4MFLA

The crystal structure of acyltransferase in complex with decanoyl-coa and tei pseudoaglycone
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
323
structure length
323
Chain Sequence
MDPETVRIALGLEERTAAWLTELDELGPPAEPVRLPRGEEARDLLRRLEVPELDAEEIVAAAPDPDRDPALWWLLERTHHAIVRHMGDHRAKPRGGPPLPYEGGAAARYFHVYVFLATVPAVRRFHAERGIPDEVGWETLTQLGELVAIHRRKYGQGGMNMQWWTTYHLRGILYRLGRLQFSLATGKDGTPHLGLAVPEWGGPLLPKAYDESLHRARPFFDRHFPEHGARVAWGSSWMLDPQLEEYLTEDSNIIQLARFWTLTDSAPEPGNADGDSSILEFVFRYNGQPLDELPQRSSLERAVIAHLKAGRHWHMRTGFVKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein tcp24
publication title Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Transferase/antibiotic
total genus 108
structure length 323
sequence length 323
ec nomenclature ec 2.3.1.-:
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18082 DUF5596 Domain of unknown function (DUF5596)
A PF18164 GNAT_C GNAT-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.120 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mflA02
4Q36A 4MFKA 4MFQA 4MFZA 4MFJA 4MFLA 4Q38A 4MFPA
chains in the Genus database with same CATH superfamily
3TE4A 1YGHA 4KOXA 4PSWA 3VATA 3D68A 3KKWA 2Q44A 2JDDA 2Z10A 4CGNA 1IYLA 3BJ8A 2ZEPA 3FEDA 4NGNA 5HH1A 4JYWA 1LAPA 2OU2A 2XEJA 2YGWA 4MHDA 2ZEGA 4GXHA 4UCNA 3BI1A 3T9YA 4YWYA 2GLFA 3GY9A 4B11A 4R3LA 4K30A 4CAFA 2WPXA 4JD6A 1Z4EA 2WSAA 3GB0A 4RI1A 3RYOA 3NH4A 1S7NA 2O53A 4A33A 1Q2YA 4MHNA 2Q7SA 3C26A 4QVTA 3F8KA 2DPTA 5LRGA 2ODFA 4XNHB 5ELYA 1JWQA 3E0KA 4OAEA 2WYRA 2VI7A 3FB3A 2VL1A 4NCZA 5K8MA 2B5GB 3K9UA 4XPLA 5J1QA 2WZNA 2QYVA 4KSIA 2BO9A 5IX3A 1LFWA 2PC1A 2QECA 1XE4A 4CAVA 4X2TA 3DLJA 3MGDA 2AJ6A 1DE4C 4FWUA 4UEZA 1YW6A 5JPHA 4Q36A 5HMNA 5H84A 2OH1A 3FF3A 3TC8A 4AVBA 4NGSA 4B10A 1QSNA 3JRUA 3D7DA 4A37A 3TX8A 4BBHA 2Q4YA 1Z9UA 2FIWA 1OBRA 5LYDA 4KVME 1S3ZA 4B5PB 1Y7RA 1P4NA 2BSWA 2EWBA 4RN7A 3R9GA 4JLYA 1I21A 3GKRA 3TO7A 2V77A 4G1PA 2VQYA 5F09A 4M6IA 5G1ZA 4MFZA 2FCKA 3KZWA 4JXRA 4P4FA 3VH9A 4KUAA 4UEFA 2AFZA 3QB8A 4MBUA 2OZGA 3KL9A 4PXBA 2C27A 4DJLA 3TCVA 1M4GA 5G21A 4P10A 1DTDA 4R9MA 3S6KA 2BL1A 4FUUA 4NFRA 3NE7A 4MMOA 1SQHA 4MCRA 4E8OA 2K5TA 2XEGA 4CAWA 1XBUA 4ZY1A 4UCMA 3PB4X 3R95A 1HDQA 2P6GA 3MN8A 2GANA 4TWEA 3IIBA 1CG2A 4M3SA 1CP6A 4QC6A 2EUIA 4OC1A 4EWTA 2B4DA 2PIYA 3RNZA 4B14A 4EMEA 3V7ZA 1BAVA 2J9AA 4AB7A 2B3UA 3FJUA 3NA6A 3ZJ0A 4A94A 2PJBA 3BXMA 3V8IA 2FE7A 2R98A 5LRJA 2I79A 1ARMA 3EY5A 2O28A 4UFVA 1P0HA 2PJ1A 4CGPA 1Q2CA 4XNHC 3IC1A 4MRIA 4OKOA 4UF4A 1ARLA 1BLLE 1TF8A 2H5MA 2NYQA 2R7HA 2GFQA 3G3SA 4OC3A 3PB7X 1F57A 2CNMA 4IHMA 2PJ4A 1QSTA 1VIXA 2HUZA 2ABZA 5AGEA 3D66A 4WWVA 2GLJA 2QJ8A 1PYTB 4CYNA 2A4NA 2EO8A 5LYIA 3S6GA 4MFQA 4R76A 3SXNA 2O4HA 4QUSA 2OZHA 4KORA 5HXDA 3D8PA 1H8LA 6CPAA 5K8OA 1QMUA 4I49A 2VXKA 4UFWA 1FT7A 3D4UA 4CRYB 4CYPA 3ZZIA 3GIUA 3S9NA 1HDUA 1WWZA 3B8GA 2CNTA 3DDDA 5F47A 4AVCA 2Z11A 3IO1A 2D4OA 3PZJA 1F2OA 2GREA 4PXCA 2IMOA 3KI9A 4FD5A 5DS0A 2PE3A 5EC4A 1AMPA 2XEIA 4RS2A 4KVOE 5CPAA 5I4MA 2B3VA 2Q51A 4R6TA 4PK2A 1M4IA 3OWCA 1N71A 3H8EA 1IU8A 3R9EA 2B58A 3DNSA 2G3TA 2PIZA 1XJOA 3B7IA 5CNPA 4E2AA 2ZEOA 3D7GA 5AG7A 4MCQA 3PFOA 3FBUA 3WR7A 1XFOA 2Q4VA 4CAEA 4W9YA 2ZW4A 4CRZB 2F7VA 1RO5A 1U6MA 3DGVA 4P45A 1J4JA 