3BJ7A

Spermine/spermidine n1-acetyltransferase from mouse: crystal structure of a ternary complex reveals solvent-mediated spermine binding
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
162
Chain Sequence
KFKIRPATASDCSDILRLIKELAKYEYMEDQVILTEKDLQEDGFGEHPFYHCLVAEVPPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMKCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diamine acetyltransferase 1
publication title The crystal structure of spermidine/spermine N1-acetyltransferase in complex with spermine provides insights into substrate binding and catalysis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 42
structure length 162
sequence length 167
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2007-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3bj7A00
3EY5A 2EUIA 4KOXA 4KZTA 2BUEA 4MBUA 2B4DB 2D4PA 3GKRA 4AVBA 5H84A 2B58A 5F47A 4CAXA 4H6UA 4R87A 1CM0A 4R9MA 2PR1A 3F5BA 2HUZA 3T90A 1S7LA 2I00A 5KTCA 5IX3A 4QUSA 2Q0YA 4U9ZA 1IICA 4L89A 1M4GA 4JWPA 1YK3A 4K30A 4UBRA 3KKWA 2J8RA 4X5KA 3FRMA 1LRZA 1VKCA 4ZBGA 3LD2A 4ORFA 2FXFA 3CXQA 4KLVA 2A4NA 4F0YA 1RO5A 4KOVA 1XEBA 3NE7A 2Q4VA 2R98A 5GCNA 4E8OA 2OZGA 2PDOA 4AG7A 2FL4A 2G3AA 1QSRA 3MGDA 1BO4A 4MHDA 2OH1A 1R57A 2CNSA 1MK4A 4MY0A 3QB8A 4M3SA 4U5YA 4CAWA 4AG9A 2R1IA 1Q2DA 3TTHA 3FNCA 5F46A 5DWMA 1QSMA 5CNPA 4J3GA 4QB9A 3IWGA 3C26A 1OZPA 2Q4YA 2B3UA 3RYOA 3LODA 3SXOA 4Y49B 4KLWA 4H6ZA 4L8AA 4JXRA 3R9EA 2ATRA 3R95A 3GY9A 2JDDA 2G3TA 4JJXA 4JXQA 3TCVA 2AJ6A 4B5PA 1PUAA 2GANA 3ZJ0A 3GYAA 3CXSA 2FIWA 2DXQA 2I79A 2BL1A 4Y49C 3F8KA 2HV2A 2P6GA 2ZW6A 2R7HA 1S5KA 4B5PB 1IB1E 1MJBA 4OLLA 3TOBA 2PR8A 2P6FA 2VQYA 2REEA 3B8GA 2Q44A 3T9YA 3SHPA 1V0CA 1Y7RA 4UWJA 4QVTA 2REFA 2RC4A 1YREA 2VZZA 2JEVA 4MI4A 4XPDB 1IIDA 1P4NA 4KVOE 1B6BA 2GIVA 4CRZB 3FXTA 2VEZA 3G3SA 4RS2A 3N7ZA 1S7FA 4EVYA 1Q2CA 2F5IA 1L0CA 5EC4A 1K4JA 3PZJA 4LX9A 1ON0A 3TO9A 4BMHA 4XPDC 2ZW4A 4B5OA 2Y0MA 2Q04A 5I0CA 2B3VA 1Y9WA 4E2AA 2J8NA 2EVNA 1N71A 1Z4EA 1I21A 2O28A 4HNWB 2OB0A 3W6SA 3G8WA 4YFJA 4R3KA 4XPKA 1QSTA 3FBUA 2Z11A 3E0KA 1J4JA 3S6KA 2G0BA 2FCKA 3P2HA 2ARHA 1M44A 2AE6A 4KORA 1Z9UA 2C27A 4PSWA 2VI7A 1I12A 3TOAA 4KVXA 1Y9KA 4AVCA 5EBVA 2ZPAA 2B5GA 4LUAA 4R3LA 4KOUA 5C88A 1BOBA 2FE7A 1XMTA 2OZUA 4FD6A 1KZFA 1Q2YA 2B5GB 1PU9A 3TO6A 1NMTA 4H89A 2X7BA 2BSWA 2CNMA 4MJ8A 3FIXA 3EXNA 3DR6A 4NEXA 1TIQA 2NMTA 4IUSA 4OADA 3EFAA 4KOYA 4II9A 1SQHA 3TFYA 4CRYB 2PRBA 1IYKA 1KUVA 3V8IA 4XNHB 2OZHA 4HNYB 3WR7A 1KUXA 3S6HA 1NSLA 3D8PA 4QBJA 5C82A 3R9FA 5HMNA 3F0AA 4KUAA 3VWEA 1S7NA 4MY3A 4JD6A 1IYLA 2VZYA 2R8VA 1YGHA 2Z10A 1B87A 2PQ8A 3IGRA 2QECA 3I9SA 3P2FA 4XNHC 1RXTA 1M4DA 2P0WA 2ZXVA 5F48A 4U9YA 3ZZIA 2WPXA 1WWZA 4NSQA 3DR8A 1FY7A 3D2MA 1MJ9A 5HH1A 2B4DA 4M85A 3D2PA 5E96A 1GHEA 2BEIA 3D3SA 1UFHA 1YX0A 1M4IA 1S7KA 1XIXA 3JVNA 4NCZA 3EO4A 2WPWA 4HKFA 1S3ZA 1S60A 1XE4A 4OAEA 3W6XA 1NE9A 2P6EA 3DDDA 4FD5A 3OWCA 4NF1A 5IV0A 3S6FA 1WK4A 3FB3A 5ISVA 2CNTA 5IB0A 4YRHA 3K9UA 4QC6A 3R9GA 1YVKA 2FT0A 5KTAA 3CXPA 4KVME 5FVJA 1P0HA 3PGPA 3TE4A 2HQYA 3R1KA 4RI1A 3JUWA 2VXKA 3R96A 2ZW7A 5KTDA 2VBQA 3QAHA 4KOWA 1CJWA 4PK3A 5DWNA 1KUYA 4PK2A 2B4BA 2Z0ZA 2QIRA 4CAVA 5JPHA 4AVAA 5J8CA 3FYNA 4FD7A 4PSXA 3BJ7A 2FIAA 3DSBA 4E0AA 2CY2A 3PP9A 2KCWA 1U6MA 1XF8A 1MJAA 1Z4RA 4YGOA 4ONUA 4IF5A 2PSWA 3H4QA 4CS0B 5J8FA 4HNXB 2OU2A 2FS5A 3BLNA 2GE3A 4JLYA 2JDCA 2JLMA 4NXYA 2K5TA 2J8MA 2IL4A 3DNSA 1YLEA 5JQ4A 4GS4A 3W91A 3TT2A 3VWDA 4UA3A 4PV6A 1I1DA 3TO7A 1YVOA 5F49A 2PC1A 4UWIA 2Q7BA 4F6AA 4I49A 2D4OA 4DNCA 2QMLA 3SXNA 3BJ8A 2FSRA 4R57A 1YR0A 3UY5A 1M1DA 4KOTA 1QSOA 1VHSA 4KOSA 2H5MA 3I3GA 4AB7A 3EC4A 1QSNA 4FD4A 2ZW5A 4XPLA 3S6GA 4KUBA 5H86A
chains in the Genus database with same CATH superfamily
