4MFLA

The crystal structure of acyltransferase in complex with decanoyl-coa and tei pseudoaglycone
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
323
structure length
323
Chain Sequence
MDPETVRIALGLEERTAAWLTELDELGPPAEPVRLPRGEEARDLLRRLEVPELDAEEIVAAAPDPDRDPALWWLLERTHHAIVRHMGDHRAKPRGGPPLPYEGGAAARYFHVYVFLATVPAVRRFHAERGIPDEVGWETLTQLGELVAIHRRKYGQGGMNMQWWTTYHLRGILYRLGRLQFSLATGKDGTPHLGLAVPEWGGPLLPKAYDESLHRARPFFDRHFPEHGARVAWGSSWMLDPQLEEYLTEDSNIIQLARFWTLTDSAPEPGNADGDSSILEFVFRYNGQPLDELPQRSSLERAVIAHLKAGRHWHMRTGFVKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein tcp24
publication title Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Transferase/antibiotic
total genus 108
structure length 323
sequence length 323
ec nomenclature ec 2.3.1.-:
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18082 DUF5596 Domain of unknown function (DUF5596)
A PF18164 GNAT_C GNAT-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.120 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mflA02
4Q36A 4MFPA 4MFLA 4MFZA 4Q38A 4MFKA 4MFJA 4MFQA
chains in the Genus database with same CATH superfamily
1LRZA 4C7IA 3PBBA 3IWGA 3D7HA 3FMCA 2B3UA 2PIYA 2B4DB 3BJ7A 4NFRA 2OZGA 3KI9A 1A2ZA 4UWJA 5BWAB 5LRGA 3KQXA 2ODFA 3P2HA 4NGSA 3R95A 4EFDA 2R7HA 4A33A 4II9A 1DE4C 4M6IA 1JQGA 1M4IA 2HV2A 2FXFA 3DR6A 2REFA 3FF3A 4H2KA 1TKHA 4LQ6A 1ELMP 3WC7A 2J8RA 2EK8A 3TFYA 2J9AA 5JM6A 3OWCA 2GFQA 3HLPA 4KUBA 2PQ8A 2POKA 3IIBA 2CNMA 3B3VA 4A38A 3G3SA 2VBQA 3JVNA 4Q36A 3W91A 4AG9A 5DS0A 1S7NA 4OC1A 1H8LA 2QMLA 1IGBA 2VEZA 4XNHB 5EMIA 4UBRA 1S7KA 1CP6A 5ELYA 4KOSA 3PFOA 3BLNA 2B58A 1ARMA 4JXRA 1QSOA 5AG7A 3SJXA 4B10A 2O28A 4KLVA 2CTCA 5IX3A 3C26A 4JD6A 1GHEA 2ZEPA 3PB4X 2BEIA 4NXYA 4M6GA 3D4UA 3FX6A 3LWUA 4OIDA 2QVPA 1MK4A 2WPWA 3EXNA 1FNOA 4BMHA 5JGFA 4KSAA 2YNCC 4DJLA 2AJ6A 1CPXA 1S5KA 1VHEA 4H6ZA 5CPAA 1LFWA 5HH1A 3IC1A 2GIVA 3TE4A 1XJOA 1LANA 1Q7LA 4NF1A 2I79A 2PJAA 3TOBA 1ZLHA 3I3GA 2NSMA 3SXOA 2RB7A 5KTDA 3FH4A 2EUIA 1Z2LA 4U9YA 4UWIA 1ZG7A 2CNSA 2YNDA 4L89A 1QSNA 4R3KA 5K8OA 4GS4A 4TWEA 2PVVA 3EC4A 1KUYA 3PB6X 1BLLE 1V0CA 2PJBA 3A9LA 4ZX9A 2OR4A 4YGOA 3NE7A 2JLMA 1ELLP 3D2MA 3MRUA 2Z10A 4CGMA 3PZJA 4MHZA 4PXCA 4Y49B 1YX0A 3E0KA 4MY3A 1VIXA 4ONUA 2XEFA 5FVJA 4Q7AA 5H84A 4YRHA 3BI1A 4AVAA 4FD4A 3EY5A 3PGPA 4QC6A 4LX9A 1CX8A 1XBUA 4ZY1A 3NH8A 3PEIA 2Q43A 3WR7A 5E96A 3KR5A 4IAVA 4Q38A 4Y49C 3FYNA 4CAWA 5AG4A 2PIZA 5JH9A 4A32A 1Y0YA 2PR1A 2AFMA 1PUAA 3CXPA 5CBMA 2DXQA 2Q4YA 3FNCA 1XMTA 4BBHA 2PCUA 1KWMA 2OU2A 2JDCA 3K2KA 4UIBA 4O23A 3RBUA 2BUEA 5G22A 4K30A 3IU1A 4XPDC 4B13A 3CPAA 1AUGA 3D68A 4P4JA 2IMOA 3GY9A 2C6PA 4UFXA 4KORA 4MFKA 4FAIA 1XEBA 4KOXA 3BXMA 1R57A 1X10A 1YSJA 1NSLA 5J8CA 3D3SA 4PSXA 4DUKA 1XFOA 3KZWA 2ZW6A 2VI7A 3H4QA 2V8GA 4MY0A 4ZBGA 2B3VA 2R1IA 2Y0MA 2OB0A 3KL9A 4MFLA 6CPAA 3B3TA 1ZG9A 1CP7A 4X3RA 2J8MA 1YVKA 4YFJA 1YW4A 4ORFA 3VWEA 5KTAA 3I9SA 4CYNA 4PV6A 3R9EA 3CT9A 1KZFA 2JBKA 2ZW4A 1XE4A 2PJ8A 4K3NA 5I4MA 4UFVA 4B12A 2X7BA 4OKOA 3LD2A 2O4HA 5D8NA 5F49A 5LRJA 4RUHA 2OOTA 1YR0A 2FVGA 1TKJA 5H86A 4F9VA 5I0CA 1IICA 2WSAA 2AE6A 2VL1A 4H89A 4OP4A 4P45A 5G20A 1ZG8A 1X12A 5G21A 4C2ZA 4E8OA 2GLJA 4C7HA 3SI1A 2HB6A 2GU2A 4QVTA 5J1QA 1N71A 2P6GA 