1Z8WA

Structure of mutant pyrrolidone carboxyl peptidase (e192i) from a hyperthermophile, pyrococcus furiosus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
208
structure length
208
Chain Sequence
MKVLVTGFEPFGGEKINPTERIAKDLDGIKIGDAQVFGRVLPVVFGKAKEVLEKTLEEIKPDIAIHVGLAPGRSAISIERIAVNAIDARIPDNEGKKIEDEPIVPGAPTAYFSTLPIKKIMKKLHERGIPAYISNSAGLYLSNYVMYLSLHHSATKGYPKMSGFIHVPYIPEQIIDKIGKGQVPPSMSYEMILEAVKVAIEVALEELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Pyrrolidone-carboxylate peptidase
publication title Completely buried, non-ion-paired glutamic acid contributes favorably to the conformational stability of pyrrolidone carboxyl peptidases from hyperthermophiles.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 70
structure length 208
sequence length 208
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.3: Pyroglutamyl-peptidase I.
pdb deposition date 2005-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01470 Peptidase_C15 Pyroglutamyl peptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.20 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Peptidase C15, pyroglutamyl peptidase I-like 1z8wA00
1IOFA 4GXHA 4HPSA 3RNZA 3RO0A 2EO8A 1A2ZA 1X10A 1X12A 1Z8WA 2DF5A 3LACA 1IOIA 2EBJA 3GIUA 1Z8TA 1AUGA 1IU8A 1Z8XA
chains in the Genus database with same CATH superfamily
3G3SA 4XPLA 1K4JA 3JRUA 4KOUA 2JEVA 3DR8A 4R8FA 3W91A 3FX6A 2QECA 4R6TA 1P0HA 1XEBA 4P45A 1XJOA 2GIVA 2Z0ZA 4NEXA 4NGRA 4OC2A 1YQEA 1QSMA 3PEIA 2DF5A 4W9YA 1Q2CA 4KOXA 4PK3A 4Q7AA 4EVYA 2B4BA 3PFEA 4KLWA 4OMEA 4YRHA 2R1IA 2AFXA 3R95A 5HVGA 4U9ZA 1MK4A 3CT9A 1ZG7A 1CG2A 2Q43A 1M4IA 1LFWA 3FB3A 4ZYQA 2PJ3A 4UF4A 4P6YA 4PSXA 1GYTA 3B3VA 3TTHA 4AB7A 3VATA 2ANPA 1AYEA 2NYQA 2Q4ZA 5AG5A 4Q38A 4FD7A 1JWQA 4C68A 2PJ5A 3PB7X 4MFJA 4XNHC 1S7NA 3RNZA 1I21A 2REEA 4RUHA 2ZEEA 2GE3A 4OIWA 1YMEA 2PJ6A 1FY7A 3KGQA 4CGMA 4RI1A 2HC9A 3FF3A 5CPAA 4HNXB 4DNCA 2VZZA 4YWYA 4X2TA 2CTBA 4JD6A 2CIJA 2G3TA 3B35A 5A28A 2ZW5A 3CXPA 4KSAA 3V38A 5F46A 4BINA 1RO5A 4L8AA 2FVGA 4MFKA 3KKWA 2XEIA 4F0YA 2FCKA 2FL4A 5AG7A 2P6EA 2ZEDA 2ZPAA 4IHMA 5G1ZA 3BI1A 2PJ1A 5HVHA 4KOTA 3B3WA 2PC1A 5CBMA 1KUVA 4ZX8A 4F0XA 2JBKA 4MHYA 3R96A 2OZUA 3LD2A 1X12A 3PFOA 4K30A 4KVOE 2VEZA 