3BJ7A

Spermine/spermidine n1-acetyltransferase from mouse: crystal structure of a ternary complex reveals solvent-mediated spermine binding
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
162
Chain Sequence
KFKIRPATASDCSDILRLIKELAKYEYMEDQVILTEKDLQEDGFGEHPFYHCLVAEVPPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMKCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Diamine acetyltransferase 1
publication title The crystal structure of spermidine/spermine N1-acetyltransferase in complex with spermine provides insights into substrate binding and catalysis.
pubmed doi rcsb
source organism Mus musculus
total genus 42
structure length 162
sequence length 167
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2007-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3bj7A00
4R87A 2Q0YA 2B3UA 4FD6A 3EO4A 4QVTA 2Q4YA 2JDCA 3LD2A 2GIVA 4AVCA 4IUSA 2EUIA 4RS2A 4X5KA 3T90A 2FIWA 4M3SA 2Z0ZA 3VWEA 2GANA 4KOSA 2A4NA 1GHEA 2ZW7A 3H4QA 1Z4RA 3QB8A 3OWCA 4PV6A 3TOBA 1SQHA 2G3TA 3DR8A 2PR8A 2HV2A 1IYKA 3D2PA 1CM0A 1V0CA 2QMLA 3R96A 4YFJA 1Y9KA 2P6GA 1Y7RA 3N7ZA 4LUAA 2J8MA 5F46A 4FD7A 4JXRA 2ATRA 2D4OA 2FS5A 2OZHA 1WWZA 1Y9WA 4CAWA 3CXQA 5KTCA 3D3SA 5C88A 4XNHB 4CAVA 3R1KA 2CNMA 4KVOE 2B58A 1M4IA 4DNCA 2FIAA 1M1DA 2Z10A 3TCVA 1S60A 2R1IA 4XPLA 3TFYA 1Q2CA 2PSWA 1S7LA 1IYLA 2HQYA 3QAHA 2KCWA 3DR6A 2FE7A 1XF8A 4E2AA 4J3GA 1KUVA 1YX0A 1P4NA 4PSWA 4UWIA 2OU2A 2C27A 2RC4A 3S6KA 1R57A 2NMTA 1MJBA 5I0CA 2I00A 2VXKA 3PP9A 2D4PA 4H6UA 4R9MA 5F49A 3GYAA 2OZUA 1P0HA 1XIXA 4EVYA 4JLYA 2QECA 4NXYA 1KUXA 4HNWB 2VZYA 2BUEA 2PQ8A 4KVXA 1B6BA 3DSBA 2JLMA 4MY0A 2FCKA 4QUSA 5JQ4A 4KVME 4FD5A 5JPHA 1FY7A 4GS4A 3W6SA 4NCZA 2VQYA 1Z4EA 4NEXA 3RYOA 5E96A 3F0AA 3R9FA 3TTHA 3SXOA 1NSLA 1I12A 2P6EA 2AJ6A 1VKCA 2PDOA 1YLEA 1CJWA 4R3LA 4KUAA 2PRBA 3ZJ0A 5CNPA 1XEBA 4PK3A 4KLWA 2CY2A 3PGPA 3IWGA 4U9ZA 5KTAA 3PZJA 5F47A 4Y49C 2VEZA 3I9SA 3I3GA 4M85A 1UFHA 3S6FA 5GCNA 1KZFA 4PSXA 4KOXA 3TE4A 4KORA 4JJXA 2VI7A 2EVNA 4AG7A 1Q2YA 2B4BA 2BEIA 1S7FA 1LRZA 3G8WA 2JEVA 2Q7BA 2P6FA 4KUBA 1PU9A 2I79A 3T9YA 1M44A 2H5MA 3V8IA 2J8RA 3EY5A 3GY9A 4QC6A 2R7HA 1YK3A 2ZW5A 4E8OA 5KTDA 4LX9A 4BMHA 4QBJA 1QSMA 3DNSA 1WK4A 4JD6A 4HNYB 2JDDA 2B5GB 3GKRA 4I49A 3R95A 1PUAA 3F5BA 3LODA 2FL4A 2OB0A 4ONUA 4PK2A 2ZXVA 3P2FA 4UWJA 1B87A 2Q4VA 2BL1A 2FT0A 3R9GA 4II9A 5DWNA 3S6GA 1TIQA 5FVJA 1IB1E 1MJAA 1S5KA 1MK4A 1QSTA 2FXFA 2REFA 4AVAA 4IF5A 1Z9UA 3K9UA 4U9YA 4KOTA 3TO6A 1YVKA 1N71A 2BSWA 5IB0A 3D8PA 4Y49B 3NE7A 2PC1A 3KKWA 3TO7A 4ORFA 4L8AA 2R98A 1RXTA 4XPDC 1OZPA 3SHPA 5ISVA 4JWPA 5EC4A 2X7BA 3CXSA 4K30A 4MBUA 1L0CA 4KLVA 4H6ZA 4OAEA 5J8CA 1VHSA 3R9EA 4CRYB 2Y0MA 1XMTA 3TO9A 1MJ9A 3FBUA 4B5OA 3G3SA 3S6HA 1S3ZA 2CNSA 1I1DA 4B5PB 4MJ8A 2B5GA 4UA3A 1QSRA 2PR1A 1QSNA 4FD4A 1XE4A 1BOBA 4KOWA 2R8VA 4F0YA 2HUZA 2O28A 1K4JA 2ZW4A 2VBQA 4MI4A 1YR0A 3JVNA 4UBRA 2B4DB 4KOYA 2REEA 3FIXA 3FYNA 1YVOA 2ZW6A 2P0WA 1Q2DA 5H86A 1NE9A 5H84A 2QIRA 4XPDB 4MY3A 4F6AA 5EBVA 4CAXA 3BJ8A 1ON0A 2OH1A 4E0AA 3D2MA 4YGOA 4HNXB 1I21A 3P2HA 2FSRA 4OLLA 2VZZA 1IIDA 4MHDA 3TT2A 1BO4A 4B5PA 2ZPAA 1NMTA 3SXNA 4XPKA 3EXNA 4OADA 3C26A 1M4GA 3W91A 3F8KA 5J8FA 4R3KA 4CS0B 2IL4A 2DXQA 2Z11A 4AVBA 1S7NA 3B8GA 4AG9A 4JXQA 2K5TA 2G3AA 5IX3A 2Q04A 4AB7A 2AE6A 2B4DA 5F48A 4CRZB 1M4DA 4HKFA 1QSOA 3DDDA 1YREA 1S7KA 2Q44A 2CNTA 3ZZIA 3FRMA 2B3VA 4NF1A 3E0KA 3WR7A 4L89A 4QB9A 4RI1A 3UY5A 1YGHA 2ARHA 2F5IA 3BJ7A 4KOUA 3FXTA 3BLNA 4NSQA 2G0BA 5DWMA 5HMNA 2WPWA 3VWDA 4R57A 4KZTA 3FB3A 3FNCA 4YRHA 3CXPA 3MGDA 1IICA 4KOVA 1RO5A 2OZGA 4XNHC 5IV0A 1U6MA 4U5YA 2GE3A 3IGRA 2J8NA 2WPXA 4H89A 3EFAA 1J4JA 3EC4A 5C82A 4ZBGA 5HH1A 3TOAA 1KUYA 3W6XA 3JUWA
chains in the Genus database with same CATH superfamily
