4MFLA

The crystal structure of acyltransferase in complex with decanoyl-coa and tei pseudoaglycone
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
323
structure length
323
Chain Sequence
MDPETVRIALGLEERTAAWLTELDELGPPAEPVRLPRGEEARDLLRRLEVPELDAEEIVAAAPDPDRDPALWWLLERTHHAIVRHMGDHRAKPRGGPPLPYEGGAAARYFHVYVFLATVPAVRRFHAERGIPDEVGWETLTQLGELVAIHRRKYGQGGMNMQWWTTYHLRGILYRLGRLQFSLATGKDGTPHLGLAVPEWGGPLLPKAYDESLHRARPFFDRHFPEHGARVAWGSSWMLDPQLEEYLTEDSNIIQLARFWTLTDSAPEPGNADGDSSILEFVFRYNGQPLDELPQRSSLERAVIAHLKAGRHWHMRTGFVKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/antibiotic
molecule keywords Putative uncharacterized protein tcp24
publication title Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
total genus 108
structure length 323
sequence length 323
ec nomenclature ec 2.3.1.-:
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18082 DUF5596 Domain of unknown function (DUF5596)
A PF18164 GNAT_C GNAT-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.120 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mflA02
4Q36A 4MFLA 4MFKA 4MFPA 4Q38A 4MFJA 4MFQA 4MFZA
chains in the Genus database with same CATH superfamily
4Q7AA 2GE3A 4NJQA 1QSNA 2ZEFA 2ZENA 4KOUA 2XEGA 1S60A 4UCMA 5BWAB 4AG9A 4A38A 2WUUA 1NSAA 1XMBA 2IL4A 2PRQA 4KSAA 3P2HA 2EK9A 3FJUA 1IYKA 1QSOA 4MBUA 3KI9A 3TOBA 3H8GA 1ZG8A 4ZY2A 3FXTA 4A32A 2PCUA 1TF8A 4PV6A 5JQ4A 1LRZA 1LAMA 3B7IA 1WWZA 3FBUA 4C68A 1IB1E 1Y0YA 2K5TA 4XNHB 2ZW7A 4IAVA 4MCPA 4PXDA 4LQGA 2JDDA 4C7IA 4UIBA 3S9LA 1MJBA 2PSWA 3CZXA 4G1PA 4Y49C 1IYLA 1Z8XA 2PJ6A 2YGWA 3IEHA 1VKCA 4CRZB 4OC5A 4KSIA 5DWNA 4OC2A 4MMOA 2BOAA 1AMPA 1ON0A 3OWCA 1XF8A 3VWEA 3CPXA 1P0HA 2FIAA 4KOTA 4R76A 1FY7A 1R57A 2PJ3A 3FIXA 1M4GA 2FL4A 4R9MA 3KASA 4NGTA 2FSRA 1CJWA 1QMUA 4X2TA 3W6SA 2QECA 3DNSA 1S5KA 4PQAA 1XFOA 3BI1A 2BCOA 2Q4VA 4P44A 3B3WA 3NH4A 4OC4A 4EWTA 1RTQA 1CPSA 2PJ7A 4NSQA 3T8WA 4DNCA 2OB0A 3IFEA 4H2KA 5DS0A 1S7FA 2Q43A 3SI0A 3NFZA 4RUHA 1YK3A 7CPAA 2VBQA 4MFQA 1Z2LA 1PYTB 3R9EA 2Z3LA 4MCQA 3IWWA 2PJ4A 2JBKA 3KL9A 4C2YA 4NGSA 2B58A 4H6UA 4CGNA 1IICA 2PC1A 4H6ZA 4DUKA 2GFQA 1GYTA 4IK2A 4P4EA 2PJAA 1CBXA 3EY5A 4UWIA 3VWDA 4A94A 3EXNA 2HQYA 2EK8A 3IWEA 3KHXA 4HNYB 4WJBA 4NF1A 2G3AA 4XPKA 4R3LA 1CP7A 4F0YA 3D4UA 2O4HA 4LX9A 2ANPA 4JXQA 4BMHA 1YW6A 1DE4C 5E96A 4B11A 3D2PA 3K9UA 3CXQA 1NMTA 3D66A 2CNSA 2WZNA 3SI2A 1MK4A 2ZOGA 1ELLP 3V7ZA 3CT9A 3WC7A 2V8HA 4RI1A 2PJ8A 1KZFA 4NEXA 2F5IA 2H5MA 5THWA 4FBEA 1YVOA 4R7MA 4EVYA 5LYLA 1XMTA 1Z9UA 2CIJA 1N71A 3S6HA 1M4DA 2CTCA 4B12A 1AUGA 2PDOA 3WC5A 4CGOA 2Z3MA 2FXFA 2CF4A 3FF3A 2GREA 2PJCA 1F2OA 2YNEA 3R95A 4ZBGA 3PEIA 2POKA 3F0AA 5IB0A 5J1QA 4UWJA 5HVHA 3QNVA 4HNXB 2I3CA 3GB0A 3PP9A 4P4IA 5F46A 1NSLA 5F49A 1UWYA 4DJLA 3IO1A 3NA6A 1XOVA 2EO8A 3JUWA 2PVWA 4C7HA 4KOXA 4HPSA 2JBJA 4MFZA 3RO0A 4TWEA 2ZXVA 3F5BA 3PB9X 1AYEA 1YSJA 2PR1A 2XEFA 4WWVA 3QAYA 4JWPA 1M44A 5AGEA 1MJAA 5F47A 1ZLHA 1A2ZA 2ZEEA 4XPLA 4UF4A 1YVKA 1HDUA 4NGNA 4BINA 4U9YA 4MCSA 2EBJA 4A37A 4CAXA 4KOVA 4II9A 4W9YA 3BI0A 4KOSA 2CY2A 3LODA 4KLWA 1QSRA 2OZUA 2ABZA 1Q2YA 5EBVA 2YNDA 4KUAA 3RBUA 3FRMA 4RN7A 4C2ZA 2R1IA 4UEZA 4KVME 1TIQA 1R43A 4Y49B 3ZJ0A 1Z8WA 1VHEA 4FAIA 4HKFA 4X3RA 3ISZA 4A2ZA 2WPXA 2AFMA 1YR0A 