1VHSA 2HUZA 4B5PB 5LYDA 4JXRA 4P4FA 2CNMA 2O53A 4Y49B 3TO9A 1V0CA 2IJZA 3H4QA 4FAIA 2AE6A 1IIDA 3PB4X 4NGTA 4UEEA 4RN7A 1NMTA 1ELMP 5J8FA 5ISVA 2OR4A 4UFVA 2BSWA 4G1PA 3HUVA 3S9MA 3D8PA 1CPXA 3KR4A 2AJ6A 3D7HA 1NSLA 1IU8A 2JEWA 1KWMA 1OZPA 1S7KA 4JXQA 1S7LA 1R3NA 4P4BA 2C6GA 5BWAB 4F9UA 3T90A 1KZFA 4IUSA 4NJQA 1BPMA 2Z3NA 1WK4A 4E0AA 5LYFA 1CX8A 2I3CA 1PCAA 2GREA 2AFUA 5F48A 4PSWA 2GU2A 5F49A 3E0KA 2YNCC 4X8IA 1NE9A 2JLMA 5IB9A 2OZGA 2ZEGA 4UIBA 1PU9A 1IY7A 2WSAA 3P2FA 3SI0A 2V8GA 3ISXA 3EC4A 4CYOA 1OBRA 1YLEA 2PRBA 4HKFA 3TFYA 2WPXA 3FH4A 2Q4YA 4H6UA 4ZX9A 1BPNA 4KS9A 3BLNA 4OADA 1Z5RA 1XRYA 4OC0A 3H8GA 4F9VA 4NXYA 1CM0A 3L2NA 3WR7A 1IOFA 3IC1A 3CXSA 4A30A 2P6GA 3G8WA 4R3LA 4XPDC 1Z4RA 4BD9A 4AVCA 2PSWA 3FMCA 4OAEA 4OC4A 3RO0A 2Z3PA 1XE4A 2J9AA 4BBHA 3B8GA 3S6GA 5LRGA 4IK2A 4UWJA 5FVJA 1QMUA 2Q04A 3PBEA 3IU2A 4KOVA 4QB9A 3FXTA 2Q44A 2DXQA 4LX9A 2YNCA 5D29A 4K3NA 1RXTA 3TOAA 1PUAA 5F09A 4UCPA 1YVOA 4NFRA 3WT4A 1HDQA 4PV6A 3SXNA 3K2KA 4QUSA 2REFA 4LQ6A 4P4JA 3VH9A 4OC3A 2PJ2A 4B6ZA 4M3SA 1M4LA 1ZG8A 2BCOA 4JYWA 3K9UA 1Q7LA 3D3SA 2PJ8A 3C26A 4IAVA 4MHDA 1B6BA 2BOAA 4P10A 5A27A 5HXDA 2GLJA 4MY0A 2B5GA 2A4NA 1YSJA 4B10A 4FBEA 1ZLIA 4NJRA 5EBVA 1A2ZA 1ZLHA 3SI2A 4OC1A 2VQYA 4HNWB 4B11A 5K8NA 1YGHA 2Z3KA 5DWMA 1N71A 4P44A 3T8WA 2AFZA 2BO9A 3EFAA 3NFZA 4NGQA 3N7ZA 1RTQA 2FS5A 2QYVA 3FRMA 4PK2A 4ZY0A 2POKA 3T9YA 1KUXA 3QAYA 2VXKA 4UBRA 1YK3A 1YREA 4NGPA 4MI4A 3GLJA 4E2AA 1F2OA 2ZEFA 3B7IA 3JUWA 2G0BA 4ZGYB 5KTCA 2EWBA 2F7VA 2Q51A 4KOYA 4LUAA 3ISZA 4OC5A 4RS2A 5DS0A 2BUEA 3VWEA 2NMTA 5THWA 4YU9A 2VL1A 3IWGA 1CPSA 4MFQA 3KQZA 4OIDA 4PPZA 4M6GA 3GYAA 3PRTA 4KSIA 1LCPA 4MCSA 4A2ZA 4JLYA 3SJXA 1Y7RA 2DPSA 3FVLA 3RBUA 4CGNA 2X7BA 3FIXA 5G20A 2KCWA 1IOIA 1XBUA 4IF5A 5LYIA 2PJ4A 3B2YA 3D2PA 2QIRA 3MN8A 3BI0A 4H6ZA 2EBJA 4I49A 4UA3A 2D4OA 2O4HA 4UFXA 4AG9A 1ARLA 3NH4A 5EMIA 3FNCA 4ZY2A 1FNOA 3NH5A 2XEGA 3R9GA 2B58A 4C7HA 5J1QA 1LAPA 5HVFA 2DEAA 3IO1A 3H8FA 3BJ8A 4AXVA 1R57A 1QSNA 4NGSA 1TF8A 2PQ8A 3I3GA 1BLLE 3P2HA 2PJ0A 3SJEA 4CGOA 3H5ZA 1S60A 4KLVA 2OZHA 4A94A 4MBUA 4KVXA 1M4GA 1XMTA 3F8KA 5LRKA 1UWYA 5H84A 1Q2DA 3PB8X 3LMSA 4A39A 3KHXA 3KZWA 4M6HA 3QNVA 4P4IA 3LODA 2ZEHA 5HMNA 4GM5A 3LACA 4MHPA 4NGNA 1KUYA 3MRUA 1LOKA 3TT2A 8CPAA 