4MFLA

The crystal structure of acyltransferase in complex with decanoyl-coa and tei pseudoaglycone
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
323
structure length
323
Chain Sequence
b'MDPETVRIALGLEERTAAWLTELDELGPPAEPVRLPRGEEARDLLRRLEVPELDAEEIVAAAPDPDRDPALWWLLERTHHAIVRHMGDHRAKPRGGPPLPYEGGAAARYFHVYVFLATVPAVRRFHAERGIPDEVGWETLTQLGELVAIHRRKYGQGGMNMQWWTTYHLRGILYRLGRLQFSLATGKDGTPHLGLAVPEWGGPLLPKAYDESLHRARPFFDRHFPEHGARVAWGSSWMLDPQLEEYLTEDSNIIQLARFWTLTDSAPEPGNADGDSSILEFVFRYNGQPLDELPQRSSLERAVIAHLKAGRHWHMRTGFVKLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein tcp24
publication title Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Transferase/antibiotic
total genus 108
structure length 323
sequence length 323
ec nomenclature ec 2.3.1.-:
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18082 DUF5596 Domain of unknown function (DUF5596)
A PF18164 GNAT_C GNAT-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.120 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mflA02
4Q38A 4MFJA 4Q36A 4MFLA 4MFZA 4MFQA 4MFKA 4MFPA
chains in the Genus database with same CATH superfamily
2J9AA 3FB3A 2EWBA 5LYLA 3IWGA 2AFWA 1U6MA 1LANA 2C6PA 2XEFA 3DDDA 4UBRA 5F47A 3DGVA 1Z8TA 5HVHA 1CJWA 2WPWA 2RFHA 2J8NA 4KSAA 3KGQA 3ISXA 4NXYA 2WZNA 3ZJ0A 3TO7A 3TX8A 2ZEDA 4B14A 2OU2A 5KTCA 2YGWA 4GM5A 3GLJA 5D8NA 1HEEA 1TIQA 3SXOA 2NSMA 4QVTA 2Q4VA 1DE4C 1TF8A 3GYAA 2QVPA 4MCRA 1NMTA 1LOKA 1S7LA 3EXNA 4YRHA 5F49A 3SJEA 4YWYA 4CS0B 1IYLA 2R98A 1Q2CA 2Z3LA 3P2HA 4PSWA 1Q2YA 3D3SA 4L8AA 3VATA 3NE7A 3I9SA 4ORFA 4PK2A 2IL4A 3MN8A 1IIDA 4E2AA 1Z2LA 4M6GA 3S6FA 5LYFA 4CAWA 2ARHA 4EWTA 5AG4A 3KASA 3BLNA 5DWNA 3SJXA 3D4UA 1BOBA 3GUXA 1VHEA 5CPAA 4G1PA 1IICA 4TWEA 3H5ZA 2CTBA 3T9YA 5J8CA 3FBUA 5EC4A 1XMBA 1Y0YA 2GLFA 3SI0A 4JYWA 4AG9A 3S6GA 4NGQA 2Q7SA 3R95A 4MHNA 4F0XA 1XFOA 2PSWA 4MHYA 1IOFA 4A2ZA 5G1ZA 3S9MA 4E0AA 1AMPA 4Y49C 2PJ9A 4O23A 2ZEGA 3LD2A 8CPAA 4P44A 1AYEA 2RC4A 1CBXA 1CP6A 1MJ9A 1HDQA 1PU9A 4XPLA 5KTDA 4UFXA 1HDUA 3R9EA 4JXRA 1YLOA 2EO8A 2Q0YA 3IIBA 4YFJA 1CP7A 2PRBA 5LYIA 4CGMA 1IU8A 3NA6A 4J3GA 2ZW7A 2YNCA 1R3NA 1BPNA 4U9ZA 2GFQA 1XJOA 4CAXA 2HV2A 1LRZA 3CXSA 4ONUA 4KOWA 1M44A 3RNZA 1NSAA 3NH4A 5IX3A 4CRZB 1FY7A 1S7FA 5AG6A 3DSBA 1YVOA 4MY3A 4C2ZA 2Q51A 1QSNA 2ZELA 5J8FA 4LQ6A 1YW4A 3IEHA 5E96A 1Q2DA 2B4DB 5HH1A 4CGOA 1YSJA 4UCNA 3PGPA 2C27A 1GYTA 2R7HA 3EC4A 4HNYB 4C2XA 2V8GA 4KS9A 3D8PA 3S6HA 2CTCA 1J4JA 2PJ3A 2ZEPA 4HKFA 2AFSA 3PBBA 2AFOA 2YNEA 4NJRA 4P6YA 4PXCA 5C82A 3ISZA 2ZEMA 4OLLA 4CRYB 2C6GA 4ONWA 1PUAA 2YNDA 2AFMA 5FVJA 3TCVA 3DNSA 2PVVA 4A95A 1H8LA 4NEXA 4FAIA 5IB9A 2PR8A 3LMSA 4WJBA 4RUHA 3S9NA 3G8WA 4II9A 5BWAB 4OC2A 4XPDB 2Q04A 3NFZA 1S5KA 3EO4A 5GCNA 4CGNA 4KUAA 1Z4EA 2JDDA 4F6AA 3V8IA 5G20A 1YR0A 4B10A 3MGDA 4QC6A 2WSAA 2B4DA 4PK3A 1I12A 2JEVA 3HLPA 4K30A 5H84A 1BO4A 1Z8WA 2ZEFA 1WWZA 2FS5A 3SI2A 4NFRA 3B3WA 2P6FA 3G3SA 1Z8XA 4YGOA 5F09A 3L2NA 3B3VA 4IF5A 2G0BA 3QNVA 1ON0A 1I1DA 4OADA 1DTDA 3H8EA 2Z3OA 4B11A 5A28A 5JPHA 4LQGA 2B3UA 2VI7A 5DWMA 3RYOA 4A31A 4OIDA 2GIVA 2Q43A 4ZI6A 2F5IA 4IK2A 5ISVA 3K9TA 4MBUA 4UWJA 4K3NA 3P2FA 2POKA 1OZPA 4CPAA 2OZUA 2WYRA 3D7FA 3LACA 4P4IA 6CPAA 5CBMA 4OMEA 2CY2A 1BPMA 4W9YA 5LYDA 