4JJXA 3LACA 1K4JA 1PU9A 3RNZA 4F9VA 4DYOA 4FD7A 5C82A 1IGBA 2XEJA 1TKHA 4LQ6A 5LRGA 5J8FA 2AFSA 3EC4A 2B4DA 4NJRA 4OC1A 4UBRA 2FT0A 4E8OA 5KTDA 3TTHA 3KQZA 4KVXA 3IC1A 1KUXA 2PQ8A 2ZW6A 1I12A 1IIDA 3D68A 3KZWA 3IWGA 3SJEA 3RYOA 4QC6A 1LOKA 3PGPA 4ONUA 2A4NA 1S7NA 1JQGA 4AB7A 4CRYB 3TOAA 1Q2CA 4ZX8A 1S7KA 3JTKA 4NFRA 4FUUA 4B5PB 3KKWA 2ARHA 3D3SA 4CYQA 4MY0A 4M6HA 2Q44A 3MGDA 4NGMA 3SXNA 4NXYA 1BO4A 2QJ8A 1Y7EA 2YNCC 4QBJA 2HC9A 3SHPA 3DR8A 4AG7A 5IV0A 5KTCA 2Z3PA 1ARLA 2P0WA 4OADA 4F6AA 1RXTA 3DDDA 3D7GA 4F9UA 2CNMA 4ZX9A 3SJGA 1S3ZA 4AVAA 2VZYA 2WYRA 2OZHA 3GIUA 4UCPA 3E0KA 1KWMA 2V8DA 2DPTA 2PJ1A 4JXRA 2PJ2A 4R6TA 1ZLIA 2ZEGA 3PFOA 3IJ3A 4PK2A 4YRHA 4Q38A 2VL1A 4L8AA 4MJ8A 2J8NA 2G3TA 2BL1A 4J3GA 5F48A 2OZGA 3CDXA 3VATA 2FCKA 3QB8A 2FVGA 1Y0RA 4CYOA 3L2NA 2BSWA 1TKFA 4P6YA 1M1DA 2B5GA 1MJ9A 2IJZA 5ELYA 5LRKA 3CPAA 5H84A 2VXKA 3A9LA 1IU8A 3TE4A 1XEBA 3D2MA 2V8VA 2G9DA 3S9MA 4F8ZA 4XNHC 4MFLA 3DR6A 4ZYQA 3TO9A 4O23A 5AG7A 2NYQA 2C27A 1IOIA 2PVVA 4KUBA 5D29A 1B6BA 2ZW4A 4PK3A 5A28A 2IQ6A 4OIWA 3TC8A 3PB6X 4LUAA 3W6XA 2PIZA 4B5OA 3BLNA 2CXAA 4CGMA 3K9TA 4IUSA 3WT4A 4OIDA 4PSXA 4B5PA 4IF5A 4MXUA 5JH9A 3GUXA 5HXDA 4GM5A 2CNTA 2PJ5A 2ZPAA 2B4BA 4KOYA 2B4DB 1PCAA 2AE6A 4U9ZA 2QYVA 4ONWA 5CNPA 3PB4X 3R9FA 2OU2A 3BHXA 3PFEA 5IX3A 2PIYA 4CAEA 2V77A 3BJ7A 1NE9A 5AG4A 4GS4A 5A27A 3FEEA 4JZ0A 1Z8LA 2DXQA 2RB7A 4KZTA 4MHDA 3NH8A 2EVNA 2Y0MA 4MHPA 4PPZA 2C6PA 2OH1A 1FT7A 4X5KA 4B14A 3K2KA 4PXCA 1GHEA 3RZAA 3MRUA 3DGVA 2P6EA 4ZY1A 3VH9A 2Q51A 4A95A 2Q7SA 2GLFA 2REFA 2ZEMA 3B3TA 3W91A 2R8VA 1ZG9A 3EFAA 3T9YA 4YFJA 2BEIA 2RFHA 2PJ0A 2QVPA 4P4FA 3FB3A 4ORFA 4UA3A 1XIXA 5K8NA 1QSMA 2ATRA 8CPAA 3B3CA 3FMCA 2VI7A 3CXSA 3I3GA 4MFKA 2R98A 5C88A 1FNOA 4OAEA 1DTDA 4CYPA 1LAPA 5G1ZA 2FS5A 3IU2A 3KGQA 1Y9KA 2G0BA 3G3SA 4P45A 3B3SA 4YWYA 2ZW5A 4FD6A 3H5ZA 2B5GB 3WC6A 4CAVA 5J8CA 4M6IA 1OBRA 1Z4RA 2B3VA 1Z5RA 4R57A 5AG5A 1CM0A 2HB6A 3P2FA 4P4JA 1I1DA 3SI1A 4KOWA 3V8IA 3TFYA 2BUEA 2ZEHA 4MFJA 1RO5A 1L0CA 2ZEPA 5LYDA 4UEEA 4AXVA 2Z10A 4EMEA 1V0CA 2AJ6A 1J4JA 1ELMP 2QIRA 3IGRA 3R1KA 1YREA 4ZGYB 2HV2A 5LRJA 1BLLE 3N5FA 1P4NA 4KORA 4PSWA 1TF9A 2QMLA 2C6GA 3PRTA 4L89A 4UFXA 3TT2A 3G8WA 1VHOA 4MRIA 1LCPA 3WABA 1Z8TA 4JYWA 1ARMA 3GY9A 4UCNA 3DLJA 3H8EA 2Q7BA 2VQYA 4NGQA 4UFWA 1Y9WA 2RC4A 1IOFA 4P10A 4XPDC 5DWMA 4BBHA 3TO6A 3HLPA 4CYNA 2XEIA 2R7HA 3FYNA 4MHZA 4OKOA 3TCVA 3D7DA 2Q4YA 1BOBA 2KCWA 4UFVA 3ISXA 2F8HA 3CXPA 5HVFA 3BJ8A 1BPNA 3ZZIA 5I0CA 4PXEA 2PRBA 3S6GA 1XJOA 1R3NA 5H86A 4H89A 2D4OA 4CS0B 1Q2DA 3IU1A 3NH5A 2IMOA 2WPWA 3PZJA 4CGPA 2B3UA 4CAFA 1YQEA 5I4MA 2Z3KA 3D8PA 5LYIA 5K8MA 5K8OA 3S6FA 4K30A 2ZELA 3B2YA 2AFOA 4KLVA 1F57A 2PR8A 4KVOE 2J8MA 2DEAA 4OC0A 1XRYA 4B10A 4QVTA 3S9NA 4E0AA 3FNCA 4M3SA 3RAMA 4A30A 2BO9A 3GKRA 3WR7A 4MCRA 2NSMA 2PJBA 2GU2A 4P4DA 3B3VA 1X12A 4R3KA 4MI4A 2YNCA 1VIXA 4I49A 1EE3P 4NGRA 2JEWA 4YGOA 3F8KA 2FE7A 1X10A 2EUIA 4A33A 5HVGA 2C6CA 4B13A 1B87A 4OMEA 4MFPA 5K8PA 4C2XA 3SJFA 3FH4A 4IHMA 1I21A 2D4PA 4P4BA 5KTAA 2O53A 4Q36A 3PB7X 1QQ9A 2Q04A 1CG2A 1F2PA 4R8FA 1BAVA 2AFZA 3JRUA 4M85A 2AFWA 1S7LA 5FVJA 1CP6A 4A39A 2ZEOA 3LWUA 1LANA 3D7FA 1SQHA 1XBUA 1YGHA 4OLLA 2ODFA 2P6FA 1VHSA 2DPSA 4B6ZA 4K3NA 3NE8A 4TNUA 2PE3A 5G20A 1IY7A 1U6MA 