4MFLA

The crystal structure of acyltransferase in complex with decanoyl-coa and tei pseudoaglycone
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
323
structure length
323
Chain Sequence
MDPETVRIALGLEERTAAWLTELDELGPPAEPVRLPRGEEARDLLRRLEVPELDAEEIVAAAPDPDRDPALWWLLERTHHAIVRHMGDHRAKPRGGPPLPYEGGAAARYFHVYVFLATVPAVRRFHAERGIPDEVGWETLTQLGELVAIHRRKYGQGGMNMQWWTTYHLRGILYRLGRLQFSLATGKDGTPHLGLAVPEWGGPLLPKAYDESLHRARPFFDRHFPEHGARVAWGSSWMLDPQLEEYLTEDSNIIQLARFWTLTDSAPEPGNADGDSSILEFVFRYNGQPLDELPQRSSLERAVIAHLKAGRHWHMRTGFVKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Transferase/antibiotic
molecule keywords Putative uncharacterized protein tcp24
total genus 108
structure length 323
sequence length 323
ec nomenclature ec 2.3.1.-:
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18082 DUF5596 Domain of unknown function (DUF5596)
A PF18164 GNAT_C GNAT-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.120 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mflA02
4MFKA 4MFJA 4MFQA 4Q38A 4Q36A 4MFLA 4MFZA 4MFPA
chains in the Genus database with same CATH superfamily
1BPNA 4B14A 1WK4A 4P4DA 1QSMA 4KSAA 3CXSA 4L8AA 4KOYA 5HH1A 4PK3A 5IV0A 5JPHA 4XNHC 1XMBA 4DNCA 2ODFA 2VEZA 2BOAA 2PJ8A 4OIWA 1KWMA 2JDDA 1ZG7A 3CZXA 2C1CA 3BLNA 2P0WA 2AFSA 4P10A 1YVKA 2KCWA 2Z3KA 2CNTA 3I1UA 3KHZA 2OZGA 4IK2A 3MRUA 3S9NA 4A39A 4B6ZA 2ATRA 2IMOA 3BXMA 3LMSA 5JM6A 4B5PB 5THWA 3C26A 4OIDA 3WT4A 7CPAA 4M6HA 2PC1A 4JZ0A 4CYNA 2A4NA 5G22A 1L0CA 2Z3PA 3JVNA 3H5ZA 4KUBA 2C6GA 2REFA 3R9EA 1PUAA 4KOUA 5KTAA 4KSIA 4NGNA 5LYFA 2JDCA 2FSRA 3B3WA 1TKFA 1QSTA 2DEAA 2ZXVA 3B3CA 4IAVA 3TOBA 1Y7RA 1CBXA 4B5PA 1CM0A 5IB0A 4IHMA 3OWCA 1AMPA 4UIBA 3EC4A 4AVCA 4P4BA 5F46A 2GLFA 2B58A 3FBUA 4A2ZA 1LRZA 3FEEA 2C6PA 3IU1A 2ZEDA 3T9YA 2G9DA 3L2NA 3S9MA 2R1IA 4FUUA 5LYIA 4CAFA 2G3AA 3KGQA 4JYWA 2WZNA 2PQ8A 2QMLA 1IGBA 2XEJA 3IJ3A 3KL9A 2ZEHA 4MCPA 3JRUA 1VHSA 4Y49C 1Z8XA 3RO0A 2Z10A 4ZX8A 3TC8A 1DE4C 4C7HA 2Q7SA 1KUVA 2WYRA 2X7BA 3IFEA 1RTQA 2JLMA 4MY3A 2FIWA 4PQAA 5EMIA 3NA6A 3D67A 3R95A 4AG9A 3TE4A 1YW4A 2WPWA 1TIQA 2V8DA 3PB9X 4A31A 4ORFA 2OR4A 3DNSA 4QC6A 3V38A 4NFRA 3VH9A 4KVOE 5LRGA 1OBRA 4OC5A 3N7ZA 3R1KA 1YK3A 4R3KA 4F0XA 1XIXA 1LAMA 2C27A 4R9MA 2EO8A 4XPDB 3WR7A 4A94A 5K8MA 2PDOA 4MFKA 2Q4YA 2YGWA 4NGSA 4XPLA 2JBJA 3SJGA 1AYEA 3SI0A 4P4FA 2CF4A 1IICA 3KHXA 3SHPA 6CPAA 1DTDA 5LYDA 4FWUA 1TKHA 2AFUA 1BO4A 4OKOA 2VZZA 3I9SA 4CGNA 5AG4A 3S6HA 3IWGA 2EUIA 4A38A 4F0YA 2PCUA 2J8RA 3D7DA 3TO6A 2F7VA 4B10A 1YX0A 5HVHA 1LANA 2GFQA 4YFJA 1S7LA 3D66A 1ZO0A 1VHOA 5K8OA 1YQEA 2PVVA 2I00A 1PU9A 1B87A 1SQHA 2OU2A 4JWPA 4A33A 3H8EA 2B3UA 3GB0A 5DS0A 4LQ6A 4C2XA 2GANA 4YGOA 4AG7A 2BO9A 4GS4A 1TKJA 2ZOGA 3DGVA 2FVGA 2FE7A 4NSQA 2AJ6A 2Z0ZA 4EVYA 1ELMP 4KOWA 5J1QA 3CT9A 4Q36A 1Z9UA 4Z65A 2OH1A 4HNYB 2ARHA 2ZENA 5H86A 2EK9A 2JBKA 2PIYA 2D4OA 4B11A 3LWUA 2REEA 1Z8TA 3BHXA 2ZW4A 1FY7A 1M4GA 2Q7BA 2WPXA 3KZWA 3DSBA 4DUKA 1R43A 1I21A 2BCOA 4C68A 1ARMA 1Z4EA 3TO9A 2PSWA 3PFOA 1B6BA 5F09A 4CS0B 2GU2A 5F48A 1QSOA 4PSXA 1I1DA 2J9AA 4OAEA 4MHZA 4CAEA 1NE9A 3T8WA 1M4LA 4JD6A 1YR0A 2EWBA 4RS2A 3PBEA 4KUAA 5DWMA 3DLJA 5AG5A 1PYTB 2QECA 4UA3A 2FCKA 1P0HA 3S6FA 2B3VA 4PXDA 2PJ6A 1Y9KA 2Q4ZA 1IY7A 