2Z3PA 3EY5A 2EUIA 2V8GA 3S9MA 4KOXA 3LWUA 4M6GA 4KZTA 3SI1A 3FVLA 2BUEA 4MBUA 4NGNA 2Q43A 2B4DB 2Q4ZA 2D4PA 3B3VA 2GU2A 2JBKA 4PXDA 3D7DA 4O23A 5JM6A 2OOTA 3GKRA 4AVBA 5H84A 2B58A 5F47A 4G1PA 4CAXA 4H6UA 3D67A 3H5ZA 4R87A 5LYLA 5LYDA 1CM0A 3IO1A 4R9MA 2PR1A 3F5BA 1ZG7A 2HUZA 3T90A 2GFQA 1S7LA 2I00A 5KTCA 3SI2A 1AMPA 5IX3A 4QUSA 2Q0YA 2ZENA 4CAFA 4MFLA 4U9ZA 1IICA 4L89A 2ZEMA 4CGPA 2Z3OA 4A38A 1M4GA 3PBBA 4JWPA 1YK3A 4K30A 4UBRA 3KKWA 2J8RA 5JH9A 4X5KA 4OIWA 4MFPA 4B10A 3FRMA 4DJLA 1LRZA 1AUGA 1VKCA 3LD2A 4ORFA 1DE4C 4ZBGA 2FXFA 3B2YA 4WWVA 3WT4A 5HVHA 3CXQA 4PXCA 3CPAA 1FT7A 4R7MA 4KSAA 2PJ2A 4KLVA 4A39A 3NH5A 2A4NA 2PCUA 4F0YA 1RO5A 4KOVA 1H8LA 3IJ3A 3D7GA 3FX6A 4P4EA 4RN7A 2JBJA 2WYRA 1XEBA 3NE7A 1OBRA 2Q4VA 4CYNA 2R98A 5GCNA 1HEEA 3B7IA 4E8OA 2OZGA 2Q7SA 2POKA 2PDOA 4R76A 4AG7A 2FL4A 2G3AA 1QSRA 2FVGA 2Z3KA 3MGDA 4ZY0A 1BO4A 4MHDA 2OH1A 1R57A 2CNSA 3BI1A 1MK4A 2J9AA 3KI9A 5G22A 1XBUA 5J1QA 3SI0A 4MY0A 3QB8A 4M3SA 4U5YA 4CAWA 2YNDA 3K9TA 5LYFA 4TNUA 4AG9A 3KQZA 4UCPA 2R1IA 2EWBA 4UEZA 1Q2DA 5F09A 3WC5A 4CYOA 3TTHA 2ANPA 1LCPA 2WZNA 1HDQA 3FNCA 4MHZA 5F46A 4MCQA 3FEDA 4MCPA 2NSMA 5DWMA 1QSMA 2ZOGA 4OP4A 1ZLHA 4P4IA 4UF4A 5CNPA 2G9DA 4J3GA 2EK8A 4QB9A 3PB8X 3IWGA 3C26A 1OZPA 1TXRA 2B3UA 2PIZA 1IOIA 2Q4YA 3DGVA 3KL9A 2BCOA 1HDUA 3LODA 4Y49B 3SJXA 1Y0YA 2AFWA 2YNCC 4KLWA 4NGMA 4H6ZA 4L8AA 4A30A 3PB9X 4JXRA 3R9EA 4PXEA 2ATRA 4NJQA 1Q7LA 3R95A 1LFWA 3GY9A 2JDDA 3WC6A 4CGOA 2G3TA 2ZEEA 4M6HA 4JJXA 4JXQA 5HXDA 3TCVA 2AJ6A 2PJ6A 4B5PA 1PUAA 4CYPA 2ZEGA 3DLJA 3T8WA 2GANA 1BAVA 4MFJA 3KHXA 3ZJ0A 3GYAA 1ZG9A 3D7FA 1F2PA 3CXSA 2FIWA 2AFSA 1CPSA 2DXQA 3CZXA 1QQ9A 2I79A 3H8FA 2BL1A 4UEFA 2ZEHA 4Y49C 3F8KA 2HV2A 4F0XA 1CBXA 2P6GA 2ZW6A 3RYOA 5IB9A 2R7HA 1S5KA 4B5PB 4PXBA 4B13A 1F2OA 1IB1E 2JEWA 3GIUA 1MJBA 5H86A 4OLLA 2F7VA 3TOBA 2PR8A 5G21A 1NSAA 2P6FA 2VQYA 1CP7A 1VGYA 3PB6X 2REEA 4KSFA 3JTKA 3ISXA 4H2KA 4B11A 3B8GA 2Q44A 3KASA 1PYTB 4M6IA 4B12A 1YW6A 3KQXA 3KZWA 1Z8WA 3ISZA 4ZYQA 3N5FA 3SXOA 3T9YA 3WABA 1IY7A 3SHPA 1V0CA 1Y7RA 4UWJA 1Y7EA 2ZEPA 4FWUA 5I4MA 4QVTA 1A2ZA 2F8HA 2REFA 4TWEA 1YLOA 2RC4A 2CIJA 4C2ZA 1YREA 2VZZA 2JEVA 4IK2A 2V8HA 4MI4A 4NJRA 2DF5A 4UIAA 4XPDB 1AYEA 4P10A 1IIDA 1ARMA 3D66A 1P4NA 4KVOE 1B6BA 2PJCA 2VL1A 2GIVA 4A31A 2C6GA 5ELYA 4CRZB 3FXTA 3TX8A 4ZY1A 2VEZA 3G3SA 4RS2A 1PCAA 3N7ZA 5CPAA 3VH9A 1S7FA 4UEEA 3D68A 4EVYA 2ZEFA 1XMBA 2Z3LA 1Q2CA 2F5IA 4UCNA 1L0CA 1XOVA 4P4BA 5EC4A 2PVVA 1K4JA 3PZJA 1X10A 3FEEA 4LX9A 1ON0A 4MRIA 2O4HA 4WJBA 3TO9A 4OMEA 2PVWA 5AG5A 4BMHA 4XPDC 2ZW4A 2GLFA 4P45A 4B5OA 4X8IA 4YWYA 3HLPA 2Y0MA 4ZX9A 4C2XA 4OC0A 2Q04A 5I0CA 2B3VA 4Z65A 5AGEA 2QYVA 1Y9WA 2C6PA 4E2AA 2J8NA 2EVNA 2PJ1A 1N71A 1ARLA 1Z4EA 4MXUA 1I21A 4EFDA 2O28A 4HNWB 1IU8A 2CF4A 2OB0A 3W6SA 4B14A 2PJ0A 3G8WA 4YFJA 1EE3P 4C7HA 4R8FA 3IIBA 4R3KA 2XEGA 4KS9A 4PQAA 4XPKA 1QSTA 2QJ8A 2RFHA 2PRQA 3RZAA 3FBUA 2Z11A 1JWQA 3I1UA 2ZELA 3E0KA 5LYIA 1FNOA 1J4JA 4MCRA 2V8DA 3S6KA 2G0BA 2FCKA 3P2HA 2ARHA 1M44A 2AE6A 2CTCA 4KORA 2ZEDA 1R3NA 1Z9UA 2C27A 2PJ3A 2VI7A 4PSWA 5A27A 1I12A 3TOAA 1ELMP 4KVXA 1Y9KA 4AVCA 5AG4A 4X3RA 5EBVA 2ZPAA 1CPXA 4CAEA 2B5GA 3L2NA 4LUAA 2DPTA 4R3LA 2V8VA 3IU2A 5D8NA 4A37A 2GLJA 4KOUA 5C88A 1BOBA 6CPAA 1VHEA 3S9NA 2FE7A 1YMEA 1XMTA 3FF3A 2OZUA 4FD6A 1XFOA 1KZFA 1CP6A 1Q2YA 4OKOA 1IOFA 2B5GB 1PU9A 3TO6A 1NMTA 4H89A 4X2TA 2X7BA 2BSWA 4OC5A 2CNMA 4MJ8A 1BLLE 3FIXA 3NFZA 4Q7AA 1TKJA 3EXNA 4OC2A 3A9LA 2PJ8A 3DR6A 3SJEA 4NEXA 4ZI6A 3FECA 2ZOFA 3IFEA 2PJ5A 1TIQA 2NMTA 4IUSA 4MFZA 4OADA 3EFAA 4RUHA 5K8OA 4KOYA 3K2KA 4GM5A 1SQHA 4NGRA 4CRYB 2PRBA 3TFYA 4II9A 4UIBA 2EO8A 3GB0A 1IYKA 1KUVA 4MHYA 3V8IA 3PFEA 4XNHB 2OZHA 4HNYB 3WR7A 4A32A 3QNVA 1KUXA 4W9YA 3S6HA 4HPSA 1NSLA 3D8PA 5K8PA 5A28A 4QBJA 4P4JA 5K8MA 5C82A 1LAPA 1F57A 3KHZA 1ZG8A 3R9FA 2V77A 4JYWA 4P44A 5HMNA 2BO9A 2ZEOA 3F0AA 4KUAA 8CPAA 3VWEA 1S7NA 1CG2A 4CYQA 4MY3A 4JD6A 4NGSA 1IYLA 3RO0A 2VZYA 4NGTA 2R8VA 1JQGA 1YGHA 2Z10A 3B3TA 1B87A 3QAYA 2CTBA 4CGLA 2PQ8A 3IGRA 2QECA 3IWEA 4F9UA 4B6ZA 2AFOA 4UFVA 2YNEA 3GUXA 3I9SA 3H8EA 1TF8A 1Y0RA 3SJGA 3P2FA 2I3CA 4XNHC 3V7ZA 1RXTA 3KR5A 1M4DA 2IQ6A 5THWA 4FBEA 4LQ6A 2P0WA 5HVGA 2ZXVA 2EK9A 5F48A 4AXVA 4U9YA 2PE3A 3ZZIA 3B3WA 2OR4A 4OIDA 4Q36A 2WPXA 3RAMA 1WWZA 3TC8A 4NSQA 4P6YA 4JZ0A 3CPXA 4KSIA 3DR8A 4Q38A 3PB7X 1FY7A 3D2MA 1MJ9A 3D7HA 2C6CA 2PJBA 2AFZA 1XJOA 4IHMA 2PJ7A 3GLJA 5HH1A 2B4DA 4M85A 4MHNA 3D2PA 4BINA 5E96A 3FH4A 1GHEA 3V38A 4OC1A 