2VEZA

Afgna1 crystal structure complexed with acetyl-coa and glucose-6p gives new insights into catalysis
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
165
structure length
165
Chain Sequence
ENTPLFSPSLISPDVLAVLPADYTIRPLCRSDYKRGYLDVLRVLTTVGDINEEQWNSRYEWIRARSDEYYLLVVCDGEGRIVGTGSLVVERKFIHSLGMVGHIEDIAVEKGQQGKKLGLRIIQALDYVAEKVGCYKTILDCSEANEGFYIKCGFKRAGLEMAHYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PUTATIVE GLUCOSAMINE 6-PHOSPHATE ACETYLTRANSFERASE
publication title Glucose-6-Phosphate as a Probe for the Glucosamine- 6-Phosphate N-Acetyltransferase Michaelis Complex.
pubmed doi rcsb
source organism Aspergillus fumigatus
total genus 46
structure length 165
sequence length 165
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2007-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2vezA01
3BLNA 3S6HA 4XPKA 2RC4A 5ISVA 3IGRA 1M4GA 2AJ6A 2JLMA 2HQYA 2ZXVA 3TO9A 4BMHA 1XIXA 2R7HA 4KUBA 2B3VA 5E96A 4YGOA 3TOBA 3V8IA 3TFYA 1KUYA 1YVKA 4RS2A 2J8MA 3D8PA 3G8WA 3FBUA 3S6GA 4NSQA 5EBVA 2FT0A 2ARHA 4QC6A 2VEZA 3K9UA 4KOSA 2G3AA 2CNSA 2BEIA 4U5YA 2HV2A 5I0CA 2OB0A 4XPDB 4NCZA 4M3SA 2P6GA 2Q44A 4CAVA 5EC4A 3ZZIA 4KOUA 4J3GA 4R9MA 4DNCA 1YX0A 4FD5A 4XPLA 3S6FA 1FY7A 2J8NA 2Q0YA 3UY5A 3FXTA 1LRZA 2QMLA 2G3TA 3PP9A 1YGHA 2O28A 1MJ9A 1Y9KA 5IX3A 4XPDC 3TOAA 1V0CA 1S5KA 1Z4EA 4M85A 3F5BA 4KVXA 1YVOA 4QVTA 3KKWA 1MJBA 5IB0A 4KOYA 2F5IA 2BL1A 3BJ8A 1CJWA 1R57A 3RYOA 5HMNA 2VZYA 2HUZA 1IICA 1BOBA 2ATRA 4H6UA 2REEA 3D2MA 5DWNA 2I00A 1QSTA 1P4NA 1U6MA 4IUSA 4H89A 3ZJ0A 2FE7A 2PC1A 4QBJA 2R1IA 1UFHA 4QB9A 1OZPA 5FVJA 3W6SA 1MJAA 3SHPA 4OLLA 1IYLA 1K4JA 4AVCA 4K30A 3MGDA 1Q2CA 1YR0A 1QSMA 4H6ZA 2P6EA 4RI1A 3R96A 2R98A 2R8VA 2PR8A 2Z0ZA 2OZHA 2QECA 2VXKA 3EC4A 1M1DA 4PSWA 4KLVA 4HNYB 2C27A 3QAHA 3SXOA 1ON0A 3WR7A 2EVNA 4KLWA 4B5OA 3DNSA 1YREA 2P6FA 2IL4A 3DSBA 4QUSA 4KOTA 4CAWA 4OAEA 4YFJA 2FCKA 4ONUA 1Y7RA 3TCVA 5J8FA 1P0HA 3BJ7A 4EVYA 4U9YA 4FD4A 3DR6A 2K5TA 3DDDA 2ZW7A 2FS5A 5DWMA 3PZJA 4JWPA 3E0KA 2I79A 4U9ZA 1Z4RA 3VWEA 3GKRA 2OZUA 2Q4VA 3QB8A 4PK3A 5GCNA 3JVNA 5C88A 5F46A 2GIVA 1BO4A 4KVOE 5F48A 4AG9A 3CXQA 1TIQA 4E0AA 2B4BA 3FB3A 2Y0MA 4AVAA 4R87A 1QSOA 3R9EA 1KUXA 4JXRA 3R9GA 5JQ4A 3I3GA 1GHEA 3G3SA 4II9A 1CM0A 1B87A 4ZBGA 4Y49C 3EY5A 3W91A 1YK3A 2D4OA 2FL4A 3I9SA 2Q04A 3IWGA 1L0CA 3JUWA 4KUAA 2Z10A 3GYAA 4R3LA 2PR1A 5J8CA 2FSRA 3TE4A 2Q4YA 4KZTA 4ORFA 2FIAA 3T9YA 4LUAA 1S7FA 4HNXB 2PRBA 2A4NA 4UWIA 3N7ZA 3CXSA 2CNTA 4KOWA 2B5GB 4PSXA 1WK4A 1NE9A 3CXPA 4F6AA 2OU2A 4XNHC 4UWJA 3FNCA 2VZZA 2EUIA 1I21A 4JLYA 1QSRA 4CRYB 1Q2YA 2BSWA 3FIXA 2B5GA 3OWCA 4GS4A 1WWZA 4YRHA 4MY3A 4JXQA 4UA3A 3S6KA 2JDDA 4CS0B 2WPXA 1S7LA 2Q7BA 4CAXA 4HNWB 4E2AA 1Q2DA 4JD6A 5JPHA 3VWDA 2J8RA 1M44A 4PV6A 2PDOA 3T90A 2QIRA 2AE6A 3LD2A 5IV0A 2WPWA 4FD7A 4IF5A 3LODA 4UBRA 4L89A 1I1DA 1Z9UA 2H5MA 3D3SA 4MJ8A 4LX9A 1I12A 2CNMA 4MI4A 2REFA 2VI7A 2GE3A 4MY0A 1S7NA 4F0YA 1XE4A 3D2PA 4MHDA 4CRZB 5C82A 3PGPA 4NXYA 4Y49B 4HKFA 1IYKA 1Y9WA 4OADA 4FD6A 2BUEA 3P2HA 1VKCA 3DR8A 5KTAA 2X7BA 4NF1A 3EXNA 3R95A 2P0WA 3F8KA 3GY9A 1XMTA 2ZW5A 4E8OA 4MBUA 1IB1E 1RXTA 2NMTA 4KORA 4AVBA 4NEXA 3B8GA 1S60A 1MK4A 5H84A 4B5PB 1QSNA 3TTHA 2VQYA 5CNPA 2OZGA 1KZFA 1IIDA 2CY2A 4X5KA 1RO5A 2GANA 2JEVA 1S3ZA 4XNHB 2PSWA 1NSLA 2JDCA 4B5PA 4R57A 3TO7A 1B6BA 1XEBA 3W6XA 3EFAA 2ZPAA 5H86A 3R9FA 1M4DA 5F47A 3P2FA 1KUVA 3H4QA 2ZW6A 2DXQA 5KTCA 1J4JA 1VHSA 1PU9A 3EO4A 5F49A 3C26A 4AG7A 2B4DB 3FRMA 2B3UA 2G0BA 2FIWA 3TO6A 4KOVA 1YLEA 1SQHA 3NE7A 4JJXA 3R1KA 5HH1A 1NMTA 4KVME 4AB7A 2B4DA 4KOXA 3SXNA 3TT2A 4L8AA 4R3KA 2Z11A 2B58A 2KCWA 2ZW4A 1M4IA 2PQ8A 2OH1A 4PK2A 1N71A 1XF8A 1PUAA 1S7KA 3FYNA 2D4PA 2VBQA 4I49A 3F0AA 2FXFA 5KTDA
chains in the Genus database with same CATH superfamily
