3BJ7A

Spermine/spermidine n1-acetyltransferase from mouse: crystal structure of a ternary complex reveals solvent-mediated spermine binding
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
162
Chain Sequence
KFKIRPATASDCSDILRLIKELAKYEYMEDQVILTEKDLQEDGFGEHPFYHCLVAEVPPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMKCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of spermidine/spermine N1-acetyltransferase in complex with spermine provides insights into substrate binding and catalysis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Diamine acetyltransferase 1
total genus 42
structure length 162
sequence length 167
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2007-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3bj7A00
4KOYA 4YRHA 1MJ9A 4X5KA 2Z11A 3GY9A 3F0AA 3CXPA 3IWGA 4R3KA 1MK4A 4AVCA 2B5GA 4JJXA 4NSQA 2P6EA 2PSWA 3K9UA 4KVME 3TCVA 1M1DA 1S7LA 3P2FA 2G3AA 4MY3A 1YK3A 5HH1A 2NMTA 3T9YA 2ARHA 1Q2CA 2Q0YA 2ZW6A 4KVXA 2PRBA 2QECA 3EFAA 2Q04A 3I3GA 1GHEA 2GANA 2G0BA 4JD6A 1YGHA 3ZJ0A 1Z4EA 3R95A 3FNCA 2ATRA 4KOUA 5FVJA 1IIDA 3CXQA 2B3UA 4H89A 4CAVA 3EXNA 2AJ6A 3FYNA 4H6ZA 3R1KA 2FIAA 3H4QA 2H5MA 4KOSA 2ZW5A 2FCKA 2OZUA 1V0CA 1P0HA 4J3GA 2VBQA 2VI7A 4RS2A 3FB3A 3S6HA 3TOAA 2RC4A 4XPKA 5EC4A 3BLNA 5I0CA 3QB8A 4XPDB 1LRZA 4QB9A 4II9A 2BEIA 2QIRA 5C82A 4ORFA 1CM0A 3EY5A 2VZYA 1N71A 4NEXA 2HUZA 3NE7A 4F6AA 3PGPA 5E96A 2JDDA 1B87A 2B3VA 5KTAA 1S7KA 1I12A 1MJBA 5F46A 2D4OA 5IX3A 2C27A 2REFA 3W91A 5KTCA 4R57A 2X7BA 2JDCA 4E0AA 4KOVA 4R9MA 2ZW7A 4AG9A 3V8IA 1RXTA 4U9ZA 1M4IA 2A4NA 3D2MA 1KZFA 3TFYA 4XNHB 5H84A 1S3ZA 3N7ZA 1S7NA 2PR1A 2Z0ZA 3VWDA 3C26A 4U5YA 4E8OA 5F48A 1M44A 2B4BA 4HNWB 2IL4A 2FIWA 1SQHA 4KOWA 4HNYB 4CRYB 4CRZB 2Q4YA 3D2PA 4PSWA 1KUVA 4QUSA 3KKWA 1XF8A 4OAEA 3WR7A 1Q2YA 2ZW4A 2WPXA 1PU9A 4UBRA 4R3LA 4FD4A 3BJ7A 2BL1A 1WK4A 2VXKA 5IB0A 1VHSA 4Y49B 3PP9A 1IICA 3FXTA 3S6GA 2O28A 4BMHA 4ONUA 4IUSA 1FY7A 4CAXA 2JEVA 2DXQA 2FT0A 5C88A 3B8GA 1NMTA 2REEA 4F0YA 1S7FA 3DDDA 3DR6A 2PDOA 3E0KA 2PR8A 3PZJA 2GE3A 4KVOE 5DWNA 1Y9WA 4FD7A 4AVAA 1S60A 1YX0A 1YLEA 4MY0A 1J4JA 2VZZA 2I79A 4QVTA 4KUAA 3W6XA 5DWMA 4M3SA 1BOBA 3EO4A 1Z4RA 2QMLA 1M4GA 4K30A 2FSRA 2JLMA 2B58A 1I1DA 3T90A 2P6FA 3G8WA 2CY2A 1NE9A 3TOBA 2FL4A 4LX9A 1BO4A 1I21A 2Q44A 1U6MA 2ZXVA 1UFHA 3FBUA 4CS0B 2J8MA 1XEBA 3OWCA 3D3SA 4LUAA 4E2AA 2FXFA 2B4DA 4NXYA 3D8PA 5EBVA 1CJWA 2AE6A 2GIVA 2R7HA 1QSRA 3DNSA 2Z10A 4OADA 4QC6A 1IYKA 2D4PA 2R98A 1XE4A 3R96A 2PQ8A 4ZBGA 3BJ8A 3ZZIA 5H86A 4MHDA 1P4NA 2P0WA 3S6KA 4AG7A 3FIXA 5KTDA 1IYLA 2CNMA 3F8KA 1R57A 4KLVA 4MBUA 2OB0A 2OZHA 2FS5A 1K4JA 2OH1A 3TO6A 1PUAA 5F47A 3GKRA 4RI1A 3RYOA 5HMNA 4GS4A 1YVKA 3R9GA 3FRMA 2R1IA 5JQ4A 2G3TA 3F5BA 3LODA 3TO9A 1MJAA 2P6GA 1KUXA 3GYAA 4IF5A 4U9YA 3LD2A 4JXQA 2WPWA 1Z9UA 1IB1E 5F49A 2B4DB 4XNHC 1WWZA 2K5TA 4JXRA 4PV6A 1M4DA 3I9SA 4KUBA 4FD6A 5GCNA 1B6BA 1YVOA 2J8NA 4KZTA 4UWJA 2CNTA 4YFJA 3CXSA 4YGOA 3SXNA 2Q7BA 1QSMA 1QSTA 1Y7RA 3SXOA 2CNSA 1KUYA 1VKCA 4EVYA 4KOXA 4DNCA 4PK2A 4H6UA 1S5KA 1NSLA 2HV2A 2KCWA 5JPHA 2Y0MA 3DR8A 4QBJA 1QSNA 3JUWA 1Y9KA 2R8VA 4L89A 4B5OA 4KOTA 2OU2A 4NCZA 4NF1A 5IV0A 4L8AA 4AVBA 3R9EA 4MJ8A 1ON0A 1TIQA 4FD5A 2EVNA 5J8FA 4JWPA 2OZGA 4XPLA 3G3SA 4MI4A 4UA3A 2PC1A 2BUEA 4B5PB 1YREA 2I00A 2ZPAA 1Q2DA 4M85A 4CAWA 1YR0A 1XIXA 2F5IA 5CNPA 4Y49C 3JVNA 4AB7A 2Q4VA 2B5GB 3R9FA 1XMTA 3P2HA 4KORA 3TT2A 4R87A 4B5PA 1L0CA 3MGDA 4KLWA 2VQYA 4PSXA 5ISVA 3TO7A 3VWEA 3TE4A 4JLYA 3SHPA 2J8RA 3DSBA 2EUIA 3W6SA 4PK3A 3TTHA 4XPDC 3UY5A 2FE7A 4I49A 3EC4A 4HNXB 1RO5A 4UWIA 3IGRA 3QAHA 4OLLA 5J8CA 3S6FA 2VEZA 4HKFA 2BSWA 2HQYA 1OZPA 1QSOA
chains in the Genus database with same CATH superfamily
