3BJ7A

Spermine/spermidine n1-acetyltransferase from mouse: crystal structure of a ternary complex reveals solvent-mediated spermine binding
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
162
Chain Sequence
KFKIRPATASDCSDILRLIKELAKYEYMEDQVILTEKDLQEDGFGEHPFYHCLVAEVPPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMKCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 1
publication title The crystal structure of spermidine/spermine N1-acetyltransferase in complex with spermine provides insights into substrate binding and catalysis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 42
structure length 162
sequence length 167
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2007-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3bj7A00
4B5OA 4KUBA 2P6GA 3S6FA 4CAXA 4UBRA 2REEA 2OZGA 3FIXA 3R9GA 3T9YA 1CJWA 2Q04A 5H86A 1XIXA 3W6XA 4F6AA 2IL4A 4ONUA 2QECA 2P0WA 4LUAA 5DWNA 4QB9A 5E96A 1Y9KA 1LRZA 4MI4A 3W91A 4AVBA 4PV6A 5IX3A 2R1IA 1MJAA 4AB7A 2AJ6A 4II9A 1XMTA 4MBUA 2PR1A 2I00A 2QIRA 4QC6A 3TOAA 3P2HA 4Y49B 3R95A 4MHDA 3I3GA 2R8VA 2CNTA 3IGRA 2ZXVA 3VWEA 2ZW7A 4JLYA 4KOSA 3K9UA 3F0AA 1YGHA 1Y9WA 4XPDB 5H84A 3VWDA 2I79A 4FD4A 3TCVA 3MGDA 2GE3A 1P4NA 4X5KA 4JWPA 2FSRA 4HNXB 1NSLA 1P0HA 3I9SA 2CY2A 4KZTA 3P2FA 2P6EA 3S6GA 4L8AA 1Q2CA 5FVJA 5IV0A 5CNPA 2R98A 2BUEA 2VZYA 3R9FA 4ZBGA 4GS4A 3R9EA 1QSRA 3FYNA 3KKWA 3S6KA 4PK3A 2P6FA 1L0CA 2ATRA 3GKRA 4NSQA 1XF8A 3F8KA 4K30A 3DSBA 4AVAA 2Q7BA 1IYLA 2Z10A 1NMTA 4XPKA 4I49A 2WPWA 2Q4YA 3BJ8A 1IICA 3GY9A 3E0KA 3PGPA 1N71A 4M85A 2C27A 1YK3A 2REFA 4R87A 4KOXA 2PRBA 3CXPA 2GIVA 1OZPA 3T90A 3D3SA 1MK4A 2HV2A 1XE4A 4NCZA 2FE7A 4QUSA 3D2PA 1S60A 2F5IA 2FT0A 1UFHA 3LD2A 3EY5A 4B5PB 1NE9A 4PSWA 5J8FA 2R7HA 3C26A 1I21A 1Q2YA 2PC1A 4XNHB 2HUZA 2ZPAA 1M4GA 1GHEA 2FXFA 4IUSA 2K5TA 3PZJA 1VKCA 4CS0B 1YVKA 3IWGA 4KORA 4HKFA 2OZHA 1IIDA 1BOBA 3DDDA 3FRMA 2J8RA 3EFAA 5KTCA 5HMNA 1VHSA 3TE4A 2FIWA 3UY5A 2Q4VA 2ARHA 2VZZA 5EC4A 1M4DA 1S7LA 1I1DA 4KOWA 4LX9A 5KTAA 2JLMA 3LODA 1BO4A 1S3ZA 4IF5A 4KOUA 4YFJA 4AVCA 2GANA 2VEZA 4FD7A 4YGOA 4U9YA 2B5GB 1IYKA 4CAVA 4CAWA 2B5GA 4PSXA 5HH1A 1WWZA 3EXNA 2EVNA 4AG9A 3SXOA 4KVME 5EBVA 4HNWB 2H5MA 4QVTA 2WPXA 2DXQA 1FY7A 3WR7A 3EC4A 2BEIA 3V8IA 2J8MA 2FIAA 4OAEA 4OLLA 1IB1E 4KVOE 2OB0A 1QSMA 4UWJA 4KOYA 1S7KA 3BLNA 5F49A 4ORFA 4DNCA 1QSNA 2G3TA 4AG7A 5JPHA 3RYOA 1KUXA 4FD6A 4F0YA 2B3VA 3D2MA 2NMTA 1YVOA 1Z4RA 1RO5A 4Y49C 2ZW5A 2B3UA 2Q0YA 4KOTA 3ZZIA 2EUIA 4L89A 2KCWA 4UA3A 1M44A 3GYAA 4XPDC 2J8NA 4JD6A 1YLEA 3OWCA 3H4QA 2PR8A 2OU2A 3D8PA 4U5YA 3FXTA 2Q44A 4B5PA 1YREA 2RC4A 4FD5A 4KLWA 1R57A 3CXSA 4H6ZA 2Z0ZA 2PSWA 1WK4A 4H89A 1CM0A 4BMHA 3QB8A 3FNCA 2BSWA 2PDOA 2AE6A 3TOBA 5I0CA 3DR6A 1B6BA 1S7FA 2G3AA 1KZFA 1B87A 2A4NA 2B58A 3QAHA 2Z11A 3R1KA 5DWMA 2HQYA 4M3SA 5ISVA 1PU9A 2PQ8A 1QSOA 1KUVA 5F46A 3SXNA 4PK2A 1XEBA 4U9ZA 4EVYA 3G8WA 1Z9UA 3TFYA 1SQHA 3FBUA 1I12A 2B4BA 2FL4A 4RS2A 4E0AA 3SHPA 1PUAA 2FS5A 4CRYB 3DR8A 2CNSA 3W6SA 1RXTA 4E8OA 4NF1A 2FCKA 4YRHA 4CRZB 1ON0A 5C82A 1KUYA 1YX0A 4E2AA 1MJBA 1J4JA 3JUWA 2VBQA 4QBJA 3PP9A 4KVXA 1Z4EA 4J3GA 2ZW4A 4R3KA 3S6HA 1S7NA 4MJ8A 2JDCA 3TO9A 2D4OA 3N7ZA 4HNYB 2VQYA 2B4DB 5GCNA 1U6MA 4RI1A 2OH1A 5F47A 1Y7RA 3TO6A 4OADA 3B8GA 3EO4A 3BJ7A 2B4DA 2JDDA 4XNHC 1MJ9A 3TT2A 4NXYA 2JEVA 2X7BA 2BL1A 4R57A 3TO7A 4XPLA 5JQ4A 5F48A 2G0BA 2OZUA 5KTDA 2VI7A 1M4IA 3JVNA 2ZW6A 3TTHA 3CXQA 4JXRA 3G3SA 2QMLA 1K4JA 4KUAA 1Q2DA 4MY3A 4JXQA 5IB0A 1YR0A 4MY0A 4H6UA 4KLVA 3F5BA 2Y0MA 4R9MA 3ZJ0A 1TIQA 1S5KA 1M1DA 2O28A 1V0CA 4NEXA 5C88A 3NE7A 3FB3A 4KOVA 2VXKA 2D4PA 3R96A 4R3LA 3DNSA 1QSTA 5J8CA 4JJXA 4UWIA 2CNMA
chains in the Genus database with same CATH superfamily
