2VXKA

Structural comparison between aspergillus fumigatus and human gna1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
165
structure length
165
Chain Sequence
b'ENTPLFSPSLISPDVLAVLPADYTIRPLCRSDYKRGYLDVLRVLTTVGDINEEQWNSRYEWIRARSDEYYLLVVCDGEGRIVGTGSLVVERKFIHSLGMVGHIEDIAVEKGQQGKKLGLRIIQALDYVAEKVGCYKTILDCSEANEGFYIKCGFKRAGLEMAHYY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSAMINE 6-PHOSPHATE ACETYLTRANSFERASE
publication title Structural and Kinetic Differences between Human and Aspergillus Fumigatus D-Glucosamine-6- Phosphate N-Acetyltransferase.
pubmed doi rcsb
source organism Aspergillus fumigatus
molecule tags Transferase
total genus 46
structure length 165
sequence length 165
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2008-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2vxkA01
5C88A 1XE4A 4KZTA 1BOBA 2K5TA 5CNPA 3DSBA 1YVOA 1I12A 1CJWA 4R9MA 3UY5A 1PUAA 1P0HA 2REEA 4ORFA 2VI7A 4XPDB 5IX3A 3W6SA 3TO7A 2NMTA 4NCZA 3F8KA 3S6HA 5JPHA 2I79A 4XNHB 3PP9A 4AG9A 4H6UA 4KVME 1Z4RA 2B4DB 2FL4A 2Z10A 4OLLA 5DWMA 3NE7A 4FD7A 1OZPA 4AVAA 2ZW7A 4H6ZA 4KUBA 4KVOE 2P6GA 4IUSA 4OADA 4H89A 4LX9A 4XPKA 1RXTA 3D3SA 3S6GA 1IYLA 4F0YA 4OAEA 4MJ8A 2G3AA 2I00A 3BJ8A 4FD6A 2B5GA 4NXYA 2FIWA 2R1IA 3DR8A 3QB8A 1MK4A 2QIRA 1XMTA 4YRHA 3KKWA 4F6AA 4U9YA 3S6FA 2FIAA 4I49A 3R9FA 4PK3A 3G8WA 4B5OA 4R3LA 2X7BA 5IV0A 4DNCA 2FXFA 5F49A 3FYNA 3VWDA 5F47A 2OZGA 3V8IA 1I21A 3TO9A 4HNXB 3I9SA 5H86A 3WR7A 2FCKA 3TOBA 1B87A 1S3ZA 1MJAA 3F5BA 3VWEA 5JQ4A 3GYAA 5E96A 4CS0B 4GS4A 1IIDA 4PV6A 4IF5A 2ARHA 2VZYA 3G3SA 3P2FA 2B5GB 3FXTA 1XF8A 1XEBA 3FB3A 2FE7A 4E0AA 4E8OA 3N7ZA 3R95A 2VQYA 2J8NA 1B6BA 4KOSA 4JD6A 1MJ9A 5DWNA 2JDDA 1YX0A 3EY5A 1Y7RA 4XPDC 3TOAA 1KZFA 1IB1E 4QB9A 2BUEA 2OZHA 5H84A 3T9YA 2GIVA 3IGRA 2WPXA 2Q0YA 2Q4YA 4JLYA 2PQ8A 4NF1A 3T90A 4MY3A 4XNHC 4Y49B 2ZW5A 1L0CA 2D4PA 2J8MA 1Q2CA 4MHDA 4X5KA 1Q2DA 2ZXVA 3PGPA 4AVBA 3DDDA 2Z11A 2VZZA 2BEIA 4U9ZA 4EVYA 3P2HA 2ZW6A 2B3UA 1MJBA 4QBJA 4CRYB 3I3GA 4UBRA 3TCVA 4J3GA 2CNMA 2ZPAA 4AG7A 4FD5A 2IL4A 4M3SA 5FVJA 1U6MA 2R98A 1QSMA 5HH1A 1WK4A 4KORA 3TE4A 3EO4A 2J8RA 4UWIA 4JXQA 2OH1A 2Q44A 4HNWB 3R9GA 4QVTA 3QAHA 4CRZB 1Y9WA 1UFHA 4FD4A 1J4JA 2A4NA 3OWCA 2AJ6A 2PR8A 1YLEA 1V0CA 3D8PA 3SHPA 3IWGA 3S6KA 4NSQA 1NMTA 2OZUA 3B8GA 2REFA 3LODA 4II9A 1KUXA 2AE6A 2PRBA 5F46A 1YREA 2Q4VA 3CXPA 1IICA 1K4JA 2GANA 2CNSA 1QSTA 2Z0ZA 4HKFA 2CNTA 1YR0A 3E0KA 1XIXA 1Y9KA 2B3VA 2P6FA 4PSXA 5J8FA 1M4DA 2RC4A 4KOVA 5EBVA 2VXKA 2QMLA 4U5YA 5KTCA 3JVNA 3SXNA 4K30A 4AB7A 2EUIA 5GCNA 5C82A 3R9EA 5F48A 4AVCA 4NEXA 2O28A 3ZJ0A 4QC6A 1PU9A 1NSLA 3FNCA 3FRMA 2B4BA 1FY7A 1YK3A 1M4GA 1WWZA 2FSRA 3BJ7A 4JWPA 4KOWA 1M4IA 2VBQA 1S7KA 2F5IA 3LD2A 2JEVA 3R96A 5KTDA 1I1DA 4YFJA 2BSWA 2P0WA 4LUAA 2GE3A 4MI4A 3CXQA 1QSOA 4L89A 2BL1A 2Q7BA 4JJXA 2Q04A 3DNSA 4JXRA 3DR6A 4R3KA 3GKRA 1YVKA 2HV2A 1S7LA 2PC1A 1R57A 4CAXA 2KCWA 1KUVA 1SQHA 3MGDA 4KOTA 1Q2YA 2DXQA 1QSRA 4HNYB 3ZZIA 1KUYA 1S7NA 1ON0A 3F0AA 4RS2A 4UWJA 2OU2A 3JUWA 4CAVA 1S60A 4RI1A 3D2PA 1RO5A 3PZJA 5HMNA 1BO4A 1P4NA 5IB0A 1VKCA 1S5KA 2HQYA 3K9UA 5ISVA 2D4OA 1QSNA 3H4QA 4KLVA 3EFAA 4B5PA 5EC4A 2JDCA 2EVNA 2B58A 3EXNA 2H5MA 3TT2A 4KOUA 2PDOA 3TTHA 4MBUA 4BMHA 2G0BA 4CAWA 3EC4A 1CM0A 1NE9A 4M85A 5J8CA 2HUZA 2FS5A 3W91A 4L8AA 2Y0MA 5I0CA 4KLWA 4KVXA 2CY2A 4ONUA 3GY9A 1IYKA 4E2AA 4PSWA 1S7FA 2FT0A 2WPWA 1Z4EA 2ATRA 3C26A 3CXSA 3D2MA 4Y49C 1TIQA 2VEZA 1GHEA 4B5PB 2R8VA 1M44A 2G3TA 2P6EA 2OB0A 4ZBGA 3W6XA 3TFYA 3RYOA 3TO6A 4XPLA 3FIXA 4MY0A 1N71A 2PR1A 3BLNA 3SXOA 4KOXA 2JLMA 1YGHA 2PSWA 2ZW4A 1M1DA 4R57A 1LRZA 4KOYA 5KTAA 4UA3A 1Z9UA 2C27A 4PK2A 4R87A 4QUSA 3FBUA 4KUAA 2B4DA 2QECA 2R7HA 1VHSA 3R1KA 4YGOA
chains in the Genus database with same CATH superfamily