4KOYA 3S9LA 4YRHA 1TKJA 1MJ9A 2ABZA 3LACA 4MFPA 4X5KA 2Z11A 3GY9A 2GREA 2DEAA 3F0AA 4C2XA 3CXPA 3IEHA 3IFEA 3KR5A 3IWGA 3K2KA 2PJ4A 4R3KA 1MK4A 3D66A 4AVCA 2B5GA 4JJXA 4NGSA 1R43A 3IO1A 5J1QA 4NSQA 2P6EA 4MCSA 2PSWA 2AFWA 3K9UA 4KVME 4MHPA 3KR4A 3TCVA 1M1DA 1S7LA 4UFVA 4C2ZA 1XRYA 2C6GA 4B10A 4II9A 2PJ8A 3CDXA 4MFQA 3PFEA 1QQ9A 3P2FA 2G3AA 4MY3A 1YK3A 5HH1A 5THWA 3SJFA 2NMTA 1LCPA 3K9TA 2ARHA 1Z8TA 3T9YA 1Q2CA 2Q0YA 2ZW6A 2BOAA 4KVXA 3B3TA 3FX6A 4B13A 2PRBA 1BPNA 1CP6A 4MFZA 4O23A 2QECA 3EFAA 2Q04A 5HVFA 2YNDA 3I3GA 2V77A 2CTBA 1BLLE 1GHEA 1X12A 2GANA 2HB6A 2G0BA 3BHXA 4JD6A 4TWEA 1YGHA 2EK8A 3ZJ0A 1Z4EA 3R95A 4CGOA 3FNCA 2ATRA 2ZEOA 4KOUA 4BINA 5F09A 4PPZA 2WSAA 2VL1A 1LFWA 2NYQA 5FVJA 1IIDA 3CXQA 2B3UA 1ZLHA 3PRTA 3EXNA 1BAVA 2AJ6A 3FYNA 4H89A 3NA6A 4TNUA 4H6ZA 4DYOA 5G22A 2FIAA 3H4QA 3R1KA 4M6IA 4OMEA 2H5MA 1XBUA 4KOSA 2PIYA 2ZW5A 2FCKA 3IWEA 2OZUA 3CT9A 4UEEA 4P45A 4A95A 1V0CA 1P0HA 2IJZA 2XEJA 4A37A 4MFKA 1YMEA 4C7IA 2C1CA 3BXMA 4J3GA 2VBQA 2PJ5A 2VI7A 4W9YA 4RS2A 3FB3A 3S6HA 4DUKA 1CP7A 3TOAA 2RC4A 4XPKA 5EC4A 4MCQA 4UCMA 5JGFA 4X8IA 3BLNA 3SJEA 5I0CA 3QB8A 4XPDB 2Z3LA 3LMSA 4F0XA 1LRZA 2GLJA 3PFOA 2BEIA 4QB9A 4CYNA 2QIRA 5JH9A 5C82A 4LQGA 3FMCA 1CM0A 3EY5A 1TXRA 3I1UA 3PB7X 2PJ3A 4ORFA 5LRKA 1LANA 3IU2A 2VZYA 1N71A 4NEXA 2HUZA 4ZX8A 4NFRA 2PJ6A 3NE7A 5D8NA 4F6AA 2Z3KA 3V38A 5LRGA 1CG2A 3PGPA 5G20A 5E96A 3GB0A 3LWUA 2YNCC 4OIWA 2JDDA 1AYEA 1B87A 2B3VA 2O4HA 3PEIA 2V8DA 4CGLA 5KTAA 1S7KA 1I12A 3GIUA 3QAYA 4ZX9A 1TF8A 3B3VA 1MJBA 1KWMA 2V8HA 5F46A 1CPXA 4LQ6A 2D4OA 2JBKA 1XJOA 4P4EA 5AGEA 2XEIA 2CF4A 5IX3A 2C27A 1IGBA 2Z3OA 2REFA 3W91A 2OOTA 3FECA 6CPAA 1YW4A 5HVHA 5BWAB 5KTCA 4R57A 2X7BA 3WC7A 2JDCA 1Y0YA 2PIZA 2ZEHA 2Q4ZA 4KOVA 4E0AA 4R9MA 2FVGA 2ZW7A 4KSFA 4PXDA 4P44A 3WC5A 4AG9A 2ZELA 4ZGYB 3V8IA 1RXTA 1TF9A 4P4BA 4A31A 4EWTA 3B2YA 3ISXA 3KI9A 4FUUA 1Y7EA 2ANPA 3H5ZA 4WJBA 4CAFA 4U9ZA 4X3RA 5D29A 1M4IA 2A4NA 3D2MA 1KZFA 3ISZA 3TFYA 2BCOA 4Q36A 1OBRA 3VATA 4G1PA 4CAVA 4XNHB 2WZNA 1S3ZA 3N7ZA 1S7NA 5H84A 4NGMA 4MCPA 4BBHA 2ODFA 4CYQA 2PR1A 2Z0ZA 2WYRA 2ZEGA 3C26A 3QNVA 3VWDA 4A32A 2C6CA 4OP4A 4U5YA 4E8OA 2PJ1A 1M44A 5F48A 3RO0A 2YNCA 2CTCA 2B4BA 4HNWB 2IL4A 2FIWA 3B3SA 2PVWA 5EMIA 1SQHA 3NE8A 1FNOA 4KOWA 4HNYB 4CRYB 4CRZB 2Q4YA 3D2PA 4PSWA 4NGNA 2I3CA 1KUVA 4QUSA 2V8GA 3KKWA 2Q51A 4ZY1A 4PXCA 1XF8A 5HXDA 3D68A 4OC1A 4OAEA 4P6YA 4ZYQA 3WR7A 1Q2YA 4MMOA 5LRJA 2ZW4A 2WPXA 1PU9A 4UBRA 4OC5A 5G1ZA 4NJQA 4Q7AA 3RZAA 2JBJA 4R3LA 5DS0A 3BJ7A 4FD4A 2BL1A 1WK4A 2VXKA 2AFZA 1Y0RA 3CZXA 2ZEPA 5IB0A 4OKOA 1VHSA 4Y49B 5AG4A 2J9AA 1IICA 2AFMA 2RFHA 3PP9A 2ZOGA 3FXTA 4NGQA 3PBBA 3S6GA 4HPSA 2OR4A 2O28A 4BMHA 1IOIA 3FVLA 3B3CA 5LYFA 2O53A 2PJBA 3IC1A 4ONUA 4IUSA 4UCNA 5CPAA 3NH8A 1FY7A 2GFQA 4CAXA 3S9MA 2JEVA 2DXQA 4EFDA 3NFZA 2FT0A 4ONWA 1LAMA 5AG5A 1VHOA 5C88A 2Z3NA 4MHYA 5AG7A 4JYWA 3B8GA 2IMOA 1NMTA 2REEA 4F0YA 1S7FA 3KQZA 2AFUA 3SI1A 3DDDA 5HVGA 5LYLA 4B11A 5IB9A 1CX8A 3DR6A 2PDOA 3E0KA 2PJCA 2PR8A 3PZJA 2GE3A 4KVOE 2EO8A 5DWNA 1Y9WA 4FD7A 4AVAA 4F9VA 1S60A 3PBEA 1YX0A 1YLEA 4MY0A 1J4JA 2VZZA 1YSJA 2GLFA 3B3WA 4OC2A 2I79A 4QVTA 4UF4A 3L2NA 4MXUA 3D67A 4KUAA 3W6XA 3BI0A 5DWMA 1LAPA 4CAEA 4M3SA 1BOBA 1AMPA 3KHZA 2ZEDA 3SI2A 1DE4C 1DTDA 3EO4A 1Z4RA 4RN7A 2QMLA 3DGVA 4A39A 1M4LA 1M4GA 1HDQA 3PB4X 4K30A 4Q38A 3V7ZA 1ARLA 2FSRA 4UCPA 4F8ZA 2JLMA 2B58A 1I1DA 2Z3MA 4MHZA 4F9UA 3H8GA 3T90A 4CYOA 4M6HA 3D7GA 4OIDA 2P6FA 3G8WA 5AG6A 4CGPA 2CY2A 1NE9A 2EK9A 3TOBA 2FL4A 4R6TA 1Z8LA 3FH4A 4LX9A 1BO4A 3WABA 2Q44A 1I21A 1U6MA 2JEWA 1Z5RA 1UFHA 2ZXVA 3FBUA 2YNEA 4CS0B 2J8MA 3TX8A 2ZEFA 1XEBA 2AFOA 4C2YA 2ZENA 1RTQA 3OWCA 3GUXA 2PRQA 3D3SA 1XFOA 3FF3A 4GXHA 4LUAA 2CXAA 2FXFA 3CPXA 4NGRA 3WC6A 4E2AA 3S9NA 2B4DA 1F57A 4NXYA 3D8PA 1Z8WA 5K8PA 5EBVA 1HEEA 4KSAA 1CJWA 4FWUA 4IHMA 2AE6A 4PXBA 2GIVA 2GU2A 5A28A 3SI0A 2QYVA 2R7HA 1AUGA 1QSRA 3MN8A 5A27A 3N5FA 3DNSA 2Z10A 1FT7A 2CIJA 4DJLA 1YW6A 3HLPA 4OADA 4QC6A 1IYKA 2D4PA 2R98A 1XE4A 4NGPA 4MCRA 2PJ7A 4UEFA 3R96A 4P4IA 2PQ8A 5ELYA 4ZBGA 3BJ8A 3ZZIA 5H86A 3FEEA 2Q7SA 3DLJA 4MHDA 1P4NA 2G9DA 3RAMA 8CPAA 2P0WA 1TKHA 3S6KA 4AG7A 1TKFA 3FIXA 5KTDA 1IYLA 4MFJA 2CNMA 3F8KA 1R57A 4KLVA 4MBUA 2OB0A 2OZHA 2Z3PA 3CPAA 1R3NA 2FS5A 1K4JA 2OH1A 1PCAA 3TO6A 2AFXA 1PUAA 2DPSA 3GKRA 4RI1A 1VHEA 5F47A 3RYOA 5HMNA 4GS4A 4B6ZA 1YVKA 3R9GA 4ZI6A 3FRMA 2NSMA 2R1IA 5JQ4A 3D7HA 4R76A 4ZY2A 2G3TA 1A2ZA 3KHXA 3F5BA 3LODA 2DF5A 3TO9A 1MJAA 2P6GA 5CBMA 4OC4A 1KUXA 4P10A 