2ZOFA 3V38A 2AFXA 5CPAA 2VEZA 6CPAA 4KS9A 4U5YA 3R96A 4JD6A 1YMEA 1TXRA 4OC3A 4MHNA 1CX8A 2Z11A 2ZEDA 1KUYA 5HMNA 2DF5A 2JLMA 3LMSA 3NE7A 2OOTA 5F09A 1ZO0A 1WK4A 3GYAA 1HDQA 2WSAA 3B35A 2Q4ZA 2I00A 2VZZA 3FECA 3GLJA 4GXHA 4FD4A 4PXBA 4CGLA 3UY5A 3PBEA 1H8LA 1ZG7A 3I1UA 3KR4A 4ZY0A 2V8GA 1PUAA 3DSBA 3R9GA 5IB9A 4A31A 4Z65A 4HNWB 5GCNA 1CPXA 2I79A 4EFDA 4QB9A 3C26A 3PB8X 2O28A 4AVBA 4ZI6A 5JGFA 4NCZA 5D8NA 3H8FA 3HUVA 2HUZA 5CBMA 3SXOA 3D7HA 3I9SA 3IIBA 3KR5A 2F7VA 4UEFA 4AVCA 3JVNA 1YLOA 1Y7RA 1BPMA 2GLJA 3T90A 1KUVA 3N7ZA 4CPAA 5LYFA 5HH1A 3VARA 2P6GA 1YLEA 2JEVA 3LD2A 1XE4A 2FIWA 2GIVA 3D67A 4KSFA 1JWQA 4YU9A 2J9AA 3KHZA 4X8IA 2Z0ZA 3KQXA 5AG6A 1Z4EA 5ISVA 3TX8A 3TO7A 5JM6A 2PJ9A 1OZPA 4BD9A 4FD5A 3H4QA 3MN8A 2AFUA 2REEA 4MHYA 2NMTA 4QUSA 2GANA 4R87A 5G21A 1QSTA 3QAHA 4XPDB 3B8GA 5G22A 4FWUA 3FX6A 1UFHA 5EMIA 4OP4A 2X7BA 1HEEA 1M4LA 2EWBA 4UIAA 4CAWA 5EC4A 1LFWA 4JLYA 1YW4A 1TKJA 3S6KA 1YX0A 2JDCA 1Q7LA 2Q0YA 4F0XA 3BXMA 3FVLA 4E2AA 1VGYA 3PBBA 3FEDA 4NGPA 1M4IA 2Z3OA 2J8RA 2C1CA 3EO4A 4MY3A 2Z3NA 3SJXA 4M6GA 2CTBA 5JPHA 4RS2A 2OR4A
chains in the Genus database with same CATH topology
2GE3A 1QSNA 4KOUA 1S60A 4UCMA 5BWAB 4AG9A 2WUUA 2IL4A 4KSAA 3P2HA 1IYKA 1QSOA 4MBUA 3TOBA 3FXTA 4A32A 4PV6A 5JQ4A 1LRZA 1WWZA 3FBUA 4C68A 1IB1E 2K5TA 4XNHB 2ZW7A 2JDDA 4C7IA 1MJBA 2PSWA 4Y49C 1IYLA 2YGWA 4CRZB 1VKCA 5DWNA 3OWCA 1ON0A 1XF8A 3VWEA 1P0HA 2FIAA 4KOTA 1FY7A 1R57A 3FIXA 1M4GA 2FL4A 4R9MA 2FSRA 1CJWA 3W6SA 2QECA 3DNSA 1S5KA 2Q4VA 4NSQA 4DNCA 2OB0A 1S7FA 1YK3A 2VBQA 4MFQA 3R9EA 2Z3LA 4C2YA 2B58A 4H6UA 4CGNA 1IICA 2PC1A 4H6ZA 3EY5A 4UWIA 3VWDA 3EXNA 2HQYA 3IWEA 4HNYB 4NF1A 2G3AA 4XPKA 4R3LA 4F0YA 4LX9A 4JXQA 4BMHA 5E96A 4B11A 3D2PA 3K9UA 3CXQA 1NMTA 2CNSA 1MK4A 4RI1A 1KZFA 4NEXA 2F5IA 2H5MA 1YVOA 4EVYA 1XMTA 1Z9UA 3S6HA 1N71A 4B12A 1M4DA 2PDOA 4CGOA 2Z3MA 2FXFA 2YNEA 3R95A 4ZBGA 3F0AA 5IB0A 4UWJA 4HNXB 3PP9A 5F46A 1NSLA 5F49A 3JUWA 4C7HA 4KOXA 4MFZA 2ZXVA 3F5BA 2PR1A 4JWPA 1M44A 5AGEA 1MJAA 5F47A 4XPLA 1YVKA 4U9YA 4CAXA 4KOVA 4II9A 4KOSA 2CY2A 3LODA 4KLWA 1QSRA 2OZUA 1Q2YA 5EBVA 2YNDA 4KUAA 3FRMA 4C2ZA 2R1IA 4KVME 1TIQA 4Y49B 3ZJ0A 4HKFA 4A2ZA 2WPXA 4JJXA 1YR0A 1K4JA 1PU9A 5C82A 4FD7A 5J8FA 3EC4A 2B4DA 4UBRA 4E8OA 2FT0A 5KTDA 3TTHA 4KVXA 1KUXA 2PQ8A 2ZW6A 1I12A 1IIDA 3IWGA 3RYOA 4QC6A 3PGPA 4ONUA 2A4NA 1S7NA 4AB7A 4CRYB 3TOAA 1Q2CA 1S7KA 3JTKA 4B5PB 3KKWA 2ARHA 3D3SA 4CYQA 4MY0A 2Q44A 3MGDA 3SXNA 4NXYA 1BO4A 2YNCC 4QBJA 3SHPA 3DR8A 4AG7A 5IV0A 5KTCA 2Z3PA 2P0WA 4OADA 4F6AA 1RXTA 3DDDA 2CNMA 1S3ZA 4AVAA 2VZYA 2OZHA 4UCPA 3E0KA 2DPTA 4JXRA 4PK2A 4YRHA 4Q38A 4L8AA 4MJ8A 2J8NA 2G3TA 2BL1A 4J3GA 5F48A 2OZGA 2FCKA 3QB8A 4CYOA 2BSWA 1M1DA 2B5GA 1MJ9A 5H84A 2VXKA 3A9LA 3TE4A 1XEBA 3D2MA 4XNHC 4MFLA 3DR6A 3TO9A 5AG7A 2C27A 4KUBA 1B6BA 2ZW4A 4PK3A 5A28A 3W6XA 4LUAA 3BLNA 2CXAA 4CGMA 4IUSA 4PSXA 4B5PA 4IF5A 2CNTA 2ZPAA 2B4BA 4KOYA 2B4DB 2AE6A 4U9ZA 5CNPA 3R9FA 2OU2A 5IX3A 4CAEA 3BJ7A 1NE9A 5AG4A 4GS4A 5A27A 2DXQA 4KZTA 4MHDA 2EVNA 2Y0MA 2OH1A 4X5KA 4B14A 1GHEA 2P6EA 4A95A 3W91A 2REFA 2R8VA 3EFAA 3T9YA 4YFJA 2BEIA 3FB3A 4ORFA 4UA3A 1XIXA 1QSMA 2ATRA 2VI7A 3CXSA 3I3GA 4MFKA 2R98A 5C88A 4CYPA 4OAEA 5G1ZA 3IU2A 2FS5A 1Y9KA 2G0BA 3G3SA 2ZW5A 4FD6A 3H5ZA 