4H2KA 2AFUA 4P4BA 4BBHA 4U5YA 2Z0ZA 4H89A 3GY9A 1NE9A 2GE3A 2CNMA 1WK4A 4KOXA 4KSIA 1YK3A 5IB0A 4KOUA 2Q7BA 4FWUA 1VIXA 4B13A 3TFYA 5G22A 3GB0A 4UEFA 5C88A 2G3AA 3PB4X 3B8GA 2I79A 1NSLA 1QSOA 2VL1A 2ODFA 1YGHA 1VHOA 3SI1A 5KTAA 4C7IA 1CM0A 1Q7LA 3PEIA 1TKHA 3QAHA 1YX0A 3IWEA 3W6XA 4B5PB 7CPAA 3IC1A 4B12A 1X12A 1XF8A 2Q44A 4DUKA 1TKFA 3DR8A 4GXHA 3FJUA 4P4FA 2VZZA 4MHDA 4R8FA 4CYPA 4XNHC 3H8GA 1M4DA 2BCOA 2PIZA 4KVME 4OP4A 3SJFA 3W6SA 4DYOA 2PJ0A 2ZW4A 4A33A 3SJGA 4AVBA 4DJLA 2JDCA 4JJXA 2ZEOA 5THWA 1RXTA 2HB6A 3BI0A 2ZW5A 4P4EA 5AGEA 4DNCA 4F8ZA 3FVLA 5A27A 1FT7A 3SHPA 3VARA 1K4JA 1VKCA 2EBJA 1S7NA 5F46A 1MK4A 2FE7A 2JBKA 4C7HA 3D7GA 4R3LA 1KUXA 1IB1E 2VBQA 1ZG8A 2Q4ZA 1IGBA 3GKRA 4OC3A 2CNSA 1XEBA 5I0CA 3K9UA 1M4IA 2QIRA 5AG7A 2GLJA 1MJBA 5ELYA 4B5PA 2JEWA 2V8HA 4CYQA 3D66A 2Z10A 3B35A 2Z3MA 2PJBA 1TKJA 2EK9A 3B3SA 1YREA 1N71A 4KSFA 2ZEEA 4LX9A 3E0KA 2CNTA 1B87A 2ATRA 3F8KA 2GANA 2P0WA 4MFJA 2D4PA 4WWVA 1LAMA 1RTQA 3EFAA 1CPSA 4IUSA 3WT4A 1XBUA 2QJ8A 3PB8X 3LWUA 1VGYA 3T90A 4MI4A 1ZG9A 2AFXA 3KL9A 4MFQA 3FNCA 3V7ZA 3OWCA 3FMCA 4R7MA 2ZXVA 3NE8A 4QUSA 4HNXB 1GHEA 2PJAA 1IOIA 2XEIA 1FNOA 2P6GA 2YNCC 2BL1A 2CXAA 1UWYA 3TC8A 1YMEA 2O53A 4UFVA 2VXKA 2J8RA 1JQGA 4ZX8A 4JWPA 1QSRA 2QYVA 4M3SA 4AXVA 1M4GA 2PJ6A 5HXDA 2OZHA 3KR4A 3D2PA 4FD6A 4MXUA 4KVOE 1Y9WA 2HUZA 2RB7A 3LODA 2Q4YA 4AG7A 2PJ8A 4AVAA 2Z3PA 4ZGYB 3B7IA 2QMLA 1RO5A 3JTKA 3BHXA 3D68A 3WC7A 2BOAA 3DLJA 4UCPA 1XRYA 2P6EA 2V8VA 4RN7A 2QECA 2PQ8A 2FT0A 4R3KA 2FL4A 1XMTA 3R96A 3D7HA 4UA3A 3C26A 3PZJA 1YLEA 3I1UA 5F48A 3FXTA 2CIJA 2EK8A 4RI1A 1LCPA 5D29A 1P0HA 4CYOA 2C6CA 2PRQA 1XIXA 2PIYA 2VQYA 2ZPAA 3JUWA 3PFEA 4MMOA 1Z9UA 3K2KA 1QSMA 4Z65A 5HMNA 5CNPA 4MJ8A 1TF9A 2OB0A 4P45A 1ZLIA 4OC4A 4X3RA 4MFLA 3CPXA 4OIWA 3EY5A 4JD6A 4MCPA 2B5GB 3VH9A 2GREA 3PRTA 4FBEA 2OR4A 4E8OA 3F5BA 2ZOFA 4KVXA 1ARMA 4HPSA 1Z4RA 2Z3NA 1Y0RA 3RO0A 1F2OA 4AVCA 2BSWA 4A37A 1ARLA 3FECA 1CPXA 4MFPA 2FCKA 2ABZA 1ZO0A 2WUUA 2IJZA 2R1IA 2Z3KA 4P4DA 4XPKA 1PCAA 3CZXA 4FD4A 2F8HA 4PV6A 4QB9A 2BO9A 2HQYA 4BD9A 5K8MA 4ZYQA 4JXQA 4MCQA 4OKOA 1F57A 3IU1A 4XNHB 1Z5RA 4HNWB 3TOAA 4F9UA 1Y7RA 1XOVA 4Q36A 3KQZA 3CXPA 1TXRA 4MHZA 3KQXA 3TOBA 3DR6A 3N7ZA 1S60A 3S6KA 2H5MA 2IMOA 2G9DA 4B5OA 4PXBA 5JQ4A 3SXNA 4XPDC 3VWEA 1P4NA 2AE6A 5I4MA 3D7DA 2B5GA 1F2PA 4MFKA 3T8WA 3ZZIA 4C2YA 2ANPA 2PCUA 3KHXA 3R1KA 4UCMA 2KCWA 4UIBA 2PE3A 2X7BA 4BINA 2WPXA 1A2ZA 2GU2A 3CDXA 3N5FA 3TT2A 2FSRA 4Y49B 4NGSA 2VZYA 2FXFA 4X5KA 1AUGA 3CXQA 4A38A 4EMEA 4Q7AA 3GIUA 3R9GA 4OC1A 4M6HA 4MRIA 4A94A 4NGMA 3S9LA 2PVWA 2Y0MA 3CPAA 2HC9A 1MJAA 2OH1A 3BI1A 3FH4A 1LAPA 5EBVA 3TTHA 1BAVA 4PPZA 2B58A 1YVKA 4YU9A 1ZLHA 4X2TA 4OC5A 3NH5A 2I3CA 2FIAA 1QSTA 4ZX9A 3TO6A 1M1DA 4KLWA 1IYKA 2JBJA 5G21A 3RAMA 2R8VA 4UF4A 5JM6A 3H8FA 2XEGA 4UEEA 4UWIA 3IJ3A 2PJ4A 4NGNA 4CAFA 4EVYA 4MFZA 2FVGA 3FF3A 1QMUA 2ZENA 3PB7X 4R9MA 4ZBGA 5LRGA 5JH9A 4FUUA 4R87A 2DPSA 4Q38A 4PXDA 1I21A 3D2MA 2I00A 1YQEA 2DEAA 3IU2A 4KZTA 2C1CA 3IWWA 1YW6A 2NMTA 2AFZA 3PB6X 4CAVA 4F0YA 2VEZA 3B2YA 3IGRA 5LRKA 4NF1A 4MHPA 5HVFA 1BLLE 2Z11A 4OAEA 4CYNA 2EVNA 4FD7A 4U9YA 2O4HA 4JZ0A 4NCZA 3JVNA 3WC6A 4KUBA 1JWQA 2JLMA 2BUEA 3KKWA 4PQAA 4FD5A 4C68A 4MY0A 1LFWA 3BJ8A 4KOSA 3WABA 4CGPA 4RS2A 