4B5OA 3L2NA 1CP7A 5CPAA 4KUBA 2P6GA 4OC3A 1YW6A 4B13A 3S6FA 4CAXA 5AG4A 4UBRA 5LYLA 2REEA 2ZEPA 3PB6X 2OZGA 2PJAA 2C6PA 4X8IA 1YMEA 3FIXA 3R9GA 3T9YA 2ANPA 3IJ3A 4MFLA 2Z3LA 1CJWA 2Q04A 2ZEHA 5H86A 4F9UA 3KR5A 1XIXA 3W6XA 4F6AA 3KASA 1BLLE 5F09A 4G1PA 5JGFA 2IL4A 3FVLA 4ONUA 2QECA 2P0WA 4LUAA 3D68A 3HLPA 4M6IA 2IQ6A 4QB9A 5DWNA 5E96A 5LYIA 2QVPA 5D8NA 4FAIA 3IC1A 4OP4A 4X3RA 3H5ZA 1Y9KA 1ZLHA 1LRZA 4MI4A 3W91A 1YW4A 2EO8A 2Q7SA 4PV6A 4AVBA 3QAYA 2R1IA 5IX3A 2V77A 1MJAA 3V38A 4AB7A 5A28A 1ZO0A 2WUUA 1CP6A 1AMPA 4NGPA 2AJ6A 4II9A 1XMTA 4MBUA 1BAVA 2PR1A 2I00A 2QIRA 4QC6A 3TOAA 3S9LA 3P2HA 4Y49B 2O53A 4UIAA 3R95A 1ARLA 4MHDA 3I3GA 3WC6A 2R8VA 4P45A 2CNTA 3IGRA 3SI0A 2ZXVA 4UF4A 2ZW7A 3IFEA 3KHZA 3VWEA 5G20A 4JLYA 2EK9A 4MHYA 4KOSA 4M6HA 4R6TA 5LYDA 3K9UA 3F0AA 2PVVA 1YGHA 1Y9WA 2AFWA 4XPDB 5H84A 4F8ZA 3VWDA 3B3CA 3JRUA 4FWUA 2I79A 4FD4A 3TCVA 2NYQA 3TC8A 3MGDA 2GE3A 1P4NA 3PFEA 4X5KA 4AXVA 4JWPA 2POKA 2FSRA 3KHXA 4HNXB 1NSLA 1P0HA 3I1UA 3I9SA 2CY2A 4CYPA 2PRQA 3D7HA 4KZTA 2PJCA 2V8DA 3B2YA 3P2FA 2P6EA 3FF3A 1TXRA 3FX6A 1TF9A 4CYQA 3S6GA 1ZG8A 3CPAA 4L8AA 4C2ZA 4LQ6A 4PQAA 1Q2CA 5FVJA 5IV0A 3PB7X 2C6CA 2R98A 5CNPA 1Y0RA 2AFUA 1IGBA 2BUEA 2VZYA 3R9FA 4ZBGA 4GS4A 1ZG9A 3R9EA 3DGVA 1QSRA 3FYNA 4UFWA 3KKWA 1TKJA 2PJ6A 4MHPA 3S6KA 4PK3A 1DE4C 2P6FA 1L0CA 2ATRA 5CBMA 3H8GA 3GKRA 2PJ5A 4KSFA 4NSQA 5G1ZA 3T8WA 1XF8A 2AFXA 3F8KA 4B14A 3V7ZA 3ISXA 3DSBA 4K30A 4AVAA 4OC2A 3GUXA 4CAFA 2Q7BA 2WZNA 4UEEA 1IYLA 3FEEA 4NJQA 3S9NA 2Z10A 1IY7A 1NMTA 1X10A 4ONWA 3H8FA 4BBHA 3GLJA 4IHMA 3SJFA 2BO9A 4XPKA 3CPXA 5K8PA 2F8HA 4OMEA 4I49A 4PPZA 2WPWA 2PE3A 5LYFA 2Q4YA 4KSAA 4P4EA 3BJ8A 1IICA 2CTCA 3E0KA 3GY9A 3PGPA 1BPMA 3KI9A 3BI1A 4UCMA 1N71A 4M85A 2C27A 2AFOA 1YK3A 2REFA 4OKOA 4R87A 3KQXA 2ZEMA 4KOXA 2V8VA 2PRBA 5AG6A 3CXPA 2GIVA 1OZPA 3B35A 3T90A 3D3SA 2DPSA 1XBUA 1MK4A 2HV2A 1XE4A 4Q7AA 4NCZA 2FE7A 1XMBA 4QUSA 3DLJA 1ZLIA 4P10A 3D2PA 4IAVA 2CTBA 2QJ8A 2IMOA 3RAMA 3RBUA 1S60A 2F5IA 2FT0A 2NSMA 4B10A 4MFPA 4NFRA 4NGSA 1R43A 1UFHA 1JQGA 3EY5A 3LD2A 4R7MA 1LOKA 4B5PB 8CPAA 1NE9A 4PSWA 4UFVA 2XEGA 3GB0A 3IU1A 2C6GA 1OBRA 5EMIA 2R7HA 5J8FA 1YLOA 3C26A 4MFKA 2WSAA 2YNEA 1I21A 1Q2YA 2PC1A 4XNHB 4H2KA 2HUZA 2ZPAA 4CGLA 4R8FA 1M4GA 1GHEA 2FXFA 4IUSA 2K5TA 3PZJA 1Z8XA 1VKCA 2Z3OA 4CPAA 4CS0B 2V8HA 1YVKA 2CIJA 3IWGA 4ZY0A 4A37A 5JH9A 3MRUA 4KORA 4HKFA 1VHOA 2OZHA 2PJ3A 1IIDA 4OIWA 1BOBA 3DDDA 3FRMA 2J8RA 3EFAA 4MRIA 5KTCA 5HMNA 1VHSA 3TE4A 2FIWA 3UY5A 3QNVA 1Z2LA 2Q4VA 1XJOA 1XRYA 2DF5A 2ARHA 1PYTB 2VZZA 3KR4A 5G22A 4B12A 5DS0A 5EC4A 4C68A 3SI1A 3VATA 4F9VA 4DUKA 5BWAB 3LWUA 4ZY2A 4CAEA 1RTQA 3FECA 3RZAA 4MHNA 4X2TA 1M4DA 1S7LA 2JBJA 4OC5A 3NH4A 1I1DA 5D29A 3IO1A 4KOWA 4LX9A 5KTAA 3B3VA 2JLMA 3D7DA 4WJBA 4C7IA 3LODA 2VL1A 1X12A 2G9DA 3BI0A 4NJRA 1BO4A 3IEHA 1S3ZA 4P4BA 4IF5A 1XFOA 2CF4A 4ZX8A 5THWA 4KOUA 4YFJA 4AVCA 6CPAA 1H8LA 2GANA 2VEZA 4FD7A 4YGOA 4F0XA 3BHXA 2IJZA 2BCOA 2B5GB 4U9YA 3PB4X 1IYKA 4CAVA 3JTKA 4CAWA 5HXDA 2B5GA 4A95A 2GU2A 1ZG7A 1F57A 3FMCA 3FEDA 4PSXA 4W9YA 5HH1A 4CYNA 1WWZA 3EXNA 2EVNA 4TWEA 4ZYQA 4MCSA 2DEAA 3SXOA 4A94A 1HDQA 4AG9A 1CPSA 4KVME 4OC4A 4TNUA 5EBVA 4MFJA 4HNWB 2H5MA 4QVTA 2WPXA 2DXQA 3FH4A 1FY7A 4GM5A 3WR7A 4UIBA 1TF8A 1M4LA 2BEIA 3EC4A 3HUVA 4UCPA 2J8MA 1EE3P 5LRGA 3V8IA 2FIAA 4OAEA 5K8OA 2EBJA 2O4HA 4OLLA 3CZXA 5AG5A 4CGPA 2WYRA 1IB1E 4KVOE 1LAPA 2OB0A 2PCUA 3A9LA 1QSMA 2JEWA 4BINA 1YSJA 1F2PA 1A2ZA 4BD9A 4UWJA 1IOFA 3N5FA 4KOYA 4C2YA 1S7KA 3BLNA 2JBKA 5F49A 4ORFA 4JYWA 3H8EA 2ZEEA 3PFOA 5G21A 3SJEA 2PJ7A 2PJBA 3KGQA 4MCPA 3NE8A 5J1QA 4DNCA 1QSNA 4PXBA 1VIXA 4UFXA 4EMEA 2G3TA 4AG7A 5JPHA 2GREA 2PVWA 3RYOA 1KUXA 4FD6A 4P44A 1NSAA 4F0YA 2B3VA 3D2MA 3PEIA 5IB9A 2NMTA 4K3NA 3WC5A 1YVOA 1Z4RA 1RO5A 4Y49C 4RUHA 2RFHA 3VARA 1XOVA 1HEEA 2XEJA 2PJ8A 2ZW5A 2B3UA 2Q0YA 4KOTA 3ZZIA 2EUIA 2GFQA 3ISZA 4L89A 4UCNA 3BXMA 2ZOGA 4P4IA 2KCWA 4UA3A 1ELLP 3IU2A 1M44A 3GYAA 3PRTA 1CPXA 4UEFA 4XPDC 3GIUA 2J8NA 4C7HA 1VHEA 4JD6A 4R76A 1YLEA 1LAMA 4JZ0A 2DPTA 3OWCA 3H4QA 1YQEA 2PR8A 4EFDA 1FT7A 2OU2A 3WC7A 3D8PA 4U5YA 4Z65A 5HVGA 2YNCA 2Q51A 3FXTA 2Q44A 5HVHA 4B5PA 4OC1A 1YREA 2RC4A 4FD5A 4KLWA 3S9MA 4A30A 3WT4A 4P4FA 4MFZA 1R57A 3CXSA 4H6ZA 2Z0ZA 3CDXA 2PSWA 4OIDA 3KL9A 5JM6A 2PJ0A 5I4MA 1WK4A 4H89A 1CM0A 1LCPA 4Q38A 4NGRA 5LRJA 1TKFA 2Z3PA 3QB8A 4BMHA 3FNCA 2ABZA 2BSWA 2PDOA 2AE6A 3TOBA 5I0CA 2F7VA 2V8GA 1JWQA 4DYOA 4MMOA 4PXEA 3DR6A 3RNZA 1B6BA 1S7FA 2G3AA 2J9AA 1KZFA 4LQGA 1B87A 