3KASA 3GYAA 4CGMA 3KL9A 1ZG9A 4C68A 4IF5A 4U9YA 3LD2A 2F7VA 1CPSA 3H8EA 4JXQA 4FAIA 1X10A 4CYPA 1NSAA 1UWYA 2WPWA 1Z9UA 1VIXA 1IB1E 4UIAA 5F49A 4P4JA 1ZLIA 2B4DB 1GYTA 2PJ2A 4XNHC 1WWZA 2K5TA 3D4UA 4JXRA 4MFLA 1ELMP 4GM5A 3FJUA 3IWWA 4PV6A 1M4DA 2ZOFA 3BI1A 3I9SA 4KUBA 4FD6A 1YLOA 5GCNA 4B14A 1F2OA 1JWQA 1JQGA 2Q43A 1B6BA 3KZWA 1YVOA 2J8NA 1XOVA 4KZTA 4R7MA 4UWJA 1ELLP 4X2TA 4B12A 1CBXA 1VGYA 2CNTA 2XEFA 4YFJA 1IOFA 3CXSA 4YGOA 4A33A 3B7IA 3SJGA 3SXNA 2Q7BA 1QSMA 3WT4A 4C7HA 1QSTA 1Y7RA 1YQEA 3JRUA 3SXOA 4RUHA 4H2KA 2CNSA 3T8WA 2F8HA 1KUYA 1VKCA 1IY7A 1Z8XA 4EVYA 4KOXA 4AXVA 4DNCA 4PK2A 4H6UA 1S5KA 1NSLA 2HV2A 2KCWA 4K3NA 5JPHA 2WUUA 2Y0MA 3DR8A 4CPAA 2YGWA 4YWYA 4QBJA 4A94A 2PCUA 3NH4A 1QSNA 4KSIA 4UEZA 3JUWA 1ZG8A 4IAVA 4PXEA 1Y9KA 5K8OA 3HUVA 2ZEMA 2EWBA 2R8VA 4Z65A 3RNZA 1XMBA 3H8FA 4A30A 4L89A 4PQAA 4B5OA 4KOTA 1BPMA 2OU2A 4UFXA 4NCZA 4NF1A 5IV0A 4L8AA 2PJ9A 3VARA 3IJ3A 4AVBA 3R9EA 4MJ8A 2BO9A 1ON0A 1TIQA 4FD5A 4P4DA 4ZY0A 2EVNA 5J8FA 4JWPA 1Z2LA 2OZGA 4XPLA 3VH9A 3G3SA 4JZ0A 3D7FA 4NJRA 4R8FA 2AFSA 4MI4A 2PC1A 4UA3A 2BUEA 5I4MA 2QJ8A 3KGQA 4B5PB 1YREA 1PYTB 4M6GA 5K8MA 2I00A 2ZPAA 3PB9X 1Q2DA 3NH5A 4M85A 1YR0A 4CAWA 1XIXA 1ZO0A 2F5IA 2RB7A 1H8LA 5CNPA 4Y49C 3JVNA 4YU9A 2Q4VA 2QVPA 4AB7A 2B5GB 3MRUA 3R9FA 4OC3A 5K8NA 4OC0A 1XMTA 4A2ZA 2DPTA 3P2HA 4KORA 3TT2A 4R87A 4B5PA 4BD9A 3D7DA 1L0CA 1ARMA 3MGDA 1Q7LA 4KLWA 2VQYA 4PSXA 5ISVA 4MRIA 3TO7A 1QMUA 4P4FA 3VWEA 4CGNA 3TE4A 4JLYA 2C6PA 1LOKA 3SHPA 2J8RA 4WWVA 4MHNA 2PJAA 3DSBA 3IU1A 4UIBA 2EUIA 3W6SA 3KQXA 2PVVA 2POKA 4PK3A 5LYIA 3TTHA 4XPDC 1F2PA 3PB6X 3SJXA 1ZG7A 3UY5A 2FE7A 4A38A 4I49A 2PJ0A 2ZEEA 4UFWA 1HDUA 2PE3A 3EC4A 3B35A 3TC8A 7CPAA 3GLJA 4HNXB 1RO5A 3IIBA 5G21A 1IU8A 3PB8X 4UWIA 5JM6A 2HC9A 1EE3P 2XEGA 2EBJA 3IGRA 3QAHA 4FBEA 4OLLA 5J8CA 3S6FA 2IQ6A 4IK2A 4KS9A 5LYDA 2VEZA 3RBUA 4HKFA 2BSWA 2HQYA 2V8VA 3FEDA 1OZPA 3JTKA 1QSOA 4EMEA 3A9LA 4NGTA
chains in the Genus database with same CATH topology
4KOYA 4YRHA 1MJ9A 4MFPA 4X5KA 2Z11A 3GY9A 3F0AA 4C2XA 3CXPA 3IWGA 4R3KA 1MK4A 4AVCA 2B5GA 4JJXA 4NSQA 2P6EA 2PSWA 3K9UA 4KVME 3TCVA 1M1DA 1S7LA 4UFVA 4C2ZA 4B10A 4MFQA 3P2FA 2G3AA 4MY3A 1YK3A 5HH1A 2NMTA 3T9YA 2ARHA 1Q2CA 2Q0YA 2ZW6A 4KVXA 4B13A 2PRBA 4MFZA 2QECA 3EFAA 2Q04A 2YNDA 3I3GA 1GHEA 2GANA 2G0BA 4JD6A 1YGHA 3ZJ0A 1Z4EA 3R95A 4CGOA 3FNCA 2ATRA 4KOUA 2WSAA 5FVJA 1IIDA 3CXQA 2B3UA 4H89A 4CAVA 3EXNA 2AJ6A 3FYNA 4H6ZA 5G22A 3R1KA 2FIAA 3H4QA 2H5MA 4KOSA 2ZW5A 2FCKA 3IWEA 2OZUA 4A95A 1V0CA 1P0HA 4MFKA 4C7IA 4J3GA 2VBQA 2VI7A 4RS2A 3FB3A 3S6HA 3TOAA 2RC4A 4XPKA 5EC4A 4UCMA 3BLNA 5I0CA 3QB8A 4XPDB 2Z3LA 4F0XA 1LRZA 4QB9A 4II9A 2BEIA 4CYNA 2QIRA 5C82A 4ORFA 1CM0A 3EY5A 3IU2A 2VZYA 1N71A 4NEXA 2HUZA 3NE7A 4F6AA 2Z3KA 3PGPA 5G20A 5E96A 2YNCC 2JDDA 1B87A 4CGLA 2B3VA 5KTAA 1S7KA 1I12A 1MJBA 5F46A 2D4OA 5AGEA 5IX3A 2C27A 2Z3OA 2REFA 3W91A 5KTCA 5BWAB 4R57A 2X7BA 2JDCA 4E0AA 4KOVA 4R9MA 2ZW7A 4KSFA 4AG9A 4ZGYB 3V8IA 1RXTA 4A31A 4CAFA 3H5ZA 4U9ZA 1M4IA 2A4NA 3D2MA 1KZFA 3TFYA 4Q36A 4XNHB 5H84A 1S3ZA 3N7ZA 1S7NA 4BBHA 4CYQA 2PR1A 2Z0ZA 3VWDA 3C26A 4A32A 4U5YA 4E8OA 5F48A 1M44A 2YNCA 2B4BA 4HNWB 2IL4A 2FIWA 1SQHA 4KOWA 4HNYB 4CRYB 4CRZB 2Q4YA 3D2PA 4PSWA 1KUVA 4QUSA 3KKWA 1XF8A 4OAEA 3WR7A 1Q2YA 2ZW4A 2WPXA 1PU9A 4UBRA 5G1ZA 4R3LA 4FD4A 3BJ7A 2BL1A 1WK4A 2VXKA 5IB0A 1VHSA 4Y49B 5AG4A 3PP9A 1IICA 3FXTA 3S6GA 2O28A 4BMHA 4ONUA 4IUSA 4UCNA 1FY7A 4CAXA 2JEVA 2DXQA 2FT0A 5AG5A 5C88A 2Z3NA 5AG7A 3B8GA 1NMTA 2REEA 4F0YA 1S7FA 3DDDA 4B11A 3DR6A 2PDOA 3E0KA 2PR8A 3PZJA 2GE3A 4KVOE 5DWNA 1Y9WA 4FD7A 4AVAA 1S60A 1YX0A 1YLEA 4MY0A 1J4JA 2VZZA 2I79A 4QVTA 4KUAA 3W6XA 5DWMA 4CAEA 4M3SA 1BOBA 3EO4A 1Z4RA 2QMLA 1M4GA 4K30A 4Q38A 2FSRA 4UCPA 2JLMA 2B58A 1I1DA 2Z3MA 3T90A 4CYOA 2P6FA 3G8WA 5AG6A 4CGPA 2CY2A 1NE9A 3TOBA 2FL4A 4LX9A 1BO4A 1I21A 2Q44A 1U6MA 2ZXVA 1UFHA 3FBUA 2YNEA 4CS0B 2J8MA 1XEBA 4C2YA 3OWCA 3D3SA 4LUAA 2CXAA 2FXFA 4E2AA 2B4DA 4NXYA 3D8PA 5EBVA 4KSAA 1CJWA 2AE6A 2GIVA 5A28A 2R7HA 1QSRA 5A27A 3DNSA 2Z10A 4OADA 4QC6A 1IYKA 2D4PA 2R98A 1XE4A 3R96A 2PQ8A 4ZBGA 3BJ8A 3ZZIA 