2J8RA

Structure of p. aeruginosa acetyltransferase pa4866 solved in complex with l-methionine sulfoximine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
170
structure length
170
Chain Sequence
ASIRDAGVADLPGILAIYNDAVGNTTAIWNETPVDLANRQAWFDARARQGYPILVASDAAGEVLGYASYGDWRPFEGFRGTVEHSVYVRDDQRGKGLGVQLLQALIERARAQGLHVMVAAIESGNAASIGLHRRLGFEISGQMPQVGQKFGRWLDLTFMQLNLDPTRSAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLTRANSFERASE PA4866 FROM P. AERUGINOSA
publication title L-Methionine Sulfoximine, But not Phosphinothricin, is a Substrate for an Acetyltransferase (Gene Pa4866) from Pseudomonas Aeruginosa: Structural and Functional Studies.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 51
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2j8rA00
2EUIA 2Y0MA 3G3SA 1M4DA 4AG9A 3TCVA 3G8WA 4H89A 3I9SA 3S6FA 1YR0A 3B8GA 4RI1A 3CXPA 2Q0YA 3R9GA 1VHSA 2PSWA 2Q04A 4MHDA 4Y49B 1YX0A 4U9ZA 4AVBA 4XPKA 2D4OA 5IX3A 2HQYA 2Q44A 2VBQA 1QSTA 4L8AA 1RO5A 2X7BA 5F49A 4IUSA 4MI4A 2ZPAA 2ATRA 4JWPA 4HKFA 2B4DB 5I0CA 4B5PA 1MJ9A 2GE3A 4ONUA 3IGRA 2EVNA 3TO6A 2OB0A 2J8NA 4MBUA 2ZW6A 1I12A 4KOXA 1I1DA 2FSRA 1B87A 2OZHA 4KOTA 3S6GA 3DR6A 1KZFA 4LUAA 1IB1E 3JUWA 2D4PA 4FD6A 1WK4A 4K30A 3QAHA 1XEBA 2JDCA 2KCWA 4YRHA 1S7FA 1XE4A 3VWDA 1UFHA 1IICA 1TIQA 1Z4RA 1Q2DA 5DWMA 2RC4A 2R7HA 4CRZB 2FT0A 1Q2CA 2FIWA 5EBVA 4UA3A 1Z9UA 1YVOA 2J8MA 1YVKA 3CXQA 4PV6A 4QB9A 2FIAA 1S7KA 4KOYA 2B5GB 5GCNA 3C26A 4Y49C 4NCZA 5JQ4A 2H5MA 2VQYA 1QSRA 2I79A 1MJAA 2P0WA 3MGDA 1S3ZA 4HNYB 3FIXA 4L89A 4XPDB 1K4JA 3TE4A 2CY2A 3I3GA 5IB0A 3D2MA 4CRYB 4KOSA 4CAVA 1KUVA 2VXKA 4J3GA 3P2HA 3TO7A 4M3SA 1CM0A 1S7NA 5FVJA 2OZGA 2QIRA 2REEA 2VI7A 2FE7A 4NXYA 3D2PA 2OU2A 3EO4A 1Z4EA 4KLVA 1J4JA 2REFA 3V8IA 2B4DA 1PUAA 3FBUA 2G3AA 4KVXA 2WPXA 4OAEA 5KTCA 3TT2A 3GKRA 3H4QA 3JVNA 4AVAA 2OH1A 4JJXA 1NMTA 2PR1A 2I00A 2PRBA 3RYOA 1FY7A 5CNPA 1V0CA 1IIDA 3F8KA 3R9FA 1S60A 2CNTA 2F5IA 2JDDA 4NSQA 4X5KA 4DNCA 3T9YA 3R9EA 4I49A 4JD6A 3SHPA 3K9UA 5EC4A 2QECA 4U5YA 3EFAA 2BL1A 2FXFA 5ISVA 3GYAA 4IF5A 2A4NA 5JPHA 3UY5A 4OLLA 4B5OA 4QUSA 1XMTA 