1I1DA 2AFSA 2PIYA 1YLOA 4MCQA 2ZEOA 5LRJA 2C6PA 3V8IA 2WPWA 4KZTA 1Z8TA 5IB0A 4F6AA 2QMLA 1BOBA 4ONUA 4B14A 1IYKA 3OWCA 2Q7BA 2FIWA 3IWEA 4YGOA 1YVKA 5AG4A 4DYOA 4NSQA 2B4DB 1S5KA 4X3RA 5KTDA 1IYLA 2OU2A 3D7FA 4H89A 1Y9WA 2J8RA 3KR5A 3CZXA 3UY5A 4XNHB 2ZW7A 4R87A 2AFWA 5AGEA 4CGLA 1GHEA 2XEFA 1LAMA 3ZJ0A 4A33A 4A37A 3W6XA 4C2YA 3DSBA 6CPAA 5IX3A 1Z8LA 4CRZB 3KASA 1ZG9A 1PYTB 3KHZA 4OP4A 4MCRA 2ZW6A 1CP7A 4UEZA 2PRQA 2JBJA 2D4PA 3PBBA 1Z9UA 2YGWA 1H8LA 2Z3LA 2PVWA 1AUGA 2C6CA 3WC7A 5KTAA 3D67A 1XIXA 4MY3A 1ZO0A 3FECA 3A9LA 4C7IA 4KOSA 2RC4A 3N5FA 1XMBA 4PXBA 4HPSA 2I00A 2C1CA 2VI7A 3SHPA 1Y9KA 2IQ6A 2YNDA 2ARHA 2CF4A 5K8MA 2CXAA 2Z11A 3I1UA 4UCNA 5C82A 1M1DA 4MHNA 2IMOA 2HQYA 3HLPA 2V77A 4ONWA 4EFDA 1L0CA 3TO7A 4QBJA 3D68A 4NCZA 4C2XA 4FWUA 3QAHA 1VHOA 3IJ3A 1UFHA 3IU1A 2ZENA 4NGMA 5K8PA 2PJ9A 1F2PA 3GKRA 4P4EA 3TX8A 2ZEPA 3IIBA 5IV0A 3K9TA 1IB1E 4MJ8A 2FT0A 3D4UA 4UWIA 2F5IA 4MXUA 5JH9A 4QVTA 2GANA 4MRIA 2I79A 4PXDA 3S6FA 4J3GA 3SXOA 3F0AA 4KORA 4QC6A 2DPTA 1VGYA 4X5KA 2AFMA 4L89A 3RYOA 5JGFA 1F57A 3TO6A 4FD6A 1I12A 1SQHA 4NF1A 2B3VA 2C27A 3IWWA 5CNPA 2FXFA 1JQGA 3DGVA 4MMOA 3VARA 1BAVA 2GLFA 5JM6A 1TF9A 1YW6A 2OOTA 4CPAA 3BJ7A 4PXCA 3I9SA 3QB8A 4KOWA 4UEFA 1VKCA 3BHXA 4R57A 4GS4A 2OH1A 4M6IA 1VHEA 3PB6X 5JPHA 2Z3MA 3D7GA 2HV2A 1EE3P 4FD4A 4A31A 3B3TA 3WC5A 4UCMA 1HEEA 2JDCA 4BMHA 2PJAA 2P6FA 5K8OA 2PJ7A 3S6HA 2CTCA 2YNEA 2RFHA 5HH1A 1J4JA 4WWVA 2VZYA 7CPAA 1MJAA 2ABZA 1XOVA 2PJCA 2RB7A 3B3SA 2ZEMA 3CXQA 4ZI6A 4EMEA 1TKJA 1AMPA 2B5GB 1BO4A 2PJBA 3CPXA 3NE8A 4PQAA 4XPDB 3TCVA 5J8CA 3S9LA 3KQXA 2WYRA 4Y49C 1MJBA 5C88A 3R1KA 2OB0A 5JQ4A 3PP9A 2ZW4A 4FD5A 4KUAA 2G9DA 2Q0YA 3KI9A 4FUUA 4TWEA 3D7DA 3DR6A 4CGPA 2IL4A 2O28A 3TE4A 1R43A 2J8MA 4YFJA 3F5BA 4KVME 2XEJA 2P0WA 3JTKA 4DUKA 2QJ8A 3IEHA 3B3CA 3S9NA 4KUBA 4R7MA 3FYNA 4GXHA 3TC8A 1VIXA 4MHZA 4F8ZA 1YX0A 3DNSA 4CAXA 4E8OA 4MFPA 2V8HA 4MFLA 2PVVA 3NA6A 3R9EA 3IGRA 1ARMA 1QSOA 4UFWA 4B5PA 3NH8A 4U9YA 1QQ9A 4C2ZA 1TXRA 4M85A 4XPKA 5G22A 1Q2YA 2EVNA 2ODFA 3CDXA 4AVAA 5I0CA 3RAMA 4ORFA 4CYPA 4Z65A 1TKHA 1ELLP 2R7HA 2FIAA 4H2KA 3SI1A 3PGPA 4WJBA 2R98A 3FEEA 4OKOA 1Z8XA 4U5YA 2QVPA 4DJLA 4CYNA 2B4DA 5DWNA 5E96A 1Z2LA 2BL1A 3LWUA 2PR1A 5D8NA 1Y0YA 1IGBA 3VWDA 5AG6A 2Y0MA 1ON0A 