5JGFA 2PJ7A 1V0CA 2PJ1A 2PDOA 2B4BA 3FX6A 4R76A 1ELMP 3BJ7A 3QB8A 1B6BA 3V38A 3VWDA 1Z8LA 3D67A 4F9VA 1PYTB 4H6UA 2FIWA 3TO9A 4CAEA 1EE3P 4B6ZA 4R6TA 1OBRA 3F0AA 1R57A 4M85A 5K8NA 4EFDA 3IFEA 5K8OA 5H86A 4GS4A 5EMIA 5HVGA 3PFOA 3FYNA 4OC0A 1X10A 4TNUA 5DS0A 4ZY0A 2REFA 3RZAA 4ZY1A 1XE4A 2G3TA 3UY5A 4BMHA 4NJQA 1UFHA 3PB9X 1L0CA 4UIAA 3QAYA 2REEA 2DF5A 4PXEA 3KR5A 3KZWA 3MRUA 3PBEA 1VHSA 4JLYA 2A4NA 2PJ5A 2ZEHA 2OOTA 2ZOGA 3FEDA 1IY7A 2IQ6A 1CX8A 1SQHA 2PJ2A 3PP9A 4IHMA 3W91A 4KLVA 5AG5A 3WR7A 2EUIA 2XEJA 4P10A 3FRMA 4A32A 3BXMA 3KI9A 4KORA 4IAVA 3FEEA 4KOYA 2O28A 2BEIA 4MCSA 4P4JA 4NGTA 2DXQA 5IV0A 1KUYA 2F7VA 3TE4A 1S7KA 4M6IA 4ZY2A 2V77A 3IO1A 4UEZA 4I49A 3B3CA 4PSXA 2PC1A 3WC5A 2K5TA 1R43A 2D4OA 2V8DA 2OZGA 1KZFA 5K8PA 3CT9A 4A39A 1KWMA 2CF4A 3NH8A 1ELLP 3B3TA 2DPTA 3RBUA 4LUAA 3A9LA 2J8MA 3JRUA 4R57A 4QBJA 4NGRA 3R9FA 1Y9KA 3FIXA 3I3GA 4UFWA 4A30A 1Y7EA 4NSQA 4X8IA 1M4LA 3KHZA 4CGLA 4KOTA 4H6ZA 1ZG7A 4KOVA 1KUVA 5J1QA 2ZW6A 2PR1A 3HUVA 4AB7A 1CG2A 1S3ZA 4L89A 4NGPA 2NYQA 2PJCA 1QQ9A 2B3VA 2AJ6A 5LRJA 3H4QA
chains in the Genus database with same CATH topology
3FB3A 3IWGA 1U6MA 3DDDA 4UBRA 5F47A 1CJWA 2WPWA 4KSAA 2J8NA 4NXYA 4B14A 3TO7A 2OU2A 5KTCA 2YGWA 3SXOA 1TIQA 4QVTA 2Q4VA 3GYAA 1NMTA 1S7LA 5F49A 3EXNA 4YRHA 4CS0B 1IYLA 2R98A 1Q2CA 2Z3LA 3P2HA 4PSWA 1Q2YA 3D3SA 4L8AA 3NE7A 3I9SA 4ORFA 4PK2A 2IL4A 1IIDA 4E2AA 3S6FA 4CAWA 2ARHA 5AG4A 3BLNA 5DWNA 1BOBA 1IICA 3H5ZA 3T9YA 5J8CA 3FBUA 5EC4A 4AG9A 3S6GA 3R95A 4F0XA 2PSWA 4A2ZA 5G1ZA 4E0AA 4Y49C 3LD2A 2RC4A 1MJ9A 4XPLA 1PU9A 5KTDA 4UFXA 3R9EA 4JXRA 2Q0YA 4YFJA 2PRBA 4CGMA 4J3GA 2ZW7A 2YNCA 4U9ZA 4CAXA 2HV2A 1LRZA 3CXSA 4ONUA 4KOWA 1M44A 5IX3A 4CRZB 1FY7A 1S7FA 5AG6A 3DSBA 1YVOA 4MY3A 4C2ZA 1QSNA 5J8FA 5E96A 1Q2DA 2B4DB 5HH1A 4CGOA 4UCNA 3PGPA 2C27A 2R7HA 3EC4A 4HNYB 4C2XA 4KS9A 3D8PA 3S6HA 4HKFA 1J4JA 3ZJ0A 5C82A 2YNEA 4OLLA 4CRYB 1PUAA 2YNDA 5FVJA 3TCVA 3DNSA 4A95A 4NEXA 2PR8A 3G8WA 4II9A 5BWAB 4XPDB 2Q04A 1S5KA 3EO4A 5GCNA 4CGNA 4KUAA 1Z4EA 2JDDA 4F6AA 3V8IA 5G20A 1YR0A 4B10A 3MGDA 4QC6A 2WSAA 2B4DA 4PK3A 1I12A 2JEVA 4K30A 5H84A 1BO4A 1WWZA 2FS5A 2P6FA 3G3SA 4YGOA 4IF5A 2G0BA 1ON0A 1I1DA 4OADA 4B11A 2Z3OA 5A28A 5JPHA 2B3UA 2VI7A 5DWMA 3RYOA 4A31A 2GIVA 2F5IA 5ISVA 4MBUA 4UWJA 3P2FA 1OZPA 2OZUA 2CY2A 4BBHA 4U5YA 2Z0ZA 4H89A 3GY9A 1NE9A 2GE3A 2CNMA 1WK4A 4KOXA 1YK3A 5IB0A 4KOUA 2Q7BA 4B13A 3TFYA 5G22A 5C88A 2G3AA 3B8GA 2I79A 1NSLA 1QSOA 1YGHA 5KTAA 4C7IA 1CM0A 3QAHA 1YX0A 3IWEA 3W6XA 4B5PB 4B12A 1XF8A 2Q44A 3DR8A 2VZZA 4MHDA 4CYPA 4XNHC 1M4DA 4KVME 3W6SA 2ZW4A 4A33A 4AVBA 2JDCA 4JJXA 1RXTA 2ZW5A 4DNCA 5AGEA 5A27A 3SHPA 1K4JA 1VKCA 1S7NA 5F46A 1MK4A 2FE7A 4C7HA 4R3LA 1KUXA 1IB1E 2VBQA 3GKRA 2CNSA 1XEBA 5I0CA 3K9UA 1M4IA 2QIRA 5AG7A 1MJBA 4B5PA 4CYQA 2Z10A 2Z3MA 1YREA 1N71A 4KSFA 4LX9A 3E0KA 2CNTA 1B87A 2ATRA 3F8KA 2GANA 2P0WA 4MFJA 2D4PA 3EFAA 4IUSA 3T90A 4MI4A 4MFQA 3FNCA 3OWCA 2ZXVA 4QUSA 4HNXB 1GHEA 2YNCC 2P6GA 2BL1A 2CXAA 4UFVA 2VXKA 2J8RA 4JWPA 1QSRA 4M3SA 1M4GA 2OZHA 3D2PA 4FD6A 4KVOE 1Y9WA 2HUZA 3LODA 2Q4YA 4AG7A 4AVAA 2Z3PA 4ZGYB 2QMLA 1RO5A 3JTKA 4UCPA 2P6EA 2QECA 2PQ8A 2FT0A 4R3KA 2FL4A 1XMTA 3R96A 4UA3A 3C26A 3PZJA 1YLEA 5F48A 3FXTA 4RI1A 4CYOA 1P0HA 2VQYA 1XIXA 2ZPAA 