3RZAA 3WC5A 2ARHA 1R43A 2QIRA 1Q7LA 4NSQA 4R3KA 1TKHA 3K2KA 4UEEA 3IGRA 3D2PA 1YK3A 4KS9A 4H2KA 4WJBA 5DWNA 5JH9A 1YREA 2V8VA 1YVKA 2PQ8A 3DSBA 2ZEFA 1YQEA 5IV0A 4OC2A 1HEEA 3IJ3A 2I00A 4M6HA 4C2ZA 2HV2A 4A38A 4II9A 4C68A 3LODA 4CGOA 1Z4RA 4Y49C 1YR0A 1K4JA 2Q43A 3T8WA 4A39A 3ISZA 1NSLA 2PJCA 1ZLIA 2V8DA 1AYEA 5JGFA 4DYOA 4NGTA 1CP7A 1CPSA 4JZ0A 1F2PA 4KSAA 4F6AA 1XMTA 2PRQA 3F0AA 1XEBA 3BHXA 1KUXA 2VZZA 3FX6A 1VHEA 3H8GA 2EK8A 4FBEA 2FT0A 2F8HA 4UFXA 1YW4A 3RAMA 3P2HA 3D2MA 3FYNA 2JEWA 4BMHA 4ZBGA 4RUHA 1Z8XA 2FSRA 2REFA 1XRYA 4HPSA 4U9YA 4A95A 4DNCA 4NXYA 2OZUA 1XMBA 4IF5A 1TXRA 3N7ZA 4B13A 2PJ2A 1PUAA 2FVGA 4IAVA 3G8WA 5KTCA 2PJ5A 2OR4A 4OIDA 2JDCA 3SJGA 3VWDA 4ONWA 1UFHA 3B35A 3BJ7A 3CXSA 3SJXA 5J8FA 2BOAA 2DPSA 4P4DA 3CT9A 5THWA 4ZY0A 2EVNA 2QVPA 1IGBA 4TNUA 1BPNA 5AG6A 4XPDC 4MFPA 1RXTA 4LQGA 3TOBA 2I3CA 2X7BA 4ZY2A 5KTAA 1TIQA 2FL4A 4ZGYB 1YX0A 4A30A 1FY7A 3IWWA 4KLVA 1QSRA 4OADA 3GUXA 2RB7A 1RTQA 1MJAA 1VGYA 3CPXA 1M44A 1MJ9A 4YGOA 3PFEA 3H4QA 4H6UA 3EO4A 4CAXA 5LYLA 1R57A 4HNXB 3W91A 2REEA 4R7MA 1NSAA 5LRKA 3TTHA 3EFAA 1S60A 4PK3A 3LACA 3R96A 4KOYA 4DUKA 2HC9A 5F46A 1WK4A 3KASA 2G0BA 2CTCA 1PU9A 1I12A 4AXVA 3PRTA 2DXQA 3I1UA 4CYQA 3NH5A 1KUYA 2C6CA 1VHOA 1Z2LA 1IOFA 2BCOA 3PB8X 3CXQA 3FIXA 3PP9A 4EVYA 2PCUA 2C6PA 2FXFA 3R9FA 2ZEHA 4B6ZA 1Y0RA 2ZW7A 3B3SA 1LCPA 3FMCA 1NMTA 4OC0A 4C2XA 4MFKA 4LQ6A 2Z3PA 4LUAA 4MHZA 4PSXA 2PJ8A 1LAMA 1X12A 5J8CA 3SHPA 5K8NA 2BEIA 5DWMA 4ONUA 5EBVA 1CJWA 1ZG7A 2B5GA 1ZG8A 3PB9X 4OLLA 2B4BA 3VWEA 3PB6X 2WUUA 2V8HA 3B3VA 3KHXA 1V0CA 2DEAA 1FNOA 2VEZA 2GE3A 3LMSA 2AE6A 2PJ0A 5EMIA 3IU1A 3MRUA 4JWPA 1Y0YA 2VZYA 1Z8TA 1ZO0A 1YLEA 5E96A 3CDXA 4Q38A 4P44A 3WABA 4E0AA 4F8ZA 5AG4A 3FRMA 3GLJA 1S7FA 3W6SA 4B5PA 3F5BA 1S7KA 4OP4A 4F9VA 3B3CA 3JUWA 3FNCA 2IJZA 4OIWA 3SJFA 3RO0A 5D8NA 1M1DA 1GHEA 3H5ZA 4JJXA 3QNVA 2G3AA 3HLPA 1BOBA 3SXOA 1B87A 4F0YA 4P6YA 2P6EA 3KQZA 2IL4A 1TF9A 4L89A 5F48A 4KOTA 5HVHA 1XF8A 4MXUA 2CTBA 2EBJA 2AFUA 4M85A 3I3GA 1YLOA 3W6XA 4MY0A 4P4BA 4MFLA 1Q2DA 2FIAA 3CPAA 3I9SA 2J8RA 2ZEDA 5KTDA 2ZOFA 1ZLHA 4KOWA 4P4EA 4QB9A 2CIJA 4KSFA 4P4JA 3TOAA 4KLWA 4CPAA 1Z8LA 4ZYQA 3JVNA 4KUBA 4ORFA 1ON0A 2R8VA 3PEIA 5JM6A 4A31A 4XPKA 3IWGA 4UWJA 7CPAA 2ZW6A 4KOSA 2Q7BA 2Z3OA 2JLMA 2ZEMA 2PJ3A 1KZFA 2PVVA 3WC7A 4M6GA 2HQYA 2JBKA 3RBUA 3KR5A 5HVGA 3R1KA 1CX8A 2RC4A 5K8PA 3NFZA 2PR8A 5A28A 4AG9A 1X10A 2NSMA 2Q04A 3FEEA 3QAYA 4U5YA 4FD4A 1AUGA 3ISXA 4C7IA 3FXTA 3SI2A 5F49A 4GM5A 5C82A 4A2ZA 2CNSA 2PR1A 2XEFA 3PGPA 3DR8A 4UIAA 3S9LA 3IU2A 4KZTA 4OC4A 4EFDA 4MHPA 3WC6A 3D3SA 4MCPA 1KWMA 2OB0A 1VKCA 2C6GA 1A2ZA 2Q0YA 1BO4A 2B4DB 5D29A 2G9DA 2ZOGA 4PV6A 4B12A 1S5KA 2D4PA 3B3WA 5IB9A 1QSOA 5HVFA 3GYAA 4ZI6A 5CBMA 4HNWB 1ELMP 3B2YA 4PQAA 1LOKA 4NF1A 4H89A 2ZEEA 3IEHA 4UIBA 4NGQA 1R3NA 2PVWA 4GS4A 3IWEA 3TT2A 3LD2A 1B6BA 2Z0ZA 2C1CA 4UA3A 1L0CA 2AFXA 4IK2A 4Z65A 4FAIA 3KGQA 5FVJA 4YFJA 1MJBA 3EXNA 5JQ4A 1JQGA 5LYFA 2CF4A 3KR4A 1TKJA 3S9MA 4QBJA 1CM0A 4MJ8A 1Y7EA 2P6FA 1M4DA 1GYTA 4L8AA 2PJ7A 4OC5A 1IYKA 2WPWA 2CXAA 3PBEA 4CS0B 4NGRA 4MI4A 4F0XA 3H8FA 2F5IA 3HUVA 2GIVA 2KCWA 3NE8A 3N5FA 3QAHA 2Q4ZA 2YNDA 2EK9A 4UWIA 1PCAA 2Z3LA 5I0CA 2FS5A 2VBQA 2RFHA 3S6FA 3JTKA 1ELLP 1XIXA 3FH4A 4FD6A 2ATRA 2JBJA 2QMLA 