4W9YA 2I00A 4ZGYB 4CRZB 1RXTA 3SJEA 1F57A 1Y7EA 3NH5A 3FIXA 2ARHA 1NSAA 1PU9A 1VHOA 2WZNA 2ZEGA 3H8EA 3PRTA 5HVHA 1M4GA 2V8HA 2ZXVA 1TXRA 4OC4A 4X5KA 4R8FA 4PXEA 2Z3NA 2ANPA 3D7GA 4PSWA 3ZZIA 3FXTA 5THWA 4R87A 4AVBA 4X8IA 3KQZA 2XEGA 4IK2A 5AG6A 4KLWA 3SHPA 1F2OA 2PJ0A 3GB0A 3N7ZA 3TC8A 2VZZA 5K8PA 4MCSA 4KS9A 1S7FA 1Y0RA 4A30A 2P0WA 4KSIA 4RI1A 5IB9A 1S7LA 2ZEOA 3KHXA 3KKWA 2C6CA 5G1ZA 1Z4RA 2EO8A 3P2FA 3TO7A 2PSWA 1B87A 1PCAA 4M3SA 4NGTA 3H8FA 4JZ0A 4JYWA 2HC9A 2PJ2A 2PDOA 5AG5A 3QAYA 4WJBA 1Y9WA 2DF5A 2R8VA 3F8KA 2GLFA 2BO9A 2EWBA 4KSFA 2H5MA 4HNWB 3R96A 5HVGA 4MFQA 2CTBA 3CXSA 2BCOA 3NH4A 3ISZA 4R76A 1BPMA 3LMSA 5AGEA 4B5PB 2Z3PA 2I3CA 3I1UA 3IU2A 4OC3A 1FY7A 3LACA 2FIAA 1UFHA 3GUXA 1Z8LA 2V8DA 2D4OA 4KVXA 5F09A 3GLJA 3D7FA 3H5ZA 3NE8A 4P4IA 4E0AA 1XOVA 2REEA 3PBEA 4P6YA 2IL4A 2D4PA 4ZY0A 3PB9X 2B4BA 3FECA 2F8HA 3QAHA 2ZELA 3T90A 1CM0A 1P0HA 1PYTB 5CNPA 3B35A 4NSQA 2Q0YA 4UEFA 4F6AA 4FD7A 3V38A 4HPSA 2GREA 1S60A 4MXUA 4U5YA 1Z9UA 4QBJA 3SJFA 3UY5A 4A94A 4MHNA 3TX8A 2K5TA 4C68A 2Q04A 4KVOE 2IJZA 4MHDA 3VATA 4R7MA 1I1DA 2B5GA 3K9TA 5JQ4A 4MRIA 4R3LA 4UCPA 5LYIA 2NYQA 3VWDA 4CAXA 4ONWA 4F9UA 1ZO0A 5J8FA 1Z5RA 3R9FA 2Z11A 4UFWA 3EO4A 2G9DA 2RFHA 4XPDB 2R98A 4MBUA 1UWYA 4OC0A 2ZOGA 2FE7A 2QYVA 4AG7A 2B4DA 3IWWA 2OZUA 1TIQA 1YVOA 2VXKA 1YMEA 2PE3A 3IFEA 1L0CA 3TCVA 4X2TA 4HNXB 1XIXA 8CPAA 2JEWA 3W6XA 3B3CA 4CGOA 2BSWA 3G8WA 3T8WA 3TTHA 2AFUA 2CIJA 4E2AA 1J4JA 3F0AA 1Z8XA 2ZPAA 4P4BA 2VQYA 4NGRA 5DWMA 2JEVA 3SJGA 2PJ9A 2PRBA 4F0XA 3KR4A 5HVFA 4QUSA 4MCQA 1LOKA 3W6SA 1VHSA 4OLLA 4UF4A 5HXDA 1XMBA 4P10A 4CRYB 3CZXA 1YW6A 2PJCA 4A39A 2JBJA 1Z8WA 4DNCA 1P4NA 3PP9A 5F48A 1AYEA 3TOAA 2JDDA 3WC5A 4UEZA 1KUXA 4YWYA 3WABA 1KUVA 2P6EA 1TF9A 3CPXA 2AFOA 2PVWA 3B3WA 3S6GA 2QIRA 2FSRA 3NFZA 4AB7A 4YU9A 4I49A 4PK2A 4MFJA 2CXAA 4L8AA 2DEAA 3FB3A 3FVLA 4TNUA 1CBXA 4R57A 4P4DA 3S9MA 2AFXA 3D7DA 1IB1E 2WUUA 2AFSA 2DPTA 5C82A 1YLEA 4A31A 1M44A 1QSRA 4IF5A 2FL4A 2ZW7A 4OC2A 4WWVA 2CY2A 3SI0A 4M85A 4MCRA 3S6KA 4PPZA 2C1CA 1WWZA 2QJ8A 4JJXA 2QECA 3K9UA 2FIWA 1B6BA 4PXDA 4IHMA 1F2PA 5LYDA 1R43A 4CGNA 1HDQA 5GCNA 4C2XA 4GXHA 3RAMA 3JRUA 1HDUA 3DLJA 4XPKA 5K8MA 1IOFA 2BL1A 3IEHA 3HUVA 4A95A 2CF4A 4B6ZA 2G3TA 1CPSA 5D29A 1QSMA 5C88A 3PB8X 3R9GA 3PFEA 1Q2DA 3TO6A 4LQGA 3KGQA 2PJ4A 4KOUA 1VGYA 2ZEHA 4ZX8A 3RNZA 1CJWA 4BD9A 1LAMA 3H8GA 4EMEA 4JLYA 2HUZA 3FBUA 2FS5A 1IYLA 3DDDA 4OAEA 4CAEA 3N5FA 4KOVA 2FCKA 1FT7A 4PQAA 2PJ3A 4CYQA 4MHPA 3GKRA 1BOBA 4CGPA 4NEXA 1Z4EA 3IGRA 2Z3MA 3DSBA 4OC5A 1IU8A 1YREA 1XRYA 1Q2CA 2AFWA 2G3AA 4UCMA 4Z65A 1M4DA 4H6UA 2VZYA 4FD6A 3B2YA 2F7VA 1NE9A 3FEDA 2KCWA 5LYFA 5A28A 4JWPA 4NGPA 1Y9KA 1OBRA 4MMOA 4OIWA 2PJ6A 4MHYA 3S6HA 2FT0A 5F47A 4EVYA 5A27A 3RYOA 4A37A 4J3GA 5IV0A 1BAVA 1BO4A 1IY7A 3DR8A 2V77A 3ISXA 2DPSA 3MGDA 3BI0A 4MFZA 4MI4A 2YNEA 3D8PA 4PXBA 1IOIA 5HMNA 4XPLA 4F0YA 4NCZA 1Y7RA 3GIUA 3IWEA 1QMUA 4GM5A 4KOYA 1YQEA 4KVME 2WYRA 2ATRA 3B7IA 3RZAA 4IUSA 5IB0A 2PR8A 4XNHC 3S6FA 2GE3A 3TO9A 4KOTA 2ZW5A 3V7ZA 4CGLA 1QSTA 1TF8A 2Q4ZA 2ZENA 2AFZA 1LCPA 2ZOFA 3IO1A 4KZTA 1YLOA 4C2YA 3KHZA 5EBVA 2EBJA 2GANA 2ZEEA 3MN8A 4EWTA 2ZEFA 2PJ5A 1ARLA 1M1DA 4UIAA 3D2PA 1SQHA 4DYOA 4AXVA 2NMTA 3FEEA 2ZEDA 4LUAA 3DNSA 1ZLIA 4OMEA 4BINA 2XEIA 