2B5GB 4CAVA 5J8CA 1Z4RA 2B3VA 4R57A 5AG5A 1CM0A 3P2FA 3V8IA 1I1DA 3TFYA 4KOWA 2BUEA 4MFJA 1RO5A 1L0CA 2Z10A 1V0CA 2AJ6A 1J4JA 2QIRA 3IGRA 3R1KA 1YREA 4ZGYB 2HV2A 1P4NA 4KORA 4PSWA 2QMLA 4L89A 4UFXA 3TT2A 3G8WA 4UCNA 3GY9A 2Q7BA 2VQYA 4UFWA 1Y9WA 2RC4A 4BBHA 4XPDC 5DWMA 3TO6A 4CYNA 2R7HA 3FYNA 3TCVA 2Q4YA 1BOBA 2KCWA 4UFVA 3CXPA 3BJ8A 3ZZIA 5I0CA 2PRBA 3S6GA 5H86A 4H89A 2D4OA 4CS0B 1Q2DA 3IU1A 3PZJA 2WPWA 4CGPA 2B3UA 4CAFA 2Z3KA 3D8PA 3S6FA 4K30A 4KVOE 4KLVA 2PR8A 2J8MA 4B10A 4QVTA 4E0AA 3FNCA 4M3SA 4A30A 3GKRA 3WR7A 4R3KA 4MI4A 2YNCA 4I49A 4YGOA 3F8KA 2FE7A 2EUIA 4A33A 4B13A 1B87A 4MFPA 4C2XA 1I21A 2D4PA 5KTAA 4Q36A 2Q04A 4M85A 1S7LA 5FVJA 1SQHA 1YGHA 4OLLA 2P6FA 1VHSA 2DPSA 5G20A 1U6MA 2VEZA 4KS9A 4U5YA 3R96A 4JD6A 2Z11A 1KUYA 5HMNA 2JLMA 3NE7A 1ZO0A 1WK4A 3GYAA 2WSAA 2VZZA 2I00A 4FD4A 4CGLA 3UY5A 1PUAA 3DSBA 3R9GA 4A31A 4HNWB 5GCNA 2I79A 4QB9A 3C26A 2O28A 4AVBA 4NCZA 2HUZA 3SXOA 3I9SA 4AVCA 3JVNA 3T90A 1Y7RA 1KUVA 3N7ZA 5HH1A 2P6GA 1YLEA 2JEVA 3LD2A 1XE4A 2FIWA 2GIVA 4KSFA 2Z0ZA 5AG6A 1Z4EA 5ISVA 3TO7A 1OZPA 4FD5A 3H4QA 2REEA 2NMTA 4QUSA 2GANA 4R87A 5G21A 1QSTA 3QAHA 4XPDB 3B8GA 5G22A 1UFHA 2X7BA 4CAWA 5EC4A 4JLYA 3S6KA 1YX0A 2JDCA 4F0XA 2Q0YA 4E2AA 1M4IA 2Z3OA 2J8RA 3EO4A 4MY3A 2Z3NA 5JPHA 4RS2A 4B5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q36 A;  4MFL A;  4MFK A;  4MFP A;  4Q38 A;  4MFJ A;  4MFQ A;  4MFZ A; 
#chains in the Genus database with same CATH topology
 4Q7A A;  2GE3 A;  4NJQ A;  1QSN A;  2ZEF A;  2ZEN A;  4KOU A;  2XEG A;  1S60 A;  4UCM A;  5BWA B;  4AG9 A;  4A38 A;  2WUU A;  1NSA A;  1XMB A;  2IL4 A;  2PRQ A;  4KSA A;  3P2H A;  2EK9 A;  3FJU A;  1IYK A;  1QSO A;  4MBU A;  3KI9 A;  3TOB A;  3H8G A;  1ZG8 A;  4ZY2 A;  3FXT A;  4A32 A;  2PCU A;  1TF8 A;  4PV6 A;  5JQ4 A;  1LRZ A;  1LAM A;  3B7I A;  1WWZ A;  3FBU A;  4C68 A;  1IB1 E;  1Y0Y A;  2K5T A;  4XNH B;  2ZW7 A;  4IAV A;  4MCP A;  4PXD A;  4LQG A;  2JDD A;  4C7I A;  4UIB A;  3S9L A;  1MJB A;  2PSW A;  3CZX A;  4G1P A;  4Y49 C;  1IYL A;  1Z8X A;  2PJ6 A;  2YGW A;  3IEH A;  1VKC A;  4CRZ B;  4OC5 A;  4KSI A;  5DWN A;  4OC2 A;  4MMO A;  2BOA A;  1AMP A;  1ON0 A;  3OWC A;  1XF8 A;  3VWE A;  3CPX A;  1P0H A;  2FIA A;  4KOT A;  4R76 A;  1FY7 A;  1R57 A;  2PJ3 A;  3FIX A;  1M4G A;  2FL4 A;  4R9M A;  3KAS A;  4NGT A;  2FSR A;  1CJW A;  1QMU A;  4X2T A;  3W6S A;  2QEC A;  3DNS A;  1S5K A;  4PQA A;  1XFO A;  3BI1 A;  2BCO A;  2Q4V A;  4P44 A;  3B3W A;  3NH4 A;  4OC4 A;  4EWT A;  1RTQ A;  1CPS A;  2PJ7 A;  4NSQ A;  3T8W A;  4DNC A;  2OB0 A;  3IFE A;  4H2K A;  5DS0 A;  1S7F A;  2Q43 A;  3SI0 A;  3NFZ A;  4RUH A;  1YK3 A;  7CPA A;  2VBQ A;  4MFQ A;  1Z2L A;  1PYT B;  3R9E A;  2Z3L A;  4MCQ A;  3IWW A;  2PJ4 A;  2JBK A;  3KL9 A;  4C2Y A;  4NGS A;  2B58 A;  4H6U A;  4CGN A;  1IIC A;  2PC1 A;  4H6Z A;  4DUK A;  2GFQ A;  1GYT A;  4IK2 A;  4P4E A;  2PJA A;  1CBX A;  3EY5 A;  4UWI A;  3VWD A;  4A94 A;  3EXN A;  2HQY A;  2EK8 A;  3IWE A;  3KHX A;  4HNY B;  4WJB A;  4NF1 A;  2G3A A;  4XPK A;  4R3L A;  1CP7 A;  4F0Y A;  3D4U A;  2O4H A;  4LX9 A;  2ANP A;  4JXQ A;  4BMH A;  1YW6 A;  1DE4 C;  5E96 A;  4B11 A;  3D2P A;  3K9U A;  3CXQ A;  1NMT A;  3D66 A;  2CNS A;  2WZN A;  3SI2 