4HNYB 5GCNA 1ZG9A 3B3TA 4NGMA 1YVOA 4LX9A 4A32A 3WT4A 2AFMA 3FECA 2HB6A 3K9TA 2ZENA 2ZXVA 3BI0A 2PJ9A 2PJ6A 3NH8A 4OMEA 3SI0A 4YRHA 2Z3NA 3CZXA 3VARA 4NGPA 4K3NA 4ZX8A 1IIDA 4PXEA 3D67A 4NJQA 4Q7AA 1QQ9A 2YNCA 2PJAA 1VHSA 2CY2A 3D7HA 4NJRA 2BUEA 4C2YA 1UWYA 3EC4A 4CGLA 4O23A 2IQ6A 4H6ZA 2YNEA 2YNCC 2JEVA 3DR6A 2AFSA 1S7LA 1QSMA 4R57A 1IOIA 3BLNA 1Y9WA 5C88A 2P0WA 2AFOA 4UBRA 2POKA 4HKFA 5G20A 1Y9KA 4Y49B 4R87A 1MK4A 1KUVA 2DF5A 2NMTA 2ZELA 4BD9A 1M4LA 4KOVA 2OOTA 4ZX9A 3SJEA 2ANPA 2ZW5A 8CPAA 2PSWA 5IB0A 4KOUA 4KVXA 4UCPA 3TFYA 5H86A 4CGMA 4AVAA 3CXPA 4U9ZA 5ISVA 1NE9A 3FVLA 2GU2A 2Z3MA 1OZPA 4MFJA 5A27A 1CPXA 4P4IA 1I1DA 2Y0MA 2AFWA 5G22A 3S6HA 3PBBA 1TKFA 1YSJA 1IB1E 1Z8WA 3LWUA 3UY5A 1IICA 4X3RA 4BINA 4NEXA 2PRBA 4B5OA 4CYOA 3L2NA 4AG7A 4PXDA 3SI1A 4JXQA 3A9LA 3KQXA 4MCSA 4X8IA 4F9UA 1YMEA 4R8FA 4XPDB 2R1IA 1XOVA 3P2FA 2Z3KA 4X5KA 2ZPAA 4FD7A 2PDOA 3TO6A 2V8GA 1CBXA 4MHYA 1LANA 4YU9A 3T90A 3TO9A 3KHZA 5AG5A 1EE3P 4C7HA 5BWAB 4PPZA 3V38A 4J3GA 1BPMA 2J8MA 3D7FA 1LRZA 1Z5RA 2J8NA 3IFEA 4IUSA 1IY7A 4MY3A
chains in the Genus database with same CATH topology
3TE4A 1YGHA 4KOXA 4PSWA 3KKWA 2Q44A 2JDDA 2Z10A 4CGNA 1IYLA 3BJ8A 5HH1A 2YGWA 2OU2A 4MHDA 4UCNA 3T9YA 3GY9A 4B11A 4R3LA 4K30A 4CAFA 2WPXA 4JD6A 1Z4EA 2WSAA 4RI1A 3RYOA 1S7NA 4A33A 1Q2YA 3C26A 4QVTA 3F8KA 2DPTA 4XNHB 3E0KA 4OAEA 2VI7A 3FB3A 4NCZA 2B5GB 3K9UA 4XPLA 5IX3A 2PC1A 2QECA 1XE4A 4CAVA 3MGDA 2AJ6A 5JPHA 4Q36A 5HMNA 5H84A 2OH1A 4AVBA 4B10A 1QSNA 4BBHA 2Q4YA 1Z9UA 2FIWA 4KVME 1S3ZA 4B5PB 1Y7RA 1P4NA 2BSWA 3R9GA 4JLYA 1I21A 3GKRA 3TO7A 2VQYA 5G1ZA 4MFZA 2FCKA 4JXRA 4KUAA 3QB8A 4MBUA 2OZGA 2C27A 3TCVA 1M4GA 5G21A 4R9MA 3S6KA 2BL1A 3NE7A 1SQHA 4E8OA 2K5TA 4CAWA 4UCMA 3R95A 2P6GA 2GANA 4M3SA 4QC6A 2EUIA 2B4DA 4B14A 4AB7A 2B3UA 3ZJ0A 3V8IA 2FE7A 2R98A 2I79A 4UFVA 3EY5A 2O28A 1P0HA 4CGPA 1Q2CA 4XNHC 2H5MA 3G3SA 2R7HA 2CNMA 1QSTA 2HUZA 5AGEA 4CYNA 2A4NA 3S6GA 4MFQA 3SXNA 4QUSA 2OZHA 4KORA 3D8PA 4I49A 2VXKA 4UFWA 4CRYB 4CYPA 3ZZIA 3B8GA 1WWZA 5F47A 2CNTA 3DDDA 4AVCA 2Z11A 2D4OA 3PZJA 4FD5A 5EC4A 4RS2A 4KVOE 2B3VA 4PK2A 1M4IA 3OWCA 1N71A 3R9EA 2B58A 3DNSA 2G3TA 5CNPA 4E2AA 5AG7A 3FBUA 3WR7A 2Q4VA 4CAEA 2ZW4A 4CRZB 1RO5A 1U6MA 1J4JA 2ARHA 2QIRA 4NSQA 4R3KA 3IGRA 3D2PA 1YK3A 4KS9A 5DWNA 1YREA 1YVKA 2PQ8A 3DSBA 5IV0A 2I00A 4C2ZA 2HV2A 4II9A 4C68A 3LODA 4CGOA 1Z4RA 4Y49C 1YR0A 1K4JA 1NSLA 4F6AA 4KSAA 1XMTA 3F0AA 1XEBA 1KUXA 2VZZA 2FT0A 4UFXA 3P2HA 3D2MA 3FYNA 4BMHA 4ZBGA 2FSRA 2REFA 4A95A 4DNCA 4U9YA 4NXYA 2OZUA 4IF5A 3N7ZA 4B13A 1PUAA 3G8WA 5KTCA 3VWDA 2JDCA 5J8FA 1UFHA 3BJ7A 3CXSA 2DPSA 2EVNA 5AG6A 4XPDC 4MFPA 1RXTA 3TOBA 2X7BA 5KTAA 1TIQA 2FL4A 4ZGYB 1YX0A 4A30A 1FY7A 4KLVA 1QSRA 4OADA 1MJAA 1M44A 1MJ9A 4YGOA 3H4QA 4H6UA 3EO4A 4CAXA 1R57A 4HNXB 3W91A 2REEA 3TTHA 3EFAA 1S60A 4PK3A 3R96A 4KOYA 5F46A 1WK4A 2G0BA 1PU9A 1I12A 2DXQA 4CYQA 1KUYA 3CXQA 3FIXA 3PP9A 4EVYA 2FXFA 3R9FA 2ZW7A 1NMTA 4C2XA 4MFKA 2Z3PA 4LUAA 4PSXA 5J8CA 3SHPA 2BEIA 5DWMA 4ONUA 5EBVA 1CJWA 2B5GA 4OLLA 2B4BA 3VWEA 2WUUA 1V0CA 2VEZA 2GE3A 2AE6A 3IU1A 4JWPA 2VZYA 1ZO0A 1YLEA 5E96A 4Q38A 5AG4A 4E0AA 3FRMA 3W6SA 1S7FA 4B5PA 3F5BA 1S7KA 3JUWA 3FNCA 1M1DA 1GHEA 3H5ZA 4JJXA 2G3AA 1BOBA 3SXOA 1B87A 4F0YA 2P6EA 2IL4A 