5C88A 4PPZA 2PJAA 3WT4A 3CPXA 1XE4A 4KZTA 1TXRA 3ISXA 5LYLA 2FVGA 4LQGA 2J9AA 1BOBA 4UFVA 2K5TA 4KSAA 5CNPA 1CPXA 2IJZA 3B3TA 3DSBA 1YVOA 3PBBA 4ZX9A 1TKHA 3RZAA 1I12A 1CJWA 4R9MA 4KSFA 3UY5A 1PUAA 3PFEA 3HUVA 3IIBA 1P0HA 5JGFA 2ZOFA 2REEA 2O53A 3PB8X 4ORFA 2VI7A 4XPDB 5IX3A 4MCPA 3W6SA 3TO7A 2NMTA 4MMOA 1CPSA 5K8PA 4P4EA 4NCZA 3F8KA 1CX8A 3PB9X 1HDQA 3FEDA 4B13A 4UIAA 3S6HA 5JPHA 2I79A 1VHEA 1ZG9A 4C2YA 3RO0A 2XEJA 4XNHB 3FECA 5A27A 2CF4A 3PP9A 4AG9A 2RFHA 4H6UA 1VGYA 4KVME 1Z4RA 2B4DB 3VARA 3LWUA 4CYOA 2FL4A 4BBHA 2Z10A 4OLLA 5DWMA 2CTCA 2WUUA 3NE7A 3SJXA 1Y0RA 4FD7A 1OZPA 3KHZA 5JM6A 5AG6A 4AVAA 1CP6A 2DEAA 4W9YA 2ZW7A 4H6ZA 4KUBA 3KHXA 4KVOE 1ZO0A 2P6GA 4IUSA 2AFMA 4H89A 4LX9A 1RXTA 4OADA 3D3SA 4NGNA 3K2KA 1F2PA 4PQAA 2PIYA 3S6GA 1IYLA 4ZYQA 2YNCC 4PXDA 4CGLA 4F0YA 3GIUA 3HLPA 4UF4A 4OAEA 4MJ8A 4P44A 4CYNA 2G3AA 1FT7A 2I00A 2ZEDA 4Z65A 3PFOA 1H8LA 2JEWA 3BJ8A 2B5GA 2WYRA 2FIWA 2Z3KA 2R1IA 4FD6A 3DR8A 4NXYA 2Q51A 3QB8A 3RAMA 3KQZA 4JZ0A 1MK4A 4MCRA 2QIRA 1TKJA 4ZY2A 4A31A 1XMTA 4YRHA 3KKWA 4F6AA 3S9LA 4U9YA 4NJRA 3D4UA 3S6FA 2ZELA 1XRYA 2FIAA 1TF9A 3B2YA 4I49A 3R9FA 4PK3A 4FBEA 1A2ZA 3G8WA 1ELMP 1HDUA 2GLJA 4P10A 4R3LA 2X7BA 4B5OA 5HVFA 4MHPA 3BI1A 5LRJA 3KI9A 4RN7A 4OKOA 5IV0A 4DNCA 2FXFA 4FAIA 4MFLA 5F49A 3FYNA 4P4DA 5D29A 3VWDA 4Q7AA 2OZGA 5AGEA 5F47A 3V8IA 1I21A 3SI0A 3SJEA 1KWMA 3TO9A 3FJUA 5CPAA 4HNXB 3I9SA 5H86A 4CGNA 3WR7A 2FCKA 3WC7A 2YNEA 3TOBA 3D7DA 3K9TA 1B87A 4DYOA 3IWWA 3PBEA 2AFWA 6CPAA 1S3ZA 1MJAA 1CP7A 2NSMA 3F5BA 1YQEA 2Z3LA 3VWEA 5JQ4A 2V8DA 3GYAA 2XEGA 1Z8XA 2AFSA 4ZY1A 5E96A 1EE3P 1ARMA 4CS0B 1BPMA 2Z3NA 3S9NA 4F9UA 4A33A 4GS4A 1IIDA 4XPKA 4PV6A 4PXEA 4F8ZA 4IF5A 5AG7A 2ARHA 2VZYA 3G3SA 1GYTA 3P2FA 2B5GB 3FXTA 1XF8A 1XEBA 2JBJA 2FE7A 3FB3A 2ZEPA 4M6GA 4E8OA 5AG4A 3N7ZA 3R95A 5CBMA 2VQYA 4LQ6A 2J8NA 1B6BA 4KOSA 4JD6A 3RBUA 4UEZA 1MJ9A 5DWNA 3KL9A 2HC9A 2NYQA 4MXUA 2JDDA 1YX0A 3EY5A 4UCNA 1Y7RA 5G20A 3L2NA 4NGQA 4ZY0A 4FWUA 1CG2A 2DPSA 4XPDC 3TOAA 1KZFA 1IB1E 2EK8A 2PJ7A 2Z3MA 4OC0A 2PJCA 2Z3OA 5ELYA 5THWA 4QB9A 4CAEA 2BUEA 2OZHA 5H84A 3T9YA 2GIVA 4P4IA 3IGRA 2PJ2A 2WPXA 2Q0YA 5G22A 5HVHA 2IMOA 1IOIA 2Q4YA 4JLYA 2PQ8A 2GU2A 1XFOA 3CDXA 4OC3A 1VHOA 4NF1A 3T90A 4MY3A 4XNHC 4Y49B 2ZW5A 1LFWA 1L0CA 1YW4A 4OC4A 3KQXA 2D4PA 1YW6A 4NGSA 1VIXA 2J8MA 2IQ6A 2AFXA 2EWBA 1Q2CA 2PJ8A 4MHDA 4CYPA 4X5KA 1Q2DA 1DE4C 2ZXVA 3PGPA 4AVBA 3DDDA 4BD9A 5K8NA 4X8IA 4NGTA 2Z11A 2VZZA 3VH9A 1X10A 2BEIA 4U9ZA 3TC8A 4EVYA 3P2HA 2ZW6A 3GB0A 4IHMA 3NFZA 1ZG8A 2B3UA 1MJBA 4QBJA 2ABZA 4CRYB 3I3GA 3D7GA 4UBRA 3TCVA 2OR4A 4J3GA 2CNMA 2ZPAA 4DUKA 4MFPA 4F0XA 3IC1A 4AG7A 4FD5A 2IL4A 4C7HA 4M3SA 5FVJA 5IB9A 2ZEEA 2C6GA 1U6MA 2R98A 1QSMA 2PE3A 2WZNA 5HH1A 4UEFA 4X3RA 3SJFA 1WK4A 2HB6A 4KORA 3H8GA 4OC1A 2Z3PA 2PJ4A 3TE4A 3EO4A 4M6HA 3SJGA 2J8RA 4UWIA 4RUHA 3NA6A 5K8OA 4JXQA 4PXBA 2OH1A 2Q44A 4HNWB 4OC2A 4QVTA 1ARLA 3QAHA 3R9GA 5LRKA 4CRZB 2F7VA 2ZEMA 4ONWA 1Y9WA 3JRUA 1UFHA 4FD4A 1DTDA 1J4JA 2PCUA 4K3NA 4P4BA 2A4NA 3OWCA 2POKA 4ZX8A 5J1QA 3TX8A 2AJ6A 1OBRA 2BCOA 2PR8A 3KR5A 2Q7SA 4MFKA 3WC5A 2ZEFA 1ZG7A 1YLEA 2EO8A 4UCPA 1V0CA 4EWTA 4UEEA 1ELLP 2WSAA 3D8PA 3SHPA 2YNCA 8CPAA 3IWGA 3S6KA 4NSQA 1NMTA 1JQGA 2OZUA 4OIDA 3B8GA 3IO1A 2V8VA 3LMSA 2EBJA 2REFA 1QMUA 2XEFA 4OC5A 3LODA 3NH8A 2AFUA 4II9A 1KUXA 1Z2LA 4A95A 2AE6A 2CTBA 2PRBA 4R76A 5F46A 1LAMA 1YREA 3IU2A 3A9LA 2YGWA 3D68A 2Q4VA 1CBXA 4UCMA 3DGVA 5G1ZA 3CXPA 3D67A 1IICA 4EFDA 2PJ9A 1K4JA 2Q43A 1NSAA 1R43A 4KSIA 1RTQA 3H8FA 2GANA 2CNSA 1QSTA 2Z0ZA 4HKFA 2CNTA 3VATA 2XEIA 1YR0A 3BHXA 3E0KA 1XIXA 1Y9KA 4MHYA 3FX6A 1XBUA 2B3VA 2P6FA 2PJ5A 4PSXA 2G9DA 5J8FA 2ANPA 1M4DA 2RC4A 4A2ZA 4KOVA 1Q7LA 4A30A 5EBVA 2PRQA 2VXKA 2QMLA 4U5YA 5D8NA 1R3NA 5KTCA 3JVNA 3SXNA 4K30A 4AB7A 1LAPA 4CGMA 4PXCA 5EMIA 4P4FA 2ZENA 2ODFA 2EUIA 5GCNA 2PJ6A 2CIJA 4OMEA 3LACA 3B3SA 5C82A 3R9EA 5F48A 3PB7X 4AVCA 4NEXA 2O28A 3ZJ0A 4QC6A 5F09A 1PU9A 1NSLA 2DPTA 4B14A 1Y0YA 1Z8TA 3FNCA 3FRMA 4P45A 1PCAA 3FH4A 2BO9A 3KASA 4MCQA 2B4BA 4WJBA 4CAFA 1IGBA 1FY7A 1YK3A 4TWEA 4R7MA 2Q4ZA 1M4GA 2YNDA 1IY7A 1WWZA 2FSRA 1F2OA 3BJ7A 3CZXA 4JWPA 4KOWA 1M4IA 1IOFA 5HXDA 2VBQA 1S7KA 2F5IA 3KZWA 4ZI6A 3LD2A 3FVLA 1LANA 2JEVA 5HVGA 4ZGYB 3R96A 1AUGA 5KTDA 3IU1A 3QAYA 3WABA 1ZLHA 1I1DA 2GFQA 1QQ9A 4YFJA 2BSWA 2CXAA 1JWQA 2PIZA 4R8FA 2P0WA 4LUAA 5BWAB 3FEEA 2GE3A 3DLJA 3CPAA 4MI4A 4MFZA 3QNVA 2PVWA 3CXQA 1QSOA 4C68A 4L89A 2BL1A 2Q7BA 3RNZA 