A;  1MK4 A;  2ZOG A;  1ELL P;  3V7Z A;  3CT9 A;  3WC7 A;  2V8H A;  4RI1 A;  2PJ8 A;  1KZF A;  4NEX A;  2F5I A;  2H5M A;  5THW A;  4FBE A;  1YVO A;  4R7M A;  4EVY A;  5LYL A;  1XMT A;  1Z9U A;  2CIJ A;  1N71 A;  3S6H A;  1M4D A;  2CTC A;  4B12 A;  1AUG A;  2PDO A;  3WC5 A;  4CGO A;  2Z3M A;  2FXF A;  2CF4 A;  3FF3 A;  2GRE A;  2PJC A;  1F2O A;  2YNE A;  3R95 A;  4ZBG A;  3PEI A;  2POK A;  3F0A A;  5IB0 A;  5J1Q A;  4UWJ A;  5HVH A;  3QNV A;  4HNX B;  2I3C A;  3GB0 A;  3PP9 A;  4P4I A;  5F46 A;  1NSL A;  5F49 A;  1UWY A;  4DJL A;  3IO1 A;  3NA6 A;  1XOV A;  2EO8 A;  3JUW A;  2PVW A;  4C7H A;  4KOX A;  4HPS A;  2JBJ A;  4MFZ A;  3RO0 A;  4TWE A;  2ZXV A;  3F5B A;  3PB9 X;  1AYE A;  1YSJ A;  2PR1 A;  2XEF A;  4WWV A;  3QAY A;  4JWP A;  1M44 A;  5AGE A;  1MJA A;  5F47 A;  1ZLH A;  1A2Z A;  2ZEE A;  4XPL A;  4UF4 A;  1YVK A;  1HDU A;  4NGN A;  4BIN A;  4U9Y A;  4MCS A;  2EBJ A;  4A37 A;  4CAX A;  4KOV A;  4II9 A;  4W9Y A;  3BI0 A;  4KOS A;  2CY2 A;  3LOD A;  4KLW A;  1QSR A;  2OZU A;  2ABZ A;  1Q2Y A;  5EBV A;  2YND A;  4KUA A;  3RBU A;  3FRM A;  4RN7 A;  4C2Z A;  2R1I A;  4UEZ A;  4KVM E;  1TIQ A;  1R43 A;  4Y49 B;  3ZJ0 A;  1Z8W A;  1VHE A;  4FAI A;  4HKF A;  4X3R A;  3ISZ A;  4A2Z A;  2WPX A;  2AFM A;  1YR0 A;  4JJX A;  3LAC A;  1K4J A;  1PU9 A;  3RNZ A;  4F9V A;  4DYO A;  4FD7 A;  5C82 A;  1IGB A;  2XEJ A;  1TKH A;  4LQ6 A;  5LRG A;  5J8F A;  2AFS A;  3EC4 A;  2B4D A;  4NJR A;  4OC1 A;  4UBR A;  2FT0 A;  4E8O A;  5KTD A;  3TTH A;  3KQZ A;  4KVX A;  3IC1 A;  1KUX A;  2PQ8 A;  2ZW6 A;  1I12 A;  1IID A;  3D68 A;  3KZW A;  3IWG A;  3SJE A;  3RYO A;  4QC6 A;  1LOK A;  3PGP A;  4ONU A;  2A4N A;  1S7N A;  1JQG A;  4AB7 A;  4CRY B;  3TOA A;  1Q2C A;  4ZX8 A;  1S7K A;  3JTK A;  4NFR A;  4FUU A;  4B5P B;  3KKW A;  2ARH A;  3D3S A;  4CYQ A;  4MY0 A;  4M6H A;  2Q44 A;  3MGD A;  4NGM A;  3SXN A;  4NXY A;  1BO4 A;  2QJ8 A;  1Y7E A;  2YNC C;  4QBJ A;  2HC9 A;  3SHP A;  3DR8 A;  4AG7 A;  5IV0 A;  5KTC A;  2Z3P A;  1ARL A;  2P0W A;  4OAD A;  4F6A A;  1RXT A;  3DDD A;  3D7G A;  4F9U A;  2CNM A;  4ZX9 A;  3SJG A;  1S3Z A;  4AVA A;  2VZY A;  2WYR A;  2OZH A;  3GIU A;  4UCP A;  3E0K A;  1KWM A;  2V8D A;  2DPT A;  2PJ1 A;  4JXR A;  2PJ2 A;  4R6T A;  1ZLI A;  2ZEG A;  3PFO A;  3IJ3 A;  4PK2 A;  4YRH A;  4Q38 A;  2VL1 A;  4L8A A;  4MJ8 A;  2J8N A;  2G3T A;  2BL1 A;  4J3G A;  5F48 A;  2OZG A;  3CDX A;  3VAT A;  2FCK A;  3QB8 A;  2FVG A;  1Y0R A;  4CYO A;  3L2N A;  2BSW A;  1TKF A;  4P6Y A;  1M1D A;  2B5G A;  1MJ9 A;  2IJZ A;  5ELY A;  5LRK A;  3CPA A;  5H84 A;  2VXK A;  3A9L A;  1IU8 A;  3TE4 A;  1XEB A;  3D2M A;  2V8V A;  2G9D A;  3S9M A;  4F8Z A;  4XNH C;  4MFL A;  3DR6 A;  4ZYQ A;  3TO9 A;  4O23 A;  5AG7 A;  2NYQ A;  2C27 A;  1IOI A;  2PVV A;  4KUB A;  5D29 A;  1B6B A;  2ZW4 A;  4PK3 A;  5A28 A;  2IQ6 A;  4OIW A;  3TC8 A;  3PB6 X;  4LUA A;  3W6X A;  2PIZ A;  4B5O A;  3BLN A;  2CXA A;  4CGM A;  3K9T A;  4IUS A;  3WT4 A;  4OID A;  4PSX A;  4B5P A;  4IF5 A;  4MXU A;  5JH9 A;  3GUX A;  5HXD A;  4GM5 A;  2CNT A;  2PJ5 A;  2ZPA A;  2B4B A;  4KOY A;  2B4D B;  1PCA A;  2AE6 A;  4U9Z A;  2QYV A;  4ONW A;  5CNP A;  3PB4 X;  3R9F A;  2OU2 A;  3BHX A;  3PFE A;  5IX3 