4L89A 5F48A 4KOTA 1XF8A 4M85A 3I3GA 3W6XA 4MY0A 4MFLA 1Q2DA 2FIAA 3I9SA 2J8RA 5KTDA 4KOWA 4QB9A 4KSFA 3TOAA 4KLWA 3JVNA 4KUBA 4ORFA 1ON0A 2R8VA 4A31A 4XPKA 3IWGA 4UWJA 2ZW6A 4KOSA 2Q7BA 2Z3OA 2JLMA 1KZFA 2HQYA 3R1KA 2RC4A 2PR8A 5A28A 4AG9A 2Q04A 4U5YA 4FD4A 4C7IA 3FXTA 5F49A 5C82A 4A2ZA 3PGPA 2CNSA 2PR1A 3DR8A 3IU2A 4KZTA 3D3SA 2OB0A 1VKCA 2Q0YA 1BO4A 2B4DB 4B12A 4PV6A 1S5KA 2D4PA 1QSOA 3GYAA 4HNWB 4NF1A 4H89A 4GS4A 3IWEA 3TT2A 3LD2A 1B6BA 2Z0ZA 4UA3A 1L0CA 5FVJA 4YFJA 1MJBA 3EXNA 5JQ4A 4QBJA 1CM0A 4MJ8A 2P6FA 1M4DA 4L8AA 1IYKA 2WPWA 2CXAA 4CS0B 4MI4A 4F0XA 2F5IA 2GIVA 2KCWA 3QAHA 4UWIA 2YNDA 2Z3LA 5I0CA 2FS5A 2VBQA 3S6FA 3JTKA 1XIXA 5GCNA 4FD6A 4HNYB 2ATRA 2QMLA 4A32A 1YVOA 4LX9A 2ZXVA 4YRHA 2Z3NA 1IIDA 2YNCA 1VHSA 2CY2A 2BUEA 4C2YA 3EC4A 4CGLA 4H6ZA 2YNEA 2YNCC 2JEVA 3DR6A 1S7LA 1QSMA 4R57A 3BLNA 1Y9WA 5C88A 2P0WA 4UBRA 4HKFA 5G20A 1Y9KA 4Y49B 4R87A 1MK4A 1KUVA 2NMTA 4KOVA 2ZW5A 2PSWA 5IB0A 4KOUA 4KVXA 4UCPA 3TFYA 5H86A 4CGMA 4AVAA 3CXPA 4U9ZA 5ISVA 1NE9A 2Z3MA 1OZPA 4MFJA 5A27A 1I1DA 2Y0MA 5G22A 3S6HA 1IB1E 3UY5A 1IICA 4NEXA 2PRBA 4B5OA 4CYOA 4AG7A 4JXQA 3A9LA 4XPDB 2R1IA 3P2FA 2Z3KA 4X5KA 2ZPAA 4FD7A 2PDOA 3TO6A 3T90A 3TO9A 5AG5A 4C7HA 5BWAB 4J3GA 2J8MA 1LRZA 2J8NA 4IUSA 4MY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q36 A;  4MFK A;  4MFQ A;  4MFZ A;  4MFJ A;  4MFL A;  4Q38 A;  4MFP A; 
#chains in the Genus database with same CATH topology
 3TE4 A;  1YGH A;  4KOX A;  4PSW A;  3VAT A;  3D68 A;  3KKW A;  2Q44 A;  2JDD A;  2Z10 A;  4CGN A;  1IYL A;  3BJ8 A;  2ZEP A;  3FED A;  4NGN A;  5HH1 A;  4JYW A;  1LAP A;  2OU2 A;  2XEJ A;  2YGW A;  4MHD A;  2ZEG A;  4GXH A;  4UCN A;  3BI1 A;  3T9Y A;  4YWY A;  2GLF A;  3GY9 A;  4B11 A;  4R3L A;  4K30 A;  4CAF A;  2WPX A;  4JD6 A;  1Z4E A;  2WSA A;  3GB0 A;  4RI1 A;  3RYO A;  3NH4 A;  1S7N A;  2O53 A;  4A33 A;  1Q2Y A;  4MHN A;  2Q7S A;  3C26 A;  4QVT A;  3F8K A;  2DPT A;  5LRG A;  2ODF A;  4XNH B;  5ELY A;  1JWQ A;  3E0K A;  4OAE A;  2WYR A;  2VI7 A;  3FB3 A;  2VL1 A;  4NCZ A;  5K8M A;  2B5G B;  3K9U A;  4XPL A;  5J1Q A;  2WZN A;  2QYV A;  4KSI A;  2BO9 A;  5IX3 A;  1LFW A;  2PC1 A;  2QEC A;  1XE4 A;  4CAV A;  4X2T A;  3DLJ A;  3MGD A;  2AJ6 A;  1DE4 C;  4FWU A;  4UEZ A;  1YW6 A;  5JPH A;  4Q36 A;  5HMN A;  5H84 A;  2OH1 A;  3FF3 A;  3TC8 A;  4AVB A;  4NGS A;  4B10 A;  1QSN A;  3JRU A;  3D7D A;  4A37 A;  3TX8 A;  4BBH A;  2Q4Y A;  1Z9U A;  2FIW A;  1OBR A;  5LYD A;  4KVM E;  1S3Z A;  4B5P B;  1Y7R A;  1P4N A;  2BSW A;  2EWB A;  4RN7 A;  3R9G A;  4JLY A;  1I21 A;  3GKR A;  3TO7 A;  2V77 A;  4G1P A;  2VQY A;  5F09 A;  4M6I A;  5G1Z A;  4MFZ A;  2FCK A;  3KZW A;  4JXR A;  4P4F A;  3VH9 A;  4KUA A;  4UEF A;  2AFZ A;  3QB8 A;  4MBU A;  2OZG A;  3KL9 A;  4PXB A;  2C27 A;  4DJL A;  3TCV A;  1M4G A;  5G21 A;  4P10 A;  1DTD A;  4R9M A;  3S6K A;  2BL1 A;  4FUU A;  4NFR A;  3NE7 A;  4MMO A;  1SQH A;  4MCR A;  4E8O A;  2K5T A;  2XEG A;  4CAW A;  1XBU A;  4ZY1 A;  4UCM A;  3PB4 X;  3R95 A;  1HDQ A;  2P6G A;  3MN8 A;  2GAN A;  4TWE A;  3IIB A;  1CG2 A;  4M3S A;  1CP6 A;  4QC6 A;  2EUI A;  4OC1 A;  4EWT A;  2B4D A;  2PIY A;  3RNZ A;  4B14 A;  4EME A;  3V7Z A;  1BAV A;  2J9A A;  4AB7 A;  2B3U