5H84A 2VZYA 3TTHA 4CS0B 2OZUA 4E2AA 1YLEA 3PGPA 4II9A 2R8VA 4KUBA 4JXQA 2QMLA 4F6AA 3FXTA 1LRZA 2B4BA 4CAWA 4XPDC 2B5GA 3S6KA 3GY9A 2CNMA 3LD2A 1M4GA 2B3UA 3TO9A 2VEZA 1R57A 2PQ8A 4YFJA 1QSOA 4KOUA 4R9MA 2PR8A 4R57A 1M1DA 3F5BA 4CAXA 4LX9A 1KUYA 1QSMA 1Q2YA 3ZJ0A 1BO4A 3CXSA 2ZXVA 4MY3A 4AB7A 2R1IA 4AVCA 4JLYA 1PU9A 1M4IA 1WWZA 3QB8A 5DWNA 5HMNA 3LODA 3NE7A 3DNSA 4KOWA 2FS5A 4KVOE 4R3LA 1XIXA 3DSBA 1GHEA 2BUEA 4UWIA 4MY0A 1NSLA 4YGOA 4KVME 3D3SA 4PSXA 1Y9KA 1IYKA 2PDOA 2B58A 4QC6A 4HNWB 3TOAA 4PK2A 4UWJA 4XNHB 4KLWA 1P0HA 3KKWA 2Z0ZA 4OADA 1U6MA 2P6FA 1MJBA 2BSWA 2G0BA 2J8RA 2R98A 3DR8A 2WPWA 4E8OA 1OZPA 2AE6A 3E0KA 4NF1A 3FYNA 2IL4A 4NEXA 3T90A 4FD4A 1XF8A 3TOBA 2HUZA 3BJ7A 1ON0A 2FCKA 3SXNA 1Y9WA 1CJWA 1KUXA 5HH1A 3S6HA 4F0YA 3P2FA 3R95A 3ZZIA 2Q4YA 2P6EA 2Z10A 2K5TA 3W91A 1IYLA 2G3TA 4PSWA 2PC1A 4BMHA 1S5KA 2CNSA 3DDDA 1BOBA 2FL4A 3BJ8A 2ZW7A 3BLNA 2JEVA 2Z11A 5J8CA 2AJ6A 3EY5A 5F47A 4H6UA 4KZTA 1M44A 4MJ8A 2C27A 4GS4A 3W6XA 3SXOA 2BEIA 1S7LA 1VKCA 5KTDA 1YK3A 4KUAA 4JXRA 3WR7A 2Q7BA 2VZZA 3FRMA 3PP9A 3FB3A 4H6ZA 5C82A 4FD7A 5F48A 4E0AA 4QBJA 4B5PB 4ORFA 1P4NA 3VWEA 4XNHC 1RXTA 2ARHA 4UBRA 5J8FA 3R96A 1N71A 2HV2A 1B6BA 2ZW4A 3D8PA 3FNCA 4R3KA 2NMTA 3PZJA 4ZBGA 4U9YA 1QSNA 1YGHA 1L0CA 4KOVA 1NE9A 4RS2A 5C88A 4FD5A 4KORA 3R1KA 4QVTA 5E96A 5H86A 4AG7A 3TFYA 2Q4VA 3F0AA 1MK4A 1SQHA 2P6GA 2GANA 4PK3A 5F46A 4M85A 2GIVA 2O28A 3EXNA 5IV0A 3EC4A 3IWGA 3W6SA 4R87A 5KTAA 3OWCA 4EVYA 2JLMA 4XPLA 1Y7RA 2B3VA 2DXQA 1I21A 4HNXB 2ZW5A 1YREA 3N7ZA
chains in the Genus database with same CATH superfamily
2EUIA 2Y0MA 2Q51A 4B12A 3G3SA 3PEIA 1M4DA 2YNEA 4OKOA 1YW6A 2JBKA 4AG9A 3TCVA 3G8WA 4MFJA 2V77A 2DF5A 4H89A 3I9SA 3NE8A 1TF8A 3S6FA 1YR0A 3B8GA 4RI1A 5D29A 3CXPA 2Q0YA 3R9GA 4ONWA 4MXUA 1VHSA 2PSWA 2EWBA 3LMSA 2Q04A 4MHDA 4Y49B 1YX0A 4U9ZA 4UF4A 3N5FA 2ZEGA 3KHXA 3JRUA 4AVBA 3WC5A 1YW4A 2QJ8A 5LYLA 2J9AA 3WT4A 1VIXA 1ZG8A 3MRUA 3D7HA 4XPKA 2ZEOA 4C2YA 2HB6A 2ZEPA 2D4OA 3K2KA 5IX3A 2PIZA 4EFDA 3IO1A 2PJ5A 2HQYA 1AMPA 2Q44A 2VBQA 1QSTA 4L8AA 1RO5A 2X7BA 4PXBA 3S9MA 4A94A 2AFXA 1DTDA 1Y7EA 5HVGA 