3BJ7A

Spermine/spermidine n1-acetyltransferase from mouse: crystal structure of a ternary complex reveals solvent-mediated spermine binding
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
162
Chain Sequence
b'KFKIRPATASDCSDILRLIKELAKYEYMEDQVILTEKDLQEDGFGEHPFYHCLVAEVPPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMKCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 1
publication title The crystal structure of spermidine/spermine N1-acetyltransferase in complex with spermine provides insights into substrate binding and catalysis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 42
structure length 162
sequence length 167
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2007-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3bj7A00
4OADA 4KORA 2Q4VA 3D3SA 4OLLA 1M4IA 5CNPA 5ISVA 2ATRA 3FBUA 3TE4A 5E96A 1R57A 4L8AA 2B5GA 4II9A 4J3GA 4KOTA 2REFA 5DWNA 1KUYA 4YRHA 1Y7RA 2FIAA 1J4JA 1YR0A 2Y0MA 3UY5A 1S7KA 4PV6A 3VWDA 1VHSA 2I00A 2OZGA 1KUXA 2BL1A 5F49A 3I9SA 5HMNA 4U5YA 2C27A 2R8VA 3W6SA 2G3TA 1RXTA 2VZYA 3T90A 2OZHA 2J8MA 4KOVA 2OZUA 4IUSA 3BLNA 3SXOA 3P2FA 4MBUA 2I79A 4ZBGA 3R95A 4R3LA 1QSRA 1Y9WA 4JXRA 3WR7A 2BEIA 5GCNA 1S3ZA 4KZTA 3R9EA 4CS0B 1QSOA 3TO9A 5J8FA 3JVNA 3DNSA 4LX9A 5F48A 2P6FA 4AB7A 4UWJA 3K9UA 4YGOA 5HH1A 3TO6A 1M4GA 4R3KA 1CJWA 4CRYB 2AE6A 1YGHA 5J8CA 2VXKA 4GS4A 3GYAA 3T9YA 4E0AA 4NF1A 1B6BA 3FIXA 5C82A 1Z4RA 3ZJ0A 2A4NA 4PSWA 4BMHA 1LRZA 4XPDC 4MY3A 5F46A 4NXYA 2P6GA 1P4NA 4X5KA 4DNCA 2B4DB 1NSLA 5I0CA 4KOSA 3DDDA 3DR8A 1Y9KA 4HNWB 3RYOA 3F0AA 3S6KA 2VI7A 2Z11A 5H84A 4JD6A 1Z4EA 2Q7BA 4H89A 5KTDA 3TCVA 3F8KA 3DR6A 5EC4A 4H6UA 2ZW6A 4CAXA 2GANA 1XIXA 3S6FA 4F0YA 2Q44A 4KUAA 3S6GA 4CAWA 1KUVA 2J8NA 3F5BA 4HNYB 2CNTA 1GHEA 4FD4A 4KOUA 4PK2A 3B8GA 4UWIA 4Y49C 4KLWA 2OH1A 2AJ6A 1YREA 2BSWA 4KUBA 1L0CA 2QECA 2B4DA 3W6XA 2CY2A 2J8RA 2VEZA 2B4BA 1PUAA 2OU2A 2REEA 1FY7A 2FIWA 1YVKA 4R57A 5EBVA 1XEBA 3EFAA 3QAHA 1WWZA 4AVBA 3TOBA 3D2MA 4JLYA 4YFJA 4XPLA 3BJ8A 4MHDA 5KTAA 2F5IA 3QB8A 2FSRA 1P0HA 2JDCA 1MK4A 3W91A 1S7FA 3DSBA 4ONUA 2DXQA 4EVYA 2D4OA 4RS2A 3LODA 4NEXA 1IICA 5FVJA 1IB1E 2JLMA 2ZW7A 2JEVA 2Q04A 2B58A 2R98A 2KCWA 3TT2A 2JDDA 1V0CA 4AVCA 2NMTA 2GE3A 4MJ8A 5IV0A 4HKFA 1Q2DA 4FD6A 4CAVA 3IWGA 3FXTA 3CXSA 3EXNA 3IGRA 1BOBA 3TOAA 2EVNA 3G8WA 3TFYA 2ARHA 3KKWA 2ZW5A 2PSWA 5IB0A 4QBJA 1XMTA 2QMLA 4NSQA 4K30A 1MJAA 1MJ9A 3BJ7A 3FNCA 2HUZA 2P6EA 4XNHC 5DWMA 2R1IA 1S7LA 3CXPA 1RO5A 4AG9A 4M85A 2HQYA 4PSXA 4IF5A 2CNMA 5C88A 2IL4A 1S7NA 2PDOA 1YX0A 4XPDB 1I12A 3VWEA 5JQ4A 2CNSA 2WPXA 4KVOE 3PGPA 4LUAA 4XPKA 3G3SA 4QUSA 1M44A 2VQYA 4KVXA 3ZZIA 4XNHB 3D8PA 3R96A 3MGDA 2K5TA 4KVME 2QIRA 3S6HA 4F6AA 1ON0A 2G3AA 3JUWA 3FRMA 1BO4A 4OAEA 1VKCA 2VBQA 2G0BA 3PP9A 4RI1A 4NCZA 2FE7A 5KTCA 4UA3A 4UBRA 4I49A 4JXQA 4PK3A 3R9GA 4MY0A 2PC1A 2FL4A 2Q4YA 2P0WA 4QB9A 3SHPA 5IX3A 2FXFA 2ZPAA 3C26A 4E8OA 2FCKA 3FYNA 3R1KA 2PRBA 4E2AA 2PR8A 1TIQA 4HNXB 3EY5A 2Q0YA 4B5PB 4Y49B 4QC6A 3FB3A 5JPHA 3OWCA 4AVAA 4JJXA 1Q2CA 1UFHA 1I1DA 1N71A 2OB0A 1Q2YA 1S60A 1CM0A 3PZJA 2RC4A 1QSTA 1KZFA 2O28A 5H86A 3GY9A 1S5KA 3TO7A 1OZPA 1M4DA 3H4QA 3SXNA 1IYLA 1Z9UA 4U9YA 4B5PA 1WK4A 1XE4A 4QVTA 3EC4A 3GKRA 1XF8A 3EO4A 3R9FA 4L89A 2Z10A 2HV2A 2Z0ZA 3I3GA 3V8IA 2PR1A 3P2HA 1NMTA 3LD2A 3NE7A 1B87A 4B5OA 4CRZB 1K4JA 1IIDA 2EUIA 2VZZA 3TTHA 2WPWA 2B3UA 4JWPA 3E0KA 1MJBA 3N7ZA 4MI4A 2B5GB 2D4PA 2BUEA 1YLEA 5F47A 4AG7A 4FD7A 1I21A 2FT0A 1SQHA 2GIVA 4KOXA 2H5MA 1IYKA 4FD5A 1NE9A 1QSNA 4H6ZA 2ZW4A 4R87A 1PU9A 2ZXVA 2B3VA 4M3SA 3CXQA 1YVOA 4KLVA 2X7BA 4R9MA 1M1DA 1YK3A 2PQ8A 1QSMA 4KOWA 4U9ZA 1U6MA 3D2PA 4ORFA 2FS5A 4KOYA 2R7HA
chains in the Genus database with same CATH superfamily