3JUWA 5HMNA 1Z9UA 1QSMA 5CNPA 4MJ8A 2OB0A 4MFLA 3EY5A 4JD6A 2B5GB 4E8OA 3F5BA 4KVXA 1Z4RA 2Z3NA 4AVCA 2BSWA 4MFPA 2FCKA 1ZO0A 2WUUA 2R1IA 2Z3KA 4XPKA 4FD4A 4PV6A 4QB9A 2HQYA 4JXQA 3IU1A 4XNHB 3TOAA 4HNWB 1Y7RA 4Q36A 3CXPA 3TOBA 3DR6A 3N7ZA 1S60A 3S6KA 2H5MA 4B5OA 5JQ4A 3SXNA 4XPDC 3VWEA 1P4NA 2AE6A 2B5GA 4MFKA 3ZZIA 4C2YA 4UCMA 3R1KA 2KCWA 2X7BA 2WPXA 3TT2A 2FSRA 4Y49B 2VZYA 2FXFA 4X5KA 3CXQA 3R9GA 2Y0MA 1MJAA 2OH1A 5EBVA 3TTHA 2B58A 1YVKA 2FIAA 1QSTA 3TO6A 1M1DA 4KLWA 1IYKA 5G21A 2R8VA 4UWIA 4EVYA 4CAFA 4MFZA 4R9MA 4ZBGA 4R87A 2DPSA 4Q38A 1I21A 3D2MA 2I00A 3IU2A 4KZTA 2NMTA 4CAVA 4F0YA 2VEZA 3IGRA 4NF1A 2Z11A 4OAEA 4CYNA 2EVNA 4FD7A 4U9YA 4NCZA 3JVNA 4KUBA 2JLMA 2BUEA 3KKWA 4FD5A 4C68A 4MY0A 3BJ8A 4KOSA 4CGPA 4RS2A 1V0CA 2PDOA 2B4BA 3QB8A 3BJ7A 1B6BA 3VWDA 4H6UA 2FIWA 3TO9A 4CAEA 3F0AA 1R57A 4M85A 5H86A 4GS4A 3FYNA 2REFA 1XE4A 2G3TA 3UY5A 4BMHA 1UFHA 1L0CA 2REEA 4JLYA 1VHSA 2A4NA 1SQHA 3WR7A 3PP9A 3W91A 4KLVA 5AG5A 2EUIA 4A32A 3FRMA 4KORA 4KOYA 2O28A 2BEIA 2DXQA 5IV0A 1KUYA 3TE4A 1S7KA 4I49A 4PSXA 2PC1A 2K5TA 2D4OA 2OZGA 1KZFA 2DPTA 4LUAA 3A9LA 2J8MA 4R57A 4QBJA 3R9FA 1Y9KA 3FIXA 3I3GA 4UFWA 4A30A 4NSQA 4CGLA 4KOTA 4H6ZA 4KOVA 1KUVA 2ZW6A 2PR1A 4AB7A 1S3ZA 4L89A 2B3VA 2AJ6A 3H4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q38 A;  4MFJ A;  4Q36 A;  4MFL A;  4MFZ A;  4MFQ A;  4MFK A;  4MFP A; 
#chains in the Genus database with same CATH topology
 2J9A A;  3FB3 A;  2EWB A;  5LYL A;  3IWG A;  2AFW A;  1U6M A;  1LAN A;  2C6P A;  2XEF A;  3DDD A;  4UBR A;  5F47 A;  3DGV A;  1Z8T A;  5HVH A;  1CJW A;  2WPW A;  2RFH A;  2J8N A;  4KSA A;  3KGQ A;  3ISX A;  4NXY A;  2WZN A;  3ZJ0 A;  3TO7 A;  3TX8 A;  2ZED A;  4B14 A;  2OU2 A;  5KTC A;  2YGW A;  4GM5 A;  3GLJ A;  5D8N A;  1HEE A;  1TIQ A;  3SXO A;  2NSM A;  4QVT A;  2Q4V A;  1DE4 C;  1TF8 A;  3GYA A;  2QVP A;  4MCR A;  1NMT A;  1LOK A;  1S7L A;  3EXN A;  4YRH A;  5F49 A;  3SJE A;  4YWY A;  4CS0 B;  1IYL A;  2R98 A;  1Q2C A;  2Z3L A;  3P2H A;  4PSW A;  1Q2Y A;  3D3S A;  4L8A A;  3VAT A;  3NE7 A;  3I9S A;  4ORF A;  4PK2 A;  2IL4 A;  3MN8 A;  1IID A;  4E2A A;  1Z2L A;  4M6G A;  3S6F A;  5LYF A;  4CAW A;  2ARH A;  4EWT A;  5AG4 A;  3KAS A;  3BLN A;  5DWN A;  3SJX A;  3D4U A;  1BOB A;  3GUX A;  1VHE A;  5CPA A;  4G1P A;  1IIC A;  4TWE A;  3H5Z A;  2CTB A;  3T9Y A;  5J8C A;  3FBU A;  5EC4 A;  1XMB A;  1Y0Y A;  2GLF A;  3SI0 A;  4JYW A;  4AG9 A;  3S6G A;  4NGQ A;  2Q7S A;  3R95 A;  4MHN A;  4F0X A;  1XFO A;  2PSW A;  4MHY A;  1IOF A;  4A2Z A;  5G1Z A;  3S9M A;  4E0A A;  1AMP A;  4Y49 C;  2PJ9 A;  4O23 A;  2ZEG A;  3LD2 A;  8CPA A;  4P44 A;  1AYE A;  2RC4 A;  1CBX A;  1CP6 A;  1MJ9 A;  1HDQ A;  1PU9 A;  4XPL A;  5KTD A;  4UFX A;  1HDU A;  3R9E A;  4JXR A;  1YLO A;  2EO8 A;  2Q0Y A;  3IIB A;  4YFJ A;  1CP7 A;  2PRB A;  5LYI A;  4CGM A;  1IU8 A;  3NA6 A;  4J3G A;  2ZW7 A;  2YNC A;  1R3N A;  1BPN A;  4U9Z A;  2GFQ A;  1XJO A;  4CAX A;  2HV2 A;  1LRZ A;  3CXS A;  4ONU A;  4KOW A;  1M44 A;  3RNZ A;  1NSA A;  3NH4 A;  5IX3 A;  4CRZ B;  1FY7 A;  1S7F A;  5AG6 A;  3DSB A;  1YVO A;  4MY3 A;  4C2Z A;  2Q51 A;  1QSN A;  2ZEL A;  5J8F A;  4LQ6 A;  1YW4 A;  3IEH A;  5E96 A;  1Q2D A;  2B4D B;  5HH1 