A;  3FJU A;  3NA6 A;  3ZJ0 A;  4A94 A;  2PJB A;  3BXM A;  3V8I A;  2FE7 A;  2R98 A;  5LRJ A;  2I79 A;  1ARM A;  3EY5 A;  2O28 A;  4UFV A;  1P0H A;  2PJ1 A;  4CGP A;  1Q2C A;  4XNH C;  3IC1 A;  4MRI A;  4OKO A;  4UF4 A;  1ARL A;  1BLL E;  1TF8 A;  2H5M A;  2NYQ A;  2R7H A;  2GFQ A;  3G3S A;  4OC3 A;  3PB7 X;  1F57 A;  2CNM A;  4IHM A;  2PJ4 A;  1QST A;  1VIX A;  2HUZ A;  2ABZ A;  5AGE A;  3D66 A;  4WWV A;  2GLJ A;  2QJ8 A;  1PYT B;  4CYN A;  2A4N A;  2EO8 A;  5LYI A;  3S6G A;  4MFQ A;  4R76 A;  3SXN A;  2O4H A;  4QUS A;  2OZH A;  4KOR A;  5HXD A;  3D8P A;  1H8L A;  6CPA A;  5K8O A;  1QMU A;  4I49 A;  2VXK A;  4UFW A;  1FT7 A;  3D4U A;  4CRY B;  4CYP A;  3ZZI A;  3GIU A;  3S9N A;  1HDU A;  1WWZ A;  3B8G A;  2CNT A;  3DDD A;  5F47 A;  4AVC A;  2Z11 A;  3IO1 A;  2D4O A;  3PZJ A;  1F2O A;  2GRE A;  4PXC A;  2IMO A;  3KI9 A;  4FD5 A;  5DS0 A;  2PE3 A;  5EC4 A;  1AMP A;  2XEI A;  4RS2 A;  4KVO E;  5CPA A;  5I4M A;  2B3V A;  2Q51 A;  4R6T A;  4PK2 A;  1M4I A;  3OWC A;  1N71 A;  3H8E A;  1IU8 A;  3R9E A;  2B58 A;  3DNS A;  2G3T A;  2PIZ A;  1XJO A;  3B7I A;  5CNP A;  4E2A A;  2ZEO A;  3D7G A;  5AG7 A;  4MCQ A;  3PFO A;  3FBU A;  3WR7 A;  1XFO A;  2Q4V A;  4CAE A;  4W9Y A;  2ZW4 A;  4CRZ B;  2F7V A;  1RO5 A;  1U6M A;  3DGV A;  4P45 A;  1J4J A;  3RZA A;  3WC5 A;  2ARH A;  1R43 A;  2QIR A;  1Q7L A;  4NSQ A;  4R3K A;  1TKH A;  3K2K A;  4UEE A;  3IGR A;  3D2P A;  1YK3 A;  4KS9 A;  4H2K A;  4WJB A;  5DWN A;  5JH9 A;  1YRE A;  2V8V A;  1YVK A;  2PQ8 A;  3DSB A;  2ZEF A;  1YQE A;  5IV0 A;  4OC2 A;  1HEE A;  3IJ3 A;  2I00 A;  4M6H A;  4C2Z A;  2HV2 A;  4A38 A;  4II9 A;  4C68 A;  3LOD A;  4CGO A;  1Z4R A;  4Y49 C;  1YR0 A;  1K4J A;  2Q43 A;  3T8W A;  4A39 A;  3ISZ A;  1NSL A;  2PJC A;  1ZLI A;  2V8D A;  1AYE A;  5JGF A;  4DYO A;  4NGT A;  1CP7 A;  1CPS A;  4JZ0 A;  1F2P A;  4KSA A;  4F6A A;  1XMT A;  2PRQ A;  3F0A A;  1XEB A;  3BHX A;  1KUX A;  2VZZ A;  3FX6 A;  1VHE A;  3H8G A;  2EK8 A;  4FBE A;  2FT0 A;  2F8H A;  4UFX A;  1YW4 A;  3RAM A;  3P2H A;  3D2M A;  3FYN A;  2JEW A;  4BMH A;  4ZBG A;  4RUH A;  1Z8X A;  2FSR A;  2REF A;  1XRY A;  4HPS A;  4U9Y A;  4A95 A;  4DNC A;  4NXY A;  2OZU A;  1XMB A;  4IF5 A;  1TXR A;  3N7Z A;  4B13 A;  2PJ2 A;  1PUA A;  2FVG A;  4IAV A;  3G8W A;  5KTC A;  2PJ5 A;  2OR4 A;  4OID A;  2JDC A;  3SJG A;  3VWD A;  4ONW A;  1UFH A;  3B35 A;  3BJ7 A;  3CXS A;  3SJX A;  5J8F A;  2BOA A;  2DPS A;  4P4D A;  3CT9 A;  5THW A;  4ZY0 A;  2EVN A;  2QVP A;  1IGB A;  4TNU A;  1BPN A;  5AG6 A;  4XPD C;  4MFP A;  1RXT A;  4LQG A;  3TOB A;  2I3C A;  2X7B A;  4ZY2 A;  5KTA A;  1TIQ A;  2FL4 A;  4ZGY B;  1YX0 A;  4A30 A;  1FY7 A;  3IWW A;  4KLV A;  1QSR A;  4OAD A;  3GUX A;  2RB7 A;  1RTQ A;  1MJA A;  1VGY A;  3CPX A;  1M44 A;  1MJ9 A;  4YGO A;  3PFE A;  3H4Q A;  4H6U A;  3EO4 A;  4CAX A;  5LYL A;  1R57 A;  4HNX B;  3W91 A;  2REE A;  4R7M A;  1NSA A;  5LRK A;  3TTH A;  3EFA A;  1S60 A;  4PK3 A;  3LAC A;  3R96 A;  4KOY A;  4DUK A;  2HC9 A;  5F46 A;  1WK4 A;  3KAS A;  2G0B A;  2CTC A;  1PU9 A;  1I12 A;  4AXV A;  3PRT A;  2DXQ A;  3I1U A;  4CYQ A;  3NH5 A;  1KUY A;  2C6C A;  1VHO A;  1Z2L A;  1IOF A;  2BCO A;  3PB8 X;  3CXQ A;  3FIX A;  