5LRGA 2BEIA 3D3SA 1UFHA 2YGWA 4MFQA 2XEIA 1YX0A 2DEAA 4ZY2A 4C2YA 3PFOA 1ELLP 1M4IA 1S7KA 1XIXA 3JVNA 4NCZA 3EO4A 1R43A 3B3SA 3JRUA 1Z8TA 2WPWA 3RNZA 4HKFA 1S3ZA 1S60A 1XE4A 1CX8A 4OAEA 4P4DA 3W6XA 4BBHA 1NE9A 2P6EA 3DDDA 3BI0A 3OWCA 4FD5A 1XRYA 4NF1A 4GXHA 3SJFA 3FJUA 4C7IA 5IV0A 2QVPA 3S6FA 1WK4A 3FB3A 5JGFA 2CNTA 3MRUA 5ISVA 2Z3NA 2PJAA 5IB0A 2WSAA 4YRHA 3K9UA 4QC6A 4NGPA 5HVFA 4NFRA 3R9GA 1YVKA 3BXMA 1BPNA 2FT0A 3MN8A 2EBJA 4A95A 5KTAA 3CXPA 4KVME 1TKFA 5FVJA 3NA6A 1P0HA 3PGPA 3TE4A 2HQYA 3PRTA 3R1KA 4RI1A 3CDXA 3KR4A 3LMSA 3JUWA 4ZX8A 2VXKA 1UWYA 3R96A 2ZW7A 5KTDA 2VBQA 3QAHA 4UFWA 3IWWA 4CPAA 4FUUA 4KOWA 5CBMA 1CJWA 1LOKA 5G1ZA 4PK3A 4C68A 2AFXA 5DWNA 2BOAA 1ZO0A 5G20A 1LANA 1KUYA 4F9VA 3BHXA 1RTQA 2XEFA 3NH8A 3H8GA 2GREA 4PK2A 1Z5RA 2YNCA 2B4BA 2RB7A 2Z0ZA 1VHOA 4MMOA 2QIRA 4CAVA 4F8ZA 4A94A 5JPHA 2Z3MA 4R6TA 3FYNA 4AVAA 5J8CA 1X12A 3IC1A 3IEHA 4FD7A 4PSXA 3BJ7A 2FIAA 4MCSA 3DSBA 4E0AA 2PJ4A 4EMEA 2CY2A 2HC9A 3PP9A 2KCWA 1U6MA 1XF8A 2AFUA 1MJAA 3KGQA 1Z4RA 5EMIA 1GYTA 1VIXA 3B35A 4YGOA 4ONUA 2PIYA 4A2ZA 4IF5A 2WUUA 4ZGYB 3FMCA 5BWAB 2PSWA 1IGBA 1TF9A 3D4UA 3H4QA 5AG6A 4CS0B 5J8FA 4MFKA 3WC7A 5DS0A 4HNXB 2OU2A 2HB6A 1Z2LA 2FS5A 4OC4A 1TKHA 4DYOA 2IMOA 4BD9A 3BLNA 5LRKA 2GE3A 1Z8LA 2PJ9A 3NE8A 2XEJA 1BPMA 2JDCA 4JLYA 2JLMA 4NXYA 4DUKA 2O53A 2K5TA 2J8MA 2IL4A 2C1CA 3DNSA 1YLEA 1YW4A 5JQ4A 4CGNA 4GS4A 3W91A 3TT2A 3VWDA 4FAIA 4UA3A 4PV6A 3HUVA 2DPSA 4UCMA 4ONWA 2Q51A 2ABZA 2IJZA 1I1DA 3TO7A 3PB4X 3B3CA 5LRJA 4EWTA 4UFXA 1YVOA 3LACA 5F49A 1DTDA 2PC1A 5D29A 4A33A 4UWIA 4CGMA 1KWMA 4NGQA 4LQGA 2Q7BA 4K3NA 4MHPA 4F6AA 1ZLIA 2AFMA 7CPAA 2CXAA 5AG7A 4YU9A 4I49A 4PPZA 2D4OA 4DNCA 3S9LA 2QMLA 3SXNA 3BJ8A 4P4FA 2FSRA 3VATA 3NH4A 4R57A 1YR0A 3VARA 1YSJA 3RBUA 3UY5A 1LAMA 1M1DA 3PEIA 4KOTA 5K8NA 1QSOA 1VHSA 4KOSA 1M4LA 4OC3A 4IAVA 2H5MA 3I3GA 1QMUA 1YQEA 4AB7A 3EC4A 1QSNA 3PBEA 2ZW5A 4FD4A 2ODFA 4XPLA 3S6GA 1Z8XA 3IU1A 4KUBA 2NYQA 3CT9A
chains in the Genus database with same CATH topology
2Z3PA 3EY5A 2EUIA 4KOXA 4KZTA 2BUEA 4MBUA 2B4DB 2D4PA 3GKRA 4AVBA 5H84A 2B58A 5F47A 4CAXA 4H6UA 3H5ZA 4R87A 1CM0A 4R9MA 2PR1A 3F5BA 2HUZA 3T90A 1S7LA 2I00A 5KTCA 5IX3A 4QUSA 2Q0YA 4CAFA 4MFLA 4U9ZA 1IICA 4L89A 4CGPA 2Z3OA 1M4GA 4JWPA 1YK3A 4K30A 4UBRA 3KKWA 2J8RA 4X5KA 4MFPA 4B10A 3FRMA 1LRZA 1VKCA 4ZBGA 3LD2A 4ORFA 2FXFA 3CXQA 4KSAA 4KLVA 2A4NA 4F0YA 1RO5A 4KOVA 1XEBA 3NE7A 2Q4VA 4CYNA 2R98A 5GCNA 4E8OA 2OZGA 2PDOA 4AG7A 2FL4A 2G3AA 1QSRA 2Z3KA 3MGDA 1BO4A 4MHDA 2OH1A 1R57A 2CNSA 1MK4A 5G22A 4MY0A 3QB8A 4M3SA 4U5YA 4CAWA 2YNDA 4AG9A 4UCPA 2R1IA 1Q2DA 4CYOA 3TTHA 3FNCA 5F46A 5DWMA 1QSMA 5CNPA 4J3GA 4QB9A 3IWGA 3C26A 1OZPA 2Q4YA 2B3UA 3RYOA 3LODA 3SXOA 4Y49B 2YNCC 4KLWA 4H6ZA 4L8AA 4A30A 4JXRA 3R9EA 2ATRA 3R95A 3GY9A 4CGOA 2JDDA 2G3TA 4JJXA 4JXQA 3TCVA 2AJ6A 4B5PA 1PUAA 4CYPA 2GANA 4MFJA 3ZJ0A 3GYAA 3CXSA 2FIWA 2DXQA 2I79A 4F0XA 2BL1A 4Y49C 3F8KA 2HV2A 2P6GA 2ZW6A 2R7HA 1S5KA 4B5PB 4B13A 1IB1E 1MJBA 4OLLA 3TOBA 2PR8A 5G21A 2P6FA 2VQYA 4KSFA 2REEA 4B12A 3JTKA 4B11A 3B8GA 2Q44A 3T9YA 3SHPA 1V0CA 1Y7RA 4UWJA 4QVTA 2REFA 2RC4A 4C2ZA 1YREA 2VZZA 2JEVA 4MI4A 4XPDB 1IIDA 1P4NA 4KVOE 1B6BA 2GIVA 4A31A 4CRZB 3FXTA 2VEZA 3G3SA 4RS2A 3N7ZA 1S7FA 4EVYA 2Z3LA 1Q2CA 2F5IA 4UCNA 1L0CA 5EC4A 1K4JA 3PZJA 4LX9A 1ON0A 3TO9A 5AG5A 4BMHA 4XPDC 2ZW4A 4B5OA 4C2XA 2Y0MA 2Q04A 5I0CA 2B3VA 5AGEA 1Y9WA 4E2AA 2J8NA 2EVNA 1N71A 1Z4EA 1I21A 2O28A 4HNWB 2OB0A 3W6SA 4B14A 3G8WA 4YFJA 4C7HA 4R3KA 4KS9A 4XPKA 1QSTA 3FBUA 2Z11A 3E0KA 1J4JA 3S6KA 2G0BA 2FCKA 3P2HA 2ARHA 1M44A 2AE6A 4KORA 1Z9UA 2C27A 5A27A 4PSWA 2VI7A 1I12A 3TOAA 4KVXA 1Y9KA 4AVCA 5AG4A 5EBVA 2ZPAA 4CAEA 2B5GA 4LUAA 2DPTA 4R3LA 3IU2A 4KOUA 5C88A 1BOBA 2FE7A 1XMTA 2OZUA 4FD6A 1KZFA 1Q2YA 2B5GB 1PU9A 3TO6A 1NMTA 4H89A 2X7BA 2BSWA 2CNMA 4MJ8A 3FIXA 3EXNA 3A9LA 3DR6A 4NEXA 1TIQA 2NMTA 4IUSA 4MFZA 4OADA 3EFAA 4KOYA 4II9A 1SQHA 3TFYA 4CRYB 2PRBA 1IYKA 1KUVA 3V8IA 4A32A 4XNHB 2OZHA 4HNYB 3WR7A 1KUXA 3S6HA 1NSLA 3D8PA 5A28A 4QBJA 5C82A 3R9FA 5HMNA 3F0AA 4KUAA 3VWEA 1S7NA 4CYQA 4MY3A 4JD6A 1IYLA 2VZYA 4CGLA 2R8VA 1YGHA 