5F49A 4AXVA 1QMUA 4GM5A 2IQ6A 4IUSA 3H8EA 2ZPAA 4MI4A 2ATRA 4JWPA 2GFQA 4HKFA 2B4DB 5I0CA 1A2ZA 4B5PA 2JBJA 2AFMA 1MJ9A 2GE3A 4GXHA 4ONUA 1CP7A 3IGRA 2EVNA 2V8HA 3TO6A 4IHMA 2ZOFA 3SJEA 3FF3A 1PCAA 2OB0A 2PJBA 2J8NA 1Z8XA 2CTCA 3D7DA 4MBUA 4NJQA 5HVHA 2ZW6A 1I12A 4KOXA 1LCPA 4OC4A 2PJ6A 1I1DA 4YWYA 2FSRA 1B87A 1QQ9A 2OZHA 4KOTA 3DR6A 3S6GA 4KSFA 1KZFA 4LUAA 3NA6A 5G22A 2V8GA 2YNCA 5BWAB 4UIAA 2PJ7A 4P4BA 1IB1E 8CPAA 3JUWA 2D4PA 4FD6A 1WK4A 1XFOA 4MFQA 4K30A 3QAHA 1XEBA 2ZENA 4K3NA 3V7ZA 2JDCA 3HUVA 3DLJA 2KCWA 2XEGA 1DE4C 4YRHA 4C7HA 2CF4A 2OR4A 5HXDA 3KI9A 1S7FA 2XEFA 3SJFA 1XE4A 3VWDA 1UFHA 2JEWA 4TWEA 1IICA 4RUHA 1TIQA 1Z4RA 1Q2DA 5DWMA 4A2ZA 1ZLIA 2Z3PA 4C2ZA 2RC4A 1TKHA 3PBEA 1LFWA 4OC2A 2R7HA 4WJBA 4CRZB 2FT0A 1AUGA 1Q2CA 1Z8TA 2FIWA 2O53A 2YGWA 4NGTA 4UEEA 4A30A 5EBVA 4UA3A 2BCOA 1Z9UA 2PJAA 2Q7SA 2J8MA 1YVOA 1JQGA 4NGNA 1YVKA 3IJ3A 3CXQA 5AG5A 4PV6A 5LYDA 4R6TA 4QB9A 2PJ1A 2FIAA 3PFEA 1S7KA 4KSIA 4KOYA 2B5GB 3PRTA 5GCNA 3C26A 3LWUA 4Y49C 4NCZA 2AFOA 5JQ4A 3KL9A 2H5MA 2VQYA 1QSRA 2I79A 3LACA 1MJAA 2P0WA 3MGDA 1S3ZA 4HNYB 2ANPA 3FIXA 4UFXA 3VH9A 5K8MA 4HPSA 4L89A 4M6IA 4XPDB 3RAMA 4C68A 1K4JA 4A33A 1Z8WA 5LYFA 2CIJA 3TE4A 2CY2A 4KS9A 3A9LA 3SI2A 3I3GA 5IB0A 3KR4A 3D2MA 1XRYA 4CYNA 4CRYB 4NGQA 4KOSA 4F9UA 3KQZA 4CAVA 1KUVA 2VXKA 5D8NA 4J3GA 3P2HA 4ZI6A 3IWWA 4MRIA 3TO7A 4M3SA 2Z3NA 1KWMA 2Z3MA 2EBJA 1CM0A 1XJOA 5J1QA 1S7NA 4UEFA 4R8FA 3PFOA 5FVJA 2OZGA 2ZEFA 5F46A 2QIRA 3B35A 2REEA 4CGPA 2DEAA 2VI7A 4UFWA 1CBXA 2FE7A 1VHOA 1ARLA 3D2PA 4NXYA 5DS0A 2OU2A 6CPAA 4R7MA 3EO4A 1Z4EA 4KLVA 4PQAA 4JZ0A 1J4JA 2REFA 3FEDA 1CX8A 2B4DA 3V8IA 4P10A 1PUAA 2CTBA 2ZEMA 3FBUA 3NH8A 2G3AA 3KGQA 3KHZA 4PXCA 5A28A 4KVXA 2WPXA 4OAEA 4JYWA 3TT2A 5KTCA 3GKRA 3H4QA 3JVNA 2PCUA 4AVAA 2OH1A 4YU9A 5LRJA 4ZY1A 4OC5A 3K9TA 4JJXA 1NMTA 2PR1A 2I00A 2PRBA 3RYOA 1FY7A 4CAFA 1FT7A 5CNPA 3RNZA 3CDXA 1V0CA 3CT9A 3RO0A 1ELMP 4NFRA 2PJ8A 1IIDA 3F8KA 4ZX9A 3R9FA 1S60A 2BOAA 2CNTA 2GLJA 5AGEA 3FJUA 3VATA 5EMIA 2F5IA 2JDDA 4NSQA 4X5KA 4DNCA 3T9YA 4EMEA 3PBBA 3R9EA 1CG2A 4I49A 4MHZA 1F2OA 3B2YA 4A39A 3I1UA 1Y0YA 2WZNA 