5H86A 4MHDA 1P4NA 2P0WA 3S6KA 4AG7A 3FIXA 5KTDA 1IYLA 4MFJA 2CNMA 3F8KA 1R57A 4KLVA 4MBUA 2OB0A 2OZHA 2Z3PA 2FS5A 1K4JA 2OH1A 3TO6A 1PUAA 2DPSA 3GKRA 4RI1A 5F47A 3RYOA 5HMNA 4GS4A 1YVKA 3R9GA 3FRMA 2R1IA 5JQ4A 2G3TA 3F5BA 3LODA 3TO9A 1MJAA 2P6GA 1KUXA 3GYAA 4CGMA 4C68A 4IF5A 4U9YA 3LD2A 4JXQA 4CYPA 2WPWA 1Z9UA 1IB1E 5F49A 2B4DB 4XNHC 1WWZA 2K5TA 4JXRA 4MFLA 4PV6A 1M4DA 3I9SA 4KUBA 4FD6A 5GCNA 4B14A 1B6BA 1YVOA 2J8NA 4KZTA 4UWJA 4B12A 2CNTA 4YFJA 3CXSA 4YGOA 4A33A 3SXNA 2Q7BA 1QSMA 4C7HA 1QSTA 1Y7RA 3SXOA 2CNSA 1KUYA 1VKCA 4EVYA 4KOXA 4DNCA 4PK2A 4H6UA 1S5KA 1NSLA 2HV2A 2KCWA 5JPHA 2WUUA 2Y0MA 3DR8A 2YGWA 4QBJA 1QSNA 3JUWA 1Y9KA 2R8VA 4A30A 4L89A 4B5OA 4KOTA 4UFXA 2OU2A 4NCZA 4NF1A 5IV0A 4L8AA 4AVBA 3R9EA 4MJ8A 1ON0A 1TIQA 4FD5A 2EVNA 5J8FA 4JWPA 2OZGA 4XPLA 3G3SA 4MI4A 2PC1A 4UA3A 2BUEA 4B5PB 1YREA 2I00A 2ZPAA 1Q2DA 4M85A 4CAWA 1YR0A 1XIXA 1ZO0A 2F5IA 5CNPA 4Y49C 3JVNA 4AB7A 2Q4VA 2B5GB 3R9FA 1XMTA 4A2ZA 2DPTA 3P2HA 4KORA 3TT2A 4R87A 4B5PA 1L0CA 3MGDA 4KLWA 2VQYA 4PSXA 5ISVA 3TO7A 3VWEA 4CGNA 3TE4A 4JLYA 3SHPA 2J8RA 3DSBA 3IU1A 2EUIA 3W6SA 4PK3A 3TTHA 4XPDC 3UY5A 2FE7A 4I49A 4UFWA 3EC4A 4HNXB 1RO5A 5G21A 4UWIA 3IGRA 3QAHA 4OLLA 5J8CA 3S6FA 4KS9A 2VEZA 4HKFA 2BSWA 2HQYA 1OZPA 3JTKA 1QSOA 3A9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KOY A;  4YRH A;  1MJ9 A;  4X5K A;  2Z11 A;  3GY9 A;  3F0A A;  3CXP A;  3IWG A;  4R3K A;  1MK4 A;  4AVC A;  2B5G A;  4JJX A;  4NSQ A;  2P6E A;  2PSW A;  3K9U A;  4KVM E;  3TCV A;  1M1D A;  1S7L A;  3P2F A;  2G3A A;  4MY3 A;  1YK3 A;  5HH1 A;  2NMT A;  3T9Y A;  2ARH A;  1Q2C A;  2Q0Y A;  2ZW6 A;  4KVX A;  2PRB A;  2QEC A;  3EFA A;  2Q04 A;  3I3G A;  1GHE A;  2GAN A;  2G0B A;  4JD6 A;  1YGH A;  3ZJ0 A;  1Z4E A;  3R95 A;  3FNC A;  2ATR A;  4KOU A;  5FVJ A;  1IID A;  3CXQ A;  2B3U A;  4H89 A;  4CAV A;  3EXN A;  2AJ6 A;  3FYN A;  4H6Z A;  3R1K A;  2FIA A;  3H4Q A;  2H5M A;  4KOS A;  2ZW5 A;  2FCK A;  2OZU A;  1V0C A;  1P0H A;  4J3G A;  2VBQ A;  2VI7 A;  4RS2 A;  3FB3 A;  3S6H A;  3TOA A;  2RC4 A;  4XPK A;  5EC4 A;  3BLN A;  5I0C A;  3QB8 A;  4XPD B;  1LRZ A;  4QB9 A;  4II9 A;  2BEI A;  2QIR A;  5C82 A;  4ORF A;  1CM0 A;  3EY5 A;  2VZY A;  1N71 A;  4NEX A;  2HUZ A;  3NE7 A;  4F6A A;  3PGP A;  5E96 A;  2JDD A;  1B87 A;  2B3V A;  5KTA A;  1S7K A;  1I12 A;  1MJB A;  5F46 A;  2D4O A;  5IX3 A;  2C27 A;  2REF A;  3W91 A;  5KTC A;  4R57 A;  2X7B A;  2JDC A;  4E0A A;  4KOV A;  4R9M A;  2ZW7 A;  4AG9 A;  3V8I A;  1RXT A;  4U9Z A;  1M4I A;  2A4N A;  3D2M A;  1KZF A;  3TFY A;  4XNH B;  5H84 A;  1S3Z A;  3N7Z A;  1S7N A;  2PR1 A;  2Z0Z A;  3VWD A;  3C26 A;  4U5Y A;  4E8O A;  5F48 A;  1M44 A;  2B4B A;  4HNW B;  2IL4 A;  2FIW A;  1SQH A;  4KOW A;  4HNY B;  4CRY B;  4CRZ B;  2Q4Y A;  3D2P A;  4PSW A;  1KUV A;  4QUS A;  3KKW A;  1XF8 A;  4OAE A;  3WR7 A;  1Q2Y A;  2ZW4 A;  2WPX A;  1PU9 A;  4UBR A;  4R3L A;  4FD4 A;  3BJ7 A;  2BL1 A;  1WK4 A;  2VXK A;  5IB0 A;  1VHS A;  4Y49 B;  3PP9 A;  1IIC A;  3FXT A;  3S6G A;  2O28 A;  4BMH A;  4ONU A;  4IUS A;  1FY7 A;  4CAX A;  2JEV A;  2DXQ A;  2FT0 A;  5C88 A;  3B8G A;  1NMT A;  2REE A;  4F0Y A;  1S7F A;  3DDD A;  3DR6 A;  2PDO A;  3E0K A;  2PR8 A;  3PZJ A;  2GE3 A;  4KVO E;  5DWN A;  1Y9W A;  4FD7 A;  4AVA A;  1S60 A;  1YX0 A;  1YLE A;  4MY0 A;  1J4J A;  2VZZ A;  2I79 A;  4QVT A;  4KUA A;  3W6X A;  5DWM A;  4M3S A;  1BOB A;  3EO4 A;  1Z4R A;  2QML A;  1M4G A;  4K30 A;  2FSR A;  2JLM A;  2B58 A;  1I1D A;  3T90 A;  2P6F A;  3G8W A;  2CY2 A;  1NE9 A;  3TOB A;  2FL4 A;  4LX9 A;  1BO4 A;  1I21 A;  2Q44 A;  1U6M A;  2ZXV A;  1UFH A;  3FBU A;  4CS0 B;  2J8M A;  1XEB A;  3OWC A;  3D3S A;  4LUA A;  4E2A A;  2FXF A;  2B4D A;  4NXY A;  3D8P A;  5EBV A;  1CJW A;  2AE6 A;  2GIV A;  2R7H A;  1QSR A;  3DNS A;  2Z10 A;  4OAD A;  4QC6 A;  1IYK A;  2D4P A;  2R98 A;  1XE4 A;  3R96 A;  2PQ8 A;  4ZBG A;  3BJ8 A;  3ZZI A;  5H86 A;  4MHD A;  1P4N A;  2P0W A;  3S6K A;  4AG7 A;  3FIX A;  5KTD A;  1IYL A;  2CNM A;  3F8K A;  1R57 A;  4KLV A;  4MBU A;  2OB0 A;  2OZH A;  2FS5 A;  