4R87A 2Q0YA 2B3UA 4FD6A 3NA6A 1AMPA 3EO4A 4QVTA 1ZG8A 2JBJA 2Q4YA 4OC1A 3D7FA 2JDCA 3LD2A 5D8NA 2GIVA 1LANA 4OKOA 5HVFA 4NGNA 4UEZA 1JWQA 4AVCA 2XEIA 4IUSA 2EUIA 4RS2A 3IU2A 3BHXA 4X5KA 3T90A 4R8FA 1ARMA 3H5ZA 2FIWA 4M3SA 3JRUA 2Z0ZA 1EE3P 2PJ9A 4A33A 3VWEA 2WUUA 5LRJA 2GANA 5K8MA 2Z3MA 4KOSA 2A4NA 3MRUA 3SI1A 1GHEA 2ZW7A 3H4QA 4KSAA 4P44A 1Z4RA 2PJ1A 3QB8A 1YSJA 2AFUA 3OWCA 4PV6A 3WT4A 3FEDA 3TOBA 2C6PA 1SQHA 2G3TA 3DR8A 2PR8A 4AXVA 1NSAA 3D68A 2HV2A 5G21A 3HUVA 4UFWA 1IYKA 4KSIA 4PXEA 1TKHA 3D2PA 3LWUA 5D29A 1A2ZA 5JGFA 3NH5A 1CM0A 1AUGA 1V0CA 2QMLA 3R96A 3KQZA 4YFJA 1Y9KA 1F2OA 2P6GA 4UCMA 1Y7RA 3FF3A 3PB4X 4IAVA 1R3NA 4MFKA 5BWAB 2PVWA 2WYRA 4Q38A 3N7ZA 4LUAA 2PJAA 3NE8A 1CX8A 2J8MA 3NFZA 5F46A 4FD7A 3V38A 4JXRA 2ATRA 3VATA 2AFMA 2PJBA 2D4OA 3WC7A 1GYTA 2FS5A 2OZHA 4NGTA 1WWZA 1XJOA 3TC8A 1ELLP 1Y9WA 4MCPA 4CAWA 1BPMA 3CXQA 4JZ0A 5KTCA 3D3SA 5C88A 2JEWA 4XNHB 3WC6A 4UFXA 4CAVA 1IGBA 3R1KA 4CAEA 2G9DA 2CNMA 2NYQA 2V77A 2ZOGA 3CZXA 4KVOE 2B58A 1F2PA 1M4IA 4DNCA 2FIAA 1M1DA 2Z10A 3TCVA 1S60A 2YNCC 2R1IA 3KQXA 2PJ6A 4GM5A 4MCSA 7CPAA 4XPLA 1CPXA 3TFYA 4K3NA 3IWEA 1IY7A 1Q2CA 2CTCA 3L2NA 4OC4A 4ZY2A 2O53A 2PSWA 4C7HA 4NJQA 1ZO0A 4C68A 4UFVA 4P4EA 3BI1A 1S7LA 4A2ZA 1IYLA 2HQYA 3HLPA 3IIBA 4C2YA 3B2YA 3QAHA 2KCWA 1HDUA 3DR6A 2FE7A 1XF8A 4E2AA 5J1QA 4ZYQA 2Q43A 4J3GA 1KUVA 4A32A 1IU8A 4ZX9A 2AFZA 1YX0A 2ZEEA 3K2KA 3D66A 1P4NA 4PSWA 4UWIA 2OU2A 2C27A 2RC4A 1Y0YA 3S6KA 1R57A 5LYIA 4MCRA 2NMTA 1MJBA 5I0CA 3D7DA 2VL1A 1QMUA 2I00A 2GLJA 3RZAA 2VXKA 4FWUA 5AG7A 4CYOA 3PP9A 3IC1A 4MFPA 2D4PA 4UIAA 4H6UA 4R9MA 4TWEA 3GYAA 5F49A 2OZUA 1P0HA 1XIXA 4MXUA 3WC5A 3WABA 4OIDA 4JLYA 4EVYA 4MMOA 4P4BA 4B12A 4M6IA 1LCPA 2QECA 4NXYA 1KUXA 3FEEA 2GU2A 2BOAA 5JH9A 4HNWB 2VZYA 2Z3LA 2BUEA 3B3SA 4B13A 3CDXA 2PJ3A 2PQ8A 4KVXA 3KGQA 4OMEA 1B6BA 1F57A 2EK9A 3DSBA 2JLMA 4MY0A 2FCKA 4QUSA 2ZOFA 4CGNA 4MHZA 5JQ4A 4GXHA 4KVME 2ZEGA 4PXDA 2WSAA 4A39A 3SJGA 3H8GA 4FD5A 3D7GA 1FY7A 4GS4A 3W6SA 4P10A 4BD9A 5CPAA 5JPHA 1CP7A 4MHYA 4OIWA 4NCZA 2VQYA 1Z4EA 3N5FA 4NEXA 3RYOA 5E96A 2EWBA 3F0AA 3R9FA 3TTHA 1YMEA 3SXOA 1NSLA 2V8GA 1I12A 1X12A 2P6EA 2AJ6A 2F8HA 1VKCA 4BINA 1Q7LA 2PDOA 1ELMP 1YLEA 1CJWA 3MN8A 4X3RA 2AFWA 4R3LA 3PBEA 4KUAA 4ZI6A 2PIZA 2YNEA 2PRBA 3GUXA 5CBMA 4P6YA 1KWMA 2JBKA 3ZJ0A 3PBBA 4CGMA 5CNPA 1XEBA 4PK3A 4KLWA 1XOVA 2CY2A 3CPAA 3PGPA 4Q7AA 3IWGA 3IWWA 4OC2A 3NH4A 4U9ZA 2EBJA 5KTAA 3PZJA 5F47A 1Z8LA 2VEZA 4Y49C 4P4FA 3I9SA 3B3TA 3T8WA 4RUHA 3I3GA 3BI0A 4M85A 1XMBA 1UFHA 1M4LA 3S6FA 4F9VA 5GCNA 1KZFA 2DF5A 4MFLA 4PSXA 4R76A 4ZX8A 4KOXA 4X2TA 4MFJA 3TE4A 1XRYA 3LMSA 2Q7SA 4JJXA 1XBUA 4KORA 2BCOA 2ZEFA 2VI7A 2EVNA 3PB8X 4NGSA 3RAMA 3FECA 2PJCA 4NGMA 4AG7A 1Q2YA 2B4BA 2BEIA 1S7FA 2DEAA 4MHPA 4B10A 1LRZA 3G8WA 5AG4A 4IK2A 2JEVA 4WWVA 2Q7BA 4EMEA 2P6FA 4KUBA 3JTKA 2FVGA 1PU9A 2RFHA 2I79A 3T9YA 5JM6A 1M44A 5AG5A 2H5MA 1JQGA 3TX8A 2J8RA 3V8IA 3EY5A 3GY9A 2PIYA 4QC6A 2R7HA 3KASA 5THWA 3PB7X 1YK3A 2QJ8A 2ZW5A 4E8OA 5KTDA 3KL9A 4LX9A 4BMHA 4LQ6A 4QBJA 1QSMA 3DNSA 1WK4A 2ZEHA 4H2KA 4JD6A 1CG2A 2JDDA 2B5GB 2GREA 3GKRA 4HNYB 4I49A 1PUAA 3R95A 4A38A 3F5BA 3LODA 4ZGYB 2FL4A 1X10A 5HVHA 2YNCA 3FX6A 2OB0A 4ONUA 4PK2A 2ZXVA 3P2FA 1Z5RA 1VIXA 4UWJA 1B87A 1TF9A 3IU1A 2Q4VA 4FAIA 1VHOA 2BL1A 2FT0A 3R9GA 1BPNA 4RN7A 5A27A 4II9A 4MCQA 5DWNA 1VHEA 2PCUA 2PJ8A 1LFWA 4OC3A 3S6GA 4B6ZA 1TIQA 5FVJA 1IB1E 1MJAA 1S5KA 4P4IA 1MK4A 1HDQA 1QSTA 2FXFA 4CYNA 2REFA 3VH9A 5K8NA 5LRKA 4AVAA 4IF5A 1Z9UA 3S9LA 3K9UA 2ODFA 4KOTA 4U9YA 1R43A 3KI9A 3TO6A 1YVKA 1N71A 5AG6A 2BSWA 3H8FA 5A28A 5IB0A 2WZNA 3D8PA 2C1CA 3NE7A 4Y49B 2PC1A 1DE4C 3CPXA 3KKWA 5EMIA 3TO7A 2CTBA 4ORFA 4WJBA 2Z3OA 4L8AA 2R98A 1RXTA 3B3WA 3D4UA 4XPDC 4MFQA 4B14A 1OZPA 4FUUA 2QYVA 3SHPA 4JWPA 5ISVA 5EC4A 1TXRA 2X7BA 3B3VA 1IOIA 3PFEA 3CXSA 4K30A 4MBUA 4FBEA 3QNVA 1L0CA 4C7IA 4KLVA 4H6ZA 4OAEA 3D7HA 2DPSA 5J8CA 1VHSA 2ZELA 3R9EA 2AFXA 4CRYB 4ZY1A 2Y0MA 1XMTA 3TO9A 4A94A 1MJ9A 3FBUA 4B5OA 4YWYA 4HPSA 2EK8A 3G3SA 4PPZA 1S3ZA 1FT7A 2CNSA 3S6HA 1I1DA 4PXBA 3K9TA 1LOKA 4B5PB 4F8ZA 4MJ8A 2B5GA 4UA3A 1Z2LA 4NFRA 3LACA 2ANPA 2XEGA 4UCPA 3RBUA 1QSRA 1Y7EA 1YW6A 3B3CA 3IFEA 2IMOA 2PR1A 3IJ3A 2ABZA 1QSNA 3NH8A 1CP6A 2PJ7A 3SJXA 4FD4A 1XE4A 2C6GA 4M6HA 3V7ZA 5G1ZA 1BOBA 4PQAA 4IHMA 3KHXA 5HXDA 1QQ9A 1ZLHA 2ZENA 4KOWA 3DLJA 2R8VA 2ZEOA 4PXCA 5I4MA 4A30A 2HUZA 4F0YA 1ARLA 4F0XA 2O28A 3PB9X 1K4JA 4Q36A 1PYTB 1RTQA 4P4JA 4CGLA 2ZW4A 2XEFA 2VBQA 4MI4A 