2Z3OA 4ZX9A 4QB9A 3WC7A 2P6EA 2OOTA 4MHDA 4BBHA 4CGLA 1VHEA 3H8FA 4NGPA 4U5YA 4CYOA 2ZEOA 1YREA 1U6MA 1RO5A 2IJZA 2Z3NA 3D2MA 3SI1A 4G1PA 2B5GB 2PJ4A 3R96A 3IWWA 5C82A 3D4UA 3TCVA 4LQGA 1NMTA 5I0CA 4GXHA 5K8NA 4F9UA 4UBRA 3W6XA 5J8CA 1TXRA 4A32A 3EFAA 5H84A 2HB6A 2F5IA 4KLVA 2BEIA 4Q38A 4MXUA 2BUEA 2ZW5A 3IC1A 2Q44A 1M4IA 3PB4X 4PXBA 1IIDA 5LYLA 3PP9A 4OLLA 2PR1A 3CDXA 2EVNA 3FH4A 3PB6X 4MFQA 4XPDC 2PR8A 1BAVA 2R8VA 3KQZA 4OC2A 2OZHA 4BMHA 5HVGA 3TX8A 2XEGA 1MJBA 1X10A 4P4JA 2VL1A 4KOTA 3N5FA 3RAMA 4B12A 3BJ7A 2AFXA 3RNZA 4ZY1A 5JGFA 3E0KA 5F47A 1Z8WA 4KORA 4OC3A 2AFWA 4B13A 1F2PA 2ZOFA 4TWEA 4WWVA 4RI1A 3BI0A 2ZEMA 2RB7A 2B4DA 3FF3A 4YRHA 2OZUA 1ZG8A 1IB1E 5KTCA 1CX8A 4PXEA 2IQ6A 2DPSA 3F0AA 2WSAA 2ABZA 3VWDA 2VI7A 3ZZIA 1QMUA 4NXYA 2PE3A 4LX9A 2K5TA 3PRTA 3TTHA 4KVXA 4R6TA 3IO1A 4B5OA 2FIAA 2PRBA 3QB8A 1YSJA 3DR6A 1YLOA 1S3ZA 2R98A 5HVFA 4AVAA 4H2KA 5LRJA 5JQ4A 2ZPAA 5A28A 3EY5A 4R7MA 4P44A 3KQXA 3NE8A 1YMEA 3KR4A 2RC4A 2DXQA 4KSFA 3D7GA 1FNOA 2AFZA 3QAHA 4U9ZA 4X3RA 5JH9A 1WWZA 3PB7X 4PSWA 2CXAA 2RFHA 3JUWA 4KS9A 4CYQA 3B35A 3QAYA 2V8HA 4CAVA 4QUSA 3SXNA 3TOAA 2ZEEA 4P45A 1BPMA 2B4BA 4OP4A 4II9A 1YW6A 3D3SA 4NGRA 4NJRA 1ELLP 4M6GA 2GREA 5GCNA 1VKCA 2ZEGA 4M6IA 3ZJ0A 4E0AA 4UFWA 4R8FA 3P2FA 2VBQA 2XEFA 4AXVA 1IYKA 4UEZA 2G3TA 4OC1A 2NSMA 3RYOA 3GUXA 2Q43A 2ANPA 3FNCA 1Z4RA 4K30A 2CY2A 1QSRA 4KOSA 1ZLIA 2DPTA 2CTCA 3CXPA 4MFZA 2HV2A 1EE3P 4ZBGA 2Q4VA 4R76A 3WABA 1CG2A 3PZJA 4FBEA 4PK2A 1YGHA 2JEWA 1S60A 4UFVA 2R7HA 3FVLA 4C2ZA 1LCPA 4CRZB 4J3GA 3NH8A 3W91A 5E96A 4O23A 3FX6A 3PEIA 5EBVA 1VIXA 1F57A 2PIZA 2PJ3A 3D7HA 4UCNA 4YU9A 4E8OA 1QQ9A 5CBMA 1F2OA 1LAPA 4FD7A 2D4PA 2HUZA 4W9YA 5A27A 5G1ZA 2BSWA 1GHEA 4MHNA 4BINA 3SJEA 3BI1A 1CPXA 3ISXA 4JXRA 4OC0A 2PJ2A 4TNUA 4P4IA 1X12A 4HPSA 4L89A 4AB7A 3LACA 5EC4A 4EFDA 3FXTA 2HQYA 1R3NA 2Y0MA 4CAWA 4CPAA 2C6CA 4R57A 4CAXA 3KASA 2GIVA 2WUUA 2ZEPA 2PJ9A 5CNPA 1PCAA 5LRKA 5FVJA 4OMEA 2XEIA 4NCZA 3D2PA 3DR8A 3IIBA 1IOIA 4FD4A 3IU2A 4JLYA 3IEHA 1XMTA 2FS5A 4NGMA 3FYNA 4X5KA 2Z11A 4MRIA 4RUHA 4MCQA 4ZI6A 3F5BA 4H6UA 3R9FA 4CGPA 1K4JA 3TO7A 1HDQA 1CPSA 1V0CA 3TFYA 5D29A 2EBJA 2CNMA 2F8HA 1P4NA 3GYAA 4ONUA 4U9YA 3NE7A 2VQYA 2AE6A 2P6FA 5CPAA 2O4HA 4X8IA 3RZAA 3FJUA 4BD9A 2ZEFA 4RN7A 1Z5RA 4MFJA 1UFHA 3FB3A 4CRYB 4DYOA 1CJWA 4M3SA 3WC6A 3BJ8A 3ISZA 3HUVA 4LUAA 2G0BA 2YNCC 1TF8A 1LFWA 1QSNA 2V8GA 2O53A 4JXQA 1OZPA 5KTDA 1HEEA 4NEXA 3LD2A 2AFMA 1Y7EA 4NJQA 4OC4A 3I3GA 2QJ8A 4UCMA 4X2TA 1MJ9A 3FMCA 3KI9A 4K3NA 4KOVA 4MMOA 3W6SA 2HC9A 5AG6A 1GYTA 2AFOA 4HNWB 1H8LA 2FXFA 3B8GA 3WC5A 1KUYA 2BL1A 1ARLA 2Q04A 1IU8A 4UIAA 3D7FA 1HDUA 3HLPA 4UFXA 4WJBA 4F9VA 4C7IA 1Y0YA 1VGYA 4F6AA 4KVME 4HKFA 2PJAA 2QIRA 3UY5A 1XBUA 1Y9WA 3B2YA 1M4DA 2Z3MA 3B3TA 4CGMA 3SXOA 2CTBA 1S7FA 1Y0RA 3FRMA 4IF5A 4UWJA 5ELYA 4CGOA 3B3VA 3EXNA 2O28A 4UF4A 4EMEA 2OB0A 2J8NA 4XNHB 5HXDA 3KR5A 4NGTA 1TF9A 2QVPA 4AVBA 2I3CA 4MBUA 1AUGA 4IUSA 4MHYA 4Y49B 8CPAA 4ZY0A 2PJ0A 2ZW6A 3PGPA 1YVOA 2YNCA 1XJOA 3IGRA 1FT7A 3VARA 4ONWA 4UWIA 4H6ZA 4UEEA 4DJLA 1KUXA 1YLEA 1IYLA 3GLJA 4M85A 3RBUA 2PRQA 3B7IA 4A37A 4MI4A 2I79A 5I4MA 5C88A 5AG7A 3R9GA 3S6KA 5D8NA 5IB9A 1Q2CA 2V8VA 2YNDA 4P6YA 1M1DA 1NSLA 4MCRA 2PJ1A 4UCPA 1IOFA 5HMNA 1LOKA 1RXTA 