2VEZA

Afgna1 crystal structure complexed with acetyl-coa and glucose-6p gives new insights into catalysis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
165
structure length
165
Chain Sequence
ENTPLFSPSLISPDVLAVLPADYTIRPLCRSDYKRGYLDVLRVLTTVGDINEEQWNSRYEWIRARSDEYYLLVVCDGEGRIVGTGSLVVERKFIHSLGMVGHIEDIAVEKGQQGKKLGLRIIQALDYVAEKVGCYKTILDCSEANEGFYIKCGFKRAGLEMAHYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Glucose-6-Phosphate as a Probe for the Glucosamine- 6-Phosphate N-Acetyltransferase Michaelis Complex.
pubmed doi rcsb
source organism Aspergillus fumigatus
molecule tags Transferase
molecule keywords PUTATIVE GLUCOSAMINE 6-PHOSPHATE ACETYLTRANSFERASE
total genus 46
structure length 165
sequence length 165
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2007-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2vezA01
4GS4A 4YGOA 1PU9A 3V8IA 2FIWA 1M44A 1YLEA 3W91A 3R96A 1XIXA 2ZW5A 4KLVA 2JDDA 4JJXA 3EXNA 1YREA 1KZFA 3P2FA 3PP9A 4JXRA 5I0CA 3F8KA 2FCKA 3BLNA 3H4QA 3TOAA 4MY3A 3F5BA 2ZPAA 3DNSA 2FXFA 2REEA 3PZJA 4RI1A 5EBVA 3JVNA 4XPKA 4MI4A 3S6HA 1U6MA 2HQYA 2Q7BA 1KUXA 2Z0ZA 1M1DA 2REFA 3R9GA 4HNXB 4ORFA 5E96A 1B87A 4CAWA 3C26A 1S3ZA 4KORA 5H86A 4U9YA 4KOTA 5DWNA 2NMTA 1Q2CA 1WWZA 2PQ8A 4II9A 3N7ZA 2HUZA 3P2HA 4PSXA 2BL1A 5ISVA 4QBJA 4YRHA 4PV6A 4KVOE 3OWCA 2VEZA 5KTCA 3G8WA 3G3SA 3LODA 4NF1A 4AB7A 2R7HA 1QSMA 2J8RA 4MHDA 2OU2A 3F0AA 4QVTA 1RO5A 2D4OA 1YVKA 3NE7A 1UFHA 3S6FA 1Z4EA 2J8NA 1YR0A 2P6GA 4UA3A 4EVYA 1SQHA 1R57A 2VQYA 2ZW4A 2BEIA 2FS5A 4JD6A 2ZW7A 2Q44A 4R3LA 5JPHA 3EC4A 4HKFA 4XNHC 2B5GB 3PGPA 2X7BA 4K30A 4E8OA 2B3VA 2WPXA 5F46A 5JQ4A 3DR8A 4XNHB 3E0KA 4MBUA 1KUYA 1XF8A 1S7LA 2ZW6A 3VWDA 3T9YA 1GHEA 2KCWA 2EVNA 3FNCA 4J3GA 2H5MA 1M4DA 2I00A 2IL4A 3EFAA 2B58A 3D3SA 3TT2A 5H84A 3SXOA 4UBRA 2RC4A 4JLYA 2F5IA 1Y9KA 4R3KA 3R9FA 4IUSA 3MGDA 2GIVA 4KOYA 4E2AA 2B3UA 2O28A 2QIRA 4NCZA 4OAEA 1M4IA 4U9ZA 5HMNA 4UWIA 1MJ9A 3S6GA 4L89A 2GANA 2R98A 5DWMA 2B5GA 3I3GA 2PR1A 4R9MA 3TO7A 4XPDB 5FVJA 3IWGA 2P6FA 4QB9A 3RYOA 3W6XA 1IYLA 1WK4A 1VKCA 3UY5A 2I79A 2OZGA 2Q04A 5J8FA 4BMHA 3LD2A 5HH1A 1LRZA 1YVOA 1Z4RA 2OB0A 4AVCA 4KOWA 1YX0A 5F49A 3TFYA 1QSTA 4Y49B 3QB8A 4H6UA 2FIAA 4CRZB 2HV2A 4ZBGA 4F0YA 2Q4YA 2JDCA 1P4NA 3B8GA 1RXTA 4YFJA 2AJ6A 2G3AA 1VHSA 3FB3A 2VXKA 4KOXA 1IICA 2PR8A 4PK2A 4JWPA 1CM0A 3QAHA 1OZPA 3TTHA 4UWJA 1XE4A 5C82A 3FYNA 4NSQA 1NE9A 2VI7A 5C88A 3VWEA 1IIDA 4X5KA 2QMLA 3TCVA 1PUAA 1I1DA 4ONUA 5F48A 4CS0B 4R57A 3IGRA 3SXNA 4U5YA 4M85A 2FE7A 1I12A 2P6EA 1YGHA 3BJ8A 3KKWA 4JXQA 2ARHA 3D2PA 2QECA 2VBQA 3GYAA 1CJWA 4KOSA 4RS2A 3DR6A 3GKRA 4AG9A 1QSRA 1Q2DA 1S7FA 2PRBA 4R87A 3FBUA 2CNMA 1N71A 4KOUA 4L8AA 1K4JA 2BUEA 4KUAA 5IV0A 2K5TA 2OZHA 2R1IA 1XEBA 4OADA 2FSRA 2VZZA 2ATRA 3T90A 1M4GA 4CAVA 4FD6A 3EY5A 1ON0A 3TO6A 2R8VA 2CNSA 4KVME 2FL4A 2P0WA 2Z10A 1FY7A 1NMTA 4FD7A 2AE6A 1IYKA 1BO4A 2WPWA 3DDDA 1MJBA 4KVXA 4PSWA 2Q4VA 1QSOA 3I9SA 5GCNA 4E0AA 1KUVA 4DNCA 1L0CA 3ZZIA 3D2MA 1V0CA 1MK4A 1S7NA 4KOVA 4NXYA 4MJ8A 4FD4A 2Z11A 3GY9A 2J8MA 4FD5A 3K9UA 4Y49C 4HNYB 1IB1E 3CXSA 2PSWA 4AVAA 3TE4A 1S60A 5KTDA 5IX3A 4OLLA 5IB0A 2CY2A 4HNWB 2OZUA 4CRYB 1QSNA 4MY0A 5KTAA 1J4JA 2DXQA 3BJ7A 1B6BA 4M3SA 2B4DA 2JEVA 3R1KA 4B5PA 2C27A 3FXTA 3S6KA 4XPDC 5F47A 3R95A 2A4NA 3JUWA 4B5OA 2D4PA 2G3TA 2PC1A 2GE3A 4KZTA 3FIXA 4H89A 3ZJ0A 3D8PA 4IF5A 3FRMA 4KLWA 2PDOA 3WR7A 2BSWA 3SHPA 4NEXA 2OH1A 4XPLA 3CXPA 3DSBA 1P0HA 1Y7RA 2ZXVA 2B4BA 4LUAA 3R9EA 3CXQA 4CAXA 2JLMA 2CNTA 1Y9WA 4QUSA 2FT0A 5J8CA 1TIQA 4LX9A 2G0BA 5CNPA 3TO9A 1YK3A 1Z9UA 4PK3A 4I49A 1NSLA 4AVBA 1XMTA 4H6ZA 5EC4A 2Y0MA 4F6AA 1BOBA 1I21A 1MJAA 3W6SA 2B4DB 4AG7A 3TOBA 2EUIA 4B5PB 1S7KA 2Q0YA 2VZYA 4QC6A 3EO4A 1S5KA 1Q2YA 4KUBA
chains in the Genus database with same CATH superfamily