2ZEMA 1YR0A 3JVNA 1LAMA 4CYQA 5K8OA 4UBRA 2B4DB 4M6GA 2ZEDA 4YU9A 4KOYA 1YLOA 4CGOA 3GB0A 3SI2A 2PRQA 2REEA 3FIXA 2OR4A 3FYNA 4DUKA 1TF8A 1YVOA 4Z65A 2ZW6A 2P0WA 1Z8WA 2YNDA 3FMCA 4F9UA 2EO8A 3D67A 1Q2DA 5H86A 1CPSA 2PJ2A 1NE9A 5ELYA 4OP4A 4P45A 4A37A 3KHZA 1BLLE 5H84A 3RNZA 3RO0A 1DTDA 2AFSA 4R6TA 4CPAA 4MHNA 2QIRA 1CBXA 2CXAA 3B35A 2IJZA 3BXMA 4MY3A 4R7MA 4XPDB 4F6AA 4O23A 2J9AA 5EBVA 3BJ8A 2GFQA 4NGPA 4CAXA 5K8PA 1ON0A 5AGEA 2OH1A 4B11A 4E0AA 3SJFA 3D2MA 3PB6X 4UF4A 4YGOA 4HNXB 1I21A 4UCNA 2V8HA 3P2HA 1TKJA 1Z8TA 2FSRA 4OLLA 2VZZA 1BAVA 1IIDA 5LYFA 4C2ZA 2F7VA 4MHDA 1Y0RA 1YW4A 3TT2A 4BBHA 3FJUA 2OOTA 2YGWA 2Z3PA 2PE3A 2Q51A 3I1UA 1BO4A 4B5PA 3KZWA 2CF4A 3GLJA 2ZPAA 1NMTA 4KS9A 5LYDA 1IOFA 3SXNA 4A95A 4C2XA 3IEHA 4A31A 4XPKA 3S9NA 3EXNA 2ZEPA 4OADA 6CPAA 3C26A 1M4GA 1OBRA 2O4HA 3W91A 3F8KA 5J8FA 4R3KA 4MFZA 4X8IA 4CS0B 4DJLA 1XFOA 2IL4A 2DXQA 2PJ5A 1TKFA 3ISZA 2Z11A 3GIUA 3B7IA 2Q4ZA 2BO9A 2NSMA 1S7NA 1ZG9A 2POKA 4KSFA 4AVBA 2V8DA 4UEEA 3FH4A 4JYWA 3VARA 3B8GA 4AG9A 4JXQA 2K5TA 2G3AA 4CAFA 5IX3A 4P4DA 3DGVA 2Q04A 4AB7A 5F09A 3A9LA 2AE6A 2HB6A 3PEIA 5G20A 2B4DA 5F48A 4TNUA 4CRZB 3KR5A 4OC0A 5DS0A 1M4DA 5G22A 4NGRA 4HKFA 1QSOA 2DPTA 4ONWA 3DDDA 1YREA 4G1PA 3PRTA 8CPAA 1Z8XA 1S7KA 2HC9A 4OC5A 1UWYA 4EWTA 1YQEA 2Q44A 2CNTA 3ZZIA 3FRMA 2B3VA 1AYEA 4NF1A 5HVGA 3E0KA 4CYPA 3WR7A 2XEJA 4L89A 4QB9A 4RI1A 3UY5A 4EFDA 1YGHA 2ARHA 2F5IA 3BJ7A 4KOUA 4LQGA 3FXTA 3BLNA 4NJRA 2G0BA 2PJ4A 4NSQA 5DWMA 5HMNA 2WPWA 2RB7A 2Z3KA 3VWDA 1VGYA 4R57A 2PVVA 4KZTA 4DYOA 3H8EA 3CT9A 1FNOA 3FB3A 3FNCA 2GLFA 2Z3NA 3ISXA 3KR4A 4YRHA 3PFOA 3CXPA 1LAPA 2V8VA 3MGDA 1IICA 4MRIA 4UEFA 3S9MA 2IQ6A 3SJEA 4KOVA 4W9YA 1RO5A 1PCAA 2OZGA 4ZY0A 4XNHC 1ZG7A 2AFOA 4UIBA 3IO1A 3SI0A 5IV0A 1U6MA 4U5YA 2PJ0A 2GE3A 3IGRA 1HEEA 4NGQA 2I3CA 2J8NA 2WPXA 5IB9A 5LRGA 1H8LA 4H89A 2C6CA 4CGPA 3EFAA 1ZLIA 5LYLA 1J4JA 3EC4A 5C82A 3FVLA 3QAYA 4ZBGA 5HH1A 3TOAA 1KUYA 2QVPA 3W6XA 3JUWA 2CIJA
chains in the Genus database with same CATH topology
4R87A 2Q0YA 2B3UA 4FD6A 3EO4A 4QVTA 2Q4YA 2JDCA 3LD2A 2GIVA 4AVCA 4IUSA 2EUIA 4RS2A 3IU2A 4X5KA 3T90A 3H5ZA 2FIWA 4M3SA 2Z0ZA 4A33A 3VWEA 2WUUA 2GANA 2Z3MA 4KOSA 2A4NA 1GHEA 2ZW7A 3H4QA 4KSAA 1Z4RA 3QB8A 3OWCA 4PV6A 3TOBA 1SQHA 2G3TA 3DR8A 2PR8A 2HV2A 5G21A 4UFWA 1IYKA 3D2PA 1CM0A 1V0CA 2QMLA 3R96A 4YFJA 1Y9KA 2P6GA 4UCMA 1Y7RA 4MFKA 5BWAB 4Q38A 3N7ZA 4LUAA 2J8MA 5F46A 4FD7A 4JXRA 2ATRA 2D4OA 2FS5A 2OZHA 1WWZA 1Y9WA 4CAWA 3CXQA 5KTCA 3D3SA 5C88A 4XNHB 4UFXA 4CAVA 3R1KA 4CAEA 2CNMA 4KVOE 2B58A 1M4IA 4DNCA 2FIAA 1M1DA 2Z10A 3TCVA 1S60A 2YNCC 2R1IA 4XPLA 3TFYA 3IWEA 1Q2CA 2PSWA 4C7HA 1ZO0A 4C68A 4UFVA 1S7LA 4A2ZA 1IYLA 2HQYA 4C2YA 3QAHA 2KCWA 3DR6A 2FE7A 1XF8A 4E2AA 4J3GA 1KUVA 4A32A 1YX0A 1P4NA 4PSWA 4UWIA 2OU2A 2C27A 2RC4A 3S6KA 1R57A 2NMTA 1MJBA 5I0CA 2I00A 2VXKA 5AG7A 4CYOA 3PP9A 4MFPA 2D4PA 4H6UA 4R9MA 5F49A 3GYAA 2OZUA 1P0HA 1XIXA 4EVYA 4JLYA 4B12A 2QECA 4NXYA 1KUXA 4HNWB 2VZYA 2Z3LA 2BUEA 4B13A 2PQ8A 4KVXA 1B6BA 3DSBA 2JLMA 4MY0A 2FCKA 4QUSA 4CGNA 5JQ4A 4KVME 2WSAA 4FD5A 5JPHA 1FY7A 4GS4A 3W6SA 4NCZA 2VQYA 1Z4EA 4NEXA 3RYOA 5E96A 3F0AA 3R9FA 3TTHA 3SXOA 1NSLA 1I12A 2P6EA 2AJ6A 1VKCA 2PDOA 1YLEA 1CJWA 4R3LA 4KUAA 2YNEA 2PRBA 3ZJ0A 4CGMA 5CNPA 1XEBA 4PK3A 4KLWA 2CY2A 3PGPA 3IWGA 4U9ZA 5KTAA 3PZJA 5F47A 4Y49C 2VEZA 3I9SA 3I3GA 4M85A 1UFHA 3S6FA 5GCNA 1KZFA 4MFLA 4PSXA 4KOXA 4MFJA 3TE4A 4KORA 4JJXA 2VI7A 2EVNA 4AG7A 1Q2YA 2B4BA 2BEIA 1S7FA 4B10A 1LRZA 3G8WA 5AG4A 2JEVA 2Q7BA 2P6FA 4KUBA 3JTKA 1PU9A 2I79A 3T9YA 1M44A 5AG5A 2H5MA 3V8IA 2J8RA 3EY5A 3GY9A 4QC6A 2R7HA 1YK3A 2ZW5A 4E8OA 5KTDA 4LX9A 4BMHA 4QBJA 1QSMA 3DNSA 1WK4A 4JD6A 4HNYB 2JDDA 2B5GB 3GKRA 4I49A 3R95A 1PUAA 3F5BA 3LODA 4ZGYB 2FL4A 2YNCA 2OB0A 4ONUA 4PK2A 2ZXVA 3P2FA 4UWJA 1B87A 2Q4VA 2BL1A 2FT0A 3R9GA 5A27A 4II9A 5DWNA 3S6GA 1TIQA 5FVJA 1IB1E 1MJAA 1S5KA 1MK4A 1QSTA 4CYNA 2FXFA 2REFA 4AVAA 4IF5A 1Z9UA 3K9UA 4U9YA 4KOTA 3TO6A 1YVKA 1N71A 5AG6A 2BSWA 5A28A 5IB0A 3D8PA 4Y49B 3NE7A 2PC1A 3KKWA 3TO7A 4ORFA 2Z3OA 4L8AA 2R98A 1RXTA 4XPDC 4MFQA 4B14A 1OZPA 3SHPA 5ISVA 4JWPA 5EC4A 