3FJUA 4JXQA 2OH1A 2XEJA 4B14A 2PC1A 2Z3LA 2PRQA 2ZEMA 4NGNA 3T9YA 4ZYQA 4CYPA 5KTCA 1HEEA 2C27A 1NMTA 2Q4VA 4NJRA 2ABZA 3DGVA 2EVNA 3NA6A 3SI2A 4B5OA 1DTDA 4F8ZA 5LYLA 1Q2YA 1RO5A 2C6GA 3TT2A 2IQ6A 4B11A 2Q7BA 3WT4A 4U9ZA 5DWNA 3B3SA 3GYAA 1K4JA 3BJ8A 3B8GA 2OZHA 3L2NA 4G1PA 2EK9A 4PK3A 1MJAA 3D66A 5ISVA 2Q7SA 4P4FA 4CYOA 2Z3OA 1AMPA 4P44A 4CS0B 3VARA 3LODA 1M4LA 1YK3A 3F5BA 4FUUA 3ZJ0A 2G0BA 4CAFA 2CNTA 1LAPA 3JTKA 4RN7A 5EC4A 3QNVA 1I12A 2Q44A 1CG2A 3BHXA 3RO0A 1I21A 2PJ1A 4HKFA 2Z0ZA 2YNCA 4P4EA 4NGQA 3VH9A 3R1KA 3S9LA 4NGMA 3IJ3A 4CPAA 4FBEA 4NJQA 4ZI6A 7CPAA 1MJBA 4UA3A 4ZY2A 4OADA 2Q51A 2YGWA 2Z3KA 3JUWA 4KUAA 3PB7X 4MFPA 4QB9A 3KASA 4R6TA 3S9NA 1S3ZA 1U6MA 1IYKA 3CXQA 4RS2A 3WC6A 1JWQA 1IIDA 2HQYA 4MCPA 5K8NA 2J8NA 1BPNA 1RTQA 4KOWA 5LRKA 2F5IA 4R9MA 1OZPA 4FWUA 4FD5A 4M6HA 1WK4A 3EFAA 4CAVA 4B5PA 2V8VA 1GYTA 1XF8A 2WPXA 4MJ8A 1TKFA 5F46A 2PJ7A 1EE3P 1R3NA 2BOAA 1Z8TA 4UEEA 3FRMA 3D67A 4UCNA 2RC4A 2P6FA 4A2ZA 1QQ9A 2O53A 2B5GB 3CDXA 3QB8A 5JPHA 4HNYB 3V8IA 2A4NA 1VKCA 1YGHA 1ON0A 3SXNA 4AVCA 1MJ9A
chains in the Genus database with same CATH topology
1LRZA 4C7IA 3IWGA 2B3UA 2B4DB 3BJ7A 2OZGA 4UWJA 3P2HA 3R95A 2R7HA 4A33A 4II9A 1M4IA 2HV2A 2FXFA 3DR6A 2REFA 2J8RA 3TFYA 3OWCA 4KUBA 2PQ8A 2CNMA 3G3SA 2VBQA 3JVNA 4Q36A 3W91A 4AG9A 1S7NA 2QMLA 2VEZA 4XNHB 4UBRA 1S7KA 4KOSA 3BLNA 2B58A 4JXRA 1QSOA 5AG7A 4B10A 2O28A 4KLVA 5IX3A 3C26A 4JD6A 1GHEA 2BEIA 4NXYA 1MK4A 2WPWA 3EXNA 4BMHA 4KSAA 2YNCC 2AJ6A 1S5KA 4H6ZA 5HH1A 2GIVA 3TE4A 4NF1A 2I79A 3TOBA 3I3GA 3SXOA 5KTDA 2EUIA 4U9YA 4UWIA 2CNSA 2YNDA 4L89A 1QSNA 4R3KA 4GS4A 3EC4A 1KUYA 1V0CA 3A9LA 4YGOA 3NE7A 2JLMA 3D2MA 2Z10A 4CGMA 3PZJA 4Y49B 1YX0A 3E0KA 4MY3A 4ONUA 5FVJA 5H84A 4YRHA 4AVAA 4FD4A 3EY5A 3PGPA 4QC6A 4LX9A 3WR7A 5E96A 4Q38A 4Y49C 3FYNA 4CAWA 5AG4A 4A32A 2PR1A 1PUAA 3CXPA 2DXQA 2Q4YA 3FNCA 1XMTA 4BBHA 2OU2A 2JDCA 2BUEA 5G22A 4K30A 3IU1A 4XPDC 4B13A 5BWAB 4UFXA 5HMNA 3GY9A 4KORA 4MFKA 1XEBA 4KOXA 1R57A 1NSLA 5J8CA 3D3SA 4PSXA 2ZW6A 2VI7A 3H4QA 4MY0A 4ZBGA 2B3VA 2R1IA 2Y0MA 2OB0A 4MFLA 2J8MA 1YVKA 4YFJA 4ORFA 3VWEA 5KTAA 3I9SA 4CYNA 4PV6A 3R9EA 1KZFA 2ZW4A 1XE4A 4UFVA 4B12A 2X7BA 3LD2A 5F49A 1YR0A 5H86A 5I0CA 1IICA 2WSAA 2AE6A 4H89A 5G20A 5G21A 4C2ZA 4E8OA 4C7HA 4QVTA 1N71A 2P6GA 2I00A 4ZGYB 4CRZB 1RXTA 3FIXA 2ARHA 1PU9A 1M4GA 2ZXVA 4X5KA 2Z3NA 4PSWA 3ZZIA 3FXTA 4AVBA 4R87A 5AG6A 4KLWA 3SHPA 3N7ZA 2VZZA 4KS9A 1S7FA 4A30A 2P0WA 4RI1A 1S7LA 3KKWA 5G1ZA 1Z4RA 3P2FA 3TO7A 2PSWA 1B87A 4M3SA 2PDOA 5AG5A 1Y9WA 2R8VA 3F8KA 4KSFA 2H5MA 4HNWB 3R96A 4MFQA 3CXSA 5AGEA 4B5PB 2Z3PA 3IU2A 1FY7A 2FIAA 1UFHA 2D4OA 4KVXA 3H5ZA 4E0AA 2REEA 2IL4A 2D4PA 2B4BA 3QAHA 3T90A 1P0HA 5CNPA 4NSQA 2Q0YA 4F6AA 4FD7A 1S60A 4QBJA 4U5YA 1Z9UA 3UY5A 4C68A 2K5TA 2Q04A 4KVOE 4MHDA 1I1DA 2B5GA 5JQ4A 4UCPA 4R3LA 4CAXA 3VWDA 1ZO0A 5J8FA 3R9FA 2Z11A 4UFWA 3EO4A 4XPDB 2R98A 4MBUA 2FE7A 4AG7A 2B4DA 2OZUA 1TIQA 1YVOA 2VXKA 3TCVA 1L0CA 4HNXB 1XIXA 3W6XA 4CGOA 2BSWA 3G8WA 3TTHA 4E2AA 1J4JA 3F0AA 2ZPAA 2VQYA 5DWMA 2JEVA 2PRBA 4F0XA 4QUSA 3W6SA 1VHSA 4OLLA 4CRYB 4DNCA 1P4NA 3PP9A 5F48A 3TOAA 2JDDA 1KUXA 1KUVA 2P6EA 3S6GA 2QIRA 2FSRA 4AB7A 4I49A 4PK2A 4MFJA 2CXAA 4L8AA 3FB3A 4R57A 1IB1E 2WUUA 5C82A 2DPTA 1YLEA 4A31A 