2VXKA

Structural comparison between aspergillus fumigatus and human gna1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
165
structure length
165
Chain Sequence
ENTPLFSPSLISPDVLAVLPADYTIRPLCRSDYKRGYLDVLRVLTTVGDINEEQWNSRYEWIRARSDEYYLLVVCDGEGRIVGTGSLVVERKFIHSLGMVGHIEDIAVEKGQQGKKLGLRIIQALDYVAEKVGCYKTILDCSEANEGFYIKCGFKRAGLEMAHYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSAMINE 6-PHOSPHATE ACETYLTRANSFERASE
publication title Structural and Kinetic Differences between Human and Aspergillus Fumigatus D-Glucosamine-6- Phosphate N-Acetyltransferase.
pubmed doi rcsb
source organism Aspergillus fumigatus
molecule tags Transferase
total genus 46
structure length 165
sequence length 165
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2008-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2vxkA01
2DXQA 1NE9A 1XMTA 2G0BA 2CY2A 4HNWB 1S3ZA 3BLNA 1Y7RA 3EFAA 2AE6A 3TOAA 2REEA 4KOWA 4MY3A 1YR0A 1M4IA 3TO9A 1UFHA 1N71A 2PR1A 2A4NA 4R3LA 3I9SA 4F6AA 2JDDA 3R9EA 1L0CA 4PV6A 4CRZB 1P0HA 4KUAA 1NSLA 3R96A 2WPXA 2EVNA 2JDCA 3DNSA 1IYLA 3S6FA 3DR8A 5H86A 2J8NA 2PDOA 4R57A 3W91A 1S7NA 3C26A 4JXQA 2ATRA 4UWIA 4YFJA 1BO4A 1P4NA 3FIXA 2B4DB 4B5PB 2PSWA 1RO5A 2ZPAA 4U5YA 1YVKA 4H6ZA 4QVTA 1YGHA 1M4DA 2VXKA 4MI4A 1B6BA 2PC1A 3GYAA 4PSWA 4M3SA 5KTDA 2J8MA 4FD5A 4MBUA 1QSMA 3T9YA 2Z10A 4AG7A 3I3GA 4XNHC 2B58A 3V8IA 2G3AA 2H5MA 2ZW6A 4ZBGA 1MJAA 4NSQA 2VBQA 4QB9A 3H4QA 3TT2A 2K5TA 1J4JA 4Y49B 3D2PA 2P6EA 1Z4RA 4I49A 1M4GA 2QIRA 4EVYA 5H84A 3SXOA 3EO4A 4JJXA 2R8VA 3PGPA 4U9YA 5GCNA 1LRZA 1V0CA 4AG9A 2HV2A 4ONUA 3ZZIA 3W6SA 2HQYA 4YRHA 4AVBA 1Z4EA 4H89A 3FNCA 3TOBA 2EUIA 4HNXB 3FXTA 2Q0YA 3EXNA 4LX9A 3PP9A 4QUSA 3BJ8A 2ZW4A 2JEVA 3N7ZA 4CAWA 1MJ9A 2PQ8A 3IGRA 2OB0A 1VKCA 1VHSA 5C88A 3OWCA 4QBJA 1K4JA 5DWNA 5JPHA 4XPDC 1KUVA 4KOVA 2AJ6A 3T90A 4U9ZA 4LUAA 1U6MA 4XPLA 4CS0B 2GANA 4PK2A 2OU2A 4DNCA 4RI1A 5HMNA 3D3SA 2D4OA 4NF1A 2R7HA 2G3TA 5C82A 2PR8A 1XEBA 2BEIA 2Q44A 3QB8A 1XE4A 3FRMA 4KOUA 4MHDA 4PSXA 4KOYA 1Y9KA 1NMTA 3TCVA 2FXFA 5F46A 5EC4A 1Z9UA 2VZZA 3CXPA 1SQHA 3EC4A 3EY5A 4JD6A 4AVCA 1R57A 2RC4A 4BMHA 5ISVA 5EBVA 1S7LA 1YX0A 4MJ8A 4B5OA 4PK3A 4KORA 4R87A 4JXRA 4OAEA 2C27A 2Q4VA 2Z0ZA 3SHPA 2O28A 2P0WA 1KUXA 4KVXA 1FY7A 2JLMA 2BUEA 3LD2A 2ARHA 3G8WA 2Y0MA 4E0AA 2VI7A 1QSOA 4OADA 3VWDA 2FS5A 4UBRA 2WPWA 2FT0A 3JUWA 3R1KA 4L89A 4NCZA 4UA3A 2B5GA 5CNPA 2Q4YA 5HH1A 2FL4A 3K9UA 1BOBA 4KVME 4FD7A 3UY5A 2Q04A 2GIVA 5KTAA 4KZTA 2VEZA 4K30A 4QC6A 2R1IA 2Q7BA 1Y9WA 2CNTA 3B8GA 3F5BA 4L8AA 4J3GA 2VZYA 1Q2YA 3KKWA 2FCKA 4CAVA 2BL1A 2ZW7A 4E8OA 3P2FA 4X5KA 2FE7A 1IYKA 3DDDA 1OZPA 3TTHA 1MK4A 3GY9A 1CJWA 5I0CA 1PUAA 3FBUA 2D4PA 4R9MA 1QSNA 3E0KA 4XPKA 3WR7A 2KCWA 1M44A 4HKFA 2CNMA 3DR6A 1RXTA 1PU9A 3G3SA 4KLVA 3D2MA 2B5GB 4IUSA 3RYOA 5IX3A 2BSWA 2J8RA 5DWMA 3TE4A 1MJBA 2OH1A 1YK3A 5FVJA 4KLWA 1TIQA 2R98A 4MY0A 2VQYA 2FIAA 2ZXVA 4E2AA 5F48A 1XIXA 1Q2DA 3BJ7A 4KOXA 1IIDA 2B3UA 3CXQA 4CRYB 4XNHB 2OZUA 2P6GA 4FD6A 5KTCA 3DSBA 5F49A 2FSRA 1WK4A 3S6GA 4AVAA 4HNYB 4JWPA 3LODA 4UWJA 1QSTA 3P2HA 5J8CA 1I12A 1KUYA 1YVOA 1I21A 1S7KA 2I79A 4R3KA 3D8PA 2NMTA 3R9GA 3TO7A 3S6KA 1IICA 5F47A 1ON0A 1S5KA 4M85A 1KZFA 3CXSA 2PRBA 1GHEA 3R95A 5IV0A 3GKRA 2OZGA 2REFA 3SXNA 4KVOE 3NE7A 3R9FA 2P6FA 3TO6A 2B4BA 1M1DA 4OLLA 1YLEA 1WWZA 1QSRA 4GS4A 4AB7A 3VWEA 2HUZA 4II9A 3S6HA 3TFYA 4YGOA 1Q2CA 1B87A 3F0AA 4XPDB 3ZJ0A 2QMLA 4NEXA 2IL4A 2GE3A 4JLYA 3FYNA 2F5IA 2B3VA 1XF8A 3JVNA 1IB1E 4IF5A 3PZJA 4H6UA 4F0YA 2QECA 3MGDA 5J8FA 4FD4A 3F8KA 4RS2A 1S7FA 2FIWA 4KUBA 2OZHA 5JQ4A 1YREA 2Z11A 5IB0A 1I1DA 2ZW5A 3IWGA 3QAHA 2X7BA 2CNSA 4CAXA 4Y49C 1CM0A 4ORFA 5E96A 3FB3A 2I00A 4KOTA 3W6XA 1S60A 4NXYA 2B4DA 4B5PA 4KOSA
chains in the Genus database with same CATH superfamily