2X7BA 3CXSA 4K30A 4MBUA 1L0CA 4C7IA 4KLVA 4H6ZA 4OAEA 2DPSA 5J8CA 1VHSA 3R9EA 4CRYB 2Y0MA 1XMTA 3TO9A 1MJ9A 3FBUA 4B5OA 3G3SA 3S6HA 1S3ZA 2CNSA 1I1DA 4B5PB 4MJ8A 2B5GA 4UA3A 4UCPA 1QSRA 2PR1A 1QSNA 4FD4A 1XE4A 5G1ZA 1BOBA 4KOWA 2R8VA 4A30A 2HUZA 4F0YA 4F0XA 2O28A 1K4JA 4Q36A 4CGLA 2ZW4A 2VBQA 4MI4A 1YR0A 3JVNA 4CYQA 4UBRA 2B4DB 4KOYA 4CGOA 2REEA 3FIXA 3FYNA 1YVOA 2ZW6A 2P0WA 2YNDA 1Q2DA 5H86A 1NE9A 5H84A 2QIRA 2CXAA 4XPDB 4MY3A 4F6AA 5EBVA 4CAXA 3BJ8A 1ON0A 5AGEA 2OH1A 4B11A 4E0AA 3D2MA 4YGOA 4HNXB 1I21A 4UCNA 3P2HA 2FSRA 4OLLA 2VZZA 1IIDA 4C2ZA 4MHDA 3TT2A 4BBHA 2YGWA 2Z3PA 1BO4A 4B5PA 4KS9A 2ZPAA 1NMTA 3SXNA 4A95A 4C2XA 4A31A 4XPKA 3EXNA 4OADA 3C26A 1M4GA 3W91A 3F8KA 5J8FA 4R3KA 4MFZA 4CS0B 2IL4A 2DXQA 2Z11A 4AVBA 1S7NA 4KSFA 3B8GA 4AG9A 4JXQA 2K5TA 2G3AA 4CAFA 5IX3A 2Q04A 4AB7A 3A9LA 2AE6A 5G20A 2B4DA 5F48A 4CRZB 1M4DA 5G22A 4HKFA 1QSOA 2DPTA 3DDDA 1YREA 1S7KA 2Q44A 2CNTA 3ZZIA 3FRMA 2B3VA 4NF1A 3E0KA 4CYPA 3WR7A 4L89A 4QB9A 4RI1A 3UY5A 1YGHA 2ARHA 2F5IA 3BJ7A 4KOUA 3FXTA 3BLNA 4NSQA 2G0BA 5DWMA 5HMNA 2WPWA 2Z3KA 3VWDA 4R57A 4KZTA 3FB3A 3FNCA 2Z3NA 4YRHA 3CXPA 3MGDA 1IICA 4KOVA 1RO5A 2OZGA 4XNHC 5IV0A 1U6MA 4U5YA 2GE3A 3IGRA 2J8NA 2WPXA 4H89A 4CGPA 3EFAA 1J4JA 3EC4A 5C82A 4ZBGA 5HH1A 3TOAA 1KUYA 3IU1A 3W6XA 3JUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R87 A;  2Q0Y A;  2B3U A;  4FD6 A;  3EO4 A;  4QVT A;  2Q4Y A;  2JDC A;  3LD2 A;  2GIV A;  4AVC A;  4IUS A;  2EUI A;  4RS2 A;  4X5K A;  3T90 A;  2FIW A;  4M3S A;  2Z0Z A;  3VWE A;  2GAN A;  4KOS A;  2A4N A;  1GHE A;  2ZW7 A;  3H4Q A;  1Z4R A;  3QB8 A;  3OWC A;  4PV6 A;  3TOB A;  1SQH A;  2G3T A;  3DR8 A;  2PR8 A;  2HV2 A;  1IYK A;  3D2P A;  1CM0 A;  1V0C A;  2QML A;  3R96 A;  4YFJ A;  1Y9K A;  2P6G A;  1Y7R A;  3N7Z A;  4LUA A;  2J8M A;  5F46 A;  4FD7 A;  4JXR A;  2ATR A;  2D4O A;  2FS5 A;  2OZH A;  1WWZ A;  1Y9W A;  4CAW A;  3CXQ A;  5KTC A;  3D3S A;  5C88 A;  4XNH B;  4CAV A;  3R1K A;  2CNM A;  4KVO E;  2B58 A;  1M4I A;  4DNC A;  2FIA A;  1M1D A;  2Z10 A;  3TCV A;  1S60 A;  2R1I A;  4XPL A;  3TFY A;  1Q2C A;  2PSW A;  1S7L A;  1IYL A;  2HQY A;  3QAH A;  2KCW A;  3DR6 A;  2FE7 A;  1XF8 A;  4E2A A;  4J3G A;  1KUV A;  1YX0 A;  1P4N A;  4PSW A;  4UWI A;  2OU2 A;  2C27 A;  2RC4 A;  3S6K A;  1R57 A;  2NMT A;  1MJB A;  5I0C A;  2I00 A;  2VXK A;  3PP9 A;  2D4P A;  4H6U A;  4R9M A;  5F49 A;  3GYA A;  2OZU A;  1P0H A;  1XIX A;  4EVY A;  4JLY A;  2QEC A;  4NXY A;  1KUX A;  4HNW B;  2VZY A;  2BUE A;  2PQ8 A;  4KVX A;  1B6B A;  3DSB A;  2JLM A;  4MY0 A;  2FCK A;  4QUS A;  5JQ4 A;  4KVM E;  4FD5 A;  5JPH A;  1FY7 A;  4GS4 A;  3W6S A;  4NCZ A;  2VQY A;  1Z4E A;  4NEX A;  3RYO A;  5E96 A;  3F0A A;  3R9F A;  3TTH A;  3SXO A;  1NSL A;  1I12 A;  2P6E A;  2AJ6 A;  1VKC A;  2PDO A;  1YLE A;  1CJW A;  4R3L A;  4KUA A;  2PRB A;  3ZJ0 A;  5CNP A;  1XEB A;  4PK3 A;  4KLW A;  2CY2 A;  3PGP A;  3IWG A;  4U9Z A;  5KTA A;  3PZJ A;  5F47 A;  4Y49 C;  2VEZ A;  3I9S A;  3I3G A;  4M85 A;  1UFH A;  3S6F A;  5GCN A;  1KZF A;  4PSX A;  4KOX A;  3TE4 A;  4KOR A;  4JJX A;  2VI7 A;  2EVN A;  4AG7 A;  1Q2Y A;  2B4B A;  2BEI A;  1S7F A;  1LRZ A;  3G8W A;  2JEV A;  2Q7B A;  2P6F A;  4KUB A;  1PU9 A;  2I79 A;  3T9Y A;  1M44 A;  2H5M A;  3V8I A;  2J8R A;  3EY5 A;  3GY9 A;  4QC6 A;  2R7H A;  1YK3 A;  2ZW5 A;  4E8O A;  5KTD A;  4LX9 A;  4BMH A;  4QBJ A;  1QSM A;  3DNS A;  1WK4 A;  4JD6 A;  4HNY B;  2JDD A;  2B5G B;  3GKR A;  4I49 A;  3R95 A;  1PUA A;  3F5B A;  3LOD A;  2FL4 A;  2OB0 A;  4ONU A;  4PK2 A;  2ZXV A;  3P2F A;  4UWJ A;  1B87 A;  2Q4V A;  2BL1 A;  2FT0 A;  3R9G A;  4II9 A;  5DWN A;  3S6G A;  1TIQ A;  5FVJ A;  1IB1 E;  1MJA A;  1S5K A;  1MK4 A;  1QST A;  2FXF A;  2REF A;  4AVA A;  4IF5 A;  1Z9U A;  3K9U A;  4U9Y A;  4KOT A;  3TO6 A;  1YVK A;  1N71 A;  2BSW A;  5IB0 A;  3D8P A;  4Y49 B;  3NE7 A;  2PC1 A;  3KKW A;  3TO7 A;  4ORF A;  4L8A A;  2R98 A;  1RXT A;  4XPD C;  1OZP A;  3SHP A;  5ISV A;  4JWP A;  5EC4 A;  2X7B A;  3CXS A;  4K30 A;  4MBU A;  1L0C A;  4KLV A;  4H6Z A;  4OAE A;  5J8C A;  