2Z10A 1B87A 2PQ8A 3IGRA 2QECA 3IWEA 4UFVA 2YNEA 3I9SA 3P2FA 4XNHC 1RXTA 1M4DA 2P0WA 2ZXVA 5F48A 4U9YA 3ZZIA 4Q36A 2WPXA 1WWZA 4NSQA 3DR8A 4Q38A 1FY7A 3D2MA 1MJ9A 5HH1A 2B4DA 4M85A 3D2PA 5E96A 1GHEA 2BEIA 3D3SA 1UFHA 2YGWA 4MFQA 1YX0A 4C2YA 1M4IA 1S7KA 1XIXA 3JVNA 4NCZA 3EO4A 2WPWA 4HKFA 1S3ZA 1S60A 1XE4A 4OAEA 3W6XA 4BBHA 1NE9A 2P6EA 3DDDA 4FD5A 3OWCA 4NF1A 4C7IA 5IV0A 3S6FA 1WK4A 3FB3A 5ISVA 2CNTA 2Z3NA 5IB0A 2WSAA 4YRHA 3K9UA 4QC6A 3R9GA 1YVKA 2FT0A 4A95A 5KTAA 3CXPA 4KVME 5FVJA 1P0HA 3PGPA 3TE4A 2HQYA 3R1KA 4RI1A 3JUWA 2VXKA 3R96A 2ZW7A 5KTDA 2VBQA 3QAHA 4UFWA 4KOWA 1CJWA 5G1ZA 4PK3A 4C68A 5DWNA 1ZO0A 5G20A 1KUYA 4PK2A 2YNCA 2B4BA 2Z0ZA 2QIRA 4CAVA 5JPHA 2Z3MA 4AVAA 3FYNA 5J8CA 4FD7A 4PSXA 3BJ7A 2FIAA 3DSBA 4E0AA 2CY2A 3PP9A 2KCWA 1U6MA 1XF8A 1MJAA 1Z4RA 4YGOA 4ONUA 4A2ZA 4IF5A 2WUUA 4ZGYB 5BWAB 2PSWA 3H4QA 5AG6A 4CS0B 5J8FA 4MFKA 4HNXB 2OU2A 2FS5A 3BLNA 2GE3A 4JLYA 2JDCA 2JLMA 4NXYA 2K5TA 2J8MA 2IL4A 3DNSA 1YLEA 5JQ4A 4CGNA 4GS4A 3W91A 3TT2A 3VWDA 4UA3A 4PV6A 2DPSA 4UCMA 1I1DA 3TO7A 4UFXA 1YVOA 5F49A 4A33A 2PC1A 4UWIA 4CGMA 2Q7BA 4F6AA 2CXAA 5AG7A 4I49A 2D4OA 4DNCA 2QMLA 3SXNA 3BJ8A 2FSRA 4R57A 1YR0A 3UY5A 1M1DA 4KOTA 1QSOA 1VHSA 4KOSA 2H5MA 3I3GA 4AB7A 3EC4A 1QSNA 4FD4A 2ZW5A 4XPLA 3S6GA 3IU1A 4KUBA 5H86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EY5 A;  2EUI A;  4KOX A;  4KZT A;  2BUE A;  4MBU A;  2B4D B;  2D4P A;  3GKR A;  4AVB A;  5H84 A;  2B58 A;  5F47 A;  4CAX A;  4H6U A;  4R87 A;  1CM0 A;  4R9M A;  2PR1 A;  3F5B A;  2HUZ A;  3T90 A;  1S7L A;  2I00 A;  5KTC A;  5IX3 A;  4QUS A;  2Q0Y A;  4U9Z A;  1IIC A;  4L89 A;  1M4G A;  4JWP A;  1YK3 A;  4K30 A;  4UBR A;  3KKW A;  2J8R A;  4X5K A;  3FRM A;  1LRZ A;  1VKC A;  4ZBG A;  3LD2 A;  4ORF A;  2FXF A;  3CXQ A;  4KLV A;  2A4N A;  4F0Y A;  1RO5 A;  4KOV A;  1XEB A;  3NE7 A;  2Q4V A;  2R98 A;  5GCN A;  4E8O A;  2OZG A;  2PDO A;  4AG7 A;  2FL4 A;  2G3A A;  1QSR A;  3MGD A;  1BO4 A;  4MHD A;  2OH1 A;  1R57 A;  2CNS A;  1MK4 A;  4MY0 A;  3QB8 A;  4M3S A;  4U5Y A;  4CAW A;  4AG9 A;  2R1I A;  1Q2D A;  3TTH A;  3FNC A;  5F46 A;  5DWM A;  1QSM A;  5CNP A;  4J3G A;  4QB9 A;  3IWG A;  3C26 A;  1OZP A;  2Q4Y A;  2B3U A;  3RYO A;  3LOD A;  3SXO A;  4Y49 B;  4KLW A;  4H6Z A;  4L8A A;  4JXR A;  3R9E A;  2ATR A;  3R95 A;  3GY9 A;  2JDD A;  2G3T A;  4JJX A;  4JXQ A;  3TCV A;  2AJ6 A;  4B5P A;  1PUA A;  2GAN A;  3ZJ0 A;  3GYA A;  3CXS A;  2FIW A;  2DXQ A;  2I79 A;  2BL1 A;  4Y49 C;  3F8K A;  2HV2 A;  2P6G A;  2ZW6 A;  2R7H A;  1S5K A;  4B5P B;  1IB1 E;  1MJB A;  4OLL A;  3TOB A;  2PR8 A;  2P6F A;  2VQY A;  2REE A;  3B8G A;  2Q44 A;  3T9Y A;  3SHP A;  1V0C A;  1Y7R A;  4UWJ A;  4QVT A;  2REF A;  2RC4 A;  1YRE A;  2VZZ A;  2JEV A;  4MI4 A;  4XPD B;  1IID A;  1P4N A;  4KVO E;  1B6B A;  2GIV A;  4CRZ B;  3FXT A;  2VEZ A;  3G3S A;  4RS2 A;  3N7Z A;  1S7F A;  4EVY A;  1Q2C A;  2F5I A;  1L0C A;  5EC4 A;  1K4J A;  3PZJ A;  4LX9 A;  1ON0 A;  3TO9 A;  4BMH A;  4XPD C;  2ZW4 A;  4B5O A;  2Y0M A;  2Q04 A;  5I0C A;  2B3V A;  1Y9W A;  4E2A A;  2J8N A;  2EVN A;  1N71 A;  1Z4E A;  1I21 A;  2O28 A;  4HNW B;  2OB0 A;  3W6S A;  3G8W A;  4YFJ A;  4R3K A;  4XPK A;  1QST A;  3FBU A;  2Z11 A;  3E0K A;  1J4J A;  3S6K A;  2G0B A;  2FCK A;  3P2H A;  2ARH A;  1M44 A;  2AE6 A;  4KOR A;  1Z9U A;  2C27 A;  4PSW A;  2VI7 A;  1I12 A;  3TOA A;  4KVX A;  1Y9K A;  4AVC A;  5EBV A;  2ZPA A;  2B5G A;  4LUA A;  4R3L A;  4KOU A;  5C88 A;  1BOB A;  2FE7 A;  1XMT A;  2OZU A;  4FD6 A;  1KZF A;  1Q2Y A;  2B5G B;  1PU9 A;  3TO6 A;  1NMT A;  4H89 A;  2X7B A;  2BSW A;  2CNM A;  4MJ8 A;  3FIX A;  3EXN A;  3DR6 A;  4NEX A;  1TIQ A;  2NMT A;  4IUS A;  4OAD A;  3EFA A;  4KOY A;  4II9 A;  1SQH A;  3TFY A;  4CRY B;  2PRB A;  1IYK A;  1KUV A;  3V8I A;  4XNH B;  2OZH A;  4HNY B;  3WR7 A;  1KUX A;  3S6H A;  1NSL A;  3D8P A;  4QBJ A;  5C82 A;  3R9F A;  5HMN A;  3F0A A;  4KUA A;  3VWE A;  1S7N A;  4MY3 A;  4JD6 A;  1IYL A;  2VZY A;  2R8V A;  1YGH A;  2Z10 A;  1B87 A;  2PQ8 A;  3IGR A;  2QEC A;  3I9S A;  3P2F A;  4XNH C;  