4GS4A 4YGOA 1IOIA 1XMBA 3ISZA 1PU9A 3H8GA 3RZAA 1F2OA 3PB4X 1DE4C 3V8IA 5AG7A 2Q51A 2FIWA 1M44A 1YLEA 3QNVA 3FEEA 5G21A 3R96A 3W91A 3PFEA 1XIXA 1Z2LA 2GFQA 2JEWA 2RB7A 2ZEHA 3RAMA 2ZW5A 4F9VA 4UFVA 4KLVA 4CAEA 4P4DA 4MMOA 3B3CA 4TWEA 3KHZA 4FUUA 1VGYA 2ZEFA 1TKFA 2F8HA 3PFOA 7CPAA 4OC5A 3PB6X 3WC5A 5G22A 2JDDA 1IU8A 4JJXA 4MCPA 4MFQA 3EXNA 2F7VA 1YREA 2IMOA 4C2YA 1KZFA 3P2FA 3PP9A 2QYVA 3IWWA 4ZYQA 1X10A 4JXRA 5I0CA 3F8KA 2FCKA 2IQ6A 2Z3NA 3BLNA 3H4QA 4P4IA 3TOAA 4MY3A 3F5BA 4X2TA 1YW6A 1TF9A 2ZPAA 3DNSA 2PE3A 2FXFA 2REEA 2Z3PA 3PZJA 4MFZA 4RI1A 3PB9X 3JVNA 4XPKA 4MI4A 5EBVA 3S6HA 1U6MA 2HQYA 2JBJA 1A2ZA 2Q7BA 1KWMA 1ZO0A 4B14A 3IWEA 1KUXA 2Z0ZA 1M1DA 4MHPA 2REFA 3R9GA 3RNZA 4HNXB 2CXAA 2AFXA 1F57A 4ORFA 1B87A 3BI1A 3FEDA 5E96A 2CIJA 2ZENA 3C26A 4G1PA 4CAWA 3H8EA 1S3ZA 2PJ0A 4KORA 5H86A 4U9YA 5K8PA 4C7IA 4KOTA 3KL9A 4C2ZA 5DWNA 2NMTA 3FJUA 4MFLA 1Q2CA 1WWZA 2PIYA 2PQ8A 3N7ZA 3SJGA 2HUZA 4II9A 3P2HA 2V8VA 2BL1A 3H8FA 4IK2A 4PSXA 2WSAA 2PCUA 4RUHA 5ISVA 4UEEA 4QBJA 4YRHA 3D68A 4PV6A 4KVOE 4PXBA 3OWCA 2VEZA 4CGMA 2PJ4A 1LAMA 4UIBA 4C68A 5KTCA 3KQXA 3G8WA 3G3SA 3LODA 4B6ZA 4NF1A 2DF5A 3VARA 4UCPA 4AB7A 2R7HA 5J1QA 1QSMA 2ABZA 2J8RA 2V77A 1GYTA 2OR4A 2PVWA 3JRUA 2WYRA 4MHDA 2OU2A 1Z8TA 2FVGA 3D7FA 3F0AA 4QVTA 1RO5A 2D4OA 4NGMA 5D8NA 3S9LA 1YVKA 3NE7A 1UFHA 4B13A 3D4UA 2POKA 2V8GA 3FF3A 1QQ9A 3VATA 4ZI6A 1LFWA 3KR4A 3FMCA 3KR5A 3S6FA 3V38A 1Z4EA 1EE3P 4P10A 2J8NA 1YR0A 2P6GA 4K3NA 4MHZA 4UA3A 4EVYA 1SQHA 1R57A 4CYNA 2C1CA 2VQYA 5HXDA 2ZW4A 2BEIA 4CYQA 3DGVA 2AFOA 2FS5A 2NSMA 4JD6A 3SJFA 4Z65A 2ZW7A 4A2ZA 5AG6A 2Q44A 4R76A 4R3LA 4EWTA 6CPAA 5JPHA 2JBKA 3EC4A 1RTQA 4HKFA 4XNHC 2B5GB 3PGPA 2X7BA 4M6IA 4K30A 4PXEA 3GUXA 4E8OA 2B3VA 4TNUA 2WPXA 5F46A 5JQ4A 1DTDA 2IJZA 3IIBA 4UF4A 3RBUA 5AG5A 4A37A 1LOKA 3DR8A 4XNHB 3E0KA 4MBUA 1KUYA 2C6CA 3HLPA 3B3VA 4DYOA 1XF8A 1S7LA 3LMSA 3D7GA 4P4JA 2ZW6A 3VWDA 5CPAA 1CP6A 3T9YA 1GHEA 3IJ3A 2KCWA 1BPMA 2EVNA 3FNCA 4J3GA 4LQ6A 1R43A 2G9DA 2H5MA 1XFOA 1M4DA 2I00A 2IL4A 3EFAA 3WABA 2PJ8A 4W9YA 2PIZA 4MHYA 4Q38A 4JYWA 2B58A 3B3SA 3D3SA 2V8DA 2AFUA 3TT2A 5H84A 3SXOA 4UBRA 2RC4A 4JLYA 2ANPA 1IOFA 1LCPA 1HEEA 2F5IA 4MXUA 1Y9KA 1UWYA 5G1ZA 4R3KA 3R9FA 4IUSA 3MGDA 2GIVA 4KOYA 2VL1A 4E2AA 5HVHA 2I3CA 1PYTB 2BOAA 2B3UA 2O28A 4B10A 4BD9A 2YGWA 2AFMA 4UFXA 1BLLE 2QIRA 3PB7X 4NCZA 4OIDA 4OIWA 4OAEA 1M4IA 4U9ZA 4F8ZA 5HMNA 3L2NA 4UWIA 3D67A 1XOVA 2YNEA 1MJ9A 1TKJA 1JWQA 2DPSA 2ZELA 4GM5A 4NGSA 4OKOA 3S6GA 5K8NA 4L89A 2GANA 2R98A 5DWMA 5LRJA 4HPSA 2EK8A 2B5GA 4B11A 3I3GA 2PR1A 3IO1A 4R9MA 3TO7A 4XPDB 4MCRA 5FVJA 1YW4A 1ARMA 1OBRA 3NE8A 4GXHA 3IWGA 4MCQA 2P6FA 4YWYA 3VH9A 4QB9A 4NJQA 4PXDA 3RYOA 3W6XA 2QVPA 1IYLA 2OOTA 2Z3LA 1WK4A 3IU2A 4BINA 1VKCA 3UY5A 2I79A 2OZGA 3KI9A 2Q04A 5HVFA 5AGEA 3LACA 4OC3A 5J8FA 2PJAA 3LD2A 5HH1A 4BMHA 1LRZA 1YVOA 1Z4RA 2OB0A 1XRYA 4JZ0A 4AVCA 3SI2A 1R3NA 4KOWA 1Q7LA 4P44A 4P4EA 1YX0A 4H2KA 5F49A 2BO9A 3TFYA 1QSTA 4MFJA 3QB8A 4Y49B 3LWUA 4H6UA 2FIAA 4CRZB 4OC0A 2GLFA 5D29A 2HV2A 1AMPA 5EMIA 2PJ5A 4A32A 1CPXA 4A30A 4ZBGA 4UEZA 4F0YA 2Q4YA 1NSAA 2JDCA 1P4NA 1RXTA 2ZOFA 3B3TA 3B8GA 4R8FA 4YFJA 2AJ6A 2G3AA 3RO0A 1VHSA 3FB3A 3I1UA 2VXKA 4KOXA 1IICA 2PR8A 1TKHA 4JWPA 4PK2A 5IB9A 2PJ7A 1CM0A 3QAHA 1H8LA 4A39A 1OZPA 3TTHA 4KS9A 4UWJA 4ZX9A 5LYDA 1XE4A 5C82A 3SI0A 3FYNA 4NSQA 1NE9A 2VI7A 5C88A 2EBJA 2J9AA 3VWEA 5AG4A 1IIDA 4OC1A 1YSJA 4X5KA 2QMLA 3BXMA 1ZLIA 3KZWA 3TCVA 1M4LA 1PUAA 1I1DA 4ONUA 5F48A 2ZEPA 4F9UA 3NH4A 4CS0B 1HDUA 4R57A 3IGRA 4Q36A 3SXNA 4U5YA 2BCOA 4M85A 4UCNA 2Q7SA 4ZX8A 3WC6A 4UEFA 3IEHA 2FE7A 3CZXA 4C2XA 2GLJA 1I12A 3CPAA 3TC8A 3H5ZA 5A27A 4RN7A 1Y0RA 4EMEA 5ELYA 2ZOGA 2Z3OA 3T8WA 1XJOA 2Q43A 3FH4A 3MN8A 2QJ8A 3WC7A 1QMUA 2P6EA 1YGHA 5DS0A 4CAFA 1Z8WA 3BJ8A 3KKWA 4JXQA 2ARHA 3SJEA 3D2PA 3DLJA 2QECA 1HDQA 2VBQA 3MRUA 2YNCC 5LRGA 5I4MA 4ZY0A 4C7HA 4FAIA 4A38A 3GYAA 2EWBA 1CJWA 2GREA 4ZY2A 4KOSA 2ZEGA 5JM6A 4RS2A 2Z3MA 3IFEA 3DR6A 3GKRA 4AG9A 1QSRA 1Q2DA 1S7FA 2PRBA 1IGBA 2PVVA 3FBUA 3K2KA 2CNMA 4OC2A 4R87A 4UCMA 5BWAB 1N71A 4EFDA 4KOUA 4L8AA 2ZEOA 1K4JA 1F2PA 3KASA 5LYFA 4P6YA 4MFPA 2BUEA 4WWVA 4KUAA 1CX8A 3IC1A 5IV0A 2K5TA 2OZHA 4KSFA 1VHEA 2R1IA 5F09A 3IU1A 3KHXA 1XEBA 4OADA 4NJRA 2FSRA 2VZZA 1ZG7A 4OC4A 4CGPA 2AFSA 2ATRA 3T90A 1ELLP 3V7ZA 1M4GA 1ZG9A 5HVGA 5K8MA 2ZEEA 4Q7AA 4CAVA 4FD6A 3EY5A 1ON0A 4CPAA 3TO6A 2R8VA 1YLOA 2CNSA 4KVME 3HUVA 4MFKA 4P4BA 