1M44A 1QSRA 4IF5A 2FL4A 2ZW7A 2CY2A 4M85A 3S6KA 1WWZA 4JJXA 2QECA 3K9UA 2FIWA 1B6BA 4CGNA 5GCNA 4C2XA 4XPKA 2BL1A 4A95A 2G3TA 1QSMA 5C88A 3R9GA 1Q2DA 3TO6A 4KOUA 1CJWA 1ON0A 4JLYA 2HUZA 3FBUA 2FS5A 1IYLA 3DDDA 4OAEA 4CAEA 4KOVA 2FCKA 4CYQA 3GKRA 1BOBA 4CGPA 4NEXA 1Z4EA 3IGRA 2Z3MA 3DSBA 1YREA 1Q2CA 2G3AA 4UCMA 1M4DA 4H6UA 2VZYA 4FD6A 1NE9A 2KCWA 5A28A 4JWPA 1Y9KA 3S6HA 4EVYA 5A27A 2FT0A 5F47A 3RYOA 4J3GA 5IV0A 3DR8A 1BO4A 3MGDA 4MFZA 2DPSA 4MI4A 2YNEA 3D8PA 4XPLA 4F0YA 4NCZA 1Y7RA 3IWEA 4KOYA 4KVME 2ATRA 4IUSA 5IB0A 2PR8A 4XNHC 3S6FA 2GE3A 3TO9A 4KOTA 2ZW5A 4CGLA 1QSTA 4KZTA 4C2YA 5EBVA 2GANA 1M1DA 3D2PA 1SQHA 2NMTA 4LUAA 3DNSA 4JXQA 2OH1A 4B14A 2PC1A 2Z3LA 3T9YA 4CYPA 5KTCA 2C27A 1NMTA 2Q4VA 2EVNA 4B5OA 1Q2YA 1RO5A 3TT2A 4B11A 2Q7BA 4U9ZA 5DWNA 3GYAA 1K4JA 3BJ8A 3B8GA 2OZHA 4PK3A 1MJAA 5ISVA 4CYOA 2Z3OA 4CS0B 3LODA 1YK3A 3F5BA 3ZJ0A 4CAFA 2G0BA 2CNTA 3JTKA 5EC4A 1I12A 2Q44A 1I21A 4HKFA 2Z0ZA 2YNCA 3R1KA 1MJBA 4UA3A 4OADA 2YGWA 2Z3KA 3JUWA 4KUAA 4MFPA 4QB9A 1S3ZA 1U6MA 1IYKA 3CXQA 4RS2A 1IIDA 2HQYA 2J8NA 4KOWA 2F5IA 4R9MA 1OZPA 4FD5A 1WK4A 3EFAA 4CAVA 4B5PA 1XF8A 2WPXA 4MJ8A 5F46A 3FRMA 4UCNA 2RC4A 2P6FA 4A2ZA 2B5GB 3QB8A 5JPHA 4HNYB 3V8IA 2A4NA 1VKCA 1YGHA 1CM0A 3SXNA 4AVCA 1MJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q36 A;  4MFP A;  4MFL A;  4MFZ A;  4Q38 A;  4MFK A;  4MFJ A;  4MFQ A; 
#chains in the Genus database with same CATH topology
 1LRZ A;  4C7I A;  3PBB A;  3IWG A;  3D7H A;  3FMC A;  2B3U A;  2PIY A;  2B4D B;  3BJ7 A;  4NFR A;  2OZG A;  3KI9 A;  1A2Z A;  4UWJ A;  5BWA B;  5LRG A;  3KQX A;  2ODF A;  3P2H A;  4NGS A;  3R95 A;  4EFD A;  2R7H A;  4A33 A;  4II9 A;  1DE4 C;  4M6I A;  1JQG A;  1M4I A;  2HV2 A;  2FXF A;  3DR6 A;  2REF A;  3FF3 A;  4H2K A;  1TKH A;  4LQ6 A;  1ELM P;  3WC7 A;  2J8R A;  2EK8 A;  3TFY A;  2J9A A;  5JM6 A;  3OWC A;  2GFQ A;  3HLP A;  4KUB A;  2PQ8 A;  2POK A;  3IIB A;  2CNM A;  3B3V A;  4A38 A;  3G3S A;  2VBQ A;  3JVN A;  4Q36 A;  3W91 A;  4AG9 A;  5DS0 A;  1S7N A;  4OC1 A;  1H8L A;  2QML A;  1IGB A;  2VEZ A;  4XNH B;  5EMI A;  4UBR A;  1S7K A;  1CP6 A;  5ELY A;  4KOS A;  3PFO A;  3BLN A;  2B58 A;  1ARM A;  4JXR A;  1QSO A;  5AG7 A;  3SJX A;  4B10 A;  2O28 A;  4KLV A;  2CTC A;  5IX3 A;  3C26 A;  4JD6 A;  1GHE A;  2ZEP A;  3PB4 X;  2BEI A;  4NXY A;  4M6G A;  3D4U A;  3FX6 A;  3LWU A;  4OID A;  2QVP A;  1MK4 A;  2WPW A;  3EXN A;  1FNO A;  4BMH A;  5JGF A;  4KSA A;  2YNC C;  4DJL A;  2AJ6 A;  1CPX A;  1S5K A;  1VHE A;  4H6Z A;  5CPA A;  1LFW A;  5HH1 A;  3IC1 A;  2GIV A;  3TE4 A;  1XJO A;  1LAN A;  1Q7L A;  4NF1 A;  2I79 A;  2PJA A;  3TOB A;  1ZLH A;  3I3G A;  2NSM A;  3SXO A;  2RB7 A;  5KTD A;  3FH4 A;  2EUI A;  1Z2L A;  4U9Y A;  4UWI A;  1ZG7 A;  2CNS A;  2YND A;  4L89 A;  1QSN A;  4R3K A;  5K8O A;  4GS4 A;  4TWE A;  2PVV A;  3EC4 A;  1KUY A;  3PB6 X;  1BLL E;  1V0C A;  2PJB A;  3A9L A;  4ZX9 A;  2OR4 A;  4YGO A;  3NE7 A;  2JLM A;  1ELL P;  3D2M A;  3MRU A;  2Z10 A;  4CGM A;  3PZJ A;  4MHZ A;  4PXC A;  4Y49 B;  1YX0 A;  3E0K A;  4MY3 A;  1VIX A;  4ONU A;  2XEF A;  5FVJ A;  4Q7A A;  5H84 A;  4YRH A;  3BI1 A;  4AVA A;  4FD4 A;  3EY5 A;  3PGP A;  4QC6 A;  4LX9 A;  1CX8 A;  1XBU A;  4ZY1 