1RXT A;  1M4D A;  2P0W A;  2ZXV A;  5F48 A;  4U9Y A;  3ZZI A;  2WPX A;  1WWZ A;  4NSQ A;  3DR8 A;  1FY7 A;  3D2M A;  1MJ9 A;  5HH1 A;  2B4D A;  4M85 A;  3D2P A;  5E96 A;  1GHE A;  2BEI A;  3D3S A;  1UFH A;  1YX0 A;  1M4I A;  1S7K A;  1XIX A;  3JVN A;  4NCZ A;  3EO4 A;  2WPW A;  4HKF A;  1S3Z A;  1S60 A;  1XE4 A;  4OAE A;  3W6X A;  1NE9 A;  2P6E A;  3DDD A;  4FD5 A;  3OWC A;  4NF1 A;  5IV0 A;  3S6F A;  1WK4 A;  3FB3 A;  5ISV A;  2CNT A;  5IB0 A;  4YRH A;  3K9U A;  4QC6 A;  3R9G A;  1YVK A;  2FT0 A;  5KTA A;  3CXP A;  4KVM E;  5FVJ A;  1P0H A;  3PGP A;  3TE4 A;  2HQY A;  3R1K A;  4RI1 A;  3JUW A;  2VXK A;  3R96 A;  2ZW7 A;  5KTD A;  2VBQ A;  3QAH A;  4KOW A;  1CJW A;  4PK3 A;  5DWN A;  1KUY A;  4PK2 A;  2B4B A;  2Z0Z A;  2QIR A;  4CAV A;  5JPH A;  4AVA A;  5J8C A;  3FYN A;  4FD7 A;  4PSX A;  3BJ7 A;  2FIA A;  3DSB A;  4E0A A;  2CY2 A;  3PP9 A;  2KCW A;  1U6M A;  1XF8 A;  1MJA A;  1Z4R A;  4YGO A;  4ONU A;  4IF5 A;  2PSW A;  3H4Q A;  4CS0 B;  5J8F A;  4HNX B;  2OU2 A;  2FS5 A;  3BLN A;  2GE3 A;  4JLY A;  2JDC A;  2JLM A;  4NXY A;  2K5T A;  2J8M A;  2IL4 A;  3DNS A;  1YLE A;  5JQ4 A;  4GS4 A;  3W91 A;  3TT2 A;  3VWD A;  4UA3 A;  4PV6 A;  1I1D A;  3TO7 A;  1YVO A;  5F49 A;  2PC1 A;  4UWI A;  2Q7B A;  4F6A A;  4I49 A;  2D4O A;  4DNC A;  2QML A;  3SXN A;  3BJ8 A;  2FSR A;  4R57 A;  1YR0 A;  3UY5 A;  1M1D A;  4KOT A;  1QSO A;  1VHS A;  4KOS A;  2H5M A;  3I3G A;  4AB7 A;  3EC4 A;  1QSN A;  4FD4 A;  2ZW5 A;  4XPL A;  3S6G A;  4KUB A;  5H86 A; 
#chains in the Genus database with same CATH topology
 2Z3P A;  3EY5 A;  2EUI A;  2V8G A;  3S9M A;  4KOX A;  3LWU A;  4M6G A;  4KZT A;  3SI1 A;  3FVL A;  2BUE A;  4MBU A;  4NGN A;  2Q43 A;  2B4D B;  2Q4Z A;  2D4P A;  3B3V A;  2GU2 A;  2JBK A;  4PXD A;  3D7D A;  4O23 A;  5JM6 A;  2OOT A;  3GKR A;  4AVB A;  5H84 A;  2B58 A;  5F47 A;  4G1P A;  4CAX A;  4H6U A;  3D67 A;  3H5Z A;  4R87 A;  5LYL A;  5LYD A;  1CM0 A;  3IO1 A;  4R9M A;  2PR1 A;  3F5B A;  1ZG7 A;  2HUZ A;  3T90 A;  2GFQ A;  1S7L A;  2I00 A;  5KTC A;  3SI2 A;  1AMP A;  5IX3 A;  4QUS A;  2Q0Y A;  2ZEN A;  4CAF A;  4MFL A;  4U9Z A;  1IIC A;  4L89 A;  2ZEM A;  4CGP A;  2Z3O A;  4A38 A;  1M4G A;  3PBB A;  4JWP A;  1YK3 A;  4K30 A;  4UBR A;  3KKW A;  2J8R A;  5JH9 A;  4X5K A;  4OIW A;  4MFP A;  4B10 A;  3FRM A;  4DJL A;  1LRZ A;  1AUG A;  1VKC A;  3LD2 A;  4ORF A;  1DE4 C;  4ZBG A;  2FXF A;  3B2Y A;  4WWV A;  3WT4 A;  5HVH A;  3CXQ A;  4PXC A;  3CPA A;  1FT7 A;  4R7M A;  4KSA A;  2PJ2 A;  4KLV A;  4A39 A;  3NH5 A;  2A4N A;  2PCU A;  4F0Y A;  1RO5 A;  4KOV A;  1H8L A;  3IJ3 A;  3D7G A;  3FX6 A;  4P4E A;  4RN7 A;  2JBJ A;  2WYR A;  1XEB A;  3NE7 A;  1OBR A;  2Q4V A;  4CYN A;  2R98 A;  5GCN A;  1HEE A;  3B7I A;  4E8O A;  2OZG A;  2Q7S A;  2POK A;  2PDO A;  4R76 A;  4AG7 A;  2FL4 A;  2G3A A;  1QSR A;  2FVG A;  2Z3K A;  3MGD A;  4ZY0 A;  1BO4 A;  4MHD A;  2OH1 A;  1R57 A;  2CNS A;  3BI1 A;  1MK4 A;  2J9A A;  3KI9 A;  5G22 A;  1XBU A;  5J1Q A;  3SI0 A;  4MY0 A;  3QB8 A;  4M3S A;  4U5Y A;  4CAW A;  2YND A;  3K9T A;  5LYF A;  4TNU A;  4AG9 A;  3KQZ A;  4UCP A;  2R1I A;  2EWB A;  4UEZ A;  1Q2D A;  5F09 A;  3WC5 A;  4CYO A;  3TTH A;  2ANP A;  1LCP A;  2WZN A;  1HDQ A;  3FNC A;  4MHZ A;  5F46 A;  4MCQ A;  3FED A;  4MCP A;  2NSM A;  5DWM A;  1QSM A;  2ZOG A;  4OP4 A;  1ZLH A;  4P4I A;  4UF4 A;  5CNP A;  2G9D A;  4J3G A;  2EK8 A;  4QB9 A;  3PB8 X;  3IWG A;  3C26 A;  1OZP A;  1TXR A;  2B3U A;  2PIZ A;  1IOI A;  2Q4Y A;  3DGV A;  3KL9 A;  2BCO A;  1HDU A;  3LOD A;  4Y49 B;  3SJX A;  1Y0Y A;  2AFW A;  2YNC C;  4KLW A;  4NGM A;  4H6Z A;  4L8A A;  4A30 A;  3PB9 X;  4JXR A;  3R9E A;  4PXE A;  2ATR A;  4NJQ A;  1Q7L A;  3R95 A;  1LFW A;  3GY9 A;  2JDD A;  3WC6 A;  4CGO A;  2G3T A;  2ZEE A;  4M6H A;  4JJX A;  4JXQ A;  5HXD A;  3TCV A;  2AJ6 A;  2PJ6 A;  4B5P A;  1PUA A;  4CYP A;  2ZEG A;  3DLJ A;  3T8W A;  2GAN A;  1BAV A;  4MFJ A;  3KHX A;  3ZJ0 A;  3GYA A;  1ZG9 A;  3D7F A;  1F2P A;  3CXS A;  2FIW A;  2AFS A;  1CPS A;  2DXQ A;  3CZX A;  1QQ9 A;  2I79 