3PP9 A;  4EVY A;  2PCU A;  2C6P A;  2FXF A;  3R9F A;  2ZEH A;  4B6Z A;  1Y0R A;  2ZW7 A;  3B3S A;  1LCP A;  3FMC A;  1NMT A;  4OC0 A;  4C2X A;  4MFK A;  4LQ6 A;  2Z3P A;  4LUA A;  4MHZ A;  4PSX A;  2PJ8 A;  1LAM A;  1X12 A;  5J8C A;  3SHP A;  5K8N A;  2BEI A;  5DWM A;  4ONU A;  5EBV A;  1CJW A;  1ZG7 A;  2B5G A;  1ZG8 A;  3PB9 X;  4OLL A;  2B4B A;  3VWE A;  3PB6 X;  2WUU A;  2V8H A;  3B3V A;  3KHX A;  1V0C A;  2DEA A;  1FNO A;  2VEZ A;  2GE3 A;  3LMS A;  2AE6 A;  2PJ0 A;  5EMI A;  3IU1 A;  3MRU A;  4JWP A;  1Y0Y A;  2VZY A;  1Z8T A;  1ZO0 A;  1YLE A;  5E96 A;  3CDX A;  4Q38 A;  4P44 A;  3WAB A;  4E0A A;  4F8Z A;  5AG4 A;  3FRM A;  3GLJ A;  1S7F A;  3W6S A;  4B5P A;  3F5B A;  1S7K A;  4OP4 A;  4F9V A;  3B3C A;  3JUW A;  3FNC A;  2IJZ A;  4OIW A;  3SJF A;  3RO0 A;  5D8N A;  1M1D A;  1GHE A;  3H5Z A;  4JJX A;  3QNV A;  2G3A A;  3HLP A;  1BOB A;  3SXO A;  1B87 A;  4F0Y A;  4P6Y A;  2P6E A;  3KQZ A;  2IL4 A;  1TF9 A;  4L89 A;  5F48 A;  4KOT A;  5HVH A;  1XF8 A;  4MXU A;  2CTB A;  2EBJ A;  2AFU A;  4M85 A;  3I3G A;  1YLO A;  3W6X A;  4MY0 A;  4P4B A;  4MFL A;  1Q2D A;  2FIA A;  3CPA A;  3I9S A;  2J8R A;  2ZED A;  5KTD A;  2ZOF A;  1ZLH A;  4KOW A;  4P4E A;  4QB9 A;  2CIJ A;  4KSF A;  4P4J A;  3TOA A;  4KLW A;  4CPA A;  1Z8L A;  4ZYQ A;  3JVN A;  4KUB A;  4ORF A;  1ON0 A;  2R8V A;  3PEI A;  5JM6 A;  4A31 A;  4XPK A;  3IWG A;  4UWJ A;  7CPA A;  2ZW6 A;  4KOS A;  2Q7B A;  2Z3O A;  2JLM A;  2ZEM A;  2PJ3 A;  1KZF A;  2PVV A;  3WC7 A;  4M6G A;  2HQY A;  2JBK A;  3RBU A;  3KR5 A;  5HVG A;  3R1K A;  1CX8 A;  2RC4 A;  5K8P A;  3NFZ A;  2PR8 A;  5A28 A;  4AG9 A;  1X10 A;  2NSM A;  2Q04 A;  3FEE A;  3QAY A;  4U5Y A;  4FD4 A;  1AUG A;  3ISX A;  4C7I A;  3FXT A;  3SI2 A;  5F49 A;  4GM5 A;  5C82 A;  4A2Z A;  2CNS A;  2PR1 A;  2XEF A;  3PGP A;  3DR8 A;  4UIA A;  3S9L A;  3IU2 A;  4KZT A;  4OC4 A;  4EFD A;  4MHP A;  3WC6 A;  3D3S A;  4MCP A;  1KWM A;  2OB0 A;  1VKC A;  2C6G A;  1A2Z A;  2Q0Y A;  1BO4 A;  2B4D B;  5D29 A;  2G9D A;  2ZOG A;  4PV6 A;  4B12 A;  1S5K A;  2D4P A;  3B3W A;  5IB9 A;  1QSO A;  5HVF A;  3GYA A;  4ZI6 A;  5CBM A;  4HNW B;  1ELM P;  3B2Y A;  4PQA A;  1LOK A;  4NF1 A;  4H89 A;  2ZEE A;  3IEH A;  4UIB A;  4NGQ A;  1R3N A;  2PVW A;  4GS4 A;  3IWE A;  3TT2 A;  3LD2 A;  1B6B A;  2Z0Z A;  2C1C A;  4UA3 A;  1L0C A;  2AFX A;  4IK2 A;  4Z65 A;  4FAI A;  3KGQ A;  5FVJ A;  4YFJ A;  1MJB A;  3EXN A;  5JQ4 A;  1JQG A;  5LYF A;  2CF4 A;  3KR4 A;  1TKJ A;  3S9M A;  4QBJ A;  1CM0 A;  4MJ8 A;  1Y7E A;  2P6F A;  1M4D A;  1GYT A;  4L8A A;  2PJ7 A;  4OC5 A;  1IYK A;  2WPW A;  2CXA A;  3PBE A;  4CS0 B;  4NGR A;  4MI4 A;  4F0X A;  3H8F A;  2F5I A;  3HUV A;  2GIV A;  2KCW A;  3NE8 A;  3N5F A;  3QAH A;  2Q4Z A;  2YND A;  2EK9 A;  4UWI A;  1PCA A;  2Z3L A;  5I0C A;  2FS5 A;  2VBQ A;  2RFH A;  3S6F A;  3JTK A;  1ELL P;  1XIX A;  3FH4 A;  4FD6 A;  2ATR A;  2JBJ A;  2QML A;  4HNY B;  5GCN A;  1ZG9 A;  3B3T A;  4NGM A;  1YVO A;  4LX9 A;  4A32 A;  3WT4 A;  2AFM A;  3FEC A;  2HB6 A;  3K9T A;  2ZEN A;  2ZXV A;  3BI0 A;  2PJ9 A;  2PJ6 A;  3NH8 A;  4OME A;  3SI0 A;  4YRH A;  2Z3N A;  3CZX A;  3VAR A;  4NGP A;  4K3N A;  4ZX8 A;  1IID A;  4PXE A;  3D67 A;  