3GB0A 4JD6A 3SHPA 3IEHA 3K9UA 2DPTA 5EC4A 1YQEA 2QECA 4U5YA 3EFAA 2BL1A 2FXFA 5ISVA 3BI0A 3GYAA 4IF5A 1FNOA 2A4NA 4NGMA 5JPHA 3CPAA 1CPSA 3UY5A 4A95A 4OLLA 1BLLE 2EK9A 4QUSA 4R76A 3KQXA 2ZOGA 3SI0A 4B5OA 4DUKA 1XMTA 4PPZA 3FMCA 1NSAA 5H84A 2VZYA 3TTHA 4F8ZA 4MFKA 5CBMA 3RZAA 4MFPA 1LAMA 2Z3LA 5THWA 5F09A 4CS0B 2OZUA 5A27A 1M4LA 4E2AA 1YLEA 4OMEA 1HEEA 3PB8X 3PGPA 4UFVA 4OC1A 4II9A 4NGPA 3FX6A 4P45A 2R8VA 4KUBA 1PYTB 2V8DA 4JXQA 2QMLA 4F6AA 4B11A 4ZGYB 3FXTA 1BPNA 1XOVA 3QAYA 1LRZA 3TX8A 2B4BA 3KASA 4CAWA 4CPAA 3IIBA 4XPDC 3VARA 1EE3P 2B5GA 4W9YA 4ZY2A 3S6KA 1RTQA 3GY9A 2CNMA 1VGYA 3B3VA 3FEEA 4IK2A 4NGRA 3LD2A 1M4GA 2B3UA 2PJ0A 4KSAA 3PB9X 3B3WA 1JWQA 3TO9A 2VEZA 4UCPA 3IFEA 4H2KA 3V38A 4MHYA 3IC1A 1R57A 2PQ8A 4CYPA 4YFJA 1QSOA 4KOUA 4UIBA 4CGMA 4R9MA 1TKJA 2PR8A 1TKFA 4R57A 4UEZA 1M1DA 3F5BA 2ZEHA 4P4FA 4CAXA 4LX9A 2PVWA 1KUYA 1QSMA 4BD9A 1Q2YA 4MFLA 4P44A 5K8OA 3ZJ0A 3NH5A 1BO4A 3CXSA 2ZXVA 4MY3A 2I3CA 2RB7A 1YSJA 3DGVA 4AB7A 4FUUA 4B10A 2PJCA 4IAVA 2GREA 2R1IA 1Q7LA 4AVCA 2V8VA 4JLYA 1Z2LA 2PJ3A 4MHPA 4M6HA 4B13A 3GLJA 1PU9A 1M4IA 1WWZA 3QB8A 5DWNA 1AYEA 4OP4A 3LODA 5HMNA 3NE7A 3IU1A 1BPMA 1LOKA 2WYRA 3DNSA 2YNDA 5G21A 4KOWA 3SI1A 2FS5A 4FAIA 4KVOE 4R3LA 5LYIA 1XIXA 2PJ4A 3KZWA 3WC6A 3DSBA 1GHEA 5G20A 2BUEA 4X8IA 3NFZA 4UWIA 2NYQA 1ZO0A 3HLPA 2AFUA 3PB6X 4MY0A 2PIYA 4P4IA 1NSLA 4MFZA 4Z65A 2WSAA 2ZEEA 1IU8A 4P6YA 4YGOA 4KVME 3D3SA 4PSXA 1Y9KA 1IYKA 2PDOA 3IWEA 7CPAA 2B58A 4MCSA 1YMEA 2Z3KA 4QC6A 4HNWB 4PXDA 3TOAA 4PK2A 4UWJA 4XNHB 1IOIA 4MMOA 4NGSA 4ZY0A 4KLWA 1P0HA 2AFZA 2ZEDA 5LRKA 3KKWA 2DPSA 2Z0ZA 4OADA 2C6PA 1YLOA 3IU2A 2CXAA 5HVFA 4OIDA 4P4JA 3TC8A 1U6MA 2P6FA 1MJBA 2ABZA 1BAVA 2BSWA 4NJRA 4A37A 2AFWA 2G0BA 3T8WA 2J8RA 4P4DA 1ZG9A 3H5ZA 2R98A 4WWVA 3B3TA 2C6CA 2WPWA 3DR8A 4E8OA 2XEJA 4ZYQA 2VL1A 1OZPA 2AE6A 3E0KA 3GUXA 4NF1A 3FYNA 5ELYA 2IL4A 4NEXA 1LANA 3QNVA 3T90A 4FD4A 1XF8A 4OIWA 3PB4X 5JGFA 4CAEA 4DJLA 4RN7A 3S9LA 3TOBA 2RFHA 4MCPA 2HUZA 2C6GA 3BJ7A 1ON0A 3BXMA 4ZX8A 2FCKA 4C2XA 4CGOA 3SXNA 1HDQA 1Y9WA 1IY7A 1CJWA 2XEIA 1KUXA 5HH1A 3CPXA 3S6HA 3BHXA 2Q4ZA 4MHNA 