4JJXA 3CT9A 1X12A 2Q04A 3DNSA 5G21A 4UFWA 4JXRA 4A39A 3DR6A 4CGPA 1UWYA 4R3KA 3GKRA 1YVKA 1XJOA 4HPSA 2ZEHA 2HV2A 1M4LA 1S7LA 2PC1A 3B3WA 1R57A 4CPAA 3B3CA 4CAXA 2KCWA 1KUVA 1SQHA 3MGDA 4E0AA 4KOTA 1Q2YA 4C7IA 2DXQA 4MHZA 3BI0A 1QSRA 1Y7EA 4HNYB 3NE8A 3ZZIA 2V77A 1KUYA 1S7NA 1ON0A 1Z5RA 3F0AA 3PB6X 4RS2A 3JTKA 3PB4X 4UWJA 4A94A 2PJBA 2OU2A 3JUWA 2QYVA 2C1CA 3IJ3A 3N5FA 3B3VA 4C2XA 4CAVA 1S60A 4RI1A 5LYDA 2C6CA 3D2PA 3D66A 1RO5A 2PJ3A 3PZJA 5HMNA 1BLLE 4MFJA 3S9MA 1BO4A 1P4NA 5IB0A 1PYTB 4NFRA 1FNOA 1S5KA 1VKCA 2HQYA 3K9UA 2ZOGA 3KGQA 5ISVA 4EMEA 2D4OA 1QSNA 3H4QA 4KLVA 1ZLIA 3EFAA 4P6YA 4B5PA 3KR4A 5EC4A 1BAVA 1YMEA 2JDCA 3GLJA 2EVNA 3I1UA 2B58A 3V38A 4OIWA 2ZEOA 3EXNA 3MN8A 2H5MA 4C2ZA 4IAVA 4MHNA 3MRUA 4KOUA 3TT2A 2PDOA 4Q36A 5LYIA 1LOKA 5JH9A 3TTHA 5LRGA 4JYWA 3IEHA 4MBUA 4BMHA 2ZEGA 2OOTA 2G0BA 4CAWA 3EC4A 1CM0A 1NE9A 3B7IA 4AXVA 1TKFA 4M85A 3IWEA 4B6ZA 4A32A 1F57A 4NJQA 3GUXA 5J8CA 2I3CA 2HUZA 4NGRA 2FS5A 3W91A 4KS9A 2Y0MA 4L8AA 5DS0A 4G1PA 5I0CA 4KLWA 4KVXA 2CY2A 4ONUA 4UFXA 1YLOA 3GY9A 1IYKA 4M6IA 2V8GA 4E2AA 4PSWA 1S7FA 2QJ8A 4H2KA 3WC6A 2V8HA 4O23A 4B11A 2FT0A 4NGMA 3PRTA 4A38A 1XOVA 3ISZA 2WPWA 3BXMA 3NH5A 1Z4EA 4GM5A 5I4MA 3NH4A 2ATRA 2AFOA 3SI2A 3C26A 3CXSA 4X2TA 7CPAA 3D2MA 4Y49C 1TF8A 1TIQA 2VEZA 1GHEA 2VL1A 4YU9A 4B5PB 1AMPA 1LCPA 2R8VA 3H5ZA 1M44A 2BOAA 2G3TA 2P6EA 4OP4A 4WWVA 2OB0A 4B10A 4ZBGA 3W6XA 3TFYA 3RYOA 3TO6A 4XPLA 4FUUA 1AYEA 3FIXA 1Z8WA 4MY0A 1N71A 2PR1A 3BLNA 3SXOA 4F9VA 2C6PA 4IK2A 3FMCA 2O4HA 3D7HA 2EK9A 3T8WA 4B12A 4UIBA 4P4JA 2PJ1A 4KOXA 2JLMA 1YGHA 1IU8A 3FF3A 2PSWA 4R6TA 3B35A 2ZW4A 4CGOA 4TNUA 1HEEA 1M1DA 2F8HA 4R57A 4MRIA 1LRZA 5A28A 1BPNA 5LYFA 2RB7A 4KOYA 4CYQA 4DJLA 5KTAA 4MFQA 2GREA 3IFEA 3PEIA 4YWYA 4Q38A 4UA3A 5AG5A 1Z9UA 3SI1A 3H8EA 5K8MA 2DF5A 2C27A 2JBKA 4A37A 4BINA 4PK2A 4R87A 2QVPA 4QUSA 4GXHA 1Z8LA 2PJ0A 3FBUA 1YSJA 4KUAA 2B4DA 4NGPA 2QECA 2R7HA 3D7FA 1VHSA 1XMBA 2AFZA 2GLFA 3V7ZA 2PVVA 4MCSA 3R1KA 4YGOA
chains in the Genus database with same CATH topology
5C88A 1XE4A 4KZTA 1BOBA 4UFVA 2K5TA 4KSAA 5CNPA 3DSBA 1YVOA 1I12A 1CJWA 4R9MA 4KSFA 3UY5A 1PUAA 1P0HA 2REEA 4ORFA 2VI7A 4XPDB 5IX3A 3W6SA 3TO7A 2NMTA 4NCZA 3F8KA 4B13A 3S6HA 5JPHA 2I79A 4C2YA 4XNHB 5A27A 3PP9A 4AG9A 4H6UA 4KVME 1Z4RA 2B4DB 4CYOA 2FL4A 4BBHA 2Z10A 4OLLA 5DWMA 2WUUA 3NE7A 4FD7A 1OZPA 5AG6A 4AVAA 2ZW7A 4H6ZA 4KUBA 4KVOE 1ZO0A 2P6GA 4IUSA 4H89A 4LX9A 4OADA 1RXTA 4XPKA 3D3SA 3S6GA 1IYLA 2YNCC 4CGLA 4F0YA 4OAEA 4MJ8A 4CYNA 2G3AA 2I00A 3BJ8A 4FD6A 2B5GA 4NXYA 2FIWA 2Z3KA 2R1IA 4Q38A 3DR8A 3QB8A 4A31A 1MK4A 2QIRA 1XMTA 4YRHA 3KKWA 4F6AA 4U9YA 3S6FA 2FIAA 4I49A 3R9FA 4PK3A 3G8WA 4B5OA 4R3LA 2X7BA 5IV0A 4DNCA 2FXFA 4MFLA 5F49A 3FYNA 3VWDA 5F47A 2OZGA 5AGEA 3V8IA 1I21A 3TO9A 4CGNA 4HNXB 3I9SA 5H86A 3WR7A 2FCKA 2YNEA 3TOBA 1B87A 1S3ZA 1MJAA 3F5BA 2Z3LA 3VWEA 5JQ4A 3GYAA 5E96A 4CS0B 2Z3NA 4A33A 4GS4A 1IIDA 4PV6A 4IF5A 5AG7A 2ARHA 2VZYA 3G3SA 3P2FA 2B5GB 3FXTA 1XF8A 1XEBA 3FB3A 2FE7A 4E0AA 4E8OA 5AG4A 3N7ZA 3R95A 2VQYA 2J8NA 1B6BA 4KOSA 4JD6A 1MJ9A 5DWNA 2JDDA 1YX0A 3EY5A 4UCNA 1Y7RA 5G20A 2DPSA 4XPDC 3TOAA 1KZFA 1IB1E 2Z3MA 2Z3OA 4QB9A 4CAEA 2BUEA 2OZHA 5H84A 3T9YA 2GIVA 3IGRA 2WPXA 2Q0YA 5G22A 2Q4YA 4JLYA 2PQ8A 4NF1A 3T90A 4MY3A 4XNHC 4Y49B 2ZW5A 1L0CA 2D4PA 2J8MA 1Q2CA 4MHDA 4CYPA 4X5KA 1Q2DA 2ZXVA 3PGPA 4AVBA 3DDDA 2Z11A 2VZZA 2BEIA 4U9ZA 4EVYA 3P2HA 2ZW6A 2B3UA 1MJBA 4QBJA 4CRYB 3I3GA 4UBRA 3TCVA 4J3GA 2CNMA 2ZPAA 4MFPA 4F0XA 4AG7A 4FD5A 2IL4A 4C7HA 4M3SA 5FVJA 1U6MA 2R98A 1QSMA 5HH1A 1WK4A 4KORA 2Z3PA 3TE4A 3EO4A 2J8RA 4UWIA 4JXQA 2OH1A 2Q44A 4HNWB 3R9GA 4QVTA 3QAHA 4CRZB 1Y9WA 1UFHA 4FD4A 1J4JA 2A4NA 3OWCA 2AJ6A 2PR8A 4MFKA 1YLEA 4UCPA 1V0CA 2WSAA 3D8PA 3SHPA 2YNCA 3IWGA 3S6KA 4NSQA 1NMTA 2OZUA 3B8GA 2REFA 3LODA 4II9A 1KUXA 4A95A 2AE6A 2PRBA 5F46A 1YREA 3IU2A 3A9LA 2YGWA 2Q4VA 4UCMA 5G1ZA 3CXPA 1IICA 1K4JA 2GANA 2CNSA 1QSTA 2Z0ZA 4HKFA 2CNTA 1YR0A 3E0KA 1XIXA 1Y9KA 2B3VA 2P6FA 4PSXA 5J8FA 1M4DA 2RC4A 4A2ZA 4KOVA 4A30A 5EBVA 2VXKA 2QMLA 4U5YA 5KTCA 3JVNA 3SXNA 4K30A 4AB7A 4CGMA 2EUIA 5GCNA 5C82A 3R9EA 5F48A 