4OADA 3IC1A 3DGVA 4KORA 2XEFA 3IJ3A 2PJ2A 4OP4A 3PB7X 2Q4VA 3D3SA 4OLLA 1M4IA 5CNPA 5ISVA 2ATRA 4WWVA 3FBUA 4B12A 4FBEA 1ZLHA 3TE4A 5E96A 1IY7A 3KR4A 4ONWA 1R57A 2AFXA 1ZO0A 2B5GA 3D4UA 3H8GA 4L8AA 4KSIA 1PYTB 1QQ9A 4II9A 4J3GA 4PXEA 2Z3OA 4OIWA 4KOTA 2REFA 2PIYA 5D8NA 4CYPA 1BPNA 2PRQA 3D7FA 5DWNA 3V7ZA 4PPZA 1KUYA 3NE8A 5I4MA 1IU8A 4YRHA 3B3WA 3FF3A 1ZG8A 1Y7RA 2FIAA 1J4JA 1YR0A 2HB6A 2Y0MA 1S7KA 3IU2A 4UFWA 3UY5A 4CYOA 4PV6A 3VWDA 2PJ8A 4CAEA 1VHSA 2I00A 2OZGA 1KUXA 1TF9A 2BL1A 5F49A 4ZY2A 3I9SA 4P45A 5HMNA 3A9LA 4R8FA 2C27A 1F2PA 2R8VA 4U5YA 3T8WA 2G3TA 3W6SA 1RXTA 5F09A 2VZYA 1TF8A 5CPAA 3S9LA 3ISZA 2PJBA 3KI9A 4MCPA 3T90A 2OZHA 4UFVA 1CPXA 5ELYA 2J8MA 2PJ9A 4KOVA 4A37A 5A27A 1R43A 2EBJA 2OZUA 2PE3A 2Z3MA 4GM5A 4IUSA 1CPSA 3BLNA 3D7DA 3SXOA 1Y0RA 4ZX9A 3P2FA 2PJ3A 4IHMA 3IU1A 4MBUA 2F7VA 2I79A 2YNEA 3GIUA 4MHPA 6CPAA 1CX8A 4ZBGA 3R95A 4R3LA 1QSRA 4F9VA 2Q4ZA 3FECA 1Y9WA 4JXRA 3WR7A 2V8GA 4NGSA 2BEIA 2ZOGA 5GCNA 1S3ZA 4KZTA 3R9EA 4CS0B 1AMPA 1QSOA 4R6TA 3TO9A 2FVGA 2ZEOA 4DJLA 4MFLA 5J8FA 2PJCA 2BOAA 3CPAA 3JVNA 5HXDA 1Z8WA 3DNSA 4LX9A 5F48A 2O4HA 4ZY0A 2OOTA 2P6FA 4WJBA 3BI0A 1TKFA 3SJFA 4UCPA 4AB7A 4UWJA 3K9UA 4P4IA 2AFUA 2EWBA 4MRIA 5A28A 4YGOA 4CAFA 4B6ZA 5HH1A 3TO6A 1M4GA 1YSJA 4UIAA 4CYNA 5AGEA 1KWMA 3CZXA 4R3KA 1CJWA 4CRYB 4Z65A 2AE6A 3IO1A 3D66A 5JH9A 1YGHA 3HLPA 5J8CA 4F9UA 1BLLE 2VXKA 5DS0A 4GS4A 2PJ1A 3FEEA 3GYAA 3T9YA 4E0AA 1Z8XA 3SI0A 1RTQA 1CG2A 1B6BA 1LANA 1ZG7A 2AFSA 3B7IA 3CT9A 3FIXA 2ZEPA 3NFZA 4P10A 4UFXA 4UF4A 1Z4RA 5C82A 4CGOA 4FAIA 3LACA 4KS9A 2A4NA 3ZJ0A 4PSWA 4BMHA 3S9NA 4A31A 1LRZA 4XPDC 1CP6A 4MY3A 1LAPA 5F46A 3IWEA 4NXYA 4MCRA 2P6GA 1P4NA 2V8VA 4X5KA 4DNCA 1QMUA 2B4DB 3NH8A 1BAVA 1NSLA 5I0CA 1IGBA 4KOSA 3TC8A 5EMIA 1F2OA 2GLJA 4AXVA 5K8OA 3DDDA 4NGTA 1LCPA 3RBUA 3DR8A 3B3VA 4YU9A 1Y9KA 4HNWB 3RYOA 3F0AA 3S6KA 3H8FA 2VI7A 2Z11A 5H84A 4JD6A 3KHXA 1Z4EA 2Q7BA 2PVVA 1IOIA 4H89A 2JEWA 5KTDA 3TCVA 3F8KA 3DR6A 1CBXA 4H6UA 5EC4A 2ZW6A 4M6HA 2GANA 4CAXA 1Y7EA 4CPAA 5LRKA 3K9TA 2NSMA 2XEJA 1XIXA 4DYOA 1IOFA 3S6FA 3FJUA 4F0YA 4CGLA 2Q44A 4KUAA 5JM6A 3PB6X 4K3NA 4A32A 3S6GA 4CAWA 1KUVA 2J8NA 3F5BA 5K8MA 3D7HA 2DPSA 4HNYB 3FMCA 1XJOA 4NJRA 1UWYA 2CNTA 1GHEA 2WYRA 3SI1A 4FD4A 3RNZA 1YW6A 3JRUA 4NFRA 2ODFA 4X2TA 5HVFA 4KOUA 4MFPA 4PK2A 1VGYA 3KQXA 3B8GA 4UWIA 3SJGA 2YNDA 2AFZA 4Y49C 2EO8A 1TXRA 4KLWA 4MHYA 2OH1A 1AUGA 2AJ6A 4RUHA 1YREA 2BSWA 2V8DA 4KUBA 4A95A 1L0CA 2QECA 2B4DA 3W6XA 2CY2A 2XEGA 2J8RA 1EE3P 2VEZA 2WSAA 2GREA 1OBRA 1PUAA 2B4BA 2PVWA 2OU2A 2REEA 1FY7A 3RAMA 2FIWA 1YVKA 4R57A 4F8ZA 2ZEHA 5EBVA 4P4DA 1XEBA 1XOVA 5LRJA 3EFAA 3PB4X 4TNUA 3QAHA 1WWZA 4ZGYB 4AVBA 2YGWA 4NF1A 1X12A 4IAVA 3TOBA 4NGMA 3D2MA 1LAMA 4JLYA 1M4LA 4C68A 2C6PA 4MCQA 1XFOA 4A2ZA 3KASA 4YFJA 4XPLA 1ELLP 4P6YA 3L2NA 4BD9A 3BJ8A 3S9MA 8CPAA 4MHDA 5KTAA 2F5IA 4PXDA 4EWTA 3QB8A 4Q36A 2FSRA 2ZOFA 1P0HA 4UCMA 3BXMA 2JDCA 2CTCA 1MK4A 1AYEA 3W91A 3MRUA 1S7FA 3DSBA 1LFWA 4ONUA 2DXQA 4EVYA 2D4OA 4FUUA 1TKJA 3D7GA 4DUKA 4RS2A 2G9DA 4M6GA 3B3SA 3LODA 4NEXA 3KHZA 2ABZA 1VHOA 1IICA 5FVJA 2GU2A 1IB1E 1ARLA 2JLMA 1Y0YA 3FX6A 5K8NA 3PRTA 2JEVA 2ZW7A 2AFMA 2ZEDA 3SI2A 3PB9X 3RO0A 4G1PA 4C2XA 2Q04A 2B58A 3PEIA 2CIJA 2J9AA 1ELMP 2R98A 2YNCC 4UEEA 5D29A 2KCWA 3MN8A 4B14A 4GXHA 3TT2A 4X3RA 3VARA 4ZY1A 4KSAA 5AG4A 2JDDA 3WABA 1FT7A 1VHEA 4X8IA 1V0CA 4AVCA 4UCNA 3KQZA 5HVHA 2NMTA 2GE3A 4MJ8A 5IV0A 4HKFA 1FNOA 1Q2DA 4FD6A 2RFHA 4CAVA 3IWGA 4A94A 3FXTA 3K2KA 2ZEGA 3CXSA 3EXNA 3KZWA 4NGPA 3IGRA 5HVGA 1BOBA 4MHZA 3TOAA 4EMEA 4R7MA 1A2ZA 2EVNA 3G8WA 3TFYA 2ARHA 1HDQA 3B2YA 4RN7A 3KKWA 5LYIA 2C6CA 4P44A 4P4EA 1Z8TA 4UIBA 2GFQA 2V8HA 2ZW5A 3TX8A 2PSWA 4F0XA 4MFZA 2CTBA 4B10A 4NGNA 5IB0A 2GLFA 5AG6A 5THWA 3DLJA 4QBJA 3QNVA 4MFJA 1XMTA 2QMLA 4NSQA 3V38A 4K30A 1MJAA 1MJ9A 2EK9A 3BJ7A 2HUZA 3FNCA 2P6EA 4XNHC 5DWMA 2ZEMA 4JZ0A 2OR4A 4NJQA 4P4JA 2CXAA 2POKA 2R1IA 1S7LA 4P4FA 4A33A 2RB7A 3CXPA 1RO5A 3GB0A 1JWQA 4AG9A 4B13A 4A30A 4M85A 2HQYA 3WT4A 4HPSA 2V77A 5LRGA 5JGFA 4PSXA 4IF5A 2PCUA 2CNMA 5C88A 2IL4A 1S7NA 2PDOA 4FWUA 1YX0A 4KSFA 2Q43A 4XPDB 1I12A 2PJ5A 3VWEA 5JQ4A 2JBKA 2CNSA 2PJ6A 2WPXA 3FVLA 3ISXA 4KVOE 3PGPA 4LUAA 4XPKA 3G3SA 4MHNA 4QUSA 1Z5RA 1DTDA 1M44A 2Z3LA 3VH9A 2VQYA 4KVXA 5G21A 3B35A 2PJ4A 3ZZIA 2WUUA 3IFEA 4XNHB 4YWYA 3D8PA 3R96A 5CBMA 3IIBA 3MGDA 2K5TA 4KVME 2BCOA 2QIRA 4M6IA 3S6HA 4F6AA 1H8LA 1ON0A 2YNCA 2G3AA 1Z8LA 3JUWA 2C1CA 4H2KA 3PBEA 3FRMA 1BO4A 4Q38A 5G1ZA 2Q7SA 4OAEA 1VKCA 