2DXQA 3D68A 1NE9A 5LRGA 4JYWA 2Z3KA 2Q51A 2PE3A 1HEEA 1XMTA 2XEIA 1OBRA 2G0BA 4UF4A 2CY2A 2OOTA 2HC9A 1YLOA 1DTDA 3WABA 4HNWB 1S3ZA 2PJ5A 3BLNA 1R43A 2Q7SA 1Y0YA 4PXCA 5F09A 3IJ3A 3DLJA 4OC5A 1Y7RA 3EFAA 2PJ7A 2CF4A 2PJ3A 1X10A 4F9UA 2AE6A 2GLJA 3TOAA 2REEA 4KOWA 4MY3A 1YR0A 4P4JA 1M4IA 2RB7A 3TO9A 1UFHA 2YNDA 4P4EA 1N71A 2PR1A 2YNEA 1Z8XA 2A4NA 4R3LA 2EWBA 3VARA 4A33A 5J1QA 5LRJA 2AFSA 3I9SA 4F6AA 4IK2A 2JDDA 3JRUA 3PBEA 2DF5A 4OMEA 3R9EA 3RO0A 1L0CA 4X2TA 3BI0A 4PV6A 4UEFA 1HDQA 4CRZB 1P0HA 3KR5A 4YWYA 4KUAA 1NSLA 4PPZA 2XEGA 2PRQA 1AMPA 3R96A 2WPXA 1UWYA 2EVNA 2JDCA 3DNSA 3MN8A 4NGNA 3FF3A 1IYLA 4CYQA 3KR4A 3S6FA 2ZEMA 3DR8A 5H86A 2J8NA 2PDOA 3KHXA 2POKA 4R57A 4MHPA 5AG7A 3W91A 4M6IA 1S7NA 1XBUA 3C26A 4JXQA 3I1UA 2ATRA 1FNOA 4UWIA 4YFJA 1BO4A 2WZNA 1P4NA 2Z3LA 3FIXA 3NA6A 2B4DB 4B5PB 1LOKA 2PSWA 1RO5A 2ZPAA 2C6GA 4U5YA 1YVKA 5JH9A 4H6ZA 3GUXA 4QVTA 1CG2A 4C2YA 4BD9A 1YGHA 1M4DA 2VXKA 4UEZA 3T8WA 4MI4A 3BXMA 4PQAA 1PCAA 1B6BA 2PC1A 3CPXA 3PB8X 4NGQA 3GYAA 5LYIA 2QYVA 2BOAA 4PSWA 4M3SA 1EE3P 5KTDA 1CBXA 2J8MA 4FD5A 4MBUA 1QSMA 4UFWA 4OC0A 5K8PA 3LACA 2DPSA 2Z10A 3D7DA 4JZ0A 3T9YA 4CGPA 5G22A 4AG7A 3PB9X 3I3GA 4XNHC 1M4LA 2B58A 3V8IA 4C7HA 2G3AA 2H5MA 2ZW6A 4ZBGA 5BWAB 1MJAA 4NSQA 5DS0A 2VBQA 4QB9A 3H4QA 5HVGA 3TT2A 2K5TA 3D4UA 1LAMA 1J4JA 4Y49B 2DPTA 2ZEOA 3D2PA 1F2PA 3KGQA 4FAIA 4UIAA 2P6EA 3B35A 4MXUA 1Z4RA 4Q7AA 4BINA 1LANA 4I49A 4UCMA 2F7VA 1M4GA 4WJBA 2QIRA 4EVYA 2WSAA 3SI1A 3GLJA 4NJRA 5H84A 3SXOA 3EO4A 2Q43A 4JJXA 2R8VA 3PGPA 2JEWA 4U9YA 4KOSA 5GCNA 1V0CA 1LRZA 3SJFA 4AG9A 2HV2A 4KS9A 4ONUA 3ZZIA 4FBEA 3W6SA 4NFRA 2HQYA 4CAFA 4YRHA 4AVBA 1Z4EA 4H89A 3FNCA 3TOBA 4O23A 2EUIA 4HNXB 4C68A 2GREA 3FXTA 4EFDA 2Q0YA 4NJQA 5AG6A 1A2ZA 3EXNA 4UFXA 4LX9A 3PP9A 5HVFA 4KSFA 2Z3MA 4LQ6A 3BI1A 3BJ8A 4QUSA 1TKJA 5THWA 4A37A 4ZGYB 1YMEA 2HB6A 3CDXA 2AFWA 2C6PA 2ZW4A 3FH4A 2JEVA 2QVPA 3IU2A 1MJ9A 3N7ZA 4CAWA 3SJXA 1YQEA 3JTKA 2PQ8A 3IGRA 3HUVA 1ZG7A 2OB0A 1VKCA 2JBJA 3FEDA 1VHSA 2IQ6A 4OIWA 5C88A 2V8GA 2PJ2A 3OWCA 4QBJA 1ZLIA 4MFJA 1K4JA 5DWNA 2XEFA 3V38A 2PJAA 4NGPA 5JPHA 3PBBA 1CP6A 1F2OA 5A28A 1X12A 2Z3OA 4CPAA 2YNCC 4XPDC 4CYOA 4MRIA 1KUVA 1XJOA 3KQXA 2AJ6A 4KOVA 3D7GA 4YU9A 3T90A 4B6ZA 4U9ZA 5HXDA 1CX8A 1BLLE 4LUAA 1U6MA 4XPLA 3KQZA 3B3VA 3PEIA 4CS0B 1RTQA 2GANA 4PK2A 2OU2A 4DNCA 1KWMA 5G21A 4RI1A 5HMNA 4R6TA 1XFOA 3D3SA 4C2XA 8CPAA 2D4OA 1CPSA 5HVHA 4MHZA 4NF1A 2R7HA 2G3TA 2PJ8A 5LYLA 5C82A 1IY7A 2PR8A 1XEBA 4B10A 2Q4ZA 2BEIA 4CGNA 2Q44A 3L2NA 3QB8A 1XE4A 4B12A 3NH4A 3FRMA 2OR4A 4KOUA 1ZO0A 4MHDA 4PSXA 4KOYA 1R3NA 1Y9KA 2V77A 1NMTA 2ZOFA 3TCVA 2FXFA 3WC6A 5F46A 5EC4A 1Z9UA 2VZZA 4OC1A 3CXPA 4C7IA 4Z65A 2GFQA 4PXEA 2VL1A 1SQHA 4X8IA 3EC4A 5LYFA 3KASA 1H8LA 2PJ9A 2V8DA 3N5FA 3D7HA 3EY5A 3VATA 4TNUA 4MCSA 3B3SA 2WUUA 4JD6A 4AVCA 5K8MA 1R57A 3K2KA 2RC4A 3IWWA 4Q38A 2EK8A 3KL9A 4OC3A 4BMHA 5ISVA 2Z3PA 1S7LA 5EBVA 1YX0A 3NFZA 2EBJA 1JQGA 4MJ8A 5EMIA 4F8ZA 2I3CA 4PK3A 4B5OA 5AG4A 3WC7A 4KORA 3DGVA 4R87A 4A2ZA 4JXRA 3FX6A 4OAEA 1BAVA 2C27A 2Q4VA 2Z0ZA 3SHPA 6CPAA 3PRTA 5G1ZA 4ZX8A 4EWTA 4GXHA 4A32A 2O28A 2P0WA 1KUXA 1Z8LA 2IJZA 2ZENA 4P4FA 2V8HA 4KVXA 1FY7A 2F8HA 2JLMA 3RAMA 4ZI6A 5JM6A 2BUEA 3LD2A 5IB9A 2ARHA 3S9MA 3D7FA 4F0XA 3G8WA 2Y0MA 5JGFA 2PJ1A 1VHOA 4E0AA 4M6GA 1YW6A 1QSOA 2VI7A 4OADA 5A27A 5I4MA 2ZOGA 4A95A 4F9VA 1TXRA 7CPAA 1Y7EA 2FS5A 4UBRA 3VWDA 2WPWA 3K9TA 3LMSA 1QQ9A 2FT0A 3JUWA 3R1KA 4L89A 3B2YA 4NCZA 4OC4A 2EK9A 4UA3A 4BBHA 2B5GA 5CNPA 4PXBA 3CT9A 2Q4YA 5HH1A 3QNVA 3WC5A 2FL4A 1Q7LA 4UFVA 2WYRA 3K9UA 3S9NA 2ABZA 2RFHA 4NGTA 4ZY1A 1BOBA 4KVME 2AFOA 4NGMA 4FD7A 3TC8A 3UY5A 2CIJA 2Q04A 4HPSA 2GIVA 3H8FA 5KTAA 4KZTA 3SI2A 2VEZA 4K30A 1AYEA 4FUUA 3SJEA 4DYOA 2C1CA 3SJGA 1TKHA 1VHEA 3MRUA 4QC6A 1ZG8A 4K3NA 2R1IA 2Q7BA 4IHMA 1YSJA 3B3TA 4MFKA 1Y9WA 2CNTA 3B8GA 3F5BA 4L8AA 4J3GA 2VZYA 4C2ZA 1YW4A 2PVVA 1Q2YA 3KKWA 2FCKA 3PFOA 4RN7A 5ELYA 4CAVA 4A30A 4CYPA 2BL1A 4ZX9A 4MFQA 1BPNA 2ZW7A 4E8OA 1ELMP 2QJ8A 1FT7A 4W9YA 2ZEEA 3P2FA 4X5KA 1NSAA 2FE7A 3FJUA 1IYKA 3DDDA 1OZPA 3TTHA 4R7MA 4UCNA 1MK4A 2PCUA 3TX8A 4P4BA 3GY9A 2YGWA 1CJWA 3BHXA 1IGBA 5I0CA 5AGEA 1PUAA 2PIZA 3H8GA 4EMEA 2D4PA 1XRYA 1BPMA 2EO8A 1QSNA 1LCPA 2O4HA 3IC1A 3E0KA 3ISZA 3A9LA 4R9MA 4XPKA 4MFLA 4ZYQA 3WR7A 2ANPA 2KCWA 1M44A 3ISXA 4P6YA 3QAYA 2ZELA 2J9AA 3NH5A 4HKFA 4B14A 2CNMA 1ZLHA 3DR6A 3FECA 1XMBA 1RXTA 4PXDA 1PU9A 2IMOA 3G3SA 4KLVA 2CXAA 2B5GB 3D2MA 4IUSA 5D29A 