2VXKA 1XEBA 5BWAB 3K9UA 4C2YA 4CYPA 3SJXA 3MGDA 1XF8A 4KZTA 4A30A 3FEDA 4KLWA 1XRYA 4A95A 3H4QA 2PVWA 2Q51A 4MFPA 2NMTA 2ZELA 3V8IA 4MJ8A 5K8PA 2GE3A 1BOBA 4KOXA 2J8MA 4MHPA 1UWYA 4H89A 3MN8A 4JJXA 2H5MA 3NH5A 1N71A 1XOVA 2PJ5A 4FD6A 2PJ7A 2ZW7A 3D68A 5G20A 2POKA 4FAIA 3NH4A 1MK4A 1M44A 4ZGYB 1Z2LA 2NYQA 4FD5A 4PPZA 3V7ZA 3GY9A 4ZY2A 5IX3A 1J4JA 4EWTA 4PV6A 3CPAA 2JEVA 3JTKA 3NFZA 3S9LA 3QNVA 4GM5A 4R87A 3CXQA 3K2KA 3T90A 2IL4A 4R3LA 1I12A 1CP7A 3VWEA 1S7KA 5G21A 4QVTA 1CP6A 3S6GA 2B4DB 2FT0A 2QYVA 3TT2A 4MCSA 4PXCA 2FL4A 3VATA 2VZYA 3D8PA 4UEFA 4XPKA 1Q2YA 3G3SA 3SJFA 5ISVA 4I49A 4F8ZA 3P2HA 1ON0A 2YNEA 2Z3LA 1Q2DA 1JQGA 3IWEA 3DDDA 4MY0A 1MJAA 2PJCA 3FECA 3CPXA 3G8WA 4QBJA 3GKRA 2DF5A 1S7NA 3A9LA 4E2AA 3GIUA 4NGQA 3EO4A 5AGEA 1XE4A 3PFEA 1XFOA 2EK8A 1R57A 1ZLHA 5J8FA 1ZG9A 2GLJA 2CNSA 3KKWA 5DWNA 4P4EA 2Q0YA 3K9TA 1JWQA 4MFLA 1A2ZA 3B3SA 2CIJA 3H8GA 1KZFA 1BLLE 1Q7LA 1Z8LA 4NF1A 5F49A 4OADA 3SI2A 4ZYQA 2P6GA 4Q7AA 3LODA 4YWYA 2B5GA 3F8KA 2V77A 3PB8X 3PBBA 1NSAA 1S5KA 2PJBA 3FIXA 4HNXB
chains in the Genus database with same CATH topology
4B14A 1WK4A 5HH1A 1QSMA 4KSAA 3CXSA 4L8AA 4KOYA 5IV0A 4PK3A 5JPHA 4XNHC 4DNCA 2VEZA 2JDDA 3BLNA 2P0WA 1YVKA 2KCWA 2Z3KA 2CNTA 2OZGA 2ATRA 4B5PB 3C26A 2PC1A 4CYNA 2A4NA 5G22A 1L0CA 2Z3PA 3JVNA 3H5ZA 4KUBA 5KTAA 2REFA 3R9EA 1PUAA 4KOUA 2JDCA 2FSRA 1QSTA 2ZXVA 3TOBA 5IB0A 4B5PA 1Y7RA 1CM0A 3OWCA 3EC4A 4AVCA 5F46A 2B58A 3FBUA 4A2ZA 1LRZA 3IU1A 3T9YA 2R1IA 4CAFA 2G3AA 2PQ8A 2QMLA 1VHSA 4Y49C 2Z10A 4C7HA 1KUVA 2X7BA 2JLMA 4MY3A 2FIWA 3R95A 3TE4A 4AG9A 2WPWA 1TIQA 4A31A 4ORFA 3DNSA 4QC6A 4KVOE 3N7ZA 3R1KA 1YK3A 4R3KA 4F0XA 1XIXA 4R9MA 2C27A 3WR7A 4XPDB 2PDOA 4MFKA 2Q4YA 2YGWA 4XPLA 1IICA 3SHPA 1BO4A 2VZZA 3I9SA 4CGNA 5AG4A 3S6HA 3IWGA 2EUIA 4F0YA 2J8RA 3TO6A 4B10A 1YX0A 4YFJA 1S7LA 1ZO0A 2I00A 1PU9A 1B87A 1SQHA 2OU2A 4JWPA 4A33A 2B3UA 4C2XA 2GANA 4YGOA 4AG7A 4GS4A 2FE7A 4NSQA 2AJ6A 2Z0ZA 4EVYA 4KOWA 4Q36A 1Z9UA 2OH1A 4HNYB 2ARHA 5H86A 2D4OA 4B11A 2REEA 2ZW4A 1FY7A 1M4GA 2Q7BA 2WPXA 3DSBA 1I21A 4C68A 1Z4EA 3TO9A 2PSWA 1B6BA 4CS0B 5F48A 1QSOA 4PSXA 1I1DA 4OAEA 4CAEA 1NE9A 4JD6A 1YR0A 4RS2A 4KUAA 5DWMA 5AG5A 2QECA 4UA3A 2FCKA 1P0HA 3S6FA 2B3VA 1Y9KA 2Z3OA 4QB9A 2P6EA 4MHDA 4BBHA 4CGLA 4U5YA 4CYOA 1YREA 1U6MA 1RO5A 3D2MA 2Z3NA 2B5GB 3R96A 5C82A 3TCVA 1NMTA 5I0CA 4UBRA 3W6XA 5J8CA 4A32A 3EFAA 5H84A 2F5IA 4KLVA 2BEIA 4Q38A 2BUEA 2ZW5A 2Q44A 1M4IA 1IIDA 3PP9A 4OLLA 2PR1A 2EVNA 4MFQA 4XPDC 2PR8A 2R8VA 2OZHA 4BMHA 1MJBA 4KOTA 4B12A 3BJ7A 3E0KA 5F47A 4KORA 4B13A 4RI1A 2B4DA 4YRHA 2OZUA 1IB1E 5KTCA 2DPSA 3F0AA 2WSAA 3VWDA 2VI7A 3ZZIA 4NXYA 4LX9A 2K5TA 3TTHA 4KVXA 4B5OA 2FIAA 2PRBA 3QB8A 3DR6A 1S3ZA 2R98A 4AVAA 5JQ4A 2ZPAA 5A28A 3EY5A 2RC4A 2DXQA 4KSFA 3QAHA 4U9ZA 1WWZA 4PSWA 2CXAA 4KS9A 3JUWA 4CYQA 4CAVA 4QUSA 3SXNA 3TOAA 2B4BA 4II9A 3D3SA 5GCNA 1VKCA 3ZJ0A 4E0AA 4UFWA 3P2FA 2VBQA 1IYKA 2G3TA 3RYOA 3FNCA 1Z4RA 4K30A 2CY2A 1QSRA 4KOSA 2DPTA 3CXPA 4MFZA 2HV2A 4ZBGA 2Q4VA 3PZJA 4PK2A 1YGHA 4C2ZA 1S60A 4UFVA 2R7HA 4CRZB 4J3GA 3W91A 5E96A 5EBVA 4UCNA 4E8OA 4FD7A 2D4PA 2HUZA 5A27A 5G1ZA 2BSWA 1GHEA 4JXRA 4L89A 4AB7A 5EC4A 3FXTA 2HQYA 2Y0MA 4CAWA 4R57A 4CAXA 2GIVA 2WUUA 5CNPA 5FVJA 4NCZA 3D2PA 3DR8A 4FD4A 3IU2A 