3BLNA 2PVVA 4JYWA 3KHZA 4XPKA 3S6HA 3IJ3A 2RC4A 4IK2A 4C2ZA 5ISVA 3FEEA 3IGRA 2RFHA 1M4GA 1F2OA 4OC4A 2AJ6A 2JLMA 4PXEA 2HQYA 2PJ7A 2ZXVA 1XBUA 3PB6X 1A2ZA 1ZLHA 3HLPA 3IC1A 3TO9A 4BMHA 5K8OA 2ANPA 2AFUA 1XIXA 2R7HA 4KUBA 2HC9A 3RZAA 5AG7A 2AFZA 2B3VA 5E96A 2PJ6A 4LQ6A 2BOAA 3L2NA 4YGOA 3T8WA 3TOBA 3V8IA 2QVPA 5D29A 3TFYA 1KUYA 4KSFA 2XEGA 1YVKA 5LYLA 4RS2A 2J8MA 4P4IA 5K8MA 3D8PA 4BD9A 3G8WA 1XFOA 4I49A 3PB8X 3FBUA 1XJOA 4NSQA 3S6GA 1F2PA 5EBVA 2FT0A 1CX8A 2ARHA 4QC6A 8CPAA 2VEZA 3K9UA 4KOSA 3PB4X 2G3AA 1R3NA 2CNSA 4MXUA 2BEIA 2GLFA 4C2YA 1ZLIA 3FH4A 3V38A 4F8ZA 5F09A 2ODFA 4U5YA 1Y0RA 2HV2A 5I0CA 2OOTA 1IU8A 2OB0A 3PRTA 1AMPA 4XPDB 1DE4C 2GLJA 4NCZA 4M3SA 1PCAA 2P6GA 2Q44A 4CAVA 5EC4A 4UIBA 3ZZIA 2Z3MA 7CPAA 4KOUA 1YW6A 4J3GA 3ISZA 4R9MA 2PJ2A 4A39A 4MCPA 2PE3A 2PJAA 4P4EA 4PPZA 4R8FA 4CYPA 1YX0A 4FD5A 4DNCA 4XPLA 3SJXA 1ARLA 1BPNA 3H8GA 1VHEA 3QNVA 3S6FA 1FY7A 2ZELA 3IO1A 3FMCA 2J8NA 2Q0YA 3UY5A 4YU9A 3B7IA 3JRUA 3N5FA 3FXTA 1LRZA 5LRGA 2AFXA 1TKJA 2QMLA 3CPAA 2G3TA 3KASA 3PP9A 2G9DA 1YGHA 2O28A 2YNDA 1MJ9A 1Y9KA 2ZOFA 3V7ZA 1QQ9A 1HEEA 5IX3A 3S9NA 4XPDC 1BAVA 3TOAA 1V0CA 4A94A 1BPMA 1S5KA 1Z4EA 4M85A 4NGNA 3WC7A 3IWEA 3F5BA 4C68A 2ZEEA 4KVXA 1YVOA 4QVTA 3KKWA 5G22A 1X10A 1MJBA 4NGPA 3FJUA 3D7DA 4KOYA 5IB0A 2F5IA 4UFVA 2BL1A 3BJ8A 4ZYQA 2OR4A 5JH9A 4A33A 1CJWA 1R57A 1YW4A 3RYOA 5HMNA 2VZYA 2HUZA 1IICA 2ZEOA 1Q7LA 1BOBA 2ATRA 2BO9A 3TX8A 4P44A 2REEA 3D2MA 3D4UA 4H6UA 2I00A 5DWNA 1PYTB 1QSTA 2POKA 1P4NA 5G20A 1U6MA 4IUSA 4YWYA 1TF9A 3KQZA 3S9LA 4H89A 4P4JA 3ZJ0A 2FE7A 3KHXA 1ELLP 2PC1A 4QBJA 2R1IA 1CPXA 1UFHA 2V77A 4UF4A 1Z8TA 4QB9A 4ZX9A 1OZPA 2ZEDA 2AFMA 1CP6A 4EWTA 5FVJA 4ZX8A 3W6SA 4MFKA 1MJAA 3SHPA 4OLLA 4CGLA 1IYLA 3KL9A 1K4JA 2CF4A 2ZOGA 5JGFA 4UCMA 4CYOA 1IGBA 4AVCA 4K30A 1YSJA 1ELMP 5AG4A 3MGDA 4RUHA 1Q2CA 3SI1A 3A9LA 4DJLA 3WABA 1YR0A 1QSMA 4H6ZA 2PCUA 2P6EA 3PBEA 4BBHA 3CPXA 4NGQA 4B6ZA 1AUGA 4RI1A 3R96A 2R98A 3IIBA 2R8VA 2JBJA 2PR8A 2Z0ZA 2OZHA 2QECA 4M6HA 4JZ0A 4F9UA 2VXKA 3EC4A 1M1DA 4MHYA 3B35A 1TKHA 2AFWA 4PSWA 4KLVA 3SI0A 4HNYB 2C27A 3QAHA 4CPAA 2F8HA 4CAFA 4W9YA 2NYQA 4Q7AA 4PXDA 2CTBA 2EO8A 3RNZA 3SXOA 2EBJA 1ON0A 3SI2A 3WR7A 2EVNA 4CYNA 1HDUA 4KLWA 4B5OA 4UCPA 3DNSA 2DF5A 1YREA 1LAPA 1LCPA 2P6FA 4M6IA 4TNUA 2EK8A 3LWUA 2IL4A 3NFZA 3D66A 4NGSA 3DSBA 4QUSA 4MFJA 3D68A 4KOTA 4CAWA 1QMUA 1VIXA 4OAEA 2FCKA 3RAMA 4CAEA 4YFJA 4ONUA 2C6GA 1Y7RA 5J1QA 4NGMA 3TCVA 3FF3A 3H5ZA 2NSMA 1F57A 5J8FA 1P0HA 3BJ7A 1XOVA 4EVYA 2CXAA 4WJBA 5LYIA 3HUVA 3K2KA 4AXVA 1IOIA 3B3WA 4U9YA 5ELYA 1BLLE 4FD4A 3DR6A 4ZY1A 2K5TA 3DDDA 3JTKA 3VATA 4C2XA 3FEDA 2ZW7A 1CPSA 3IWWA 3VH9A 2FS5A 5DWMA 3PZJA 4JWPA 1TF8A 3E0KA 3D7FA 4PQAA 2I79A 2WZNA 2VL1A 4OC0A 4U9ZA 1Z4RA 2QYVA 4P4DA 4OIWA 1Z8LA 1XRYA 4OC2A 4FUUA 3VWEA 2V8DA 4A95A 3GKRA 2OZUA 2Q4VA 3QB8A 2GFQA 4PK3A 1CG2A 4X2TA 5GCNA 1EE3P 3JVNA 4P10A 5C88A 1M4LA 1ZG8A 5F46A 2C6CA 2GIVA 3BI1A 1BO4A 4DYOA 4KVOE 5F48A 4CGMA 4ZY0A 2AFSA 4AG9A 2ZEGA 3CXQA 1TIQA 4E0AA 2B4BA 2BCOA 4B10A 3FB3A 4B12A 4MCQA 2Y0MA 5G1ZA 4TWEA 4AVAA 1UWYA 4R87A 2DPTA 1QSOA 3R9EA 4X3RA 1KUXA 4JXRA 3R9GA 5JQ4A 2O53A 1GHEA 3G3SA 3I3GA 1CM0A 1B87A 3B3VA 3RO0A 3KR4A 4O23A 4II9A 1ZG7A 4ZBGA 1Y0YA 4Y49C 2WSAA 3EY5A 3IEHA 3W91A 1YK3A 3IU1A 4B14A 5THWA 2D4OA 3H8FA 2FL4A 3I9SA 2Q04A 3IWGA 4B13A 5D8NA 1L0CA 4IAVA 4F9VA 2CTCA 3IU2A 3JUWA 4KSAA 3RBUA 4KUAA 1HDQA 2PJ4A 2Z10A 3GYAA 4R3LA 1JWQA 2PR1A 5J8CA 1Z8XA 1H8LA 2FSRA 3TE4A 1XMBA 2Q4YA 2YNEA 4KZTA 4ORFA 3SJFA 1Z2LA 4DUKA 2FIAA 3T9YA 4LUAA 2DPSA 3LMSA 3WC6A 2PJ1A 1S7FA 5A28A 4RN7A 2ABZA 4HNXB 2PRBA 2A4NA 3CZXA 4MCSA 4UWIA 5LRJA 1ARMA 1Y7EA 3BXMA 3DLJA 4LQGA 3N7ZA 4IHMA 5HVFA 3NH4A 2PIYA 5I4MA 3CXSA 2CNTA 3KI9A 4KOWA 2Z3NA 4K3NA 2B5GB 3LACA 1WK4A 1NE9A 3CXPA 4PSXA 2EWBA 2I3CA 2IMOA 4F6AA 2OU2A 4CGPA 1YLOA 3NA6A 4C7IA 4ONWA 4XNHC 3WC5A 4P45A 4PXCA 4UWJA 5G21A 3FNCA 2VZZA 2PJ0A 3NH8A 2PIZA 3TC8A 4MHPA 3D67A 2EUIA 3GIUA 1ZO0A 1I21A 4R76A 2GREA 4JLYA 4ZI6A 1QSRA 4CRYB 1Q2YA 2BSWA 3FIXA 3PBBA 2B5GA 3OWCA 4GS4A 1WWZA 5K8PA 2C6PA 4YRHA 4MY3A 4M6GA 4MFQA 4JXQA 4UA3A 3S6KA 2JDDA 1LANA 3PFEA 4CS0B 2WPXA 1S7LA 2QJ8A 2Q7BA 4CAXA 4OC5A 3D7GA 1LFWA 3CT9A 5EMIA 5LYDA 4HNWB 4E2AA 1IY7A 1Q2DA 2HB6A 3K9TA 4GXHA 5AGEA 4JD6A 5JPHA 4UEEA 4UCNA 3VWDA 2J8RA 5LRKA 1M44A 4PV6A 2ZENA 3BI0A 2PJ3A 4OMEA 2PJCA 2C1CA 4FAIA 2PDOA 4B11A 3T90A 2QIRA 2PVWA 2Q51A 2WUUA 3KGQA 2AE6A 2EK9A 3LD2A 3FVLA 4OC1A 1LAMA 