3KHZA 3RYOA 5IX3A 2BSWA 2J8RA 5DWMA 3TE4A 1IU8A 1MJBA 3WT4A 4MCRA 2OH1A 2PVWA 1YK3A 3LWUA 1XOVA 5FVJA 4KLWA 3VH9A 1TIQA 2R98A 2CTCA 1ARMA 4MY0A 3HLPA 2PJ6A 2ZEDA 3PB4X 3RZAA 4MFZA 2VQYA 2FIAA 4OIDA 2ZXVA 4E2AA 3D67A 4P4DA 5LYDA 3KZWA 4OKOA 5F48A 1XIXA 1Q2DA 3BJ7A 4KOXA 2CTBA 4WWVA 2DEAA 4RUHA 3H5ZA 1IIDA 2B3UA 1ELLP 3CXQA 4DJLA 4CRYB 4XNHB 4M6HA 1DE4C 2OZUA 2P6GA 3IWEA 2ODFA 4FD6A 4B13A 1TKFA 4LQGA 5KTCA 3DSBA 5F49A 2FSRA 1F57A 4MMOA 1VGYA 1WK4A 3S6GA 4AVAA 2YNCA 4HNYB 4CGLA 3IO1A 4JWPA 3LODA 4UWJA 5CPAA 1QSTA 2XEJA 3P2HA 2BCOA 1TF9A 1PYTB 5J8CA 2AFXA 4X3RA 2PJCA 3FEEA 4MHNA 2FVGA 4P44A 2AFMA 3PFEA 2ZEHA 1I12A 1KUYA 1YVOA 1I21A 2ZEPA 1S7KA 2I79A 4R3KA 3D8PA 4R8FA 4GM5A 1CPXA 2NMTA 2PJ0A 3R9GA 3TO7A 4CYNA 3S6KA 2AFUA 1Y0RA 1IICA 1ARLA 4MHYA 5F47A 1LAPA 1ON0A 1S5KA 3FMCA 4M85A 5K8NA 3PB7X 4ZY0A 4AXVA 4UCPA 1KZFA 2PJBA 2ZEFA 3CXSA 2PRBA 2GLFA 1VIXA 3IEHA 1Z8WA 1GHEA 3R95A 4IAVA 5IV0A 3GKRA 2ZEGA 3GB0A 2OZGA 2REFA 5AG5A 3V7ZA 1JWQA 1IOIA 3SXNA 4KVOE 3NE7A 3R9FA 3B7IA 2P6FA 3TO6A 2B4BA 2C6CA 1M1DA 4OP4A 3D66A 4OLLA 4UEEA 4CAEA 4NGSA 5G20A 4A94A 3PB6X 4H2KA 1YLEA 1WWZA 1QSRA 4GS4A 4AB7A 3VWEA 2HUZA 4P45A 4A39A 4II9A 3IIBA 3S6HA 3TFYA 4YGOA 4MFPA 2AFZA 3GIUA 3CZXA 1Q2CA 1LFWA 3CPAA 1B87A 3B3CA 3NE8A 4MCPA 5CBMA 3F0AA 4XPDB 2V8VA 4B11A 2G9DA 3NH8A 3ZJ0A 3S9LA 2QMLA 4NEXA 2IL4A 2GE3A 3H8EA 4JLYA 3FYNA 4OC2A 2O53A 2F5IA 2B3VA 4R76A 4P4IA 2Z3NA 1XF8A 3JVNA 3SI0A 1IB1E 3FVLA 2GU2A 3B3WA 1TF8A 4NGRA 4IF5A 4ZY2A 3PZJA 5K8OA 4ONWA 4H6UA 1CP7A 3KI9A 4FWUA 4A38A 1Z2LA 2BO9A 2QECA 3MGDA 4KSIA 4F0YA 5J8FA 5LRKA 4FD4A 3F8KA 4RS2A 1S7FA 2PJ4A 1ZG9A 2FIWA 1HDUA 4KUBA 5D8NA 2OZHA 5JQ4A 1YREA 2Z11A 4UIBA 5IB0A 4KSAA 1AUGA 1I1DA 2ZW5A 3IWGA 3RNZA 2JBKA 3QAHA 1Z8TA 4Q36A 2X7BA 2CNSA 2NSMA 2NYQA 4A31A 4CAXA 1Z5RA 4DUKA 4Y49C 1CM0A 4ORFA 3RBUA 4CGMA 4G1PA 3FB3A 5E96A 4TWEA 2I00A 4KOTA 2PIYA 3W6XA 4CGOA 1S60A 3IFEA 1QMUA 4MCQA 4NXYA 1IOFA 2B4DA 4B5PA 1GYTA 4P10A 3IU1A 3FBUA
chains in the Genus database with same CATH topology
2DXQA 1NE9A 2Z3KA 1XMTA 2G0BA 2CY2A 4HNWB 1S3ZA 3BLNA 1Y7RA 3EFAA 2AE6A 3TOAA 2REEA 4KOWA 4MY3A 1YR0A 1M4IA 3TO9A 1UFHA 2YNDA 1N71A 2PR1A 2YNEA 2A4NA 4R3LA 4A33A 3I9SA 4F6AA 2JDDA 3R9EA 1L0CA 4PV6A 4CRZB 1P0HA 4KUAA 1NSLA 3R96A 2WPXA 2EVNA 2JDCA 3DNSA 1IYLA 4CYQA 3S6FA 3DR8A 5H86A 2J8NA 2PDOA 4R57A 5AG7A 3W91A 1S7NA 3C26A 4JXQA 2ATRA 4UWIA 4YFJA 1BO4A 1P4NA 2Z3LA 3FIXA 2B4DB 4B5PB 2PSWA 1RO5A 2ZPAA 4U5YA 1YVKA 4H6ZA 4QVTA 4C2YA 1YGHA 1M4DA 2VXKA 4MI4A 1B6BA 2PC1A 3GYAA 4PSWA 4M3SA 5KTDA 2J8MA 4FD5A 4MBUA 1QSMA 4UFWA 2DPSA 2Z10A 3T9YA 4CGPA 5G22A 4AG7A 3I3GA 4XNHC 2B58A 3V8IA 4C7HA 2G3AA 2H5MA 2ZW6A 4ZBGA 5BWAB 1MJAA 4NSQA 2VBQA 4QB9A 3H4QA 3TT2A 2K5TA 1J4JA 4Y49B 2DPTA 3D2PA 2P6EA 1Z4RA 4UCMA 4I49A 1M4GA 2QIRA 4EVYA 2WSAA 5H84A 3SXOA 3EO4A 4JJXA 2R8VA 3PGPA 4U9YA 4KOSA 5GCNA 1LRZA 1V0CA 4AG9A 2HV2A 4KS9A 4ONUA 3ZZIA 3W6SA 2HQYA 4CAFA 4YRHA 4AVBA 1Z4EA 4H89A 3FNCA 3TOBA 2EUIA 4HNXB 4C68A 3FXTA 2Q0YA 5AG6A 3EXNA 4UFXA 4LX9A 3PP9A 4KSFA 2Z3MA 4QUSA 3BJ8A 4ZGYB 2ZW4A 2JEVA 3N7ZA 3IU2A 1MJ9A 4CAWA 3JTKA 2PQ8A 3IGRA 2OB0A 1VKCA 1VHSA 5C88A 3OWCA 4QBJA 4MFJA 1K4JA 5DWNA 5JPHA 5A28A 2Z3OA 2YNCC 4XPDC 4CYOA 1KUVA 4KOVA 2AJ6A 3T90A 4U9ZA 4LUAA 1U6MA 4XPLA 4CS0B 2GANA 4PK2A 2OU2A 4DNCA 5G21A 4RI1A 5HMNA 4C2XA 3D3SA 2D4OA 4NF1A 2R7HA 2G3TA 5C82A 2PR8A 1XEBA 4B10A 2BEIA 4CGNA 2Q44A 3QB8A 1XE4A 4B12A 3FRMA 4KOUA 1ZO0A 4MHDA 4PSXA 4KOYA 1Y9KA 1NMTA 3TCVA 2FXFA 5F46A 5EC4A 1Z9UA 2VZZA 4C7IA 3CXPA 1SQHA 3EC4A 3EY5A 2WUUA 4JD6A 4AVCA 1R57A 4Q38A 2RC4A 4BMHA 5ISVA 2Z3PA 1S7LA 5EBVA 1YX0A 4MJ8A 4B5OA 4PK3A 5AG4A 4KORA 4R87A 4A2ZA 4JXRA 4OAEA 2C27A 2Q4VA 2Z0ZA 3SHPA 5G1ZA 4A32A 2O28A 2P0WA 1KUXA 4KVXA 1FY7A 2JLMA 2BUEA 3LD2A 2ARHA 4F0XA 3G8WA 2Y0MA 4E0AA 2VI7A 1QSOA 4OADA 5A27A 4A95A 3VWDA 2FS5A 4UBRA 2WPWA 2FT0A 3JUWA 3R1KA 4L89A 4NCZA 4UA3A 4BBHA 2B5GA 5CNPA 2Q4YA 5HH1A 2FL4A 4UFVA 3K9UA 1BOBA 4KVME 4FD7A 3UY5A 2Q04A 2GIVA 5KTAA 4KZTA 2VEZA 4K30A 4QC6A 2R1IA 2Q7BA 4MFKA 1Y9WA 2CNTA 3B8GA 3F5BA 4L8AA 4J3GA 2VZYA 4C2ZA 1Q2YA 3KKWA 2FCKA 4CAVA 