLM A;  3P2H A;  1QSN A;  2QEC A;  2ZW4 A;  1YR0 A;  2FE7 A;  3FMC A;  4ZX9 A;  4Q36 A;  1X10 A;  1Y0Y A;  4MJ8 A;  1RXT A;  3IEH A;  3MRU A;  4UWJ A;  1CX8 A;  1V0C A;  3B3S A;  1M44 A;  4IF5 A;  1BPM A;  3GYA A;  4MY3 A;  5F49 A;  4CRZ B;  1YW6 A;  5A27 A;  1YW4 A;  2VZZ A;  4JXR A;  3H8G A;  2F8H A;  1VKC A;  2FIW A;  5HMN A;  3E0K A;  2Z3K A;  2B4B A;  5DWM A;  2VEZ A;  2DPT A;  2CF4 A;  1QST A;  1JQG A;  3GUX A;  1BLL E;  1Z8X A;  1AUG A;  2FT0 A;  3H8E A;  3R95 A;  1YK3 A;  3PFO A;  4GM5 A;  2IMO A;  3QAY A;  2WSA A;  4OC3 A;  2Z11 A;  3D7H A;  1XBU A;  1QSR A;  2AJ6 A;  3PB4 X;  3FJU A;  5J8F A;  4CYN A;  4DYO A;  1YVK A;  2G0B A;  4OC4 A;  1S3Z A;  2HV2 A;  5G1Z A;  3G8W A;  4E0A A;  3BI1 A;  2O4H A;  4MCP A;  4P4E A;  2VBQ A;  1JWQ A;  3TC8 A;  3K2K A;  2XEF A;  5KTC A;  4HNW B;  4B5P B;  2EK9 A;  1CJW A;  3H8F A;  3D3S A;  3P2F A;  1YQE A;  2PJ3 A;  2V8H A;  4Y49 C;  2OZU A;  4UFW A;  1H8L A;  1OBR A;  1BPN A;  4P4F A;  4ZI6 A;  6CPA A;  5KTD A;  4M6I A;  2R98 A;  2O53 A;  2PRQ A;  2PJC A;  2WZN A;  2EBJ A;  4NJR A;  1A2Z A;  1Q2Y A;  4KOY A;  4AB7 A;  2ZOG A;  2NYQ A;  3SJF A;  4OME A;  2ZW5 A;  2B4D A;  4H6U A;  5AGE A;  4UEZ A;  3B35 A;  1TF9 A;  4DUK A;  5JQ4 A;  1F2P A;  2P6F A;  2NSM A;  4W9Y A;  1Y0R A;  2PR1 A;  4OC1 A;  4QVT A;  2FL4 A;  3DLJ A;  2ZEP A;  2Y0M A;  4XPD C;  3GIU A;  2J8M A;  4DNC A;  4FAI A;  4B10 A;  1NSL A;  1I21 A;  4B11 A;  1IOI A;  3IJ3 A;  3EO4 A;  3WC5 A;  1Y7R A;  1RO5 A;  4UCP A;  2HQY A;  3BI0 A;  1LFW A;  1J4J A;  1Q7L A;  3V8I A;  1S7N A;  4DJL A;  2EVN A;  1U6M A;  3VWD A;  4B6Z A;  3FRM A;  4M6G A;  5I4M A;  2ZPA A;  3IO1 A;  4TWE A;  3W6S A;  2ANP A;  3SHP A;  3TT2 A;  1EE3 P;  4OIW A;  4C2Z A;  1NSA A;  1CBX A;  4PPZ A;  3SI1 A;  3TO7 A;  2PJ6 A;  2PJ9 A;  4P4J A;  5CNP A;  1ZLI A;  4A2Z A;  5C82 A;  1B6B A;  1X12 A;  2POK A;  3CXS A;  3FVL A;  5HXD A;  3NFZ A;  2PJ8 A;  4CGM A;  2R8V A;  3CZX A;  4GXH A;  3RYO A;  1Y7E A;  3B3C A;  4A31 A;  1WWZ A;  4TNU A;  2AFZ A;  2BL1 A;  2DF5 A;  1LRZ A;  4J3G A;  4JZ0 A;  3EC4 A;  3RNZ A;  3TOB A;  4CAX A;  3H5Z A;  3C26 A;  4M6H A;  2HUZ A;  3D2M A;  4BD9 A;  2ZEO A;  3D67 A;  2Q43 A;  1QQ9 A;  4X3R A;  4B5O A;  1UWY A;  1IGB A;  5LRK A;  5AG5 A;  1SQH A;  4P45 A;  1LAP A;  1XIX A;  3IWW A;  1FY7 A;  5ELY A;  2ZEN A;  4FD6 A;  2B3V A;  2GFQ A;  1IYK A;  3H4Q A;  2P0W A;  2VXK A;  1XRY A;  2Q4Y A;  4WWV A;  5G21 A;  3R96 A;  