1X12A 2IJZA 3IFEA 4EFDA 5IV0A 2WPWA 3ISXA 4FD7A 4IF5A 4P4FA 3LODA 4UBRA 4L89A 1I1DA 1Z9UA 2H5MA 1IOFA 2GU2A 2JBKA 1RTQA 1DTDA 3D3SA 4MFPA 4MHNA 2F7VA 4MJ8A 2XEIA 4LX9A 2YGWA 4R7MA 1I12A 1JQGA 2CNMA 5HVGA 3FECA 4MI4A 2V8GA 3PFOA 2REFA 2VI7A 3B2YA 4OIDA 3PEIA 2GE3A 3GLJA 3QAYA 4MY0A 1S7NA 4F0YA 4MCRA 4OP4A 1XE4A 3D2PA 1VHOA 2FVGA 4FWUA 4MHDA 4CRZB 5C82A 4NJRA 3PGPA 4NXYA 3S9MA 3GB0A 2PJBA 2Q4ZA 1GYTA 4Y49B 4HKFA 2PJ9A 1IYKA 1Y9WA 4Z65A 4PXBA 4OADA 1FT7A 4FD6A 5CBMA 2BUEA 3P2HA 2WYRA 1VKCA 3DR8A 5KTAA 1ZG9A 2X7BA 4NF1A 4F0XA 5IB9A 2ZEPA 3EXNA 4KS9A 3D7HA 3R95A 4FBEA 4OKOA 2P0WA 3F8KA 3GY9A 1XMTA 2ZW5A 4A32A 4E8OA 4MBUA 5LYFA 1IB1E 1RXTA 3B3CA 2NMTA 4MMOA 5AG6A 4KORA 4AVBA 4NEXA 3B8GA 2AFOA 1CP7A 1S60A 1MK4A 5H84A 4B5PB 1QSNA 5JM6A 4A30A 4Q36A 2RB7A 1Z5RA 3TTHA 3DGVA 4MFLA 2VQYA 5CNPA 2OZGA 3FX6A 1KZFA 1IIDA 2CY2A 2Z3PA 4H2KA 5DS0A 4X5KA 5CPAA 4C7HA 1RO5A 2Z3LA 1R43A 2GANA 2V8HA 2JEVA 1S3ZA 5BWAB 1FNOA 4UEFA 4XNHB 4BINA 3PB9X 2PSWA 1NSLA 3I1UA 2JDCA 4R6TA 4B5PA 4GM5A 4R57A 3TO7A 1YQEA 2Q7SA 1B6BA 3KQXA 4A31A 4ZGYB 4A37A 3MRUA 1XEBA 1CBXA 3W6XA 2ZEMA 3KR5A 4EMEA 1YMEA 4Q38A 3SJEA 3EFAA 2ZPAA 5KTDA 5H86A 3R9FA 4CGOA 3MN8A 3B3TA 1M4DA 5F47A 1TKFA 3P2FA 3VARA 4A2ZA 5A27A 1KUVA 3H4QA 4NGRA 4UFXA 2ZW6A 2DXQA 5KTCA 2Z3KA 1J4JA 1VHSA 1PU9A 4HPSA 3GUXA 2J9AA 4MRIA 4G1PA 1OBRA 1Z8WA 2XEFA 2PJ5A 1LOKA 6CPAA 5HXDA 2CIJA 3EO4A 4NFRA 3C26A 5F49A 4AG7A 4WWVA 2B4DB 4UFWA 2IQ6A 3FRMA 4KSIA 5K8NA 2B3UA 2G0BA 1AYEA 4NJQA 3NH5A 2FIWA 3TO6A 4KOVA 1YLEA 1SQHA 5AG5A 3SJGA 2ZEHA 4UEZA 1KWMA 3NE7A 3NE8A 4JJXA 4CGNA 3R1KA 5HH1A 2PRQA 2Z3OA 3PB7X 4P4BA 4A38A 1NMTA 2V8VA 3H8EA 1VGYA 2DEAA 4KVME 5HVHA 2ZEFA 4AB7A 2B4DA 3B3SA 1TXRA 4KOXA 4P6YA 2JEWA 3SXNA 3TT2A 2YNCA 4NGTA 4CYQA 4L8AA 4R3KA 3KZWA 2Z11A 2B58A 2KCWA 3WT4A 2ZW4A 2XEJA 3CDXA 1M4IA 2PQ8A 2OH1A 4PK2A 2O4HA 1NSAA 4OC3A 4UIAA 4X8IA 1N71A 1XF8A 1PUAA 1S7KA 3FYNA 2Q43A 2YNCC 4MFZA 4MHZA 2D4PA 2PJ8A 2VBQA 3F0AA 2FXFA 3BHXA 4ZY2A
chains in the Genus database with same CATH topology
3BLNA 3S6HA 4XPKA 2RC4A 4C2ZA 5ISVA 3IGRA 1M4GA 2AJ6A 2JLMA 2HQYA 2ZXVA 3TO9A 4BMHA 1XIXA 2R7HA 4KUBA 5AG7A 2B3VA 5E96A 4YGOA 3TOBA 3V8IA 3TFYA 1KUYA 4KSFA 1YVKA 4RS2A 2J8MA 3D8PA 3G8WA 3FBUA 3S6GA 4NSQA 5EBVA 2FT0A 2ARHA 4QC6A 2VEZA 3K9UA 4KOSA 2G3AA 2CNSA 2BEIA 4C2YA 4U5YA 2HV2A 5I0CA 2OB0A 4XPDB 4NCZA 4M3SA 2P6GA 2Q44A 4CAVA 5EC4A 3ZZIA 2Z3MA 4KOUA 4J3GA 4R9MA 4DNCA 4CYPA 1YX0A 4FD5A 4XPLA 3S6FA 1FY7A 2J8NA 2Q0YA 3UY5A 3FXTA 1LRZA 2QMLA 2G3TA 3PP9A 1YGHA 2O28A 2YNDA 1MJ9A 1Y9KA 5IX3A 4XPDC 3TOAA 1V0CA 1S5KA 1Z4EA 4M85A 3IWEA 3F5BA 4C68A 4KVXA 1YVOA 4QVTA 3KKWA 5G22A 1MJBA 5IB0A 4KOYA 2F5IA 4UFVA 2BL1A 3BJ8A 4A33A 1CJWA 1R57A 3RYOA 5HMNA 2VZYA 2HUZA 1IICA 1BOBA 2ATRA 4H6UA 2REEA 3D2MA 5DWNA 2I00A 1QSTA 5G20A 1P4NA 1U6MA 4IUSA 4H89A 3ZJ0A 2FE7A 2PC1A 4QBJA 2R1IA 1UFHA 4QB9A 1OZPA 5FVJA 3W6SA 4MFKA 1MJAA 3SHPA 4OLLA 4CGLA 1IYLA 1K4JA 4UCMA 4CYOA 4AVCA 4K30A 5AG4A 3MGDA 1Q2CA 3A9LA 1YR0A 1QSMA 4H6ZA 4BBHA 2P6EA 4RI1A 3R96A 2R98A 2R8VA 2PR8A 2Z0ZA 2OZHA 2QECA 2VXKA 3EC4A 1M1DA 4PSWA 4KLVA 4HNYB 2C27A 3QAHA 4CAFA 3SXOA 1ON0A 3WR7A 4CYNA 2EVNA 4KLWA 4B5OA 4UCPA 3DNSA 1YREA 2P6FA 2IL4A 3DSBA 4QUSA 4MFJA 4KOTA 4CAWA 4OAEA 4YFJA 2FCKA 4CAEA 4ONUA 1Y7RA 3TCVA 3H5ZA 5J8FA 1P0HA 3BJ7A 4EVYA 2CXAA 4U9YA 4FD4A 3DR6A 2K5TA 3DDDA 3JTKA 4C2XA 2ZW7A 2FS5A 5DWMA 3PZJA 4JWPA 3E0KA 2I79A 4U9ZA 1Z4RA 3VWEA 4A95A 3GKRA 2OZUA 2Q4VA 3QB8A 4PK3A 5GCNA 3JVNA 5C88A 5F46A 2GIVA 1BO4A 4KVOE 5F48A 4CGMA 4AG9A 3CXQA 1TIQA 4E0AA 2B4BA 4B10A 3FB3A 4B12A 2Y0MA 5G1ZA 4AVAA 4R87A 2DPTA 1QSOA 3R9EA 1KUXA 4JXRA 3R9GA 5JQ4A 3I3GA 1GHEA 3G3SA 4II9A 1CM0A 1B87A 4ZBGA 4Y49C 2WSAA 3EY5A 3W91A 1YK3A 3IU1A 4B14A 2D4OA 2FL4A 3I9SA 2Q04A 3IWGA 4B13A 1L0CA 3IU2A 3JUWA 4KSAA 4KUAA 2Z10A 3GYAA 4R3LA 2PR1A 5J8CA 2FSRA 3TE4A 2Q4YA 2YNEA 4KZTA 4ORFA 2FIAA 3T9YA 4LUAA 2DPSA 1S7FA 5A28A 4HNXB 2PRBA 2A4NA 4UWIA 3N7ZA 3CXSA 2CNTA 4KOWA 2Z3NA 2B5GB 4PSXA 1WK4A 1NE9A 3CXPA 4F6AA 2OU2A 4CGPA 4C7IA 4XNHC 5G21A 4UWJA 3FNCA 2VZZA 2EUIA 1ZO0A 1I21A 4JLYA 1QSRA 4CRYB 1Q2YA 2BSWA 3FIXA 