4CYPA 4A30A 2BL1A 4MFQA 2ZW7A 4E8OA 3P2FA 4X5KA 2FE7A 1IYKA 3DDDA 1OZPA 3TTHA 4UCNA 1MK4A 3GY9A 2YGWA 1CJWA 5I0CA 5AGEA 1PUAA 2D4PA 4R9MA 1QSNA 3E0KA 4XPKA 3A9LA 4MFLA 3WR7A 2KCWA 1M44A 4HKFA 4B14A 2CNMA 3DR6A 1RXTA 1PU9A 3G3SA 4KLVA 2CXAA 2B5GB 3D2MA 4IUSA 3RYOA 5IX3A 2BSWA 2J8RA 5DWMA 3TE4A 1MJBA 2OH1A 1YK3A 5FVJA 4KLWA 1TIQA 2R98A 4MY0A 4MFZA 2VQYA 2FIAA 2ZXVA 4E2AA 5F48A 1XIXA 1Q2DA 3BJ7A 4KOXA 3H5ZA 1IIDA 2B3UA 3CXQA 4CRYB 4XNHB 2OZUA 2P6GA 3IWEA 4FD6A 4B13A 5KTCA 3DSBA 5F49A 2FSRA 1WK4A 3S6GA 4AVAA 2YNCA 4HNYB 4CGLA 4JWPA 3LODA 4UWJA 1QSTA 3P2HA 5J8CA 1I12A 1KUYA 1YVOA 1I21A 1S7KA 2I79A 4R3KA 3D8PA 2NMTA 3R9GA 3TO7A 4CYNA 3S6KA 1IICA 5F47A 1ON0A 1S5KA 4M85A 4UCPA 1KZFA 3CXSA 2PRBA 1GHEA 3R95A 5IV0A 3GKRA 2OZGA 2REFA 5AG5A 3SXNA 4KVOE 3NE7A 3R9FA 2P6FA 3TO6A 2B4BA 1M1DA 4OLLA 4CAEA 5G20A 1YLEA 1WWZA 1QSRA 4GS4A 4AB7A 3VWEA 2HUZA 4II9A 3S6HA 3TFYA 4YGOA 4MFPA 1Q2CA 1B87A 3F0AA 4XPDB 4B11A 3ZJ0A 2QMLA 4NEXA 2IL4A 2GE3A 4JLYA 3FYNA 2F5IA 2B3VA 2Z3NA 1XF8A 3JVNA 1IB1E 4IF5A 3PZJA 4H6UA 4F0YA 2QECA 3MGDA 5J8FA 4FD4A 3F8KA 4RS2A 1S7FA 2FIWA 4KUBA 2OZHA 5JQ4A 1YREA 2Z11A 5IB0A 4KSAA 1I1DA 2ZW5A 3IWGA 3QAHA 4Q36A 2X7BA 2CNSA 4A31A 4CAXA 4Y49C 1CM0A 4ORFA 4CGMA 5E96A 3FB3A 2I00A 4KOTA 3W6XA 4CGOA 1S60A 4NXYA 2B4DA 4B5PA 3IU1A 3FBUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXQ A;  1NE9 A;  1XMT A;  2G0B A;  2CY2 A;  4HNW B;  1S3Z A;  3BLN A;  1Y7R A;  3EFA A;  2AE6 A;  3TOA A;  2REE A;  4KOW A;  4MY3 A;  1YR0 A;  1M4I A;  3TO9 A;  1UFH A;  1N71 A;  2PR1 A;  2A4N A;  4R3L A;  3I9S A;  4F6A A;  2JDD A;  3R9E A;  1L0C A;  4PV6 A;  4CRZ B;  1P0H A;  4KUA A;  1NSL A;  3R96 A;  2WPX A;  2EVN A;  2JDC A;  3DNS A;  1IYL A;  3S6F A;  3DR8 A;  5H86 A;  2J8N A;  2PDO A;  4R57 A;  3W91 A;  1S7N A;  3C26 A;  4JXQ A;  2ATR A;  4UWI A;  4YFJ A;  1BO4 A;  1P4N A;  3FIX A;  2B4D B;  4B5P B;  2PSW A;  1RO5 A;  2ZPA A;  4U5Y A;  1YVK A;  4H6Z A;  4QVT A;  1YGH A;  1M4D A;  2VXK A;  4MI4 A;  1B6B A;  2PC1 A;  3GYA A;  4PSW A;  4M3S A;  5KTD A;  2J8M A;  4FD5 A;  4MBU A;  1QSM A;  3T9Y A;  2Z10 A;  4AG7 A;  3I3G A;  4XNH C;  2B58 A;  3V8I A;  2G3A A;  2H5M A;  2ZW6 A;  4ZBG A;  1MJA A;  4NSQ A;  2VBQ A;  4QB9 A;  3H4Q A;  3TT2 A;  2K5T A;  1J4J A;  4Y49 B;  3D2P A;  2P6E A;  1Z4R A;  4I49 A;  1M4G A;  2QIR A;  4EVY A;  5H84 A;  3SXO A;  3EO4 A;  4JJX A;  2R8V A;  3PGP A;  4U9Y A;  5GCN A;  1LRZ A;  1V0C A;  4AG9 A;  2HV2 A;  4ONU A;  3ZZI A;  3W6S A;  2HQY A;  4YRH A;  4AVB A;  1Z4E A;  4H89 A;  3FNC A;  3TOB A;  2EUI A;  4HNX B;  3FXT A;  2Q0Y A;  3EXN A;  4LX9 A;  3PP9 A;  4QUS A;  3BJ8 A;  2ZW4 A;  2JEV A;  3N7Z A;  4CAW A;  1MJ9 A;  2PQ8 A;  3IGR A;  2OB0 A;  1VKC A;  1VHS A;  5C88 A;  3OWC A;  4QBJ A;  1K4J A;  5DWN A;  5JPH A;  4XPD C;  1KUV A;  4KOV A;  2AJ6 A;  3T90 A;  4U9Z A;  4LUA A;  1U6M A;  4XPL A;  4CS0 B;  2GAN A;  4PK2 A;  2OU2 A;  4DNC A;  4RI1 A;  5HMN A;  3D3S A;  2D4O A;  4NF1 A;  2R7H A;  2G3T A;  5C82 A;  2PR8 A;  1XEB A;  2BEI A;  2Q44 A;  3QB8 A;  1XE4 A;  3FRM A;  4KOU A;  4MHD A;  4PSX A;  4KOY A;  1Y9K A;  1NMT A;  3TCV A;  2FXF A;  5F46 A;  5EC4 A;  1Z9U A;  2VZZ A;  3CXP A;  1SQH A;  3EC4 A;  3EY5 A;  4JD6 A;  4AVC A;  1R57 A;  2RC4 A;  4BMH A;  5ISV A;  5EBV A;  1S7L A;  1YX0 A;  4MJ8 A;  4B5O A;  4PK3 A;  4KOR A;  4R87 A;  4JXR A;  4OAE A;  2C27 A;  2Q4V A;  2Z0Z A;  3SHP A;  2O28 A;  2P0W A;  1KUX A;  4KVX A;  1FY7 A;  2JLM A;  2BUE A;  3LD2 A;  2ARH A;  3G8W A;  2Y0M A;  4E0A A;  2VI7 A;  1QSO A;  4OAD A;  3VWD A;  2FS5 A;  4UBR A;  2WPW A;  2FT0 A;  3JUW A;  3R1K A;  4L89 A;  4NCZ A;  4UA3 A;  2B5G A;  5CNP A;  2Q4Y A;  5HH1 A;  2FL4 A;  3K9U A;  1BOB A;  4KVM E;  4FD7 A;  3UY5 A;  2Q04 A;  2GIV A;  5KTA A;  4KZT A;  2VEZ A;  4K30 A;  4QC6 A;  2R1I A;  2Q7B A;  1Y9W A;  2CNT A;  3B8G A;  3F5B A;  4L8A A;  4J3G A;  2VZY A;  1Q2Y A;  3KKW A;  2FCK A;  4CAV A;  2BL1 A;  2ZW7 A;  4E8O A;  3P2F A;  4X5K A;  2FE7 A;  1IYK A;  3DDD A;  1OZP A;  3TTH A;  1MK4 A;  3GY9 A;  1CJW A;  5I0C A;  1PUA A;  3FBU