2FL4A 2Q4ZA 4X8IA 2HB6A 2PJCA 2P0WA 2Z10A 1ZG8A 3SJXA 3CDXA 2WUUA 1TXRA 2C6PA 3GB0A 1BPNA 2NYQA 1FY7A 1TF8A 1NMTA 4FD7A 2AE6A 3GIUA 4A33A 2O53A 3NH8A 4R6TA 1ARLA 1IYKA 1BO4A 2WPWA 4CYPA 4MRIA 3DDDA 1MJBA 4KVXA 2PRQA 1YQEA 2Q4VA 1QSOA 3I9SA 4PSWA 5GCNA 4E0AA 3PEIA 1KUVA 1LANA 3CT9A 4DNCA 1L0CA 2PJ3A 2GU2A 3ZZIA 3D2MA 4OMEA 1JQGA 2ZEMA 3S9MA 5CBMA 2Z3KA 3B35A 1V0CA 1MK4A 1S7NA 4KOVA 4NXYA 4IAVA 1FNOA 5JH9A 1YMEA 4MJ8A 2ODFA 4P45A 4CGNA 3ISXA 4FD4A 3N5FA 4M6GA 2V8HA 1CBXA 2Z11A 3GY9A 2J8MA 4FD5A 3K9UA 4X3RA 3A9LA 4Y49C 4HNYB 1IB1E 3CXSA 2PSWA 4AVAA 2CTCA 3BI0A 2PJ9A 3TE4A 1S60A 5KTDA 3GLJA 5IX3A 4OLLA 2EK9A 4NGTA 5IB0A 2O4HA 3QAYA 2PJ6A 2CY2A 1ELMP 3PBEA 4HNWB 1XBUA 1Y7EA 2OZUA 4CRYB 1QSNA 3D66A 5LYLA 1FT7A 4MY0A 4A31A 1Z8XA 2WZNA 5KTAA 4FWUA 5THWA 1J4JA 2DXQA 3K9TA 3NH5A 4KSAA 3BJ7A 1B6BA 4CGLA 4UIAA 4M3SA 1VIXA 1Y0YA 2PJ2A 3KGQA 2XEFA 4O23A 1CPSA 2B4DA 4PXCA 2JEVA 3TX8A 3R1KA 4B5PA 1Z5RA 2C27A 3FXTA 3S6KA 4AXVA 3B2YA 4XPDC 5F47A 5G20A 5K8OA 1IY7A 4NGRA 2A4NA 2RFHA 4MHNA 3JUWA 4R7MA 3R95A 4B5OA 2D4PA 5LRKA 2DPTA 2G3TA 2PC1A 2GE3A 4PQAA 4LQGA 2AFZA 4KZTA 3FIXA 3S9NA 4H89A 3ZJ0A 3D8PA 3D7HA 4IF5A 4DJLA 2C6GA 2YNDA 3FRMA 4CGOA 4KLWA 2PDOA 4NGPA 3WR7A 2BSWA 2XEIA 3KQZA 3SHPA 1BAVA 4NEXA 1VHOA 1AYEA 2OH1A 3CXPA 4NFRA 4XPLA 4YU9A 3SI1A 4FBEA 2XEGA 3DSBA 3CPXA 1P0HA 1Y7RA 2XEJA 4NGQA 2ZXVA 2B4BA 3B7IA 3B3WA 4LUAA 1ZLHA 4WJBA 3R9EA 1Z8LA 3CXQA 4CAXA 2JLMA 8CPAA 2AFWA 5A28A 2CNTA 3FX6A 1Y9WA 4QUSA 3FECA 4UFWA 2HC9A 3PBBA 2FT0A 1PCAA 5J8CA 1TIQA 4LX9A 3BHXA 1X12A 2G0BA 5CNPA 3PRTA 2CTBA 3TO9A 1YK3A 1Z9UA 4KSIA 2YNCA 3NFZA 5JGFA 4PK3A 2CF4A 4I49A 4F0XA 1NSLA 2PJ1A 4AVBA 4DUKA 1XMTA 4H6ZA 5EC4A 4A95A 2Y0MA 1CG2A 4MCSA 4ZGYB 4F6AA 4P4FA 4BBHA 3FVLA 1AUGA 1BOBA 3WT4A 3D7DA 1I21A 1LAPA 3PB8X 1MJAA 2DEAA 3JTKA 3W6SA 2B4DB 4AG7A 4PPZA 3TOBA 2PJBA 2EUIA 4B5PB 1S7KA 4CYOA 4A94A 2Q0YA 4ONWA 2EO8A 3NA6A 2ZEDA 2VZYA 4QC6A 4IHMA 3EO4A 4M6HA 4OP4A 4NGNA 1S5KA 4B12A 5LYIA 4ZY1A 1Q2YA 4KUBA 1CP7A
chains in the Genus database with same CATH topology
4GS4A 4YGOA 1PU9A 3V8IA 5AG7A 2FIWA 1M44A 1YLEA 5G21A 3W91A 3R96A 1XIXA 2ZW5A 4UFVA 4KLVA 4CAEA 5G22A 2JDDA 4JJXA 4MFQA 3EXNA 1YREA 4C2YA 1KZFA 3P2FA 3PP9A 4JXRA 5I0CA 3F8KA 2FCKA 2Z3NA 3BLNA 3H4QA 3TOAA 4MY3A 3F5BA 2ZPAA 3DNSA 2FXFA 2REEA 2Z3PA 3PZJA 4MFZA 4RI1A 5EBVA 3JVNA 4XPKA 4MI4A 3S6HA 1U6MA 2HQYA 2Q7BA 1ZO0A 4B14A 3IWEA 1KUXA 2Z0ZA 1M1DA 2REFA 3R9GA 4HNXB 2CXAA 4ORFA 5E96A 1B87A 4CAWA 3C26A 1S3ZA 4KORA 5H86A 4U9YA 4C7IA 4KOTA 4C2ZA 5DWNA 2NMTA 4MFLA 1Q2CA 1WWZA 2PQ8A 4II9A 3N7ZA 2HUZA 3P2HA 4PSXA 2BL1A 2WSAA 5ISVA 4QBJA 4YRHA 4PV6A 4KVOE 3OWCA 2VEZA 4CGMA 4C68A 5KTCA 3G8WA 3G3SA 3LODA 4NF1A 4UCPA 4AB7A 2R7HA 1QSMA 2J8RA 4MHDA 2OU2A 3F0AA 4QVTA 1RO5A 2D4OA 1YVKA 3NE7A 1UFHA 4B13A 3S6FA 1Z4EA 2J8NA 1YR0A 2P6GA 4UA3A 4EVYA 1SQHA 1R57A 4CYNA 2VQYA 2ZW4A 2BEIA 4CYQA 2FS5A 4JD6A 2ZW7A 4A2ZA 5AG6A 2Q44A 4R3LA 5JPHA 3EC4A 4HKFA 4XNHC 2B5GB 3PGPA 2X7BA 4K30A 4E8OA 2B3VA 2WPXA 5F46A 5JQ4A 5AG5A 3DR8A 4XNHB 3E0KA 4MBUA 1KUYA 1XF8A 1S7LA 2ZW6A 3VWDA 3T9YA 1GHEA 2KCWA 2EVNA 3FNCA 4J3GA 2H5MA 1M4DA 2I00A 2IL4A 3EFAA 4Q38A 2B58A 3D3SA 3TT2A 5H84A 3SXOA 4UBRA 2RC4A 4JLYA 2F5IA 1Y9KA 5G1ZA 4R3KA 3R9FA 4IUSA 3MGDA 2GIVA 4KOYA 4E2AA 2B3UA 2O28A 4B10A 2YGWA 4UFXA 2QIRA 4NCZA 4OAEA 1M4IA 4U9ZA 5HMNA 4UWIA 2YNEA 1MJ9A 2DPSA 3S6GA 4L89A 2GANA 2R98A 5DWMA 2B5GA 4B11A 3I3GA 2PR1A 4R9MA 3TO7A 4XPDB 5FVJA 3IWGA 2P6FA 4QB9A 3RYOA 3W6XA 1IYLA 2Z3LA 1WK4A 3IU2A 1VKCA 3UY5A 2I79A 2OZGA 2Q04A 5AGEA 5J8FA 4BMHA 3LD2A 5HH1A 1LRZA 1YVOA 1Z4RA 2OB0A 4AVCA 4KOWA 1YX0A 5F49A 3TFYA 1QSTA 4MFJA 3QB8A 4Y49B 4H6UA 2FIAA 4CRZB 2HV2A 4A32A 4A30A 4ZBGA 4F0YA 2Q4YA 2JDCA 1P4NA 3B8GA 1RXTA 4YFJA 2AJ6A 2G3AA 1VHSA 3FB3A 2VXKA 4KOXA 1IICA 2PR8A 4PK2A 4JWPA 1CM0A 3QAHA 1OZPA 3TTHA 4KS9A 4UWJA 1XE4A 5C82A 3FYNA 4NSQA 1NE9A 2VI7A 5C88A 3VWEA 5AG4A 1IIDA 4X5KA 2QMLA 3TCVA 1PUAA 1I1DA 4ONUA 5F48A 4CS0B 4R57A 3IGRA 4Q36A 3SXNA 4U5YA 4M85A 4UCNA 2FE7A 4C2XA 1I12A 5A27A 3H5ZA 2Z3OA 2P6EA 1YGHA 4CAFA 3BJ8A 3KKWA 4JXQA 2ARHA 3D2PA 2QECA 2VBQA 2YNCC 4C7HA 