4NJQ A;  4Q7A A;  1QQ9 A;  2YNC A;  2PJA A;  1VHS A;  2CY2 A;  3D7H A;  4NJR A;  2BUE A;  4C2Y A;  1UWY A;  3EC4 A;  4CGL A;  4O23 A;  2IQ6 A;  4H6Z A;  2YNE A;  2YNC C;  2JEV A;  3DR6 A;  2AFS A;  1S7L A;  1QSM A;  4R57 A;  1IOI A;  3BLN A;  1Y9W A;  5C88 A;  2P0W A;  2AFO A;  4UBR A;  2POK A;  4HKF A;  5G20 A;  1Y9K A;  4Y49 B;  4R87 A;  1MK4 A;  1KUV A;  2DF5 A;  2NMT A;  2ZEL A;  4BD9 A;  1M4L A;  4KOV A;  2OOT A;  4ZX9 A;  3SJE A;  2ANP A;  2ZW5 A;  8CPA A;  2PSW A;  5IB0 A;  4KOU A;  4KVX A;  4UCP A;  3TFY A;  5H86 A;  4CGM A;  4AVA A;  3CXP A;  4U9Z A;  5ISV A;  1NE9 A;  3FVL A;  2GU2 A;  2Z3M A;  1OZP A;  4MFJ A;  5A27 A;  1CPX A;  4P4I A;  1I1D A;  2Y0M A;  2AFW A;  5G22 A;  3S6H A;  3PBB A;  1TKF A;  1YSJ A;  1IB1 E;  1Z8W A;  3LWU A;  3UY5 A;  1IIC A;  4X3R A;  4BIN A;  4NEX A;  2PRB A;  4B5O A;  4CYO A;  3L2N A;  4AG7 A;  4PXD A;  3SI1 A;  4JXQ A;  3A9L A;  3KQX A;  4MCS A;  4X8I A;  4F9U A;  1YME A;  4R8F A;  4XPD B;  2R1I A;  1XOV A;  3P2F A;  2Z3K A;  4X5K A;  2ZPA A;  4FD7 A;  2PDO A;  3TO6 A;  2V8G A;  1CBX A;  4MHY A;  1LAN A;  4YU9 A;  3T90 A;  3TO9 A;  3KHZ A;  5AG5 A;  1EE3 P;  4C7H A;  5BWA B;  4PPZ A;  3V38 A;  4J3G A;  1BPM A;  2J8M A;  3D7F A;  1LRZ A;  1Z5R A;  2J8N A;  3IFE A;  4IUS A;  1IY7 A;  4MY3 A; 
#chains in the Genus database with same CATH homology
 3TE4 A;  1YGH A;  4KOX A;  4PSW A;  3KKW A;  2Q44 A;  2JDD A;  2Z10 A;  4CGN A;  1IYL A;  3BJ8 A;  5HH1 A;  2YGW A;  2OU2 A;  4MHD A;  4UCN A;  3T9Y A;  3GY9 A;  4B11 A;  4R3L A;  4K30 A;  4CAF A;  2WPX A;  4JD6 A;  1Z4E A;  2WSA A;  4RI1 A;  3RYO A;  1S7N A;  4A33 A;  1Q2Y A;  3C26 A;  4QVT A;  3F8K A;  2DPT A;  4XNH B;  3E0K A;  4OAE A;  2VI7 A;  3FB3 A;  4NCZ A;  2B5G B;  3K9U A;  4XPL A;  5IX3 A;  2PC1 A;  2QEC A;  1XE4 A;  4CAV A;  3MGD A;  2AJ6 A;  5JPH A;  4Q36 A;  5HMN A;  5H84 A;  2OH1 A;  4AVB A;  4B10 A;  1QSN A;  4BBH A;  2Q4Y A;  1Z9U A;  2FIW A;  4KVM E;  1S3Z A;  4B5P B;  1Y7R A;  1P4N A;  2BSW A;  3R9G A;  4JLY A;  1I21 A;  3GKR A;  3TO7 A;  2VQY A;  5G1Z A;  4MFZ A;  2FCK A;  4JXR A;  4KUA A;  3QB8 A;  4MBU A;  2OZG A;  2C27 A;  3TCV A;  1M4G A;  5G21 A;  4R9M A;  3S6K A;  2BL1 A;  3NE7 A;  1SQH A;  4E8O A;  2K5T A;  4CAW A;  4UCM A;  3R95 A;  2P6G A;  2GAN A;  4M3S A;  4QC6 A;  2EUI A;  2B4D A;  4B14 A;  4AB7 A;  2B3U A;  3ZJ0 A;  3V8I A;  2FE7 A;  2R98 A;  2I79 A;  4UFV A;  3EY5 A;  2O28 A;  1P0H A;  4CGP A;  1Q2C A;  4XNH C;  2H5M A;  3G3S A;  2R7H A;  2CNM A;  1QST A;  2HUZ A;  5AGE A;  4CYN A;  2A4N A;  3S6G A;  4MFQ A;  3SXN A;  4QUS A;  2OZH A;  4KOR A;  3D8P A;  4I49 A;  2VXK A;  4UFW A;  4CRY B;  4CYP A;  3ZZI A;  3B8G A;  1WWZ A;  5F47 A;  2CNT A;  3DDD A;  4AVC A;  2Z11 A;  2D4O A;  3PZJ A;  4FD5 A;  5EC4 A;  4RS2 A;  4KVO E;  2B3V A;  4PK2 A;  1M4I A;  3OWC A;  1N71 A;  3R9E A;  2B58 A;  3DNS A;  2G3T A;  5CNP A;  4E2A A;  5AG7 A;  3FBU A;  3WR7 A;  2Q4V A;  4CAE A;  2ZW4 A;  4CRZ B;  1RO5 A;  1U6M A;  1J4J A;  2ARH A;  2QIR A;  4NSQ A;  4R3K A;  3IGR A;  3D2P A;  1YK3 A;  4KS9 A;  5DWN A;  1YRE A;  1YVK A;  2PQ8 A;  3DSB A;  5IV0 A;  2I00 A;  4C2Z A;  2HV2 A;  4II9 A;  4C68 A;  3LOD A;  4CGO A;  1Z4R A;  4Y49 C;  1YR0 