4JLYA 1XMTA 2FS5A 3FYNA 4X5KA 2Z11A 3F5BA 4H6UA 3R9FA 4CGPA 1K4JA 3TO7A 1V0CA 3TFYA 2CNMA 1P4NA 3GYAA 4ONUA 4U9YA 3NE7A 2VQYA 2AE6A 2P6FA 4MFJA 1UFHA 3FB3A 4CRYB 1CJWA 4M3SA 3BJ8A 4LUAA 2G0BA 2YNCC 1QSNA 4JXQA 1OZPA 5KTDA 4NEXA 3LD2A 3I3GA 4UCMA 1MJ9A 4KOVA 3W6SA 5AG6A 4HNWB 2FXFA 3B8GA 1KUYA 2BL1A 2Q04A 4UFXA 4C7IA 4F6AA 4KVME 4HKFA 2QIRA 3UY5A 1Y9WA 1M4DA 2Z3MA 4CGMA 3SXOA 1S7FA 3FRMA 4IF5A 4UWJA 4CGOA 3EXNA 2O28A 2OB0A 2J8NA 4XNHB 4AVBA 4MBUA 4IUSA 4Y49B 2ZW6A 3PGPA 1YVOA 2YNCA 3IGRA 4UWIA 4H6ZA 1KUXA 1YLEA 1IYLA 4M85A 4MI4A 2I79A 5C88A 5AG7A 3R9GA 3S6KA 1Q2CA 2YNDA 1M1DA 1NSLA 4UCPA 5HMNA 1RXTA 2VXKA 1XEBA 5BWAB 3K9UA 4C2YA 4CYPA 3MGDA 1XF8A 4KZTA 4A30A 4KLWA 4A95A 3H4QA 3V8IA 4MFPA 2NMTA 4MJ8A 2GE3A 1BOBA 4KOXA 2J8MA 4H89A 4JJXA 2H5MA 1N71A 4FD6A 2ZW7A 5G20A 1MK4A 1M44A 4ZGYB 4FD5A 3GY9A 5IX3A 1J4JA 4PV6A 2JEVA 3JTKA 4R87A 3CXQA 3T90A 2IL4A 4R3LA 1I12A 3VWEA 1S7KA 5G21A 4QVTA 3S6GA 2B4DB 2FT0A 3TT2A 2FL4A 2VZYA 3D8PA 4XPKA 1Q2YA 3G3SA 5ISVA 4I49A 3P2HA 1ON0A 2YNEA 2Z3LA 1Q2DA 3IWEA 3DDDA 4MY0A 1MJAA 4QBJA 3G8WA 3GKRA 4E2AA 1S7NA 3A9LA 5AGEA 3EO4A 1XE4A 1R57A 5J8FA 2CNSA 3KKWA 5DWNA 2Q0YA 4MFLA 4NF1A 1KZFA 5F49A 4OADA 2P6GA 3LODA 2B5GA 3F8KA 1S5KA 3FIXA 4HNXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFK A;  4MFJ A;  4MFQ A;  4Q38 A;  4Q36 A;  4MFL A;  4MFZ A;  4MFP A; 
#chains in the Genus database with same CATH topology
 1BPN A;  4B14 A;  1WK4 A;  4P4D A;  1QSM A;  4KSA A;  3CXS A;  4L8A A;  4KOY A;  5HH1 A;  4PK3 A;  5IV0 A;  5JPH A;  4XNH C;  1XMB A;  4DNC A;  2ODF A;  2VEZ A;  2BOA A;  2PJ8 A;  4OIW A;  1KWM A;  2JDD A;  1ZG7 A;  3CZX A;  2C1C A;  3BLN A;  2P0W A;  2AFS A;  4P10 A;  1YVK A;  2KCW A;  2Z3K A;  2CNT A;  3I1U A;  3KHZ A;  2OZG A;  4IK2 A;  3MRU A;  3S9N A;  4A39 A;  4B6Z A;  2ATR A;  2IMO A;  3BXM A;  3LMS A;  5JM6 A;  4B5P B;  5THW A;  3C26 A;  4OID A;  3WT4 A;  7CPA A;  4M6H A;  2PC1 A;  4JZ0 A;  4CYN A;  2A4N A;  5G22 A;  1L0C A;  2Z3P A;  3JVN A;  3H5Z A;  4KUB A;  2C6G A;  2REF A;  3R9E A;  1PUA A;  4KOU A;  5KTA A;  4KSI A;  4NGN A;  5LYF A;  2JDC A;  2FSR A;  3B3W A;  1TKF A;  1QST A;  2DEA A;  2ZXV A;  3B3C A;  4IAV A;  3TOB A;  1Y7R A;  1CBX A;  4B5P A;  1CM0 A;  5IB0 A;  4IHM A;  3OWC A;  1AMP A;  4UIB A;  3EC4 A;  4AVC A;  4P4B A;  5F46 A;  2GLF A;  2B58 A;  3FBU A;  4A2Z A;  1LRZ A;  3FEE A;  2C6P A;  3IU1 A;  2ZED A;  3T9Y A;  2G9D A;  3L2N A;  3S9M A;  2R1I A;  4FUU A;  5LYI A;  4CAF A;  2G3A A;  3KGQ A;  4JYW A;  2WZN A;  2PQ8 A;  2QML A;  1IGB A;  2XEJ A;  3IJ3 A;  3KL9 A;  2ZEH A;  4MCP A;  3JRU A;  1VHS A;  4Y49 C;  1Z8X A;  3RO0 A;  2Z10 A;  4ZX8 A;  3TC8 A;  1DE4 C;  4C7H A;  2Q7S A;  1KUV A;  2WYR A;  2X7B A;  3IFE A;  1RTQ A;  2JLM A;  4MY3 A;  2FIW A;  4PQA A;  5EMI A;  3NA6 A;  3D67 A;  3R95 A;  4AG9 A;  3TE4 A;  1YW4 A;  2WPW A;  1TIQ A;  2V8D A;  3PB9 X;  4A31 A;  4ORF A;  2OR4 A;  3DNS A;  4QC6 A;  3V38 A;  4NFR A;  3VH9 A;  4KVO E;  5LRG A;  1OBR A;  4OC5 A;  3N7Z A;  3R1K A;  1YK3 A;  4R3K A;  4F0X A;  1XIX A;  1LAM A;  2C27 A;  4R9M A;  2EO8 A;  4XPD B;  3WR7 A;  4A94 A;  5K8M A;  2PDO A;  4MFK A;  2Q4Y A;  2YGW A;  4NGS A;  4XPL A;  2JBJ A;  3SJG A;  1AYE A;  