3GYAA 1CJWA 4KOSA 4RS2A 2Z3MA 3DR6A 3GKRA 4AG9A 1QSRA 1Q2DA 1S7FA 2PRBA 4R87A 3FBUA 5BWAB 2CNMA 4UCMA 1N71A 4KOUA 4L8AA 1K4JA 4MFPA 2BUEA 4KUAA 5IV0A 2K5TA 2OZHA 4KSFA 2R1IA 3IU1A 1XEBA 4OADA 2FSRA 2VZZA 4CGPA 2ATRA 3T90A 1M4GA 4CAVA 4FD6A 3EY5A 1ON0A 3TO6A 2R8VA 2CNSA 4KVME 4MFKA 2FL4A 2P0WA 2Z10A 2WUUA 1FY7A 1NMTA 4FD7A 2AE6A 4A33A 1IYKA 1BO4A 2WPWA 4CYPA 3DDDA 1MJBA 4KVXA 4PSWA 2Q4VA 1QSOA 3I9SA 5GCNA 4E0AA 1KUVA 4DNCA 1L0CA 3ZZIA 3D2MA 2Z3KA 1V0CA 1MK4A 1S7NA 4KOVA 4NXYA 4MJ8A 4CGNA 4FD4A 2Z11A 3GY9A 2J8MA 4FD5A 3K9UA 3A9LA 4Y49C 4HNYB 1IB1E 3CXSA 2PSWA 4AVAA 3TE4A 1S60A 5KTDA 5IX3A 4OLLA 5IB0A 2CY2A 4HNWB 2OZUA 4CRYB 1QSNA 4MY0A 4A31A 5KTAA 1J4JA 2DXQA 4KSAA 3BJ7A 1B6BA 4CGLA 4M3SA 4A95A 2B4DA 2JEVA 3R1KA 4B5PA 2C27A 3FXTA 3S6KA 4XPDC 5F47A 5G20A 3R95A 2A4NA 3JUWA 4B5OA 2D4PA 2DPTA 2G3TA 2PC1A 2GE3A 4KZTA 3FIXA 4H89A 3ZJ0A 3D8PA 4IF5A 2YNDA 3FRMA 4CGOA 4KLWA 2PDOA 3WR7A 2BSWA 3SHPA 4NEXA 2OH1A 4XPLA 3CXPA 3DSBA 1P0HA 1Y7RA 2ZXVA 2B4BA 4LUAA 3R9EA 3CXQA 4CAXA 2JLMA 5A28A 2CNTA 1Y9WA 4QUSA 4UFWA 2FT0A 5J8CA 1TIQA 4LX9A 2G0BA 5CNPA 3TO9A 1YK3A 1Z9UA 2YNCA 4PK3A 4F0XA 4I49A 1NSLA 4AVBA 1XMTA 4H6ZA 5EC4A 2Y0MA 4ZGYB 4F6AA 4BBHA 1BOBA 1I21A 1MJAA 3JTKA 3W6SA 2B4DB 4AG7A 3TOBA 2EUIA 4B5PB 1S7KA 4CYOA 2Q0YA 2VZYA 4QC6A 3EO4A 4B12A 1S5KA 1Q2YA 4KUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GS4 A;  4YGO A;  1PU9 A;  3V8I A;  2FIW A;  1M44 A;  1YLE A;  3W91 A;  3R96 A;  1XIX A;  2ZW5 A;  4KLV A;  2JDD A;  4JJX A;  3EXN A;  1YRE A;  1KZF A;  3P2F A;  3PP9 A;  4JXR A;  5I0C A;  3F8K A;  2FCK A;  3BLN A;  3H4Q A;  3TOA A;  4MY3 A;  3F5B A;  2ZPA A;  3DNS A;  2FXF A;  2REE A;  3PZJ A;  4RI1 A;  5EBV A;  3JVN A;  4XPK A;  4MI4 A;  3S6H A;  1U6M A;  2HQY A;  2Q7B A;  1KUX A;  2Z0Z A;  1M1D A;  2REF A;  3R9G A;  4HNX B;  4ORF A;  5E96 A;  1B87 A;  4CAW A;  3C26 A;  1S3Z A;  4KOR A;  5H86 A;  4U9Y A;  4KOT A;  5DWN A;  2NMT A;  1Q2C A;  1WWZ A;  2PQ8 A;  4II9 A;  3N7Z A;  2HUZ A;  3P2H A;  4PSX A;  2BL1 A;  5ISV A;  4QBJ A;  4YRH A;  4PV6 A;  4KVO E;  3OWC A;  2VEZ A;  5KTC A;  3G8W A;  3G3S A;  3LOD A;  4NF1 A;  4AB7 A;  2R7H A;  1QSM A;  2J8R A;  4MHD A;  2OU2 A;  3F0A A;  4QVT A;  1RO5 A;  2D4O A;  1YVK A;  3NE7 A;  1UFH A;  3S6F A;  1Z4E A;  2J8N A;  1YR0 A;  2P6G A;  4UA3 A;  4EVY A;  1SQH A;  1R57 A;  2VQY A;  2ZW4 A;  2BEI A;  2FS5 A;  4JD6 A;  2ZW7 A;  2Q44 A;  4R3L A;  5JPH A;  3EC4 A;  4HKF A;  4XNH C;  2B5G B;  3PGP A;  2X7B A;  4K30 A;  4E8O A;  2B3V A;  2WPX A;  5F46 A;  5JQ4 A;  3DR8 A;  4XNH B;  3E0K A;  4MBU A;  1KUY A;  1XF8 A;  1S7L A;  2ZW6 A;  3VWD A;  3T9Y A;  1GHE A;  2KCW A;  2EVN A;  3FNC A;  4J3G A;  2H5M A;  1M4D A;  2I00 A;  2IL4 A;  3EFA A;  2B58 A;  3D3S A;  3TT2 A;  5H84 A;  3SXO A;  4UBR A;  2RC4 A;  4JLY A;  2F5I A;  1Y9K A;  4R3K A;  3R9F A;  4IUS A;  3MGD A;  2GIV A;  4KOY A;  4E2A A;  2B3U A;  2O28 A;  2QIR A;  4NCZ A;  4OAE A;  1M4I A;  4U9Z A;  5HMN A;  4UWI A;  1MJ9 A;  3S6G A;  4L89 A;  2GAN A;  2R98 A;  5DWM A;  2B5G A;  3I3G A;  2PR1 A;  4R9M A;  3TO7 A;  4XPD B;  5FVJ A;  3IWG A;  2P6F A;  4QB9 A;  3RYO A;  3W6X A;  1IYL A;  1WK4 A;  1VKC A;  3UY5 A;  2I79 A;  2OZG A;  2Q04 A;  5J8F A;  4BMH A;  3LD2 A;  5HH1 A;  1LRZ A;  1YVO A;  1Z4R A;  2OB0 A;  4AVC A;  4KOW A;  1YX0 A;  5F49 A;  3TFY A;  1QST A;  4Y49 B;  3QB8 A;  4H6U A;  2FIA A;  4CRZ B;  2HV2 A;  4ZBG A;  4F0Y A;  2Q4Y A;  2JDC A;  1P4N A;  3B8G A;  1RXT A;  4YFJ A;  2AJ6 A;  2G3A A;  1VHS A;  3FB3 A;  2VXK A;  4KOX A;  1IIC A;  2PR8 A;  4PK2 A;  4JWP A;  1CM0 A;  3QAH A;  1OZP A;  3TTH A;  4UWJ A;  1XE4 A;  5C82 A;  3FYN A;  4NSQ A;  1NE9 A;  2VI7 A;  5C88 A;  3VWE A;  1IID A;  4X5K A;  2QML A;  3TCV A;  1PUA A;  1I1D A;  4ONU A;  5F48 A;  4CS0 B;  4R57 A;  3IGR A;  3SXN A;  4U5Y A;  4M85 A;  2FE7 A;  1I12 A;  2P6E A;  1YGH A;  3BJ8 A;  3KKW A;  4JXQ A;  2ARH A;  3D2P A;  2QEC A;  2VBQ A;  3GYA A;  1CJW A;  4KOS A;  4RS2 A;  3DR6 A;  3GKR A;  4AG9 A;  1QSR A;  1Q2D A;  1S7F A;  2PRB A;  4R87 A;  3FBU A;  2CNM A;  1N71 A;  