4AVCA 4NEXA 2O28A 3ZJ0A 4QC6A 1PU9A 1NSLA 2DPTA 4B14A 3FNCA 3FRMA 2B4BA 4CAFA 1FY7A 1YK3A 1M4GA 2YNDA 1WWZA 2FSRA 3BJ7A 4JWPA 4KOWA 1M4IA 2VBQA 1S7KA 2F5IA 3LD2A 2JEVA 4ZGYB 3R96A 5KTDA 3IU1A 1I1DA 4YFJA 2BSWA 2CXAA 2P0WA 4LUAA 5BWAB 2GE3A 4MI4A 4MFZA 3CXQA 1QSOA 4C68A 4L89A 2BL1A 2Q7BA 4JJXA 5G21A 2Q04A 3DNSA 4UFWA 4JXRA 4CGPA 3DR6A 4R3KA 3GKRA 1YVKA 2HV2A 1S7LA 2PC1A 1R57A 4CAXA 2KCWA 1KUVA 1SQHA 3MGDA 4KOTA 1Q2YA 4C7IA 2DXQA 1QSRA 4HNYB 3ZZIA 1KUYA 1S7NA 1ON0A 3F0AA 4RS2A 3JTKA 4UWJA 2OU2A 3JUWA 4C2XA 4CAVA 1S60A 4RI1A 3D2PA 1RO5A 3PZJA 5HMNA 4MFJA 1BO4A 1P4NA 5IB0A 1VKCA 1S5KA 2HQYA 3K9UA 5ISVA 2D4OA 1QSNA 3H4QA 4KLVA 3EFAA 4B5PA 5EC4A 2JDCA 2EVNA 2B58A 3EXNA 4C2ZA 2H5MA 3TT2A 4KOUA 2PDOA 4Q36A 3TTHA 4MBUA 4BMHA 2G0BA 4CAWA 3EC4A 1CM0A 1NE9A 4M85A 3IWEA 5J8CA 4A32A 2HUZA 2FS5A 3W91A 4KS9A 2Y0MA 4L8AA 5I0CA 4KLWA 4KVXA 2CY2A 4ONUA 4UFXA 3GY9A 1IYKA 4E2AA 4PSWA 1S7FA 4B11A 2FT0A 2WPWA 1Z4EA 2ATRA 3C26A 3CXSA 3D2MA 4Y49C 1TIQA 2VEZA 1GHEA 4B5PB 2R8VA 3H5ZA 1M44A 2G3TA 2P6EA 4B10A 2OB0A 4ZBGA 3W6XA 3TFYA 3RYOA 3TO6A 4XPLA 3FIXA 4MY0A 1N71A 2PR1A 3BLNA 3SXOA 4B12A 4KOXA 2JLMA 1YGHA 2PSWA 2ZW4A 4CGOA 1M1DA 4R57A 1LRZA 5A28A 4KOYA 4CYQA 5KTAA 4MFQA 4UA3A 5AG5A 1Z9UA 2C27A 4PK2A 4R87A 4QUSA 3FBUA 4KUAA 2B4DA 2QECA 2R7HA 1VHSA 3R1KA 4YGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C88 A;  1XE4 A;  4KZT A;  1BOB A;  2K5T A;  5CNP A;  3DSB A;  1YVO A;  1I12 A;  1CJW A;  4R9M A;  3UY5 A;  1PUA A;  1P0H A;  2REE A;  4ORF A;  2VI7 A;  4XPD B;  5IX3 A;  3W6S A;  3TO7 A;  2NMT A;  4NCZ A;  3F8K A;  3S6H A;  5JPH A;  2I79 A;  4XNH B;  3PP9 A;  4AG9 A;  4H6U A;  4KVM E;  1Z4R A;  2B4D B;  2FL4 A;  2Z10 A;  4OLL A;  5DWM A;  3NE7 A;  4FD7 A;  1OZP A;  4AVA A;  2ZW7 A;  4H6Z A;  4KUB A;  4KVO E;  2P6G A;  4IUS A;  4OAD A;  4H89 A;  4LX9 A;  4XPK A;  1RXT A;  3D3S A;  3S6G A;  1IYL A;  4F0Y A;  4OAE A;  4MJ8 A;  2G3A A;  2I00 A;  3BJ8 A;  4FD6 A;  2B5G A;  4NXY A;  2FIW A;  2R1I A;  3DR8 A;  3QB8 A;  1MK4 A;  2QIR A;  1XMT A;  4YRH A;  3KKW A;  4F6A A;  4U9Y A;  3S6F A;  2FIA A;  4I49 A;  3R9F A;  4PK3 A;  3G8W A;  4B5O A;  4R3L A;  2X7B A;  5IV0 A;  4DNC A;  2FXF A;  5F49 A;  3FYN A;  3VWD A;  5F47 A;  2OZG A;  3V8I A;  1I21 A;  3TO9 A;  4HNX B;  3I9S A;  5H86 A;  3WR7 A;  2FCK A;  3TOB A;  1B87 A;  1S3Z A;  1MJA A;  3F5B A;  3VWE A;  5JQ4 A;  3GYA A;  5E96 A;  4CS0 B;  4GS4 A;  1IID A;  4PV6 A;  4IF5 A;  2ARH A;  2VZY A;  3G3S A;  3P2F A;  2B5G B;  3FXT A;  1XF8 A;  1XEB A;  3FB3 A;  2FE7 A;  4E0A A;  4E8O A;  3N7Z A;  3R95 A;  2VQY A;  2J8N A;  1B6B A;  4KOS A;  4JD6 A;  1MJ9 A;  5DWN A;  2JDD A;  1YX0 A;  3EY5 A;  1Y7R A;  4XPD C;  3TOA A;  1KZF A;  1IB1 E;  4QB9 A;  2BUE A;  2OZH A;  5H84 A;  3T9Y A;  2GIV A;  3IGR A;  2WPX A;  2Q0Y A;  2Q4Y A;  4JLY A;  2PQ8 A;  4NF1 A;  3T90 A;  4MY3 A;  4XNH C;  4Y49 B;  2ZW5 A;  1L0C A;  2D4P A;  2J8M A;  1Q2C A;  4MHD A;  4X5K A;  1Q2D A;  2ZXV A;  3PGP A;  4AVB A;  3DDD A;  2Z11 A;  2VZZ A;  2BEI A;  4U9Z A;  4EVY A;  3P2H A;  2ZW6 A;  2B3U A;  1MJB A;  4QBJ A;  4CRY B;  3I3G A;  4UBR A;  3TCV A;  4J3G A;  2CNM A;  2ZPA A;  4AG7 A;  4FD5 A;  2IL4 A;  4M3S A;  5FVJ A;  1U6M A;  2R98 A;  1QSM A;  5HH1 A;  1WK4 A;  4KOR A;  3TE4 A;  3EO4 A;  2J8R A;  4UWI A;  4JXQ A;  2OH1 A;  2Q44 A;  4HNW B;  3R9G A;  4QVT A;  3QAH A;  4CRZ B;  1Y9W A;  1UFH A;  4FD4 A;  1J4J A;  2A4N A;  3OWC A;  2AJ6 A;  2PR8 A;  1YLE A;  1V0C A;  3D8P A;  3SHP A;  3IWG A;  3S6K A;  4NSQ A;  1NMT A;  2OZU A;  3B8G A;  2REF A;  3LOD A;  4II9 A;  1KUX A;  2AE6 A;  2PRB A;  5F46 A;  1YRE A;  2Q4V A;  3CXP A;  1IIC A;  1K4J A;  2GAN A;  2CNS A;  1QST A;  2Z0Z A;  4HKF A;  2CNT A;  1YR0 A;  3E0K A;  1XIX A;  1Y9K A;  2B3V A;  2P6F A;  4PSX A;  5J8F A;  1M4D A;  2RC4 A;  4KOV A;  5EBV A;  2VXK A;  2QML A;  4U5Y A;  5KTC A;  3JVN A;  3SXN A;  4K30 A;  4AB7 A;  2EUI A;  5GCN A;  5C82 A;  3R9E A;  5F48 A;  4AVC A;  4NEX A;  2O28 A;  3ZJ0 A;  4QC6 A;  1PU9 A;  1NSL A;  3FNC A;  3FRM A;  2B4B A;  1FY7 A;  1YK3 A;  1M4G A;  1WWZ A;  2FSR A;  3BJ7 A;  4JWP A;  4KOW A;  1M4I A;  2VBQ A;  1S7K A;  2F5I A;  3LD2 A;  2JEV A;  3R96 A;  5KTD A;  1I1D A;  4YFJ A;  2BSW A;  2P0W A;  4LUA A;  2GE3 A;  4MI4 A;  3CXQ A;  1QSO A;  4L89 A;  2BL1 A;  2Q7B A;  4JJX A;  2Q04 A;  3DNS A;  4JXR A;  3DR6 A;  4R3K A;  3GKR A;  1YVK A;  2HV2 A;  1S7L A;  2PC1 A;  1R57 A;  4CAX A;  2KCW A;  1KUV A;  1SQH A;  3MGD A;  4KOT A;  1Q2Y A;  2DXQ A;  1QSR A;  4HNY B;  3ZZI A;  1KUY A;  1S7N A;  1ON0 A;  3F0A A;  4RS2 A;  4UWJ A;  2OU2 A;  3JUW A;  4CAV A;  1S60 A;  4RI1 A;  3D2P A;  1RO5 A;  3PZJ A;  5HMN A;  1BO4 A;  1P4N A;  5IB0 A;  1VKC A;  1S5K A;  2HQY A;  3K9U A;  5ISV A;  2D4O A;  1QSN A;  3H4Q A;  4KLV A;  3EFA A;  4B5P A;  5EC4 A;  2JDC A;  2EVN A;  2B58 A;  3EXN A;  2H5M A;  3TT2 A;  4KOU A;  2PDO A;  3TTH A;  4MBU A;  4BMH A;  2G0B A;  4CAW A;  3EC4 A;  1CM0 A;  1NE9 A;  4M85 A;  5J8C A;  2HUZ A;  2FS5 A;  3W91 A;  4L8A A;  2Y0M A;  5I0C A;  4KLW A;  4KVX A;  2CY2 A;  4ONU A;  3GY9 A;  1IYK A;  4E2A A;  4PSW A;  1S7F A;  2FT0 A;  2WPW A;  1Z4E A;  2ATR A;  3C26 A;  3CXS A;  3D2M A;  4Y49 C;  1TIQ A;  2VEZ A;  1GHE A;  4B5P B;  2R8V A;  1M44 A;  2G3T A;  2P6E A;  2OB0 A;  4ZBG A;  3W6X A;  3TFY A;  3RYO A;  3TO6 A;  4XPL A;  3FIX A;  4MY0 A;  1N71 A;  2PR1 A;  3BLN A;  3SXO A;  4KOX A;  2JLM A;  1YGH A;  2PSW A;  2ZW4 A;  1M1D A;  4R57 A;  1LRZ A;  4KOY A;  5KTA A;  4UA3 A;  1Z9U A;  2C27 A;  4PK2 A;  4R87 A;  4QUS A;  3FBU A;  4KUA A;  2B4D A;  2QEC A;  2R7H A;  1VHS A;  3R1K A;  4YGO A; 
#chains in the Genus database with same CATH topology
 5C88 A;  4PPZ A;  2PJA A;  3WT4 A;  3CPX A;  1XE4 A;  4KZT A;  1TXR A;  3ISX A;  5LYL A;  2FVG A;  4LQG A;  2J9A A;  1BOB A;  4UFV A;  2K5T A;  4KSA A;  5CNP A;  1CPX A;  2IJZ A;  3B3T A;  3DSB A;  1YVO A;  3PBB A;  4ZX9 A;  1TKH A;  3RZA A;  1I12 A;  1CJW A;  4R9M A;  4KSF A;  3UY5 A;  1PUA A;  3PFE A;  3HUV A;  3IIB A;  1P0H A;  5JGF A;  2ZOF A;  2REE A;  2O53 A;  3PB8 X;  4ORF A;  2VI7 A;  4XPD B;  5IX3 A;  4MCP A;  3W6S A;  3TO7 A;  2NMT A;  4MMO A;  1CPS A;  5K8P A;  4P4E A;  4NCZ A;  3F8K A;  1CX8 A;  3PB9 X;  1HDQ A;  3FED A;  4B13 A;  4UIA A;  3S6H A;  5JPH A;  2I79 A;  1VHE A;  1ZG9 A;  4C2Y A;  3RO0 A;  2XEJ A;  4XNH B;  3FEC A;  5A27 A;  2CF4 A;  3PP9 A;  4AG9 A;  2RFH A;  4H6U A;  1VGY A;  4KVM E;  1Z4R A;  2B4D B;  3VAR A;  3LWU A;  4CYO A;  2FL4 A;  4BBH A;  2Z10 A;  4OLL A;  5DWM A;  2CTC A;  2WUU A;  3NE7 A;  3SJX A;  1Y0R A;  4FD7 A;  1OZP A;  3KHZ A;  5JM6 A;  5AG6 A;  4AVA A;  1CP6 A;  2DEA A;  4W9Y A;  2ZW7 A;  4H6Z A;  4KUB A;  3KHX A;  4KVO E;  1ZO0 A;  2P6G A;  4IUS A;  2AFM A;  4H89 A;  4LX9 A;  1RXT A;  4OAD A;  3D3S A;  4NGN A;  3K2K A;  1F2P A;  4PQA A;  2PIY A;  3S6G A;  1IYL A;  4ZYQ A;  2YNC C;  4PXD A;  4CGL A;  4F0Y A;  3GIU A;  3HLP A;  4UF4 A;  4OAE A;  4MJ8 A;  4P44 A;  4CYN A;  2G3A A;  1FT7 A;  2I00 A;  2ZED A;  4Z65 A;  3PFO A;  1H8L A;  2JEW A;  3BJ8 A;  2B5G A;  2WYR A;  2FIW A;  2Z3K A;  2R1I A;  4FD6 A;  3DR8 A;  4NXY A;  2Q51 A;  3QB8 A;  3RAM A;  3KQZ A;  4JZ0 A;  1MK4 A;  4MCR A;  2QIR A;  1TKJ A;  4ZY2 A;  4A31 A;  1XMT A;  4YRH A;  3KKW A;  4F6A A;  3S9L A;  4U9Y A;  4NJR A;  3D4U A;  3S6F A;  2ZEL A;  1XRY A;  2FIA A;  1TF9 A;  3B2Y A;  4I49 A;  3R9F A;  4PK3 A;  4FBE A;  1A2Z A;  3G8W A;  1ELM P;  1HDU A;  2GLJ A;  4P10 A;  4R3L A;  2X7B A;  4B5O A;  5HVF A;  4MHP A;  3BI1 A;  5LRJ A;  3KI9 A;  4RN7 A;  4OKO A;  5IV0 A;  4DNC A;  2FXF A;  4FAI A;  4MFL A;  5F49 A;  3FYN A;  4P4D A;  5D29 A;  3VWD A;  4Q7A A;  2OZG A;  5AGE A;  5F47 A;  3V8I A;  1I21 A;  3SI0 A;  3SJE A;  1KWM A;  3TO9 A;  3FJU A;  5CPA A;  4HNX B;  3I9S A;  5H86 A;  4CGN A;  3WR7 A;  2FCK A;  3WC7 A;  2YNE A;  3TOB A;  3D7D A;  3K9T A;  1B87 A;  4DYO A;  3IWW A;  3PBE A;  2AFW A;  6CPA A;  1S3Z A;  1MJA A;  1CP7 A;  2NSM A;  3F5B A;  1YQE A;  2Z3L A;  3VWE A;  5JQ4 A;  2V8D A;  3GYA A;  2XEG A;  1Z8X A;  2AFS A;  4ZY1 A;  5E96 A;  1EE3 P;  1ARM A;  4CS0 B;  1BPM A;  2Z3N A;  3S9N A;  4F9U A;  4A33 A;  4GS4 