3SI0 A;  4P4F A;  2CF4 A;  1IIC A;  3KHX A;  3SHP A;  6CPA A;  1DTD A;  5LYD A;  4FWU A;  1TKH A;  2AFU A;  1BO4 A;  4OKO A;  2VZZ A;  3I9S A;  4CGN A;  5AG4 A;  3S6H A;  3IWG A;  2EUI A;  4A38 A;  4F0Y A;  2PCU A;  2J8R A;  3D7D A;  3TO6 A;  2F7V A;  4B10 A;  1YX0 A;  5HVH A;  1LAN A;  2GFQ A;  4YFJ A;  1S7L A;  3D66 A;  1ZO0 A;  1VHO A;  5K8O A;  1YQE A;  2PVV A;  2I00 A;  1PU9 A;  1B87 A;  1SQH A;  2OU2 A;  4JWP A;  4A33 A;  3H8E A;  2B3U A;  3GB0 A;  5DS0 A;  4LQ6 A;  4C2X A;  2GAN A;  4YGO A;  4AG7 A;  2BO9 A;  4GS4 A;  1TKJ A;  2ZOG A;  3DGV A;  2FVG A;  2FE7 A;  4NSQ A;  2AJ6 A;  2Z0Z A;  4EVY A;  1ELM P;  4KOW A;  5J1Q A;  3CT9 A;  4Q36 A;  1Z9U A;  4Z65 A;  2OH1 A;  4HNY B;  2ARH A;  2ZEN A;  5H86 A;  2EK9 A;  2JBK A;  2PIY A;  2D4O A;  4B11 A;  3LWU A;  2REE A;  1Z8T A;  3BHX A;  2ZW4 A;  1FY7 A;  1M4G A;  2Q7B A;  2WPX A;  3KZW A;  3DSB A;  4DUK A;  1R43 A;  1I21 A;  2BCO A;  4C68 A;  1ARM A;  1Z4E A;  3TO9 A;  2PSW A;  3PFO A;  1B6B A;  5F09 A;  4CS0 B;  2GU2 A;  5F48 A;  1QSO A;  4PSX A;  1I1D A;  2J9A A;  4OAE A;  4MHZ A;  4CAE A;  1NE9 A;  3T8W A;  1M4L A;  4JD6 A;  1YR0 A;  2EWB A;  4RS2 A;  3PBE A;  4KUA A;  5DWM A;  3DLJ A;  5AG5 A;  1PYT B;  2QEC A;  4UA3 A;  2FCK A;  1P0H A;  3S6F A;  2B3V A;  4PXD A;  2PJ6 A;  1Y9K A;  2Q4Z A;  1IY7 A;  2Z3O A;  4ZX9 A;  4QB9 A;  3WC7 A;  2P6E A;  2OOT A;  4MHD A;  4BBH A;  4CGL A;  1VHE A;  3H8F A;  4NGP A;  4U5Y A;  4CYO A;  2ZEO A;  1YRE A;  1U6M A;  1RO5 A;  2IJZ A;  2Z3N A;  3D2M A;  3SI1 A;  4G1P A;  2B5G B;  2PJ4 A;  3R96 A;  3IWW A;  5C82 A;  3D4U A;  3TCV A;  4LQG A;  1NMT A;  5I0C A;  4GXH A;  5K8N A;  4F9U A;  4UBR A;  3W6X A;  5J8C A;  1TXR A;  4A32 A;  3EFA A;  5H84 A;  2HB6 A;  2F5I A;  4KLV A;  2BEI A;  4Q38 A;  4MXU A;  2BUE A;  2ZW5 A;  3IC1 A;  2Q44 A;  1M4I A;  3PB4 X;  4PXB A;  1IID A;  5LYL A;  3PP9 A;  4OLL A;  2PR1 A;  3CDX A;  2EVN A;  3FH4 A;  3PB6 X;  4MFQ A;  4XPD C;  2PR8 A;  1BAV A;  2R8V A;  3KQZ A;  4OC2 A;  2OZH A;  4BMH A;  5HVG A;  3TX8 A;  2XEG A;  1MJB A;  1X10 A;  4P4J A;  2VL1 A;  4KOT A;  3N5F A;  3RAM A;  4B12 A;  3BJ7 A;  2AFX A;  3RNZ A;  4ZY1 A;  5JGF A;  3E0K A;  5F47 A;  1Z8W A;  4KOR A;  4OC3 A;  2AFW A;  4B13 A;  1F2P A;  2ZOF A;  4TWE A;  4WWV A;  4RI1 A;  3BI0 A;  2ZEM A;  2RB7 A;  2B4D A;  3FF3 A;  4YRH A;  2OZU A;  1ZG8 A;  1IB1 E;  5KTC A;  1CX8 A;  4PXE A;  2IQ6 A;  2DPS A;  3F0A A;  2WSA A;  2ABZ A;  3VWD A;  2VI7 A;  3ZZI A;  1QMU A;  4NXY A;  2PE3 A;  4LX9 A;  2K5T A;  3PRT A;  3TTH A;  4KVX A;  4R6T A;  3IO1 A;  4B5O A;  2FIA A;  2PRB A;  3QB8 A;  1YSJ A;  3DR6 A;  1YLO A;  1S3Z A;  2R98 A;  5HVF A;  4AVA A;  4H2K A;  5LRJ A;  5JQ4 A;  2ZPA A;  5A28 A;  3EY5 A;  4R7M A;  4P44 A;  3KQX A;  3NE8 A;  1YME A;  3KR4 A;  2RC4 A;  2DXQ A;  4KSF A;  3D7G A;  1FNO A;  2AFZ A;  3QAH A;  4U9Z A;  4X3R A;  5JH9 A;  1WWZ A;  3PB7 X;  4PSW A;  2CXA A;  2RFH A;  3JUW A;  4KS9 A;  4CYQ A;  3B35 A;  3QAY A;  2V8H A;  4CAV A;  4QUS A;  3SXN A;  3TOA A;  2ZEE A;  4P45 A;  1BPM A;  2B4B A;  4OP4 A;  4II9 A;  1YW6 A;  3D3S A;  4NGR A;  4NJR A;  1ELL P;  4M6G A;  2GRE A;  5GCN A;  1VKC A;  2ZEG A;  4M6I A;  3ZJ0 A;  4E0A A;  4UFW A;  