4KOU A;  4L8A A;  1K4J A;  2BUE A;  4KUA A;  5IV0 A;  2K5T A;  2OZH A;  2R1I A;  1XEB A;  4OAD A;  2FSR A;  2VZZ A;  2ATR A;  3T90 A;  1M4G A;  4CAV A;  4FD6 A;  3EY5 A;  1ON0 A;  3TO6 A;  2R8V A;  2CNS A;  4KVM E;  2FL4 A;  2P0W A;  2Z10 A;  1FY7 A;  1NMT A;  4FD7 A;  2AE6 A;  1IYK A;  1BO4 A;  2WPW A;  3DDD A;  1MJB A;  4KVX A;  4PSW A;  2Q4V A;  1QSO A;  3I9S A;  5GCN A;  4E0A A;  1KUV A;  4DNC A;  1L0C A;  3ZZI A;  3D2M A;  1V0C A;  1MK4 A;  1S7N A;  4KOV A;  4NXY A;  4MJ8 A;  4FD4 A;  2Z11 A;  3GY9 A;  2J8M A;  4FD5 A;  3K9U A;  4Y49 C;  4HNY B;  1IB1 E;  3CXS A;  2PSW A;  4AVA A;  3TE4 A;  1S60 A;  5KTD A;  5IX3 A;  4OLL A;  5IB0 A;  2CY2 A;  4HNW B;  2OZU A;  4CRY B;  1QSN A;  4MY0 A;  5KTA A;  1J4J A;  2DXQ A;  3BJ7 A;  1B6B A;  4M3S A;  2B4D A;  2JEV A;  3R1K A;  4B5P A;  2C27 A;  3FXT A;  3S6K A;  4XPD C;  5F47 A;  3R95 A;  2A4N A;  3JUW A;  4B5O A;  2D4P A;  2G3T A;  2PC1 A;  2GE3 A;  4KZT A;  3FIX A;  4H89 A;  3ZJ0 A;  3D8P A;  4IF5 A;  3FRM A;  4KLW A;  2PDO A;  3WR7 A;  2BSW A;  3SHP A;  4NEX A;  2OH1 A;  4XPL A;  3CXP A;  3DSB A;  1P0H A;  1Y7R A;  2ZXV A;  2B4B A;  4LUA A;  3R9E A;  3CXQ A;  4CAX A;  2JLM A;  2CNT A;  1Y9W A;  4QUS A;  2FT0 A;  5J8C A;  1TIQ A;  4LX9 A;  2G0B A;  5CNP A;  3TO9 A;  1YK3 A;  1Z9U A;  4PK3 A;  4I49 A;  1NSL A;  4AVB A;  1XMT A;  4H6Z A;  5EC4 A;  2Y0M A;  4F6A A;  1BOB A;  1I21 A;  1MJA A;  3W6S A;  2B4D B;  4AG7 A;  3TOB A;  2EUI A;  4B5P B;  1S7K A;  2Q0Y A;  2VZY A;  4QC6 A;  3EO4 A;  1S5K A;  1Q2Y A;  4KUB A; 
#chains in the Genus database with same CATH topology
 4GS4 A;  4YGO A;  1IOI A;  1XMB A;  3ISZ A;  1PU9 A;  3H8G A;  3RZA A;  1F2O A;  3PB4 X;  1DE4 C;  3V8I A;  5AG7 A;  2Q51 A;  2FIW A;  1M44 A;  1YLE A;  3QNV A;  3FEE A;  5G21 A;  3R96 A;  3W91 A;  3PFE A;  1XIX A;  1Z2L A;  2GFQ A;  2JEW A;  2RB7 A;  2ZEH A;  3RAM A;  2ZW5 A;  4F9V A;  4UFV A;  4KLV A;  4CAE A;  4P4D A;  4MMO A;  3B3C A;  4TWE A;  3KHZ A;  4FUU A;  1VGY A;  2ZEF A;  1TKF A;  2F8H A;  3PFO A;  7CPA A;  4OC5 A;  3PB6 X;  3WC5 A;  5G22 A;  2JDD A;  1IU8 A;  4JJX A;  4MCP A;  4MFQ A;  3EXN A;  2F7V A;  1YRE A;  2IMO A;  4C2Y A;  1KZF A;  3P2F A;  3PP9 A;  2QYV A;  3IWW A;  4ZYQ A;  1X10 A;  4JXR A;  5I0C A;  3F8K A;  2FCK A;  2IQ6 A;  2Z3N A;  3BLN A;  3H4Q A;  4P4I A;  3TOA A;  4MY3 A;  3F5B A;  4X2T A;  1YW6 A;  1TF9 A;  2ZPA A;  3DNS A;  2PE3 A;  2FXF A;  2REE A;  2Z3P A;  3PZJ A;  4MFZ A;  4RI1 A;  3PB9 X;  3JVN A;  4XPK A;  4MI4 A;  5EBV A;  3S6H A;  1U6M A;  2HQY A;  2JBJ A;  1A2Z A;  2Q7B A;  1KWM A;  1ZO0 A;  4B14 A;  3IWE A;  1KUX A;  2Z0Z A;  1M1D A;  4MHP A;  2REF A;  3R9G A;  3RNZ A;  4HNX B;  2CXA A;  2AFX A;  1F57 A;  4ORF A;  1B87 A;  3BI1 A;  3FED A;  5E96 A;  2CIJ A;  2ZEN A;  3C26 A;  4G1P A;  4CAW A;  3H8E A;  1S3Z A;  2PJ0 A;  4KOR A;  5H86 A;  4U9Y A;  5K8P A;  4C7I A;  4KOT A;  3KL9 A;  4C2Z A;  5DWN A;  2NMT A;  3FJU A;  4MFL A;  1Q2C A;  1WWZ A;  2PIY A;  2PQ8 A;  3N7Z A;  3SJG A;  2HUZ A;  4II9 A;  3P2H A;  2V8V A;  2BL1 A;  3H8F A;  4IK2 A;  4PSX A;  2WSA A;  2PCU A;  4RUH A;  5ISV A;  4UEE A;  4QBJ A;  4YRH A;  3D68 A;  4PV6 A;  4KVO E;  4PXB A;  3OWC A;  2VEZ A;  4CGM A;  2PJ4 A;  1LAM A;  4UIB A;  4C68 A;  5KTC A;  3KQX A;  3G8W A;  3G3S A;  3LOD A;  4B6Z A;  4NF1 A;  2DF5 A;  3VAR A;  4UCP A;  4AB7 A;  2R7H A;  5J1Q A;  1QSM A;  2ABZ A;  2J8R A;  2V77 A;  1GYT A;  2OR4 A;  2PVW A;  3JRU A;  2WYR A;  4MHD A;  2OU2 A;  1Z8T A;  2FVG A;  3D7F A;  3F0A A;  4QVT A;  1RO5 A;  2D4O A;  4NGM A;  5D8N A;  3S9L A;  1YVK A;  3NE7 A;  1UFH A;  4B13 A;  3D4U A;  2POK A;  2V8G A;  3FF3 A;  1QQ9 A;  3VAT A;  4ZI6 A;  1LFW A;  3KR4 A;  3FMC A;  3KR5 A;  3S6F A;  3V38 A;  1Z4E A;  1EE3 P;  4P10 A;  2J8N A;  1YR0 A;  2P6G A;  4K3N A;  4MHZ A;  4UA3 A;  4EVY A;  1SQH A;  1R57 A;  4CYN A;  2C1C A;  2VQY A;  5HXD A;  2ZW4 A;  2BEI A;  4CYQ A;  3DGV A;  2AFO A;  2FS5 A;  2NSM A;  4JD6 A;  3SJF A;  4Z65 A;  2ZW7 A;  4A2Z A;  5AG6 A;  2Q44 A;  4R76 A;  4R3L A;  4EWT A;  6CPA A;  5JPH A;  2JBK