1K4J A;  2OH1 A;  3TO6 A;  1PUA A;  5F47 A;  3GKR A;  4RI1 A;  3RYO A;  5HMN A;  4GS4 A;  1YVK A;  3R9G A;  3FRM A;  2R1I A;  5JQ4 A;  2G3T A;  3F5B A;  3LOD A;  3TO9 A;  1MJA A;  2P6G A;  1KUX A;  3GYA A;  4IF5 A;  4U9Y A;  3LD2 A;  4JXQ A;  2WPW A;  1Z9U A;  1IB1 E;  5F49 A;  2B4D B;  4XNH C;  1WWZ A;  2K5T A;  4JXR A;  4PV6 A;  1M4D A;  3I9S A;  4KUB A;  4FD6 A;  5GCN A;  1B6B A;  1YVO A;  2J8N A;  4KZT A;  4UWJ A;  2CNT A;  4YFJ A;  3CXS A;  4YGO A;  3SXN A;  2Q7B A;  1QSM A;  1QST A;  1Y7R A;  3SXO A;  2CNS A;  1KUY A;  1VKC A;  4EVY A;  4KOX A;  4DNC A;  4PK2 A;  4H6U A;  1S5K A;  1NSL A;  2HV2 A;  2KCW A;  5JPH A;  2Y0M A;  3DR8 A;  4QBJ A;  1QSN A;  3JUW A;  1Y9K A;  2R8V A;  4L89 A;  4B5O A;  4KOT A;  2OU2 A;  4NCZ A;  4NF1 A;  5IV0 A;  4L8A A;  4AVB A;  3R9E A;  4MJ8 A;  1ON0 A;  1TIQ A;  4FD5 A;  2EVN A;  5J8F A;  4JWP A;  2OZG A;  4XPL A;  3G3S A;  4MI4 A;  4UA3 A;  2PC1 A;  2BUE A;  4B5P B;  1YRE A;  2I00 A;  2ZPA A;  1Q2D A;  4M85 A;  4CAW A;  1YR0 A;  1XIX A;  2F5I A;  5CNP A;  4Y49 C;  3JVN A;  4AB7 A;  2Q4V A;  2B5G B;  3R9F A;  1XMT A;  3P2H A;  4KOR A;  3TT2 A;  4R87 A;  4B5P A;  1L0C A;  3MGD A;  4KLW A;  2VQY A;  4PSX A;  5ISV A;  3TO7 A;  3VWE A;  3TE4 A;  4JLY A;  3SHP A;  2J8R A;  3DSB A;  2EUI A;  3W6S A;  4PK3 A;  3TTH A;  4XPD C;  3UY5 A;  2FE7 A;  4I49 A;  3EC4 A;  4HNX B;  1RO5 A;  4UWI A;  3IGR A;  3QAH A;  4OLL A;  5J8C A;  3S6F A;  2VEZ A;  4HKF A;  2BSW A;  2HQY A;  1OZP A;  1QSO A; 
#chains in the Genus database with same CATH topology
 4KOY A;  3S9L A;  4YRH A;  1TKJ A;  1MJ9 A;  2ABZ A;  3LAC A;  4MFP A;  4X5K A;  2Z11 A;  3GY9 A;  2GRE A;  2DEA A;  3F0A A;  4C2X A;  3CXP A;  3IEH A;  3IFE A;  3KR5 A;  3IWG A;  3K2K A;  2PJ4 A;  4R3K A;  1MK4 A;  3D66 A;  4AVC A;  2B5G A;  4JJX A;  4NGS A;  1R43 A;  3IO1 A;  5J1Q A;  4NSQ A;  2P6E A;  4MCS A;  2PSW A;  2AFW A;  3K9U A;  4KVM E;  4MHP A;  3KR4 A;  3TCV A;  1M1D A;  1S7L A;  4UFV A;  4C2Z A;  1XRY A;  2C6G A;  4B10 A;  4II9 A;  2PJ8 A;  3CDX A;  4MFQ A;  3PFE A;  1QQ9 A;  3P2F A;  2G3A A;  4MY3 A;  1YK3 A;  5HH1 A;  5THW A;  3SJF A;  2NMT A;  1LCP A;  3K9T A;  2ARH A;  1Z8T A;  3T9Y A;  1Q2C A;  2Q0Y A;  2ZW6 A;  2BOA A;  4KVX A;  3B3T A;  3FX6 A;  4B13 A;  2PRB A;  1BPN A;  1CP6 A;  4MFZ A;  4O23 A;  2QEC A;  3EFA A;  2Q04 A;  5HVF A;  2YND A;  3I3G A;  2V77 A;  2CTB A;  1BLL E;  1GHE A;  1X12 A;  2GAN A;  2HB6 A;  2G0B A;  3BHX A;  4JD6 A;  4TWE A;  1YGH A;  2EK8 A;  3ZJ0 A;  1Z4E A;  3R95 A;  4CGO A;  3FNC A;  2ATR A;  2ZEO A;  4KOU A;  4BIN A;  5F09 A;  4PPZ A;  2WSA A;  2VL1 A;  1LFW A;  2NYQ A;  5FVJ A;  1IID A;  3CXQ A;  2B3U A;  1ZLH A;  3PRT A;  3EXN A;  1BAV A;  2AJ6 A;  3FYN A;  4H89 A;  3NA6 A;  4TNU A;  4H6Z A;  4DYO A;  5G22 A;  2FIA A;  3H4Q A;  3R1K A;  4M6I A;  4OME A;  2H5M A;  1XBU A;  4KOS A;  2PIY A;  2ZW5 A;  2FCK A;  3IWE A;  2OZU A;  3CT9 A;  4UEE A;  4P45 A;  4A95 A;  1V0C A;  1P0H A;  2IJZ A;  2XEJ A;  4A37 A;  4MFK A;  1YME A;  4C7I A;  2C1C A;  3BXM A;  4J3G A;  2VBQ A;  2PJ5 A;  2VI7 A;  4W9Y A;  4RS2 A;  3FB3 A;  3S6H A;  4DUK A;  1CP7 A;  3TOA A;  2RC4 A;  4XPK A;  5EC4 A;  4MCQ A;  4UCM A;  5JGF A;  4X8I A;  3BLN A;  3SJE A;  5I0C A;  3QB8 A;  4XPD B;  2Z3L A;  3LMS A;  4F0X A;  1LRZ A;  2GLJ A;  3PFO A;  2BEI A;  4QB9 A;  4CYN A;  2QIR A;  5JH9 A;  5C82 A;  4LQG A;  3FMC A;  1CM0 A;  3EY5 A;  1TXR A;  3I1U A;  3PB7 X;  2PJ3 A;  4ORF A;  5LRK A;  1LAN A;  3IU2 A;  2VZY A;  1N71 A;  4NEX A;  2HUZ A;  4ZX8 A;  4NFR A;  2PJ6 A;  3NE7 A;  5D8N A;  4F6A A;  2Z3K A;  3V38 A;  5LRG A;  1CG2 A;  3PGP A;  5G20 A;  5E96 A;  3GB0 A;  3LWU A;  2YNC C;  4OIW A;  2JDD A;  1AYE A;  1B87 A;  2B3V A;  2O4H A;  3PEI A;  2V8D A;  4CGL A;  5KTA A;  1S7K A;  1I12 A;  3GIU A;  3QAY A;  4ZX9 A;  1TF8 A;  3B3V A;  1MJB A;  1KWM A;  2V8H A;  5F46 A;  1CPX A;  4LQ6 A;  2D4O A;  2JBK A;  1XJO A;  4P4E A;  5AGE A;  2XEI A;  2CF4 A;  5IX3 A;  2C27 A;  1IGB A;  2Z3O A;  2REF A;  3W91 A;  2OOT A;  3FEC A;  6CPA A;  1YW4 A;  