A;  1IID A;  4XPK A;  4PV6 A;  4PXE A;  4F8Z A;  4IF5 A;  5AG7 A;  2ARH A;  2VZY A;  3G3S A;  1GYT A;  3P2F A;  2B5G B;  3FXT A;  1XF8 A;  1XEB A;  2JBJ A;  2FE7 A;  3FB3 A;  2ZEP A;  4M6G A;  4E8O A;  5AG4 A;  3N7Z A;  3R95 A;  5CBM A;  2VQY A;  4LQ6 A;  2J8N A;  1B6B A;  4KOS A;  4JD6 A;  3RBU A;  4UEZ A;  1MJ9 A;  5DWN A;  3KL9 A;  2HC9 A;  2NYQ A;  4MXU A;  2JDD A;  1YX0 A;  3EY5 A;  4UCN A;  1Y7R A;  5G20 A;  3L2N A;  4NGQ A;  4ZY0 A;  4FWU A;  1CG2 A;  2DPS A;  4XPD C;  3TOA A;  1KZF A;  1IB1 E;  2EK8 A;  2PJ7 A;  2Z3M A;  4OC0 A;  2PJC A;  2Z3O A;  5ELY A;  5THW A;  4QB9 A;  4CAE A;  2BUE A;  2OZH A;  5H84 A;  3T9Y A;  2GIV A;  4P4I A;  3IGR A;  2PJ2 A;  2WPX A;  2Q0Y A;  5G22 A;  5HVH A;  2IMO A;  1IOI A;  2Q4Y A;  4JLY A;  2PQ8 A;  2GU2 A;  1XFO A;  3CDX A;  4OC3 A;  1VHO A;  4NF1 A;  3T90 A;  4MY3 A;  4XNH C;  4Y49 B;  2ZW5 A;  1LFW A;  1L0C A;  1YW4 A;  4OC4 A;  3KQX A;  2D4P A;  1YW6 A;  4NGS A;  1VIX A;  2J8M A;  2IQ6 A;  2AFX A;  2EWB A;  1Q2C A;  2PJ8 A;  4MHD A;  4CYP A;  4X5K A;  1Q2D A;  1DE4 C;  2ZXV A;  3PGP A;  4AVB A;  3DDD A;  4BD9 A;  5K8N A;  4X8I A;  4NGT A;  2Z11 A;  2VZZ A;  3VH9 A;  1X10 A;  2BEI A;  4U9Z A;  3TC8 A;  4EVY A;  3P2H A;  2ZW6 A;  3GB0 A;  4IHM A;  3NFZ A;  1ZG8 A;  2B3U A;  1MJB A;  4QBJ A;  2ABZ A;  4CRY B;  3I3G A;  3D7G A;  4UBR A;  3TCV A;  2OR4 A;  4J3G A;  2CNM A;  2ZPA A;  4DUK A;  4MFP A;  4F0X A;  3IC1 A;  4AG7 A;  4FD5 A;  2IL4 A;  4C7H A;  4M3S A;  5FVJ A;  5IB9 A;  2ZEE A;  2C6G A;  1U6M A;  2R98 A;  1QSM A;  2PE3 A;  2WZN A;  5HH1 A;  4UEF A;  4X3R A;  3SJF A;  1WK4 A;  2HB6 A;  4KOR A;  3H8G A;  4OC1 A;  2Z3P A;  2PJ4 A;  3TE4 A;  3EO4 A;  4M6H A;  3SJG A;  2J8R A;  4UWI A;  4RUH A;  3NA6 A;  5K8O A;  4JXQ A;  4PXB A;  2OH1 A;  2Q44 A;  4HNW B;  4OC2 A;  4QVT A;  1ARL A;  3QAH A;  3R9G A;  5LRK A;  4CRZ B;  2F7V A;  2ZEM A;  4ONW A;  1Y9W A;  3JRU A;  1UFH A;  4FD4 A;  1DTD A;  1J4J A;  2PCU A;  4K3N A;  4P4B A;  2A4N A;  3OWC A;  2POK A;  4ZX8 A;  5J1Q A;  3TX8 A;  2AJ6 A;  1OBR A;  2BCO A;  2PR8 A;  3KR5 A;  2Q7S A;  4MFK A;  3WC5 A;  2ZEF A;  1ZG7 A;  1YLE A;  2EO8 A;  4UCP A;  1V0C A;  4EWT A;  4UEE A;  1ELL P;  2WSA A;  3D8P A;  3SHP A;  2YNC A;  8CPA A;  3IWG A;  3S6K A;  4NSQ A;  1NMT A;  1JQG A;  2OZU A;  4OID A;  3B8G A;  3IO1 A;  2V8V A;  3LMS A;  2EBJ A;  2REF A;  1QMU A;  2XEF A;  4OC5 A;  3LOD A;  3NH8 A;  2AFU A;  4II9 A;  1KUX A;  1Z2L A;  4A95 A;  2AE6 A;  2CTB A;  2PRB A;  4R76 A;  5F46 A;  1LAM A;  1YRE A;  3IU2 A;  3A9L A;  2YGW A;  3D68 A;  2Q4V A;  1CBX A;  4UCM A;  3DGV A;  5G1Z A;  3CXP A;  3D67 A;  1IIC A;  4EFD A;  2PJ9 A;  1K4J A;  2Q43 A;  1NSA A;  1R43 A;  4KSI A;  1RTQ A;  3H8F A;  2GAN A;  2CNS A;  1QST A;  2Z0Z A;  4HKF A;  2CNT A;  3VAT A;  2XEI A;  1YR0 A;  3BHX A;  3E0K A;  1XIX A;  1Y9K A;  4MHY A;  3FX6 A;  1XBU A;  2B3V A;  2P6F A;  2PJ5 A;  4PSX A;  2G9D A;  5J8F A;  2ANP A;  1M4D A;  2RC4 A;  4A2Z A;  4KOV A;  1Q7L A;  4A30 A;  5EBV A;  2PRQ A;  2VXK A;  2QML A;  4U5Y A;  5D8N A;  1R3N A;  5KTC A;  3JVN A;  3SXN A;  4K30 A;  4AB7 A;  1LAP A;  4CGM A;  4PXC A;  5EMI A;  4P4F A;  2ZEN A;  2ODF A;  2EUI A;  5GCN A;  2PJ6 A;  2CIJ A;  4OME A;  3LAC A;  3B3S A;  5C82 A;  3R9E A;  5F48 A;  3PB7 X;  4AVC A;  4NEX A;  2O28 A;  3ZJ0 A;  4QC6 A;  5F09 A;  1PU9 A;  1NSL A;  2DPT A;  4B14 A;  1Y0Y A;  1Z8T A;  3FNC A;  3FRM A;  4P45 A;  1PCA A;  3FH4 A;  2BO9 A;  3KAS A;  4MCQ A;  2B4B A;  4WJB A;  4CAF A;  1IGB A;  1FY7 A;  1YK3 A;  4TWE A;  4R7M A;  2Q4Z A;  1M4G A;  2YND A;  1IY7 A;  1WWZ A;  2FSR A;  1F2O A;  3BJ7 A;  3CZX A;  4JWP A;  4KOW A;  1M4I A;  1IOF A;  5HXD A;  2VBQ A;  1S7K A;  2F5I A;  3KZW A;  4ZI6 A;  3LD2 A;  3FVL A;  1LAN A;  2JEV A;  5HVG A;  4ZGY B;  3R96 A;  1AUG A;  5KTD A;  3IU1 A;  3QAY A;  3WAB A;  1ZLH A;  1I1D A;  2GFQ A;  1QQ9 A;  4YFJ A;  2BSW A;  2CXA A;  1JWQ A;  2PIZ A;  4R8F A;  2P0W A;  4LUA A;  5BWA B;  3FEE A;  2GE3 A;  3DLJ A;  3CPA A;  4MI4 A;  4MFZ A;  3QNV A;  2PVW A;  3CXQ A;  1QSO A;  4C68 