A;  3NH8 A;  3PEI A;  2Q43 A;  3WR7 A;  5E96 A;  3KR5 A;  4IAV A;  4Q38 A;  4Y49 C;  3FYN A;  4CAW A;  5AG4 A;  2PIZ A;  5JH9 A;  4A32 A;  1Y0Y A;  2PR1 A;  2AFM A;  1PUA A;  3CXP A;  5CBM A;  2DXQ A;  2Q4Y A;  3FNC A;  1XMT A;  4BBH A;  2PCU A;  1KWM A;  2OU2 A;  2JDC A;  3K2K A;  4UIB A;  4O23 A;  3RBU A;  2BUE A;  5G22 A;  4K30 A;  3IU1 A;  4XPD C;  4B13 A;  3CPA A;  1AUG A;  3D68 A;  4P4J A;  2IMO A;  3GY9 A;  2C6P A;  4UFX A;  4KOR A;  4MFK A;  4FAI A;  1XEB A;  4KOX A;  3BXM A;  1R57 A;  1X10 A;  1YSJ A;  1NSL A;  5J8C A;  3D3S A;  4PSX A;  4DUK A;  1XFO A;  3KZW A;  2ZW6 A;  2VI7 A;  3H4Q A;  2V8G A;  4MY0 A;  4ZBG A;  2B3V A;  2R1I A;  2Y0M A;  2OB0 A;  3KL9 A;  4MFL A;  6CPA A;  3B3T A;  1ZG9 A;  1CP7 A;  4X3R A;  2J8M A;  1YVK A;  4YFJ A;  1YW4 A;  4ORF A;  3VWE A;  5KTA A;  3I9S A;  4CYN A;  4PV6 A;  3R9E A;  3CT9 A;  1KZF A;  2JBK A;  2ZW4 A;  1XE4 A;  2PJ8 A;  4K3N A;  5I4M A;  4UFV A;  4B12 A;  2X7B A;  4OKO A;  3LD2 A;  2O4H A;  5D8N A;  5F49 A;  5LRJ A;  4RUH A;  2OOT A;  1YR0 A;  2FVG A;  1TKJ A;  5H86 A;  4F9V A;  5I0C A;  1IIC A;  2WSA A;  2AE6 A;  2VL1 A;  4H89 A;  4OP4 A;  4P45 A;  5G20 A;  1ZG8 A;  1X12 A;  5G21 A;  4C2Z A;  4E8O A;  2GLJ A;  4C7H A;  3SI1 A;  2HB6 A;  2GU2 A;  4QVT A;  5J1Q A;  1N71 A;  2P6G A;  4W9Y A;  2I00 A;  4ZGY B;  4CRZ B;  1RXT A;  3SJE A;  1F57 A;  1Y7E A;  3NH5 A;  3FIX A;  2ARH A;  1NSA A;  1PU9 A;  1VHO A;  2WZN A;  2ZEG A;  3H8E A;  3PRT A;  5HVH A;  1M4G A;  2V8H A;  2ZXV A;  1TXR A;  4OC4 A;  4X5K A;  4R8F A;  4PXE A;  2Z3N A;  2ANP A;  3D7G A;  4PSW A;  3ZZI A;  3FXT A;  5THW A;  4R87 A;  4AVB A;  4X8I A;  3KQZ A;  2XEG A;  4IK2 A;  5AG6 A;  4KLW A;  3SHP A;  1F2O A;  2PJ0 A;  3GB0 A;  3N7Z A;  3TC8 A;  2VZZ A;  5K8P A;  4MCS A;  4KS9 A;  1S7F A;  1Y0R A;  4A30 A;  2P0W A;  4KSI A;  4RI1 A;  5IB9 A;  1S7L A;  2ZEO A;  3KHX A;  3KKW A;  2C6C A;  5G1Z A;  1Z4R A;  2EO8 A;  3P2F A;  3TO7 A;  2PSW A;  1B87 A;  1PCA A;  4M3S A;  4NGT A;  3H8F A;  4JZ0 A;  4JYW A;  2HC9 A;  2PJ2 A;  2PDO A;  5AG5 A;  3QAY A;  4WJB A;  1Y9W A;  2DF5 A;  2R8V A;  3F8K A;  2GLF A;  2BO9 A;  2EWB A;  4KSF A;  2H5M A;  4HNW B;  3R96 A;  5HVG A;  4MFQ A;  2CTB A;  3CXS A;  2BCO A;  3NH4 A;  3ISZ A;  4R76 A;  1BPM A;  3LMS A;  5AGE A;  4B5P B;  2Z3P A;  2I3C A;  3I1U A;  3IU2 A;  4OC3 A;  1FY7 A;  3LAC A;  2FIA A;  1UFH A;  3GUX A;  1Z8L A;  2V8D A;  2D4O A;  4KVX A;  5F09 A;  3GLJ A;  3D7F A;  3H5Z A;  3NE8 A;  4P4I A;  4E0A A;  1XOV A;  2REE A;  3PBE A;  4P6Y A;  2IL4 A;  2D4P A;  4ZY0 A;  3PB9 X;  2B4B A;  3FEC A;  2F8H A;  3QAH A;  2ZEL A;  3T90 A;  1CM0 A;  1P0H A;  1PYT B;  5CNP A;  3B35 A;  4NSQ A;  2Q0Y A;  4UEF A;  4F6A A;  4FD7 A;  3V38 A;  4HPS A;  2GRE A;  1S60 A;  4MXU A;  4U5Y A;  1Z9U A;  4QBJ A;  3SJF A;  3UY5 A;  4A94 A;  4MHN A;  3TX8 A;  2K5T A;  4C68 A;  2Q04 A;  4KVO E;  2IJZ A;  4MHD A;  3VAT A;  4R7M A;  1I1D A;  2B5G A;  3K9T A;  5JQ4 A;  4MRI A;  4R3L A;  4UCP A;  5LYI A;  2NYQ A;  3VWD A;  4CAX A;  4ONW A;  4F9U A;  1ZO0 A;  5J8F A;  1Z5R A;  3R9F A;  2Z11 A;  4UFW A;  3EO4 A;  2G9D A;  2RFH A;  4XPD B;  2R98 A;  4MBU A;  1UWY A;  4OC0 A;  2ZOG A;  2FE7 A;  2QYV A;  4AG7 A;  2B4D A;  3IWW A;  2OZU A;  1TIQ A;  1YVO A;  2VXK A;  1YME A;  2PE3 A;  3IFE A;  1L0C A;  3TCV A;  4X2T A;  4HNX B;  1XIX A;  8CPA A;  2JEW A;  3W6X A;  3B3C A;  4CGO A;  2BSW A;  3G8W A;  3T8W A;  3TTH A;  2AFU A;  2CIJ A;  4E2A A;  1J4J A;  3F0A A;  1Z8X A;  2ZPA A;  4P4B A;  2VQY A;  4NGR A;  5DWM A;  2JEV A;  3SJG A;  2PJ9 A;  2PRB A;  4F0X A;  3KR4 A;  5HVF A;  4QUS A;  4MCQ A;  1LOK A;  3W6S A;  1VHS A;  4OLL A;  4UF4 A;  5HXD A;  1XMB A;  4P10 A;  4CRY B;  3CZX A;  1YW6 A;  2PJC A;  4A39 A;  2JBJ A;  1Z8W A;  4DNC A;  1P4N A;  3PP9 A;  5F48 A;  1AYE A;  3TOA A;  2JDD A;  3WC5 A;  4UEZ A;  1KUX A;  4YWY A;  3WAB A;  1KUV A;  2P6E A;  1TF9 A;  3CPX A;  2AFO A;  2PVW A;  3B3W A;  3S6G A;  2QIR A;  2FSR A;  3NFZ A;  4AB7 A;  4YU9 A;  4I49 A;  4PK2 A;  4MFJ A;  2CXA A;  4L8A A;  2DEA A;  3FB3 A;  3FVL A;  4TNU A;  1CBX A;  4R57 A;  4P4D A;  3S9M A;  2AFX A;  3D7D A;  1IB1 E;  2WUU A;  2AFS A;  2DPT A;  5C82 A;  1YLE A;  4A31 A;  1M44 A;  1QSR A;  4IF5 A;  2FL4 A;  2ZW7 A;  4OC2 A;  4WWV A;  2CY2 A;  3SI0 A;  4M85 A;  4MCR A;  3S6K A;  4PPZ A;  2C1C A;  1WWZ A;  2QJ8 A;  4JJX A;  2QEC A;  3K9U A;  2FIW A;  1B6B A;  4PXD A;  4IHM A;  1F2P A;  5LYD A;  1R43 A;  4CGN A;  1HDQ A;  5GCN A;  4C2X A;  4GXH A;  3RAM A;  3JRU A;  1HDU A;  3DLJ A;  4XPK A;  5K8M A;  1IOF A;  2BL1 A;  3IEH A;  3HUV A;  4A95 A;  2CF4 A;  4B6Z A;  2G3T A;  1CPS A;  5D29 A;  1QSM A;  5C88 A;  3PB8 X;  3R9G A;  3PFE A;  1Q2D A;  3TO6 A;  4LQG A;  3KGQ A;  2PJ4 A;  4KOU A;  1VGY A;  2ZEH A;  4ZX8 A;  3RNZ A;  1CJW A;  4BD9 A;  1LAM A;  3H8G A;  4EME A;  4JLY A;  2HUZ A;  3FBU A;  2FS5 A;  1IYL A;  3DDD A;  4OAE A;  4CAE A;  3N5F A;  4KOV A;  2FCK A;  1FT7 A;  4PQA A;  2PJ3 A;  4CYQ A;  4MHP A;  3GKR A;  1BOB A;  4CGP A;  4NEX A;  1Z4E A;  3IGR A;  2Z3M A;  3DSB A;  4OC5 A;  1IU8 A;  1YRE A;  1XRY A;  1Q2C A;  2AFW A;  2G3A A;  4UCM A;  4Z65 A;  1M4D A;  4H6U A;  2VZY A;  4FD6 A;  3B2Y A;  2F7V A;  1NE9 A;  3FED A;  2KCW A;  5LYF A;  5A28 A;  4JWP A;  4NGP A;  1Y9K A;  1OBR A;  4MMO A;  4OIW A;  2PJ6 A;  4MHY A;  3S6H A;  2FT0 A;  5F47 A;  4EVY A;  5A27 A;  3RYO A;  4A37 A;  4J3G A;  5IV0 A;  1BAV A;  1BO4 A;  1IY7 A;  3DR8 A;  2V77 A;  3ISX A;  2DPS A;  3MGD A;  3BI0 A;  4MFZ A;  4MI4 A;  2YNE A;  3D8P A;  4PXB A;  1IOI A;  5HMN A;  4XPL A;  4F0Y A;  4NCZ A;  1Y7R A;  3GIU A;  3IWE A;  1QMU A;  4GM5 A;  4KOY A;  1YQE A;  4KVM E;  2WYR A;  2ATR A;  3B7I A;  3RZA A;  4IUS A;  5IB0 A;  2PR8 A;  4XNH C;  3S6F A;  2GE3 A;  3TO9 A;  4KOT A;  2ZW5 A;  3V7Z A;  4CGL A;  1QST A;  1TF8 A;  2Q4Z A;  2ZEN A;  2AFZ A;  1LCP A;  2ZOF A;  3IO1 A;  4KZT A;  1YLO A;  4C2Y A;  3KHZ A;  5EBV A;  2EBJ A;  2GAN A;  2ZEE A;  3MN8 A;  4EWT A;  2ZEF A;  2PJ5 A;  1ARL A;  1M1D A;  4UIA A;  3D2P A;  1SQH A;  4DYO A;  4AXV A;  2NMT A;  3FEE A;  2ZED A;  4LUA A;  3DNS A;  1ZLI A;  4OME A;  4BIN A;  2XEI A;  3FJU A;  4JXQ A;  2OH1 A;  2XEJ A;  4B14 A;  2PC1 A;  2Z3L A;  2PRQ A;  2ZEM A;  4NGN A;  3T9Y A;  4ZYQ A;  4CYP A;  5KTC A;  1HEE A;  2C27 A;  1NMT A;  2Q4V A;  4NJR A;  2ABZ A;  3DGV A;  2EVN A;  3NA6 A;  3SI2 A;  4B5O A;  1DTD A;  4F8Z A;  5LYL A;  1Q2Y A;  1RO5 A;  2C6G A;  