5G1ZA 5CPAA 4A38A 4F0YA 3P2FA 3R95A 3ZZIA 4LQ6A 2PE3A 2Q4YA 3S9NA 2P6EA 3NH4A 2HC9A 2Z10A 2K5TA 4FWUA 4Q38A 3W91A 1IYLA 2G3TA 4PSWA 1TF9A 3ISZA 4MCRA 1ELLP 1VHEA 3WC7A 2PC1A 4BMHA 5JM6A 3D66A 4X3RA 4PXEA 4BBHA 4CGNA 4F9VA 2QVPA 1S5KA 1R43A 1Z8LA 3SJGA 2CNSA 4O23A 3DDDA 4B14A 2WUUA 1CPXA 1BOBA 3FECA 4TNUA 5AG4A 4MCQA 4CYQA 1LAPA 2FL4A 3D67A 3BJ8A 2ZW7A 3BLNA 3KR5A 5AG6A 1UWYA 2C1CA 4DYOA 2IMOA 4UCNA 1F57A 4P4EA 2JEVA 2Z11A 5J8CA 2AJ6A 2PRQA 3EY5A 5F47A 4B6ZA 2QYVA 2YNCC 3PB7X 4H6UA 4KZTA 1M44A 4MJ8A 2C27A 4GS4A 2OOTA 1TXRA 3SXOA 2G9DA 3W6XA 2BEIA 5JH9A 4UCMA 1S7LA 1VKCA 5KTDA 4C7IA 1YK3A 4KUAA 1Y0RA 4JXRA 3WR7A 5K8NA 2Q7BA 3BI1A 2VZZA 3JTKA 3FRMA 3PP9A 1F2PA 3FB3A 2F8HA 4H6ZA 5C82A 1X12A 4FD7A 2ODFA 2POKA 3D7FA 5F48A 4E0AA 1ZG7A 4QBJA 4A32A 5I4MA 3MN8A 4B5PB 2PJ2A 1ZLHA 4ORFA 1P4NA 3VWEA 1R3NA 4XNHC 5LRGA 3ISXA 1RXTA 2ARHA 2FVGA 2IJZA 3FH4A 3D68A 4F0XA 3D7GA 4UBRA 5J8FA 3B3CA 3R96A 4X2TA 1N71A 4Q7AA 2HV2A 4CGLA 1B6BA 1X10A 5AG7A 2ZW4A 4BINA 3D8PA 5IB9A 3FNCA 4R3KA 4EWTA 2NMTA 3B3SA 3PZJA 1ARMA 4ZBGA 5K8PA 4G1PA 1GYTA 4U9YA 1QSNA 1YGHA 4CYOA 1L0CA 4KOVA 1NE9A 4RS2A 3FVLA 3L2NA 5C88A 4FD5A 4OC3A 4KORA 3RBUA 4FBEA 1XBUA 3B7IA 1IGBA 4LQGA 1OBRA 2PJ9A 3R1KA 4QVTA 5E96A 5H86A 4AG7A 3TFYA 2Z3OA 3H8FA 2Q4VA 3F0AA 1MK4A 1SQHA 2P6GA 2GANA 2ZELA 1Z5RA 3H8GA 4M85A 1XMBA 2GIVA 2Q43A 3GIUA 4PK3A 2O28A 3SJXA 3EXNA 5IV0A 2BO9A 1CP6A 3EC4A 3IWGA 3W6SA 1H8LA 4R87A 4OC0A 5KTAA 3OWCA 4M6GA 2O4HA 3WABA 4EVYA 2JLMA 1IOFA 2GU2A 1HDUA 4XPLA 1Y7RA 2PVVA 2B3VA 4A31A 2EO8A 2DXQA 1I21A 4HNXB 4Q36A 3CZXA 3D4UA 2GLFA 2F7VA 2NSMA 2AFSA 2ZW5A 1YREA 2EK8A 3N7ZA
chains in the Genus database with same CATH topology
2EUIA 2Y0MA 4B12A 3G3SA 1M4DA 2YNEA 4AG9A 3TCVA 3G8WA 4MFJA 4H89A 3I9SA 3S6FA 1YR0A 3B8GA 4RI1A 3CXPA 2Q0YA 3R9GA 1VHSA 2PSWA 2Q04A 4MHDA 4Y49B 1YX0A 4U9ZA 4AVBA 4XPKA 4C2YA 2D4OA 5IX3A 2HQYA 2Q44A 2VBQA 1QSTA 4L8AA 1RO5A 2X7BA 5F49A 4IUSA 4MI4A 2ZPAA 2ATRA 4JWPA 4HKFA 2B4DB 5I0CA 4B5PA 1MJ9A 2GE3A 4ONUA 3IGRA 2EVNA 3TO6A 2OB0A 2J8NA 4MBUA 2ZW6A 1I12A 4KOXA 1I1DA 2FSRA 1B87A 2OZHA 4KOTA 3S6GA 3DR6A 4KSFA 