4R8F A;  3P2F A;  2VBQ A;  2XEF A;  4AXV A;  1IYK A;  4UEZ A;  2G3T A;  4OC1 A;  2NSM A;  3RYO A;  3GUX A;  2Q43 A;  2ANP A;  3FNC A;  1Z4R A;  4K30 A;  2CY2 A;  1QSR A;  4KOS A;  1ZLI A;  2DPT A;  2CTC A;  3CXP A;  4MFZ A;  2HV2 A;  1EE3 P;  4ZBG A;  2Q4V A;  4R76 A;  3WAB A;  1CG2 A;  3PZJ A;  4FBE A;  4PK2 A;  1YGH A;  2JEW A;  1S60 A;  4UFV A;  2R7H A;  3FVL A;  4C2Z A;  1LCP A;  4CRZ B;  4J3G A;  3NH8 A;  3W91 A;  5E96 A;  4O23 A;  3FX6 A;  3PEI A;  5EBV A;  1VIX A;  1F57 A;  2PIZ A;  2PJ3 A;  3D7H A;  4UCN A;  4YU9 A;  4E8O A;  1QQ9 A;  5CBM A;  1F2O A;  1LAP A;  4FD7 A;  2D4P A;  2HUZ A;  4W9Y A;  5A27 A;  5G1Z A;  2BSW A;  1GHE A;  4MHN A;  4BIN A;  3SJE A;  3BI1 A;  1CPX A;  3ISX A;  4JXR A;  4OC0 A;  2PJ2 A;  4TNU A;  4P4I A;  1X12 A;  4HPS A;  4L89 A;  4AB7 A;  3LAC A;  5EC4 A;  4EFD A;  3FXT A;  2HQY A;  1R3N A;  2Y0M A;  4CAW A;  4CPA A;  2C6C A;  4R57 A;  4CAX A;  3KAS A;  2GIV A;  2WUU A;  2ZEP A;  2PJ9 A;  5CNP A;  1PCA A;  5LRK A;  5FVJ A;  4OME A;  2XEI A;  4NCZ A;  3D2P A;  3DR8 A;  3IIB A;  1IOI A;  4FD4 A;  3IU2 A;  4JLY A;  3IEH A;  1XMT A;  2FS5 A;  4NGM A;  3FYN A;  4X5K A;  2Z11 A;  4MRI A;  4RUH A;  4MCQ A;  4ZI6 A;  3F5B A;  4H6U A;  3R9F A;  4CGP A;  1K4J A;  3TO7 A;  1HDQ A;  1CPS A;  1V0C A;  3TFY A;  5D29 A;  2EBJ A;  2CNM A;  2F8H A;  1P4N A;  3GYA A;  4ONU A;  4U9Y A;  3NE7 A;  2VQY A;  2AE6 A;  2P6F A;  5CPA A;  2O4H A;  4X8I A;  3RZA A;  3FJU A;  4BD9 A;  2ZEF A;  4RN7 A;  1Z5R A;  4MFJ A;  1UFH A;  3FB3 A;  4CRY B;  4DYO A;  1CJW A;  4M3S A;  3WC6 A;  3BJ8 A;  3ISZ A;  3HUV A;  4LUA A;  2G0B A;  2YNC C;  1TF8 A;  1LFW A;  1QSN A;  2V8G A;  2O53 A;  4JXQ A;  1OZP A;  5KTD A;  1HEE A;  4NEX A;  3LD2 A;  2AFM A;  1Y7E A;  4NJQ A;  4OC4 A;  3I3G A;  2QJ8 A;  4UCM A;  4X2T A;  1MJ9 A;  3FMC A;  3KI9 A;  4K3N A;  4KOV A;  4MMO A;  3W6S A;  2HC9 A;  5AG6 A;  1GYT A;  2AFO A;  4HNW B;  1H8L A;  2FXF A;  3B8G A;  3WC5 A;  1KUY A;  2BL1 A;  1ARL A;  2Q04 A;  1IU8 A;  4UIA A;  3D7F A;  1HDU A;  3HLP A;  4UFX A;  4WJB A;  4F9V A;  4C7I A;  1Y0Y A;  1VGY A;  4F6A A;  4KVM E;  4HKF A;  2PJA A;  2QIR A;  3UY5 A;  1XBU A;  1Y9W A;  3B2Y A;  1M4D A;  2Z3M A;  3B3T A;  4CGM A;  3SXO A;  2CTB A;  1S7F A;  1Y0R A;  3FRM A;  4IF5 A;  4UWJ A;  5ELY A;  4CGO A;  3B3V A;  3EXN A;  2O28 A;  4UF4 A;  4EME A;  2OB0 A;  2J8N A;  4XNH B;  5HXD A;  3KR5 A;  4NGT A;  1TF9 A;  2QVP A;  4AVB A;  2I3C A;  4MBU A;  1AUG A;  4IUS A;  4MHY A;  4Y49 B;  8CPA A;  4ZY0 A;  2PJ0 A;  2ZW6 A;  3PGP A;  1YVO A;  2YNC A;  1XJO A;  3IGR A;  1FT7 A;  3VAR A;  4ONW A;  4UWI A;  4H6Z A;  4UEE A;  4DJL A;  1KUX A;  1YLE A;  1IYL A;  3GLJ A;  4M85 A;  3RBU A;  2PRQ A;  3B7I A;  4A37 A;  4MI4 A;  2I79 A;  5I4M A;  5C88 A;  5AG7 A;  3R9G A;  3S6K A;  5D8N A;  5IB9 A;  1Q2C A;  2V8V A;  2YND A;  4P6Y A;  1M1D A;  1NSL A;  4MCR A;  2PJ1 A;  4UCP A;  1IOF A;  5HMN A;  1LOK A;  1RXT A;  2VXK A;  1XEB A;  5BWA B;  3K9U A;  4C2Y A;  4CYP A;  3SJX A;  3MGD A;  1XF8 A;  4KZT A;  4A30 A;  3FED A;  4KLW A;  1XRY A;  4A95 A;  3H4Q A;  2PVW A;  2Q51 A;  4MFP A;  2NMT A;  2ZEL A;  3V8I A;  4MJ8 A;  5K8P A;  2GE3 A;  1BOB A;  4KOX A;  2J8M A;  4MHP A;  