A;  2D4P A;  4R9M A;  1QSN A;  3E0K A;  4XPK A;  3WR7 A;  2KCW A;  1M44 A;  4HKF A;  2CNM A;  3DR6 A;  1RXT A;  1PU9 A;  3G3S A;  4KLV A;  3D2M A;  2B5G B;  4IUS A;  3RYO A;  5IX3 A;  2BSW A;  2J8R A;  5DWM A;  3TE4 A;  1MJB A;  2OH1 A;  1YK3 A;  5FVJ A;  4KLW A;  1TIQ A;  2R98 A;  4MY0 A;  2VQY A;  2FIA A;  2ZXV A;  4E2A A;  5F48 A;  1XIX A;  1Q2D A;  3BJ7 A;  4KOX A;  1IID A;  2B3U A;  3CXQ A;  4CRY B;  4XNH B;  2OZU A;  2P6G A;  4FD6 A;  5KTC A;  3DSB A;  5F49 A;  2FSR A;  1WK4 A;  3S6G A;  4AVA A;  4HNY B;  4JWP A;  3LOD A;  4UWJ A;  1QST A;  3P2H A;  5J8C A;  1I12 A;  1KUY A;  1YVO A;  1I21 A;  1S7K A;  2I79 A;  4R3K A;  3D8P A;  2NMT A;  3R9G A;  3TO7 A;  3S6K A;  1IIC A;  5F47 A;  1ON0 A;  1S5K A;  4M85 A;  1KZF A;  3CXS A;  2PRB A;  1GHE A;  3R95 A;  5IV0 A;  3GKR A;  2OZG A;  2REF A;  3SXN A;  4KVO E;  3NE7 A;  3R9F A;  2P6F A;  3TO6 A;  2B4B A;  1M1D A;  4OLL A;  1YLE A;  1WWZ A;  1QSR A;  4GS4 A;  4AB7 A;  3VWE A;  2HUZ A;  4II9 A;  3S6H A;  3TFY A;  4YGO A;  1Q2C A;  1B87 A;  3F0A A;  4XPD B;  3ZJ0 A;  2QML A;  4NEX A;  2IL4 A;  2GE3 A;  4JLY A;  3FYN A;  2F5I A;  2B3V A;  1XF8 A;  3JVN A;  1IB1 E;  4IF5 A;  3PZJ A;  4H6U A;  4F0Y A;  2QEC A;  3MGD A;  5J8F A;  4FD4 A;  3F8K A;  4RS2 A;  1S7F A;  2FIW A;  4KUB A;  2OZH A;  5JQ4 A;  1YRE A;  2Z11 A;  5IB0 A;  1I1D A;  2ZW5 A;  3IWG A;  3QAH A;  2X7B A;  2CNS A;  4CAX A;  4Y49 C;  1CM0 A;  4ORF A;  5E96 A;  3FB3 A;  2I00 A;  4KOT A;  3W6X A;  1S60 A;  4NXY A;  2B4D A;  4B5P A;  4KOS A; 
#chains in the Genus database with same CATH topology
 2DXQ A;  3D68 A;  1NE9 A;  5LRG A;  4JYW A;  2Z3K A;  2Q51 A;  2PE3 A;  1HEE A;  1XMT A;  2XEI A;  1OBR A;  2G0B A;  4UF4 A;  2CY2 A;  2OOT A;  2HC9 A;  1YLO A;  1DTD A;  3WAB A;  4HNW B;  1S3Z A;  2PJ5 A;  3BLN A;  1R43 A;  2Q7S A;  1Y0Y A;  4PXC A;  5F09 A;  3IJ3 A;  3DLJ A;  4OC5 A;  1Y7R A;  3EFA A;  2PJ7 A;  2CF4 A;  2PJ3 A;  1X10 A;  4F9U A;  2AE6 A;  2GLJ A;  3TOA A;  2REE A;  4KOW A;  4MY3 A;  1YR0 A;  4P4J A;  1M4I A;  2RB7 A;  3TO9 A;  1UFH A;  2YND A;  4P4E A;  1N71 A;  2PR1 A;  2YNE A;  1Z8X A;  2A4N A;  4R3L A;  2EWB A;  3VAR A;  4A33 A;  5J1Q A;  5LRJ A;  2AFS A;  3I9S A;  4F6A A;  4IK2 A;  2JDD A;  3JRU A;  3PBE A;  2DF5 A;  4OME A;  3R9E A;  3RO0 A;  1L0C A;  4X2T A;  3BI0 A;  4PV6 A;  4UEF A;  1HDQ A;  4CRZ B;  1P0H A;  3KR5 A;  4YWY A;  4KUA A;  1NSL A;  4PPZ A;  2XEG A;  2PRQ A;  1AMP A;  3R96 A;  2WPX A;  1UWY A;  2EVN A;  2JDC A;  3DNS A;  3MN8 A;  4NGN A;  3FF3 A;  1IYL A;  4CYQ A;  3KR4 A;  3S6F A;  2ZEM A;  3DR8 A;  5H86 A;  2J8N A;  2PDO A;  3KHX A;  2POK A;  4R57 A;  4MHP A;  5AG7 A;  3W91 A;  4M6I A;  1S7N A;  1XBU A;  3C26 A;  4JXQ A;  3I1U A;  2ATR A;  1FNO A;  4UWI A;  4YFJ A;  1BO4 A;  2WZN A;  1P4N A;  2Z3L A;  3FIX A;  3NA6 A;  2B4D B;  4B5P B;  1LOK A;  2PSW A;  1RO5 A;  2ZPA A;  2C6G A;  4U5Y A;  1YVK A;  5JH9 A;  4H6Z A;  3GUX A;  4QVT A;  1CG2 A;  4C2Y A;  4BD9 A;  1YGH A;  1M4D A;  2VXK A;  4UEZ A;  3T8W A;  4MI4 A;  3BXM A;  4PQA A;  1PCA A;  1B6B A;  2PC1 A;  3CPX A;  3PB8 X;  4NGQ A;  3GYA A;  5LYI A;  2QYV A;  2BOA A;  4PSW A;  4M3S A;  1EE3 P;  5KTD A;  1CBX A;  2J8M A;  4FD5 A;  4MBU A;  1QSM A;  4UFW A;  4OC0 A;  5K8P A;  3LAC A;  2DPS A;  2Z10 A;  3D7D A;  4JZ0 A;  3T9Y A;  4CGP A;  5G22 A;  4AG7 A;  3PB9 X;  3I3G A;  4XNH C;  1M4L A;  2B58 A;  3V8I A;  4C7H A;  2G3A A;  2H5M A;  2ZW6 A;  4ZBG A;  5BWA B;  1MJA A;  4NSQ A;  5DS0 A;  2VBQ A;  4QB9 A;  3H4Q A;  5HVG A;  3TT2 A;  2K5T A;  3D4U A;  1LAM A;  1J4J A;  4Y49 B;  2DPT A;  2ZEO A;  3D2P A;  1F2P A;  3KGQ A;  4FAI A;  4UIA A;  2P6E A;  3B35 A;  4MXU A;  1Z4R A;  4Q7A A;  4BIN A;  1LAN A;  4I49 A;  4UCM A;  2F7V A;  1M4G A;  4WJB A;  2QIR A;  4EVY A;  2WSA A;  3SI1 A;  3GLJ A;  4NJR A;  5H84 A;  3SXO A;  3EO4 A;  2Q43 A;  4JJX A;  2R8V A;  3PGP A;  2JEW A;  4U9Y A;  4KOS A;  5GCN A;  1V0C A;  1LRZ A;  3SJF A;  4AG9 A;  2HV2 A;  4KS9 A;  4ONU A;  3ZZI A;  4FBE A;  3W6S A;  4NFR A;  2HQY A;  4CAF A;  4YRH A;  4AVB A;  1Z4E