A;  2PIY A;  4CAE A;  2V77 A;  3BJ7 A;  1NE9 A;  5AG4 A;  4GS4 A;  5A27 A;  3FEE A;  4JZ0 A;  1Z8L A;  2DXQ A;  2RB7 A;  4KZT A;  4MHD A;  3NH8 A;  2EVN A;  2Y0M A;  4MHP A;  4PPZ A;  2C6P A;  2OH1 A;  1FT7 A;  4X5K A;  4B14 A;  3K2K A;  4PXC A;  1GHE A;  3RZA A;  3MRU A;  3DGV A;  2P6E A;  4ZY1 A;  3VH9 A;  2Q51 A;  4A95 A;  2Q7S A;  2GLF A;  2REF A;  2ZEM A;  3B3T A;  3W91 A;  2R8V A;  1ZG9 A;  3EFA A;  3T9Y A;  4YFJ A;  2BEI A;  2RFH A;  2PJ0 A;  2QVP A;  4P4F A;  3FB3 A;  4ORF A;  4UA3 A;  1XIX A;  5K8N A;  1QSM A;  2ATR A;  8CPA A;  3B3C A;  3FMC A;  2VI7 A;  3CXS A;  3I3G A;  4MFK A;  2R98 A;  5C88 A;  1FNO A;  4OAE A;  1DTD A;  4CYP A;  1LAP A;  5G1Z A;  2FS5 A;  3IU2 A;  3KGQ A;  1Y9K A;  2G0B A;  3G3S A;  4P45 A;  3B3S A;  4YWY A;  2ZW5 A;  4FD6 A;  3H5Z A;  2B5G B;  3WC6 A;  4CAV A;  5J8C A;  4M6I A;  1OBR A;  1Z4R A;  2B3V A;  1Z5R A;  4R57 A;  5AG5 A;  1CM0 A;  2HB6 A;  3P2F A;  4P4J A;  1I1D A;  3SI1 A;  4KOW A;  3V8I A;  3TFY A;  2BUE A;  2ZEH A;  4MFJ A;  1RO5 A;  1L0C A;  2ZEP A;  5LYD A;  4UEE A;  4AXV A;  2Z10 A;  4EME A;  1V0C A;  2AJ6 A;  1J4J A;  1ELM P;  2QIR A;  3IGR A;  3R1K A;  1YRE A;  4ZGY B;  2HV2 A;  5LRJ A;  1BLL E;  3N5F A;  1P4N A;  4KOR A;  4PSW A;  1TF9 A;  2QML A;  2C6G A;  3PRT A;  4L89 A;  4UFX A;  3TT2 A;  3G8W A;  1VHO A;  4MRI A;  1LCP A;  3WAB A;  1Z8T A;  4JYW A;  1ARM A;  3GY9 A;  4UCN A;  3DLJ A;  3H8E A;  2Q7B A;  2VQY A;  4NGQ A;  4UFW A;  1Y9W A;  2RC4 A;  1IOF A;  4P10 A;  4XPD C;  5DWM A;  4BBH A;  3TO6 A;  3HLP A;  4CYN A;  2XEI A;  2R7H A;  3FYN A;  4MHZ A;  4OKO A;  3TCV A;  3D7D A;  2Q4Y A;  1BOB A;  2KCW A;  4UFV A;  3ISX A;  2F8H A;  3CXP A;  5HVF A;  3BJ8 A;  1BPN A;  3ZZI A;  5I0C A;  4PXE A;  2PRB A;  3S6G A;  1XJO A;  1R3N A;  5H86 A;  4H89 A;  2D4O A;  4CS0 B;  1Q2D A;  3IU1 A;  3NH5 A;  2IMO A;  2WPW A;  3PZJ A;  4CGP A;  2B3U A;  4CAF A;  1YQE A;  5I4M A;  2Z3K A;  3D8P A;  5LYI A;  5K8M A;  5K8O A;  3S6F A;  4K30 A;  2ZEL A;  3B2Y A;  2AFO A;  4KLV A;  1F57 A;  2PR8 A;  4KVO E;  2J8M A;  2DEA A;  4OC0 A;  1XRY A;  4B10 A;  4QVT A;  3S9N A;  4E0A A;  3FNC A;  4M3S A;  3RAM A;  4A30 A;  2BO9 A;  3GKR A;  3WR7 A;  4MCR A;  2NSM A;  2PJB A;  2GU2 A;  4P4D A;  3B3V A;  1X12 A;  4R3K A;  4MI4 A;  2YNC A;  1VIX A;  4I49 A;  1EE3 P;  4NGR A;  2JEW A;  4YGO A;  3F8K A;  2FE7 A;  1X10 A;  2EUI A;  4A33 A;  5HVG A;  2C6C A;  4B13 A;  1B87 A;  4OME A;  4MFP A;  5K8P A;  4C2X A;  3SJF A;  3FH4 A;  4IHM A;  1I21 A;  2D4P A;  4P4B A;  5KTA A;  2O53 A;  4Q36 A;  3PB7 X;  1QQ9 A;  2Q04 A;  1CG2 A;  1F2P A;  4R8F A;  1BAV A;  2AFZ A;  3JRU A;  4M85 A;  2AFW A;  1S7L A;  5FVJ A;  1CP6 A;  4A39 A;  2ZEO A;  3LWU A;  1LAN A;  3D7F A;  1SQH A;  1XBU A;  1YGH A;  4OLL A;  2ODF A;  2P6F A;  1VHS A;  2DPS A;  4B6Z A;  4K3N A;  3NE8 A;  4TNU A;  2PE3 A;  5G20 A;  1IY7 A;  1U6M A;  2ZOF A;  3V38 A;  2AFX A;  5CPA A;  2VEZ A;  6CPA A;  4KS9 A;  4U5Y A;  3R96 A;  4JD6 A;  1YME A;  1TXR A;  4OC3 A;  4MHN A;  1CX8 A;  2Z11 A;  2ZED A;  1KUY A;  5HMN A;  2DF5 A;  2JLM A;  3LMS A;  3NE7 A;  2OOT A;  5F09 A;  1ZO0 A;  1WK4 A;  3GYA A;  1HDQ A;  2WSA A;  3B35 A;  2Q4Z A;  2I00 A;  2VZZ A;  3FEC A;  