2VBQA 2G0BA 3PP9A 4RI1A 4NCZA 2FE7A 5KTCA 4UA3A 4UBRA 3WC7A 4I49A 1JQGA 2DF5A 4JXQA 4PK3A 3R9GA 4C2YA 4C7IA 4CGMA 2QJ8A 3PFOA 4MY0A 2PC1A 1YMEA 2F8HA 2FL4A 2Q4YA 2P0WA 4PXCA 4QB9A 4R76A 3SHPA 5IX3A 2EK8A 2FXFA 2ZPAA 3C26A 4E8OA 3WC5A 2FCKA 3FYNA 3GLJA 3R1KA 2IMOA 4MCSA 4A39A 3CPXA 1HDUA 2I3CA 1HEEA 4CYQA 2PRBA 4E2AA 4EFDA 2PR8A 1TIQA 1ZLIA 2AFOA 3H5ZA 2VL1A 3RZAA 4HNXB 3EY5A 2ZENA 4MFKA 3D68A 4JYWA 4CGNA 2Q0YA 4B5PB 4Y49B 4QC6A 2DEAA 3JTKA 3FB3A 3IWWA 5JPHA 4OC4A 2QVPA 3OWCA 4LQGA 4NGRA 4AVAA 2CF4A 4JJXA 4O23A 4OC1A 1GYTA 1Q2CA 1UFHA 1I1DA 1N71A 2OB0A 3QAYA 4W9YA 3CDXA 1Q2YA 1S60A 2HC9A 4B11A 4TWEA 1CM0A 3PZJA 2RC4A 2JBJA 4NGQA 4ZX8A 1ZG9A 3BHXA 1QSTA 4OC5A 3N5FA 4ZI6A 1DE4C 2ZEEA 1KZFA 2O28A 3FEDA 5H86A 4ZYQA 1PCAA 1S5KA 1YW4A 3GY9A 2AFWA 3I1UA 4Q7AA 3KGQA 5AG7A 2O53A 2Q51A 1XBUA 4OC3A 3TO7A 1OZPA 5K8PA 1M4DA 3B3CA 3FH4A 2QYVA 5LYDA 3H4QA 3SXNA 3VATA 3WC6A 4PQAA 4A38A 1X10A 4PXBA 1NSAA 3PB8X 2PJ0A 1IYLA 1Z9UA 4OC0A 4U9YA 3GUXA 1YLOA 3H8EA 3HUVA 1ARMA 3NH5A 1WK4A 1LOKA 4B5PA 3SJXA 4OC2A 1XE4A 1TKHA 3EC4A 3GKRA 1XF8A 4QVTA 3EO4A 1XRYA 3R9FA 4L89A 2PIZA 2Z10A 2HV2A 5J1QA 1Q7LA 4P4BA 2Z0ZA 1Z2LA 2Z3NA 3I3GA 2ZEFA 3NA6A 3V8IA 4UEZA 2PR1A 3P2HA 1VIXA 5AG5A 1NMTA 4OKOA 3LD2A 4BBHA 3NE7A 4IK2A 1B87A 4B5OA 3PBBA 5G22A 4CRZB 1IIDA 1K4JA 2EUIA 2VZZA 1YQEA 2BO9A 3TTHA 2WPWA 3B3TA 4BINA 5G20A 2B3UA 4JWPA 3LWUA 4C2ZA 3SJEA 5BWAB 2IJZA 3E0KA 3NH4A 4LQ6A 1MJBA 3D67A 3N7ZA 4MI4A 2PJAA 2B5GB 2D4PA 2BUEA 1YLEA 5F47A 4AG7A 4FD7A 1CP7A 3PFEA 2PJ7A 1I21A 2XEIA 5IB9A 4UEFA 2FT0A 1SQHA 1BPMA 2GIVA 4CGPA 2WZNA 2Z3PA 4KOXA 4C7HA 2ANPA 4OMEA 2H5MA 1IYKA 4FD5A 1NE9A 1QSNA 1R3NA 4H6ZA 2ZW4A 4R87A 1PU9A 2NYQA 2ZXVA 5LYLA 2B3VA 4M3SA 5LYFA 4MMOA 3CXQA 1YVOA 4KLVA 2Z3KA 2ZELA 7CPAA 2X7BA 1XMBA 2C6GA 4R9MA 1M1DA 1YK3A 2PQ8A 1F57A 3LMSA 4MFQA 1QSMA 3KL9A 4MXUA 2DPTA 4KOWA 4U9ZA 1U6MA 3D2PA 2IQ6A 3IEHA 4ORFA 3KR5A 4OIDA 3BI1A 2FS5A 4KOYA 2R7HA
chains in the Genus database with same CATH topology
4OADA 4KORA 2Q4VA 3D3SA 4OLLA 1M4IA 5CNPA 5ISVA 2ATRA 3FBUA 4B12A 3TE4A 5E96A 1R57A 4L8AA 1ZO0A 2B5GA 4II9A 4J3GA 2Z3OA 4KOTA 2REFA 4CYPA 5DWNA 1KUYA 4YRHA 1Y7RA 2FIAA 1J4JA 1YR0A 2Y0MA 3IU2A 1S7KA 4UFWA 3UY5A 4CYOA 4PV6A 3VWDA 4CAEA 1VHSA 2I00A 2OZGA 1KUXA 2BL1A 5F49A 3I9SA 5HMNA 3A9LA 4U5YA 2C27A 2R8VA 3W6SA 2G3TA 1RXTA 2VZYA 3T90A 2OZHA 4UFVA 2J8MA 4KOVA 5A27A 2OZUA 4IUSA 2Z3MA 3BLNA 3SXOA 3P2FA 3IU1A 4MBUA 2I79A 2YNEA 4ZBGA 3R95A 4R3LA 1QSRA 1Y9WA 4JXRA 3WR7A 2BEIA 5GCNA 1S3ZA 4KZTA 3R9EA 4CS0B 1QSOA 3TO9A 4MFLA 5J8FA 3JVNA 3DNSA 4LX9A 5F48A 2P6FA 4UCPA 4AB7A 4UWJA 3K9UA 5A28A 4YGOA 4CAFA 5HH1A 3TO6A 1M4GA 4CYNA 5AGEA 4R3KA 1CJWA 4CRYB 2AE6A 1YGHA 5J8CA 2VXKA 4GS4A 3GYAA 3T9YA 4E0AA 4NF1A 1B6BA 3FIXA 4UFXA 5C82A 1Z4RA 4CGOA 3ZJ0A 4KS9A 2A4NA 4PSWA 4BMHA 4A31A 1LRZA 4XPDC 4MY3A 5F46A 3IWEA 4NXYA 2P6GA 1P4NA 4X5KA 4DNCA 2B4DB 1NSLA 5I0CA 4KOSA 3DDDA 3DR8A 1Y9KA 4HNWB 3RYOA 3F0AA 3S6KA 2VI7A 2Z11A 5H84A 4JD6A 1Z4EA 2Q7BA 4H89A 5KTDA 3TCVA 3F8KA 3DR6A 5EC4A 4H6UA 2ZW6A 4CAXA 2GANA 1XIXA 3S6FA 4F0YA 4CGLA 2Q44A 4KUAA 4A32A 3S6GA 4CAWA 1KUVA 2J8NA 3F5BA 2DPSA 4HNYB 2CNTA 1GHEA 4FD4A 4KOUA 4MFPA 4PK2A 3B8GA 4UWIA 2YNDA 4Y49C 4KLWA 2OH1A 2AJ6A 1YREA 2BSWA 4KUBA 4A95A 1L0CA 2QECA 2B4DA 3W6XA 2CY2A 2J8RA 2WSAA 2VEZA 2B4BA 1PUAA 2OU2A 2REEA 1FY7A 2FIWA 1YVKA 4R57A 5EBVA 1XEBA 3EFAA 4ZGYB 3QAHA 1WWZA 4AVBA 2YGWA 3TOBA 3D2MA 4JLYA 4A2ZA 4YFJA 4XPLA 3BJ8A 4MHDA 5KTAA 2F5IA 3QB8A 4Q36A 2FSRA 1P0HA 4UCMA 2JDCA 1MK4A 3W91A 1S7FA 3DSBA 4ONUA 2DXQA 4EVYA 2D4OA 4RS2A 3LODA 4NEXA 1IICA 5FVJA 1IB1E 2JLMA 2ZW7A 2JEVA 4C2XA 2Q04A 2B58A 2R98A 2YNCC 2KCWA 4B14A 3TT2A 4KSAA 5AG4A 2JDDA 1V0CA 4AVCA 4UCNA 2NMTA 2GE3A 4MJ8A 5IV0A 4HKFA 1Q2DA 4FD6A 4CAVA 3IWGA 3FXTA 3CXSA 3EXNA 3IGRA 1BOBA 3TOAA 2EVNA 3G8WA 3TFYA 2ARHA 3KKWA 2ZW5A 2PSWA 4F0XA 4MFZA 4B10A 5IB0A 5AG6A 4QBJA 4MFJA 1XMTA 2QMLA 4NSQA 4K30A 1MJAA 1MJ9A 3BJ7A 3FNCA 2HUZA 2P6EA 4XNHC 5DWMA 2CXAA 2R1IA 1S7LA 4A33A 3CXPA 1RO5A 4AG9A 4B13A 4A30A 4M85A 2HQYA 4PSXA 4IF5A 2CNMA 5C88A 2IL4A 1S7NA 2PDOA 1YX0A 4KSFA 4XPDB 1I12A 