A;  4H89 A;  3FNC A;  3TOB A;  4O23 A;  2EUI A;  4HNX B;  4C68 A;  2GRE A;  3FXT A;  4EFD A;  2Q0Y A;  4NJQ A;  5AG6 A;  1A2Z A;  3EXN A;  4UFX A;  4LX9 A;  3PP9 A;  5HVF A;  4KSF A;  2Z3M A;  4LQ6 A;  3BI1 A;  3BJ8 A;  4QUS A;  1TKJ A;  5THW A;  4A37 A;  4ZGY B;  1YME A;  2HB6 A;  3CDX A;  2AFW A;  2C6P A;  2ZW4 A;  3FH4 A;  2JEV A;  2QVP A;  3IU2 A;  1MJ9 A;  3N7Z A;  4CAW A;  3SJX A;  1YQE A;  3JTK A;  2PQ8 A;  3IGR A;  3HUV A;  1ZG7 A;  2OB0 A;  1VKC A;  2JBJ A;  3FED A;  1VHS A;  2IQ6 A;  4OIW A;  5C88 A;  2V8G A;  2PJ2 A;  3OWC A;  4QBJ A;  1ZLI A;  4MFJ A;  1K4J A;  5DWN A;  2XEF A;  3V38 A;  2PJA A;  4NGP A;  5JPH A;  3PBB A;  1CP6 A;  1F2O A;  5A28 A;  1X12 A;  2Z3O A;  4CPA A;  2YNC C;  4XPD C;  4CYO A;  4MRI A;  1KUV A;  1XJO A;  3KQX A;  2AJ6 A;  4KOV A;  3D7G A;  4YU9 A;  3T90 A;  4B6Z A;  4U9Z A;  5HXD A;  1CX8 A;  1BLL E;  4LUA A;  1U6M A;  4XPL A;  3KQZ A;  3B3V A;  3PEI A;  4CS0 B;  1RTQ A;  2GAN A;  4PK2 A;  2OU2 A;  4DNC A;  1KWM A;  5G21 A;  4RI1 A;  5HMN A;  4R6T A;  1XFO A;  3D3S A;  4C2X A;  8CPA A;  2D4O A;  1CPS A;  5HVH A;  4MHZ A;  4NF1 A;  2R7H A;  2G3T A;  2PJ8 A;  5LYL A;  5C82 A;  1IY7 A;  2PR8 A;  1XEB A;  4B10 A;  2Q4Z A;  2BEI A;  4CGN A;  2Q44 A;  3L2N A;  3QB8 A;  1XE4 A;  4B12 A;  3NH4 A;  3FRM A;  2OR4 A;  4KOU A;  1ZO0 A;  4MHD A;  4PSX A;  4KOY A;  1R3N A;  1Y9K A;  2V77 A;  1NMT A;  2ZOF A;  3TCV A;  2FXF A;  3WC6 A;  5F46 A;  5EC4 A;  1Z9U A;  2VZZ A;  4OC1 A;  3CXP A;  4C7I A;  4Z65 A;  2GFQ A;  4PXE A;  2VL1 A;  1SQH A;  4X8I A;  3EC4 A;  5LYF A;  3KAS A;  1H8L A;  2PJ9 A;  2V8D A;  3N5F A;  3D7H A;  3EY5 A;  3VAT A;  4TNU A;  4MCS A;  3B3S A;  2WUU A;  4JD6 A;  4AVC A;  5K8M A;  1R57 A;  3K2K A;  2RC4 A;  3IWW A;  4Q38 A;  2EK8 A;  3KL9 A;  4OC3 A;  4BMH A;  5ISV A;  2Z3P A;  1S7L A;  5EBV A;  1YX0 A;  3NFZ A;  2EBJ A;  1JQG A;  4MJ8 A;  5EMI A;  4F8Z A;  2I3C A;  4PK3 A;  4B5O A;  5AG4 A;  3WC7 A;  4KOR A;  3DGV A;  4R87 A;  4A2Z A;  4JXR A;  3FX6 A;  4OAE A;  1BAV A;  2C27 A;  2Q4V A;  2Z0Z A;  3SHP A;  6CPA A;  3PRT A;  5G1Z A;  4ZX8 A;  4EWT A;  4GXH A;  4A32 A;  2O28 A;  2P0W A;  1KUX A;  1Z8L A;  2IJZ A;  2ZEN A;  4P4F A;  2V8H A;  4KVX A;  1FY7 A;  2F8H A;  2JLM A;  3RAM A;  4ZI6 A;  5JM6 A;  2BUE A;  3LD2 A;  5IB9 A;  2ARH A;  3S9M A;  3D7F A;  4F0X A;  3G8W A;  2Y0M A;  5JGF A;  2PJ1 A;  1VHO A;  4E0A A;  4M6G A;  1YW6 A;  1QSO A;  2VI7 A;  4OAD A;  5A27 A;  5I4M A;  2ZOG A;  4A95 A;  4F9V A;  1TXR A;  7CPA A;  1Y7E A;  2FS5 A;  4UBR A;  3VWD A;  2WPW A;  3K9T A;  3LMS A;  1QQ9 A;  2FT0 A;  3JUW A;  3R1K A;  4L89 A;  3B2Y A;  4NCZ A;  4OC4 A;  2EK9 A;  4UA3 A;  4BBH A;  2B5G A;  5CNP A;  4PXB A;  3CT9 A;  2Q4Y A;  5HH1 A;  3QNV A;  3WC5 A;  2FL4 A;  1Q7L A;  4UFV A;  2WYR A;  3K9U A;  3S9N A;  2ABZ A;  2RFH A;  4NGT A;  4ZY1 A;  1BOB A;  4KVM E;  2AFO A;  4NGM A;  4FD7 A;  3TC8 A;  3UY5 A;  2CIJ A;  2Q04 A;  4HPS A;  2GIV A;  3H8F A;  5KTA A;  4KZT A;  3SI2 A;  2VEZ A;  4K30 A;  1AYE A;  4FUU A;  3SJE A;  4DYO A;  2C1C A;  3SJG A;  1TKH A;  1VHE A;  3MRU A;  4QC6 A;  1ZG8 A;  4K3N A;  2R1I A;  2Q7B A;  4IHM A;  1YSJ A;  3B3T A;  4MFK A;  1Y9W A;  2CNT A;  3B8G A;  3F5B A;  4L8A A;  4J3G A;  2VZY A;  4C2Z A;  1YW4 A;  2PVV A;  1Q2Y A;  3KKW A;  2FCK A;  3PFO A;  4RN7 A;  5ELY A;  4CAV A;  4A30 A;  4CYP A;  2BL1 A;  4ZX9 A;  4MFQ A;  1BPN A;  2ZW7 A;  4E8O A;  1ELM P;  2QJ8 A;  1FT7 A;  4W9Y A;  2ZEE A;  3P2F A;  4X5K A;  1NSA A;  2FE7 A;  3FJU A;  1IYK A;  3DDD A;  1OZP A;  3TTH A;  4R7M A;  4UCN A;  1MK4 A;  2PCU A;  3TX8 A;  4P4B A;  3GY9 A;  2YGW A;  1CJW A;  3BHX A;  1IGB A;  5I0C A;  5AGE A;  1PUA A;  2PIZ A;  3H8G A;  4EME A;  2D4P A;  1XRY A;  1BPM A;  2EO8 A;  1QSN A;  1LCP A;  2O4H A;  3IC1 A;  3E0K A;  3ISZ A;  3A9L A;  4R9M A;  4XPK A;  4MFL A;  4ZYQ A;  3WR7 A;  2ANP A;  2KCW A;  1M44 A;  3ISX A;  4P6Y A;  3QAY A;  2ZEL A;  2J9A A;  3NH5 A;  4HKF A;  4B14 A;  2CNM A;  1ZLH A;  3DR6 A;  3FEC A;  1XMB A;  1RXT A;  4PXD A;  1PU9 A;  2IMO A;  3G3S A;  4KLV