A;  4CGO A;  1YSJ A;  4UCN A;  3PGP A;  2C27 A;  1GYT A;  2R7H A;  3EC4 A;  4HNY B;  4C2X A;  2V8G A;  4KS9 A;  3D8P A;  3S6H A;  2CTC A;  1J4J A;  2PJ3 A;  2ZEP A;  4HKF A;  2AFS A;  3PBB A;  2AFO A;  2YNE A;  4NJR A;  4P6Y A;  4PXC A;  5C82 A;  3ISZ A;  2ZEM A;  4OLL A;  4CRY B;  2C6G A;  4ONW A;  1PUA A;  2YND A;  2AFM A;  5FVJ A;  3TCV A;  3DNS A;  2PVV A;  4A95 A;  1H8L A;  4NEX A;  4FAI A;  5IB9 A;  2PR8 A;  3LMS A;  4WJB A;  4RUH A;  3S9N A;  3G8W A;  4II9 A;  5BWA B;  4OC2 A;  4XPD B;  2Q04 A;  3NFZ A;  1S5K A;  3EO4 A;  5GCN A;  4CGN A;  4KUA A;  1Z4E A;  2JDD A;  4F6A A;  3V8I A;  5G20 A;  1YR0 A;  4B10 A;  3MGD A;  4QC6 A;  2WSA A;  2B4D A;  4PK3 A;  1I12 A;  2JEV A;  3HLP A;  4K30 A;  5H84 A;  1BO4 A;  1Z8W A;  2ZEF A;  1WWZ A;  2FS5 A;  3SI2 A;  4NFR A;  3B3W A;  2P6F A;  3G3S A;  1Z8X A;  4YGO A;  5F09 A;  3L2N A;  3B3V A;  4IF5 A;  2G0B A;  3QNV A;  1ON0 A;  1I1D A;  4OAD A;  1DTD A;  3H8E A;  2Z3O A;  4B11 A;  5A28 A;  5JPH A;  4LQG A;  2B3U A;  2VI7 A;  5DWM A;  3RYO A;  4A31 A;  4OID A;  2GIV A;  2Q43 A;  4ZI6 A;  2F5I A;  4IK2 A;  5ISV A;  3K9T A;  4MBU A;  4UWJ A;  4K3N A;  3P2F A;  2POK A;  1OZP A;  4CPA A;  2OZU A;  2WYR A;  3D7F A;  3LAC A;  4P4I A;  6CPA A;  5CBM A;  4OME A;  2CY2 A;  1BPM A;  4W9Y A;  5LYD A;  4H2K A;  2AFU A;  4P4B A;  4BBH A;  4U5Y A;  2Z0Z A;  4H89 A;  3GY9 A;  1NE9 A;  2GE3 A;  2CNM A;  1WK4 A;  4KOX A;  4KSI A;  1YK3 A;  5IB0 A;  4KOU A;  2Q7B A;  4FWU A;  1VIX A;  4B13 A;  3TFY A;  5G22 A;  3GB0 A;  4UEF A;  5C88 A;  2G3A A;  3PB4 X;  3B8G A;  2I79 A;  1NSL A;  1QSO A;  2VL1 A;  2ODF A;  1YGH A;  1VHO A;  3SI1 A;  5KTA A;  4C7I A;  1CM0 A;  1Q7L A;  3PEI A;  1TKH A;  3QAH A;  1YX0 A;  3IWE A;  3W6X A;  4B5P B;  7CPA A;  3IC1 A;  4B12 A;  1X12 A;  1XF8 A;  2Q44 A;  4DUK A;  1TKF A;  3DR8 A;  4GXH A;  3FJU A;  4P4F A;  2VZZ A;  4MHD A;  4R8F A;  4CYP A;  4XNH C;  3H8G A;  1M4D A;  2BCO A;  2PIZ A;  4KVM E;  4OP4 A;  3SJF A;  3W6S A;  4DYO A;  2PJ0 A;  2ZW4 A;  4A33 A;  3SJG A;  4AVB A;  4DJL A;  2JDC A;  4JJX A;  2ZEO A;  5THW A;  1RXT A;  2HB6 A;  3BI0 A;  2ZW5 A;  4P4E A;  5AGE A;  4DNC A;  4F8Z A;  3FVL A;  5A27 A;  1FT7 A;  3SHP A;  3VAR A;  1K4J A;  1VKC A;  2EBJ A;  1S7N A;  5F46 A;  1MK4 A;  2FE7 A;  2JBK A;  4C7H A;  3D7G A;  4R3L A;  1KUX A;  1IB1 E;  2VBQ A;  1ZG8 A;  2Q4Z A;  1IGB A;  3GKR A;  4OC3 A;  2CNS A;  1XEB A;  5I0C A;  3K9U A;  1M4I A;  2QIR A;  5AG7 A;  2GLJ A;  1MJB A;  5ELY A;  4B5P A;  2JEW A;  2V8H A;  4CYQ A;  3D66 A;  2Z10 A;  3B35 A;  2Z3M A;  2PJB A;  1TKJ A;  2EK9 A;  3B3S A;  1YRE A;  1N71 A;  4KSF A;  2ZEE A;  4LX9 A;  3E0K A;  2CNT A;  1B87 A;  2ATR A;  3F8K A;  2GAN A;  2P0W A;  4MFJ A;  2D4P A;  4WWV A;  1LAM A;  1RTQ A;  3EFA A;  1CPS A;  4IUS A;  3WT4 A;  1XBU A;  2QJ8 A;  3PB8 X;  3LWU A;  1VGY A;  3T90 A;  4MI4 A;  1ZG9 A;  2AFX A;  3KL9 A;  4MFQ A;  3FNC A;  3V7Z A;  3OWC A;  3FMC A;  4R7M A;  2ZXV A;  3NE8 A;  4QUS A;  4HNX B;  1GHE A;  2PJA A;  1IOI A;  2XEI A;  1FNO A;  2P6G A;  2YNC C;  2BL1 A;  2CXA A;  1UWY A;  3TC8 A;  1YME A;  2O53 A;  4UFV A;  2VXK A;  2J8R A;  1JQG A;  4ZX8 A;  4JWP A;  1QSR A;  2QYV A;  4M3S A;  4AXV A;  1M4G