1VHS A;  3R9E A;  4CRY B;  2Y0M A;  1XMT A;  3TO9 A;  1MJ9 A;  3FBU A;  4B5O A;  3G3S A;  3S6H A;  1S3Z A;  2CNS A;  1I1D A;  4B5P B;  4MJ8 A;  2B5G A;  4UA3 A;  1QSR A;  2PR1 A;  1QSN A;  4FD4 A;  1XE4 A;  1BOB A;  4KOW A;  2R8V A;  4F0Y A;  2HUZ A;  2O28 A;  1K4J A;  2ZW4 A;  2VBQ A;  4MI4 A;  1YR0 A;  3JVN A;  4UBR A;  2B4D B;  4KOY A;  2REE A;  3FIX A;  3FYN A;  1YVO A;  2ZW6 A;  2P0W A;  1Q2D A;  5H86 A;  1NE9 A;  5H84 A;  2QIR A;  4XPD B;  4MY3 A;  4F6A A;  5EBV A;  4CAX A;  3BJ8 A;  1ON0 A;  2OH1 A;  4E0A A;  3D2M A;  4YGO A;  4HNX B;  1I21 A;  3P2H A;  2FSR A;  4OLL A;  2VZZ A;  1IID A;  4MHD A;  3TT2 A;  1BO4 A;  4B5P A;  2ZPA A;  1NMT A;  3SXN A;  4XPK A;  3EXN A;  4OAD A;  3C26 A;  1M4G A;  3W91 A;  3F8K A;  5J8F A;  4R3K A;  4CS0 B;  2IL4 A;  2DXQ A;  2Z11 A;  4AVB A;  1S7N A;  3B8G A;  4AG9 A;  4JXQ A;  2K5T A;  2G3A A;  5IX3 A;  2Q04 A;  4AB7 A;  2AE6 A;  2B4D A;  5F48 A;  4CRZ B;  1M4D A;  4HKF A;  1QSO A;  3DDD A;  1YRE A;  1S7K A;  2Q44 A;  2CNT A;  3ZZI A;  3FRM A;  2B3V A;  4NF1 A;  3E0K A;  3WR7 A;  4L89 A;  4QB9 A;  4RI1 A;  3UY5 A;  1YGH A;  2ARH A;  2F5I A;  3BJ7 A;  4KOU A;  3FXT A;  3BLN A;  4NSQ A;  2G0B A;  5DWM A;  5HMN A;  2WPW A;  3VWD A;  4R57 A;  4KZT A;  3FB3 A;  3FNC A;  4YRH A;  3CXP A;  3MGD A;  1IIC A;  4KOV A;  1RO5 A;  2OZG A;  4XNH C;  5IV0 A;  1U6M A;  4U5Y A;  2GE3 A;  3IGR A;  2J8N A;  2WPX A;  4H89 A;  3EFA A;  1J4J A;  3EC4 A;  5C82 A;  4ZBG A;  5HH1 A;  3TOA A;  1KUY A;  3W6X A;  3JUW A; 
#chains in the Genus database with same CATH topology
 4R87 A;  2Q0Y A;  2B3U A;  4FD6 A;  3NA6 A;  1AMP A;  3EO4 A;  4QVT A;  1ZG8 A;  2JBJ A;  2Q4Y A;  4OC1 A;  3D7F A;  2JDC A;  3LD2 A;  5D8N A;  2GIV A;  1LAN A;  4OKO A;  5HVF A;  4NGN A;  4UEZ A;  1JWQ A;  4AVC A;  2XEI A;  4IUS A;  2EUI A;  4RS2 A;  3IU2 A;  3BHX A;  4X5K A;  3T90 A;  4R8F A;  1ARM A;  3H5Z A;  2FIW A;  4M3S A;  3JRU A;  2Z0Z A;  1EE3 P;  2PJ9 A;  4A33 A;  3VWE A;  2WUU A;  5LRJ A;  2GAN A;  5K8M A;  2Z3M A;  4KOS A;  2A4N A;  3MRU A;  3SI1 A;  1GHE A;  2ZW7 A;  3H4Q A;  4KSA A;  4P44 A;  1Z4R A;  2PJ1 A;  3QB8 A;  1YSJ A;  2AFU A;  3OWC A;  4PV6 A;  3WT4 A;  3FED A;  3TOB A;  2C6P A;  1SQH A;  2G3T A;  3DR8 A;  2PR8 A;  4AXV A;  1NSA A;  3D68 A;  2HV2 A;  5G21 A;  3HUV A;  4UFW A;  1IYK A;  4KSI A;  4PXE A;  1TKH A;  3D2P A;  3LWU A;  5D29 A;  1A2Z A;  5JGF A;  3NH5 A;  1CM0 A;  1AUG A;  1V0C A;  2QML A;  3R96 A;  3KQZ A;  4YFJ A;  1Y9K A;  1F2O A;  2P6G A;  4UCM A;  1Y7R A;  3FF3 A;  3PB4 X;  4IAV A;  1R3N A;  4MFK A;  5BWA B;  2PVW A;  2WYR A;  4Q38 A;  3N7Z A;  4LUA A;  2PJA A;  3NE8 A;  1CX8 A;  2J8M A;  3NFZ A;  5F46 A;  4FD7 A;  3V38 A;  4JXR A;  2ATR A;  3VAT A;  2AFM A;  2PJB A;  2D4O A;  3WC7 A;  1GYT A;  2FS5 A;  2OZH A;  4NGT A;  1WWZ A;  1XJO A;  3TC8 A;  1ELL P;  1Y9W A;  4MCP A;  4CAW A;  1BPM A;  3CXQ A;  4JZ0 A;  5KTC A;  3D3S A;  5C88 A;  2JEW A;  4XNH B;  3WC6 A;  4UFX A;  4CAV A;  1IGB A;  3R1K A;  4CAE A;  2G9D A;  2CNM A;  2NYQ A;  2V77 A;  2ZOG A;  3CZX A;  4KVO E;  2B58 A;  1F2P A;  1M4I A;  4DNC A;  2FIA A;  1M1D A;  2Z10 A;  3TCV A;  1S60 A;  2YNC C;  2R1I A;  3KQX A;  2PJ6 A;  4GM5 A;  4MCS A;  7CPA A;  4XPL A;  1CPX A;  3TFY A;  4K3N A;  3IWE A;  1IY7 A;  1Q2C A;  2CTC A;  3L2N A;  4OC4 A;  4ZY2 A;  2O53 A;  2PSW A;  4C7H A;  4NJQ A;  1ZO0 A;  4C68 A;  4UFV A;  4P4E A;  3BI1 A;  1S7L A;  4A2Z A;  1IYL A;  2HQY A;  3HLP A;  3IIB A;  4C2Y A;  3B2Y A;  3QAH A;  2KCW A;  1HDU A;  3DR6 A;  2FE7 A;  1XF8 A;  4E2A A;  5J1Q A;  4ZYQ A;  2Q43 A;  4J3G A;  1KUV A;  4A32 A;  1IU8 A;  4ZX9 A;  2AFZ A;  1YX0 A;  2ZEE A;  3K2K A;  3D66 A;  1P4N A;  4PSW A;  4UWI A;  2OU2 A;  2C27 A;  2RC4 A;  1Y0Y A;  3S6K A;  1R57 A;  5LYI A;  4MCR A;  2NMT A;  1MJB A;  5I0C A;  3D7D A;  2VL1 A;  1QMU A;  2I00 A;  2GLJ A;  3RZA A;  2VXK A;  4FWU A;  5AG7 A;  4CYO A;  3PP9 A;  3IC1 A;  4MFP A;  2D4P A;  4UIA A;  4H6U A;  4R9M A;  4TWE A;  3GYA A;  5F49 A;  2OZU A;  1P0H A;  1XIX A;  4MXU A;  3WC5 A;  3WAB A;  4OID