A;  1K4J A;  1NSL A;  4F6A A;  4KSA A;  1XMT A;  3F0A A;  1XEB A;  1KUX A;  2VZZ A;  2FT0 A;  4UFX A;  3P2H A;  3D2M A;  3FYN A;  4BMH A;  4ZBG A;  2FSR A;  2REF A;  4A95 A;  4DNC A;  4U9Y A;  4NXY A;  2OZU A;  4IF5 A;  3N7Z A;  4B13 A;  1PUA A;  3G8W A;  5KTC A;  3VWD A;  2JDC A;  5J8F A;  1UFH A;  3BJ7 A;  3CXS A;  2DPS A;  2EVN A;  5AG6 A;  4XPD C;  4MFP A;  1RXT A;  3TOB A;  2X7B A;  5KTA A;  1TIQ A;  2FL4 A;  4ZGY B;  1YX0 A;  4A30 A;  1FY7 A;  4KLV A;  1QSR A;  4OAD A;  1MJA A;  1M44 A;  1MJ9 A;  4YGO A;  3H4Q A;  4H6U A;  3EO4 A;  4CAX A;  1R57 A;  4HNX B;  3W91 A;  2REE A;  3TTH A;  3EFA A;  1S60 A;  4PK3 A;  3R96 A;  4KOY A;  5F46 A;  1WK4 A;  2G0B A;  1PU9 A;  1I12 A;  2DXQ A;  4CYQ A;  1KUY A;  3CXQ A;  3FIX A;  3PP9 A;  4EVY A;  2FXF A;  3R9F A;  2ZW7 A;  1NMT A;  4C2X A;  4MFK A;  2Z3P A;  4LUA A;  4PSX A;  5J8C A;  3SHP A;  2BEI A;  5DWM A;  4ONU A;  5EBV A;  1CJW A;  2B5G A;  4OLL A;  2B4B A;  3VWE A;  2WUU A;  1V0C A;  2VEZ A;  2GE3 A;  2AE6 A;  3IU1 A;  4JWP A;  2VZY A;  1ZO0 A;  1YLE A;  5E96 A;  4Q38 A;  5AG4 A;  4E0A A;  3FRM A;  3W6S A;  1S7F A;  4B5P A;  3F5B A;  1S7K A;  3JUW A;  3FNC A;  1M1D A;  1GHE A;  3H5Z A;  4JJX A;  2G3A A;  1BOB A;  3SXO A;  1B87 A;  4F0Y A;  2P6E A;  2IL4 A;  4L89 A;  5F48 A;  4KOT A;  1XF8 A;  4M85 A;  3I3G A;  3W6X A;  4MY0 A;  4MFL A;  1Q2D A;  2FIA A;  3I9S A;  2J8R A;  5KTD A;  4KOW A;  4QB9 A;  4KSF A;  3TOA A;  4KLW A;  3JVN A;  4KUB A;  4ORF A;  1ON0 A;  2R8V A;  4A31 A;  4XPK A;  3IWG A;  4UWJ A;  2ZW6 A;  4KOS A;  2Q7B A;  2Z3O A;  2JLM A;  1KZF A;  2HQY A;  3R1K A;  2RC4 A;  2PR8 A;  5A28 A;  4AG9 A;  2Q04 A;  4U5Y A;  4FD4 A;  4C7I A;  3FXT A;  5F49 A;  5C82 A;  4A2Z A;  3PGP A;  2CNS A;  2PR1 A;  3DR8 A;  3IU2 A;  4KZT A;  3D3S A;  2OB0 A;  1VKC A;  2Q0Y A;  1BO4 A;  2B4D B;  4B12 A;  4PV6 A;  1S5K A;  2D4P A;  1QSO A;  3GYA A;  4HNW B;  4NF1 A;  4H89 A;  4GS4 A;  3IWE A;  3TT2 A;  3LD2 A;  1B6B A;  2Z0Z A;  4UA3 A;  1L0C A;  5FVJ A;  4YFJ A;  1MJB A;  3EXN A;  5JQ4 A;  4QBJ A;  1CM0 A;  4MJ8 A;  2P6F A;  1M4D A;  4L8A A;  1IYK A;  2WPW A;  2CXA A;  4CS0 B;  4MI4 A;  4F0X A;  2F5I A;  2GIV A;  2KCW A;  3QAH A;  4UWI A;  2YND A;  2Z3L A;  5I0C A;  2FS5 A;  2VBQ A;  3S6F A;  3JTK A;  1XIX A;  5GCN A;  4FD6 A;  4HNY B;  2ATR A;  2QML A;  4A32 A;  1YVO A;  4LX9 A;  2ZXV A;  4YRH A;  2Z3N A;  1IID A;  2YNC A;  1VHS A;  2CY2 A;  2BUE A;  4C2Y A;  3EC4 A;  4CGL A;  4H6Z A;  2YNE A;  2YNC C;  2JEV A;  3DR6 A;  1S7L A;  1QSM A;  4R57 A;  3BLN A;  1Y9W A;  5C88 A;  2P0W A;  4UBR A;  4HKF A;  5G20 A;  1Y9K A;  4Y49 B;  4R87 A;  1MK4 A;  1KUV A;  2NMT A;  4KOV A;  2ZW5 A;  2PSW A;  5IB0 A;  4KOU A;  4KVX A;  4UCP A;  3TFY A;  5H86 A;  4CGM A;  4AVA A;  3CXP A;  4U9Z A;  5ISV A;  1NE9 A;  2Z3M A;  1OZP A;  4MFJ A;  5A27 A;  1I1D A;  2Y0M A;  5G22 A;  3S6H A;  1IB1 E;  3UY5 A;  1IIC A;  4NEX A;  2PRB A;  4B5O A;  4CYO A;  4AG7 A;  4JXQ A;  3A9L A;  4XPD B;  2R1I A;  3P2F A;  2Z3K A;  4X5K A;  2ZPA A;  4FD7 A;  2PDO A;  3TO6 A;  3T90 A;  3TO9 A;  5AG5 A;  4C7H A;  5BWA B;  4J3G A;  2J8M A;  1LRZ A;  2J8N A;  4IUS A;  4MY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...