1LANA 2Q4VA 2JDDA 2AFOA 5LYLA 1Z8WA 3PB9X 2WZNA 2WUUA 1P4NA 2CNSA 1XFOA 1LRZA 4CYQA 4B5OA 4A32A 4AG7A 2EUIA 5EC4A 1CBXA 3RZAA 4A95A 4O23A 3R9FA 3GUXA 4UIAA 3FBUA 3CPAA 5I4MA 1X10A 1DE4C 2ATRA 2Q7SA 3IFEA 2CNTA 4JZ0A 4AVBA 2ZOFA 4PXEA 2EK8A 1NSAA 2FE7A 3FJUA 1QSTA 3FEDA 3TOBA 2ZELA 3DDDA 5GCNA 2PR8A 2BEIA 4R3KA 2V8VA 1S7FA 2NSMA 1YR0A 1WWZA 2PIZA 2K5TA 4CAEA 1M4DA 4JJXA 4CAVA 3D2MA 3PZJA 1DTDA 4Q36A 3EO4A 2PDOA 4MFZA 1HDUA 1FT7A 3EY5A 3SJFA 1MJ9A 1Y7EA 2PCUA 4MCPA 3W6SA 1Z4EA 2F8HA 2Z10A 1XF8A 3SJGA 3EXNA 1QSRA 1Y0RA 4CRYB 4CAFA 4LQGA 1B87A 4OLLA 4KSFA 5G21A 2V8DA 2ZOGA 4EWTA 4A38A 1U6MA 3MGDA 2Z3OA 4R9MA 3WABA 3WC6A 5F47A 3ZZIA 2H5MA 2EO8A 3D66A 4II9A 2FSRA 1S3ZA 2R8VA 2VBQA 1CJWA 2ZXVA 3BXMA 3DLJA 3GY9A 4HNYB 4CAWA 4CS0B 4ZY1A 4ZBGA 1IICA 4R76A 2B3UA 2EK9A 4B12A 5H86A 3NE7A 2CY2A 4P4DA 5ELYA 3S6KA 4B13A 2G3AA 1CP6A 1TIQA 3H8EA 2HB6A 3KL9A 4JWPA 2GFQA 3GIUA 1TKFA 2J8NA 1YW4A 3GB0A 3JVNA 4TNUA 1M44A 2PE3A 3V7ZA
chains in the Genus database with same CATH topology
1IOFA 4GXHA 4HPSA 3RNZA 3RO0A 2EO8A 1A2ZA 1X10A 1X12A 1Z8WA 2DF5A 3LACA 1IOIA 2EBJA 3GIUA 1Z8TA 1AUGA 1IU8A 1Z8XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IOF A;  4GXH A;  4HPS A;  3RNZ A;  3RO0 A;  2EO8 A;  1A2Z A;  1X10 A;  1X12 A;  1Z8W A;  2DF5 A;  3LAC A;  1IOI A;  2EBJ A;  3GIU A;  1Z8T A;  1AUG A;  1IU8 A;  1Z8X A; 
#chains in the Genus database with same CATH topology
 3G3S A;  4XPL A;  1K4J A;  3JRU A;  4KOU A;  2JEV A;  3DR8 A;  4R8F A;  3W91 A;  3FX6 A;  2QEC A;  4R6T A;  1P0H A;  1XEB A;  4P45 A;  1XJO A;  2GIV A;  2Z0Z A;  4NEX A;  4NGR A;  4OC2 A;  1YQE A;  1QSM A;  3PEI A;  2DF5 A;  4W9Y A;  1Q2C A;  4KOX A;  4PK3 A;  4Q7A A;  4EVY A;  2B4B A;  3PFE A;  4KLW A;  4OME A;  4YRH A;  2R1I A;  2AFX A;  3R95 A;  5HVG A;  4U9Z A;  1MK4 A;  3CT9 A;  1ZG7 A;  1CG2 A;  2Q43 A;  1M4I A;  1LFW A;  3FB3 A;  4ZYQ A;  2PJ3 A;  4UF4 A;  4P6Y A;  4PSX A;  1GYT A;  3B3V A;  3TTH A;  4AB7 A;  3VAT A;  2ANP A;  1AYE A;  2NYQ A;  2Q4Z A;  5AG5 A;  4Q38 A;  4FD7 A;  1JWQ A;  4C68 A;  2PJ5 A;  3PB7 X;  4MFJ A;  4XNH C;  1S7N A;  3RNZ A;  1I21 A;  2REE A;  4RUH A;  2ZEE A;  2GE3 A;  4OIW A;  1YME A;  2PJ6 A;  1FY7 A;  3KGQ A;  4CGM A;  4RI1 A;  2HC9 A;  