2B5GA 3OWCA 4GS4A 1WWZA 4YRHA 4MY3A 4MFQA 4JXQA 4UA3A 3S6KA 2JDDA 4CS0B 2WPXA 1S7LA 2Q7BA 4CAXA 4HNWB 4E2AA 1Q2DA 5AGEA 4JD6A 5JPHA 4UCNA 3VWDA 2J8RA 1M44A 4PV6A 2PDOA 4B11A 3T90A 2QIRA 2WUUA 2AE6A 3LD2A 5IV0A 2WPWA 4FD7A 4IF5A 3LODA 4UBRA 4L89A 1I1DA 1Z9UA 2H5MA 3D3SA 4MFPA 4MJ8A 4LX9A 2YGWA 1I12A 2CNMA 4MI4A 2REFA 2VI7A 2GE3A 4MY0A 1S7NA 4F0YA 1XE4A 3D2PA 4MHDA 4CRZB 5C82A 3PGPA 4NXYA 4Y49B 4HKFA 1IYKA 1Y9WA 4OADA 4FD6A 2BUEA 3P2HA 1VKCA 3DR8A 5KTAA 2X7BA 4NF1A 4F0XA 4KS9A 3EXNA 3R95A 2P0WA 3F8KA 3GY9A 1XMTA 2ZW5A 4A32A 4E8OA 4MBUA 1IB1E 1RXTA 2NMTA 5AG6A 4KORA 4AVBA 4NEXA 3B8GA 1S60A 1MK4A 5H84A 4B5PB 1QSNA 4A30A 4Q36A 3TTHA 4MFLA 2VQYA 5CNPA 2OZGA 1KZFA 1IIDA 2CY2A 2Z3PA 4X5KA 4C7HA 1RO5A 2Z3LA 2GANA 2JEVA 1S3ZA 5BWAB 4XNHB 2PSWA 1NSLA 2JDCA 4B5PA 4R57A 3TO7A 1B6BA 4A31A 4ZGYB 1XEBA 3W6XA 4Q38A 3EFAA 2ZPAA 5H86A 3R9FA 4CGOA 1M4DA 5F47A 3P2FA 4A2ZA 5A27A 1KUVA 3H4QA 4UFXA 2ZW6A 2DXQA 5KTCA 2Z3KA 1J4JA 1VHSA 1PU9A 3EO4A 5F49A 3C26A 4AG7A 2B4DB 4UFWA 3FRMA 2B3UA 2G0BA 2FIWA 3TO6A 4KOVA 1YLEA 1SQHA 5AG5A 3NE7A 4CGNA 4JJXA 3R1KA 5HH1A 2Z3OA 1NMTA 4KVME 4AB7A 2B4DA 4KOXA 3SXNA 3TT2A 2YNCA 4CYQA 4L8AA 4R3KA 2Z11A 2B58A 2KCWA 2ZW4A 1M4IA 2PQ8A 2OH1A 4PK2A 1N71A 3FYNA 1XF8A 1PUAA 1S7KA 2YNCC 4MFZA 2D4PA 2VBQA 4I49A 3F0AA 2FXFA 5KTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BLN A;  3S6H A;  4XPK A;  2RC4 A;  5ISV A;  3IGR A;  1M4G A;  2AJ6 A;  2JLM A;  2HQY A;  2ZXV A;  3TO9 A;  4BMH A;  1XIX A;  2R7H A;  4KUB A;  2B3V A;  5E96 A;  4YGO A;  3TOB A;  3V8I A;  3TFY A;  1KUY A;  1YVK A;  4RS2 A;  2J8M A;  3D8P A;  3G8W A;  3FBU A;  3S6G A;  4NSQ A;  5EBV A;  2FT0 A;  2ARH A;  4QC6 A;  2VEZ A;  3K9U A;  4KOS A;  2G3A A;  2CNS A;  2BEI A;  4U5Y A;  2HV2 A;  5I0C A;  2OB0 A;  4XPD B;  4NCZ A;  4M3S A;  2P6G A;  2Q44 A;  4CAV A;  5EC4 A;  3ZZI A;  4KOU A;  4J3G A;  4R9M A;  4DNC A;  1YX0 A;  4FD5 A;  4XPL A;  3S6F A;  1FY7 A;  2J8N A;  2Q0Y A;  3UY5 A;  3FXT A;  1LRZ A;  2QML A;  2G3T A;  3PP9 A;  1YGH A;  2O28 A;  1MJ9 A;  1Y9K A;  5IX3 A;  4XPD C;  3TOA A;  1V0C A;  1S5K A;  1Z4E A;  4M85 A;  3F5B A;  4KVX A;  1YVO A;  4QVT A;  3KKW A;  1MJB A;  5IB0 A;  4KOY A;  2F5I A;  2BL1 A;  3BJ8 A;  1CJW A;  1R57 A;  3RYO A;  5HMN A;  2VZY A;  2HUZ A;  1IIC A;  1BOB A;  2ATR A;  4H6U A;  2REE A;  3D2M A;  5DWN A;  2I00 A;  1QST A;  1P4N A;  1U6M A;  4IUS A;  4H89 A;  3ZJ0 A;  2FE7 A;  2PC1 A;  4QBJ A;  2R1I A;  1UFH A;  4QB9 A;  1OZP A;  5FVJ A;  3W6S A;  1MJA A;  3SHP A;  4OLL A;  1IYL A;  1K4J A;  4AVC A;  4K30 A;  3MGD A;  1Q2C A;  1YR0 A;  1QSM A;  4H6Z A;  2P6E A;  4RI1 A;  3R96 A;  2R98 A;  2R8V A;  2PR8 A;  2Z0Z A;  2OZH A;  2QEC A;  2VXK A;  3EC4 A;  1M1D A;  4PSW A;  4KLV A;  4HNY B;  2C27 A;  3QAH A;  3SXO A;  1ON0 A;  3WR7 A;  2EVN A;  4KLW A;  4B5O A;  3DNS A;  1YRE A;  2P6F A;  2IL4 A;  3DSB A;  4QUS A;  4KOT A;  4CAW A;  4OAE A;  4YFJ A;  2FCK A;  4ONU A;  1Y7R A;  3TCV A;  5J8F A;  1P0H A;  3BJ7 A;  4EVY A;  4U9Y A;  4FD4 A;  3DR6 A;  2K5T A;  3DDD A;  2ZW7 A;  2FS5 A;  5DWM A;  3PZJ A;  4JWP A;  3E0K A;  2I79 A;  4U9Z A;  1Z4R A;  3VWE A;  3GKR A;  2OZU A;  2Q4V A;  3QB8 A;  4PK3 A;  5GCN A;  3JVN A;  5C88 A;  5F46 A;  2GIV A;  1BO4 A;  4KVO E;  5F48 A;  4AG9 A;  3CXQ A;  1TIQ A;  4E0A A;  2B4B A;  3FB3 A;  2Y0M A;  4AVA A;  4R87 A;  1QSO A;  3R9E A;  1KUX A;  4JXR A;  3R9G A;  5JQ4 A;  3I3G A;  1GHE A;  3G3S A;  4II9 A;  1CM0 A;  1B87 A;  4ZBG A;  4Y49 C;  3EY5 A;  3W91 A;  1YK3 A;  2D4O A;  2FL4 A;  3I9S A;  2Q04 A;  3IWG A;  1L0C A;  3JUW A;  4KUA A;  2Z10 A;  3GYA A;  4R3L A;  2PR1 A;  5J8C A;  2FSR A;  3TE4 A;  2Q4Y A;  4KZT A;  4ORF A;  2FIA A;  3T9Y A;  4LUA A;  1S7F A;  4HNX B;  2PRB A;  2A4N A;  4UWI A;  3N7Z A;  3CXS A;  2CNT A;  4KOW A;  2B5G B;  4PSX A;  1WK4 A;  1NE9 A;  3CXP A;  4F6A A;  2OU2 A;  4XNH C;  4UWJ A;  3FNC A;  2VZZ A;  2EUI A;  1I21 A;  4JLY A;  1QSR A;  4CRY B;  1Q2Y A;  2BSW A;  3FIX A;  2B5G A;  3OWC A;  4GS4 A;  1WWZ A;  4YRH A;  4MY3 A;  4JXQ A;  4UA3 A;  3S6K A;  2JDD A;  4CS0 