3GLJ A;  4GXH A;  4FD4 A;  4PXB A;  4CGL A;  3UY5 A;  3PBE A;  1H8L A;  1ZG7 A;  3I1U A;  3KR4 A;  4ZY0 A;  2V8G A;  1PUA A;  3DSB A;  3R9G A;  5IB9 A;  4A31 A;  4Z65 A;  4HNW B;  5GCN A;  1CPX A;  2I79 A;  4EFD A;  4QB9 A;  3C26 A;  3PB8 X;  2O28 A;  4AVB A;  4ZI6 A;  5JGF A;  4NCZ A;  5D8N A;  3H8F A;  3HUV A;  2HUZ A;  5CBM A;  3SXO A;  3D7H A;  3I9S A;  3IIB A;  3KR5 A;  2F7V A;  4UEF A;  4AVC A;  3JVN A;  1YLO A;  1Y7R A;  1BPM A;  2GLJ A;  3T90 A;  1KUV A;  3N7Z A;  4CPA A;  5LYF A;  5HH1 A;  3VAR A;  2P6G A;  1YLE A;  2JEV A;  3LD2 A;  1XE4 A;  2FIW A;  2GIV A;  3D67 A;  4KSF A;  1JWQ A;  4YU9 A;  2J9A A;  3KHZ A;  4X8I A;  2Z0Z A;  3KQX A;  5AG6 A;  1Z4E A;  5ISV A;  3TX8 A;  3TO7 A;  5JM6 A;  2PJ9 A;  1OZP A;  4BD9 A;  4FD5 A;  3H4Q A;  3MN8 A;  2AFU A;  2REE A;  4MHY A;  2NMT A;  4QUS A;  2GAN A;  4R87 A;  5G21 A;  1QST A;  3QAH A;  4XPD B;  3B8G A;  5G22 A;  4FWU A;  3FX6 A;  1UFH A;  5EMI A;  4OP4 A;  2X7B A;  1HEE A;  1M4L A;  2EWB A;  4UIA A;  4CAW A;  5EC4 A;  1LFW A;  4JLY A;  1YW4 A;  1TKJ A;  3S6K A;  1YX0 A;  2JDC A;  1Q7L A;  2Q0Y A;  4F0X A;  3BXM A;  3FVL A;  4E2A A;  1VGY A;  3PBB A;  3FED A;  4NGP A;  1M4I A;  2Z3O A;  2J8R A;  2C1C A;  3EO4 A;  4MY3 A;  2Z3N A;  3SJX A;  4M6G A;  2CTB A;  5JPH A;  4RS2 A;  2OR4 A; 
#chains in the Genus database with same CATH homology
 2GE3 A;  1QSN A;  4KOU A;  1S60 A;  4UCM A;  5BWA B;  4AG9 A;  2WUU A;  2IL4 A;  4KSA A;  3P2H A;  1IYK A;  1QSO A;  4MBU A;  3TOB A;  3FXT A;  4A32 A;  4PV6 A;  5JQ4 A;  1LRZ A;  1WWZ A;  3FBU A;  4C68 A;  1IB1 E;  2K5T A;  4XNH B;  2ZW7 A;  2JDD A;  4C7I A;  1MJB A;  2PSW A;  4Y49 C;  1IYL A;  2YGW A;  4CRZ B;  1VKC A;  5DWN A;  3OWC A;  1ON0 A;  1XF8 A;  3VWE A;  1P0H A;  2FIA A;  4KOT A;  1FY7 A;  1R57 A;  3FIX A;  1M4G A;  2FL4 A;  4R9M A;  2FSR A;  1CJW A;  3W6S A;  2QEC A;  3DNS A;  1S5K A;  2Q4V A;  4NSQ A;  4DNC A;  2OB0 A;  1S7F A;  1YK3 A;  2VBQ A;  4MFQ A;  3R9E A;  2Z3L A;  4C2Y A;  2B58 A;  4H6U A;  4CGN A;  1IIC A;  2PC1 A;  4H6Z A;  3EY5 A;  4UWI A;  3VWD A;  3EXN A;  2HQY A;  3IWE A;  4HNY B;  4NF1 A;  2G3A A;  4XPK A;  4R3L A;  4F0Y A;  4LX9 A;  4JXQ A;  4BMH A;  5E96 A;  4B11 A;  3D2P A;  3K9U A;  3CXQ A;  1NMT A;  2CNS A;  1MK4 A;  4RI1 A;  1KZF A;  4NEX A;  2F5I A;  2H5M A;  1YVO A;  4EVY A;  1XMT A;  1Z9U A;  3S6H A;  1N71 A;  4B12 A;  1M4D A;  2PDO A;  4CGO A;  2Z3M A;  2FXF A;  2YNE A;  3R95 A;  4ZBG A;  3F0A A;  5IB0 A;  4UWJ A;  4HNX B;  3PP9 A;  5F46 A;  1NSL A;  5F49 A;  3JUW A;  4C7H A;  4KOX A;  4MFZ A;  2ZXV A;  3F5B A;  2PR1 A;  4JWP A;  1M44 A;  5AGE A;  1MJA A;  5F47 A;  4XPL A;  1YVK A;  4U9Y A;  4CAX A;  4KOV A;  4II9 A;  4KOS A;  2CY2 A;  3LOD A;  4KLW A;  1QSR A;  2OZU A;  1Q2Y A;  5EBV A;  2YND A;  4KUA A;  3FRM A;  4C2Z A;  2R1I A;  4KVM E;  1TIQ A;  4Y49 B;  3ZJ0 A;  4HKF A;  4A2Z A;  2WPX A;  4JJX A;  1YR0 A;  1K4J A;  1PU9 A;  5C82 A;  4FD7 A;  5J8F A;  3EC4 A;  2B4D A;  4UBR A;  4E8O A;  2FT0 A;  5KTD A;  3TTH A;  4KVX A;  1KUX A;  2PQ8 A;  2ZW6 A;  1I12 A;  1IID A;  3IWG A;  3RYO A;  4QC6 A;  3PGP A;  4ONU A;  2A4N A;  1S7N A;  4AB7 A;  4CRY B;  3TOA A;  1Q2C A;  1S7K A;  3JTK A;  4B5P B;  3KKW