3VWEA 5JQ4A 2CNSA 2WPXA 4KVOE 3PGPA 4LUAA 4XPKA 3G3SA 4QUSA 1M44A 2Z3LA 2VQYA 4KVXA 5G21A 3ZZIA 2WUUA 4XNHB 3D8PA 3R96A 3MGDA 2K5TA 4KVME 2QIRA 3S6HA 4F6AA 1ON0A 2YNCA 2G3AA 3JUWA 3FRMA 1BO4A 4Q38A 5G1ZA 4OAEA 1VKCA 2VBQA 2G0BA 3PP9A 4RI1A 4NCZA 2FE7A 5KTCA 4UA3A 4UBRA 4I49A 4JXQA 4PK3A 4C2YA 3R9GA 4C7IA 4CGMA 4MY0A 2PC1A 2FL4A 2Q4YA 2P0WA 4QB9A 3SHPA 5IX3A 2FXFA 2ZPAA 3C26A 4E8OA 2FCKA 3FYNA 3R1KA 4CYQA 2PRBA 4E2AA 2PR8A 1TIQA 3H5ZA 4HNXB 3EY5A 4MFKA 4CGNA 2Q0YA 4B5PB 4Y49B 4QC6A 3JTKA 3FB3A 5JPHA 3OWCA 4AVAA 4JJXA 1Q2CA 1UFHA 1I1DA 1N71A 2OB0A 1Q2YA 1S60A 4B11A 1CM0A 3PZJA 2RC4A 1QSTA 1KZFA 2O28A 5H86A 3GY9A 1S5KA 5AG7A 3TO7A 1OZPA 1M4DA 3H4QA 3SXNA 1IYLA 1Z9UA 4U9YA 4B5PA 1WK4A 1XE4A 4QVTA 3EC4A 3GKRA 1XF8A 3EO4A 3R9FA 4L89A 2Z10A 2HV2A 2Z0ZA 3I3GA 2Z3NA 3V8IA 2PR1A 3P2HA 5AG5A 1NMTA 3LD2A 4BBHA 3NE7A 1B87A 4B5OA 5G22A 4CRZB 1K4JA 1IIDA 2EUIA 2VZZA 3TTHA 2WPWA 5G20A 2B3UA 4JWPA 4C2ZA 5BWAB 3E0KA 1MJBA 3N7ZA 4MI4A 2B5GB 2D4PA 2BUEA 1YLEA 5F47A 4AG7A 4FD7A 1I21A 2FT0A 1SQHA 2GIVA 4CGPA 2Z3PA 4C7HA 4KOXA 2H5MA 1IYKA 4FD5A 1NE9A 1QSNA 4H6ZA 2ZW4A 4R87A 1PU9A 2ZXVA 2B3VA 4M3SA 3CXQA 1YVOA 4KLVA 2Z3KA 2X7BA 4R9MA 1M1DA 1YK3A 2PQ8A 4MFQA 1QSMA 2DPTA 4KOWA 4U9ZA 1U6MA 3D2PA 4ORFA 4C68A 2FS5A 4KOYA 2R7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAD A;  4KOR A;  2Q4V A;  3D3S A;  4OLL A;  1M4I A;  5CNP A;  5ISV A;  2ATR A;  3FBU A;  3TE4 A;  5E96 A;  1R57 A;  4L8A A;  2B5G A;  4II9 A;  4J3G A;  4KOT A;  2REF A;  5DWN A;  1KUY A;  4YRH A;  1Y7R A;  2FIA A;  1J4J A;  1YR0 A;  2Y0M A;  3UY5 A;  1S7K A;  4PV6 A;  3VWD A;  1VHS A;  2I00 A;  2OZG A;  1KUX A;  2BL1 A;  5F49 A;  3I9S A;  5HMN A;  4U5Y A;  2C27 A;  2R8V A;  3W6S A;  2G3T A;  1RXT A;  2VZY A;  3T90 A;  2OZH A;  2J8M A;  4KOV A;  2OZU A;  4IUS A;  3BLN A;  3SXO A;  3P2F A;  4MBU A;  2I79 A;  4ZBG A;  3R95 A;  4R3L A;  1QSR A;  1Y9W A;  4JXR A;  3WR7 A;  2BEI A;  5GCN A;  1S3Z A;  4KZT A;  3R9E A;  4CS0 B;  1QSO A;  3TO9 A;  5J8F A;  3JVN A;  3DNS A;  4LX9 A;  5F48 A;  2P6F A;  4AB7 A;  4UWJ A;  3K9U A;  4YGO A;  5HH1 A;  3TO6 A;  1M4G A;  4R3K A;  1CJW A;  4CRY B;  2AE6 A;  1YGH A;  5J8C A;  2VXK A;  4GS4 A;  3GYA A;  3T9Y A;  4E0A A;  4NF1 A;  1B6B A;  3FIX A;  5C82 A;  1Z4R A;  3ZJ0 A;  2A4N A;  4PSW A;  4BMH A;  1LRZ A;  4XPD C;  4MY3 A;  5F46 A;  4NXY A;  2P6G A;  1P4N A;  4X5K A;  4DNC A;  2B4D B;  1NSL A;  5I0C A;  4KOS A;  3DDD A;  3DR8 A;  1Y9K A;  4HNW B;  3RYO A;  3F0A A;  3S6K A;  2VI7 A;  2Z11 A;  5H84 A;  4JD6 A;  1Z4E A;  2Q7B A;  4H89 A;  5KTD A;  3TCV A;  3F8K A;  3DR6 A;  5EC4 A;  4H6U A;  2ZW6 A;  4CAX A;  2GAN A;  1XIX A;  3S6F A;  4F0Y A;  2Q44 A;  4KUA A;  3S6G A;  4CAW A;  1KUV A;  2J8N A;  3F5B A;  4HNY B;  2CNT A;  1GHE A;  4FD4 A;  4KOU A;  4PK2 A;  3B8G A;  4UWI A;  4Y49 C;  4KLW A;  2OH1 A;  2AJ6 A;  1YRE A;  2BSW A;  4KUB A;  1L0C A;  2QEC A;  2B4D A;  3W6X A;  2CY2 A;  2J8R A;  2VEZ A;  2B4B A;  1PUA A;  2OU2 A;  2REE A;  1FY7 A;  2FIW A;  1YVK A;  4R57 A;  5EBV A;  1XEB A;  3EFA A;  3QAH A;  1WWZ A;  4AVB A;  3TOB A;  3D2M A;  4JLY A;  4YFJ A;  4XPL A;  3BJ8 A;  4MHD A;  5KTA A;  2F5I A;  3QB8 A;  2FSR A;  1P0H A;  2JDC A;  1MK4 A;  3W91 A;  1S7F A;  3DSB A;  4ONU A;  2DXQ A;  4EVY A;  2D4O A;  4RS2 A;  3LOD A;  4NEX A;  1IIC A;  5FVJ A;  1IB1 E;  2JLM A;  2ZW7 A;  2JEV A;  2Q04 A;  2B58 A;  2R98 A;  2KCW A;  3TT2 A;  2JDD A;  1V0C A;  4AVC A;  2NMT A;  2GE3 A;  4MJ8 A;  5IV0 A;  4HKF A;  1Q2D A;  4FD6 A;  4CAV A;  3IWG A;  3FXT A;  3CXS A;  3EXN A;  3IGR A;  1BOB A;  3TOA A;  2EVN A;  3G8W A;  3TFY A;  2ARH A;  3KKW A;  2ZW5 A;  2PSW A;  5IB0 A;  4QBJ A;  1XMT A;  2QML A;  4NSQ A;  4K30 A;  1MJA A;  1MJ9 A;  3BJ7 A;  3FNC A;  2HUZ A;  2P6E A;  4XNH C;  5DWM A;  2R1I A;  1S7L A;  3CXP A;  1RO5 A;  4AG9 A;  4M85 A;  2HQY A;  4PSX A;  4IF5 A;  2CNM A;  5C88 A;  2IL4 A;  1S7N A;  2PDO A;  1YX0 A;  4XPD B;  1I12 A;  3VWE A;  5JQ4 A;  2CNS A;  2WPX A;  4KVO E;  3PGP A;  4LUA A;  4XPK A;  3G3S A;  4QUS A;  1M44 A;  2VQY A;  4KVX