5HVH A;  5BWA B;  5KTC A;  4R57 A;  2X7B A;  3WC7 A;  2JDC A;  1Y0Y A;  2PIZ A;  2ZEH A;  2Q4Z A;  4KOV A;  4E0A A;  4R9M A;  2FVG A;  2ZW7 A;  4KSF A;  4PXD A;  4P44 A;  3WC5 A;  4AG9 A;  2ZEL A;  4ZGY B;  3V8I A;  1RXT A;  1TF9 A;  4P4B A;  4A31 A;  4EWT A;  3B2Y A;  3ISX A;  3KI9 A;  4FUU A;  1Y7E A;  2ANP A;  3H5Z A;  4WJB A;  4CAF A;  4U9Z A;  4X3R A;  5D29 A;  1M4I A;  2A4N A;  3D2M A;  1KZF A;  3ISZ A;  3TFY A;  2BCO A;  4Q36 A;  1OBR A;  3VAT A;  4G1P A;  4CAV A;  4XNH B;  2WZN A;  1S3Z A;  3N7Z A;  1S7N A;  5H84 A;  4NGM A;  4MCP A;  4BBH A;  2ODF A;  4CYQ A;  2PR1 A;  2Z0Z A;  2WYR A;  2ZEG A;  3C26 A;  3QNV A;  3VWD A;  4A32 A;  2C6C A;  4OP4 A;  4U5Y A;  4E8O A;  2PJ1 A;  1M44 A;  5F48 A;  3RO0 A;  2YNC A;  2CTC A;  2B4B A;  4HNW B;  2IL4 A;  2FIW A;  3B3S A;  2PVW A;  5EMI A;  1SQH A;  3NE8 A;  1FNO A;  4KOW A;  4HNY B;  4CRY B;  4CRZ B;  2Q4Y A;  3D2P A;  4PSW A;  4NGN A;  2I3C A;  1KUV A;  4QUS A;  2V8G A;  3KKW A;  2Q51 A;  4ZY1 A;  4PXC A;  1XF8 A;  5HXD A;  3D68 A;  4OC1 A;  4OAE A;  4P6Y A;  4ZYQ A;  3WR7 A;  1Q2Y A;  4MMO A;  5LRJ A;  2ZW4 A;  2WPX A;  1PU9 A;  4UBR A;  4OC5 A;  5G1Z A;  4NJQ A;  4Q7A A;  3RZA A;  2JBJ A;  4R3L A;  5DS0 A;  3BJ7 A;  4FD4 A;  2BL1 A;  1WK4 A;  2VXK A;  2AFZ A;  1Y0R A;  3CZX A;  2ZEP A;  5IB0 A;  4OKO A;  1VHS A;  4Y49 B;  5AG4 A;  2J9A A;  1IIC A;  2AFM A;  2RFH A;  3PP9 A;  2ZOG A;  3FXT A;  4NGQ A;  3PBB A;  3S6G A;  4HPS A;  2OR4 A;  2O28 A;  4BMH A;  1IOI A;  3FVL A;  3B3C A;  5LYF A;  2O53 A;  2PJB A;  3IC1 A;  4ONU A;  4IUS A;  4UCN A;  5CPA A;  3NH8 A;  1FY7 A;  2GFQ A;  4CAX A;  3S9M A;  2JEV A;  2DXQ A;  4EFD A;  3NFZ A;  2FT0 A;  4ONW A;  1LAM A;  5AG5 A;  1VHO A;  5C88 A;  2Z3N A;  4MHY A;  5AG7 A;  4JYW A;  3B8G A;  2IMO A;  1NMT A;  2REE A;  4F0Y A;  1S7F A;  3KQZ A;  2AFU A;  3SI1 A;  3DDD A;  5HVG A;  5LYL A;  4B11 A;  5IB9 A;  1CX8 A;  3DR6 A;  2PDO A;  3E0K A;  2PJC A;  2PR8 A;  3PZJ A;  2GE3 A;  4KVO E;  2EO8 A;  5DWN A;  1Y9W A;  4FD7 A;  4AVA A;  4F9V A;  1S60 A;  3PBE A;  1YX0 A;  1YLE A;  4MY0 A;  1J4J A;  2VZZ A;  1YSJ A;  2GLF A;  3B3W A;  4OC2 A;  2I79 A;  4QVT A;  4UF4 A;  3L2N A;  4MXU A;  3D67 A;  4KUA A;  3W6X A;  3BI0 A;  5DWM A;  1LAP A;  4CAE A;  4M3S A;  1BOB A;  1AMP A;  3KHZ A;  2ZED A;  3SI2 A;  1DE4 C;  1DTD A;  3EO4 A;  1Z4R A;  4RN7 A;  2QML A;  3DGV A;  4A39 A;  1M4L A;  1M4G A;  1HDQ A;  3PB4 X;  4K30 A;  4Q38 A;  3V7Z A;  1ARL A;  2FSR A;  4UCP A;  4F8Z A;  2JLM A;  2B58 A;  1I1D A;  2Z3M A;  4MHZ A;  4F9U A;  3H8G A;  3T90 A;  4CYO A;  4M6H A;  3D7G A;  4OID A;  2P6F A;  3G8W A;  5AG6 A;  4CGP A;  2CY2 A;  1NE9 A;  2EK9 A;  3TOB A;  2FL4 A;  4R6T A;  1Z8L A;  3FH4 A;  4LX9 A;  1BO4 A;  3WAB A;  2Q44 A;  1I21 A;  1U6M A;  2JEW A;  1Z5R A;  1UFH A;  2ZXV A;  3FBU A;  2YNE A;  4CS0 B;  2J8M A;  3TX8 A;  2ZEF A;  1XEB A;  2AFO A;  4C2Y A;  2ZEN A;  1RTQ A;  3OWC A;  3GUX A;  2PRQ A;  3D3S A;  1XFO A;  3FF3 A;  4GXH A;  4LUA A;  2CXA A;  2FXF A;  3CPX A;  4NGR A;  3WC6 A;  4E2A A;  3S9N A;  2B4D A;  1F57 A;  4NXY A;  3D8P A;  1Z8W A;  5K8P A;  5EBV A;  1HEE A;  4KSA A;  1CJW A;  4FWU A;  4IHM A;  2AE6 A;  4PXB A;  2GIV A;  2GU2 A;  5A28 A;  3SI0 A;  2QYV A;  2R7H A;  1AUG A;  1QSR A;  3MN8 A;  5A27 A;  3N5F A;  3DNS A;  2Z10 A;  1FT7 A;  2CIJ A;  4DJL A;  1YW6 A;  3HLP A;  4OAD A;  4QC6 A;  1IYK A;  2D4P A;  2R98 A;  1XE4 A;  4NGP A;  4MCR A;  2PJ7 A;  4UEF A;  3R96 A;  4P4I A;  2PQ8 A;  5ELY A;  4ZBG A;  3BJ8 A;  3ZZI A;  5H86 A;  3FEE A;  2Q7S A;  3DLJ A;  4MHD A;  1P4N A;  2G9D A;  3RAM A;  8CPA A;  2P0W A;  1TKH A;  3S6K A;  4AG7 A;  1TKF A;  3FIX A;  5KTD A;  1IYL A;  4MFJ A;  2CNM A;  3F8K A;  1R57 A;  4KLV A;  4MBU A;  2OB0 A;  2OZH A;  2Z3P A;  3CPA A;  1R3N A;  2FS5 A;  1K4J A;  2OH1 A;  1PCA A;  3TO6 A;  2AFX A;  1PUA A;  2DPS A;  3GKR A;  4RI1 A;  1VHE A;  5F47 A;  3RYO A;  5HMN A;  4GS4 A;  4B6Z A;  1YVK A;  3R9G A;  4ZI6 A;  3FRM A;  2NSM A;  2R1I A;  5JQ4 A;  3D7H A;  4R76 A;  4ZY2 A;  2G3T A;  1A2Z A;  