2A4NA 2B58A 3QAHA 2Z11A 2GLJA 2Z3MA 2AFSA 4MCQA 4PXCA 4Q36A 3R1KA 5DWMA 3MN8A 2HQYA 4M3SA 4P4DA 1QQ9A 5K8MA 5ISVA 2HC9A 3B3WA 3PBEA 4NGMA 4CYOA 4A32A 4A2ZA 1PU9A 5HVFA 2PQ8A 2Z3NA 1QSOA 3SJGA 4FBEA 1KUVA 4PXDA 3KZWA 5A27A 5F46A 2ZOFA 3SXNA 2PJ9A 4NGNA 2ZENA 3VH9A 3LACA 4PK2A 3SJXA 1IOIA 3KQZA 1XEBA 2PJ2A 4U9ZA 5AG7A 3SI2A 4EVYA 3G8WA 1Z9UA 3CT9A 3TFYA 1Y0YA 1SQHA 2PJ4A 4M6GA 4GXHA 3FBUA 1I12A 2B4BA 4B11A 4IK2A 2FL4A 4O23A 4RS2A 2XEFA 1PUAA 4YWYA 3SHPA 1Z8TA 4E0AA 1CX8A 3PB9X 4HPSA 1Y7EA 2FS5A 3NH5A 2BOAA 4CRYB 4DJLA 3DR8A 2I3CA 2RB7A 2CNSA 1Z5RA 3W6SA 2PIZA 3K9TA 1BPNA 4RN7A 1RXTA 4E8OA 5LRKA 4NF1A 1Q7LA 2FCKA 3B3SA 4YRHA 1ON0A 4CRZB 3PB8X 3D7FA 1KUYA 2Q4ZA 5C82A 1YX0A 3NH8A 4E2AA 2HB6A 4MHZA 1MJBA 1J4JA 3JUWA 2VBQA 1DTDA 4QBJA 3LMSA 3PP9A 4KVXA 3B7IA 1Z4EA 4UEZA 3WABA 4J3GA 3D4UA 2ZW4A 2ZEGA 3D67A 2ODFA 1AUGA 4R3KA 3S6HA 1S7NA 3NA6A 4MJ8A 2YNCC 2JDCA 2XEIA 1ARMA 4A33A 3TO9A 1IU8A 1LANA 2D4OA 3N7ZA 4HNYB 2VQYA 2CXAA 1PCAA 4ZGYB 2B4DB 5GCNA 1U6MA 1VGYA 2PIYA 4RI1A 2OH1A 5F47A 1Y7RA 3TO6A 3NFZA 2Z3KA 3B8GA 3EO4A 2FVGA 2B4DA 1R3NA 3BJ7A 4OADA 2JDDA 4P4JA 4XNHC 1MJ9A 3RO0A 4EWTA 2YNDA 4MFQA 3TT2A 4NXYA 3IWWA 2EWBA 2JEVA 4CGMA 2X7BA 2BL1A 1Z8WA 4R57A 2GLFA 3TO7A 1GYTA 4XPLA 1CBXA 5JQ4A 5F48A 2ZEOA 4OC0A 2G0BA 2OZUA 2OOTA 5KTDA 2PJ1A 2VI7A 1M4IA 1HDUA 2ZEFA 2ZW6A 3JVNA 4KS9A 3CXQA 4JXRA 3TTHA 4A39A 4ZI6A 4B6ZA 2AFZA 1AYEA 1FNOA 4NGQA 4A31A 3G3SA 4CGOA 5K8NA 2QMLA 7CPAA 1K4JA 4NGTA 3B3TA 4KUAA 2YGWA 1Q2DA 4MY3A 4JXQA 4MCRA 4ZX9A 1CG2A 1YR0A 2ZEDA 3FJUA 4MY0A 5IB0A 4H6UA 2C1CA 4KLVA 3F5BA 1LFWA 2Y0MA 1UWYA 4R9MA 1TIQA 4YU9A 3ZJ0A 1S5KA 2AFMA 3D7GA 3TX8A 4ZY1A 1M1DA 2OR4A 1ELMP 1F2OA 2O28A 1V0CA 3D66A 2Q43A 4NEXA 4P6YA 2EK8A 4WWVA 4FUUA 4C2XA 5C88A 5AGEA 3K2KA 4A38A 3NE7A 1Z8LA 3FB3A 4KOVA 1TKHA 3IIBA 2VXKA 3PBBA 2D4PA 3R96A 5ELYA 4KSIA 3DNSA 4R3LA 4CGNA 1QSTA 1QMUA 4JJXA 5J8CA 4MXUA 1KWMA 2ZELA 4UWIA 2QYVA 2CNMA 3IWEA
chains in the Genus database with same CATH topology
4B5OA 4KUBA 2P6GA 4B13A 3S6FA 4CAXA 5AG4A 4UBRA 2REEA 2OZGA 3FIXA 3R9GA 3T9YA 4MFLA 2Z3LA 1CJWA 2Q04A 5H86A 1XIXA 3W6XA 4F6AA 2IL4A 4ONUA 2QECA 2P0WA 4LUAA 5DWNA 4QB9A 5E96A 3H5ZA 1Y9KA 1LRZA 4MI4A 3W91A 4AVBA 4PV6A 5IX3A 2R1IA 1MJAA 4AB7A 5A28A 1ZO0A 2WUUA 2AJ6A 4II9A 1XMTA 4MBUA 2PR1A 2I00A 2QIRA 4QC6A 3TOAA 3P2HA 4Y49B 3R95A 4MHDA 3I3GA 2R8VA 2CNTA 3IGRA 2ZXVA 3VWEA 2ZW7A 5G20A 4JLYA 4KOSA 3K9UA 3F0AA 1YGHA 1Y9WA 4XPDB 5H84A 3VWDA 2I79A 4FD4A 3TCVA 3MGDA 2GE3A 1P4NA 4X5KA 4JWPA 2FSRA 4HNXB 1NSLA 4CYPA 1P0HA 3I9SA 2CY2A 4KZTA 3P2FA 2P6EA 4CYQA 3S6GA 4L8AA 4C2ZA 1Q2CA 5FVJA 5IV0A 5CNPA 2R98A 2BUEA 2VZYA 3R9FA 4ZBGA 4GS4A 3R9EA 1QSRA 3FYNA 4UFWA 3KKWA 3S6KA 4PK3A 2P6FA 1L0CA 2ATRA 3GKRA 4KSFA 4NSQA 5G1ZA 1XF8A 3F8KA 4B14A 4K30A 3DSBA 4AVAA 4CAFA 2Q7BA 1IYLA 2Z10A 1NMTA 4BBHA 4XPKA 4I49A 2WPWA 2Q4YA 4KSAA 3BJ8A 1IICA 3GY9A 3E0KA 3PGPA 4UCMA 1N71A 4M85A 2C27A 1YK3A 2REFA 4R87A 4KOXA 5AG6A 2PRBA 3CXPA 2GIVA 1OZPA 3T90A 3D3SA 2DPSA 1MK4A 2HV2A 1XE4A 4NCZA 2FE7A 4QUSA 3D2PA 1S60A 2F5IA 2FT0A 4B10A 4MFPA 1UFHA 3LD2A 3EY5A 4B5PB 1NE9A 4PSWA 4UFVA 3IU1A 5J8FA 2R7HA 3C26A 4MFKA 2WSAA 2YNEA 1I21A 1Q2YA 2PC1A 4XNHB 2HUZA 2ZPAA 4CGLA 1M4GA 1GHEA 2FXFA 4IUSA 2K5TA 3PZJA 1VKCA 2Z3OA 4CS0B 1YVKA 3IWGA 4KORA 4HKFA 2OZHA 1IIDA 1BOBA 3DDDA 3FRMA 2J8RA 3EFAA 5KTCA 5HMNA 1VHSA 3TE4A 2FIWA 3UY5A 2Q4VA 2ARHA 2VZZA 5G22A 4B12A 5EC4A 4C68A 5BWAB 4CAEA 1M4DA 1S7LA 1I1DA 4KOWA 4LX9A 5KTAA 2JLMA 4C7IA 3LODA 1BO4A 1S3ZA 4IF5A 4KOUA 4YFJA 4AVCA 2GANA 2VEZA 4FD7A 4YGOA 4F0XA 4U9YA 2B5GB 1IYKA 4CAVA 3JTKA 4CAWA 2B5GA 4A95A 4PSXA 5HH1A 4CYNA 1WWZA 3EXNA 2EVNA 4AG9A 3SXOA 4KVME 5EBVA 4MFJA 4HNWB 2H5MA 4QVTA 2WPXA 2DXQA 1FY7A 3WR7A 3EC4A 2BEIA 3V8IA 4UCPA 2J8MA 2FIAA 4OAEA 5AG5A 4OLLA 4CGPA 1IB1E 4KVOE 2OB0A 3A9LA 1QSMA 4UWJA 4KOYA 4C2YA 1S7KA 3BLNA 5F49A 4ORFA 5G21A 4DNCA 1QSNA 4UFXA 2G3TA 4AG7A 5JPHA 3RYOA 1KUXA 4FD6A 4F0YA 2B3VA 3D2MA 2NMTA 1YVOA 1Z4RA 1RO5A 4Y49C 2ZW5A 2B3UA 2Q0YA 4KOTA 3ZZIA 2EUIA 4L89A 4UCNA 2KCWA 4UA3A 3IU2A 1M44A 3GYAA 4XPDC 2J8NA 4C7HA 4JD6A 1YLEA 2DPTA 3OWCA 