A;  2CXA A;  2B5G B;  3D2M A;  4IUS A;  5D29 A;  3KHZ A;  3RYO A;  5IX3 A;  2BSW A;  2J8R A;  5DWM A;  3TE4 A;  1IU8 A;  1MJB A;  3WT4 A;  4MCR A;  2OH1 A;  2PVW A;  1YK3 A;  3LWU A;  1XOV A;  5FVJ A;  4KLW A;  3VH9 A;  1TIQ A;  2R98 A;  2CTC A;  1ARM A;  4MY0 A;  3HLP A;  2PJ6 A;  2ZED A;  3PB4 X;  3RZA A;  4MFZ A;  2VQY A;  2FIA A;  4OID A;  2ZXV A;  4E2A A;  3D67 A;  4P4D A;  5LYD A;  3KZW A;  4OKO A;  5F48 A;  1XIX A;  1Q2D A;  3BJ7 A;  4KOX A;  2CTB A;  4WWV A;  2DEA A;  4RUH A;  3H5Z A;  1IID A;  2B3U A;  1ELL P;  3CXQ A;  4DJL A;  4CRY B;  4XNH B;  4M6H A;  1DE4 C;  2OZU A;  2P6G A;  3IWE A;  2ODF A;  4FD6 A;  4B13 A;  1TKF A;  4LQG A;  5KTC A;  3DSB A;  5F49 A;  2FSR A;  1F57 A;  4MMO A;  1VGY A;  1WK4 A;  3S6G A;  4AVA A;  2YNC A;  4HNY B;  4CGL A;  3IO1 A;  4JWP A;  3LOD A;  4UWJ A;  5CPA A;  1QST A;  2XEJ A;  3P2H A;  2BCO A;  1TF9 A;  1PYT B;  5J8C A;  2AFX A;  4X3R A;  2PJC A;  3FEE A;  4MHN A;  2FVG A;  4P44 A;  2AFM A;  3PFE A;  2ZEH A;  1I12 A;  1KUY A;  1YVO A;  1I21 A;  2ZEP A;  1S7K A;  2I79 A;  4R3K A;  3D8P A;  4R8F A;  4GM5 A;  1CPX A;  2NMT A;  2PJ0 A;  3R9G A;  3TO7 A;  4CYN A;  3S6K A;  2AFU A;  1Y0R A;  1IIC A;  1ARL A;  4MHY A;  5F47 A;  1LAP A;  1ON0 A;  1S5K A;  3FMC A;  4M85 A;  5K8N A;  3PB7 X;  4ZY0 A;  4AXV A;  4UCP A;  1KZF A;  2PJB A;  2ZEF A;  3CXS A;  2PRB A;  2GLF A;  1VIX A;  3IEH A;  1Z8W A;  1GHE A;  3R95 A;  4IAV A;  5IV0 A;  3GKR A;  2ZEG A;  3GB0 A;  2OZG A;  2REF A;  5AG5 A;  3V7Z A;  1JWQ A;  1IOI A;  3SXN A;  4KVO E;  3NE7 A;  3R9F A;  3B7I A;  2P6F A;  3TO6 A;  2B4B A;  2C6C A;  1M1D A;  4OP4 A;  3D66 A;  4OLL A;  4UEE A;  4CAE A;  4NGS A;  5G20 A;  4A94 A;  3PB6 X;  4H2K A;  1YLE A;  1WWZ A;  1QSR A;  4GS4 A;  4AB7 A;  3VWE A;  2HUZ A;  4P45 A;  4A39 A;  4II9 A;  3IIB A;  3S6H A;  3TFY A;  4YGO A;  4MFP A;  2AFZ A;  3GIU A;  3CZX A;  1Q2C A;  1LFW A;  3CPA A;  1B87 A;  3B3C A;  3NE8 A;  4MCP A;  5CBM A;  3F0A A;  4XPD B;  2V8V A;  4B11 A;  2G9D A;  3NH8 A;  3ZJ0 A;  3S9L A;  2QML A;  4NEX A;  2IL4 A;  2GE3 A;  3H8E A;  4JLY A;  3FYN A;  4OC2 A;  2O53 A;  2F5I A;  2B3V A;  4R76 A;  4P4I A;  2Z3N A;  1XF8 A;  3JVN A;  3SI0 A;  1IB1 E;  3FVL A;  2GU2 A;  3B3W A;  1TF8 A;  4NGR A;  4IF5 A;  4ZY2 A;  3PZJ A;  5K8O A;  4ONW A;  4H6U A;  1CP7 A;  3KI9 A;  4FWU A;  4A38 A;  1Z2L A;  2BO9 A;  2QEC A;  3MGD A;  4KSI A;  4F0Y A;  5J8F A;  5LRK A;  4FD4 A;  3F8K A;  4RS2 A;  1S7F A;  2PJ4 A;  1ZG9 A;  2FIW A;  1HDU A;  4KUB A;  5D8N A;  2OZH A;  5JQ4 A;  1YRE A;  2Z11 A;  4UIB A;  5IB0 A;  4KSA A;  1AUG A;  1I1D A;  2ZW5 A;  3IWG A;  3RNZ A;  2JBK A;  3QAH A;  1Z8T A;  4Q36 A;  2X7B A;  2CNS A;  2NSM A;  2NYQ A;  4A31 A;  4CAX A;  1Z5R A;  4DUK A;  4Y49 C;  1CM0 A;  4ORF A;  3RBU A;  4CGM A;  4G1P A;  3FB3 A;  5E96 A;  4TWE A;  2I00 A;  4KOT A;  2PIY A;  3W6X A;  4CGO A;  1S60 A;  3IFE A;  1QMU A;  4MCQ A;  4NXY A;  1IOF A;  2B4D A;  4B5P A;  1GYT A;  4P10 A;  3IU1 A;  3FBU A; 
#chains in the Genus database with same CATH homology
 2DXQ A;  1NE9 A;  2Z3K A;  1XMT A;  2G0B A;  2CY2 A;  4HNW B;  1S3Z A;  3BLN A;  1Y7R A;  3EFA A;  2AE6 A;  3TOA A;  2REE A;  4KOW A;  4MY3 A;  1YR0 A;  1M4I A;  3TO9 A;  1UFH A;  2YND A;  1N71 A;  2PR1 A;  2YNE A;  2A4N A;  4R3L A;  4A33 A;  3I9S A;  4F6A A;  2JDD A;  3R9E A;  1L0C A;  4PV6 A;  4CRZ B;  1P0H A;  4KUA A;  1NSL A;  3R96 A;  2WPX A;  2EVN A;  2JDC A;  3DNS A;  1IYL A;  4CYQ A;  3S6F A;  3DR8 A;  5H86 A;  2J8N A;  2PDO A;  4R57 A;  5AG7 A;  3W91 A;  1S7N A;  3C26 A;  4JXQ A;  2ATR A;  4UWI A;  4YFJ A;  1BO4 A;  1P4N A;  2Z3L A;  3FIX A;  2B4D B;  4B5P B;  2PSW A;  1RO5 A;  2ZPA A;  4U5Y A;  1YVK A;  4H6Z A;  4QVT A;  4C2Y A;  1YGH A;  1M4D A;  2VXK A;  4MI4 A;  1B6B A;  2PC1 A;  3GYA A;  4PSW A;  4M3S A;  5KTD A;  2J8M A;  4FD5 A;  4MBU A;  1QSM A;  4UFW A;  2DPS A;  2Z10 A;  3T9Y A;  4CGP A;  5G22 A;  4AG7 A;  3I3G A;  4XNH C;  2B58 A;  3V8I A;  4C7H A;  2G3A A;  2H5M A;  2ZW6 A;  4ZBG A;  5BWA B;  1MJA A;  4NSQ A;  2VBQ A;  4QB9 A;  3H4Q