A;  3ZZI A;  4XNH B;  3D8P A;  3R96 A;  3MGD A;  2K5T A;  4KVM E;  2QIR A;  3S6H A;  4F6A A;  1ON0 A;  2G3A A;  3JUW A;  3FRM A;  1BO4 A;  4OAE A;  1VKC A;  2VBQ A;  2G0B A;  3PP9 A;  4RI1 A;  4NCZ A;  2FE7 A;  5KTC A;  4UA3 A;  4UBR A;  4I49 A;  4JXQ A;  4PK3 A;  3R9G A;  4MY0 A;  2PC1 A;  2FL4 A;  2Q4Y A;  2P0W A;  4QB9 A;  3SHP A;  5IX3 A;  2FXF A;  2ZPA A;  3C26 A;  4E8O A;  2FCK A;  3FYN A;  3R1K A;  2PRB A;  4E2A A;  2PR8 A;  1TIQ A;  4HNX B;  3EY5 A;  2Q0Y A;  4B5P B;  4Y49 B;  4QC6 A;  3FB3 A;  5JPH A;  3OWC A;  4AVA A;  4JJX A;  1Q2C A;  1UFH A;  1I1D A;  1N71 A;  2OB0 A;  1Q2Y A;  1S60 A;  1CM0 A;  3PZJ A;  2RC4 A;  1QST A;  1KZF A;  2O28 A;  5H86 A;  3GY9 A;  1S5K A;  3TO7 A;  1OZP A;  1M4D A;  3H4Q A;  3SXN A;  1IYL A;  1Z9U A;  4U9Y A;  4B5P A;  1WK4 A;  1XE4 A;  4QVT A;  3EC4 A;  3GKR A;  1XF8 A;  3EO4 A;  3R9F A;  4L89 A;  2Z10 A;  2HV2 A;  2Z0Z A;  3I3G A;  3V8I A;  2PR1 A;  3P2H A;  1NMT A;  3LD2 A;  3NE7 A;  1B87 A;  4B5O A;  4CRZ B;  1K4J A;  1IID A;  2EUI A;  2VZZ A;  3TTH A;  2WPW A;  2B3U A;  4JWP A;  3E0K A;  1MJB A;  3N7Z A;  4MI4 A;  2B5G B;  2D4P A;  2BUE A;  1YLE A;  5F47 A;  4AG7 A;  4FD7 A;  1I21 A;  2FT0 A;  1SQH A;  2GIV A;  4KOX A;  2H5M A;  1IYK A;  4FD5 A;  1NE9 A;  1QSN A;  4H6Z A;  2ZW4 A;  4R87 A;  1PU9 A;  2ZXV A;  2B3V A;  4M3S A;  3CXQ A;  1YVO A;  4KLV A;  2X7B A;  4R9M A;  1M1D A;  1YK3 A;  2PQ8 A;  1QSM A;  4KOW A;  4U9Z A;  1U6M A;  3D2P A;  4ORF A;  2FS5 A;  4KOY A;  2R7H A; 
#chains in the Genus database with same CATH topology
 4OAD A;  3IC1 A;  3DGV A;  4KOR A;  2XEF A;  3IJ3 A;  2PJ2 A;  4OP4 A;  3PB7 X;  2Q4V A;  3D3S A;  4OLL A;  1M4I A;  5CNP A;  5ISV A;  2ATR A;  4WWV A;  3FBU A;  4B12 A;  4FBE A;  1ZLH A;  3TE4 A;  5E96 A;  1IY7 A;  3KR4 A;  4ONW A;  1R57 A;  2AFX A;  1ZO0 A;  2B5G A;  3D4U A;  3H8G A;  4L8A A;  4KSI A;  1PYT B;  1QQ9 A;  4II9 A;  4J3G A;  4PXE A;  2Z3O A;  4OIW A;  4KOT A;  2REF A;  2PIY A;  5D8N A;  4CYP A;  1BPN A;  2PRQ A;  3D7F A;  5DWN A;  3V7Z A;  4PPZ A;  1KUY A;  3NE8 A;  5I4M A;  1IU8 A;  4YRH A;  3B3W A;  3FF3 A;  1ZG8 A;  1Y7R A;  2FIA A;  1J4J A;  1YR0 A;  2HB6 A;  2Y0M A;  1S7K A;  3IU2 A;  4UFW A;  3UY5 A;  4CYO A;  4PV6 A;  3VWD A;  2PJ8 A;  4CAE A;  1VHS A;  2I00 A;  2OZG A;  1KUX A;  1TF9 A;  2BL1 A;  5F49 A;  4ZY2 A;  3I9S A;  4P45 A;  5HMN A;  3A9L A;  4R8F A;  2C27 A;  1F2P A;  2R8V A;  4U5Y A;  3T8W A;  2G3T A;  3W6S A;  1RXT A;  5F09 A;  2VZY A;  1TF8 A;  5CPA A;  3S9L A;  3ISZ A;  2PJB A;  3KI9 A;  4MCP A;  3T90 A;  2OZH A;  4UFV A;  1CPX A;  5ELY A;  2J8M A;  2PJ9 A;  4KOV A;  4A37 A;  5A27 A;  1R43 A;  2EBJ A;  2OZU A;  2PE3 A;  2Z3M A;  4GM5 A;  4IUS A;  1CPS A;  3BLN A;  3D7D A;  3SXO A;  1Y0R A;  4ZX9 A;  3P2F A;  2PJ3 A;  4IHM A;  3IU1 A;  4MBU A;  2F7V A;  2I79 A;  2YNE A;  3GIU A;  4MHP A;  6CPA A;  1CX8 A;  4ZBG A;  3R95 A;  4R3L A;  1QSR A;  4F9V A;  2Q4Z A;  3FEC A;  1Y9W A;  4JXR A;  3WR7 A;  2V8G A;  4NGS A;  2BEI A;  2ZOG A;  5GCN A;  1S3Z A;  4KZT A;  3R9E A;  4CS0 B;  1AMP A;  1QSO A;  4R6T A;  3TO9 A;  2FVG A;  2ZEO A;  4DJL A;  4MFL A;  5J8F A;  2PJC A;  2BOA A;  3CPA A;  3JVN A;  5HXD A;  1Z8W A;  3DNS A;  4LX9 A;  5F48 A;  2O4H A;  4ZY0 A;  2OOT A;  2P6F A;  4WJB A;  3BI0 A;  1TKF A;  3SJF A;  4UCP A;  4AB7 A;  4UWJ A;  3K9U A;  4P4I A;  2AFU A;  2EWB A;  4MRI A;  5A28 A;  4YGO A;  4CAF A;  4B6Z A;  5HH1 A;  3TO6 A;  1M4G A;  1YSJ A;  4UIA A;  4CYN A;  5AGE A;  1KWM A;  3CZX A;  4R3K A;  1CJW A;  4CRY B;  4Z65 A;  2AE6 A;  3IO1 A;  3D66 A;  5JH9 A;  1YGH A;  3HLP A;  5J8C A;  4F9U A;  1BLL E;  2VXK A;  5DS0 A;  4GS4 A;  2PJ1 A;  3FEE A;  3GYA A;  3T9Y A;  4E0A A;  1Z8X A;  3SI0 A;  1RTQ A;  1CG2 A;  1B6B A;  1LAN A;  1ZG7 A;  2AFS A;  3B7I A;  3CT9 A;  3FIX A;  2ZEP A;  3NFZ A;  4P10 A;  4UFX A;  4UF4 A;  1Z4R A;  5C82 A;  4CGO A;  4FAI A;  3LAC A;  4KS9 A;  2A4N A;  3ZJ0 A;  4PSW A;  4BMH A;  3S9N A;  4A31 A;  1LRZ A;  4XPD C;  1CP6 A;  4MY3 A;  1LAP A;  5F46 A;  3IWE A;  4NXY A;  4MCR A;  2P6G