3H4QA 2PR8A 2OU2A 3D8PA 4U5YA 2YNCA 3FXTA 2Q44A 4B5PA 1YREA 2RC4A 4FD5A 4KLWA 4A30A 4MFZA 1R57A 3CXSA 4H6ZA 2Z0ZA 2PSWA 1WK4A 4H89A 1CM0A 4Q38A 2Z3PA 3QB8A 4BMHA 3FNCA 2BSWA 2PDOA 2AE6A 3TOBA 5I0CA 3DR6A 1B6BA 1S7FA 2G3AA 1KZFA 1B87A 2A4NA 2B58A 3QAHA 2Z11A 2Z3MA 4Q36A 3R1KA 5DWMA 2HQYA 4M3SA 5ISVA 4CYOA 4A32A 4A2ZA 1PU9A 2PQ8A 2Z3NA 1QSOA 1KUVA 5A27A 5F46A 3SXNA 4PK2A 1XEBA 4U9ZA 5AG7A 4EVYA 3G8WA 1Z9UA 3TFYA 1SQHA 3FBUA 1I12A 2B4BA 4B11A 2FL4A 4RS2A 4E0AA 3SHPA 1PUAA 2FS5A 4CRYB 3DR8A 2CNSA 3W6SA 1RXTA 4E8OA 4NF1A 2FCKA 4YRHA 4CRZB 1ON0A 5C82A 1KUYA 1YX0A 4E2AA 1MJBA 1J4JA 3JUWA 2VBQA 4QBJA 3PP9A 4KVXA 1Z4EA 4J3GA 2ZW4A 4R3KA 3S6HA 1S7NA 4MJ8A 2YNCC 2JDCA 4A33A 3TO9A 2D4OA 3N7ZA 4HNYB 2VQYA 2CXAA 4ZGYB 2B4DB 5GCNA 1U6MA 4RI1A 2OH1A 5F47A 1Y7RA 3TO6A 2Z3KA 3B8GA 3EO4A 3BJ7A 2B4DA 4OADA 2JDDA 4XNHC 1MJ9A 2YNDA 4MFQA 3TT2A 4NXYA 4CGMA 2JEVA 2X7BA 2BL1A 4R57A 3TO7A 4XPLA 5JQ4A 5F48A 2G0BA 2OZUA 5KTDA 2VI7A 1M4IA 3JVNA 2ZW6A 4KS9A 3CXQA 4JXRA 3TTHA 4A31A 3G3SA 4CGOA 2QMLA 1K4JA 4KUAA 2YGWA 1Q2DA 4MY3A 4JXQA 5IB0A 1YR0A 4MY0A 4H6UA 4KLVA 3F5BA 2Y0MA 4R9MA 3ZJ0A 1TIQA 1S5KA 1M1DA 2O28A 1V0CA 4NEXA 4C2XA 5C88A 5AGEA 3NE7A 3FB3A 4KOVA 2VXKA 2D4PA 3R96A 4R3LA 3DNSA 4CGNA 1QSTA 5J8CA 4JJXA 4UWIA 2CNMA 3IWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B5O A;  4KUB A;  2P6G A;  3S6F A;  4CAX A;  4UBR A;  2REE A;  2OZG A;  3FIX A;  3R9G A;  3T9Y A;  1CJW A;  2Q04 A;  5H86 A;  1XIX A;  3W6X A;  4F6A A;  2IL4 A;  4ONU A;  2QEC A;  2P0W A;  4LUA A;  5DWN A;  4QB9 A;  5E96 A;  1Y9K A;  1LRZ A;  4MI4 A;  3W91 A;  4AVB A;  4PV6 A;  5IX3 A;  2R1I A;  1MJA A;  4AB7 A;  2AJ6 A;  4II9 A;  1XMT A;  4MBU A;  2PR1 A;  2I00 A;  2QIR A;  4QC6 A;  3TOA A;  3P2H A;  4Y49 B;  3R95 A;  4MHD A;  3I3G A;  2R8V A;  2CNT A;  3IGR A;  2ZXV A;  3VWE A;  2ZW7 A;  4JLY A;  4KOS A;  3K9U A;  3F0A A;  1YGH A;  1Y9W A;  4XPD B;  5H84 A;  3VWD A;  2I79 A;  4FD4 A;  3TCV A;  3MGD A;  2GE3 A;  1P4N A;  4X5K A;  4JWP A;  2FSR A;  4HNX B;  1NSL A;  1P0H A;  3I9S A;  2CY2 A;  4KZT A;  3P2F A;  2P6E A;  3S6G A;  4L8A A;  1Q2C A;  5FVJ A;  5IV0 A;  5CNP A;  2R98 A;  2BUE A;  2VZY A;  3R9F A;  4ZBG A;  4GS4 A;  3R9E A;  1QSR A;  3FYN A;  3KKW A;  3S6K A;  4PK3 A;  2P6F A;  1L0C A;  2ATR A;  3GKR A;  4NSQ A;  1XF8 A;  3F8K A;  4K30 A;  3DSB A;  4AVA A;  2Q7B A;  1IYL A;  2Z10 A;  1NMT A;  4XPK A;  4I49 A;  2WPW A;  2Q4Y A;  3BJ8 A;  1IIC A;  3GY9 A;  3E0K A;  3PGP A;  1N71 A;  4M85 A;  2C27 A;  1YK3 A;  2REF A;  4R87 A;  4KOX A;  2PRB A;  3CXP A;  2GIV A;  1OZP A;  3T90 A;  3D3S A;  1MK4 A;  2HV2 A;  1XE4 A;  4NCZ A;  2FE7 A;  4QUS A;  3D2P A;  1S60 A;  2F5I A;  2FT0 A;  1UFH A;  3LD2 A;  3EY5 A;  4B5P B;  1NE9 A;  4PSW A;  5J8F A;  2R7H A;  3C26 A;  1I21 A;  1Q2Y A;  2PC1 A;  4XNH B;  2HUZ A;  2ZPA A;  1M4G A;  1GHE A;  2FXF A;  4IUS A;  2K5T A;  3PZJ A;  1VKC A;  4CS0 B;  1YVK A;  3IWG A;  4KOR A;  4HKF A;  2OZH A;  1IID A;  1BOB A;  3DDD A;  3FRM A;  2J8R A;  3EFA A;  5KTC A;  5HMN A;  1VHS A;  3TE4 A;  2FIW A;  3UY5 A;  2Q4V A;  2ARH A;  2VZZ A;  5EC4 A;  1M4D A;  1S7L A;  1I1D A;  4KOW A;  4LX9 A;  5KTA A;  2JLM A;  3LOD A;  1BO4 A;  1S3Z A;  4IF5 A;  4KOU A;  4YFJ A;  4AVC A;  2GAN A;  2VEZ A;  4FD7 A;  4YGO A;  4U9Y A;  2B5G B;  1IYK A;  4CAV A;  4CAW A;  2B5G A;  4PSX A;  5HH1 A;  1WWZ A;  3EXN A;  2EVN A;  4AG9 A;  3SXO A;  4KVM E;  5EBV A;  4HNW B;  2H5M A;  4QVT A;  2WPX A;  2DXQ A;  1FY7 A;  3WR7 A;  3EC4 A;  2BEI A;  3V8I A;  2J8M A;  2FIA A;  4OAE A;  4OLL A;  1IB1 E;  4KVO E;  2OB0 A;  1QSM A;  4UWJ A;  4KOY A;  1S7K A;  3BLN A;  5F49 A;  4ORF A;  4DNC A;  1QSN A;  2G3T A;  4AG7 A;  5JPH A;  3RYO A;  1KUX A;  4FD6 A;  4F0Y A;  2B3V A;  3D2M A;  2NMT A;  1YVO A;  1Z4R A;  1RO5 A;  4Y49 C;  2ZW5 A;  2B3U A;  2Q0Y A;  4KOT A;  3ZZI A;  2EUI A;  4L89 A;  2KCW A;  4UA3 A;  1M44 A;  3GYA A;  4XPD C;  2J8N A;  4JD6 A;  1YLE A;  3OWC A;  3H4Q A;  2PR8 A;  2OU2 A;  3D8P A;  4U5Y A;  3FXT A;  2Q44 A;  4B5P A;  1YRE A;  2RC4 A;  4FD5 A;  4KLW A;  1R57 