A;  2PJ6 A;  5HXD A;  2OZH A;  3KR4 A;  3D2P A;  4FD6 A;  4MXU A;  4KVO E;  1Y9W A;  2HUZ A;  2RB7 A;  3LOD A;  2Q4Y A;  4AG7 A;  2PJ8 A;  4AVA A;  2Z3P A;  4ZGY B;  3B7I A;  2QML A;  1RO5 A;  3JTK A;  3BHX A;  3D68 A;  3WC7 A;  2BOA A;  3DLJ A;  4UCP A;  1XRY A;  2P6E A;  2V8V A;  4RN7 A;  2QEC A;  2PQ8 A;  2FT0 A;  4R3K A;  2FL4 A;  1XMT A;  3R96 A;  3D7H A;  4UA3 A;  3C26 A;  3PZJ A;  1YLE A;  3I1U A;  5F48 A;  3FXT A;  2CIJ A;  2EK8 A;  4RI1 A;  1LCP A;  5D29 A;  1P0H A;  4CYO A;  2C6C A;  2PRQ A;  1XIX A;  2PIY A;  2VQY A;  2ZPA A;  3JUW A;  3PFE A;  4MMO A;  1Z9U A;  3K2K A;  1QSM A;  4Z65 A;  5HMN A;  5CNP A;  4MJ8 A;  1TF9 A;  2OB0 A;  4P45 A;  1ZLI A;  4OC4 A;  4X3R A;  4MFL A;  3CPX A;  4OIW A;  3EY5 A;  4JD6 A;  4MCP A;  2B5G B;  3VH9 A;  2GRE A;  3PRT A;  4FBE A;  2OR4 A;  4E8O A;  3F5B A;  2ZOF A;  4KVX A;  1ARM A;  4HPS A;  1Z4R A;  2Z3N A;  1Y0R A;  3RO0 A;  1F2O A;  4AVC A;  2BSW A;  4A37 A;  1ARL A;  3FEC A;  1CPX A;  4MFP A;  2FCK A;  2ABZ A;  1ZO0 A;  2WUU A;  2IJZ A;  2R1I A;  2Z3K A;  4P4D A;  4XPK A;  1PCA A;  3CZX A;  4FD4 A;  2F8H A;  4PV6 A;  4QB9 A;  2BO9 A;  2HQY A;  4BD9 A;  5K8M A;  4ZYQ A;  4JXQ A;  4MCQ A;  4OKO A;  1F57 A;  3IU1 A;  4XNH B;  1Z5R A;  4HNW B;  3TOA A;  4F9U A;  1Y7R A;  1XOV A;  4Q36 A;  3KQZ A;  3CXP A;  1TXR A;  4MHZ A;  3KQX A;  3TOB A;  3DR6 A;  3N7Z A;  1S60 A;  3S6K A;  2H5M A;  2IMO A;  2G9D A;  4B5O A;  4PXB A;  5JQ4 A;  3SXN A;  4XPD C;  3VWE A;  1P4N A;  2AE6 A;  5I4M A;  3D7D A;  2B5G A;  1F2P A;  4MFK A;  3T8W A;  3ZZI A;  4C2Y A;  2ANP A;  2PCU A;  3KHX A;  3R1K A;  4UCM A;  2KCW A;  4UIB A;  2PE3 A;  2X7B A;  4BIN A;  2WPX A;  1A2Z A;  2GU2 A;  3CDX A;  3N5F A;  3TT2 A;  2FSR A;  4Y49 B;  4NGS A;  2VZY A;  2FXF A;  4X5K A;  1AUG A;  3CXQ A;  4A38 A;  4EME A;  4Q7A A;  3GIU A;  3R9G A;  4OC1 A;  4M6H A;  4MRI A;  4A94 A;  4NGM A;  3S9L A;  2PVW A;  2Y0M A;  3CPA A;  2HC9 A;  1MJA A;  2OH1 A;  3BI1 A;  3FH4 A;  1LAP A;  5EBV A;  3TTH A;  1BAV A;  4PPZ A;  2B58 A;  1YVK A;  4YU9 A;  1ZLH A;  4X2T A;  4OC5 A;  3NH5 A;  2I3C A;  2FIA A;  1QST A;  4ZX9 A;  3TO6 A;  1M1D A;  4KLW A;  1IYK A;  2JBJ A;  5G21 A;  3RAM A;  2R8V A;  4UF4 A;  5JM6 A;  3H8F A;  2XEG A;  4UEE A;  4UWI A;  3IJ3 A;  2PJ4 A;  4NGN A;  4CAF A;  4EVY A;  4MFZ A;  2FVG A;  3FF3 A;  1QMU A;  2ZEN A;  3PB7 X;  4R9M A;  4ZBG A;  5LRG A;  5JH9 A;  4FUU A;  4R87 A;  2DPS A;  4Q38 A;  4PXD A;  1I21 A;  3D2M A;  2I00 A;  1YQE A;  2DEA A;  3IU2 A;  4KZT A;  2C1C A;  3IWW A;  1YW6 A;  2NMT A;  2AFZ A;  3PB6 X;  4CAV A;  4F0Y A;  2VEZ A;  3B2Y A;  3IGR A;  5LRK A;  4NF1 A;  4MHP A;  5HVF A;  1BLL E;  2Z11 A;  4OAE A;  4CYN A;  2EVN A;  4FD7 A;  4U9Y A;  2O4H A;  4JZ0 A;  4NCZ A;  3JVN A;  3WC6 A;  4KUB A;  1JWQ A;  2JLM A;  2BUE A;  3KKW A;  4PQA A;  4FD5 A;  4C68 A;  4MY0 A;  1LFW A;  3BJ8 A;  4KOS A;  3WAB A;  4CGP A;  4RS2 A;  5JGF A;  2PJ7 A;  1V0C A;  2PJ1 A;  2PDO A;  2B4B A;  3FX6 A;  4R76 A;  1ELM P;  3BJ7 A;  3QB8 A;  1B6B A;  3V38 A;  3VWD A;  1Z8L A;  3D67 A;  4F9V A;  1PYT B;  4H6U A;  2FIW A;  3TO9 A;  4CAE A;  1EE3 P;  4B6Z A;  4R6T A;  1OBR A;  3F0A A;  1R57 A;  4M85 A;  5K8N A;  4EFD A;  3IFE A;  