A;  1P4N A;  2V8V A;  4X5K A;  4DNC A;  1QMU A;  2B4D B;  3NH8 A;  1BAV A;  1NSL A;  5I0C A;  1IGB A;  4KOS A;  3TC8 A;  5EMI A;  1F2O A;  2GLJ A;  4AXV A;  5K8O A;  3DDD A;  4NGT A;  1LCP A;  3RBU A;  3DR8 A;  3B3V A;  4YU9 A;  1Y9K A;  4HNW B;  3RYO A;  3F0A A;  3S6K A;  3H8F A;  2VI7 A;  2Z11 A;  5H84 A;  4JD6 A;  3KHX A;  1Z4E A;  2Q7B A;  2PVV A;  1IOI A;  4H89 A;  2JEW A;  5KTD A;  3TCV A;  3F8K A;  3DR6 A;  1CBX A;  4H6U A;  5EC4 A;  2ZW6 A;  4M6H A;  2GAN A;  4CAX A;  1Y7E A;  4CPA A;  5LRK A;  3K9T A;  2NSM A;  2XEJ A;  1XIX A;  4DYO A;  1IOF A;  3S6F A;  3FJU A;  4F0Y A;  4CGL A;  2Q44 A;  4KUA A;  5JM6 A;  3PB6 X;  4K3N A;  4A32 A;  3S6G A;  4CAW A;  1KUV A;  2J8N A;  3F5B A;  5K8M A;  3D7H A;  2DPS A;  4HNY B;  3FMC A;  1XJO A;  4NJR A;  1UWY A;  2CNT A;  1GHE A;  2WYR A;  3SI1 A;  4FD4 A;  3RNZ A;  1YW6 A;  3JRU A;  4NFR A;  2ODF A;  4X2T A;  5HVF A;  4KOU A;  4MFP A;  4PK2 A;  1VGY A;  3KQX A;  3B8G A;  4UWI A;  3SJG A;  2YND A;  2AFZ A;  4Y49 C;  2EO8 A;  1TXR A;  4KLW A;  4MHY A;  2OH1 A;  1AUG A;  2AJ6 A;  4RUH A;  1YRE A;  2BSW A;  2V8D A;  4KUB A;  4A95 A;  1L0C A;  2QEC A;  2B4D A;  3W6X A;  2CY2 A;  2XEG A;  2J8R A;  1EE3 P;  2VEZ A;  2WSA A;  2GRE A;  1OBR A;  1PUA A;  2B4B A;  2PVW A;  2OU2 A;  2REE A;  1FY7 A;  3RAM A;  2FIW A;  1YVK A;  4R57 A;  4F8Z A;  2ZEH A;  5EBV A;  4P4D A;  1XEB A;  1XOV A;  5LRJ A;  3EFA A;  3PB4 X;  4TNU A;  3QAH A;  1WWZ A;  4ZGY B;  4AVB A;  2YGW A;  4NF1 A;  1X12 A;  4IAV A;  3TOB A;  4NGM A;  3D2M A;  1LAM A;  4JLY A;  1M4L A;  4C68 A;  2C6P A;  4MCQ A;  1XFO A;  4A2Z A;  3KAS A;  4YFJ A;  4XPL A;  1ELL P;  4P6Y A;  3L2N A;  4BD9 A;  3BJ8 A;  3S9M A;  8CPA A;  4MHD A;  5KTA A;  2F5I A;  4PXD A;  4EWT A;  3QB8 A;  4Q36 A;  2FSR A;  2ZOF A;  1P0H A;  4UCM A;  3BXM A;  2JDC A;  2CTC A;  1MK4 A;  1AYE A;  3W91 A;  3MRU A;  1S7F A;  3DSB A;  1LFW A;  4ONU A;  2DXQ A;  4EVY A;  2D4O A;  4FUU A;  1TKJ A;  3D7G A;  4DUK A;  4RS2 A;  2G9D A;  4M6G A;  3B3S A;  3LOD A;  4NEX A;  3KHZ A;  2ABZ A;  1VHO A;  1IIC A;  5FVJ A;  2GU2 A;  1IB1 E;  1ARL A;  2JLM A;  1Y0Y A;  3FX6 A;  5K8N A;  3PRT A;  2JEV A;  2ZW7 A;  2AFM A;  2ZED A;  3SI2 A;  3PB9 X;  3RO0 A;  4G1P A;  4C2X A;  2Q04 A;  2B58 A;  3PEI A;  2CIJ A;  2J9A A;  1ELM P;  2R98 A;  2YNC C;  4UEE A;  5D29 A;  2KCW A;  3MN8 A;  4B14 A;  4GXH A;  3TT2 A;  4X3R A;  3VAR A;  4ZY1 A;  4KSA A;  5AG4 A;  2JDD A;  3WAB A;  1FT7 A;  1VHE A;  4X8I A;  1V0C A;  4AVC A;  4UCN A;  3KQZ A;  5HVH A;  2NMT A;  2GE3 A;  4MJ8 A;  5IV0 A;  4HKF A;  1FNO A;  1Q2D A;  4FD6 A;  2RFH A;  4CAV A;  3IWG A;  4A94 A;  3FXT A;  3K2K A;  2ZEG A;  3CXS A;  3EXN A;  3KZW A;  4NGP A;  3IGR A;  5HVG A;  1BOB A;  4MHZ A;  3TOA A;  4EME A;  4R7M A;  1A2Z A;  2EVN A;  3G8W A;  3TFY A;  2ARH A;  1HDQ A;  3B2Y A;  4RN7 A;  3KKW A;  5LYI A;  2C6C A;  4P44 A;  4P4E A;  1Z8T A;  4UIB A;  2GFQ A;  2V8H A;  2ZW5 A;  3TX8 A;  2PSW A;  4F0X A;  4MFZ A;  2CTB A;  4B10 A;  4NGN A;  5IB0 A;  2GLF A;  5AG6 A;  5THW A;  3DLJ A;  4QBJ A;  3QNV A;  4MFJ A;  1XMT A;  2QML A;  4NSQ A;  3V38 A;  4K30 A;  1MJA A;  1MJ9 A;  2EK9 A;  3BJ7 A;  2HUZ A;  3FNC A;  2P6E A;  4XNH C;  5DWM A;  2ZEM A;  4JZ0 A;  2OR4 A;  4NJQ A;  4P4J A;  2CXA A;  2POK A;  2R1I A;  1S7L A;  4P4F A;  4A33 A;  2RB7 A;  3CXP A;  1RO5 A;  3GB0 A;  1JWQ A;  4AG9 A;  4B13 A;  4A30 A;  4M85 A;  2HQY A;  3WT4 A;  4HPS A;  2V77 A;  5LRG A;  5JGF A;  4PSX A;  4IF5 A;  2PCU A;  2CNM A;  5C88 A;  2IL4 A;  1S7N A;  2PDO A;  4FWU A;  1YX0 A;  4KSF A;  2Q43 A;  4XPD B;  1I12 A;  2PJ5 A;  3VWE A;  5JQ4 A;  2JBK A;  2CNS A;  2PJ6 A;  2WPX A;  3FVL A;  3ISX A;  4KVO E;  3PGP A;  4LUA A;  4XPK A;  3G3S A;  4MHN A;  4QUS A;  1Z5R A;  1DTD A;  1M44 A;  2Z3L A;  3VH9 A;  2VQY A;  4KVX A;  5G21 A;  3B35 A;  2PJ4 A;  3ZZI A;  2WUU A;  3IFE A;  4XNH B;  4YWY A;  3D8P A;  3R96 A;  5CBM A;  3IIB A;  3MGD A;  2K5T A;  4KVM E;  2BCO A;  2QIR A;  4M6I A;  3S6H A;  4F6A A;  1H8L A;  1ON0 A;  2YNC A;  2G3A A;  1Z8L A;  3JUW A;  