A;  3H8F A;  2BL1 A;  4UEF A;  2ZEH A;  4Y49 C;  3F8K A;  2HV2 A;  4F0X A;  1CBX A;  2P6G A;  2ZW6 A;  3RYO A;  5IB9 A;  2R7H A;  1S5K A;  4B5P B;  4PXB A;  4B13 A;  1F2O A;  1IB1 E;  2JEW A;  3GIU A;  1MJB A;  5H86 A;  4OLL A;  2F7V A;  3TOB A;  2PR8 A;  5G21 A;  1NSA A;  2P6F A;  2VQY A;  1CP7 A;  1VGY A;  3PB6 X;  2REE A;  4KSF A;  3JTK A;  3ISX A;  4H2K A;  4B11 A;  3B8G A;  2Q44 A;  3KAS A;  1PYT B;  4M6I A;  4B12 A;  1YW6 A;  3KQX A;  3KZW A;  1Z8W A;  3ISZ A;  4ZYQ A;  3N5F A;  3SXO A;  3T9Y A;  3WAB A;  1IY7 A;  3SHP A;  1V0C A;  1Y7R A;  4UWJ A;  1Y7E A;  2ZEP A;  4FWU A;  5I4M A;  4QVT A;  1A2Z A;  2F8H A;  2REF A;  4TWE A;  1YLO A;  2RC4 A;  2CIJ A;  4C2Z A;  1YRE A;  2VZZ A;  2JEV A;  4IK2 A;  2V8H A;  4MI4 A;  4NJR A;  2DF5 A;  4UIA A;  4XPD B;  1AYE A;  4P10 A;  1IID A;  1ARM A;  3D66 A;  1P4N A;  4KVO E;  1B6B A;  2PJC A;  2VL1 A;  2GIV A;  4A31 A;  2C6G A;  5ELY A;  4CRZ B;  3FXT A;  3TX8 A;  4ZY1 A;  2VEZ A;  3G3S A;  4RS2 A;  1PCA A;  3N7Z A;  5CPA A;  3VH9 A;  1S7F A;  4UEE A;  3D68 A;  4EVY A;  2ZEF A;  1XMB A;  2Z3L A;  1Q2C A;  2F5I A;  4UCN A;  1L0C A;  1XOV A;  4P4B A;  5EC4 A;  2PVV A;  1K4J A;  3PZJ A;  1X10 A;  3FEE A;  4LX9 A;  1ON0 A;  4MRI A;  2O4H A;  4WJB A;  3TO9 A;  4OME A;  2PVW A;  5AG5 A;  4BMH A;  4XPD C;  2ZW4 A;  2GLF A;  4P45 A;  4B5O A;  4X8I A;  4YWY A;  3HLP A;  2Y0M A;  4ZX9 A;  4C2X A;  4OC0 A;  2Q04 A;  5I0C A;  2B3V A;  4Z65 A;  5AGE A;  2QYV A;  1Y9W A;  2C6P A;  4E2A A;  2J8N A;  2EVN A;  2PJ1 A;  1N71 A;  1ARL A;  1Z4E A;  4MXU A;  1I21 A;  4EFD A;  2O28 A;  4HNW B;  1IU8 A;  2CF4 A;  2OB0 A;  3W6S A;  4B14 A;  2PJ0 A;  3G8W A;  4YFJ A;  1EE3 P;  4C7H A;  4R8F A;  3IIB A;  4R3K A;  2XEG A;  4KS9 A;  4PQA A;  4XPK A;  1QST A;  2QJ8 A;  2RFH A;  2PRQ A;  3RZA A;  3FBU A;  2Z11 A;  1JWQ A;  3I1U A;  2ZEL A;  3E0K A;  5LYI A;  1FNO A;  1J4J A;  4MCR A;  2V8D A;  3S6K A;  2G0B A;  2FCK A;  3P2H A;  2ARH A;  1M44 A;  2AE6 A;  2CTC A;  4KOR A;  2ZED A;  1R3N A;  1Z9U A;  2C27 A;  2PJ3 A;  2VI7 A;  4PSW A;  5A27 A;  1I12 A;  3TOA A;  1ELM P;  4KVX A;  1Y9K A;  4AVC A;  5AG4 A;  4X3R A;  5EBV A;  2ZPA A;  1CPX A;  4CAE A;  2B5G A;  3L2N A;  4LUA A;  2DPT A;  4R3L A;  2V8V A;  3IU2 A;  5D8N A;  4A37 A;  2GLJ A;  4KOU A;  5C88 A;  1BOB A;  6CPA A;  1VHE A;  3S9N A;  2FE7 A;  1YME A;  1XMT A;  3FF3 A;  2OZU A;  4FD6 A;  1XFO A;  1KZF A;  1CP6 A;  1Q2Y A;  4OKO A;  1IOF A;  2B5G B;  1PU9 A;  3TO6 A;  1NMT A;  4H89 A;  4X2T A;  2X7B A;  2BSW A;  4OC5 A;  2CNM A;  4MJ8 A;  1BLL E;  3FIX A;  3NFZ A;  4Q7A A;  1TKJ A;  3EXN A;  4OC2 A;  3A9L A;  2PJ8 A;  3DR6 A;  3SJE A;  4NEX A;  4ZI6 A;  3FEC A;  2ZOF A;  3IFE A;  2PJ5 A;  1TIQ A;  2NMT A;  4IUS A;  4MFZ A;  4OAD A;  3EFA A;  4RUH A;  5K8O A;  4KOY A;  3K2K A;  4GM5 A;  1SQH A;  4NGR A;  4CRY B;  2PRB A;  3TFY A;  4II9 A;  4UIB A;  2EO8 A;  3GB0 A;  1IYK A;  1KUV A;  4MHY A;  3V8I A;  3PFE A;  4XNH B;  2OZH A;  4HNY B;  3WR7 A;  4A32 A;  3QNV A;  1KUX A;  4W9Y A;  3S6H A;  4HPS A;  1NSL A;  3D8P A;  5K8P A;  5A28 A;  4QBJ A;  4P4J A;  5K8M A;  5C82 A;  1LAP A;  1F57 A;  3KHZ A;  1ZG8 A;  3R9F A;  2V77 A;  4JYW A;  4P44 A;  5HMN A;  2BO9 A;  2ZEO A;  3F0A A;  4KUA A;  8CPA A;  3VWE A;  1S7N A;  1CG2 A;  4CYQ A;  4MY3 A;  4JD6 A;  4NGS A;  1IYL A;  3RO0 A;  2VZY A;  4NGT A;  2R8V A;  1JQG A;  1YGH A;  2Z10 A;  3B3T A;  1B87 A;  3QAY A;  2CTB A;  4CGL A;  2PQ8 A;  3IGR A;  2QEC A;  3IWE A;  4F9U A;  4B6Z A;  2AFO A;  4UFV A;  2YNE A;  3GUX A;  3I9S A;  3H8E A;  1TF8 A;  1Y0R A;  3SJG A;  3P2F A;  2I3C A;  4XNH C;  3V7Z A;  1RXT A;  3KR5 A;  1M4D A;  2IQ6 A;  5THW A;  4FBE A;  4LQ6 A;  2P0W A;  5HVG A;  2ZXV A;  2EK9 A;  5F48 A;  4AXV A;  4U9Y A;  2PE3 A;  3ZZI A;  3B3W A;  2OR4 A;  4OID A;  4Q36 A;  2WPX A;  3RAM A;  1WWZ A;  3TC8 A;  4NSQ A;  4P6Y A;  4JZ0 A;  3CPX A;  4KSI A;  3DR8 A;  4Q38 A;  3PB7 X;  1FY7 A;  3D2M A;  1MJ9 A;  3D7H A;  2C6C A;  2PJB A;  2AFZ A;  1XJO A;  4IHM A;  2PJ7 A;  3GLJ A;  5HH1 A;  2B4D A;  4M85 A;  4MHN