A;  3EC4 A;  1RTQ A;  4HKF A;  4XNH C;  2B5G B;  3PGP A;  2X7B A;  4M6I A;  4K30 A;  4PXE A;  3GUX A;  4E8O A;  2B3V A;  4TNU A;  2WPX A;  5F46 A;  5JQ4 A;  1DTD A;  2IJZ A;  3IIB A;  4UF4 A;  3RBU A;  5AG5 A;  4A37 A;  1LOK A;  3DR8 A;  4XNH B;  3E0K A;  4MBU A;  1KUY A;  2C6C A;  3HLP A;  3B3V A;  4DYO A;  1XF8 A;  1S7L A;  3LMS A;  3D7G A;  4P4J A;  2ZW6 A;  3VWD A;  5CPA A;  1CP6 A;  3T9Y A;  1GHE A;  3IJ3 A;  2KCW A;  1BPM A;  2EVN A;  3FNC A;  4J3G A;  4LQ6 A;  1R43 A;  2G9D A;  2H5M A;  1XFO A;  1M4D A;  2I00 A;  2IL4 A;  3EFA A;  3WAB A;  2PJ8 A;  4W9Y A;  2PIZ A;  4MHY A;  4Q38 A;  4JYW A;  2B58 A;  3B3S A;  3D3S A;  2V8D A;  2AFU A;  3TT2 A;  5H84 A;  3SXO A;  4UBR A;  2RC4 A;  4JLY A;  2ANP A;  1IOF A;  1LCP A;  1HEE A;  2F5I A;  4MXU A;  1Y9K A;  1UWY A;  5G1Z A;  4R3K A;  3R9F A;  4IUS A;  3MGD A;  2GIV A;  4KOY A;  2VL1 A;  4E2A A;  5HVH A;  2I3C A;  1PYT B;  2BOA A;  2B3U A;  2O28 A;  4B10 A;  4BD9 A;  2YGW A;  2AFM A;  4UFX A;  1BLL E;  2QIR A;  3PB7 X;  4NCZ A;  4OID A;  4OIW A;  4OAE A;  1M4I A;  4U9Z A;  4F8Z A;  5HMN A;  3L2N A;  4UWI A;  3D67 A;  1XOV A;  2YNE A;  1MJ9 A;  1TKJ A;  1JWQ A;  2DPS A;  2ZEL A;  4GM5 A;  4NGS A;  4OKO A;  3S6G A;  5K8N A;  4L89 A;  2GAN A;  2R98 A;  5DWM A;  5LRJ A;  4HPS A;  2EK8 A;  2B5G A;  4B11 A;  3I3G A;  2PR1 A;  3IO1 A;  4R9M A;  3TO7 A;  4XPD B;  4MCR A;  5FVJ A;  1YW4 A;  1ARM A;  1OBR A;  3NE8 A;  4GXH A;  3IWG A;  4MCQ A;  2P6F A;  4YWY A;  3VH9 A;  4QB9 A;  4NJQ A;  4PXD A;  3RYO A;  3W6X A;  2QVP A;  1IYL A;  2OOT A;  2Z3L A;  1WK4 A;  3IU2 A;  4BIN A;  1VKC A;  3UY5 A;  2I79 A;  2OZG A;  3KI9 A;  2Q04 A;  5HVF A;  5AGE A;  3LAC A;  4OC3 A;  5J8F A;  2PJA A;  3LD2 A;  5HH1 A;  4BMH A;  1LRZ A;  1YVO A;  1Z4R A;  2OB0 A;  1XRY A;  4JZ0 A;  4AVC A;  3SI2 A;  1R3N A;  4KOW A;  1Q7L A;  4P44 A;  4P4E A;  1YX0 A;  4H2K A;  5F49 A;  2BO9 A;  3TFY A;  1QST A;  4MFJ A;  3QB8 A;  4Y49 B;  3LWU A;  4H6U A;  2FIA A;  4CRZ B;  4OC0 A;  2GLF A;  5D29 A;  2HV2 A;  1AMP A;  5EMI A;  2PJ5 A;  4A32 A;  1CPX A;  4A30 A;  4ZBG A;  4UEZ A;  4F0Y A;  2Q4Y A;  1NSA A;  2JDC A;  1P4N A;  1RXT A;  2ZOF A;  3B3T A;  3B8G A;  4R8F A;  4YFJ A;  2AJ6 A;  2G3A A;  3RO0 A;  1VHS A;  3FB3 A;  3I1U A;  2VXK A;  4KOX A;  1IIC A;  2PR8 A;  1TKH A;  4JWP A;  4PK2 A;  5IB9 A;  2PJ7 A;  1CM0 A;  3QAH A;  1H8L A;  4A39 A;  1OZP A;  3TTH A;  4KS9 A;  4UWJ A;  4ZX9 A;  5LYD A;  1XE4 A;  5C82 A;  3SI0 A;  3FYN A;  4NSQ A;  1NE9 A;  2VI7 A;  5C88 A;  2EBJ A;  2J9A A;  3VWE A;  5AG4 A;  1IID A;  4OC1 A;  1YSJ A;  4X5K A;  2QML A;  3BXM A;  1ZLI A;  3KZW A;  3TCV A;  1M4L A;  1PUA A;  1I1D A;  4ONU A;  5F48 A;  2ZEP A;  4F9U A;  3NH4 A;  4CS0 B;  1HDU A;  4R57 A;  3IGR A;  4Q36 A;  3SXN A;  4U5Y A;  2BCO A;  4M85 A;  4UCN A;  2Q7S A;  4ZX8 A;  3WC6 A;  4UEF A;  3IEH A;  2FE7 A;  3CZX A;  4C2X A;  2GLJ A;  1I12 A;  3CPA A;  3TC8 A;  3H5Z A;  5A27 A;  4RN7 A;  1Y0R A;  4EME A;  5ELY A;  2ZOG A;  2Z3O A;  3T8W A;  1XJO A;  2Q43 A;  3FH4 A;  3MN8 A;  2QJ8 A;  3WC7 A;  1QMU A;  2P6E A;  1YGH A;  5DS0 A;  4CAF A;  1Z8W A;  3BJ8 A;  3KKW A;  4JXQ A;  2ARH A;  3SJE A;  3D2P A;  3DLJ A;  2QEC A;  1HDQ A;  2VBQ A;  3MRU A;  2YNC C;  5LRG A;  5I4M A;  4ZY0 A;  4C7H A;  4FAI A;  4A38 A;  3GYA A;  2EWB A;  1CJW A;  2GRE A;  4ZY2 A;  4KOS A;  2ZEG A;  5JM6 A;  4RS2 A;  2Z3M A;  3IFE A;  3DR6 A;  3GKR A;  4AG9 A;  1QSR A;  1Q2D A;  1S7F A;  2PRB A;  1IGB A;  2PVV A;  3FBU A;  3K2K A;  2CNM A;  4OC2 A;  4R87 A;  4UCM A;  5BWA B;  1N71 A;  4EFD A;  4KOU A;  4L8A A;  2ZEO A;  1K4J A;  1F2P A;  3KAS A;  5LYF A;  4P6Y A;  4MFP A;  2BUE A;  4WWV A;  4KUA A;  1CX8 A;  3IC1 A;  5IV0 A;  2K5T A;  2OZH A;  4KSF A;  1VHE A;  2R1I A;  5F09 A;  3IU1 A;  3KHX A;  1XEB A;  4OAD A;  4NJR A;  2FSR A;  2VZZ A;  1ZG7 A;  4OC4 A;  4CGP A;  2AFS A;  2ATR A;  3T90 A;  1ELL P;  3V7Z A;  1M4G A;  1ZG9 A;  5HVG A;  5K8M A;  2ZEE A;  4Q7A A;  4CAV A;  4FD6 A;  3EY5 A;  1ON0 A;  4CPA A;  3TO6 A;  2R8V A;  1YLO A;  2CNS A;  4KVM E;  3HUV A;  