1UWY A;  4H89 A;  3MN8 A;  4JJX A;  2H5M A;  3NH5 A;  1N71 A;  1XOV A;  2PJ5 A;  4FD6 A;  2PJ7 A;  2ZW7 A;  3D68 A;  5G20 A;  2POK A;  4FAI A;  3NH4 A;  1MK4 A;  1M44 A;  4ZGY B;  1Z2L A;  2NYQ A;  4FD5 A;  4PPZ A;  3V7Z A;  3GY9 A;  4ZY2 A;  5IX3 A;  1J4J A;  4EWT A;  4PV6 A;  3CPA A;  2JEV A;  3JTK A;  3NFZ A;  3S9L A;  3QNV A;  4GM5 A;  4R87 A;  3CXQ A;  3K2K A;  3T90 A;  2IL4 A;  4R3L A;  1I12 A;  1CP7 A;  3VWE A;  1S7K A;  5G21 A;  4QVT A;  1CP6 A;  3S6G A;  2B4D B;  2FT0 A;  2QYV A;  3TT2 A;  4MCS A;  4PXC A;  2FL4 A;  3VAT A;  2VZY A;  3D8P A;  4UEF A;  4XPK A;  1Q2Y A;  3G3S A;  3SJF A;  5ISV A;  4I49 A;  4F8Z A;  3P2H A;  1ON0 A;  2YNE A;  2Z3L A;  1Q2D A;  1JQG A;  3IWE A;  3DDD A;  4MY0 A;  1MJA A;  2PJC A;  3FEC A;  3CPX A;  3G8W A;  4QBJ A;  3GKR A;  2DF5 A;  1S7N A;  3A9L A;  4E2A A;  3GIU A;  4NGQ A;  3EO4 A;  5AGE A;  1XE4 A;  3PFE A;  1XFO A;  2EK8 A;  1R57 A;  1ZLH A;  5J8F A;  1ZG9 A;  2GLJ A;  2CNS A;  3KKW A;  5DWN A;  4P4E A;  2Q0Y A;  3K9T A;  1JWQ A;  4MFL A;  1A2Z A;  3B3S A;  2CIJ A;  3H8G A;  1KZF A;  1BLL E;  1Q7L A;  1Z8L A;  4NF1 A;  5F49 A;  4OAD A;  3SI2 A;  4ZYQ A;  2P6G A;  4Q7A A;  3LOD A;  4YWY A;  2B5G A;  3F8K A;  2V77 A;  3PB8 X;  3PBB A;  1NSA A;  1S5K A;  2PJB A;  3FIX A;  4HNX B; 
#chains in the Genus database with same CATH homology
 4B14 A;  1WK4 A;  5HH1 A;  1QSM A;  4KSA A;  3CXS A;  4L8A A;  4KOY A;  5IV0 A;  4PK3 A;  5JPH A;  4XNH C;  4DNC A;  2VEZ A;  2JDD A;  3BLN A;  2P0W A;  1YVK A;  2KCW A;  2Z3K A;  2CNT A;  2OZG A;  2ATR A;  4B5P B;  3C26 A;  2PC1 A;  4CYN A;  2A4N A;  5G22 A;  1L0C A;  2Z3P A;  3JVN A;  3H5Z A;  4KUB A;  5KTA A;  2REF A;  3R9E A;  1PUA A;  4KOU A;  2JDC A;  2FSR A;  1QST A;  2ZXV A;  3TOB A;  5IB0 A;  4B5P A;  1Y7R A;  1CM0 A;  3OWC A;  3EC4 A;  4AVC A;  5F46 A;  2B58 A;  3FBU A;  4A2Z A;  1LRZ A;  3IU1 A;  3T9Y A;  2R1I A;  4CAF A;  2G3A A;  2PQ8 A;  2QML A;  1VHS A;  4Y49 C;  2Z10 A;  4C7H A;  1KUV A;  2X7B A;  2JLM A;  4MY3 A;  2FIW A;  3R95 A;  3TE4 A;  4AG9 A;  2WPW A;  1TIQ A;  4A31 A;  4ORF A;  3DNS A;  4QC6 A;  4KVO E;  3N7Z A;  3R1K A;  1YK3 A;  4R3K A;  4F0X A;  1XIX A;  4R9M A;  2C27 A;  3WR7 A;  4XPD B;  2PDO A;  4MFK A;  2Q4Y A;  2YGW A;  4XPL A;  1IIC A;  3SHP A;  1BO4 A;  2VZZ A;  3I9S A;  4CGN A;  5AG4 A;  3S6H A;  3IWG A;  2EUI A;  4F0Y A;  2J8R A;  3TO6 A;  4B10 A;  1YX0 A;  4YFJ A;  1S7L A;  1ZO0 A;  2I00 A;  1PU9 A;  1B87 A;  1SQH A;  2OU2 A;  4JWP A;  4A33 A;  2B3U A;  4C2X A;  2GAN A;  4YGO A;  4AG7 A;  4GS4 A;  2FE7 A;  4NSQ A;  2AJ6 A;  2Z0Z A;  4EVY A;  4KOW A;  4Q36 A;  1Z9U A;  2OH1 A;  4HNY B;  2ARH A;  5H86 A;  2D4O A;  4B11 A;  2REE A;  2ZW4 A;  1FY7 A;  1M4G A;  2Q7B A;  2WPX A;  3DSB A;  1I21 A;  4C68 A;  1Z4E A;  3TO9 A;  2PSW A;  1B6B A;  4CS0 B;  5F48 A;  1QSO A;  4PSX A;  1I1D A;  4OAE A;  4CAE A;  1NE9 A;  4JD6 A;  1YR0 A;  4RS2 A;  4KUA A;  5DWM A;  5AG5 A;  2QEC A;  4UA3 A;  2FCK A;  1P0H A;  3S6F A;  2B3V A;  1Y9K A;  2Z3O A;  4QB9 A;  2P6E A;  4MHD A;  4BBH A;  4CGL A;  4U5Y A;  4CYO A;  1YRE A;  1U6M A;  1RO5 A;  3D2M A;  2Z3N A;  2B5G B;  3R96 A;  5C82 A;  3TCV A;  1NMT A;  5I0C A;  4UBR A;  3W6X A;  5J8C