2C1C A;  4H2K A;  3PBE A;  3FRM A;  1BO4 A;  4Q38 A;  5G1Z A;  2Q7S A;  4OAE A;  1VKC A;  2VBQ A;  2G0B A;  3PP9 A;  4RI1 A;  4NCZ A;  2FE7 A;  5KTC A;  4UA3 A;  4UBR A;  3WC7 A;  4I49 A;  1JQG A;  2DF5 A;  4JXQ A;  4PK3 A;  3R9G A;  4C2Y A;  4C7I A;  4CGM A;  2QJ8 A;  3PFO A;  4MY0 A;  2PC1 A;  1YME A;  2F8H A;  2FL4 A;  2Q4Y A;  2P0W A;  4PXC A;  4QB9 A;  4R76 A;  3SHP A;  5IX3 A;  2EK8 A;  2FXF A;  2ZPA A;  3C26 A;  4E8O A;  3WC5 A;  2FCK A;  3FYN A;  3GLJ A;  3R1K A;  2IMO A;  4MCS A;  4A39 A;  3CPX A;  1HDU A;  2I3C A;  1HEE A;  4CYQ A;  2PRB A;  4E2A A;  4EFD A;  2PR8 A;  1TIQ A;  1ZLI A;  2AFO A;  3H5Z A;  2VL1 A;  3RZA A;  4HNX B;  3EY5 A;  2ZEN A;  4MFK A;  3D68 A;  4JYW A;  4CGN A;  2Q0Y A;  4B5P B;  4Y49 B;  4QC6 A;  2DEA A;  3JTK A;  3FB3 A;  3IWW A;  5JPH A;  4OC4 A;  2QVP A;  3OWC A;  4LQG A;  4NGR A;  4AVA A;  2CF4 A;  4JJX A;  4O23 A;  4OC1 A;  1GYT A;  1Q2C A;  1UFH A;  1I1D A;  1N71 A;  2OB0 A;  3QAY A;  4W9Y A;  3CDX A;  1Q2Y A;  1S60 A;  2HC9 A;  4B11 A;  4TWE A;  1CM0 A;  3PZJ A;  2RC4 A;  2JBJ A;  4NGQ A;  4ZX8 A;  1ZG9 A;  3BHX A;  1QST A;  4OC5 A;  3N5F A;  4ZI6 A;  1DE4 C;  2ZEE A;  1KZF A;  2O28 A;  3FED A;  5H86 A;  4ZYQ A;  1PCA A;  1S5K A;  1YW4 A;  3GY9 A;  2AFW A;  3I1U A;  4Q7A A;  3KGQ A;  5AG7 A;  2O53 A;  2Q51 A;  1XBU A;  4OC3 A;  3TO7 A;  1OZP A;  5K8P A;  1M4D A;  3B3C A;  3FH4 A;  2QYV A;  5LYD A;  3H4Q A;  3SXN A;  3VAT A;  3WC6 A;  4PQA A;  4A38 A;  1X10 A;  4PXB A;  1NSA A;  3PB8 X;  2PJ0 A;  1IYL A;  1Z9U A;  4OC0 A;  4U9Y A;  3GUX A;  1YLO A;  3H8E A;  3HUV A;  1ARM A;  3NH5 A;  1WK4 A;  1LOK A;  4B5P A;  3SJX A;  4OC2 A;  1XE4 A;  1TKH A;  3EC4 A;  3GKR A;  1XF8 A;  4QVT A;  3EO4 A;  1XRY A;  3R9F A;  4L89 A;  2PIZ A;  2Z10 A;  2HV2 A;  5J1Q A;  1Q7L A;  4P4B A;  2Z0Z A;  1Z2L A;  2Z3N A;  3I3G A;  2ZEF A;  3NA6 A;  3V8I A;  4UEZ A;  2PR1 A;  3P2H A;  1VIX A;  5AG5 A;  1NMT A;  4OKO A;  3LD2 A;  4BBH A;  3NE7 A;  4IK2 A;  1B87 A;  4B5O A;  3PBB A;  5G22 A;  4CRZ B;  1IID A;  1K4J A;  2EUI A;  2VZZ A;  1YQE A;  2BO9 A;  3TTH A;  2WPW A;  3B3T A;  4BIN A;  5G20 A;  2B3U A;  4JWP A;  3LWU A;  4C2Z A;  3SJE A;  5BWA B;  2IJZ A;  3E0K A;  3NH4 A;  4LQ6 A;  1MJB A;  3D67 A;  3N7Z A;  4MI4 A;  2PJA A;  2B5G B;  2D4P A;  2BUE A;  1YLE A;  5F47 A;  4AG7 A;  4FD7 A;  1CP7 A;  3PFE A;  2PJ7 A;  1I21 A;  2XEI A;  5IB9 A;  4UEF A;  2FT0 A;  1SQH A;  1BPM A;  2GIV A;  4CGP A;  2WZN A;  2Z3P A;  4KOX A;  4C7H A;  2ANP A;  4OME A;  2H5M A;  1IYK A;  4FD5 A;  1NE9 A;  1QSN A;  1R3N A;  4H6Z A;  2ZW4 A;  4R87 A;  1PU9 A;  2NYQ A;  2ZXV A;  5LYL A;  2B3V A;  4M3S A;  5LYF A;  4MMO A;  3CXQ A;  1YVO A;  4KLV A;  2Z3K A;  2ZEL A;  7CPA A;  2X7B A;  1XMB A;  2C6G A;  4R9M A;  1M1D A;  1YK3 A;  2PQ8 A;  1F57 A;  3LMS A;  4MFQ A;  1QSM A;  3KL9 A;  4MXU A;  2DPT A;  4KOW A;  4U9Z A;  1U6M A;  3D2P A;  2IQ6 A;  3IEH A;  4ORF A;  3KR5 A;  4OID A;  3BI1 A;  2FS5 A;  4KOY A;  2R7H A; 
#chains in the Genus database with same CATH homology
 4OAD A;  4KOR A;  2Q4V A;  3D3S A;  4OLL A;  1M4I A;  5CNP A;  5ISV A;  2ATR A;  3FBU A;  4B12 A;  3TE4 A;  5E96 A;  1R57 A;  4L8A A;  1ZO0 A;  2B5G A;  4II9 A;  4J3G A;  2Z3O A;  4KOT A;  2REF A;  4CYP A;  5DWN A;  1KUY A;  4YRH A;  1Y7R A;  2FIA A;  1J4J A;  1YR0 A;  2Y0M A;  3IU2 A;  1S7K A;  4UFW A;  3UY5 A;  4CYO A;  4PV6 A;  3VWD A;  4CAE A;  1VHS A;  2I00 A;  2OZG A;  1KUX A;  2BL1 A;  5F49 A;  3I9S A;  5HMN A;  3A9L A;  4U5Y A;  2C27 A;  2R8V A;  3W6S A;  2G3T A;  1RXT A;  2VZY A;  3T90 A;  2OZH A;  4UFV A;  2J8M A;  4KOV A;  5A27 A;  2OZU A;  4IUS A;  2Z3M A;  3BLN A;  3SXO A;  3P2F A;  3IU1 A;  4MBU A;  2I79 A;  2YNE A;  4ZBG A;  3R95 A;  4R3L A;  1QSR A;  1Y9W A;  4JXR A;  3WR7 A;  2BEI A;  5GCN A;  1S3Z A;  4KZT A;  3R9E A;  4CS0 B;  1QSO A;  3TO9 A;  4MFL A;  5J8F A;  3JVN A;  3DNS A;  4LX9 A;  5F48 A;  2P6F A;  4UCP A;  4AB7 A;  4UWJ A;  3K9U A;  5A28 A;  4YGO A;  4CAF A;  5HH1 A;  3TO6 A;  1M4G A;  4CYN A;  5AGE A;  4R3K A;  1CJW A;  4CRY B;  