1KZFA 4LUAA 5G22A 2YNCA 5BWAB 1IB1E 3JUWA 2D4PA 4FD6A 1WK4A 4MFQA 4K30A 3QAHA 1XEBA 2JDCA 2KCWA 4YRHA 4C7HA 1S7FA 1XE4A 3VWDA 1UFHA 1IICA 1TIQA 1Z4RA 1Q2DA 5DWMA 4A2ZA 2Z3PA 4C2ZA 2RC4A 2R7HA 4CRZB 2FT0A 1Q2CA 2FIWA 2YGWA 4A30A 5EBVA 4UA3A 1Z9UA 1YVOA 2J8MA 1YVKA 5AG5A 3CXQA 4PV6A 4QB9A 2FIAA 1S7KA 4KOYA 2B5GB 5GCNA 3C26A 4Y49C 4NCZA 5JQ4A 2H5MA 2VQYA 1QSRA 2I79A 1MJAA 2P0WA 3MGDA 1S3ZA 4HNYB 4UFXA 3FIXA 4L89A 4XPDB 4C68A 1K4JA 4A33A 3TE4A 2CY2A 4KS9A 3A9LA 3I3GA 5IB0A 3D2MA 4CYNA 4CRYB 4KOSA 4CAVA 1KUVA 2VXKA 4J3GA 3P2HA 3TO7A 4M3SA 2Z3NA 2Z3MA 1CM0A 1S7NA 5FVJA 2OZGA 2QIRA 2REEA 4CGPA 2VI7A 4UFWA 2FE7A 4NXYA 3D2PA 2OU2A 3EO4A 1Z4EA 4KLVA 1J4JA 2REFA 3V8IA 2B4DA 1PUAA 3FBUA 2G3AA 5A28A 4KVXA 2WPXA 4OAEA 5KTCA 3TT2A 3GKRA 3H4QA 3JVNA 4AVAA 2OH1A 4JJXA 1NMTA 2PR1A 2I00A 2PRBA 3RYOA 1FY7A 4CAFA 5CNPA 1V0CA 1IIDA 3F8KA 3R9FA 1S60A 2CNTA 5AGEA 2F5IA 2JDDA 4NSQA 4X5KA 4DNCA 3T9YA 3R9EA 4I49A 4JD6A 3SHPA 3K9UA 2DPTA 5EC4A 2QECA 4U5YA 3EFAA 2BL1A 2FXFA 5ISVA 3GYAA 4IF5A 2A4NA 5JPHA 3UY5A 4A95A 4OLLA 4B5OA 4QUSA 1XMTA 5H84A 2VZYA 3TTHA 4MFKA 4MFPA 2Z3LA 4CS0B 2OZUA 5A27A 4E2AA 1YLEA 3PGPA 4UFVA 4II9A 2R8VA 4KUBA 4JXQA 2QMLA 4F6AA 4B11A 4ZGYB 3FXTA 1LRZA 2B4BA 4CAWA 4XPDC 2B5GA 3S6KA 3GY9A 2CNMA 3LD2A 1M4GA 2B3UA 4KSAA 3TO9A 2VEZA 4UCPA 4CYPA 1R57A 2PQ8A 4YFJA 1QSOA 4KOUA 4CGMA 4R9MA 2PR8A 4R57A 1M1DA 3F5BA 4CAXA 4LX9A 1KUYA 1QSMA 1Q2YA 4MFLA 3ZJ0A 1BO4A 3CXSA 2ZXVA 4MY3A 4AB7A 4B10A 2R1IA 4AVCA 4JLYA 4B13A 1PU9A 1M4IA 1WWZA 3QB8A 5DWNA 5HMNA 3LODA 3NE7A 3IU1A 5G21A 3DNSA 2YNDA 4KOWA 2FS5A 4KVOE 4R3LA 1XIXA 3DSBA 1GHEA 5G20A 2BUEA 4UWIA 1ZO0A 4MY0A 1NSLA 4MFZA 2WSAA 4YGOA 4KVME 3D3SA 4PSXA 1Y9KA 1IYKA 2PDOA 3IWEA 2B58A 2Z3KA 4QC6A 4HNWB 3TOAA 4PK2A 4UWJA 4XNHB 4KLWA 1P0HA 3KKWA 2DPSA 2Z0ZA 4OADA 3IU2A 2CXAA 1U6MA 2P6FA 1MJBA 2BSWA 2G0BA 2J8RA 3H5ZA 2R98A 3DR8A 2WPWA 4E8OA 1OZPA 2AE6A 3E0KA 4NF1A 3FYNA 2IL4A 4NEXA 3T90A 4FD4A 1XF8A 4CAEA 3TOBA 2HUZA 3BJ7A 1ON0A 2FCKA 4C2XA 4CGOA 3SXNA 1Y9WA 1CJWA 1KUXA 5HH1A 3S6HA 5G1ZA 4F0YA 3P2FA 3R95A 3ZZIA 2Q4YA 2P6EA 2Z10A 2K5TA 4Q38A 3W91A 1IYLA 