B;  2WPX A;  1S7L A;  2Q7B A;  4CAX A;  4HNW B;  4E2A A;  1Q2D A;  4JD6 A;  5JPH A;  3VWD A;  2J8R A;  1M44 A;  4PV6 A;  2PDO A;  3T90 A;  2QIR A;  2AE6 A;  3LD2 A;  5IV0 A;  2WPW A;  4FD7 A;  4IF5 A;  3LOD A;  4UBR A;  4L89 A;  1I1D A;  1Z9U A;  2H5M A;  3D3S A;  4MJ8 A;  4LX9 A;  1I12 A;  2CNM A;  4MI4 A;  2REF A;  2VI7 A;  2GE3 A;  4MY0 A;  1S7N A;  4F0Y A;  1XE4 A;  3D2P A;  4MHD A;  4CRZ B;  5C82 A;  3PGP A;  4NXY A;  4Y49 B;  4HKF A;  1IYK A;  1Y9W A;  4OAD A;  4FD6 A;  2BUE A;  3P2H A;  1VKC A;  3DR8 A;  5KTA A;  2X7B A;  4NF1 A;  3EXN A;  3R95 A;  2P0W A;  3F8K A;  3GY9 A;  1XMT A;  2ZW5 A;  4E8O A;  4MBU A;  1IB1 E;  1RXT A;  2NMT A;  4KOR A;  4AVB A;  4NEX A;  3B8G A;  1S60 A;  1MK4 A;  5H84 A;  4B5P B;  1QSN A;  3TTH A;  2VQY A;  5CNP A;  2OZG A;  1KZF A;  1IID A;  2CY2 A;  4X5K A;  1RO5 A;  2GAN A;  2JEV A;  1S3Z A;  4XNH B;  2PSW A;  1NSL A;  2JDC A;  4B5P A;  4R57 A;  3TO7 A;  1B6B A;  1XEB A;  3W6X A;  3EFA A;  2ZPA A;  5H86 A;  3R9F A;  1M4D A;  5F47 A;  3P2F A;  1KUV A;  3H4Q A;  2ZW6 A;  2DXQ A;  5KTC A;  1J4J A;  1VHS A;  1PU9 A;  3EO4 A;  5F49 A;  3C26 A;  4AG7 A;  2B4D B;  3FRM A;  2B3U A;  2G0B A;  2FIW A;  3TO6 A;  4KOV A;  1YLE A;  1SQH A;  3NE7 A;  4JJX A;  3R1K A;  5HH1 A;  1NMT A;  4KVM E;  4AB7 A;  2B4D A;  4KOX A;  3SXN A;  3TT2 A;  4L8A A;  4R3K A;  2Z11 A;  2B58 A;  2KCW A;  2ZW4 A;  1M4I A;  2PQ8 A;  2OH1 A;  4PK2 A;  1N71 A;  1XF8 A;  1PUA A;  1S7K A;  3FYN A;  2D4P A;  2VBQ A;  4I49 A;  3F0A A;  2FXF A;  5KTD A; 
#chains in the Genus database with same CATH topology
 3BLN A;  2PVV A;  4JYW A;  3KHZ A;  4XPK A;  3S6H A;  3IJ3 A;  2RC4 A;  4IK2 A;  4C2Z A;  5ISV A;  3FEE A;  3IGR A;  2RFH A;  1M4G A;  1F2O A;  4OC4 A;  2AJ6 A;  2JLM A;  4PXE A;  2HQY A;  2PJ7 A;  2ZXV A;  1XBU A;  3PB6 X;  1A2Z A;  1ZLH A;  3HLP A;  3IC1 A;  3TO9 A;  4BMH A;  5K8O A;  2ANP A;  2AFU A;  1XIX A;  2R7H A;  4KUB A;  2HC9 A;  3RZA A;  5AG7 A;  2AFZ A;  2B3V A;  5E96 A;  2PJ6 A;  4LQ6 A;  2BOA A;  3L2N A;  4YGO A;  3T8W A;  3TOB A;  3V8I A;  2QVP A;  5D29 A;  3TFY A;  1KUY A;  4KSF A;  2XEG A;  1YVK A;  5LYL A;  4RS2 A;  2J8M A;  4P4I A;  5K8M A;  3D8P A;  4BD9 A;  3G8W A;  1XFO A;  4I49 A;  3PB8 X;  3FBU A;  1XJO A;  4NSQ A;  3S6G A;  1F2P A;  5EBV A;  2FT0 A;  1CX8 A;  2ARH A;  4QC6 A;  8CPA A;  2VEZ A;  3K9U A;  4KOS A;  3PB4 X;  2G3A A;  1R3N A;  2CNS A;  4MXU A;  2BEI A;  2GLF A;  4C2Y A;  1ZLI A;  3FH4 A;  3V38 A;  4F8Z A;  5F09 A;  2ODF A;  4U5Y A;  1Y0R A;  2HV2 A;  5I0C A;  2OOT A;  1IU8 A;  2OB0 A;  3PRT A;  1AMP A;  4XPD B;  1DE4 C;  2GLJ A;  4NCZ A;  4M3S A;  1PCA A;  2P6G A;  2Q44 A;  4CAV A;  5EC4 A;  4UIB A;  3ZZI A;  2Z3M A;  7CPA A;  4KOU A;  1YW6 A;  4J3G A;  3ISZ A;  4R9M A;  2PJ2 A;  4A39 A;  4MCP A;  2PE3 A;  2PJA A;  4P4E A;  4PPZ A;  4R8F A;  4CYP A;  1YX0 A;  4FD5 A;  4DNC A;  4XPL A;  3SJX A;  1ARL A;  1BPN A;  3H8G A;  1VHE A;  3QNV A;  3S6F A;  1FY7 A;  2ZEL A;  3IO1 A;  3FMC A;  2J8N A;  2Q0Y A;  3UY5 A;  4YU9 A;  3B7I A;  3JRU A;  3N5F A;  3FXT A;  1LRZ A;  5LRG A;  2AFX A;  1TKJ A;  2QML A;  3CPA A;  2G3T A;  3KAS A;  3PP9 A;  2G9D A;  1YGH A;  2O28 A;  2YND A;  1MJ9 A;  1Y9K A;  2ZOF A;  3V7Z A;  1QQ9 A;  1HEE A;  5IX3 A;  3S9N A;  4XPD C;  1BAV A;  3TOA A;  1V0C A;  4A94 A;  1BPM A;  1S5K A;  1Z4E A;  4M85 A;  4NGN A;  3WC7 A;  3IWE A;  3F5B A;  4C68 A;  2ZEE A;  4KVX A;  1YVO A;  4QVT A;  3KKW A;  5G22 A;  1X10 A;  1MJB A;  4NGP A;  3FJU A;  3D7D A;  4KOY A;  5IB0 A;  2F5I A;  4UFV A;  2BL1 A;  3BJ8 A;  4ZYQ A;  2OR4 A;  5JH9 A;  4A33 A;  1CJW A;  1R57 A;  1YW4 A;  3RYO A;  5HMN A;  2VZY A;  2HUZ A;  1IIC A;  2ZEO A;  1Q7L A;  1BOB A;  2ATR A;  2BO9 A;  3TX8 A;  4P44 A;  2REE A;  3D2M A;  3D4U A;  4H6U A;  2I00 A;  5DWN A;  1PYT B;  1QST A;  2POK A;  1P4N A;  5G20 A;  1U6M A;  4IUS A;  4YWY A;  1TF9 A;  3KQZ A;  3S9L A;  4H89 A;  4P4J A;  3ZJ0 A;  2FE7 A;  3KHX A;  1ELL P;  2PC1 A;  4QBJ A;  2R1I A;  1CPX A;  1UFH A;  2V77 A;  4UF4 A;  1Z8T A;  4QB9 A;  4ZX9 A;  1OZP A;  2ZED