2AFO A;  3RZA A;  2QJ8 A;  2AFS A;  4U9Z A;  3FYN A;  3N7Z A;  3DR6 A;  4R9M A;  5LYI A;  3D7G A;  4FD5 A;  1MJ9 A;  3R9E A;  1M4G A;  1NE9 A;  2WPW A;  3CT9 A;  2CNS A;  3LAC A;  4OLL A;  4KVM E;  4MY0 A;  3D4U A;  2ARH A;  2BOA A;  4QB9 A;  1P0H A;  1ZG7 A;  4R76 A;  2JEV A;  3SJX A;  4A38 A;  4B5P A;  4LQ6 A;  2PVV A;  3ZZI A;  2C6G A;  3NA6 A;  2B4D B;  2VI7 A;  2IL4 A;  3CPA A;  4OC0 A;  1IIC A;  2R7H A;  4A95 A;  5F47 A;  3RBU A;  4P6Y A;  4KOT A;  4MFQ A;  3FED A;  5CPA A;  4KLW A;  3D68 A;  4PK2 A;  3QAH A;  4Y49 B;  4PV6 A;  2PVW A;  3WC7 A;  3PB7 X;  1PUA A;  1YVO A;  4KOS A;  4P10 A;  2GLJ A;  3PRT A;  2V8G A;  4M3S A;  4K30 A;  1Z8T A;  2FVG A;  3B3W A;  4A30 A;  4MFL A;  4KZT A;  1Y9K A;  1Z9U A;  2Z3N A;  2I79 A;  3KHZ A;  4GS4 A;  2Q04 A;  5FVJ A;  2C27 A;  1PU9 A;  3KQZ A;  5ISV A;  4PXE A;  2ZEG A;  3R9F A;  4WJB A;  4AVB A;  2OU2 A;  3IWG A;  2V8D A;  3FB3 A;  4H6Z A;  1TXR A;  2ZW7 A;  1CM0 A;  2A4N A;  3D8P A;  1S5K A;  1TKF A;  1Z4R A;  1YLE A;  2OZH A;  3CDX A;  2D4P A;  4OAE A;  2PRB A;  4XPD B;  1Z8L A;  2YND A;  1VHE A;  3F5B A;  4RS2 A;  4UCM A;  3NH5 A;  2C6C A;  1VHS A;  1GHE A;  2ZEE A;  4FUU A;  3SJG A;  2GLF A;  4B13 A;  3KR4 A;  1KUX A;  1M4I A;  3NE7 A;  1M1D A;  1QSO A;  4MHP A;  4IAV A;  3IU1 A;  3B7I A;  2Q7S A;  2VQY A;  1YX0 A;  4KSA A;  4R8F A;  2G9D A;  4UFV A;  3S9N A;  1XMT A;  2ZOF A;  4Q38 A;  1OZP A;  5EC4 A;  4II9 A;  1I12 A;  5CBM A;  1PCA A;  2Q4V A;  3WC6 A;  1LAN A;  1Q2C A;  5DWN A;  5H84 A;  2WUU A;  3D7D A;  4YFJ A;  3BJ7 A;  2PJA A;  2QYV A;  1S7L A;  3BXM A;  4E8O A;  3KAS A;  2PQ8 A;  4NXY A;  2FXF A;  2B5G B;  3CPX A;  4CGL A;  4JWP A;  2ZEM A;  2PSW A;  4ONU A;  5GCN A;  1ZG8 A;  4U5Y A;  2GAN A;  2IJZ A;  4ZY0 A;  2ABZ A;  1KWM A;  2QML A;  3ISZ A;  3IFE A;  3KI9 A;  2Q44 A;  3RO0 A;  3VAR A;  5K8M A;  1AMP A;  5EMI A;  4HKF A;  3TCV A;  3GLJ A;  2OB0 A;  4ORF A;  2B3U A;  4H2K A;  2F7V A;  2XEG A;  3F8K A;  4KLV A;  1IID A;  3IU2 A;  3PZJ A;  4C2Y A;  1B87 A;  1ELL P;  4MXU A;  5LRJ A;  2GIV A;  1CPS A;  4NGP A;  4L8A A;  4IK2 A;  3TOA A;  3KKW A;  2CTC A;  1HDQ A;  2VZY A;  4MFJ A;  4MRI A;  4RI1 A;  2O28 A;  1XE4 A;  3PFE A;  4CYO A;  1UFH A;  2BCO A;  2WYR A; 
#chains in the Genus database with same CATH homology