A;  3D2P A;  4BIN A;  5E96 A;  3FH4 A;  1GHE A;  3V38 A;  4OC1 A;  5LRG A;  2BEI A;  3D3S A;  1UFH A;  2YGW A;  4MFQ A;  2XEI A;  1YX0 A;  2DEA A;  4ZY2 A;  4C2Y A;  3PFO A;  1ELL P;  1M4I A;  1S7K A;  1XIX A;  3JVN A;  4NCZ A;  3EO4 A;  1R43 A;  3B3S A;  3JRU A;  1Z8T A;  2WPW A;  3RNZ A;  4HKF A;  1S3Z A;  1S60 A;  1XE4 A;  1CX8 A;  4OAE A;  4P4D A;  3W6X A;  4BBH A;  1NE9 A;  2P6E A;  3DDD A;  3BI0 A;  3OWC A;  4FD5 A;  1XRY A;  4NF1 A;  4GXH A;  3SJF A;  3FJU A;  4C7I A;  5IV0 A;  2QVP A;  3S6F A;  1WK4 A;  3FB3 A;  5JGF A;  2CNT A;  3MRU A;  5ISV A;  2Z3N A;  2PJA A;  5IB0 A;  2WSA A;  4YRH A;  3K9U A;  4QC6 A;  4NGP A;  5HVF A;  4NFR A;  3R9G A;  1YVK A;  3BXM A;  1BPN A;  2FT0 A;  3MN8 A;  2EBJ A;  4A95 A;  5KTA A;  3CXP A;  4KVM E;  1TKF A;  5FVJ A;  3NA6 A;  1P0H A;  3PGP A;  3TE4 A;  2HQY A;  3PRT A;  3R1K A;  4RI1 A;  3CDX A;  3KR4 A;  3LMS A;  3JUW A;  4ZX8 A;  2VXK A;  1UWY A;  3R96 A;  2ZW7 A;  5KTD A;  2VBQ A;  3QAH A;  4UFW A;  3IWW A;  4CPA A;  4FUU A;  4KOW A;  5CBM A;  1CJW A;  1LOK A;  5G1Z A;  4PK3 A;  4C68 A;  2AFX A;  5DWN A;  2BOA A;  1ZO0 A;  5G20 A;  1LAN A;  1KUY A;  4F9V A;  3BHX A;  1RTQ A;  2XEF A;  3NH8 A;  3H8G A;  2GRE A;  4PK2 A;  1Z5R A;  2YNC A;  2B4B A;  2RB7 A;  2Z0Z A;  1VHO A;  4MMO A;  2QIR A;  4CAV A;  4F8Z A;  4A94 A;  5JPH A;  2Z3M A;  4R6T A;  3FYN A;  4AVA A;  5J8C A;  1X12 A;  3IC1 A;  3IEH A;  4FD7 A;  4PSX A;  3BJ7 A;  2FIA A;  4MCS A;  3DSB A;  4E0A A;  2PJ4 A;  4EME A;  2CY2 A;  2HC9 A;  3PP9 A;  2KCW A;  1U6M A;  1XF8 A;  2AFU A;  1MJA A;  3KGQ A;  1Z4R A;  5EMI A;  1GYT A;  1VIX A;  3B35 A;  4YGO A;  4ONU A;  2PIY A;  4A2Z A;  4IF5 A;  2WUU A;  4ZGY B;  3FMC A;  5BWA B;  2PSW A;  1IGB A;  1TF9 A;  3D4U A;  3H4Q A;  5AG6 A;  4CS0 B;  5J8F A;  4MFK A;  3WC7 A;  5DS0 A;  4HNX B;  2OU2 A;  2HB6 A;  1Z2L A;  2FS5 A;  4OC4 A;  1TKH A;  4DYO A;  2IMO A;  4BD9 A;  3BLN A;  5LRK A;  2GE3 A;  1Z8L A;  2PJ9 A;  3NE8 A;  2XEJ A;  1BPM A;  2JDC A;  4JLY A;  2JLM A;  4NXY A;  4DUK A;  2O53 A;  2K5T A;  2J8M A;  2IL4 A;  2C1C A;  3DNS A;  1YLE A;  1YW4 A;  5JQ4 A;  4CGN A;  4GS4 A;  3W91 A;  3TT2 A;  3VWD A;  4FAI A;  4UA3 A;  4PV6 A;  3HUV A;  2DPS A;  4UCM A;  4ONW A;  2Q51 A;  2ABZ A;  2IJZ A;  1I1D A;  3TO7 A;  3PB4 X;  3B3C A;  5LRJ A;  4EWT A;  4UFX A;  1YVO A;  3LAC A;  5F49 A;  1DTD A;  2PC1 A;  5D29 A;  4A33 A;  4UWI A;  4CGM A;  1KWM A;  4NGQ A;  4LQG A;  2Q7B A;  4K3N A;  4MHP A;  4F6A A;  1ZLI A;  2AFM A;  7CPA A;  2CXA A;  5AG7 A;  4YU9 A;  4I49 A;  4PPZ A;  2D4O A;  4DNC A;  3S9L A;  2QML A;  3SXN A;  3BJ8 A;  4P4F A;  2FSR A;  3VAT A;  3NH4 A;  4R57 A;  1YR0 A;  3VAR A;  1YSJ A;  3RBU A;  3UY5 A;  1LAM A;  1M1D A;  3PEI A;  4KOT A;  5K8N A;  1QSO A;  1VHS A;  4KOS A;  1M4L A;  4OC3 A;  4IAV A;  2H5M A;  3I3G A;  1QMU A;  1YQE A;  4AB7 A;  3EC4 A;  1QSN A;  3PBE A;  2ZW5 A;  4FD4 A;  2ODF A;  4XPL A;  3S6G A;  1Z8X A;  3IU1 A;  4KUB A;  2NYQ A;  3CT9 A; 
#chains in the Genus database with same CATH homology
 2Z3P A;  3EY5 A;  2EUI A;  4KOX A;  4KZT A;  2BUE A;  4MBU A;  2B4D B;  2D4P A;  3GKR A;  4AVB A;  5H84 A;  2B58 A;  5F47 A;  4CAX A;  4H6U A;  3H5Z A;  4R87 A;  1CM0 A;  4R9M A;  2PR1 A;  3F5B A;  2HUZ A;  3T90 A;  1S7L A;  2I00 A;  5KTC A;  5IX3 A;  4QUS A;  2Q0Y A;  4CAF A;  4MFL A;  4U9Z A;  1IIC A;  4L89 A;  4CGP A;  2Z3O A;  1M4G A;  4JWP A;  1YK3 A;  4K30 A;  4UBR A;  3KKW A;  2J8R A;  4X5K A;  4MFP A;  4B10 A;  3FRM A;  1LRZ A;  1VKC A;  4ZBG A;  3LD2 A;  4ORF A;  2FXF A;  3CXQ A;  4KSA A;  4KLV A;  2A4N A;  4F0Y A;  1RO5 A;  4KOV A;  1XEB A;  3NE7 A;  2Q4V A;  4CYN A;  2R98 A;  5GCN A;  4E8O A;  2OZG A;  2PDO A;  4AG7 A;  2FL4 A;  2G3A A;  1QSR A;  2Z3K A;  3MGD A;  1BO4 A;  4MHD A;  2OH1 A;  1R57 A;  2CNS A;  1MK4 A;  5G22 A;  4MY0 A;  3QB8 A;  4M3S A;  4U5Y A;  4CAW A;  2YND A;  4AG9 A;  4UCP A;  2R1I A;  1Q2D A;  4CYO A;  3TTH A;  3FNC A;  5F46 A;  5DWM A;  1QSM A;  5CNP A;  4J3G A;  4QB9 A;  3IWG A;  3C26 A;  1OZP A;  2Q4Y A;  2B3U A;  3RYO A;  