A;  2AFM A;  1CP6 A;  4EWT A;  5FVJ A;  4ZX8 A;  3W6S A;  4MFK A;  1MJA A;  3SHP A;  4OLL A;  4CGL A;  1IYL A;  3KL9 A;  1K4J A;  2CF4 A;  2ZOG A;  5JGF A;  4UCM A;  4CYO A;  1IGB A;  4AVC A;  4K30 A;  1YSJ A;  1ELM P;  5AG4 A;  3MGD A;  4RUH A;  1Q2C A;  3SI1 A;  3A9L A;  4DJL A;  3WAB A;  1YR0 A;  1QSM A;  4H6Z A;  2PCU A;  2P6E A;  3PBE A;  4BBH A;  3CPX A;  4NGQ A;  4B6Z A;  1AUG A;  4RI1 A;  3R96 A;  2R98 A;  3IIB A;  2R8V A;  2JBJ A;  2PR8 A;  2Z0Z A;  2OZH A;  2QEC A;  4M6H A;  4JZ0 A;  4F9U A;  2VXK A;  3EC4 A;  1M1D A;  4MHY A;  3B35 A;  1TKH A;  2AFW A;  4PSW A;  4KLV A;  3SI0 A;  4HNY B;  2C27 A;  3QAH A;  4CPA A;  2F8H A;  4CAF A;  4W9Y A;  2NYQ A;  4Q7A A;  4PXD A;  2CTB A;  2EO8 A;  3RNZ A;  3SXO A;  2EBJ A;  1ON0 A;  3SI2 A;  3WR7 A;  2EVN A;  4CYN A;  1HDU A;  4KLW A;  4B5O A;  4UCP A;  3DNS A;  2DF5 A;  1YRE A;  1LAP A;  1LCP A;  2P6F A;  4M6I A;  4TNU A;  2EK8 A;  3LWU A;  2IL4 A;  3NFZ A;  3D66 A;  4NGS A;  3DSB A;  4QUS A;  4MFJ A;  3D68 A;  4KOT A;  4CAW A;  1QMU A;  1VIX A;  4OAE A;  2FCK A;  3RAM A;  4CAE A;  4YFJ A;  4ONU A;  2C6G A;  1Y7R A;  5J1Q A;  4NGM A;  3TCV A;  3FF3 A;  3H5Z A;  2NSM A;  1F57 A;  5J8F A;  1P0H A;  3BJ7 A;  1XOV A;  4EVY A;  2CXA A;  4WJB A;  5LYI A;  3HUV A;  3K2K A;  4AXV A;  1IOI A;  3B3W A;  4U9Y A;  5ELY A;  1BLL E;  4FD4 A;  3DR6 A;  4ZY1 A;  2K5T A;  3DDD A;  3JTK A;  3VAT A;  4C2X A;  3FED A;  2ZW7 A;  1CPS A;  3IWW A;  3VH9 A;  2FS5 A;  5DWM A;  3PZJ A;  4JWP A;  1TF8 A;  3E0K A;  3D7F A;  4PQA A;  2I79 A;  2WZN A;  2VL1 A;  4OC0 A;  4U9Z A;  1Z4R A;  2QYV A;  4P4D A;  4OIW A;  1Z8L A;  1XRY A;  4OC2 A;  4FUU A;  3VWE A;  2V8D A;  4A95 A;  3GKR A;  2OZU A;  2Q4V A;  3QB8 A;  2GFQ A;  4PK3 A;  1CG2 A;  4X2T A;  5GCN A;  1EE3 P;  3JVN A;  4P10 A;  5C88 A;  1M4L A;  1ZG8 A;  5F46 A;  2C6C A;  2GIV A;  3BI1 A;  1BO4 A;  4DYO A;  4KVO E;  5F48 A;  4CGM A;  4ZY0 A;  2AFS A;  4AG9 A;  2ZEG A;  3CXQ A;  1TIQ A;  4E0A A;  2B4B A;  2BCO A;  4B10 A;  3FB3 A;  4B12 A;  4MCQ A;  2Y0M A;  5G1Z A;  4TWE A;  4AVA A;  1UWY A;  4R87 A;  2DPT A;  1QSO A;  3R9E A;  4X3R A;  1KUX A;  4JXR A;  3R9G A;  5JQ4 A;  2O53 A;  1GHE A;  3G3S A;  3I3G A;  1CM0 A;  1B87 A;  3B3V A;  3RO0 A;  3KR4 A;  4O23 A;  4II9 A;  1ZG7 A;  4ZBG A;  1Y0Y A;  4Y49 C;  2WSA A;  3EY5 A;  3IEH A;  3W91 A;  1YK3 A;  3IU1 A;  4B14 A;  5THW A;  2D4O A;  3H8F A;  2FL4 A;  3I9S A;  2Q04 A;  3IWG A;  4B13 A;  5D8N A;  1L0C A;  4IAV A;  4F9V A;  2CTC A;  3IU2 A;  3JUW A;  4KSA A;  3RBU A;  4KUA A;  1HDQ A;  2PJ4 A;  2Z10 A;  3GYA A;  4R3L A;  1JWQ A;  2PR1 A;  5J8C A;  1Z8X A;  1H8L A;  2FSR A;  3TE4 A;  1XMB A;  2Q4Y A;  2YNE A;  4KZT A;  4ORF A;  3SJF A;  1Z2L A;  4DUK A;  2FIA A;  3T9Y A;  4LUA A;  2DPS A;  3LMS A;  3WC6 A;  2PJ1 A;  1S7F A;  5A28 A;  4RN7 A;  2ABZ A;  4HNX B;  2PRB A;  2A4N A;  3CZX A;  4MCS A;  4UWI A;  5LRJ A;  1ARM A;  1Y7E A;  3BXM A;  3DLJ A;  4LQG A;  3N7Z A;  4IHM A;  5HVF A;  3NH4 A;  2PIY A;  5I4M A;  3CXS A;  2CNT A;  3KI9 A;  4KOW A;  2Z3N A;  4K3N A;  2B5G B;  3LAC A;  1WK4 A;  1NE9 A;  3CXP A;  4PSX A;  2EWB A;  2I3C A;  2IMO A;  4F6A A;  2OU2 A;  4CGP A;  1YLO A;  3NA6 A;  4C7I A;  4ONW A;  4XNH C;  3WC5 A;  4P45 A;  4PXC A;  4UWJ A;  5G21 A;  3FNC A;  2VZZ A;  2PJ0 A;  3NH8 A;  2PIZ A;  3TC8 A;  4MHP A;  3D67 A;  2EUI A;  3GIU A;  1ZO0 A;  1I21 A;  4R76 A;  2GRE A;  4JLY A;  4ZI6 A;  1QSR A;  4CRY B;  1Q2Y A;  2BSW A;  3FIX A;  3PBB A;  2B5G A;  3OWC A;  4GS4 A;  1WWZ A;  5K8P A;  2C6P A;  4YRH A;  4MY3 A;  4M6G A;  4MFQ A;  4JXQ A;  4UA3 A;  3S6K A;  2JDD A;  1LAN A;  3PFE A;  4CS0 B;  2WPX A;  1S7L A;  2QJ8 A;  2Q7B A;  4CAX A;  4OC5 A;  3D7G A;  1LFW A;  3CT9 A;  5EMI A;  5LYD A;  4HNW B;  4E2A A;  1IY7 A;  1Q2D A;  2HB6 A;  3K9T A;  4GXH A;  5AGE A;  4JD6 A;  5JPH A;  4UEE A;  4UCN A;  3VWD A;  2J8R A;  5LRK A;  1M44 A;  4PV6 A;  2ZEN A;  3BI0 A;  2PJ3 A;  4OME A;  2PJC A;  2C1C A;  4FAI A;  2PDO A;  4B11 A;  3T90 A;  2QIR A;  2PVW A;  2Q51 A;  2WUU A;  3KGQ A;  2AE6 A;  2EK9 