5K8O A;  5H86 A;  4GS4 A;  5EMI A;  5HVG A;  3PFO A;  3FYN A;  4OC0 A;  1X10 A;  4TNU A;  5DS0 A;  4ZY0 A;  2REF A;  3RZA A;  4ZY1 A;  1XE4 A;  2G3T A;  3UY5 A;  4BMH A;  4NJQ A;  1UFH A;  3PB9 X;  1L0C A;  4UIA A;  3QAY A;  2REE A;  2DF5 A;  4PXE A;  3KR5 A;  3KZW A;  3MRU A;  3PBE A;  1VHS A;  4JLY A;  2A4N A;  2PJ5 A;  2ZEH A;  2OOT A;  2ZOG A;  3FED A;  1IY7 A;  2IQ6 A;  1CX8 A;  1SQH A;  2PJ2 A;  3PP9 A;  4IHM A;  3W91 A;  4KLV A;  5AG5 A;  3WR7 A;  2EUI A;  2XEJ A;  4P10 A;  3FRM A;  4A32 A;  3BXM A;  3KI9 A;  4KOR A;  4IAV A;  3FEE A;  4KOY A;  2O28 A;  2BEI A;  4MCS A;  4P4J A;  4NGT A;  2DXQ A;  5IV0 A;  1KUY A;  2F7V A;  3TE4 A;  1S7K A;  4M6I A;  4ZY2 A;  2V77 A;  3IO1 A;  4UEZ A;  4I49 A;  3B3C A;  4PSX A;  2PC1 A;  3WC5 A;  2K5T A;  1R43 A;  2D4O A;  2V8D A;  2OZG A;  1KZF A;  5K8P A;  3CT9 A;  4A39 A;  1KWM A;  2CF4 A;  3NH8 A;  1ELL P;  3B3T A;  2DPT A;  3RBU A;  4LUA A;  3A9L A;  2J8M A;  3JRU A;  4R57 A;  4QBJ A;  4NGR A;  3R9F A;  1Y9K A;  3FIX A;  3I3G A;  4UFW A;  4A30 A;  1Y7E A;  4NSQ A;  4X8I A;  1M4L A;  3KHZ A;  4CGL A;  4KOT A;  4H6Z A;  1ZG7 A;  4KOV A;  1KUV A;  5J1Q A;  2ZW6 A;  2PR1 A;  3HUV A;  4AB7 A;  1CG2 A;  1S3Z A;  4L89 A;  4NGP A;  2NYQ A;  2PJC A;  1QQ9 A;  2B3V A;  2AJ6 A;  5LRJ A;  3H4Q A; 
#chains in the Genus database with same CATH homology
 3FB3 A;  3IWG A;  1U6M A;  3DDD A;  4UBR A;  5F47 A;  1CJW A;  2WPW A;  4KSA A;  2J8N A;  4NXY A;  4B14 A;  3TO7 A;  2OU2 A;  5KTC A;  2YGW A;  3SXO A;  1TIQ A;  4QVT A;  2Q4V A;  3GYA A;  1NMT A;  1S7L A;  5F49 A;  3EXN A;  4YRH A;  4CS0 B;  1IYL A;  2R98 A;  1Q2C A;  2Z3L A;  3P2H A;  4PSW A;  1Q2Y A;  3D3S A;  4L8A A;  3NE7 A;  3I9S A;  4ORF A;  4PK2 A;  2IL4 A;  1IID A;  4E2A A;  3S6F A;  4CAW A;  2ARH A;  5AG4 A;  3BLN A;  5DWN A;  1BOB A;  1IIC A;  3H5Z A;  3T9Y A;  5J8C A;  3FBU A;  5EC4 A;  4AG9 A;  3S6G A;  3R95 A;  4F0X A;  2PSW A;  4A2Z A;  5G1Z A;  4E0A A;  4Y49 C;  3LD2 A;  2RC4 A;  1MJ9 A;  4XPL A;  1PU9 A;  5KTD A;  4UFX A;  3R9E A;  4JXR A;  2Q0Y A;  4YFJ A;  2PRB A;  4CGM A;  4J3G A;  2ZW7 A;  2YNC A;  4U9Z A;  4CAX A;  2HV2 A;  1LRZ A;  3CXS A;  4ONU A;  4KOW A;  1M44 A;  5IX3 A;  4CRZ B;  1FY7 A;  1S7F A;  5AG6 A;  3DSB A;  1YVO A;  4MY3 A;  4C2Z A;  1QSN A;  5J8F A;  5E96 A;  1Q2D A;  2B4D B;  5HH1 A;  4CGO A;  4UCN A;  3PGP A;  2C27 A;  2R7H A;  3EC4 A;  4HNY B;  4C2X A;  4KS9 A;  3D8P A;  3S6H A;  4HKF A;  1J4J A;  3ZJ0 A;  5C82 A;  2YNE A;  4OLL A;  4CRY B;  1PUA A;  2YND A;  5FVJ A;  3TCV A;  3DNS A;  4A95 A;  4NEX A;  2PR8 A;  3G8W A;  4II9 A;  5BWA B;  4XPD B;  2Q04 A;  1S5K A;  3EO4 A;  5GCN A;  4CGN A;  4KUA A;  1Z4E A;  2JDD A;  4F6A A;  3V8I A;  5G20 A;  1YR0 A;  4B10 A;  3MGD A;  4QC6 A;  2WSA A;  2B4D A;  4PK3 A;  1I12 A;  2JEV A;  4K30 A;  5H84 A;  1BO4 A;  1WWZ A;  2FS5 A;  2P6F A;  3G3S A;  4YGO A;  4IF5 A;  2G0B A;  1ON0 A;  1I1D A;  4OAD A;  4B11 A;  2Z3O A;  5A28 A;  5JPH A;  2B3U A;  2VI7 A;  5DWM A;  3RYO A;  4A31 A;  2GIV A;  2F5I A;  5ISV A;  4MBU A;  4UWJ A;  3P2F A;  1OZP A;  2OZU A;  2CY2 A;  4BBH A;  4U5Y A;  2Z0Z A;  4H89 A;  3GY9 A;  1NE9 A;  2GE3 A;  2CNM A;  1WK4 A;  4KOX A;  1YK3 A;  5IB0 A;  