3KHX A;  3F5B A;  3LOD A;  2DF5 A;  3TO9 A;  1MJA A;  2P6G A;  5CBM A;  4OC4 A;  1KUX A;  4P10 A;  3KAS A;  3GYA A;  4CGM A;  3KL9 A;  1ZG9 A;  4C68 A;  4IF5 A;  4U9Y A;  3LD2 A;  2F7V A;  1CPS A;  3H8E A;  4JXQ A;  4FAI A;  1X10 A;  4CYP A;  1NSA A;  1UWY A;  2WPW A;  1Z9U A;  1VIX A;  1IB1 E;  4UIA A;  5F49 A;  4P4J A;  1ZLI A;  2B4D B;  1GYT A;  2PJ2 A;  4XNH C;  1WWZ A;  2K5T A;  3D4U A;  4JXR A;  4MFL A;  1ELM P;  4GM5 A;  3FJU A;  3IWW A;  4PV6 A;  1M4D A;  2ZOF A;  3BI1 A;  3I9S A;  4KUB A;  4FD6 A;  1YLO A;  5GCN A;  4B14 A;  1F2O A;  1JWQ A;  1JQG A;  2Q43 A;  1B6B A;  3KZW A;  1YVO A;  2J8N A;  1XOV A;  4KZT A;  4R7M A;  4UWJ A;  1ELL P;  4X2T A;  4B12 A;  1CBX A;  1VGY A;  2CNT A;  2XEF A;  4YFJ A;  1IOF A;  3CXS A;  4YGO A;  4A33 A;  3B7I A;  3SJG A;  3SXN A;  2Q7B A;  1QSM A;  3WT4 A;  4C7H A;  1QST A;  1Y7R A;  1YQE A;  3JRU A;  3SXO A;  4RUH A;  4H2K A;  2CNS A;  3T8W A;  2F8H A;  1KUY A;  1VKC A;  1IY7 A;  1Z8X A;  4EVY A;  4KOX A;  4AXV A;  4DNC A;  4PK2 A;  4H6U A;  1S5K A;  1NSL A;  2HV2 A;  2KCW A;  4K3N A;  5JPH A;  2WUU A;  2Y0M A;  3DR8 A;  4CPA A;  2YGW A;  4YWY A;  4QBJ A;  4A94 A;  2PCU A;  3NH4 A;  1QSN A;  4KSI A;  4UEZ A;  3JUW A;  1ZG8 A;  4IAV A;  4PXE A;  1Y9K A;  5K8O A;  3HUV A;  2ZEM A;  2EWB A;  2R8V A;  4Z65 A;  3RNZ A;  1XMB A;  3H8F A;  4A30 A;  4L89 A;  4PQA A;  4B5O A;  4KOT A;  1BPM A;  2OU2 A;  4UFX A;  4NCZ A;  4NF1 A;  5IV0 A;  4L8A A;  2PJ9 A;  3VAR A;  3IJ3 A;  4AVB A;  3R9E A;  4MJ8 A;  2BO9 A;  1ON0 A;  1TIQ A;  4FD5 A;  4P4D A;  4ZY0 A;  2EVN A;  5J8F A;  4JWP A;  1Z2L A;  2OZG A;  4XPL A;  3VH9 A;  3G3S A;  4JZ0 A;  3D7F A;  4NJR A;  4R8F A;  2AFS A;  4MI4 A;  2PC1 A;  4UA3 A;  2BUE A;  5I4M A;  2QJ8 A;  3KGQ A;  4B5P B;  1YRE A;  1PYT B;  4M6G A;  5K8M A;  2I00 A;  2ZPA A;  3PB9 X;  1Q2D A;  3NH5 A;  4M85 A;  1YR0 A;  4CAW A;  1XIX A;  1ZO0 A;  2F5I A;  2RB7 A;  1H8L A;  5CNP A;  4Y49 C;  3JVN A;  4YU9 A;  2Q4V A;  2QVP A;  4AB7 A;  2B5G B;  3MRU A;  3R9F A;  4OC3 A;  5K8N A;  4OC0 A;  1XMT A;  4A2Z A;  2DPT A;  3P2H A;  4KOR A;  3TT2 A;  4R87 A;  4B5P A;  4BD9 A;  3D7D A;  1L0C A;  1ARM A;  3MGD A;  1Q7L A;  4KLW A;  2VQY A;  4PSX A;  5ISV A;  4MRI A;  3TO7 A;  1QMU A;  4P4F A;  3VWE A;  4CGN A;  3TE4 A;  4JLY A;  2C6P A;  1LOK A;  3SHP A;  2J8R A;  4WWV A;  4MHN A;  2PJA A;  3DSB A;  3IU1 A;  4UIB A;  2EUI A;  3W6S A;  3KQX A;  2PVV A;  2POK A;  4PK3 A;  5LYI A;  3TTH A;  4XPD C;  1F2P A;  3PB6 X;  3SJX A;  1ZG7 A;  3UY5 A;  2FE7 A;  4A38 A;  4I49 A;  2PJ0 A;  2ZEE A;  4UFW A;  1HDU A;  2PE3 A;  3EC4 A;  3B35 A;  3TC8 A;  7CPA A;  3GLJ A;  4HNX B;  1RO5 A;  3IIB A;  5G21 A;  1IU8 A;  3PB8 X;  4UWI A;  5JM6 A;  2HC9 A;  1EE3 P;  2XEG A;  2EBJ A;  3IGR A;  3QAH A;  4FBE A;  4OLL A;  5J8C A;  3S6F A;  2IQ6 A;  4IK2 A;  4KS9 A;  5LYD A;  2VEZ A;  3RBU A;  4HKF A;  2BSW A;  2HQY A;  2V8V A;  3FED A;  1OZP A;  3JTK A;  1QSO A;  4EME A;  3A9L A;  4NGT A; 
#chains in the Genus database with same CATH homology
 4KOY A;  4YRH A;  1MJ9 A;  4MFP A;  4X5K A;  2Z11 A;  3GY9 A;  3F0A A;  4C2X A;  3CXP A;  3IWG A;  4R3K A;  1MK4 A;  4AVC A;  2B5G A;  4JJX A;  4NSQ A;  2P6E A;  2PSW A;  3K9U A;  4KVM E;  3TCV A;  1M1D A;  1S7L A;  4UFV A;  4C2Z A;  4B10 A;  4MFQ A;  3P2F A;  2G3A A;  4MY3 A;  1YK3 A;  5HH1 A;  2NMT A;  3T9Y A;  2ARH A;  1Q2C A;  2Q0Y A;  2ZW6 A;  4KVX A;  4B13 A;  2PRB A;  4MFZ A;  2QEC A;  3EFA A;  2Q04 A;  2YND A;  3I3G A;  1GHE A;  2GAN A;  2G0B A;  4JD6 A;  1YGH A;  3ZJ0 A;  1Z4E A;  3R95 A;  4CGO A;  3FNC A;  2ATR A;  4KOU A;  2WSA A;  5FVJ A;  1IID A;  3CXQ A;  2B3U A;  4H89 A;  4CAV A;  3EXN A;  2AJ6 A;  3FYN A;  4H6Z A;  5G22 A;  3R1K A;  2FIA A;  3H4Q A;  2H5M A;  4KOS A;  2ZW5 A;  2FCK A;  3IWE A;  2OZU A;  4A95 A;  1V0C A;  1P0H A;  4MFK A;  4C7I A;  4J3G A;  2VBQ A;  2VI7 A;  4RS2 A;  3FB3 A;  3S6H A;  3TOA A;  2RC4 A;  4XPK A;  5EC4 A;  4UCM A;  3BLN A;  5I0C A;  3QB8 A;  4XPD B;  2Z3L A;  4F0X A;  1LRZ A;  4QB9 A;  4II9 A;  2BEI A;  4CYN A;  2QIR