A;  3CXS A;  4H6Z A;  2Z0Z A;  2PSW A;  1WK4 A;  4H89 A;  1CM0 A;  4BMH A;  3QB8 A;  3FNC A;  2BSW A;  2PDO A;  2AE6 A;  3TOB A;  5I0C A;  3DR6 A;  1B6B A;  1S7F A;  2G3A A;  1KZF A;  1B87 A;  2A4N A;  2B58 A;  3QAH A;  2Z11 A;  3R1K A;  5DWM A;  2HQY A;  4M3S A;  5ISV A;  1PU9 A;  2PQ8 A;  1QSO A;  1KUV A;  5F46 A;  3SXN A;  4PK2 A;  1XEB A;  4U9Z A;  4EVY A;  3G8W A;  1Z9U A;  3TFY A;  1SQH A;  3FBU A;  1I12 A;  2B4B A;  2FL4 A;  4RS2 A;  4E0A A;  3SHP A;  1PUA A;  2FS5 A;  4CRY B;  3DR8 A;  2CNS A;  3W6S A;  1RXT A;  4E8O A;  4NF1 A;  2FCK A;  4YRH A;  4CRZ B;  1ON0 A;  5C82 A;  1KUY A;  1YX0 A;  4E2A A;  1MJB A;  1J4J A;  3JUW A;  2VBQ A;  4QBJ A;  3PP9 A;  4KVX A;  1Z4E A;  4J3G A;  2ZW4 A;  4R3K A;  3S6H A;  1S7N A;  4MJ8 A;  2JDC A;  3TO9 A;  2D4O A;  3N7Z A;  4HNY B;  2VQY A;  2B4D B;  5GCN A;  1U6M A;  4RI1 A;  2OH1 A;  5F47 A;  1Y7R A;  3TO6 A;  4OAD A;  3B8G A;  3EO4 A;  3BJ7 A;  2B4D A;  2JDD A;  4XNH C;  1MJ9 A;  3TT2 A;  4NXY A;  2JEV A;  2X7B A;  2BL1 A;  4R57 A;  3TO7 A;  4XPL A;  5JQ4 A;  5F48 A;  2G0B A;  2OZU A;  5KTD A;  2VI7 A;  1M4I A;  3JVN A;  2ZW6 A;  3TTH A;  3CXQ A;  4JXR A;  3G3S A;  2QML A;  1K4J A;  4KUA A;  1Q2D A;  4MY3 A;  4JXQ A;  5IB0 A;  1YR0 A;  4MY0 A;  4H6U A;  4KLV A;  3F5B A;  2Y0M A;  4R9M A;  3ZJ0 A;  1TIQ A;  1S5K A;  1M1D A;  2O28 A;  1V0C A;  4NEX A;  5C88 A;  3NE7 A;  3FB3 A;  4KOV A;  2VXK A;  2D4P A;  3R96 A;  4R3L A;  3DNS A;  1QST A;  5J8C A;  4JJX A;  4UWI A;  2CNM A; 
#chains in the Genus database with same CATH topology
 4B5O A;  3L2N A;  1CP7 A;  5CPA A;  4KUB A;  2P6G A;  4OC3 A;  1YW6 A;  4B13 A;  3S6F A;  4CAX A;  5AG4 A;  4UBR A;  5LYL A;  2REE A;  2ZEP A;  3PB6 X;  2OZG A;  2PJA A;  2C6P A;  4X8I A;  1YME A;  3FIX A;  3R9G A;  3T9Y A;  2ANP A;  3IJ3 A;  4MFL A;  2Z3L A;  1CJW A;  2Q04 A;  2ZEH A;  5H86 A;  4F9U A;  3KR5 A;  1XIX A;  3W6X A;  4F6A A;  3KAS A;  1BLL E;  5F09 A;  4G1P A;  5JGF A;  2IL4 A;  3FVL A;  4ONU A;  2QEC A;  2P0W A;  4LUA A;  3D68 A;  3HLP A;  4M6I A;  2IQ6 A;  4QB9 A;  5DWN A;  5E96 A;  5LYI A;  2QVP A;  5D8N A;  4FAI A;  3IC1 A;  4OP4 A;  4X3R A;  3H5Z A;  1Y9K A;  1ZLH A;  1LRZ A;  4MI4 A;  3W91 A;  1YW4 A;  2EO8 A;  2Q7S A;  4PV6 A;  4AVB A;  3QAY A;  2R1I A;  5IX3 A;  2V77 A;  1MJA A;  3V38 A;  4AB7 A;  5A28 A;  1ZO0 A;  2WUU A;  1CP6 A;  1AMP A;  4NGP A;  2AJ6 A;  4II9 A;  1XMT A;  4MBU A;  1BAV A;  2PR1 A;  2I00 A;  2QIR A;  4QC6 A;  3TOA A;  3S9L A;  3P2H A;  4Y49 B;  2O53 A;  4UIA A;  3R95 A;  1ARL A;  4MHD A;  3I3G A;  3WC6 A;  2R8V A;  4P45 A;  2CNT A;  3IGR A;  3SI0 A;  2ZXV A;  4UF4 A;  2ZW7 A;  3IFE A;  3KHZ A;  3VWE A;  5G20 A;  4JLY A;  2EK9 A;  4MHY A;  4KOS A;  4M6H A;  4R6T A;  5LYD A;  3K9U A;  3F0A A;  2PVV A;  1YGH A;  1Y9W A;  2AFW A;  4XPD B;  5H84 A;  4F8Z A;  3VWD A;  3B3C A;  3JRU A;  4FWU A;  2I79 A;  4FD4 A;  3TCV A;  2NYQ A;  3TC8 A;  3MGD A;  2GE3 A;  1P4N A;  3PFE A;  4X5K A;  4AXV A;  4JWP A;  2POK A;  2FSR A;  3KHX A;  4HNX B;  1NSL A;  1P0H A;  3I1U A;  3I9S A;  2CY2 A;  4CYP A;  2PRQ A;  3D7H A;  4KZT A;  2PJC A;  2V8D A;  3B2Y A;  3P2F A;  2P6E A;  3FF3 A;  1TXR A;  3FX6 A;  1TF9 A;  4CYQ A;  3S6G A;  1ZG8 A;  3CPA A;  4L8A A;  4C2Z A;  4LQ6 A;  4PQA A;  1Q2C A;  5FVJ A;  5IV0 A;  3PB7 X;  2C6C A;  2R98 A;  5CNP A;  1Y0R A;  2AFU A;  1IGB A;  2BUE A;  2VZY A;  3R9F A;  4ZBG A;  4GS4 A;  1ZG9 A;  3R9E A;  3DGV A;  1QSR A;  3FYN A;  4UFW A;  3KKW A;  1TKJ A;  2PJ6 A;  4MHP A;  3S6K A;  4PK3 A;  1DE4 C;  2P6F A;  1L0C A;  2ATR A;  5CBM A;  3H8G A;  3GKR A;  2PJ5 A;  4KSF A;  4NSQ A;  5G1Z A;  3T8W A;  1XF8 A;  2AFX A;  3F8K A;  4B14 A;  3V7Z A;  3ISX A;  3DSB A;  4K30 A;  4AVA A;  4OC2 A;  3GUX A;  4CAF A;  2Q7B A;  2WZN A;  4UEE A;  1IYL A;  3FEE A;  4NJQ A;  3S9N A;  2Z10 A;  1IY7 A;  1NMT A;  1X10 A;  4ONW A;  3H8F A;  4BBH A;  3GLJ A;  4IHM A;  3SJF A;  2BO9 A;  4XPK A;  3CPX A;  5K8P A;  2F8H A;  4OME A;  4I49 A;  4PPZ A;  2WPW A;  2PE3 A;  5LYF A;  2Q4Y A;  4KSA A;  4P4E A;  3BJ8 A;  1IIC A;  