A;  4L89 A;  2BL1 A;  2Q7B A;  3RNZ A;  4JJX A;  3CT9 A;  1X12 A;  2Q04 A;  3DNS A;  5G21 A;  4UFW A;  4JXR A;  4A39 A;  3DR6 A;  4CGP A;  1UWY A;  4R3K A;  3GKR A;  1YVK A;  1XJO A;  4HPS A;  2ZEH A;  2HV2 A;  1M4L A;  1S7L A;  2PC1 A;  3B3W A;  1R57 A;  4CPA A;  3B3C A;  4CAX A;  2KCW A;  1KUV A;  1SQH A;  3MGD A;  4E0A A;  4KOT A;  1Q2Y A;  4C7I A;  2DXQ A;  4MHZ A;  3BI0 A;  1QSR A;  1Y7E A;  4HNY B;  3NE8 A;  3ZZI A;  2V77 A;  1KUY A;  1S7N A;  1ON0 A;  1Z5R A;  3F0A A;  3PB6 X;  4RS2 A;  3JTK A;  3PB4 X;  4UWJ A;  4A94 A;  2PJB A;  2OU2 A;  3JUW A;  2QYV A;  2C1C A;  3IJ3 A;  3N5F A;  3B3V A;  4C2X A;  4CAV A;  1S60 A;  4RI1 A;  5LYD A;  2C6C A;  3D2P A;  3D66 A;  1RO5 A;  2PJ3 A;  3PZJ A;  5HMN A;  1BLL E;  4MFJ A;  3S9M A;  1BO4 A;  1P4N A;  5IB0 A;  1PYT B;  4NFR A;  1FNO A;  1S5K A;  1VKC A;  2HQY A;  3K9U A;  2ZOG A;  3KGQ A;  5ISV A;  4EME A;  2D4O A;  1QSN A;  3H4Q A;  4KLV A;  1ZLI A;  3EFA A;  4P6Y A;  4B5P A;  3KR4 A;  5EC4 A;  1BAV A;  1YME A;  2JDC A;  3GLJ A;  2EVN A;  3I1U A;  2B58 A;  3V38 A;  4OIW A;  2ZEO A;  3EXN A;  3MN8 A;  2H5M A;  4C2Z A;  4IAV A;  4MHN A;  3MRU A;  4KOU A;  3TT2 A;  2PDO A;  4Q36 A;  5LYI A;  1LOK A;  5JH9 A;  3TTH A;  5LRG A;  4JYW A;  3IEH A;  4MBU A;  4BMH A;  2ZEG A;  2OOT A;  2G0B A;  4CAW A;  3EC4 A;  1CM0 A;  1NE9 A;  3B7I A;  4AXV A;  1TKF A;  4M85 A;  3IWE A;  4B6Z A;  4A32 A;  1F57 A;  4NJQ A;  3GUX A;  5J8C A;  2I3C A;  2HUZ A;  4NGR A;  2FS5 A;  3W91 A;  4KS9 A;  2Y0M A;  4L8A A;  5DS0 A;  4G1P A;  5I0C A;  4KLW A;  4KVX A;  2CY2 A;  4ONU A;  4UFX A;  1YLO A;  3GY9 A;  1IYK A;  4M6I A;  2V8G A;  4E2A A;  4PSW A;  1S7F A;  2QJ8 A;  4H2K A;  3WC6 A;  2V8H A;  4O23 A;  4B11 A;  2FT0 A;  4NGM A;  3PRT A;  4A38 A;  1XOV A;  3ISZ A;  2WPW A;  3BXM A;  3NH5 A;  1Z4E A;  4GM5 A;  5I4M A;  3NH4 A;  2ATR A;  2AFO A;  3SI2 A;  3C26 A;  3CXS A;  4X2T A;  7CPA A;  3D2M A;  4Y49 C;  1TF8 A;  1TIQ A;  2VEZ A;  1GHE A;  2VL1 A;  4YU9 A;  4B5P B;  1AMP A;  1LCP A;  2R8V A;  3H5Z A;  1M44 A;  2BOA A;  2G3T A;  2P6E A;  4OP4 A;  4WWV A;  2OB0 A;  4B10 A;  4ZBG A;  3W6X A;  3TFY A;  3RYO A;  3TO6 A;  4XPL A;  4FUU A;  1AYE A;  3FIX A;  1Z8W A;  4MY0 A;  1N71 A;  2PR1 A;  3BLN A;  3SXO A;  4F9V A;  2C6P A;  4IK2 A;  3FMC A;  2O4H A;  3D7H A;  2EK9 A;  3T8W A;  4B12 A;  4UIB A;  4P4J A;  2PJ1 A;  4KOX A;  2JLM A;  1YGH A;  1IU8 A;  3FF3 A;  2PSW A;  4R6T A;  3B35 A;  2ZW4 A;  4CGO A;  4TNU A;  1HEE A;  1M1D A;  2F8H A;  4R57 A;  4MRI A;  1LRZ A;  5A28 A;  1BPN A;  5LYF A;  2RB7 A;  4KOY A;  4CYQ A;  4DJL A;  5KTA A;  4MFQ A;  2GRE A;  3IFE A;  3PEI A;  4YWY A;  4Q38 A;  4UA3 A;  5AG5 A;  1Z9U A;  3SI1 A;  3H8E A;  5K8M A;  2DF5 A;  2C27 A;  2JBK A;  4A37 A;  4BIN A;  4PK2 A;  4R87 A;  2QVP A;  4QUS A;  4GXH A;  1Z8L A;  2PJ0 A;  3FBU A;  1YSJ A;  4KUA A;  2B4D A;  4NGP A;  2QEC A;  2R7H A;  3D7F A;  1VHS A;  1XMB A;  2AFZ A;  2GLF A;  3V7Z A;  2PVV A;  4MCS A;  3R1K A;  4YGO A; 
#chains in the Genus database with same CATH homology
 5C88 A;  1XE4 A;  4KZT A;  1BOB A;  4UFV A;  2K5T A;  4KSA A;  5CNP A;  3DSB A;  1YVO A;  1I12 A;  1CJW A;  4R9M A;  4KSF A;  3UY5 A;  1PUA A;  1P0H A;  2REE A;  4ORF A;  2VI7 A;  4XPD B;  5IX3 A;  3W6S A;  3TO7 A;  2NMT A;  4NCZ A;  3F8K A;  4B13 A;  3S6H A;  5JPH A;  2I79 A;  4C2Y A;  4XNH B;  5A27 A;  3PP9 A;  4AG9 A;  4H6U A;  4KVM E;  1Z4R A;  2B4D B;  4CYO A;  2FL4 A;  4BBH A;  2Z10 A;  4OLL A;  5DWM A;  2WUU A;  3NE7 A;  4FD7 A;  1OZP A;  5AG6 A;  4AVA A;  2ZW7 A;  4H6Z A;  4KUB A;  4KVO E;  1ZO0 A;  2P6G A;  4IUS A;  4H89 A;  4LX9 A;  4OAD A;  1RXT A;  4XPK A;  3D3S A;  3S6G A;  1IYL A;  2YNC C;  4CGL A;  4F0Y A;  4OAE A;  4MJ8 A;  4CYN A;  2G3A A;  2I00 A;  3BJ8 A;  4FD6 A;  2B5G A;  4NXY A;  2FIW A;  2Z3K A;  2R1I A;  4Q38 A;  3DR8 A;  3QB8 A;  4A31 A;  1MK4 A;  2QIR A;  1XMT A;  4YRH A;  3KKW A;  4F6A A;  4U9Y A;  3S6F A;  2FIA A;  4I49 A;  3R9F A;  4PK3 A;  3G8W A;  4B5O A;  4R3L A;  2X7B A;  5IV0 A;  4DNC A;  2FXF A;  4MFL A;  5F49 A;  3FYN