3FF3 A;  5CPA A;  4HNX B;  4DNC A;  2VZZ A;  4YWY A;  4X2T A;  2CTB A;  4JD6 A;  2CIJ A;  2G3T A;  3B35 A;  5A28 A;  2ZW5 A;  3CXP A;  4KSA A;  3V38 A;  5F46 A;  4BIN A;  1RO5 A;  4L8A A;  2FVG A;  4MFK A;  3KKW A;  2XEI A;  4F0Y A;  2FCK A;  2FL4 A;  5AG7 A;  2P6E A;  2ZED A;  2ZPA A;  4IHM A;  5G1Z A;  3BI1 A;  2PJ1 A;  5HVH A;  4KOT A;  3B3W A;  2PC1 A;  5CBM A;  1KUV A;  4ZX8 A;  4F0X A;  2JBK A;  4MHY A;  3R96 A;  2OZU A;  3LD2 A;  1X12 A;  3PFO A;  4K30 A;  4KVO E;  2VEZ A;  1VHS A;  2HUZ A;  4B5P B;  5LYD A;  4JXR A;  4P4F A;  2CNM A;  2O53 A;  4Y49 B;  3TO9 A;  1V0C A;  2IJZ A;  3H4Q A;  4FAI A;  2AE6 A;  1IID A;  3PB4 X;  4NGT A;  4UEE A;  4RN7 A;  1NMT A;  1ELM P;  5J8F A;  5ISV A;  2OR4 A;  4UFV A;  2BSW A;  4G1P A;  3HUV A;  3S9M A;  3D8P A;  1CPX A;  3KR4 A;  2AJ6 A;  3D7H A;  1NSL A;  1IU8 A;  2JEW A;  1KWM A;  1OZP A;  1S7K A;  4JXQ A;  1S7L A;  1R3N A;  4P4B A;  2C6G A;  5BWA B;  4F9U A;  3T90 A;  1KZF A;  4IUS A;  4NJQ A;  1BPM A;  2Z3N A;  1WK4 A;  4E0A A;  5LYF A;  1CX8 A;  2I3C A;  1PCA A;  2GRE A;  2AFU A;  5F48 A;  4PSW A;  2GU2 A;  5F49 A;  3E0K A;  2YNC C;  4X8I A;  1NE9 A;  2JLM A;  5IB9 A;  2OZG A;  2ZEG A;  4UIB A;  1PU9 A;  1IY7 A;  2WSA A;  3P2F A;  3SI0 A;  2V8G A;  3ISX A;  3EC4 A;  4CYO A;  1OBR A;  1YLE A;  2PRB A;  4HKF A;  3TFY A;  2WPX A;  3FH4 A;  2Q4Y A;  4H6U A;  4ZX9 A;  1BPN A;  4KS9 A;  3BLN A;  4OAD A;  1Z5R A;  1XRY A;  4OC0 A;  3H8G A;  4F9V A;  4NXY A;  1CM0 A;  3L2N A;  3WR7 A;  1IOF A;  3IC1 A;  3CXS A;  4A30 A;  2P6G A;  3G8W A;  4R3L A;  4XPD C;  1Z4R A;  4BD9 A;  4AVC A;  2PSW A;  3FMC A;  4OAE A;  4OC4 A;  3RO0 A;  2Z3P A;  1XE4 A;  2J9A A;  4BBH A;  3B8G A;  3S6G A;  5LRG A;  4IK2 A;  4UWJ A;  5FVJ A;  1QMU A;  2Q04 A;  3PBE A;  3IU2 A;  4KOV A;  4QB9 A;  3FXT A;  2Q44 A;  2DXQ A;  4LX9 A;  2YNC A;  5D29 A;  4K3N A;  1RXT A;  3TOA A;  1PUA A;  5F09 A;  4UCP A;  1YVO A;  4NFR A;  3WT4 A;  1HDQ A;  4PV6 A;  3SXN A;  3K2K A;  4QUS A;  2REF A;  4LQ6 A;  4P4J A;  3VH9 A;  4OC3 A;  2PJ2 A;  4B6Z A;  4M3S A;  1M4L A;  1ZG8 A;  2BCO A;  4JYW A;  3K9U A;  1Q7L A;  3D3S A;  2PJ8 A;  3C26 A;  4IAV A;  4MHD A;  1B6B A;  2BOA A;  4P10 A;  5A27 A;  5HXD A;  2GLJ A;  4MY0 A;  