2CTC A;  3E0K A;  3GY9 A;  3PGP A;  1BPM A;  3KI9 A;  3BI1 A;  4UCM A;  1N71 A;  4M85 A;  2C27 A;  2AFO A;  1YK3 A;  2REF A;  4OKO A;  4R87 A;  3KQX A;  2ZEM A;  4KOX A;  2V8V A;  2PRB A;  5AG6 A;  3CXP A;  2GIV A;  1OZP A;  3B35 A;  3T90 A;  3D3S A;  2DPS A;  1XBU A;  1MK4 A;  2HV2 A;  1XE4 A;  4Q7A A;  4NCZ A;  2FE7 A;  1XMB A;  4QUS A;  3DLJ A;  1ZLI A;  4P10 A;  3D2P A;  4IAV A;  2CTB A;  2QJ8 A;  2IMO A;  3RAM A;  3RBU A;  1S60 A;  2F5I A;  2FT0 A;  2NSM A;  4B10 A;  4MFP A;  4NFR A;  4NGS A;  1R43 A;  1UFH A;  1JQG A;  3EY5 A;  3LD2 A;  4R7M A;  1LOK A;  4B5P B;  8CPA A;  1NE9 A;  4PSW A;  4UFV A;  2XEG A;  3GB0 A;  3IU1 A;  2C6G A;  1OBR A;  5EMI A;  2R7H A;  5J8F A;  1YLO A;  3C26 A;  4MFK A;  2WSA A;  2YNE A;  1I21 A;  1Q2Y A;  2PC1 A;  4XNH B;  4H2K A;  2HUZ A;  2ZPA A;  4CGL A;  4R8F A;  1M4G A;  1GHE A;  2FXF A;  4IUS A;  2K5T A;  3PZJ A;  1Z8X A;  1VKC A;  2Z3O A;  4CPA A;  4CS0 B;  2V8H A;  1YVK A;  2CIJ A;  3IWG A;  4ZY0 A;  4A37 A;  5JH9 A;  3MRU A;  4KOR A;  4HKF A;  1VHO A;  2OZH A;  2PJ3 A;  1IID A;  4OIW A;  1BOB A;  3DDD A;  3FRM A;  2J8R A;  3EFA A;  4MRI A;  5KTC A;  5HMN A;  1VHS A;  3TE4 A;  2FIW A;  3UY5 A;  3QNV A;  1Z2L A;  2Q4V A;  1XJO A;  1XRY A;  2DF5 A;  2ARH A;  1PYT B;  2VZZ A;  3KR4 A;  5G22 A;  4B12 A;  5DS0 A;  5EC4 A;  4C68 A;  3SI1 A;  3VAT A;  4F9V A;  4DUK A;  5BWA B;  3LWU A;  4ZY2 A;  4CAE A;  1RTQ A;  3FEC A;  3RZA A;  4MHN A;  4X2T A;  1M4D A;  1S7L A;  2JBJ A;  4OC5 A;  3NH4 A;  1I1D A;  5D29 A;  3IO1 A;  4KOW A;  4LX9 A;  5KTA A;  3B3V A;  2JLM A;  3D7D A;  4WJB A;  4C7I A;  3LOD A;  2VL1 A;  1X12 A;  2G9D A;  3BI0 A;  4NJR A;  1BO4 A;  3IEH A;  1S3Z A;  4P4B A;  4IF5 A;  1XFO A;  2CF4 A;  4ZX8 A;  5THW A;  4KOU A;  4YFJ A;  4AVC A;  6CPA A;  1H8L A;  2GAN A;  2VEZ A;  4FD7 A;  4YGO A;  4F0X A;  3BHX A;  2IJZ A;  2BCO A;  2B5G B;  4U9Y A;  3PB4 X;  1IYK A;  4CAV A;  3JTK A;  4CAW A;  5HXD A;  2B5G A;  4A95 A;  2GU2 A;  1ZG7 A;  1F57 A;  3FMC A;  3FED A;  4PSX A;  4W9Y A;  5HH1 A;  4CYN A;  1WWZ A;  3EXN A;  2EVN A;  4TWE A;  4ZYQ A;  4MCS A;  2DEA A;  3SXO A;  4A94 A;  1HDQ A;  4AG9 A;  1CPS A;  4KVM E;  4OC4 A;  4TNU A;  5EBV A;  4MFJ A;  4HNW B;  2H5M A;  4QVT A;  2WPX A;  2DXQ A;  3FH4 A;  1FY7 A;  4GM5 A;  3WR7 A;  4UIB A;  1TF8 A;  1M4L A;  2BEI A;  3EC4 A;  3HUV A;  4UCP A;  2J8M A;  1EE3 P;  5LRG A;  3V8I A;  2FIA A;  4OAE A;  5K8O A;  2EBJ A;  2O4H A;  4OLL A;  3CZX A;  5AG5 A;  4CGP A;  2WYR A;  1IB1 E;  4KVO E;  1LAP A;  2OB0 A;  2PCU A;  3A9L A;  1QSM A;  2JEW A;  4BIN A;  1YSJ A;  1F2P A;  1A2Z A;  4BD9 A;  4UWJ A;  1IOF A;  3N5F A;  4KOY A;  4C2Y A;  1S7K A;  3BLN A;  2JBK A;  5F49 A;  4ORF A;  4JYW A;  3H8E A;  2ZEE A;  3PFO A;  5G21 A;  3SJE A;  2PJ7 A;  2PJB A;  3KGQ A;  4MCP A;  3NE8 A;  5J1Q A;  4DNC A;  1QSN A;  4PXB A;  1VIX A;  4UFX A;  4EME A;  2G3T A;  4AG7 A;  5JPH A;  2GRE A;  2PVW A;  3RYO A;  1KUX A;  4FD6 A;  4P44 A;  1NSA A;  4F0Y A;  2B3V A;  3D2M A;  3PEI A;  5IB9 A;  2NMT A;  4K3N A;  3WC5 A;  1YVO A;  1Z4R A;  1RO5 A;  4Y49 C;  4RUH A;  2RFH A;  3VAR A;  1XOV A;  1HEE A;  2XEJ A;  2PJ8 A;  2ZW5 A;  2B3U A;  2Q0Y A;  4KOT A;  3ZZI A;  2EUI A;  2GFQ A;  3ISZ A;  4L89 A;  4UCN A;  3BXM A;  2ZOG A;  4P4I A;  2KCW A;  4UA3 A;  1ELL P;  3IU2 A;  1M44 A;  3GYA A;  3PRT A;  1CPX A;  4UEF A;  4XPD C;  3GIU A;  2J8N A;  4C7H A;  1VHE A;  4JD6 A;  4R76 A;  1YLE A;  1LAM A;  4JZ0 A;  2DPT A;  3OWC A;  3H4Q A;  1YQE A;  2PR8 A;  4EFD A;  1FT7 A;  2OU2 A;  3WC7 A;  3D8P A;  4U5Y A;  4Z65 A;  5HVG A;  2YNC A;  2Q51 A;  3FXT A;  2Q44 A;  5HVH A;  4B5P A;  4OC1 A;  1YRE A;  2RC4 A;  4FD5 A;  4KLW A;  3S9M A;  4A30 A;  3WT4 A;  4P4F A;  4MFZ A;  1R57 A;  3CXS A;  4H6Z A;  2Z0Z A;  3CDX A;  2PSW A;  4OID A;  3KL9 A;  5JM6 A;  2PJ0 A;  5I4M A;  1WK4 A;  4H89 A;  1CM0 A;  1LCP A;  4Q38 A;  4NGR A;  5LRJ A;  1TKF A;  2Z3P A;  3QB8 A;  4BMH A;  3FNC A;  2ABZ A;  2BSW A;  2PDO A;  2AE6 A;  3TOB A;  5I0C A;  2F7V A;  2V8G A;  1JWQ A;  4DYO A;  4MMO A;  