4KOU A;  2Q7B A;  4B13 A;  3TFY A;  5G22 A;  5C88 A;  2G3A A;  3B8G A;  2I79 A;  1NSL A;  1QSO A;  1YGH A;  5KTA A;  4C7I A;  1CM0 A;  3QAH A;  1YX0 A;  3IWE A;  3W6X A;  4B5P B;  4B12 A;  1XF8 A;  2Q44 A;  3DR8 A;  2VZZ A;  4MHD A;  4CYP A;  4XNH C;  1M4D A;  4KVM E;  3W6S A;  2ZW4 A;  4A33 A;  4AVB A;  2JDC A;  4JJX A;  1RXT A;  2ZW5 A;  4DNC A;  5AGE A;  5A27 A;  3SHP A;  1K4J A;  1VKC A;  1S7N A;  5F46 A;  1MK4 A;  2FE7 A;  4C7H A;  4R3L A;  1KUX A;  1IB1 E;  2VBQ A;  3GKR A;  2CNS A;  1XEB A;  5I0C A;  3K9U A;  1M4I A;  2QIR A;  5AG7 A;  1MJB A;  4B5P A;  4CYQ A;  2Z10 A;  2Z3M A;  1YRE A;  1N71 A;  4KSF A;  4LX9 A;  3E0K A;  2CNT A;  1B87 A;  2ATR A;  3F8K A;  2GAN A;  2P0W A;  4MFJ A;  2D4P A;  3EFA A;  4IUS A;  3T90 A;  4MI4 A;  4MFQ A;  3FNC A;  3OWC A;  2ZXV A;  4QUS A;  4HNX B;  1GHE A;  2YNC C;  2P6G A;  2BL1 A;  2CXA A;  4UFV A;  2VXK A;  2J8R A;  4JWP A;  1QSR A;  4M3S A;  1M4G A;  2OZH A;  3D2P A;  4FD6 A;  4KVO E;  1Y9W A;  2HUZ A;  3LOD A;  2Q4Y A;  4AG7 A;  4AVA A;  2Z3P A;  4ZGY B;  2QML A;  1RO5 A;  3JTK A;  4UCP A;  2P6E A;  2QEC A;  2PQ8 A;  2FT0 A;  4R3K A;  2FL4 A;  1XMT A;  3R96 A;  4UA3 A;  3C26 A;  3PZJ A;  1YLE A;  5F48 A;  3FXT A;  4RI1 A;  4CYO A;  1P0H A;  2VQY A;  1XIX A;  2ZPA A;  3JUW A;  5HMN A;  1Z9U A;  1QSM A;  5CNP A;  4MJ8 A;  2OB0 A;  4MFL A;  3EY5 A;  4JD6 A;  2B5G B;  4E8O A;  3F5B A;  4KVX A;  1Z4R A;  2Z3N A;  4AVC A;  2BSW A;  4MFP A;  2FCK A;  1ZO0 A;  2WUU A;  2R1I A;  2Z3K A;  4XPK A;  4FD4 A;  4PV6 A;  4QB9 A;  2HQY A;  4JXQ A;  3IU1 A;  4XNH B;  3TOA A;  4HNW B;  1Y7R A;  4Q36 A;  3CXP A;  3TOB A;  3DR6 A;  3N7Z A;  1S60 A;  3S6K A;  2H5M A;  4B5O A;  5JQ4 A;  3SXN A;  4XPD C;  3VWE A;  1P4N A;  2AE6 A;  2B5G A;  4MFK A;  3ZZI A;  4C2Y A;  4UCM A;  3R1K A;  2KCW A;  2X7B A;  2WPX A;  3TT2 A;  2FSR A;  4Y49 B;  2VZY A;  2FXF A;  4X5K A;  3CXQ A;  3R9G A;  2Y0M A;  1MJA A;  2OH1 A;  5EBV A;  3TTH A;  2B58 A;  1YVK A;  2FIA A;  1QST A;  3TO6 A;  1M1D A;  4KLW A;  1IYK A;  5G21 A;  2R8V A;  4UWI A;  4EVY A;  4CAF A;  4MFZ A;  4R9M A;  4ZBG A;  4R87 A;  2DPS A;  4Q38 A;  1I21 A;  3D2M A;  2I00 A;  3IU2 A;  4KZT A;  2NMT A;  4CAV A;  4F0Y A;  2VEZ A;  3IGR A;  4NF1 A;  2Z11 A;  4OAE A;  4CYN A;  2EVN A;  4FD7 A;  4U9Y A;  4NCZ A;  3JVN A;  4KUB A;  2JLM A;  2BUE A;  3KKW A;  4FD5 A;  4C68 A;  4MY0 A;  3BJ8 A;  4KOS A;  4CGP A;  4RS2 A;  1V0C A;  2PDO A;  2B4B A;  3QB8 A;  3BJ7 A;  1B6B A;  3VWD A;  4H6U A;  2FIW A;  3TO9 A;  4CAE A;  3F0A A;  1R57 A;  4M85 A;  5H86 A;  4GS4 A;  3FYN A;  2REF A;  1XE4 A;  2G3T A;  3UY5 A;  4BMH A;  1UFH A;  1L0C A;  2REE A;  4JLY A;  1VHS A;  2A4N A;  1SQH A;  3WR7 A;  3PP9 A;  3W91 A;  4KLV A;  5AG5 A;  2EUI A;  4A32 A;  3FRM A;  4KOR A;  4KOY A;  2O28 A;  2BEI A;  2DXQ A;  5IV0 A;  1KUY A;  3TE4 A;  1S7K A;  4I49 A;  4PSX A;  2PC1 A;  2K5T A;  2D4O A;  2OZG A;  1KZF A;  2DPT A;  4LUA A;  3A9L A;  2J8M A;  4R57 A;  4QBJ A;  3R9F A;  1Y9K A;  3FIX A;  3I3G A;  4UFW A;  4A30 A;  4NSQ A;  4CGL A;  4KOT A;  4H6Z A;  4KOV A;  1KUV A;  2ZW6 A;  2PR1 A;  4AB7 A;  1S3Z A;  4L89 A;  2B3V A;  2AJ6 A;  3H4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...