2B5G A;  2A4N A;  1YSJ A;  4B10 A;  4FBE A;  1ZLI A;  4NJR A;  5EBV A;  1A2Z A;  1ZLH A;  3SI2 A;  4OC1 A;  2VQY A;  4HNW B;  4B11 A;  5K8N A;  1YGH A;  2Z3K A;  5DWM A;  1N71 A;  4P44 A;  3T8W A;  2AFZ A;  2BO9 A;  3EFA A;  3NFZ A;  4NGQ A;  3N7Z A;  1RTQ A;  2FS5 A;  2QYV A;  3FRM A;  4PK2 A;  4ZY0 A;  2POK A;  3T9Y A;  1KUX A;  3QAY A;  2VXK A;  4UBR A;  1YK3 A;  1YRE A;  4NGP A;  4MI4 A;  3GLJ A;  4E2A A;  1F2O A;  2ZEF A;  3B7I A;  3JUW A;  2G0B A;  4ZGY B;  5KTC A;  2EWB A;  2F7V A;  2Q51 A;  4KOY A;  4LUA A;  3ISZ A;  4OC5 A;  4RS2 A;  5DS0 A;  2BUE A;  3VWE A;  2NMT A;  5THW A;  4YU9 A;  2VL1 A;  3IWG A;  1CPS A;  4MFQ A;  3KQZ A;  4OID A;  4PPZ A;  4M6G A;  3GYA A;  3PRT A;  4KSI A;  1LCP A;  4MCS A;  4A2Z A;  4JLY A;  3SJX A;  1Y7R A;  2DPS A;  3FVL A;  3RBU A;  4CGN A;  2X7B A;  3FIX A;  5G20 A;  2KCW A;  1IOI A;  1XBU A;  4IF5 A;  5LYI A;  2PJ4 A;  3B2Y A;  3D2P A;  2QIR A;  3MN8 A;  3BI0 A;  4H6Z A;  2EBJ A;  4I49 A;  4UA3 A;  2D4O A;  2O4H A;  4UFX A;  4AG9 A;  1ARL A;  3NH4 A;  5EMI A;  3FNC A;  4ZY2 A;  1FNO A;  3NH5 A;  2XEG A;  3R9G A;  2B58 A;  4C7H A;  5J1Q A;  1LAP A;  5HVF A;  2DEA A;  3IO1 A;  3H8F A;  3BJ8 A;  4AXV A;  1R57 A;  1QSN A;  4NGS A;  1TF8 A;  2PQ8 A;  3I3G A;  1BLL E;  3P2H A;  2PJ0 A;  3SJE A;  4CGO A;  3H5Z A;  1S60 A;  4KLV A;  2OZH A;  4A94 A;  4MBU A;  4KVX A;  1M4G A;  1XMT A;  3F8K A;  5LRK A;  1UWY A;  5H84 A;  1Q2D A;  3PB8 X;  3LMS A;  4A39 A;  3KHX A;  3KZW A;  4M6H A;  3QNV A;  4P4I A;  3LOD A;  2ZEH A;  5HMN A;  4GM5 A;  3LAC A;  4MHP A;  4NGN A;  1KUY A;  3MRU A;  1LOK A;  3TT2 A;  8CPA A;  1I1D A;  2AFS A;  2PIY A;  1YLO A;  4MCQ A;  2ZEO A;  5LRJ A;  2C6P A;  3V8I A;  2WPW A;  4KZT A;  1Z8T A;  5IB0 A;  4F6A A;  2QML A;  1BOB A;  4ONU A;  4B14 A;  1IYK A;  3OWC A;  2Q7B A;  2FIW A;  3IWE A;  4YGO A;  1YVK A;  5AG4 A;  4DYO A;  4NSQ A;  2B4D B;  1S5K A;  4X3R A;  5KTD A;  1IYL A;  2OU2 A;  3D7F A;  4H89 A;  1Y9W A;  2J8R A;  3KR5 A;  3CZX A;  3UY5 A;  4XNH B;  2ZW7 A;  4R87 A;  2AFW A;  5AGE A;  4CGL A;  1GHE A;  2XEF A;  1LAM A;  3ZJ0 A;  4A33 A;  4A37 A;  3W6X A;  4C2Y A;  3DSB A;  6CPA A;  5IX3 A;  1Z8L A;  4CRZ B;  3KAS A;  1ZG9 A;  1PYT B;  3KHZ A;  4OP4 A;  4MCR