3TT2 A;  2IQ6 A;  4B11 A;  2Q7B A;  3WT4 A;  4U9Z A;  5DWN A;  3B3S A;  3GYA A;  1K4J A;  3BJ8 A;  3B8G A;  2OZH A;  3L2N A;  4G1P A;  2EK9 A;  4PK3 A;  1MJA A;  3D66 A;  5ISV A;  2Q7S A;  4P4F A;  4CYO A;  2Z3O A;  1AMP A;  4P44 A;  4CS0 B;  3VAR A;  3LOD A;  1M4L A;  1YK3 A;  3F5B A;  4FUU A;  3ZJ0 A;  2G0B A;  4CAF A;  2CNT A;  1LAP A;  3JTK A;  4RN7 A;  5EC4 A;  3QNV A;  1I12 A;  2Q44 A;  1CG2 A;  3BHX A;  3RO0 A;  1I21 A;  2PJ1 A;  4HKF A;  2Z0Z A;  2YNC A;  4P4E A;  4NGQ A;  3VH9 A;  3R1K A;  3S9L A;  4NGM A;  3IJ3 A;  4CPA A;  4FBE A;  4NJQ A;  4ZI6 A;  7CPA A;  1MJB A;  4UA3 A;  4ZY2 A;  4OAD A;  2Q51 A;  2YGW A;  2Z3K A;  3JUW A;  4KUA A;  3PB7 X;  4MFP A;  4QB9 A;  3KAS A;  4R6T A;  3S9N A;  1S3Z A;  1U6M A;  1IYK A;  3CXQ A;  4RS2 A;  3WC6 A;  1JWQ A;  1IID A;  2HQY A;  4MCP A;  5K8N A;  2J8N A;  1BPN A;  1RTQ A;  4KOW A;  5LRK A;  2F5I A;  4R9M A;  1OZP A;  4FWU A;  4FD5 A;  4M6H A;  1WK4 A;  3EFA A;  4CAV A;  4B5P A;  2V8V A;  1GYT A;  1XF8 A;  2WPX A;  4MJ8 A;  1TKF A;  5F46 A;  2PJ7 A;  1EE3 P;  1R3N A;  2BOA A;  1Z8T A;  4UEE A;  3FRM A;  3D67 A;  4UCN A;  2RC4 A;  2P6F A;  4A2Z A;  1QQ9 A;  2O53 A;  2B5G B;  3CDX A;  3QB8 A;  5JPH A;  4HNY B;  3V8I A;  2A4N A;  1VKC A;  1YGH A;  1ON0 A;  3SXN A;  4AVC A;  1MJ9 A; 
#chains in the Genus database with same CATH homology
 1LRZ A;  4C7I A;  3IWG A;  2B3U A;  2B4D B;  3BJ7 A;  2OZG A;  4UWJ A;  3P2H A;  3R95 A;  2R7H A;  4A33 A;  4II9 A;  1M4I A;  2HV2 A;  2FXF A;  3DR6 A;  2REF A;  2J8R A;  3TFY A;  3OWC A;  4KUB A;  2PQ8 A;  2CNM A;  3G3S A;  2VBQ A;  3JVN A;  4Q36 A;  3W91 A;  4AG9 A;  1S7N A;  2QML A;  2VEZ A;  4XNH B;  4UBR A;  1S7K A;  4KOS A;  3BLN A;  2B58 A;  4JXR A;  1QSO A;  5AG7 A;  4B10 A;  2O28 A;  4KLV A;  5IX3 A;  3C26 A;  4JD6 A;  1GHE A;  2BEI A;  4NXY A;  1MK4 A;  2WPW A;  3EXN A;  4BMH A;  4KSA A;  2YNC C;  2AJ6 A;  1S5K A;  4H6Z A;  5HH1 A;  2GIV A;  3TE4 A;  4NF1 A;  2I79 A;  3TOB A;  3I3G A;  3SXO A;  5KTD A;  2EUI A;  4U9Y A;  4UWI A;  2CNS A;  2YND A;  4L89 A;  1QSN A;  4R3K A;  4GS4 A;  3EC4 A;  1KUY A;  1V0C A;  3A9L A;  4YGO A;  3NE7 A;  2JLM A;  3D2M A;  2Z10 A;  4CGM A;  3PZJ A;  4Y49 B;  1YX0 A;  3E0K A;  4MY3 A;  4ONU A;  5FVJ A;  5H84 A;  4YRH A;  4AVA A;  4FD4 A;  3EY5 A;  3PGP A;  4QC6 A;  4LX9 A;  3WR7 A;  5E96 A;  4Q38 A;  4Y49 C;  3FYN A;  4CAW A;  5AG4 A;  4A32 A;  2PR1 A;  1PUA A;  3CXP A;  2DXQ A;  2Q4Y A;  3FNC A;  1XMT A;  4BBH A;  2OU2 A;  2JDC A;  2BUE A;  5G22 A;  4K30 A;  3IU1 A;  4XPD C;  4B13 A;  5BWA B;  4UFX A;  5HMN A;  3GY9 A;  4KOR A;  4MFK A;  1XEB A;  4KOX A;  1R57 A;  1NSL A;  5J8C A;  3D3S A;  4PSX A;  2ZW6 A;  2VI7 A;  3H4Q A;  4MY0 A;  4ZBG A;  2B3V A;  2R1I A;  2Y0M A;  2OB0 A;  4MFL A;  2J8M A;  1YVK A;  4YFJ A;  4ORF A;  3VWE A;  5KTA A;  3I9S A;  4CYN A;  4PV6 A;  3R9E A;  1KZF A;  2ZW4 A;  1XE4 A;  4UFV A;  4B12 A;  2X7B A;  3LD2 A;  5F49 A;  1YR0 A;  5H86 A;  5I0C A;  1IIC A;  2WSA A;  2AE6 A;  4H89 A;  5G20 A;  5G21 A;  4C2Z A;  4E8O A;  4C7H A;  4QVT A;  1N71 A;  2P6G A;  2I00 A;  4ZGY B;  4CRZ B;  1RXT A;  3FIX A;  2ARH A;  1PU9 A;  1M4G A;  2ZXV A;  4X5K A;  2Z3N A;  4PSW A;  3ZZI A;  3FXT A;  4AVB