A;  4JLY A;  4EVY A;  4MMO A;  4P4B A;  4B12 A;  4M6I A;  1LCP A;  2QEC A;  4NXY A;  1KUX A;  3FEE A;  2GU2 A;  2BOA A;  5JH9 A;  4HNW B;  2VZY A;  2Z3L A;  2BUE A;  3B3S A;  4B13 A;  3CDX A;  2PJ3 A;  2PQ8 A;  4KVX A;  3KGQ A;  4OME A;  1B6B A;  1F57 A;  2EK9 A;  3DSB A;  2JLM A;  4MY0 A;  2FCK A;  4QUS A;  2ZOF A;  4CGN A;  4MHZ A;  5JQ4 A;  4GXH A;  4KVM E;  2ZEG A;  4PXD A;  2WSA A;  4A39 A;  3SJG A;  3H8G A;  4FD5 A;  3D7G A;  1FY7 A;  4GS4 A;  3W6S A;  4P10 A;  4BD9 A;  5CPA A;  5JPH A;  1CP7 A;  4MHY A;  4OIW A;  4NCZ A;  2VQY A;  1Z4E A;  3N5F A;  4NEX A;  3RYO A;  5E96 A;  2EWB A;  3F0A A;  3R9F A;  3TTH A;  1YME A;  3SXO A;  1NSL A;  2V8G A;  1I12 A;  1X12 A;  2P6E A;  2AJ6 A;  2F8H A;  1VKC A;  4BIN A;  1Q7L A;  2PDO A;  1ELM P;  1YLE A;  1CJW A;  3MN8 A;  4X3R A;  2AFW A;  4R3L A;  3PBE A;  4KUA A;  4ZI6 A;  2PIZ A;  2YNE A;  2PRB A;  3GUX A;  5CBM A;  4P6Y A;  1KWM A;  2JBK A;  3ZJ0 A;  3PBB A;  4CGM A;  5CNP A;  1XEB A;  4PK3 A;  4KLW A;  1XOV A;  2CY2 A;  3CPA A;  3PGP A;  4Q7A A;  3IWG A;  3IWW A;  4OC2 A;  3NH4 A;  4U9Z A;  2EBJ A;  5KTA A;  3PZJ A;  5F47 A;  1Z8L A;  2VEZ A;  4Y49 C;  4P4F A;  3I9S A;  3B3T A;  3T8W A;  4RUH A;  3I3G A;  3BI0 A;  4M85 A;  1XMB A;  1UFH A;  1M4L A;  3S6F A;  4F9V A;  5GCN A;  1KZF A;  2DF5 A;  4MFL A;  4PSX A;  4R76 A;  4ZX8 A;  4KOX A;  4X2T A;  4MFJ A;  3TE4 A;  1XRY A;  3LMS A;  2Q7S A;  4JJX A;  1XBU A;  4KOR A;  2BCO A;  2ZEF A;  2VI7 A;  2EVN A;  3PB8 X;  4NGS A;  3RAM A;  3FEC A;  2PJC A;  4NGM A;  4AG7 A;  1Q2Y A;  2B4B A;  2BEI A;  1S7F A;  2DEA A;  4MHP A;  4B10 A;  1LRZ A;  3G8W A;  5AG4 A;  4IK2 A;  2JEV A;  4WWV A;  2Q7B A;  4EME A;  2P6F A;  4KUB A;  3JTK A;  2FVG A;  1PU9 A;  2RFH A;  2I79 A;  3T9Y A;  5JM6 A;  1M44 A;  5AG5 A;  2H5M A;  1JQG A;  3TX8 A;  2J8R A;  3V8I A;  3EY5 A;  3GY9 A;  2PIY A;  4QC6 A;  2R7H A;  3KAS A;  5THW A;  3PB7 X;  1YK3 A;  2QJ8 A;  2ZW5 A;  4E8O A;  5KTD A;  3KL9 A;  4LX9 A;  4BMH A;  4LQ6 A;  4QBJ A;  1QSM A;  3DNS A;  1WK4 A;  2ZEH A;  4H2K A;  4JD6 A;  1CG2 A;  2JDD A;  2B5G B;  2GRE A;  3GKR A;  4HNY B;  4I49 A;  1PUA A;  3R95 A;  4A38 A;  3F5B A;  3LOD A;  4ZGY B;  2FL4 A;  1X10 A;  5HVH A;  2YNC A;  3FX6 A;  2OB0 A;  4ONU A;  4PK2 A;  2ZXV A;  3P2F A;  1Z5R A;  1VIX A;  4UWJ A;  1B87 A;  1TF9 A;  3IU1 A;  2Q4V A;  4FAI A;  1VHO A;  2BL1 A;  2FT0 A;  3R9G A;  1BPN A;  4RN7 A;  5A27 A;  4II9 A;  4MCQ A;  5DWN A;  1VHE A;  2PCU A;  2PJ8 A;  1LFW A;  4OC3 A;  3S6G A;  4B6Z A;  1TIQ A;  5FVJ A;  1IB1 E;  1MJA A;  1S5K A;  4P4I A;  1MK4 A;  1HDQ A;  1QST A;  2FXF A;  4CYN A;  2REF A;  3VH9 A;  5K8N A;  5LRK A;  4AVA A;  4IF5 A;  1Z9U A;  3S9L A;  3K9U A;  2ODF A;  4KOT A;  4U9Y A;  1R43 A;  3KI9 A;  3TO6 A;  1YVK A;  1N71 A;  5AG6 A;  2BSW A;  3H8F A;  5A28 A;  5IB0 A;  2WZN A;  3D8P A;  2C1C A;  3NE7 A;  4Y49 B;  2PC1 A;  1DE4 C;  3CPX A;  3KKW A;  5EMI A;  3TO7 A;  2CTB A;  4ORF A;  4WJB A;  2Z3O A;  4L8A A;  2R98 A;  1RXT A;  3B3W A;  3D4U A;  4XPD C;  4MFQ A;  4B14 A;  1OZP A;  4FUU A;  2QYV A;  3SHP A;  4JWP A;  5ISV A;  5EC4 A;  1TXR A;  2X7B A;  3B3V A;  1IOI A;  3PFE A;  3CXS A;  4K30 A;  4MBU A;  4FBE A;  3QNV A;  1L0C A;  4C7I A;  4KLV A;  4H6Z A;  4OAE A;  3D7H A;  2DPS A;  5J8C A;  1VHS A;  2ZEL A;  3R9E A;  2AFX A;  4CRY B;  4ZY1 A;  2Y0M A;  1XMT A;  3TO9 A;  4A94 A;  1MJ9 A;  3FBU A;  4B5O A;  4YWY A;  4HPS A;  2EK8 A;  3G3S A;  4PPZ A;  1S3Z A;  1FT7 A;  2CNS A;  3S6H A;  1I1D A;  4PXB A;  3K9T A;  1LOK A;  4B5P B;  4F8Z A;  4MJ8 A;  2B5G A;  4UA3 A;  1Z2L A;  4NFR A;  3LAC A;  2ANP A;  2XEG A;  4UCP A;  3RBU A;  1QSR A;  1Y7E A;  1YW6 A;  3B3C A;  3IFE A;  2IMO A;  2PR1 A;  3IJ3 A;  2ABZ A;  1QSN A;  3NH8 A;  1CP6 A;  2PJ7 A;  3SJX A;  4FD4 A;  1XE4 A;  2C6G A;  4M6H A;  3V7Z A;  5G1Z A;  1BOB A;  4PQA A;  4IHM A;  3KHX A;  5HXD A;  1QQ9 A;  1ZLH A;  2ZEN A;  4KOW A;  3DLJ A;  2R8V A;  2ZEO A;  4PXC A;  5I4M A;  4A30 A;  2HUZ A;  4F0Y A;  1ARL A;  4F0X A;  2O28 A;  3PB9 X;  1K4J A;  4Q36 A;  1PYT B;  