4PXE A;  3DR6 A;  3RNZ A;  1B6B A;  1S7F A;  2G3A A;  2J9A A;  1KZF A;  4LQG A;  1B87 A;  2A4N A;  2B58 A;  3QAH A;  2Z11 A;  2GLJ A;  2Z3M A;  2AFS A;  4MCQ A;  4PXC A;  4Q36 A;  3R1K A;  5DWM A;  3MN8 A;  2HQY A;  4M3S A;  4P4D A;  1QQ9 A;  5K8M A;  5ISV A;  2HC9 A;  3B3W A;  3PBE A;  4NGM A;  4CYO A;  4A32 A;  4A2Z A;  1PU9 A;  5HVF A;  2PQ8 A;  2Z3N A;  1QSO A;  3SJG A;  4FBE A;  1KUV A;  4PXD A;  3KZW A;  5A27 A;  5F46 A;  2ZOF A;  3SXN A;  2PJ9 A;  4NGN A;  2ZEN A;  3VH9 A;  3LAC A;  4PK2 A;  3SJX A;  1IOI A;  3KQZ A;  1XEB A;  2PJ2 A;  4U9Z A;  5AG7 A;  3SI2 A;  4EVY A;  3G8W A;  1Z9U A;  3CT9 A;  3TFY A;  1Y0Y A;  1SQH A;  2PJ4 A;  4M6G A;  4GXH A;  3FBU A;  1I12 A;  2B4B A;  4B11 A;  4IK2 A;  2FL4 A;  4O23 A;  4RS2 A;  2XEF A;  1PUA A;  4YWY A;  3SHP A;  1Z8T A;  4E0A A;  1CX8 A;  3PB9 X;  4HPS A;  1Y7E A;  2FS5 A;  3NH5 A;  2BOA A;  4CRY B;  4DJL A;  3DR8 A;  2I3C A;  2RB7 A;  2CNS A;  1Z5R A;  3W6S A;  2PIZ A;  3K9T A;  1BPN A;  4RN7 A;  1RXT A;  4E8O A;  5LRK A;  4NF1 A;  1Q7L A;  2FCK A;  3B3S A;  4YRH A;  1ON0 A;  4CRZ B;  3PB8 X;  3D7F A;  1KUY A;  2Q4Z A;  5C82 A;  1YX0 A;  3NH8 A;  4E2A A;  2HB6 A;  4MHZ A;  1MJB A;  1J4J A;  3JUW A;  2VBQ A;  1DTD A;  4QBJ A;  3LMS A;  3PP9 A;  4KVX A;  3B7I A;  1Z4E A;  4UEZ A;  3WAB A;  4J3G A;  3D4U A;  2ZW4 A;  2ZEG A;  3D67 A;  2ODF A;  1AUG A;  4R3K A;  3S6H A;  1S7N A;  3NA6 A;  4MJ8 A;  2YNC C;  2JDC A;  2XEI A;  1ARM A;  4A33 A;  3TO9 A;  1IU8 A;  1LAN A;  2D4O A;  3N7Z A;  4HNY B;  2VQY A;  2CXA A;  1PCA A;  4ZGY B;  2B4D B;  5GCN A;  1U6M A;  1VGY A;  2PIY A;  4RI1 A;  2OH1 A;  5F47 A;  1Y7R A;  3TO6 A;  3NFZ A;  2Z3K A;  3B8G A;  3EO4 A;  2FVG A;  2B4D A;  1R3N A;  3BJ7 A;  4OAD A;  2JDD A;  4P4J A;  4XNH C;  1MJ9 A;  3RO0 A;  4EWT A;  2YND A;  4MFQ A;  3TT2 A;  4NXY A;  3IWW A;  2EWB A;  2JEV A;  4CGM A;  2X7B A;  2BL1 A;  1Z8W A;  4R57 A;  2GLF A;  3TO7 A;  1GYT A;  4XPL A;  1CBX A;  5JQ4 A;  5F48 A;  2ZEO A;  4OC0 A;  2G0B A;  2OZU A;  2OOT A;  5KTD A;  2PJ1 A;  2VI7 A;  1M4I A;  1HDU A;  2ZEF A;  2ZW6 A;  3JVN A;  4KS9 A;  3CXQ A;  4JXR A;  3TTH A;  4A39 A;  4ZI6 A;  4B6Z A;  2AFZ A;  1AYE A;  1FNO A;  4NGQ A;  4A31 A;  3G3S A;  4CGO A;  5K8N A;  2QML A;  7CPA A;  1K4J A;  4NGT A;  3B3T A;  4KUA A;  2YGW A;  1Q2D A;  4MY3 A;  4JXQ A;  4MCR A;  4ZX9 A;  1CG2 A;  1YR0 A;  2ZED A;  3FJU A;  4MY0 A;  5IB0 A;  4H6U A;  2C1C A;  4KLV A;  3F5B A;  1LFW A;  2Y0M A;  1UWY A;  4R9M A;  1TIQ A;  4YU9 A;  3ZJ0 A;  1S5K A;  2AFM A;  3D7G A;  3TX8 A;  4ZY1 A;  1M1D A;  2OR4 A;  1ELM P;  1F2O A;  2O28 A;  1V0C A;  3D66 A;  2Q43 A;  4NEX A;  4P6Y A;  2EK8 A;  4WWV A;  4FUU A;  4C2X A;  5C88 A;  5AGE A;  3K2K A;  4A38 A;  3NE7 A;  1Z8L A;  3FB3 A;  4KOV A;  1TKH A;  3IIB A;  2VXK A;  3PBB A;  2D4P A;  3R96 A;  5ELY A;  4KSI A;  3DNS A;  4R3L A;  4CGN A;  1QST A;  1QMU A;  4JJX A;  5J8C A;  4MXU A;  1KWM A;  2ZEL A;  4UWI A;  2QYV A;  2CNM A;  3IWE A; 
#chains in the Genus database with same CATH homology
 4B5O A;  4KUB A;  2P6G A;  4B13 A;  3S6F A;  4CAX A;  5AG4 A;  4UBR A;  2REE A;  2OZG A;  3FIX A;  3R9G A;  3T9Y A;  4MFL A;  2Z3L A;  1CJW A;  2Q04 A;  5H86 A;  1XIX A;  3W6X A;  4F6A A;  2IL4 A;  4ONU A;  2QEC A;  2P0W A;  4LUA A;  5DWN A;  4QB9 A;  5E96 A;  3H5Z A;  1Y9K A;  1LRZ A;  4MI4 A;  3W91 A;  4AVB A;  4PV6 A;  5IX3 A;  2R1I A;  1MJA A;  4AB7 A;  5A28 A;  1ZO0 A;  2WUU A;  2AJ6 A;  4II9 A;  1XMT A;  4MBU A;  2PR1 A;  2I00 A;  2QIR A;  4QC6 A;  3TOA A;  3P2H A;  4Y49 B;  3R95 A;  4MHD A;  3I3G A;  2R8V A;  2CNT A;  3IGR A;  2ZXV A;  3VWE A;  2ZW7 A;  5G20 A;  4JLY A;  4KOS A;  3K9U A;  3F0A A;  1YGH A;  1Y9W A;  4XPD B;  5H84 A;  3VWD A;  2I79 A;  4FD4 A;  3TCV A;  3MGD A;  2GE3 A;  1P4N A;  4X5K A;  4JWP A;  2FSR A;  4HNX B;  1NSL A;  4CYP A;  1P0H A;  3I9S A;  2CY2 A;  4KZT A;  3P2F A;  2P6E A;  4CYQ A;  3S6G A;  4L8A A;  4C2Z A;  1Q2C A;  5FVJ A;  5IV0 A;  5CNP A;  2R98 A;  2BUE A;  2VZY A;  3R9F A;  4ZBG A;  4GS4 A;  3R9E A;  1QSR A;  3FYN A;  