A;  4R87 A;  5AG6 A;  4KLW A;  3SHP A;  3N7Z A;  2VZZ A;  4KS9 A;  1S7F A;  4A30 A;  2P0W A;  4RI1 A;  1S7L A;  3KKW A;  5G1Z A;  1Z4R A;  3P2F A;  3TO7 A;  2PSW A;  1B87 A;  4M3S A;  2PDO A;  5AG5 A;  1Y9W A;  2R8V A;  3F8K A;  4KSF A;  2H5M A;  4HNW B;  3R96 A;  4MFQ A;  3CXS A;  5AGE A;  4B5P B;  2Z3P A;  3IU2 A;  1FY7 A;  2FIA A;  1UFH A;  2D4O A;  4KVX A;  3H5Z A;  4E0A A;  2REE A;  2IL4 A;  2D4P A;  2B4B A;  3QAH A;  3T90 A;  1P0H A;  5CNP A;  4NSQ A;  2Q0Y A;  4F6A A;  4FD7 A;  1S60 A;  4QBJ A;  4U5Y A;  1Z9U A;  3UY5 A;  4C68 A;  2K5T A;  2Q04 A;  4KVO E;  4MHD A;  1I1D A;  2B5G A;  5JQ4 A;  4UCP A;  4R3L A;  4CAX A;  3VWD A;  1ZO0 A;  5J8F A;  3R9F A;  2Z11 A;  4UFW A;  3EO4 A;  4XPD B;  2R98 A;  4MBU A;  2FE7 A;  4AG7 A;  2B4D A;  2OZU A;  1TIQ A;  1YVO A;  2VXK A;  3TCV A;  1L0C A;  4HNX B;  1XIX A;  3W6X A;  4CGO A;  2BSW A;  3G8W A;  3TTH A;  4E2A A;  1J4J A;  3F0A A;  2ZPA A;  2VQY A;  5DWM A;  2JEV A;  2PRB A;  4F0X A;  4QUS A;  3W6S A;  1VHS A;  4OLL A;  4CRY B;  4DNC A;  1P4N A;  3PP9 A;  5F48 A;  3TOA A;  2JDD A;  1KUX A;  1KUV A;  2P6E A;  3S6G A;  2QIR A;  2FSR A;  4AB7 A;  4I49 A;  4PK2 A;  4MFJ A;  2CXA A;  4L8A A;  3FB3 A;  4R57 A;  1IB1 E;  2WUU A;  5C82 A;  2DPT A;  1YLE A;  4A31 A;  1M44 A;  1QSR A;  4IF5 A;  2FL4 A;  2ZW7 A;  2CY2 A;  4M85 A;  3S6K A;  1WWZ A;  4JJX A;  2QEC A;  3K9U A;  2FIW A;  1B6B A;  4CGN A;  5GCN A;  4C2X A;  4XPK A;  2BL1 A;  4A95 A;  2G3T A;  1QSM A;  5C88 A;  3R9G A;  1Q2D A;  3TO6 A;  4KOU A;  1CJW A;  1ON0 A;  4JLY A;  2HUZ A;  3FBU A;  2FS5 A;  1IYL A;  3DDD A;  4OAE A;  4CAE A;  4KOV A;  2FCK A;  4CYQ A;  3GKR A;  1BOB A;  4CGP A;  4NEX A;  1Z4E A;  3IGR A;  2Z3M A;  3DSB A;  1YRE A;  1Q2C A;  2G3A A;  4UCM A;  1M4D A;  4H6U A;  2VZY A;  4FD6 A;  1NE9 A;  2KCW A;  5A28 A;  4JWP A;  1Y9K A;  3S6H A;  4EVY A;  5A27 A;  2FT0 A;  5F47 A;  3RYO A;  4J3G A;  5IV0 A;  3DR8 A;  1BO4 A;  3MGD A;  4MFZ A;  2DPS A;  4MI4 A;  2YNE A;  3D8P A;  4XPL A;  4F0Y A;  4NCZ A;  1Y7R A;  3IWE A;  4KOY A;  4KVM E;  2ATR A;  4IUS A;  5IB0 A;  2PR8 A;  4XNH C;  3S6F A;  2GE3 A;  3TO9 A;  4KOT A;  2ZW5 A;  4CGL A;  1QST A;  4KZT A;  4C2Y A;  5EBV A;  2GAN A;  1M1D A;  3D2P A;  1SQH A;  2NMT A;  4LUA A;  3DNS A;  4JXQ A;  2OH1 A;  4B14 A;  2PC1 A;  2Z3L A;  3T9Y A;  4CYP A;  5KTC A;  2C27 A;  1NMT A;  2Q4V A;  2EVN A;  4B5O A;  1Q2Y A;  1RO5 A;  3TT2 A;  4B11 A;  2Q7B A;  4U9Z A;  5DWN A;  3GYA A;  1K4J A;  3BJ8 A;  3B8G A;  2OZH A;  4PK3 A;  1MJA A;  5ISV A;  4CYO A;  2Z3O A;  4CS0 B;  3LOD A;  1YK3 A;  3F5B A;  3ZJ0 A;  4CAF A;  2G0B A;  2CNT A;  3JTK A;  5EC4 A;  1I12 A;  2Q44 A;  1I21 A;  4HKF A;  2Z0Z A;  2YNC A;  3R1K A;  1MJB A;  4UA3 A;  4OAD A;  2YGW A;  2Z3K A;  3JUW A;  4KUA A;  4MFP A;  4QB9 A;  1S3Z A;  1U6M A;  1IYK A;  3CXQ A;  4RS2 A;  1IID A;  2HQY A;  2J8N A;  4KOW A;  2F5I A;  4R9M A;  1OZP A;  4FD5 A;  1WK4 A;  3EFA A;  4CAV A;  4B5P A;  1XF8 A;  2WPX A;  4MJ8 A;  5F46 A;  3FRM A;  4UCN A;  2RC4 A;  2P6F A;  4A2Z A;  2B5G B;  3QB8 A;  5JPH A;  4HNY B;  3V8I A;  2A4N A;  1VKC A;  1YGH A;  1CM0 A;  3SXN A;  4AVC A;  1MJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...