1RTQ A;  4P4J A;  4CGL A;  2ZW4 A;  2XEF A;  2VBQ A;  4MI4 A;  2ZEM A;  1YR0 A;  3JVN A;  1LAM A;  4CYQ A;  5K8O A;  4UBR A;  2B4D B;  4M6G A;  2ZED A;  4YU9 A;  4KOY A;  1YLO A;  4CGO A;  3GB0 A;  3SI2 A;  2PRQ A;  2REE A;  3FIX A;  2OR4 A;  3FYN A;  4DUK A;  1TF8 A;  1YVO A;  4Z65 A;  2ZW6 A;  2P0W A;  1Z8W A;  2YND A;  3FMC A;  4F9U A;  2EO8 A;  3D67 A;  1Q2D A;  5H86 A;  1CPS A;  2PJ2 A;  1NE9 A;  5ELY A;  4OP4 A;  4P45 A;  4A37 A;  3KHZ A;  1BLL E;  5H84 A;  3RNZ A;  3RO0 A;  1DTD A;  2AFS A;  4R6T A;  4CPA A;  4MHN A;  2QIR A;  1CBX A;  2CXA A;  3B35 A;  2IJZ A;  3BXM A;  4MY3 A;  4R7M A;  4XPD B;  4F6A A;  4O23 A;  2J9A A;  5EBV A;  3BJ8 A;  2GFQ A;  4NGP A;  4CAX A;  5K8P A;  1ON0 A;  5AGE A;  2OH1 A;  4B11 A;  4E0A A;  3SJF A;  3D2M A;  3PB6 X;  4UF4 A;  4YGO A;  4HNX B;  1I21 A;  4UCN A;  2V8H A;  3P2H A;  1TKJ A;  1Z8T A;  2FSR A;  4OLL A;  2VZZ A;  1BAV A;  1IID A;  5LYF A;  4C2Z A;  2F7V A;  4MHD A;  1Y0R A;  1YW4 A;  3TT2 A;  4BBH A;  3FJU A;  2OOT A;  2YGW A;  2Z3P A;  2PE3 A;  2Q51 A;  3I1U A;  1BO4 A;  4B5P A;  3KZW A;  2CF4 A;  3GLJ A;  2ZPA A;  1NMT A;  4KS9 A;  5LYD A;  1IOF A;  3SXN A;  4A95 A;  4C2X A;  3IEH A;  4A31 A;  4XPK A;  3S9N A;  3EXN A;  2ZEP A;  4OAD A;  6CPA A;  3C26 A;  1M4G A;  1OBR A;  2O4H A;  3W91 A;  3F8K A;  5J8F A;  4R3K A;  4MFZ A;  4X8I A;  4CS0 B;  4DJL A;  1XFO A;  2IL4 A;  2DXQ A;  2PJ5 A;  1TKF A;  3ISZ A;  2Z11 A;  3GIU A;  3B7I A;  2Q4Z A;  2BO9 A;  2NSM A;  1S7N A;  1ZG9 A;  2POK A;  4KSF A;  4AVB A;  2V8D A;  4UEE A;  3FH4 A;  4JYW A;  3VAR A;  3B8G A;  4AG9 A;  4JXQ A;  2K5T A;  2G3A A;  4CAF A;  5IX3 A;  4P4D A;  3DGV A;  2Q04 A;  4AB7 A;  5F09 A;  3A9L A;  2AE6 A;  2HB6 A;  3PEI A;  5G20 A;  2B4D A;  5F48 A;  4TNU A;  4CRZ B;  3KR5 A;  4OC0 A;  5DS0 A;  1M4D A;  5G22 A;  4NGR A;  4HKF A;  1QSO A;  2DPT A;  4ONW A;  3DDD A;  1YRE A;  4G1P A;  3PRT A;  8CPA A;  1Z8X A;  1S7K A;  2HC9 A;  4OC5 A;  1UWY A;  4EWT A;  1YQE A;  2Q44 A;  2CNT A;  3ZZI A;  3FRM A;  2B3V A;  1AYE A;  4NF1 A;  5HVG A;  3E0K A;  4CYP A;  3WR7 A;  2XEJ A;  4L89 A;  4QB9 A;  4RI1 A;  3UY5 A;  4EFD A;  1YGH A;  2ARH A;  2F5I A;  3BJ7 A;  4KOU A;  4LQG A;  3FXT A;  3BLN A;  4NJR A;  2G0B A;  2PJ4 A;  4NSQ A;  5DWM A;  5HMN A;  2WPW A;  2RB7 A;  2Z3K A;  3VWD A;  1VGY A;  4R57 A;  2PVV A;  4KZT A;  4DYO A;  3H8E A;  3CT9 A;  1FNO A;  3FB3 A;  3FNC A;  2GLF A;  2Z3N A;  3ISX A;  3KR4 A;  4YRH A;  3PFO A;  3CXP A;  1LAP A;  2V8V A;  3MGD A;  1IIC A;  4MRI A;  4UEF A;  3S9M A;  2IQ6 A;  3SJE A;  4KOV A;  4W9Y A;  1RO5 A;  1PCA A;  2OZG A;  4ZY0 A;  4XNH C;  1ZG7 A;  2AFO A;  4UIB A;  3IO1 A;  3SI0 A;  5IV0 A;  1U6M A;  4U5Y A;  2PJ0 A;  2GE3 A;  3IGR A;  1HEE A;  4NGQ A;  2I3C A;  2J8N A;  2WPX A;  5IB9 A;  5LRG A;  1H8L A;  4H89 A;  2C6C A;  4CGP A;  3EFA A;  1ZLI A;  5LYL A;  1J4J A;  3EC4 A;  5C82 A;  3FVL A;  3QAY A;  4ZBG A;  5HH1 A;  3TOA A;  1KUY A;  2QVP A;  3W6X A;  3JUW A;  2CIJ A; 
#chains in the Genus database with same CATH homology
 4R87 A;  2Q0Y A;  2B3U A;  4FD6 A;  3EO4 A;  4QVT A;  2Q4Y A;  2JDC A;  3LD2 A;  2GIV A;  4AVC A;  4IUS A;  2EUI A;  4RS2 A;  3IU2 A;  4X5K A;  3T90 A;  3H5Z A;  2FIW A;  4M3S A;  2Z0Z A;  4A33 A;  3VWE A;  2WUU A;  2GAN A;  2Z3M A;  4KOS A;  2A4N A;  1GHE A;  2ZW7 A;  3H4Q A;  4KSA A;  1Z4R A;  3QB8 A;  3OWC A;  4PV6 A;  3TOB A;  1SQH A;  2G3T A;  3DR8 A;  2PR8 A;  2HV2 A;  5G21 A;  4UFW A;  1IYK A;  3D2P A;  1CM0 A;  1V0C A;  2QML A;  3R96 A;  4YFJ A;  1Y9K A;  2P6G A;  4UCM A;  1Y7R A;  4MFK A;  5BWA B;  4Q38 A;  3N7Z A;  4LUA A;  2J8M A;  5F46 A;  4FD7 A;  4JXR A;  2ATR A;  2D4O A;  2FS5 A;  2OZH A;  1WWZ A;  1Y9W A;  4CAW A;  3CXQ A;  5KTC A;  3D3S A;  5C88 A;  4XNH B;  4UFX A;  4CAV A;  3R1K A;  4CAE A;  2CNM A;  4KVO E;  2B58 A;  1M4I A;  4DNC A;  2FIA A;  1M1D A;  2Z10 A;  3TCV A;  1S60 A;  2YNC C;  2R1I A;  4XPL A;  3TFY A;  3IWE A;  1Q2C A;  2PSW A;  4C7H A;  1ZO0 A;  4C68 A;  4UFV A;  1S7L A;  4A2Z A;  1IYL A;  2HQY A;  4C2Y A;  3QAH A;  2KCW A;  