A;  2ZW6 A;  1CP7 A;  4UEZ A;  2PRQ A;  2JBJ A;  2D4P A;  3PBB A;  1Z9U A;  2YGW A;  1H8L A;  2Z3L A;  2PVW A;  1AUG A;  2C6C A;  3WC7 A;  5KTA A;  3D67 A;  1XIX A;  4MY3 A;  1ZO0 A;  3FEC A;  3A9L A;  4C7I A;  4KOS A;  2RC4 A;  3N5F A;  1XMB A;  4PXB A;  4HPS A;  2I00 A;  2C1C A;  2VI7 A;  3SHP A;  1Y9K A;  2IQ6 A;  2YND A;  2ARH A;  2CF4 A;  5K8M A;  2CXA A;  2Z11 A;  3I1U A;  4UCN A;  5C82 A;  1M1D A;  4MHN A;  2IMO A;  2HQY A;  3HLP A;  2V77 A;  4ONW A;  4EFD A;  1L0C A;  3TO7 A;  4QBJ A;  3D68 A;  4NCZ A;  4C2X A;  4FWU A;  3QAH A;  1VHO A;  3IJ3 A;  1UFH A;  3IU1 A;  2ZEN A;  4NGM A;  5K8P A;  2PJ9 A;  1F2P A;  3GKR A;  4P4E A;  3TX8 A;  2ZEP A;  3IIB A;  5IV0 A;  3K9T A;  1IB1 E;  4MJ8 A;  2FT0 A;  3D4U A;  4UWI A;  2F5I A;  4MXU A;  5JH9 A;  4QVT A;  2GAN A;  4MRI A;  2I79 A;  4PXD A;  3S6F A;  4J3G A;  3SXO A;  3F0A A;  4KOR A;  4QC6 A;  2DPT A;  1VGY A;  4X5K A;  2AFM A;  4L89 A;  3RYO A;  5JGF A;  1F57 A;  3TO6 A;  4FD6 A;  1I12 A;  1SQH A;  4NF1 A;  2B3V A;  2C27 A;  3IWW A;  5CNP A;  2FXF A;  1JQG A;  3DGV A;  4MMO A;  3VAR A;  1BAV A;  2GLF A;  5JM6 A;  1TF9 A;  1YW6 A;  2OOT A;  4CPA A;  3BJ7 A;  4PXC A;  3I9S A;  3QB8 A;  4KOW A;  4UEF A;  1VKC A;  3BHX A;  4R57 A;  4GS4 A;  2OH1 A;  4M6I A;  1VHE A;  3PB6 X;  5JPH A;  2Z3M A;  3D7G A;  2HV2 A;  1EE3 P;  4FD4 A;  4A31 A;  3B3T A;  3WC5 A;  4UCM A;  1HEE A;  2JDC A;  4BMH A;  2PJA A;  2P6F A;  5K8O A;  2PJ7 A;  3S6H A;  2CTC A;  2YNE A;  2RFH A;  5HH1 A;  1J4J A;  4WWV A;  2VZY A;  7CPA A;  1MJA A;  2ABZ A;  1XOV A;  2PJC A;  2RB7 A;  3B3S A;  2ZEM A;  3CXQ A;  4ZI6 A;  4EME A;  1TKJ A;  1AMP A;  2B5G B;  1BO4 A;  2PJB A;  3CPX A;  3NE8 A;  4PQA A;  4XPD B;  3TCV A;  5J8C A;  3S9L A;  3KQX A;  2WYR A;  4Y49 C;  1MJB A;  5C88 A;  3R1K A;  2OB0 A;  5JQ4 A;  3PP9 A;  2ZW4 A;  4FD5 A;  4KUA A;  2G9D A;  2Q0Y A;  3KI9 A;  4FUU A;  4TWE A;  3D7D A;  3DR6 A;  4CGP A;  2IL4 A;  2O28 A;  3TE4 A;  1R43 A;  2J8M A;  4YFJ A;  3F5B A;  4KVM E;  2XEJ A;  2P0W A;  3JTK A;  4DUK A;  2QJ8 A;  3IEH A;  3B3C A;  3S9N A;  4KUB A;  4R7M A;  3FYN A;  4GXH A;  3TC8 A;  1VIX A;  4MHZ A;  4F8Z A;  1YX0 A;  3DNS A;  4CAX A;  4E8O A;  4MFP A;  2V8H A;  4MFL A;  2PVV A;  3NA6 