4MFK A;  4P4B A;  2FL4 A;  2Q4Z A;  4X8I A;  2HB6 A;  2PJC A;  2P0W A;  2Z10 A;  1ZG8 A;  3SJX A;  3CDX A;  2WUU A;  1TXR A;  2C6P A;  3GB0 A;  1BPN A;  2NYQ A;  1FY7 A;  1TF8 A;  1NMT A;  4FD7 A;  2AE6 A;  3GIU A;  4A33 A;  2O53 A;  3NH8 A;  4R6T A;  1ARL A;  1IYK A;  1BO4 A;  2WPW A;  4CYP A;  4MRI A;  3DDD A;  1MJB A;  4KVX A;  2PRQ A;  1YQE A;  2Q4V A;  1QSO A;  3I9S A;  4PSW A;  5GCN A;  4E0A A;  3PEI A;  1KUV A;  1LAN A;  3CT9 A;  4DNC A;  1L0C A;  2PJ3 A;  2GU2 A;  3ZZI A;  3D2M A;  4OME A;  1JQG A;  2ZEM A;  3S9M A;  5CBM A;  2Z3K A;  3B35 A;  1V0C A;  1MK4 A;  1S7N A;  4KOV A;  4NXY A;  4IAV A;  1FNO A;  5JH9 A;  1YME A;  4MJ8 A;  2ODF A;  4P45 A;  4CGN A;  3ISX A;  4FD4 A;  3N5F A;  4M6G A;  2V8H A;  1CBX A;  2Z11 A;  3GY9 A;  2J8M A;  4FD5 A;  3K9U A;  4X3R A;  3A9L A;  4Y49 C;  4HNY B;  1IB1 E;  3CXS A;  2PSW A;  4AVA A;  2CTC A;  3BI0 A;  2PJ9 A;  3TE4 A;  1S60 A;  5KTD A;  3GLJ A;  5IX3 A;  4OLL A;  2EK9 A;  4NGT A;  5IB0 A;  2O4H A;  3QAY A;  2PJ6 A;  2CY2 A;  1ELM P;  3PBE A;  4HNW B;  1XBU A;  1Y7E A;  2OZU A;  4CRY B;  1QSN A;  3D66 A;  5LYL A;  1FT7 A;  4MY0 A;  4A31 A;  1Z8X A;  2WZN A;  5KTA A;  4FWU A;  5THW A;  1J4J A;  2DXQ A;  3K9T A;  3NH5 A;  4KSA A;  3BJ7 A;  1B6B A;  4CGL A;  4UIA A;  4M3S A;  1VIX A;  1Y0Y A;  2PJ2 A;  3KGQ A;  2XEF A;  4O23 A;  1CPS A;  2B4D A;  4PXC A;  2JEV A;  3TX8 A;  3R1K A;  4B5P A;  1Z5R A;  2C27 A;  3FXT A;  3S6K A;  4AXV A;  3B2Y A;  4XPD C;  5F47 A;  5G20 A;  5K8O A;  1IY7 A;  4NGR A;  2A4N A;  2RFH A;  4MHN A;  3JUW A;  4R7M A;  3R95 A;  4B5O A;  2D4P A;  5LRK A;  2DPT A;  2G3T A;  2PC1 A;  2GE3 A;  4PQA A;  4LQG A;  2AFZ A;  4KZT A;  3FIX A;  3S9N A;  4H89 A;  3ZJ0 A;  3D8P A;  3D7H A;  4IF5 A;  4DJL A;  2C6G A;  2YND A;  3FRM A;  4CGO A;  4KLW A;  2PDO A;  4NGP A;  3WR7 A;  2BSW A;  2XEI A;  3KQZ A;  3SHP A;  1BAV A;  4NEX A;  1VHO A;  1AYE A;  2OH1 A;  3CXP A;  4NFR A;  4XPL A;  4YU9 A;  3SI1 A;  4FBE A;  2XEG A;  3DSB A;  3CPX A;  1P0H A;  1Y7R A;  2XEJ A;  4NGQ A;  2ZXV A;  2B4B A;  3B7I A;  3B3W A;  4LUA A;  1ZLH A;  4WJB A;  3R9E A;  1Z8L A;  3CXQ A;  4CAX A;  2JLM A;  8CPA A;  2AFW A;  5A28 A;  2CNT A;  3FX6 A;  1Y9W A;  4QUS A;  3FEC A;  4UFW A;  2HC9 A;  3PBB A;  2FT0 A;  1PCA A;  5J8C A;  1TIQ A;  4LX9 A;  3BHX A;  1X12 A;  2G0B A;  5CNP A;  3PRT A;  2CTB A;  3TO9 A;  1YK3 A;  1Z9U A;  4KSI A;  2YNC A;  3NFZ A;  5JGF A;  4PK3 A;  2CF4 A;  4I49 A;  4F0X A;  1NSL A;  2PJ1 A;  4AVB A;  4DUK A;  1XMT A;  4H6Z A;  5EC4 A;  4A95 A;  2Y0M A;  1CG2 A;  4MCS A;  4ZGY B;  4F6A A;  4P4F A;  4BBH A;  3FVL A;  1AUG A;  1BOB A;  3WT4 A;  3D7D A;  1I21 A;  1LAP A;  3PB8 X;  1MJA A;  2DEA A;  3JTK A;  3W6S A;  2B4D B;  4AG7 A;  4PPZ A;  3TOB A;  2PJB A;  2EUI A;  4B5P B;  1S7K A;  4CYO A;  4A94 A;  2Q0Y A;  4ONW A;  2EO8 A;  3NA6 A;  2ZED A;  2VZY A;  4QC6 A;  4IHM A;  3EO4 A;  4M6H A;  4OP4 A;  4NGN A;  1S5K A;  4B12 A;  5LYI A;  4ZY1 A;  1Q2Y A;  4KUB A;  1CP7 A; 
#chains in the Genus database with same CATH homology
 4GS4 A;  4YGO A;  1PU9 A;  3V8I A;  5AG7 A;  2FIW A;  1M44 A;  1YLE A;  5G21 A;  3W91 A;  3R96 A;  1XIX A;  2ZW5 A;  4UFV A;  4KLV A;  4CAE A;  5G22 A;  2JDD A;  4JJX A;  4MFQ A;  3EXN A;  1YRE A;  4C2Y A;  1KZF A;  3P2F A;  3PP9 A;  4JXR A;  5I0C A;  3F8K A;  2FCK A;  2Z3N A;  3BLN A;  3H4Q A;  3TOA A;  4MY3 A;  3F5B A;  2ZPA A;  3DNS A;  2FXF A;  2REE A;  2Z3P A;  3PZJ A;  4MFZ A;  4RI1 A;  5EBV A;  3JVN A;  4XPK A;  4MI4 A;  3S6H A;  1U6M A;  2HQY A;  2Q7B A;  1ZO0 A;  4B14 A;  3IWE A;  1KUX A;  2Z0Z A;  1M1D A;  2REF A;  3R9G A;  4HNX B;  2CXA A;  4ORF A;  5E96 A;  1B87 A;  4CAW A;  3C26 A;  1S3Z A;  4KOR A;  5H86 A;  4U9Y A;  4C7I A;  4KOT A;  4C2Z A;  5DWN A;  2NMT A;  4MFL A;  1Q2C A;  1WWZ A;  2PQ8 A;  4II9 A;  3N7Z A;  2HUZ A;  3P2H A;  4PSX A;  2BL1 A;  2WSA A;  5ISV A;  4QBJ A;  4YRH A;  4PV6 A;  4KVO E;  3OWC A;  2VEZ A;  4CGM A;  4C68 A;  5KTC A;  3G8W A;  3G3S A;  3LOD A;  4NF1 A;  4UCP A;  4AB7 A;  2R7H A;  1QSM A;  2J8R A;  4MHD A;  