A;  4A32 A;  3EFA A;  5H84 A;  2F5I A;  4KLV A;  2BEI A;  4Q38 A;  2BUE A;  2ZW5 A;  2Q44 A;  1M4I A;  1IID A;  3PP9 A;  4OLL A;  2PR1 A;  2EVN A;  4MFQ A;  4XPD C;  2PR8 A;  2R8V A;  2OZH A;  4BMH A;  1MJB A;  4KOT A;  4B12 A;  3BJ7 A;  3E0K A;  5F47 A;  4KOR A;  4B13 A;  4RI1 A;  2B4D A;  4YRH A;  2OZU A;  1IB1 E;  5KTC A;  2DPS A;  3F0A A;  2WSA A;  3VWD A;  2VI7 A;  3ZZI A;  4NXY A;  4LX9 A;  2K5T A;  3TTH A;  4KVX A;  4B5O A;  2FIA A;  2PRB A;  3QB8 A;  3DR6 A;  1S3Z A;  2R98 A;  4AVA A;  5JQ4 A;  2ZPA A;  5A28 A;  3EY5 A;  2RC4 A;  2DXQ A;  4KSF A;  3QAH A;  4U9Z A;  1WWZ A;  4PSW A;  2CXA A;  4KS9 A;  3JUW A;  4CYQ A;  4CAV A;  4QUS A;  3SXN A;  3TOA A;  2B4B A;  4II9 A;  3D3S A;  5GCN A;  1VKC A;  3ZJ0 A;  4E0A A;  4UFW A;  3P2F A;  2VBQ A;  1IYK A;  2G3T A;  3RYO A;  3FNC A;  1Z4R A;  4K30 A;  2CY2 A;  1QSR A;  4KOS A;  2DPT A;  3CXP A;  4MFZ A;  2HV2 A;  4ZBG A;  2Q4V A;  3PZJ A;  4PK2 A;  1YGH A;  4C2Z A;  1S60 A;  4UFV A;  2R7H A;  4CRZ B;  4J3G A;  3W91 A;  5E96 A;  5EBV A;  4UCN A;  4E8O A;  4FD7 A;  2D4P A;  2HUZ A;  5A27 A;  5G1Z A;  2BSW A;  1GHE A;  4JXR A;  4L89 A;  4AB7 A;  5EC4 A;  3FXT A;  2HQY A;  2Y0M A;  4CAW A;  4R57 A;  4CAX A;  2GIV A;  2WUU A;  5CNP A;  5FVJ A;  4NCZ A;  3D2P A;  3DR8 A;  4FD4 A;  3IU2 A;  4JLY A;  1XMT A;  2FS5 A;  3FYN A;  4X5K A;  2Z11 A;  3F5B A;  4H6U A;  3R9F A;  4CGP A;  1K4J A;  3TO7 A;  1V0C A;  3TFY A;  2CNM A;  1P4N A;  3GYA A;  4ONU A;  4U9Y A;  3NE7 A;  2VQY A;  2AE6 A;  2P6F A;  4MFJ A;  1UFH A;  3FB3 A;  4CRY B;  1CJW A;  4M3S A;  3BJ8 A;  4LUA A;  2G0B A;  2YNC C;  1QSN A;  4JXQ A;  1OZP A;  5KTD A;  4NEX A;  3LD2 A;  3I3G A;  4UCM A;  1MJ9 A;  4KOV A;  3W6S A;  5AG6 A;  4HNW B;  2FXF A;  3B8G A;  1KUY A;  2BL1 A;  2Q04 A;  4UFX A;  4C7I A;  4F6A A;  4KVM E;  4HKF A;  2QIR A;  3UY5 A;  1Y9W A;  1M4D A;  2Z3M A;  4CGM A;  3SXO A;  1S7F A;  3FRM A;  4IF5 A;  4UWJ A;  4CGO A;  3EXN A;  2O28 A;  2OB0 A;  2J8N A;  4XNH B;  4AVB A;  4MBU A;  4IUS A;  4Y49 B;  2ZW6 A;  3PGP A;  1YVO A;  2YNC A;  3IGR A;  4UWI A;  4H6Z A;  1KUX A;  1YLE A;  1IYL A;  4M85 A;  4MI4 A;  2I79 A;  5C88 A;  5AG7 A;  3R9G A;  3S6K A;  1Q2C A;  2YND A;  1M1D A;  1NSL A;  4UCP A;  5HMN A;  1RXT A;  2VXK A;  1XEB A;  5BWA B;  3K9U A;  4C2Y A;  4CYP A;  3MGD A;  1XF8 A;  4KZT A;  4A30 A;  4KLW A;  4A95 A;  3H4Q A;  3V8I A;  4MFP A;  2NMT A;  4MJ8 A;  2GE3 A;  1BOB A;  4KOX A;  2J8M A;  4H89 A;  4JJX A;  2H5M A;  1N71 A;  4FD6 A;  2ZW7 A;  5G20 A;  1MK4 A;  1M44 A;  4ZGY B;  4FD5 A;  3GY9 A;  5IX3 A;  1J4J A;  4PV6 A;  2JEV A;  3JTK A;  4R87 A;  3CXQ A;  3T90 A;  2IL4 A;  4R3L A;  1I12 A;  3VWE A;  1S7K A;  5G21 A;  4QVT A;  3S6G A;  2B4D B;  2FT0 A;  3TT2 A;  2FL4 A;  2VZY A;  3D8P A;  4XPK A;  1Q2Y A;  3G3S A;  5ISV A;  4I49 A;  3P2H A;  1ON0 A;  2YNE A;  2Z3L A;  1Q2D A;  3IWE A;  3DDD A;  4MY0 A;  1MJA A;  4QBJ A;  3G8W A;  3GKR A;  4E2A A;  1S7N A;  3A9L A;  5AGE A;  3EO4 A;  1XE4 A;  1R57 A;  5J8F A;  2CNS A;  3KKW A;  5DWN A;  2Q0Y A;  4MFL A;  4NF1 A;  1KZF A;  5F49 A;  4OAD A;  2P6G A;  3LOD A;  2B5G A;  3F8K A;  1S5K A;  3FIX A;  4HNX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...