3LOD A;  3SXO A;  4Y49 B;  2YNC C;  4KLW A;  4H6Z A;  4L8A A;  4A30 A;  4JXR A;  3R9E A;  2ATR A;  3R95 A;  3GY9 A;  4CGO A;  2JDD A;  2G3T A;  4JJX A;  4JXQ A;  3TCV A;  2AJ6 A;  4B5P A;  1PUA A;  4CYP A;  2GAN A;  4MFJ A;  3ZJ0 A;  3GYA A;  3CXS A;  2FIW A;  2DXQ A;  2I79 A;  4F0X A;  2BL1 A;  4Y49 C;  3F8K A;  2HV2 A;  2P6G A;  2ZW6 A;  2R7H A;  1S5K A;  4B5P B;  4B13 A;  1IB1 E;  1MJB A;  4OLL A;  3TOB A;  2PR8 A;  5G21 A;  2P6F A;  2VQY A;  4KSF A;  2REE A;  4B12 A;  3JTK A;  4B11 A;  3B8G A;  2Q44 A;  3T9Y A;  3SHP A;  1V0C A;  1Y7R A;  4UWJ A;  4QVT A;  2REF A;  2RC4 A;  4C2Z A;  1YRE A;  2VZZ A;  2JEV A;  4MI4 A;  4XPD B;  1IID A;  1P4N A;  4KVO E;  1B6B A;  2GIV A;  4A31 A;  4CRZ B;  3FXT A;  2VEZ A;  3G3S A;  4RS2 A;  3N7Z A;  1S7F A;  4EVY A;  2Z3L A;  1Q2C A;  2F5I A;  4UCN A;  1L0C A;  5EC4 A;  1K4J A;  3PZJ A;  4LX9 A;  1ON0 A;  3TO9 A;  5AG5 A;  4BMH A;  4XPD C;  2ZW4 A;  4B5O A;  4C2X A;  2Y0M A;  2Q04 A;  5I0C A;  2B3V A;  5AGE A;  1Y9W A;  4E2A A;  2J8N A;  2EVN A;  1N71 A;  1Z4E A;  1I21 A;  2O28 A;  4HNW B;  2OB0 A;  3W6S A;  4B14 A;  3G8W A;  4YFJ A;  4C7H A;  4R3K A;  4KS9 A;  4XPK A;  1QST A;  3FBU A;  2Z11 A;  3E0K A;  1J4J A;  3S6K A;  2G0B A;  2FCK A;  3P2H A;  2ARH A;  1M44 A;  2AE6 A;  4KOR A;  1Z9U A;  2C27 A;  5A27 A;  4PSW A;  2VI7 A;  1I12 A;  3TOA A;  4KVX A;  1Y9K A;  4AVC A;  5AG4 A;  5EBV A;  2ZPA A;  4CAE A;  2B5G A;  4LUA A;  2DPT A;  4R3L A;  3IU2 A;  4KOU A;  5C88 A;  1BOB A;  2FE7 A;  1XMT A;  2OZU A;  4FD6 A;  1KZF A;  1Q2Y A;  2B5G B;  1PU9 A;  3TO6 A;  1NMT A;  4H89 A;  2X7B A;  2BSW A;  2CNM A;  4MJ8 A;  3FIX A;  3EXN A;  3A9L A;  3DR6 A;  4NEX A;  1TIQ A;  2NMT A;  4IUS A;  4MFZ A;  4OAD A;  3EFA A;  4KOY A;  4II9 A;  1SQH A;  3TFY A;  4CRY B;  2PRB A;  1IYK A;  1KUV A;  3V8I A;  4A32 A;  4XNH B;  2OZH A;  4HNY B;  3WR7 A;  1KUX A;  3S6H A;  1NSL A;  3D8P A;  5A28 A;  4QBJ A;  5C82 A;  3R9F A;  5HMN A;  3F0A A;  4KUA A;  3VWE A;  1S7N A;  4CYQ A;  4MY3 A;  4JD6 A;  1IYL A;  2VZY A;  4CGL A;  2R8V A;  1YGH A;  2Z10 A;  1B87 A;  2PQ8 A;  3IGR A;  2QEC A;  3IWE A;  4UFV A;  2YNE A;  3I9S A;  3P2F A;  4XNH C;  1RXT A;  1M4D A;  2P0W A;  2ZXV A;  5F48 A;  4U9Y A;  3ZZI A;  4Q36 A;  2WPX A;  1WWZ A;  4NSQ A;  3DR8 A;  4Q38 A;  1FY7 A;  3D2M A;  1MJ9 A;  5HH1 A;  2B4D A;  4M85 A;  3D2P A;  5E96 A;  1GHE A;  2BEI A;  3D3S A;  1UFH A;  2YGW A;  4MFQ A;  1YX0 A;  4C2Y A;  1M4I A;  1S7K A;  1XIX A;  3JVN A;  4NCZ A;  3EO4 A;  2WPW A;  4HKF A;  1S3Z A;  1S60 A;  1XE4 A;  4OAE A;  3W6X A;  4BBH A;  1NE9 A;  2P6E A;  3DDD A;  4FD5 A;  3OWC A;  4NF1 A;  4C7I A;  5IV0 A;  3S6F A;  1WK4 A;  3FB3 A;  5ISV A;  2CNT A;  2Z3N A;  5IB0 A;  2WSA A;  4YRH A;  3K9U A;  4QC6 A;  3R9G A;  1YVK A;  2FT0 A;  4A95 A;  5KTA A;  3CXP A;  4KVM E;  5FVJ A;  1P0H A;  3PGP A;  3TE4 A;  2HQY A;  3R1K A;  4RI1 A;  3JUW A;  2VXK A;  3R96 A;  2ZW7 A;  5KTD A;  2VBQ A;  3QAH A;  4UFW A;  4KOW A;  1CJW A;  5G1Z A;  4PK3 A;  4C68 A;  5DWN A;  1ZO0 A;  5G20 A;  1KUY A;  4PK2 A;  2YNC A;  2B4B A;  2Z0Z A;  2QIR A;  4CAV A;  5JPH A;  2Z3M A;  4AVA A;  3FYN A;  5J8C A;  4FD7 A;  4PSX A;  3BJ7 A;  2FIA A;  3DSB A;  4E0A A;  2CY2 A;  3PP9 A;  2KCW A;  1U6M A;  1XF8 A;  1MJA A;  1Z4R A;  4YGO A;  4ONU A;  4A2Z A;  4IF5 A;  2WUU A;  4ZGY B;  5BWA B;  2PSW A;  3H4Q A;  5AG6 A;  4CS0 B;  5J8F A;  4MFK A;  4HNX B;  2OU2 A;  2FS5 A;  3BLN A;  2GE3 A;  4JLY A;  2JDC A;  2JLM A;  4NXY A;  2K5T A;  2J8M A;  2IL4 A;  3DNS A;  1YLE A;  5JQ4 A;  4CGN A;  4GS4 A;  3W91 A;  3TT2 A;  3VWD A;  4UA3 A;  4PV6 A;  2DPS A;  4UCM A;  1I1D A;  3TO7 A;  4UFX A;  1YVO A;  5F49 A;  4A33 A;  2PC1 A;  4UWI A;  4CGM A;  2Q7B A;  4F6A A;  2CXA A;  5AG7 A;  4I49 A;  2D4O A;  4DNC A;  2QML A;  3SXN A;  3BJ8 A;  2FSR A;  4R57 A;  1YR0 A;  3UY5 A;  1M1D A;  4KOT A;  1QSO A;  1VHS A;  4KOS A;  2H5M A;  3I3G A;  4AB7 A;  3EC4 A;  1QSN A;  4FD4 A;  2ZW5 A;  4XPL A;  3S6G A;  3IU1 A;  4KUB A;  5H86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...