A;  3LD2 A;  3FVL A;  4OC1 A;  1LAM A;  1X12 A;  2IJZ A;  3IFE A;  4EFD A;  5IV0 A;  2WPW A;  3ISX A;  4FD7 A;  4IF5 A;  4P4F A;  3LOD A;  4UBR A;  4L89 A;  1I1D A;  1Z9U A;  2H5M A;  1IOF A;  2GU2 A;  2JBK A;  1RTQ A;  1DTD A;  3D3S A;  4MFP A;  4MHN A;  2F7V A;  4MJ8 A;  2XEI A;  4LX9 A;  2YGW A;  4R7M A;  1I12 A;  1JQG A;  2CNM A;  5HVG A;  3FEC A;  4MI4 A;  2V8G A;  3PFO A;  2REF A;  2VI7 A;  3B2Y A;  4OID A;  3PEI A;  2GE3 A;  3GLJ A;  3QAY A;  4MY0 A;  1S7N A;  4F0Y A;  4MCR A;  4OP4 A;  1XE4 A;  3D2P A;  1VHO A;  2FVG A;  4FWU A;  4MHD A;  4CRZ B;  5C82 A;  4NJR A;  3PGP A;  4NXY A;  3S9M A;  3GB0 A;  2PJB A;  2Q4Z A;  1GYT A;  4Y49 B;  4HKF A;  2PJ9 A;  1IYK A;  1Y9W A;  4Z65 A;  4PXB A;  4OAD A;  1FT7 A;  4FD6 A;  5CBM A;  2BUE A;  3P2H A;  2WYR A;  1VKC A;  3DR8 A;  5KTA A;  1ZG9 A;  2X7B A;  4NF1 A;  4F0X A;  5IB9 A;  2ZEP A;  3EXN A;  4KS9 A;  3D7H A;  3R95 A;  4FBE A;  4OKO A;  2P0W A;  3F8K A;  3GY9 A;  1XMT A;  2ZW5 A;  4A32 A;  4E8O A;  4MBU A;  5LYF A;  1IB1 E;  1RXT A;  3B3C A;  2NMT A;  4MMO A;  5AG6 A;  4KOR A;  4AVB A;  4NEX A;  3B8G A;  2AFO A;  1CP7 A;  1S60 A;  1MK4 A;  5H84 A;  4B5P B;  1QSN A;  5JM6 A;  4A30 A;  4Q36 A;  2RB7 A;  1Z5R A;  3TTH A;  3DGV A;  4MFL A;  2VQY A;  5CNP A;  2OZG A;  3FX6 A;  1KZF A;  1IID A;  2CY2 A;  2Z3P A;  4H2K A;  5DS0 A;  4X5K A;  5CPA A;  4C7H A;  1RO5 A;  2Z3L A;  1R43 A;  2GAN A;  2V8H A;  2JEV A;  1S3Z A;  5BWA B;  1FNO A;  4UEF A;  4XNH B;  4BIN A;  3PB9 X;  2PSW A;  1NSL A;  3I1U A;  2JDC A;  4R6T A;  4B5P A;  4GM5 A;  4R57 A;  3TO7 A;  1YQE A;  2Q7S A;  1B6B A;  3KQX A;  4A31 A;  4ZGY B;  4A37 A;  3MRU A;  1XEB A;  1CBX A;  3W6X A;  2ZEM A;  3KR5 A;  4EME A;  1YME A;  4Q38 A;  3SJE A;  3EFA A;  2ZPA A;  5KTD A;  5H86 A;  3R9F A;  4CGO A;  3MN8 A;  3B3T A;  1M4D A;  5F47 A;  1TKF A;  3P2F A;  3VAR A;  4A2Z A;  5A27 A;  1KUV A;  3H4Q A;  4NGR A;  4UFX A;  2ZW6 A;  2DXQ A;  5KTC A;  2Z3K A;  1J4J A;  1VHS A;  1PU9 A;  4HPS A;  3GUX A;  2J9A A;  4MRI A;  4G1P A;  1OBR A;  1Z8W A;  2XEF A;  2PJ5 A;  1LOK A;  6CPA A;  5HXD A;  2CIJ A;  3EO4 A;  4NFR A;  3C26 A;  5F49 A;  4AG7 A;  4WWV A;  2B4D B;  4UFW A;  2IQ6 A;  3FRM A;  4KSI A;  5K8N A;  2B3U A;  2G0B A;  1AYE A;  4NJQ A;  3NH5 A;  2FIW A;  3TO6 A;  4KOV A;  1YLE A;  1SQH A;  5AG5 A;  3SJG A;  2ZEH A;  4UEZ A;  1KWM A;  3NE7 A;  3NE8 A;  4JJX A;  4CGN A;  3R1K A;  5HH1 A;  2PRQ A;  2Z3O A;  3PB7 X;  4P4B A;  4A38 A;  1NMT A;  2V8V A;  3H8E A;  1VGY A;  2DEA A;  4KVM E;  5HVH A;  2ZEF A;  4AB7 A;  2B4D A;  3B3S A;  1TXR A;  4KOX A;  4P6Y A;  2JEW A;  3SXN A;  3TT2 A;  2YNC A;  4NGT A;  4CYQ A;  4L8A A;  4R3K A;  3KZW A;  2Z11 A;  2B58 A;  2KCW A;  3WT4 A;  2ZW4 A;  2XEJ A;  3CDX A;  1M4I A;  2PQ8 A;  2OH1 A;  4PK2 A;  2O4H A;  1NSA A;  4OC3 A;  4UIA A;  4X8I A;  1N71 A;  1XF8 A;  1PUA A;  1S7K A;  3FYN A;  2Q43 A;  2YNC C;  4MFZ A;  4MHZ A;  2D4P A;  2PJ8 A;  2VBQ A;  3F0A A;  2FXF A;  3BHX A;  4ZY2 A; 
#chains in the Genus database with same CATH homology
 3BLN A;  3S6H A;  4XPK A;  2RC4 A;  4C2Z A;  5ISV A;  3IGR A;  1M4G A;  2AJ6 A;  2JLM A;  2HQY A;  2ZXV A;  3TO9 A;  4BMH A;  1XIX A;  2R7H A;  4KUB A;  5AG7 A;  2B3V A;  5E96 A;  4YGO A;  3TOB A;  3V8I A;  3TFY A;  1KUY A;  4KSF A;  1YVK A;  4RS2 A;  2J8M A;  3D8P A;  3G8W A;  3FBU A;  3S6G A;  4NSQ A;  5EBV A;  2FT0 A;  2ARH A;  4QC6 A;  2VEZ A;  3K9U A;  4KOS A;  2G3A A;  2CNS A;  2BEI A;  4C2Y A;  4U5Y A;  2HV2 A;  5I0C A;  2OB0 A;  4XPD B;  4NCZ A;  4M3S A;  2P6G A;  2Q44 A;  4CAV A;  5EC4 A;  3ZZI A;  2Z3M A;  4KOU A;  4J3G A;  4R9M A;  4DNC A;  4CYP A;  1YX0 A;  4FD5 A;  4XPL A;  3S6F A;  1FY7 A;  2J8N A;  2Q0Y A;  3UY5 A;  3FXT A;  1LRZ A;  2QML A;  2G3T A;  3PP9 A;  1YGH A;  2O28 A;  2YND A;  1MJ9 A;  1Y9K A;  5IX3 A;  4XPD C;  3TOA A;  1V0C A;  1S5K A;  1Z4E A;  4M85 A;  3IWE A;  3F5B A;  4C68 A;  4KVX A;  1YVO A;  4QVT A;  3KKW A;  5G22 A;  1MJB A;  5IB0 A;  4KOY A;  2F5I A;  4UFV A;  2BL1 A;  3BJ8 A;  4A33 A;  1CJW A;  1R57 A;  3RYO A;  5HMN