2G3TA 4PSWA 2PC1A 4BMHA 4BBHA 4CGNA 1S5KA 4B14A 2CNSA 3DDDA 2WUUA 1BOBA 5AG4A 4CYQA 2FL4A 3BJ8A 2ZW7A 3BLNA 5AG6A 4UCNA 2JEVA 2Z11A 5J8CA 2AJ6A 3EY5A 5F47A 4H6UA 2YNCC 4KZTA 1M44A 4MJ8A 2C27A 4GS4A 3W6XA 3SXOA 2BEIA 4UCMA 1S7LA 1VKCA 5KTDA 4C7IA 1YK3A 4KUAA 4JXRA 3WR7A 2Q7BA 2VZZA 3JTKA 3FRMA 3PP9A 3FB3A 4H6ZA 5C82A 4FD7A 5F48A 4E0AA 4QBJA 4A32A 4B5PB 4ORFA 1P4NA 3VWEA 4XNHC 1RXTA 2ARHA 4F0XA 4UBRA 5J8FA 3R96A 1N71A 4CGLA 2HV2A 1B6BA 5AG7A 2ZW4A 3D8PA 3FNCA 4R3KA 2NMTA 3PZJA 4ZBGA 4U9YA 1QSNA 1YGHA 4CYOA 1L0CA 4KOVA 1NE9A 4RS2A 5C88A 4FD5A 4KORA 3R1KA 4QVTA 5E96A 5H86A 4AG7A 3TFYA 2Z3OA 2Q4VA 3F0AA 1MK4A 1SQHA 2P6GA 2GANA 4PK3A 5F46A 4M85A 2GIVA 2O28A 3EXNA 5IV0A 3EC4A 3IWGA 3W6SA 4R87A 5KTAA 3OWCA 4EVYA 2JLMA 4XPLA 1Y7RA 2B3VA 4A31A 2DXQA 1I21A 4HNXB 4Q36A 2ZW5A 1YREA 3N7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EUI A;  2Y0M A;  3G3S A;  1M4D A;  4AG9 A;  3TCV A;  3G8W A;  4H89 A;  3I9S A;  3S6F A;  1YR0 A;  3B8G A;  4RI1 A;  3CXP A;  2Q0Y A;  3R9G A;  1VHS A;  2PSW A;  2Q04 A;  4MHD A;  4Y49 B;  1YX0 A;  4U9Z A;  4AVB A;  4XPK A;  2D4O A;  5IX3 A;  2HQY A;  2Q44 A;  2VBQ A;  1QST A;  4L8A A;  1RO5 A;  2X7B A;  5F49 A;  4IUS A;  4MI4 A;  2ZPA A;  2ATR A;  4JWP A;  4HKF A;  2B4D B;  5I0C A;  4B5P A;  1MJ9 A;  2GE3 A;  4ONU A;  3IGR A;  2EVN A;  3TO6 A;  2OB0 A;  2J8N A;  4MBU A;  2ZW6 A;  1I12 A;  4KOX A;  1I1D A;  2FSR A;  1B87 A;  2OZH A;  4KOT A;  3S6G A;  3DR6 A;  1KZF A;  4LUA A;  1IB1 E;  3JUW A;  2D4P A;  4FD6 A;  1WK4 A;  4K30 A;  3QAH A;  1XEB A;  2JDC A;  2KCW A;  4YRH A;  1S7F A;  1XE4 A;  3VWD A;  1UFH A;  1IIC A;  1TIQ A;  1Z4R A;  1Q2D A;  5DWM A;  2RC4 A;  2R7H A;  4CRZ B;  2FT0 A;  1Q2C A;  2FIW A;  5EBV A;  4UA3 A;  1Z9U A;  1YVO A;  2J8M A;  1YVK A;  3CXQ A;  4PV6 A;  4QB9 A;  2FIA A;  1S7K A;  4KOY A;  2B5G B;  5GCN A;  3C26 A;  4Y49 C;  4NCZ A;  5JQ4 A;  2H5M A;  2VQY A;  1QSR A;  2I79 A;  1MJA A;  2P0W A;  3MGD A;  1S3Z A;  4HNY B;  3FIX A;  4L89 A;  4XPD B;  1K4J A;  3TE4 A;  2CY2 A;  3I3G A;  5IB0 A;  3D2M A;  4CRY B;  4KOS A;  4CAV A;  1KUV A;  