4UFW A;  3KKW A;  3S6K A;  4PK3 A;  2P6F A;  1L0C A;  2ATR A;  3GKR A;  4KSF A;  4NSQ A;  5G1Z A;  1XF8 A;  3F8K A;  4B14 A;  4K30 A;  3DSB A;  4AVA A;  4CAF A;  2Q7B A;  1IYL A;  2Z10 A;  1NMT A;  4BBH A;  4XPK A;  4I49 A;  2WPW A;  2Q4Y A;  4KSA A;  3BJ8 A;  1IIC A;  3GY9 A;  3E0K A;  3PGP A;  4UCM A;  1N71 A;  4M85 A;  2C27 A;  1YK3 A;  2REF A;  4R87 A;  4KOX A;  5AG6 A;  2PRB A;  3CXP A;  2GIV A;  1OZP A;  3T90 A;  3D3S A;  2DPS A;  1MK4 A;  2HV2 A;  1XE4 A;  4NCZ A;  2FE7 A;  4QUS A;  3D2P A;  1S60 A;  2F5I A;  2FT0 A;  4B10 A;  4MFP A;  1UFH A;  3LD2 A;  3EY5 A;  4B5P B;  1NE9 A;  4PSW A;  4UFV A;  3IU1 A;  5J8F A;  2R7H A;  3C26 A;  4MFK A;  2WSA A;  2YNE A;  1I21 A;  1Q2Y A;  2PC1 A;  4XNH B;  2HUZ A;  2ZPA A;  4CGL A;  1M4G A;  1GHE A;  2FXF A;  4IUS A;  2K5T A;  3PZJ A;  1VKC A;  2Z3O A;  4CS0 B;  1YVK A;  3IWG A;  4KOR A;  4HKF A;  2OZH A;  1IID A;  1BOB A;  3DDD A;  3FRM A;  2J8R A;  3EFA A;  5KTC A;  5HMN A;  1VHS A;  3TE4 A;  2FIW A;  3UY5 A;  2Q4V A;  2ARH A;  2VZZ A;  5G22 A;  4B12 A;  5EC4 A;  4C68 A;  5BWA B;  4CAE A;  1M4D A;  1S7L A;  1I1D A;  4KOW A;  4LX9 A;  5KTA A;  2JLM A;  4C7I A;  3LOD A;  1BO4 A;  1S3Z A;  4IF5 A;  4KOU A;  4YFJ A;  4AVC A;  2GAN A;  2VEZ A;  4FD7 A;  4YGO A;  4F0X A;  4U9Y A;  2B5G B;  1IYK A;  4CAV A;  3JTK A;  4CAW A;  2B5G A;  4A95 A;  4PSX A;  5HH1 A;  4CYN A;  1WWZ A;  3EXN A;  2EVN A;  4AG9 A;  3SXO A;  4KVM E;  5EBV A;  4MFJ A;  4HNW B;  2H5M A;  4QVT A;  2WPX A;  2DXQ A;  1FY7 A;  3WR7 A;  3EC4 A;  2BEI A;  3V8I A;  4UCP A;  2J8M A;  2FIA A;  4OAE A;  5AG5 A;  4OLL A;  4CGP A;  1IB1 E;  4KVO E;  2OB0 A;  3A9L A;  1QSM A;  4UWJ A;  4KOY A;  4C2Y A;  1S7K A;  3BLN A;  5F49 A;  4ORF A;  5G21 A;  4DNC A;  1QSN A;  4UFX A;  2G3T A;  4AG7 A;  5JPH A;  3RYO A;  1KUX A;  4FD6 A;  4F0Y A;  2B3V A;  3D2M A;  2NMT A;  1YVO A;  1Z4R A;  1RO5 A;  4Y49 C;  2ZW5 A;  2B3U A;  2Q0Y A;  4KOT A;  3ZZI A;  2EUI A;  4L89 A;  4UCN A;  2KCW A;  4UA3 A;  3IU2 A;  1M44 A;  3GYA A;  4XPD C;  2J8N A;  4C7H A;  4JD6 A;  1YLE A;  2DPT A;  3OWC A;  3H4Q A;  2PR8 A;  2OU2 A;  3D8P A;  4U5Y A;  2YNC A;  3FXT A;  2Q44 A;  4B5P A;  1YRE A;  2RC4 A;  4FD5 A;  4KLW A;  4A30 A;  4MFZ A;  1R57 A;  3CXS A;  4H6Z A;  2Z0Z A;  2PSW A;  1WK4 A;  4H89 A;  1CM0 A;  4Q38 A;  2Z3P A;  3QB8 A;  4BMH A;  3FNC A;  2BSW A;  2PDO A;  2AE6 A;  3TOB A;  5I0C A;  3DR6 A;  1B6B A;  1S7F A;  2G3A A;  1KZF A;  1B87 A;  2A4N A;  2B58 A;  3QAH A;  2Z11 A;  2Z3M A;  4Q36 A;  3R1K A;  5DWM A;  2HQY A;  4M3S A;  5ISV A;  4CYO A;  4A32 A;  4A2Z A;  1PU9 A;  2PQ8 A;  2Z3N A;  1QSO A;  1KUV A;  5A27 A;  5F46 A;  3SXN A;  4PK2 A;  1XEB A;  4U9Z A;  5AG7 A;  4EVY A;  3G8W A;  1Z9U A;  3TFY A;  1SQH A;  3FBU A;  1I12 A;  2B4B A;  4B11 A;  2FL4 A;  4RS2 A;  4E0A A;  3SHP A;  1PUA A;  2FS5 A;  4CRY B;  3DR8 A;  2CNS A;  3W6S A;  1RXT A;  4E8O A;  4NF1 A;  2FCK A;  4YRH A;  4CRZ B;  1ON0 A;  5C82 A;  1KUY A;  1YX0 A;  4E2A A;  1MJB A;  1J4J A;  3JUW A;  2VBQ A;  4QBJ A;  3PP9 A;  4KVX A;  1Z4E A;  4J3G A;  2ZW4 A;  4R3K A;  3S6H A;  1S7N A;  4MJ8 A;  2YNC C;  2JDC A;  4A33 A;  3TO9 A;  2D4O A;  3N7Z A;  4HNY B;  2VQY A;  2CXA A;  4ZGY B;  2B4D B;  5GCN A;  1U6M A;  4RI1 A;  2OH1 A;  5F47 A;  1Y7R A;  3TO6 A;  2Z3K A;  3B8G A;  3EO4 A;  3BJ7 A;  2B4D A;  4OAD A;  2JDD A;  4XNH C;  1MJ9 A;  2YND A;  4MFQ A;  3TT2 A;  4NXY A;  4CGM A;  2JEV A;  2X7B A;  2BL1 A;  4R57 A;  3TO7 A;  4XPL A;  5JQ4 A;  5F48 A;  2G0B A;  2OZU A;  5KTD A;  2VI7 A;  1M4I A;  3JVN A;  2ZW6 A;  4KS9 A;  3CXQ A;  4JXR A;  3TTH A;  4A31 A;  3G3S A;  4CGO A;  2QML A;  1K4J A;  4KUA A;  2YGW A;  1Q2D A;  4MY3 A;  4JXQ A;  5IB0 A;  1YR0 A;  4MY0 A;  4H6U A;  4KLV A;  3F5B A;  2Y0M A;  4R9M A;  3ZJ0 A;  1TIQ A;  1S5K A;  1M1D A;  2O28 A;  1V0C A;  4NEX A;  4C2X A;  5C88 A;  5AGE A;  3NE7 A;  3FB3 A;  4KOV A;  2VXK A;  2D4P A;  3R96 A;  4R3L A;  3DNS A;  4CGN A;  1QST A;  5J8C A;  4JJX A;  4UWI A;  2CNM A;  3IWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...