A;  2ARH A;  3D3S A;  4CYQ A;  4MY0 A;  2Q44 A;  3MGD A;  3SXN A;  4NXY A;  1BO4 A;  2YNC C;  4QBJ A;  3SHP A;  3DR8 A;  4AG7 A;  5IV0 A;  5KTC A;  2Z3P A;  2P0W A;  4OAD A;  4F6A A;  1RXT A;  3DDD A;  2CNM A;  1S3Z A;  4AVA A;  2VZY A;  2OZH A;  4UCP A;  3E0K A;  2DPT A;  4JXR A;  4PK2 A;  4YRH A;  4Q38 A;  4L8A A;  4MJ8 A;  2J8N A;  2G3T A;  2BL1 A;  4J3G A;  5F48 A;  2OZG A;  2FCK A;  3QB8 A;  4CYO A;  2BSW A;  1M1D A;  2B5G A;  1MJ9 A;  5H84 A;  2VXK A;  3A9L A;  3TE4 A;  1XEB A;  3D2M A;  4XNH C;  4MFL A;  3DR6 A;  3TO9 A;  5AG7 A;  2C27 A;  4KUB A;  1B6B A;  2ZW4 A;  4PK3 A;  5A28 A;  3W6X A;  4LUA A;  3BLN A;  2CXA A;  4CGM A;  4IUS A;  4PSX A;  4B5P A;  4IF5 A;  2CNT A;  2ZPA A;  2B4B A;  4KOY A;  2B4D B;  2AE6 A;  4U9Z A;  5CNP A;  3R9F A;  2OU2 A;  5IX3 A;  4CAE A;  3BJ7 A;  1NE9 A;  5AG4 A;  4GS4 A;  5A27 A;  2DXQ A;  4KZT A;  4MHD A;  2EVN A;  2Y0M A;  2OH1 A;  4X5K A;  4B14 A;  1GHE A;  2P6E A;  4A95 A;  3W91 A;  2REF A;  2R8V A;  3EFA A;  3T9Y A;  4YFJ A;  2BEI A;  3FB3 A;  4ORF A;  4UA3 A;  1XIX A;  1QSM A;  2ATR A;  2VI7 A;  3CXS A;  3I3G A;  4MFK A;  2R98 A;  5C88 A;  4CYP A;  4OAE A;  5G1Z A;  3IU2 A;  2FS5 A;  1Y9K A;  2G0B A;  3G3S A;  2ZW5 A;  4FD6 A;  3H5Z A;  2B5G B;  4CAV A;  5J8C A;  1Z4R A;  2B3V A;  4R57 A;  5AG5 A;  1CM0 A;  3P2F A;  3V8I A;  1I1D A;  3TFY A;  4KOW A;  2BUE A;  4MFJ A;  1RO5 A;  1L0C A;  2Z10 A;  1V0C A;  2AJ6 A;  1J4J A;  2QIR A;  3IGR A;  3R1K A;  1YRE A;  4ZGY B;  2HV2 A;  1P4N A;  4KOR A;  4PSW A;  2QML A;  4L89 A;  4UFX A;  3TT2 A;  3G8W A;  4UCN A;  3GY9 A;  2Q7B A;  2VQY A;  4UFW A;  1Y9W A;  2RC4 A;  4BBH A;  4XPD C;  5DWM A;  3TO6 A;  4CYN A;  2R7H A;  3FYN A;  3TCV A;  2Q4Y A;  1BOB A;  2KCW A;  4UFV A;  3CXP A;  3BJ8 A;  3ZZI A;  5I0C A;  2PRB A;  3S6G A;  5H86 A;  4H89 A;  2D4O A;  4CS0 B;  1Q2D A;  3IU1 A;  3PZJ A;  2WPW A;  4CGP A;  2B3U A;  4CAF A;  2Z3K A;  3D8P A;  3S6F A;  4K30 A;  4KVO E;  4KLV A;  2PR8 A;  2J8M A;  4B10 A;  4QVT A;  4E0A A;  3FNC A;  4M3S A;  4A30 A;  3GKR A;  3WR7 A;  4R3K A;  4MI4 A;  2YNC A;  4I49 A;  4YGO A;  3F8K A;  2FE7 A;  2EUI A;  4A33 A;  4B13 A;  1B87 A;  4MFP A;  4C2X A;  1I21 A;  2D4P A;  5KTA A;  4Q36 A;  2Q04 A;  4M85 A;  1S7L A;  5FVJ A;  1SQH A;  1YGH A;  4OLL A;  2P6F A;  1VHS A;  2DPS A;  5G20 A;  1U6M A;  2VEZ A;  4KS9 A;  4U5Y A;  3R96 A;  4JD6 A;  2Z11 A;  1KUY A;  5HMN A;  2JLM A;  3NE7 A;  1ZO0 A;  1WK4 A;  3GYA A;  2WSA A;  2VZZ A;  2I00 A;  4FD4 A;  4CGL A;  3UY5 A;  1PUA A;  3DSB A;  3R9G A;  4A31 A;  4HNW B;  5GCN A;  2I79 A;  4QB9 A;  3C26 A;  2O28 A;  4AVB A;  4NCZ A;  2HUZ A;  3SXO A;  3I9S A;  4AVC A;  3JVN A;  3T90 A;  1Y7R A;  1KUV A;  3N7Z A;  5HH1 A;  2P6G A;  1YLE A;  2JEV A;  3LD2 A;  1XE4 A;  2FIW A;  2GIV A;  4KSF A;  2Z0Z A;  5AG6 A;  1Z4E A;  5ISV A;  3TO7 A;  1OZP A;  4FD5 A;  3H4Q A;  2REE A;  2NMT A;  4QUS A;  2GAN A;  4R87 A;  5G21 A;  1QST A;  3QAH A;  4XPD B;  3B8G A;  5G22 A;  1UFH A;  2X7B A;  4CAW A;  5EC4 A;  4JLY A;  3S6K A;  1YX0 A;  2JDC A;  4F0X A;  2Q0Y A;  4E2A A;  1M4I A;  2Z3O A;  2J8R A;  3EO4 A;  4MY3 A;  2Z3N A;  5JPH A;  4RS2 A;  4B5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...