A;  3TT2 A;  2K5T A;  1J4J A;  4Y49 B;  2DPT A;  3D2P A;  2P6E A;  1Z4R A;  4UCM A;  4I49 A;  1M4G A;  2QIR A;  4EVY A;  2WSA A;  5H84 A;  3SXO A;  3EO4 A;  4JJX A;  2R8V A;  3PGP A;  4U9Y A;  4KOS A;  5GCN A;  1LRZ A;  1V0C A;  4AG9 A;  2HV2 A;  4KS9 A;  4ONU A;  3ZZI A;  3W6S A;  2HQY A;  4CAF A;  4YRH A;  4AVB A;  1Z4E A;  4H89 A;  3FNC A;  3TOB A;  2EUI A;  4HNX B;  4C68 A;  3FXT A;  2Q0Y A;  5AG6 A;  3EXN A;  4UFX A;  4LX9 A;  3PP9 A;  4KSF A;  2Z3M A;  4QUS A;  3BJ8 A;  4ZGY B;  2ZW4 A;  2JEV A;  3N7Z A;  3IU2 A;  1MJ9 A;  4CAW A;  3JTK A;  2PQ8 A;  3IGR A;  2OB0 A;  1VKC A;  1VHS A;  5C88 A;  3OWC A;  4QBJ A;  4MFJ A;  1K4J A;  5DWN A;  5JPH A;  5A28 A;  2Z3O A;  2YNC C;  4XPD C;  4CYO A;  1KUV A;  4KOV A;  2AJ6 A;  3T90 A;  4U9Z A;  4LUA A;  1U6M A;  4XPL A;  4CS0 B;  2GAN A;  4PK2 A;  2OU2 A;  4DNC A;  5G21 A;  4RI1 A;  5HMN A;  4C2X A;  3D3S A;  2D4O A;  4NF1 A;  2R7H A;  2G3T A;  5C82 A;  2PR8 A;  1XEB A;  4B10 A;  2BEI A;  4CGN A;  2Q44 A;  3QB8 A;  1XE4 A;  4B12 A;  3FRM A;  4KOU A;  1ZO0 A;  4MHD A;  4PSX A;  4KOY A;  1Y9K A;  1NMT A;  3TCV A;  2FXF A;  5F46 A;  5EC4 A;  1Z9U A;  2VZZ A;  4C7I A;  3CXP A;  1SQH A;  3EC4 A;  3EY5 A;  2WUU A;  4JD6 A;  4AVC A;  1R57 A;  4Q38 A;  2RC4 A;  4BMH A;  5ISV A;  2Z3P A;  1S7L A;  5EBV A;  1YX0 A;  4MJ8 A;  4B5O A;  4PK3 A;  5AG4 A;  4KOR A;  4R87 A;  4A2Z A;  4JXR A;  4OAE A;  2C27 A;  2Q4V A;  2Z0Z A;  3SHP A;  5G1Z A;  4A32 A;  2O28 A;  2P0W A;  1KUX A;  4KVX A;  1FY7 A;  2JLM A;  2BUE A;  3LD2 A;  2ARH A;  4F0X A;  3G8W A;  2Y0M A;  4E0A A;  2VI7 A;  1QSO A;  4OAD A;  5A27 A;  4A95 A;  3VWD A;  2FS5 A;  4UBR A;  2WPW A;  2FT0 A;  3JUW A;  3R1K A;  4L89 A;  4NCZ A;  4UA3 A;  4BBH A;  2B5G A;  5CNP A;  2Q4Y A;  5HH1 A;  2FL4 A;  4UFV A;  3K9U A;  1BOB A;  4KVM E;  4FD7 A;  3UY5 A;  2Q04 A;  2GIV A;  5KTA A;  4KZT A;  2VEZ A;  4K30 A;  4QC6 A;  2R1I A;  2Q7B A;  4MFK A;  1Y9W A;  2CNT A;  3B8G A;  3F5B A;  4L8A A;  4J3G A;  2VZY A;  4C2Z A;  1Q2Y A;  3KKW A;  2FCK A;  4CAV A;  4CYP A;  4A30 A;  2BL1 A;  4MFQ A;  2ZW7 A;  4E8O A;  3P2F A;  4X5K A;  2FE7 A;  1IYK A;  3DDD A;  1OZP A;  3TTH A;  4UCN A;  1MK4 A;  3GY9 A;  2YGW A;  1CJW A;  5I0C A;  5AGE A;  1PUA A;  2D4P A;  4R9M A;  1QSN A;  3E0K A;  4XPK A;  3A9L A;  4MFL A;  3WR7 A;  2KCW A;  1M44 A;  4HKF A;  4B14 A;  2CNM A;  3DR6 A;  1RXT A;  1PU9 A;  3G3S A;  4KLV A;  2CXA A;  2B5G B;  3D2M A;  4IUS A;  3RYO A;  5IX3 A;  2BSW A;  2J8R A;  5DWM A;  3TE4 A;  1MJB A;  2OH1 A;  1YK3 A;  5FVJ A;  4KLW A;  1TIQ A;  2R98 A;  4MY0 A;  4MFZ A;  2VQY A;  2FIA A;  2ZXV A;  4E2A A;  5F48 A;  1XIX A;  1Q2D A;  3BJ7 A;  4KOX A;  3H5Z A;  1IID A;  2B3U A;  3CXQ A;  4CRY B;  4XNH B;  2OZU A;  2P6G A;  3IWE A;  4FD6 A;  4B13 A;  5KTC A;  3DSB A;  5F49 A;  2FSR A;  1WK4 A;  3S6G A;  4AVA A;  2YNC A;  4HNY B;  4CGL A;  4JWP A;  3LOD A;  4UWJ A;  1QST A;  3P2H A;  5J8C A;  1I12 A;  1KUY A;  1YVO A;  1I21 A;  1S7K A;  2I79 A;  4R3K A;  3D8P A;  2NMT A;  3R9G A;  3TO7 A;  4CYN A;  3S6K A;  1IIC A;  5F47 A;  1ON0 A;  1S5K A;  4M85 A;  4UCP A;  1KZF A;  3CXS A;  2PRB A;  1GHE A;  3R95 A;  5IV0 A;  3GKR A;  2OZG A;  2REF A;  5AG5 A;  3SXN A;  4KVO E;  3NE7 A;  3R9F A;  2P6F A;  3TO6 A;  2B4B A;  1M1D A;  4OLL A;  4CAE A;  5G20 A;  1YLE A;  1WWZ A;  1QSR A;  4GS4 A;  4AB7 A;  3VWE A;  2HUZ A;  4II9 A;  3S6H A;  3TFY A;  4YGO A;  4MFP A;  1Q2C A;  1B87 A;  3F0A A;  4XPD B;  4B11 A;  3ZJ0 A;  2QML A;  4NEX A;  2IL4 A;  2GE3 A;  4JLY A;  3FYN A;  2F5I A;  2B3V A;  2Z3N A;  1XF8 A;  3JVN A;  1IB1 E;  4IF5 A;  3PZJ A;  4H6U A;  4F0Y A;  2QEC A;  3MGD A;  5J8F A;  4FD4 A;  3F8K A;  4RS2 A;  1S7F A;  2FIW A;  4KUB A;  2OZH A;  5JQ4 A;  1YRE A;  2Z11 A;  5IB0 A;  4KSA A;  1I1D A;  2ZW5 A;  3IWG A;  3QAH A;  4Q36 A;  2X7B A;  2CNS A;  4A31 A;  4CAX A;  4Y49 C;  1CM0 A;  4ORF A;  4CGM A;  5E96 A;  3FB3 A;  2I00 A;  4KOT A;  3W6X A;  4CGO A;  1S60 A;  4NXY A;  2B4D A;  4B5P A;  3IU1 A;  3FBU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...