2OU2 A;  3F0A A;  4QVT A;  1RO5 A;  2D4O A;  1YVK A;  3NE7 A;  1UFH A;  4B13 A;  3S6F A;  1Z4E A;  2J8N A;  1YR0 A;  2P6G A;  4UA3 A;  4EVY A;  1SQH A;  1R57 A;  4CYN A;  2VQY A;  2ZW4 A;  2BEI A;  4CYQ A;  2FS5 A;  4JD6 A;  2ZW7 A;  4A2Z A;  5AG6 A;  2Q44 A;  4R3L A;  5JPH A;  3EC4 A;  4HKF A;  4XNH C;  2B5G B;  3PGP A;  2X7B A;  4K30 A;  4E8O A;  2B3V A;  2WPX A;  5F46 A;  5JQ4 A;  5AG5 A;  3DR8 A;  4XNH B;  3E0K A;  4MBU A;  1KUY A;  1XF8 A;  1S7L A;  2ZW6 A;  3VWD A;  3T9Y A;  1GHE A;  2KCW A;  2EVN A;  3FNC A;  4J3G A;  2H5M A;  1M4D A;  2I00 A;  2IL4 A;  3EFA A;  4Q38 A;  2B58 A;  3D3S A;  3TT2 A;  5H84 A;  3SXO A;  4UBR A;  2RC4 A;  4JLY A;  2F5I A;  1Y9K A;  5G1Z A;  4R3K A;  3R9F A;  4IUS A;  3MGD A;  2GIV A;  4KOY A;  4E2A A;  2B3U A;  2O28 A;  4B10 A;  2YGW A;  4UFX A;  2QIR A;  4NCZ A;  4OAE A;  1M4I A;  4U9Z A;  5HMN A;  4UWI A;  2YNE A;  1MJ9 A;  2DPS A;  3S6G A;  4L89 A;  2GAN A;  2R98 A;  5DWM A;  2B5G A;  4B11 A;  3I3G A;  2PR1 A;  4R9M A;  3TO7 A;  4XPD B;  5FVJ A;  3IWG A;  2P6F A;  4QB9 A;  3RYO A;  3W6X A;  1IYL A;  2Z3L A;  1WK4 A;  3IU2 A;  1VKC A;  3UY5 A;  2I79 A;  2OZG A;  2Q04 A;  5AGE A;  5J8F A;  4BMH A;  3LD2 A;  5HH1 A;  1LRZ A;  1YVO A;  1Z4R A;  2OB0 A;  4AVC A;  4KOW A;  1YX0 A;  5F49 A;  3TFY A;  1QST A;  4MFJ A;  3QB8 A;  4Y49 B;  4H6U A;  2FIA A;  4CRZ B;  2HV2 A;  4A32 A;  4A30 A;  4ZBG A;  4F0Y A;  2Q4Y A;  2JDC A;  1P4N A;  3B8G A;  1RXT A;  4YFJ A;  2AJ6 A;  2G3A A;  1VHS A;  3FB3 A;  2VXK A;  4KOX A;  1IIC A;  2PR8 A;  4PK2 A;  4JWP A;  1CM0 A;  3QAH A;  1OZP A;  3TTH A;  4KS9 A;  4UWJ A;  1XE4 A;  5C82 A;  3FYN A;  4NSQ A;  1NE9 A;  2VI7 A;  5C88 A;  3VWE A;  5AG4 A;  1IID A;  4X5K A;  2QML A;  3TCV A;  1PUA A;  1I1D A;  4ONU A;  5F48 A;  4CS0 B;  4R57 A;  3IGR A;  4Q36 A;  3SXN A;  4U5Y A;  4M85 A;  4UCN A;  2FE7 A;  4C2X A;  1I12 A;  5A27 A;  3H5Z A;  2Z3O A;  2P6E A;  1YGH A;  4CAF A;  3BJ8 A;  3KKW A;  4JXQ A;  2ARH A;  3D2P A;  2QEC A;  2VBQ A;  2YNC C;  4C7H A;  3GYA A;  1CJW A;  4KOS A;  4RS2 A;  2Z3M A;  3DR6 A;  3GKR A;  4AG9 A;  1QSR A;  1Q2D A;  1S7F A;  2PRB A;  4R87 A;  3FBU A;  5BWA B;  2CNM A;  4UCM A;  1N71 A;  4KOU A;  4L8A A;  1K4J A;  4MFP A;  2BUE A;  4KUA A;  5IV0 A;  2K5T A;  2OZH A;  4KSF A;  2R1I A;  3IU1 A;  1XEB A;  4OAD A;  2FSR A;  2VZZ A;  4CGP A;  2ATR A;  3T90 A;  1M4G A;  4CAV A;  4FD6 A;  3EY5 A;  1ON0 A;  3TO6 A;  2R8V A;  2CNS A;  4KVM E;  4MFK A;  2FL4 A;  2P0W A;  2Z10 A;  2WUU A;  1FY7 A;  1NMT A;  4FD7 A;  2AE6 A;  4A33 A;  1IYK A;  1BO4 A;  2WPW A;  4CYP A;  3DDD A;  1MJB A;  4KVX A;  4PSW A;  2Q4V A;  1QSO A;  3I9S A;  5GCN A;  4E0A A;  1KUV A;  4DNC A;  1L0C A;  3ZZI A;  3D2M A;  2Z3K A;  1V0C A;  1MK4 A;  1S7N A;  4KOV A;  4NXY A;  4MJ8 A;  4CGN A;  4FD4 A;  2Z11 A;  3GY9 A;  2J8M A;  4FD5 A;  3K9U A;  3A9L A;  4Y49 C;  4HNY B;  1IB1 E;  3CXS A;  2PSW A;  4AVA A;  3TE4 A;  1S60 A;  5KTD A;  5IX3 A;  4OLL A;  5IB0 A;  2CY2 A;  4HNW B;  2OZU A;  4CRY B;  1QSN A;  4MY0 A;  4A31 A;  5KTA A;  1J4J A;  2DXQ A;  4KSA A;  3BJ7 A;  1B6B A;  4CGL A;  4M3S A;  4A95 A;  2B4D A;  2JEV A;  3R1K A;  4B5P A;  2C27 A;  3FXT A;  3S6K A;  4XPD C;  5F47 A;  5G20 A;  3R95 A;  2A4N A;  3JUW A;  4B5O A;  2D4P A;  2DPT A;  2G3T A;  2PC1 A;  2GE3 A;  4KZT A;  3FIX A;  4H89 A;  3ZJ0 A;  3D8P A;  4IF5 A;  2YND A;  3FRM A;  4CGO A;  4KLW A;  2PDO A;  3WR7 A;  2BSW A;  3SHP A;  4NEX A;  2OH1 A;  4XPL A;  3CXP A;  3DSB A;  1P0H A;  1Y7R A;  2ZXV A;  2B4B A;  4LUA A;  3R9E A;  3CXQ A;  4CAX A;  2JLM A;  5A28 A;  2CNT A;  1Y9W A;  4QUS A;  4UFW A;  2FT0 A;  5J8C A;  1TIQ A;  4LX9 A;  2G0B A;  5CNP A;  3TO9 A;  1YK3 A;  1Z9U A;  2YNC A;  4PK3 A;  4F0X A;  4I49 A;  1NSL A;  4AVB A;  1XMT A;  4H6Z A;  5EC4 A;  2Y0M A;  4ZGY B;  4F6A A;  4BBH A;  1BOB A;  1I21 A;  1MJA A;  3JTK A;  3W6S A;  2B4D B;  4AG7 A;  3TOB A;  2EUI A;  4B5P B;  1S7K A;  4CYO A;  2Q0Y A;  2VZY A;  4QC6 A;  3EO4 A;  4B12 A;  1S5K A;  1Q2Y A;  4KUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...