A;  3VWD A;  5F47 A;  2OZG A;  5AGE A;  3V8I A;  1I21 A;  3TO9 A;  4CGN A;  4HNX B;  3I9S A;  5H86 A;  3WR7 A;  2FCK A;  2YNE A;  3TOB A;  1B87 A;  1S3Z A;  1MJA A;  3F5B A;  2Z3L A;  3VWE A;  5JQ4 A;  3GYA A;  5E96 A;  4CS0 B;  2Z3N A;  4A33 A;  4GS4 A;  1IID A;  4PV6 A;  4IF5 A;  5AG7 A;  2ARH A;  2VZY A;  3G3S A;  3P2F A;  2B5G B;  3FXT A;  1XF8 A;  1XEB A;  3FB3 A;  2FE7 A;  4E0A A;  4E8O A;  5AG4 A;  3N7Z A;  3R95 A;  2VQY A;  2J8N A;  1B6B A;  4KOS A;  4JD6 A;  1MJ9 A;  5DWN A;  2JDD A;  1YX0 A;  3EY5 A;  4UCN A;  1Y7R A;  5G20 A;  2DPS A;  4XPD C;  3TOA A;  1KZF A;  1IB1 E;  2Z3M A;  2Z3O A;  4QB9 A;  4CAE A;  2BUE A;  2OZH A;  5H84 A;  3T9Y A;  2GIV A;  3IGR A;  2WPX A;  2Q0Y A;  5G22 A;  2Q4Y A;  4JLY A;  2PQ8 A;  4NF1 A;  3T90 A;  4MY3 A;  4XNH C;  4Y49 B;  2ZW5 A;  1L0C A;  2D4P A;  2J8M A;  1Q2C A;  4MHD A;  4CYP A;  4X5K A;  1Q2D A;  2ZXV A;  3PGP A;  4AVB A;  3DDD A;  2Z11 A;  2VZZ A;  2BEI A;  4U9Z A;  4EVY A;  3P2H A;  2ZW6 A;  2B3U A;  1MJB A;  4QBJ A;  4CRY B;  3I3G A;  4UBR A;  3TCV A;  4J3G A;  2CNM A;  2ZPA A;  4MFP A;  4F0X A;  4AG7 A;  4FD5 A;  2IL4 A;  4C7H A;  4M3S A;  5FVJ A;  1U6M A;  2R98 A;  1QSM A;  5HH1 A;  1WK4 A;  4KOR A;  2Z3P A;  3TE4 A;  3EO4 A;  2J8R A;  4UWI A;  4JXQ A;  2OH1 A;  2Q44 A;  4HNW B;  3R9G A;  4QVT A;  3QAH A;  4CRZ B;  1Y9W A;  1UFH A;  4FD4 A;  1J4J A;  2A4N A;  3OWC A;  2AJ6 A;  2PR8 A;  4MFK A;  1YLE A;  4UCP A;  1V0C A;  2WSA A;  3D8P A;  3SHP A;  2YNC A;  3IWG A;  3S6K A;  4NSQ A;  1NMT A;  2OZU A;  3B8G A;  2REF A;  3LOD A;  4II9 A;  1KUX A;  4A95 A;  2AE6 A;  2PRB A;  5F46 A;  1YRE A;  3IU2 A;  3A9L A;  2YGW A;  2Q4V A;  4UCM A;  5G1Z A;  3CXP A;  1IIC A;  1K4J A;  2GAN A;  2CNS A;  1QST A;  2Z0Z A;  4HKF A;  2CNT A;  1YR0 A;  3E0K A;  1XIX A;  1Y9K A;  2B3V A;  2P6F A;  4PSX A;  5J8F A;  1M4D A;  2RC4 A;  4A2Z A;  4KOV A;  4A30 A;  5EBV A;  2VXK A;  2QML A;  4U5Y A;  5KTC A;  3JVN A;  3SXN A;  4K30 A;  4AB7 A;  4CGM A;  2EUI A;  5GCN A;  5C82 A;  3R9E A;  5F48 A;  4AVC A;  4NEX A;  2O28 A;  3ZJ0 A;  4QC6 A;  1PU9 A;  1NSL A;  2DPT A;  4B14 A;  3FNC A;  3FRM A;  2B4B A;  4CAF A;  1FY7 A;  1YK3 A;  1M4G A;  2YND A;  1WWZ A;  2FSR A;  3BJ7 A;  4JWP A;  4KOW A;  1M4I A;  2VBQ A;  1S7K A;  2F5I A;  3LD2 A;  2JEV A;  4ZGY B;  3R96 A;  5KTD A;  3IU1 A;  1I1D A;  4YFJ A;  2BSW A;  2CXA A;  2P0W A;  4LUA A;  5BWA B;  2GE3 A;  4MI4 A;  4MFZ A;  3CXQ A;  1QSO A;  4C68 A;  4L89 A;  2BL1 A;  2Q7B A;  4JJX A;  5G21 A;  2Q04 A;  3DNS A;  4UFW A;  4JXR A;  4CGP A;  3DR6 A;  4R3K A;  3GKR A;  1YVK A;  2HV2 A;  1S7L A;  2PC1 A;  1R57 A;  4CAX A;  2KCW A;  1KUV A;  1SQH A;  3MGD A;  4KOT A;  1Q2Y A;  4C7I A;  2DXQ A;  1QSR A;  4HNY B;  3ZZI A;  1KUY A;  1S7N A;  1ON0 A;  3F0A A;  4RS2 A;  3JTK A;  4UWJ A;  2OU2 A;  3JUW A;  4C2X A;  4CAV A;  1S60 A;  4RI1 A;  3D2P A;  1RO5 A;  3PZJ A;  5HMN A;  4MFJ A;  1BO4 A;  1P4N A;  5IB0 A;  1VKC A;  1S5K A;  2HQY A;  3K9U A;  5ISV A;  2D4O A;  1QSN A;  3H4Q A;  4KLV A;  3EFA A;  4B5P A;  5EC4 A;  2JDC A;  2EVN A;  2B58 A;  3EXN A;  4C2Z A;  2H5M A;  3TT2 A;  4KOU A;  2PDO A;  4Q36 A;  3TTH A;  4MBU A;  4BMH A;  2G0B A;  4CAW A;  3EC4 A;  1CM0 A;  1NE9 A;  4M85 A;  3IWE A;  5J8C A;  4A32 A;  2HUZ A;  2FS5 A;  3W91 A;  4KS9 A;  2Y0M A;  4L8A A;  5I0C A;  4KLW A;  4KVX A;  2CY2 A;  4ONU A;  4UFX A;  3GY9 A;  1IYK A;  4E2A A;  4PSW A;  1S7F A;  4B11 A;  2FT0 A;  2WPW A;  1Z4E A;  2ATR A;  3C26 A;  3CXS A;  3D2M A;  4Y49 C;  1TIQ A;  2VEZ A;  1GHE A;  4B5P B;  2R8V A;  3H5Z A;  1M44 A;  2G3T A;  2P6E A;  4B10 A;  2OB0 A;  4ZBG A;  3W6X A;  3TFY A;  3RYO A;  3TO6 A;  4XPL A;  3FIX A;  4MY0 A;  1N71 A;  2PR1 A;  3BLN A;  3SXO A;  4B12 A;  4KOX A;  2JLM A;  1YGH A;  2PSW A;  2ZW4 A;  4CGO A;  1M1D A;  4R57 A;  1LRZ A;  5A28 A;  4KOY A;  4CYQ A;  5KTA A;  4MFQ A;  4UA3 A;  5AG5 A;  1Z9U A;  2C27 A;  4PK2 A;  4R87 A;  4QUS A;  3FBU A;  4KUA A;  2B4D A;  2QEC A;  2R7H A;  1VHS A;  3R1K A;  4YGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...