A;  3R9E A;  3IGR A;  1ARM A;  1QSO A;  4UFW A;  4B5P A;  3NH8 A;  4U9Y A;  1QQ9 A;  4C2Z A;  1TXR A;  4M85 A;  4XPK A;  5G22 A;  1Q2Y A;  2EVN A;  2ODF A;  3CDX A;  4AVA A;  5I0C A;  3RAM A;  4ORF A;  4CYP A;  4Z65 A;  1TKH A;  1ELL P;  2R7H A;  2FIA A;  4H2K A;  3SI1 A;  3PGP A;  4WJB A;  2R98 A;  3FEE A;  4OKO A;  1Z8X A;  4U5Y A;  2QVP A;  4DJL A;  4CYN A;  2B4D A;  5DWN A;  5E96 A;  1Z2L A;  2BL1 A;  3LWU A;  2PR1 A;  5D8N A;  1Y0Y A;  1IGB A;  3VWD A;  5AG6 A;  2Y0M A;  1ON0 A;  1LAN A;  2Q4V A;  2JDD A;  2AFO A;  5LYL A;  1Z8W A;  3PB9 X;  2WZN A;  2WUU A;  1P4N A;  2CNS A;  1XFO A;  1LRZ A;  4CYQ A;  4B5O A;  4A32 A;  4AG7 A;  2EUI A;  5EC4 A;  1CBX A;  3RZA A;  4A95 A;  4O23 A;  3R9F A;  3GUX A;  4UIA A;  3FBU A;  3CPA A;  5I4M A;  1X10 A;  1DE4 C;  2ATR A;  2Q7S A;  3IFE A;  2CNT A;  4JZ0 A;  4AVB A;  2ZOF A;  4PXE A;  2EK8 A;  1NSA A;  2FE7 A;  3FJU A;  1QST A;  3FED A;  3TOB A;  2ZEL A;  3DDD A;  5GCN A;  2PR8 A;  2BEI A;  4R3K A;  2V8V A;  1S7F A;  2NSM A;  1YR0 A;  1WWZ A;  2PIZ A;  2K5T A;  4CAE A;  1M4D A;  4JJX A;  4CAV A;  3D2M A;  3PZJ A;  1DTD A;  4Q36 A;  3EO4 A;  2PDO A;  4MFZ A;  1HDU A;  1FT7 A;  3EY5 A;  3SJF A;  1MJ9 A;  1Y7E A;  2PCU A;  4MCP A;  3W6S A;  1Z4E A;  2F8H A;  2Z10 A;  1XF8 A;  3SJG A;  3EXN A;  1QSR A;  1Y0R A;  4CRY B;  4CAF A;  4LQG A;  1B87 A;  4OLL A;  4KSF A;  5G21 A;  2V8D A;  2ZOG A;  4EWT A;  4A38 A;  1U6M A;  3MGD A;  2Z3O A;  4R9M A;  3WAB A;  3WC6 A;  5F47 A;  3ZZI A;  2H5M A;  2EO8 A;  3D66 A;  4II9 A;  2FSR A;  1S3Z A;  2R8V A;  2VBQ A;  1CJW A;  2ZXV A;  3BXM A;  3DLJ A;  3GY9 A;  4HNY B;  4CAW A;  4CS0 B;  4ZY1 A;  4ZBG A;  1IIC A;  4R76 A;  2B3U A;  2EK9 A;  4B12 A;  5H86 A;  3NE7 A;  2CY2 A;  4P4D A;  5ELY A;  3S6K A;  4B13 A;  2G3A A;  1CP6 A;  1TIQ A;  3H8E A;  2HB6 A;  3KL9 A;  4JWP A;  2GFQ A;  3GIU A;  1TKF A;  2J8N A;  1YW4 A;  3GB0 A;  3JVN A;  4TNU A;  1M44 A;  2PE3 A;  3V7Z A; 
#chains in the Genus database with same CATH homology
 1IOF A;  4GXH A;  4HPS A;  3RNZ A;  3RO0 A;  2EO8 A;  1A2Z A;  1X10 A;  1X12 A;  1Z8W A;  2DF5 A;  3LAC A;  1IOI A;  2EBJ A;  3GIU A;  1Z8T A;  1AUG A;  1IU8 A;  1Z8X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...