A;  5C82 A;  4ORF A;  1CM0 A;  3EY5 A;  3IU2 A;  2VZY A;  1N71 A;  4NEX A;  2HUZ A;  3NE7 A;  4F6A A;  2Z3K A;  3PGP A;  5G20 A;  5E96 A;  2YNC C;  2JDD A;  1B87 A;  4CGL A;  2B3V A;  5KTA A;  1S7K A;  1I12 A;  1MJB A;  5F46 A;  2D4O A;  5AGE A;  5IX3 A;  2C27 A;  2Z3O A;  2REF A;  3W91 A;  5KTC A;  5BWA B;  4R57 A;  2X7B A;  2JDC A;  4E0A A;  4KOV A;  4R9M A;  2ZW7 A;  4KSF A;  4AG9 A;  4ZGY B;  3V8I A;  1RXT A;  4A31 A;  4CAF A;  3H5Z A;  4U9Z A;  1M4I A;  2A4N A;  3D2M A;  1KZF A;  3TFY A;  4Q36 A;  4XNH B;  5H84 A;  1S3Z A;  3N7Z A;  1S7N A;  4BBH A;  4CYQ A;  2PR1 A;  2Z0Z A;  3VWD A;  3C26 A;  4A32 A;  4U5Y A;  4E8O A;  5F48 A;  1M44 A;  2YNC A;  2B4B A;  4HNW B;  2IL4 A;  2FIW A;  1SQH A;  4KOW A;  4HNY B;  4CRY B;  4CRZ B;  2Q4Y A;  3D2P A;  4PSW A;  1KUV A;  4QUS A;  3KKW A;  1XF8 A;  4OAE A;  3WR7 A;  1Q2Y A;  2ZW4 A;  2WPX A;  1PU9 A;  4UBR A;  5G1Z A;  4R3L A;  4FD4 A;  3BJ7 A;  2BL1 A;  1WK4 A;  2VXK A;  5IB0 A;  1VHS A;  4Y49 B;  5AG4 A;  3PP9 A;  1IIC A;  3FXT A;  3S6G A;  2O28 A;  4BMH A;  4ONU A;  4IUS A;  4UCN A;  1FY7 A;  4CAX A;  2JEV A;  2DXQ A;  2FT0 A;  5AG5 A;  5C88 A;  2Z3N A;  5AG7 A;  3B8G A;  1NMT A;  2REE A;  4F0Y A;  1S7F A;  3DDD A;  4B11 A;  3DR6 A;  2PDO A;  3E0K A;  2PR8 A;  3PZJ A;  2GE3 A;  4KVO E;  5DWN A;  1Y9W A;  4FD7 A;  4AVA A;  1S60 A;  1YX0 A;  1YLE A;  4MY0 A;  1J4J A;  2VZZ A;  2I79 A;  4QVT A;  4KUA A;  3W6X A;  5DWM A;  4CAE A;  4M3S A;  1BOB A;  3EO4 A;  1Z4R A;  2QML A;  1M4G A;  4K30 A;  4Q38 A;  2FSR A;  4UCP A;  2JLM A;  2B58 A;  1I1D A;  2Z3M A;  3T90 A;  4CYO A;  2P6F A;  3G8W A;  5AG6 A;  4CGP A;  2CY2 A;  1NE9 A;  3TOB A;  2FL4 A;  4LX9 A;  1BO4 A;  1I21 A;  2Q44 A;  1U6M A;  2ZXV A;  1UFH A;  3FBU A;  2YNE A;  4CS0 B;  2J8M A;  1XEB A;  4C2Y A;  3OWC A;  3D3S A;  4LUA A;  2CXA A;  2FXF A;  4E2A A;  2B4D A;  4NXY A;  3D8P A;  5EBV A;  4KSA A;  1CJW A;  2AE6 A;  2GIV A;  5A28 A;  2R7H A;  1QSR A;  5A27 A;  3DNS A;  2Z10 A;  4OAD A;  4QC6 A;  1IYK A;  2D4P A;  2R98 A;  1XE4 A;  3R96 A;  2PQ8 A;  4ZBG A;  3BJ8 A;  3ZZI A;  5H86 A;  4MHD A;  1P4N A;  2P0W A;  3S6K A;  4AG7 A;  3FIX A;  5KTD A;  1IYL A;  4MFJ A;  2CNM A;  3F8K A;  1R57 A;  4KLV A;  4MBU A;  2OB0 A;  2OZH A;  2Z3P A;  2FS5 A;  1K4J A;  2OH1 A;  3TO6 A;  1PUA A;  2DPS A;  3GKR A;  4RI1 A;  5F47 A;  3RYO A;  5HMN A;  4GS4 A;  1YVK A;  3R9G A;  3FRM A;  2R1I A;  5JQ4 A;  2G3T A;  3F5B A;  3LOD A;  3TO9 A;  1MJA A;  2P6G A;  1KUX A;  3GYA A;  4CGM A;  4C68 A;  4IF5 A;  4U9Y A;  3LD2 A;  4JXQ A;  4CYP A;  2WPW A;  1Z9U A;  1IB1 E;  5F49 A;  2B4D B;  4XNH C;  1WWZ A;  2K5T A;  4JXR A;  4MFL A;  4PV6 A;  1M4D A;  3I9S A;  4KUB A;  4FD6 A;  5GCN A;  4B14 A;  1B6B A;  1YVO A;  2J8N A;  4KZT A;  4UWJ A;  4B12 A;  2CNT A;  4YFJ A;  3CXS A;  4YGO A;  4A33 A;  3SXN A;  2Q7B A;  1QSM A;  4C7H A;  1QST A;  1Y7R A;  3SXO A;  2CNS A;  1KUY A;  1VKC A;  4EVY A;  4KOX A;  4DNC A;  4PK2 A;  4H6U A;  1S5K A;  1NSL A;  2HV2 A;  2KCW A;  5JPH A;  2WUU A;  2Y0M A;  3DR8 A;  2YGW A;  4QBJ A;  1QSN A;  3JUW A;  1Y9K A;  2R8V A;  4A30 A;  4L89 A;  4B5O A;  4KOT A;  4UFX A;  2OU2 A;  4NCZ A;  4NF1 A;  5IV0 A;  4L8A A;  4AVB A;  3R9E A;  4MJ8 A;  1ON0 A;  1TIQ A;  4FD5 A;  2EVN A;  5J8F A;  4JWP A;  2OZG A;  4XPL A;  3G3S A;  4MI4 A;  2PC1 A;  4UA3 A;  2BUE A;  4B5P B;  1YRE A;  2I00 A;  2ZPA A;  1Q2D A;  4M85 A;  4CAW A;  1YR0 A;  1XIX A;  1ZO0 A;  2F5I A;  5CNP A;  4Y49 C;  3JVN A;  4AB7 A;  2Q4V A;  2B5G B;  3R9F A;  1XMT A;  4A2Z A;  2DPT A;  3P2H A;  4KOR A;  3TT2 A;  4R87 A;  4B5P A;  1L0C A;  3MGD A;  4KLW A;  2VQY A;  4PSX A;  5ISV A;  3TO7 A;  3VWE A;  4CGN A;  3TE4 A;  4JLY A;  3SHP A;  2J8R A;  3DSB A;  3IU1 A;  2EUI A;  3W6S A;  4PK3 A;  3TTH A;  4XPD C;  3UY5 A;  2FE7 A;  4I49 A;  4UFW A;  3EC4 A;  4HNX B;  1RO5 A;  5G21 A;  4UWI A;  3IGR A;  3QAH A;  4OLL A;  5J8C A;  3S6F A;  4KS9 A;  2VEZ A;  4HKF A;  2BSW A;  2HQY A;  1OZP A;  3JTK A;  1QSO A;  3A9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...