3DR6 A;  2FE7 A;  1XF8 A;  4E2A A;  4J3G A;  1KUV A;  4A32 A;  1YX0 A;  1P4N A;  4PSW A;  4UWI A;  2OU2 A;  2C27 A;  2RC4 A;  3S6K A;  1R57 A;  2NMT A;  1MJB A;  5I0C A;  2I00 A;  2VXK A;  5AG7 A;  4CYO A;  3PP9 A;  4MFP A;  2D4P A;  4H6U A;  4R9M A;  5F49 A;  3GYA A;  2OZU A;  1P0H A;  1XIX A;  4EVY A;  4JLY A;  4B12 A;  2QEC A;  4NXY A;  1KUX A;  4HNW B;  2VZY A;  2Z3L A;  2BUE A;  4B13 A;  2PQ8 A;  4KVX A;  1B6B A;  3DSB A;  2JLM A;  4MY0 A;  2FCK A;  4QUS A;  4CGN A;  5JQ4 A;  4KVM E;  2WSA A;  4FD5 A;  5JPH A;  1FY7 A;  4GS4 A;  3W6S A;  4NCZ A;  2VQY A;  1Z4E A;  4NEX A;  3RYO A;  5E96 A;  3F0A A;  3R9F A;  3TTH A;  3SXO A;  1NSL A;  1I12 A;  2P6E A;  2AJ6 A;  1VKC A;  2PDO A;  1YLE A;  1CJW A;  4R3L A;  4KUA A;  2YNE A;  2PRB A;  3ZJ0 A;  4CGM A;  5CNP A;  1XEB A;  4PK3 A;  4KLW A;  2CY2 A;  3PGP A;  3IWG A;  4U9Z A;  5KTA A;  3PZJ A;  5F47 A;  4Y49 C;  2VEZ A;  3I9S A;  3I3G A;  4M85 A;  1UFH A;  3S6F A;  5GCN A;  1KZF A;  4MFL A;  4PSX A;  4KOX A;  4MFJ A;  3TE4 A;  4KOR A;  4JJX A;  2VI7 A;  2EVN A;  4AG7 A;  1Q2Y A;  2B4B A;  2BEI A;  1S7F A;  4B10 A;  1LRZ A;  3G8W A;  5AG4 A;  2JEV A;  2Q7B A;  2P6F A;  4KUB A;  3JTK A;  1PU9 A;  2I79 A;  3T9Y A;  1M44 A;  5AG5 A;  2H5M A;  3V8I A;  2J8R A;  3EY5 A;  3GY9 A;  4QC6 A;  2R7H A;  1YK3 A;  2ZW5 A;  4E8O A;  5KTD A;  4LX9 A;  4BMH A;  4QBJ A;  1QSM A;  3DNS A;  1WK4 A;  4JD6 A;  4HNY B;  2JDD A;  2B5G B;  3GKR A;  4I49 A;  3R95 A;  1PUA A;  3F5B A;  3LOD A;  4ZGY B;  2FL4 A;  2YNC A;  2OB0 A;  4ONU A;  4PK2 A;  2ZXV A;  3P2F A;  4UWJ A;  1B87 A;  2Q4V A;  2BL1 A;  2FT0 A;  3R9G A;  5A27 A;  4II9 A;  5DWN A;  3S6G A;  1TIQ A;  5FVJ A;  1IB1 E;  1MJA A;  1S5K A;  1MK4 A;  1QST A;  4CYN A;  2FXF A;  2REF A;  4AVA A;  4IF5 A;  1Z9U A;  3K9U A;  4U9Y A;  4KOT A;  3TO6 A;  1YVK A;  1N71 A;  5AG6 A;  2BSW A;  5A28 A;  5IB0 A;  3D8P A;  4Y49 B;  3NE7 A;  2PC1 A;  3KKW A;  3TO7 A;  4ORF A;  2Z3O A;  4L8A A;  2R98 A;  1RXT A;  4XPD C;  4MFQ A;  4B14 A;  1OZP A;  3SHP A;  5ISV A;  4JWP A;  5EC4 A;  2X7B A;  3CXS A;  4K30 A;  4MBU A;  1L0C A;  4C7I A;  4KLV A;  4H6Z A;  4OAE A;  2DPS A;  5J8C A;  1VHS A;  3R9E A;  4CRY B;  2Y0M A;  1XMT A;  3TO9 A;  1MJ9 A;  3FBU A;  4B5O A;  3G3S A;  3S6H A;  1S3Z A;  2CNS A;  1I1D A;  4B5P B;  4MJ8 A;  2B5G A;  4UA3 A;  4UCP A;  1QSR A;  2PR1 A;  1QSN A;  4FD4 A;  1XE4 A;  5G1Z A;  1BOB A;  4KOW A;  2R8V A;  4A30 A;  2HUZ A;  4F0Y A;  4F0X A;  2O28 A;  1K4J A;  4Q36 A;  4CGL A;  2ZW4 A;  2VBQ A;  4MI4 A;  1YR0 A;  3JVN A;  4CYQ A;  4UBR A;  2B4D B;  4KOY A;  4CGO A;  2REE A;  3FIX A;  3FYN A;  1YVO A;  2ZW6 A;  2P0W A;  2YND A;  1Q2D A;  5H86 A;  1NE9 A;  5H84 A;  2QIR A;  2CXA A;  4XPD B;  4MY3 A;  4F6A A;  5EBV A;  4CAX A;  3BJ8 A;  1ON0 A;  5AGE A;  2OH1 A;  4B11 A;  4E0A A;  3D2M A;  4YGO A;  4HNX B;  1I21 A;  4UCN A;  3P2H A;  2FSR A;  4OLL A;  2VZZ A;  1IID A;  4C2Z A;  4MHD A;  3TT2 A;  4BBH A;  2YGW A;  2Z3P A;  1BO4 A;  4B5P A;  4KS9 A;  2ZPA A;  1NMT A;  3SXN A;  4A95 A;  4C2X A;  4A31 A;  4XPK A;  3EXN A;  4OAD A;  3C26 A;  1M4G A;  3W91 A;  3F8K A;  5J8F A;  4R3K A;  4MFZ A;  4CS0 B;  2IL4 A;  2DXQ A;  2Z11 A;  4AVB A;  1S7N A;  4KSF A;  3B8G A;  4AG9 A;  4JXQ A;  2K5T A;  2G3A A;  4CAF A;  5IX3 A;  2Q04 A;  4AB7 A;  3A9L A;  2AE6 A;  5G20 A;  2B4D A;  5F48 A;  4CRZ B;  1M4D A;  5G22 A;  4HKF A;  1QSO A;  2DPT A;  3DDD A;  1YRE A;  1S7K A;  2Q44 A;  2CNT A;  3ZZI A;  3FRM A;  2B3V A;  4NF1 A;  3E0K A;  4CYP A;  3WR7 A;  4L89 A;  4QB9 A;  4RI1 A;  3UY5 A;  1YGH A;  2ARH A;  2F5I A;  3BJ7 A;  4KOU A;  3FXT A;  3BLN A;  4NSQ A;  2G0B A;  5DWM A;  5HMN A;  2WPW A;  2Z3K A;  3VWD A;  4R57 A;  4KZT A;  3FB3 A;  3FNC A;  2Z3N A;  4YRH A;  3CXP A;  3MGD A;  1IIC A;  4KOV A;  1RO5 A;  2OZG A;  4XNH C;  5IV0 A;  1U6M A;  4U5Y A;  2GE3 A;  3IGR A;  2J8N A;  2WPX A;  4H89 A;  4CGP A;  3EFA A;  1J4J A;  3EC4 A;  5C82 A;  4ZBG A;  5HH1 A;  3TOA A;  1KUY A;  3IU1 A;  3W6X A;  3JUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...