A;  2VZY A;  2HUZ A;  1IIC A;  1BOB A;  2ATR A;  4H6U A;  2REE A;  3D2M A;  5DWN A;  2I00 A;  1QST A;  5G20 A;  1P4N A;  1U6M A;  4IUS A;  4H89 A;  3ZJ0 A;  2FE7 A;  2PC1 A;  4QBJ A;  2R1I A;  1UFH A;  4QB9 A;  1OZP A;  5FVJ A;  3W6S A;  4MFK A;  1MJA A;  3SHP A;  4OLL A;  4CGL A;  1IYL A;  1K4J A;  4UCM A;  4CYO A;  4AVC A;  4K30 A;  5AG4 A;  3MGD A;  1Q2C A;  3A9L A;  1YR0 A;  1QSM A;  4H6Z A;  4BBH A;  2P6E A;  4RI1 A;  3R96 A;  2R98 A;  2R8V A;  2PR8 A;  2Z0Z A;  2OZH A;  2QEC A;  2VXK A;  3EC4 A;  1M1D A;  4PSW A;  4KLV A;  4HNY B;  2C27 A;  3QAH A;  4CAF A;  3SXO A;  1ON0 A;  3WR7 A;  4CYN A;  2EVN A;  4KLW A;  4B5O A;  4UCP A;  3DNS A;  1YRE A;  2P6F A;  2IL4 A;  3DSB A;  4QUS A;  4MFJ A;  4KOT A;  4CAW A;  4OAE A;  4YFJ A;  2FCK A;  4CAE A;  4ONU A;  1Y7R A;  3TCV A;  3H5Z A;  5J8F A;  1P0H A;  3BJ7 A;  4EVY A;  2CXA A;  4U9Y A;  4FD4 A;  3DR6 A;  2K5T A;  3DDD A;  3JTK A;  4C2X A;  2ZW7 A;  2FS5 A;  5DWM A;  3PZJ A;  4JWP A;  3E0K A;  2I79 A;  4U9Z A;  1Z4R A;  3VWE A;  4A95 A;  3GKR A;  2OZU A;  2Q4V A;  3QB8 A;  4PK3 A;  5GCN A;  3JVN A;  5C88 A;  5F46 A;  2GIV A;  1BO4 A;  4KVO E;  5F48 A;  4CGM A;  4AG9 A;  3CXQ A;  1TIQ A;  4E0A A;  2B4B A;  4B10 A;  3FB3 A;  4B12 A;  2Y0M A;  5G1Z A;  4AVA A;  4R87 A;  2DPT A;  1QSO A;  3R9E A;  1KUX A;  4JXR A;  3R9G A;  5JQ4 A;  3I3G A;  1GHE A;  3G3S A;  4II9 A;  1CM0 A;  1B87 A;  4ZBG A;  4Y49 C;  2WSA A;  3EY5 A;  3W91 A;  1YK3 A;  3IU1 A;  4B14 A;  2D4O A;  2FL4 A;  3I9S A;  2Q04 A;  3IWG A;  4B13 A;  1L0C A;  3IU2 A;  3JUW A;  4KSA A;  4KUA A;  2Z10 A;  3GYA A;  4R3L A;  2PR1 A;  5J8C A;  2FSR A;  3TE4 A;  2Q4Y A;  2YNE A;  4KZT A;  4ORF A;  2FIA A;  3T9Y A;  4LUA A;  2DPS A;  1S7F A;  5A28 A;  4HNX B;  2PRB A;  2A4N A;  4UWI A;  3N7Z A;  3CXS A;  2CNT A;  4KOW A;  2Z3N A;  2B5G B;  4PSX A;  1WK4 A;  1NE9 A;  3CXP A;  4F6A A;  2OU2 A;  4CGP A;  4C7I A;  4XNH C;  5G21 A;  4UWJ A;  3FNC A;  2VZZ A;  2EUI A;  1ZO0 A;  1I21 A;  4JLY A;  1QSR A;  4CRY B;  1Q2Y A;  2BSW A;  3FIX A;  2B5G A;  3OWC A;  4GS4 A;  1WWZ A;  4YRH A;  4MY3 A;  4MFQ A;  4JXQ A;  4UA3 A;  3S6K A;  2JDD A;  4CS0 B;  2WPX A;  1S7L A;  2Q7B A;  4CAX A;  4HNW B;  4E2A A;  1Q2D A;  5AGE A;  4JD6 A;  5JPH A;  4UCN A;  3VWD A;  2J8R A;  1M44 A;  4PV6 A;  2PDO A;  4B11 A;  3T90 A;  2QIR A;  2WUU A;  2AE6 A;  3LD2 A;  5IV0 A;  2WPW A;  4FD7 A;  4IF5 A;  3LOD A;  4UBR A;  4L89 A;  1I1D A;  1Z9U A;  2H5M A;  3D3S A;  4MFP A;  4MJ8 A;  4LX9 A;  2YGW A;  1I12 A;  2CNM A;  4MI4 A;  2REF A;  2VI7 A;  2GE3 A;  4MY0 A;  1S7N A;  4F0Y A;  1XE4 A;  3D2P A;  4MHD A;  4CRZ B;  5C82 A;  3PGP A;  4NXY A;  4Y49 B;  4HKF A;  1IYK A;  1Y9W A;  4OAD A;  4FD6 A;  2BUE A;  3P2H A;  1VKC A;  3DR8 A;  5KTA A;  2X7B A;  4NF1 A;  4F0X A;  4KS9 A;  3EXN A;  3R95 A;  2P0W A;  3F8K A;  3GY9 A;  1XMT A;  2ZW5 A;  4A32 A;  4E8O A;  4MBU A;  1IB1 E;  1RXT A;  2NMT A;  5AG6 A;  4KOR A;  4AVB A;  4NEX A;  3B8G A;  1S60 A;  1MK4 A;  5H84 A;  4B5P B;  1QSN A;  4A30 A;  4Q36 A;  3TTH A;  4MFL A;  2VQY A;  5CNP A;  2OZG A;  1KZF A;  1IID A;  2CY2 A;  2Z3P A;  4X5K A;  4C7H A;  1RO5 A;  2Z3L A;  2GAN A;  2JEV A;  1S3Z A;  5BWA B;  4XNH B;  2PSW A;  1NSL A;  2JDC A;  4B5P A;  4R57 A;  3TO7 A;  1B6B A;  4A31 A;  4ZGY B;  1XEB A;  3W6X A;  4Q38 A;  3EFA A;  2ZPA A;  5H86 A;  3R9F A;  4CGO A;  1M4D A;  5F47 A;  3P2F A;  4A2Z A;  5A27 A;  1KUV A;  3H4Q A;  4UFX A;  2ZW6 A;  2DXQ A;  5KTC A;  2Z3K A;  1J4J A;  1VHS A;  1PU9 A;  3EO4 A;  5F49 A;  3C26 A;  4AG7 A;  2B4D B;  4UFW A;  3FRM A;  2B3U A;  2G0B A;  2FIW A;  3TO6 A;  4KOV A;  1YLE A;  1SQH A;  5AG5 A;  3NE7 A;  4CGN A;  4JJX A;  3R1K A;  5HH1 A;  2Z3O A;  1NMT A;  4KVM E;  4AB7 A;  2B4D A;  4KOX A;  3SXN A;  3TT2 A;  2YNC A;  4CYQ A;  4L8A A;  4R3K A;  2Z11 A;  2B58 A;  2KCW A;  2ZW4 A;  1M4I A;  2PQ8 A;  2OH1 A;  4PK2 A;  1N71 A;  3FYN A;  1XF8 A;  1PUA A;  1S7K A;  2YNC C;  4MFZ A;  2D4P A;  2VBQ A;  4I49 A;  3F0A A;  2FXF A;  5KTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...