 3G3S A;  5G20 A;  3LOD A;  3IGR A;  4CGP A;  2YNC C;  2X7B A;  4CRY B;  3EXN A;  5IX3 A;  2Z10 A;  3S6H A;  3ZJ0 A;  4QC6 A;  3OWC A;  4LUA A;  5AG4 A;  1IYL A;  4U9Y A;  4XPL A;  1S60 A;  4A33 A;  2PC1 A;  2FIA A;  4CYP A;  4C7I A;  3DDD A;  2Z3P A;  5G22 A;  4KOR A;  3W6X A;  2NMT A;  4MHD A;  3W91 A;  4FD4 A;  4X5K A;  4CAE A;  4KOW A;  2R1I A;  4R3L A;  1ON0 A;  5JPH A;  4UWI A;  4M85 A;  4EVY A;  2QIR A;  2B5G A;  2PR8 A;  3T9Y A;  1M4D A;  5F46 A;  4CAW A;  4HNX B;  4UBR A;  1K4J A;  3PP9 A;  4XPK A;  3DSB A;  4BBH A;  4PSW A;  3JTK A;  3EFA A;  1Q2D A;  5AG6 A;  2G3A A;  3I9S A;  1WK4 A;  2OZG A;  3PGP A;  4R87 A;  2DXQ A;  3LD2 A;  3BJ8 A;  5HH1 A;  1XEB A;  3TE4 A;  3FNC A;  3FIX A;  2CNM A;  2Z3L A;  4FD7 A;  4A32 A;  4NEX A;  3UY5 A;  3WR7 A;  1KUV A;  2ATR A;  4L89 A;  1IB1 E;  5J8C A;  3CXQ A;  2D4O A;  2P6G A;  3BLN A;  4F6A A;  2OH1 A;  1Y9W A;  3D2P A;  4F0Y A;  4OAD A;  4XNH C;  1BO4 A;  1MK4 A;  4C7H A;  4CGO A;  2AE6 A;  4KUB A;  2J8R A;  4AVC A;  4JJX A;  4CGN A;  4JD6 A;  1L0C A;  2PDO A;  2KCW A;  3F0A A;  4CAV A;  4JLY A;  4PSX A;  2G3T A;  3K9U A;  1R57 A;  2DPS A;  1I1D A;  4H89 A;  4B12 A;  5IV0 A;  2Z3M A;  2REE A;  3FXT A;  2RC4 A;  4LX9 A;  3VWE A;  4YRH A;  1Z4E A;  2YNE A;  4NCZ A;  2ZXV A;  2CY2 A;  3S6K A;  3R1K A;  4MBU A;  4BMH A;  4QBJ A;  1KZF A;  4UCN A;  4CAF A;  2GE3 A;  4F0X A;  2REF A;  3TTH A;  5H86 A;  4JXQ A;  4AG7 A;  4R3K A;  5KTA A;  2I00 A;  2BEI A;  4KSF A;  4I49 A;  2FSR A;  2EUI A;  1BOB A;  1S7F A;  4MFP A;  4IUS A;  3QB8 A;  3DR8 A;  5I0C A;  4NSQ A;  1P4N A;  4NF1 A;  4AG9 A;  4KOX A;  2K5T A;  3B8G A;  3DNS A;  2Q7B A;  1S7K A;  5A28 A;  5EBV A;  2YNC A;  2BUE A;  4KVX A;  3EY5 A;  4C2X A;  4XNH B;  2Q0Y A;  4ZBG A;  5AG7 A;  3S6F A;  3T90 A;  1MJA A;  1MJB A;  3JUW A;  1KUY A;  4HNY B;  2BSW A;  2CXA A;  3I3G A;  1YGH A;  3TO9 A;  4UA3 A;  4QUS A;  2YGW A;  4AVA A;  2JDD A;  3FBU A;  4KOV A;  4KS9 A;  3MGD A;  3SXN A;  4C68 A;  5C88 A;  2ZW6 A;  4CYQ A;  2H5M A;  3TO6 A;  3CXP A;  1N71 A;  3JVN A;  2P6E A;  3GY9 A;  5BWA B;  2Z0Z A;  5F48 A;  4B14 A;  3IWE A;  2JDC A;  4KVO E;  1YRE A;  2F5I A;  3GKR A;  3S6G A;  5IB0 A;  4KUA A;  1NMT A;  4MFK A;  4KOU A;  2B58 A;  4MI4 A;  2WPX A;  4YGO A;  2FS5 A;  4MFZ A;  2Z3O A;  1TIQ A;  4R57 A;  3R9G A;  4E2A A;  4ZGY B;  1ZO0 A;  1XF8 A;  4CS0 B;  2FCK A;  5E96 A;  2CNT A;  2J8N A;  3TFY A;  1QSM A;  3A9L A;  4PK3 A;  4UFX A;  3SXO A;  2JLM A;  3P2H A;  1QSN A;  2QEC A;  2ZW4 A;  1YR0 A;  2FE7 A;  4Q36 A;  4MJ8 A;  1RXT A;  4UWJ A;  1V0C A;  1M44 A;  4IF5 