2AE6 A;  1YGH A;  5J8C A;  2VXK A;  4GS4 A;  3GYA A;  3T9Y A;  4E0A A;  4NF1 A;  1B6B A;  3FIX A;  4UFX A;  5C82 A;  1Z4R A;  4CGO A;  3ZJ0 A;  4KS9 A;  2A4N A;  4PSW A;  4BMH A;  4A31 A;  1LRZ A;  4XPD C;  4MY3 A;  5F46 A;  3IWE A;  4NXY A;  2P6G A;  1P4N A;  4X5K A;  4DNC A;  2B4D B;  1NSL A;  5I0C A;  4KOS A;  3DDD A;  3DR8 A;  1Y9K A;  4HNW B;  3RYO A;  3F0A A;  3S6K A;  2VI7 A;  2Z11 A;  5H84 A;  4JD6 A;  1Z4E A;  2Q7B A;  4H89 A;  5KTD A;  3TCV A;  3F8K A;  3DR6 A;  5EC4 A;  4H6U A;  2ZW6 A;  4CAX A;  2GAN A;  1XIX A;  3S6F A;  4F0Y A;  4CGL A;  2Q44 A;  4KUA A;  4A32 A;  3S6G A;  4CAW A;  1KUV A;  2J8N A;  3F5B A;  2DPS A;  4HNY B;  2CNT A;  1GHE A;  4FD4 A;  4KOU A;  4MFP A;  4PK2 A;  3B8G A;  4UWI A;  2YND A;  4Y49 C;  4KLW A;  2OH1 A;  2AJ6 A;  1YRE A;  2BSW A;  4KUB A;  4A95 A;  1L0C A;  2QEC A;  2B4D A;  3W6X A;  2CY2 A;  2J8R A;  2WSA A;  2VEZ A;  2B4B A;  1PUA A;  2OU2 A;  2REE A;  1FY7 A;  2FIW A;  1YVK A;  4R57 A;  5EBV A;  1XEB A;  3EFA A;  4ZGY B;  3QAH A;  1WWZ A;  4AVB A;  2YGW A;  3TOB A;  3D2M A;  4JLY A;  4A2Z A;  4YFJ A;  4XPL A;  3BJ8 A;  4MHD A;  5KTA A;  2F5I A;  3QB8 A;  4Q36 A;  2FSR A;  1P0H A;  4UCM A;  2JDC A;  1MK4 A;  3W91 A;  1S7F A;  3DSB A;  4ONU A;  2DXQ A;  4EVY A;  2D4O A;  4RS2 A;  3LOD A;  4NEX A;  1IIC A;  5FVJ A;  1IB1 E;  2JLM A;  2ZW7 A;  2JEV A;  4C2X A;  2Q04 A;  2B58 A;  2R98 A;  2YNC C;  2KCW A;  4B14 A;  3TT2 A;  4KSA A;  5AG4 A;  2JDD A;  1V0C A;  4AVC A;  4UCN A;  2NMT A;  2GE3 A;  4MJ8 A;  5IV0 A;  4HKF A;  1Q2D A;  4FD6 A;  4CAV A;  3IWG A;  3FXT A;  3CXS A;  3EXN A;  3IGR A;  1BOB A;  3TOA A;  2EVN A;  3G8W A;  3TFY A;  2ARH A;  3KKW A;  2ZW5 A;  2PSW A;  4F0X A;  4MFZ A;  4B10 A;  5IB0 A;  5AG6 A;  4QBJ A;  4MFJ A;  1XMT A;  2QML A;  4NSQ A;  4K30 A;  1MJA A;  1MJ9 A;  3BJ7 A;  3FNC A;  2HUZ A;  2P6E A;  4XNH C;  5DWM A;  2CXA A;  2R1I A;  1S7L A;  4A33 A;  3CXP A;  1RO5 A;  4AG9 A;  4B13 A;  4A30 A;  4M85 A;  2HQY A;  4PSX A;  4IF5 A;  2CNM A;  5C88 A;  2IL4 A;  1S7N A;  2PDO A;  1YX0 A;  4KSF A;  4XPD B;  1I12 A;  3VWE A;  5JQ4 A;  2CNS A;  2WPX A;  4KVO E;  3PGP A;  4LUA A;  4XPK A;  3G3S A;  4QUS A;  1M44 A;  2Z3L A;  2VQY A;  4KVX A;  5G21 A;  3ZZI A;  2WUU A;  4XNH B;  3D8P A;  3R96 A;  3MGD A;  2K5T A;  4KVM E;  2QIR A;  3S6H A;  4F6A A;  1ON0 A;  2YNC A;  2G3A A;  3JUW A;  3FRM A;  1BO4 A;  4Q38 A;  5G1Z A;  4OAE A;  1VKC A;  2VBQ A;  2G0B A;  3PP9 A;  4RI1 A;  4NCZ A;  2FE7 A;  5KTC A;  4UA3 A;  4UBR A;  4I49 A;  4JXQ A;  4PK3 A;  4C2Y A;  3R9G A;  4C7I A;  4CGM A;  4MY0 A;  2PC1 A;  2FL4 A;  2Q4Y A;  2P0W A;  4QB9 A;  3SHP A;  5IX3 A;  2FXF A;  2ZPA A;  3C26 A;  4E8O A;  2FCK A;  3FYN A;  3R1K A;  4CYQ A;  2PRB A;  4E2A A;  2PR8 A;  1TIQ A;  3H5Z A;  4HNX B;  3EY5 A;  4MFK A;  4CGN A;  2Q0Y A;  4B5P B;  4Y49 B;  4QC6 A;  3JTK A;  3FB3 A;  5JPH A;  3OWC A;  4AVA A;  4JJX A;  1Q2C A;  1UFH A;  1I1D A;  1N71 A;  2OB0 A;  1Q2Y A;  1S60 A;  4B11 A;  1CM0 A;  3PZJ A;  2RC4 A;  1QST A;  1KZF A;  2O28 A;  5H86 A;  3GY9 A;  1S5K A;  5AG7 A;  3TO7 A;  1OZP A;  1M4D A;  3H4Q A;  3SXN A;  1IYL A;  1Z9U A;  4U9Y A;  4B5P A;  1WK4 A;  1XE4 A;  4QVT A;  3EC4 A;  3GKR A;  1XF8 A;  3EO4 A;  3R9F A;  4L89 A;  2Z10 A;  2HV2 A;  2Z0Z A;  3I3G A;  2Z3N A;  3V8I A;  2PR1 A;  3P2H A;  5AG5 A;  1NMT A;  3LD2 A;  4BBH A;  3NE7 A;  1B87 A;  4B5O A;  5G22 A;  4CRZ B;  1K4J A;  1IID A;  2EUI A;  2VZZ A;  3TTH A;  2WPW A;  5G20 A;  2B3U A;  4JWP A;  4C2Z A;  5BWA B;  3E0K A;  1MJB A;  3N7Z A;  4MI4 A;  2B5G B;  2D4P A;  2BUE A;  1YLE A;  5F47 A;  4AG7 A;  4FD7 A;  1I21 A;  2FT0 A;  1SQH A;  2GIV A;  4CGP A;  2Z3P A;  4C7H A;  4KOX A;  2H5M A;  1IYK A;  4FD5 A;  1NE9 A;  1QSN A;  4H6Z A;  2ZW4 A;  4R87 A;  1PU9 A;  2ZXV A;  2B3V A;  4M3S A;  3CXQ A;  1YVO A;  4KLV A;  2Z3K A;  2X7B A;  4R9M A;  1M1D A;  1YK3 A;  2PQ8 A;  4MFQ A;  1QSM A;  2DPT A;  4KOW A;  4U9Z A;  1U6M A;  3D2P A;  4ORF A;  4C68 A;  2FS5 A;  4KOY A;  2R7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...