A;  4CRZ B;  3GYA A;  4MY3 A;  5A27 A;  2VZZ A;  4JXR A;  1VKC A;  2FIW A;  5HMN A;  3E0K A;  2Z3K A;  2B4B A;  5DWM A;  2VEZ A;  2DPT A;  1QST A;  2FT0 A;  3R95 A;  1YK3 A;  2WSA A;  2Z11 A;  1QSR A;  2AJ6 A;  5J8F A;  4CYN A;  1YVK A;  2G0B A;  1S3Z A;  2HV2 A;  3G8W A;  4E0A A;  2VBQ A;  5KTC A;  4HNW B;  4B5P B;  1CJW A;  3P2F A;  3D3S A;  4Y49 C;  2OZU A;  4UFW A;  5KTD A;  2R98 A;  1Q2Y A;  4KOY A;  4AB7 A;  2ZW5 A;  2B4D A;  4H6U A;  5AGE A;  5JQ4 A;  2P6F A;  2PR1 A;  4QVT A;  2FL4 A;  2Y0M A;  4XPD C;  2J8M A;  4DNC A;  4B10 A;  1NSL A;  1I21 A;  4B11 A;  3EO4 A;  1Y7R A;  1RO5 A;  4UCP A;  2HQY A;  1J4J A;  3V8I A;  1S7N A;  2EVN A;  1U6M A;  3VWD A;  3FRM A;  2ZPA A;  3W6S A;  3SHP A;  3TT2 A;  4C2Z A;  3TO7 A;  5CNP A;  4A2Z A;  5C82 A;  1B6B A;  3CXS A;  4CGM A;  2R8V A;  3RYO A;  4A31 A;  1WWZ A;  2BL1 A;  3TOB A;  1LRZ A;  4J3G A;  3EC4 A;  4CAX A;  3H5Z A;  3C26 A;  2HUZ A;  3D2M A;  4B5O A;  5AG5 A;  1SQH A;  1XIX A;  1FY7 A;  4FD6 A;  2B3V A;  1IYK A;  3H4Q A;  2P0W A;  2VXK A;  2Q4Y A;  5G21 A;  3R96 A;  4U9Z A;  3FYN A;  3N7Z A;  3DR6 A;  4R9M A;  4FD5 A;  1MJ9 A;  3R9E A;  1M4G A;  1NE9 A;  2WPW A;  2CNS A;  4OLL A;  4KVM E;  4MY0 A;  4QB9 A;  2ARH A;  5G1Z A;  1P0H A;  2JEV A;  4B5P A;  3ZZI A;  2B4D B;  2VI7 A;  2IL4 A;  1IIC A;  2R7H A;  4A95 A;  5F47 A;  4KOT A;  4MFQ A;  4KLW A;  4PK2 A;  3QAH A;  4Y49 B;  4PV6 A;  1PUA A;  1YVO A;  4KOS A;  4M3S A;  4K30 A;  4A30 A;  4MFL A;  4KZT A;  1Y9K A;  1Z9U A;  2Z3N A;  2I79 A;  4GS4 A;  5FVJ A;  2Q04 A;  2C27 A;  1PU9 A;  5ISV A;  3R9F A;  4AVB A;  2OU2 A;  3IWG A;  3FB3 A;  4H6Z A;  2ZW7 A;  1CM0 A;  2A4N A;  3D8P A;  1S5K A;  1Z4R A;  1YLE A;  2OZH A;  2D4P A;  4OAE A;  2PRB A;  4XPD B;  3F5B A;  2YND A;  4RS2 A;  4UCM A;  1VHS A;  1GHE A;  4B13 A;  3NE7 A;  1KUX A;  1M4I A;  1M1D A;  1QSO A;  3IU1 A;  4KSA A;  2VQY A;  1YX0 A;  4UFV A;  1XMT A;  4Q38 A;  1OZP A;  5EC4 A;  4II9 A;  1I12 A;  2Q4V A;  1Q2C A;  5DWN A;  5H84 A;  2WUU A;  4YFJ A;  3BJ7 A;  1S7L A;  4E8O A;  4NXY A;  2PQ8 A;  2FXF A;  2B5G B;  4CGL A;  4JWP A;  4ONU A;  2PSW A;  5GCN A;  4U5Y A;  2GAN A;  2QML A;  2Q44 A;  4HKF A;  3TCV A;  2OB0 A;  4ORF A;  2B3U A;  3F8K A;  4KLV A;  1IID A;  3IU2 A;  3PZJ A;  4C2Y A;  1B87 A;  2GIV A;  4L8A A;  3TOA A;  3KKW A;  4MFJ A;  2VZY A;  4RI1 A;  2O28 A;  1XE4 A;  4CYO A;  1UFH A;  5F49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...