2VXK A;  4J3G A;  3P2H A;  3TO7 A;  4M3S A;  1CM0 A;  1S7N A;  5FVJ A;  2OZG A;  2QIR A;  2REE A;  2VI7 A;  2FE7 A;  4NXY A;  3D2P A;  2OU2 A;  3EO4 A;  1Z4E A;  4KLV A;  1J4J A;  2REF A;  3V8I A;  2B4D A;  1PUA A;  3FBU A;  2G3A A;  4KVX A;  2WPX A;  4OAE A;  5KTC A;  3TT2 A;  3GKR A;  3H4Q A;  3JVN A;  4AVA A;  2OH1 A;  4JJX A;  1NMT A;  2PR1 A;  2I00 A;  2PRB A;  3RYO A;  1FY7 A;  5CNP A;  1V0C A;  1IID A;  3F8K A;  3R9F A;  1S60 A;  2CNT A;  2F5I A;  2JDD A;  4NSQ A;  4X5K A;  4DNC A;  3T9Y A;  3R9E A;  4I49 A;  4JD6 A;  3SHP A;  3K9U A;  5EC4 A;  2QEC A;  4U5Y A;  3EFA A;  2BL1 A;  2FXF A;  5ISV A;  3GYA A;  4IF5 A;  2A4N A;  5JPH A;  3UY5 A;  4OLL A;  4B5O A;  4QUS A;  1XMT A;  5H84 A;  2VZY A;  3TTH A;  4CS0 B;  2OZU A;  4E2A A;  1YLE A;  3PGP A;  4II9 A;  2R8V A;  4KUB A;  4JXQ A;  2QML A;  4F6A A;  3FXT A;  1LRZ A;  2B4B A;  4CAW A;  4XPD C;  2B5G A;  3S6K A;  3GY9 A;  2CNM A;  3LD2 A;  1M4G A;  2B3U A;  3TO9 A;  2VEZ A;  1R57 A;  2PQ8 A;  4YFJ A;  1QSO A;  4KOU A;  4R9M A;  2PR8 A;  4R57 A;  1M1D A;  3F5B A;  4CAX A;  4LX9 A;  1KUY A;  1QSM A;  1Q2Y A;  3ZJ0 A;  1BO4 A;  3CXS A;  2ZXV A;  4MY3 A;  4AB7 A;  2R1I A;  4AVC A;  4JLY A;  1PU9 A;  1M4I A;  1WWZ A;  3QB8 A;  5DWN A;  5HMN A;  3LOD A;  3NE7 A;  3DNS A;  4KOW A;  2FS5 A;  4KVO E;  4R3L A;  1XIX A;  3DSB A;  1GHE A;  2BUE A;  4UWI A;  4MY0 A;  1NSL A;  4YGO A;  4KVM E;  3D3S A;  4PSX A;  1Y9K A;  1IYK A;  2PDO A;  2B58 A;  4QC6 A;  4HNW B;  3TOA A;  4PK2 A;  4UWJ A;  4XNH B;  4KLW A;  1P0H A;  3KKW A;  2Z0Z A;  4OAD A;  1U6M A;  2P6F A;  1MJB A;  2BSW A;  2G0B A;  2J8R A;  2R98 A;  3DR8 A;  2WPW A;  4E8O A;  1OZP A;  2AE6 A;  3E0K A;  4NF1 A;  3FYN A;  2IL4 A;  4NEX A;  3T90 A;  4FD4 A;  1XF8 A;  3TOB A;  2HUZ A;  3BJ7 A;  1ON0 A;  2FCK A;  3SXN A;  1Y9W A;  1CJW A;  1KUX A;  5HH1 A;  3S6H A;  4F0Y A;  3P2F A;  3R95 A;  3ZZI A;  2Q4Y A;  2P6E A;  2Z10 A;  2K5T A;  3W91 A;  1IYL A;  2G3T A;  4PSW A;  2PC1 A;  4BMH A;  1S5K A;  2CNS A;  3DDD A;  1BOB A;  2FL4 A;  3BJ8 A;  2ZW7 A;  3BLN A;  2JEV A;  2Z11 A;  5J8C A;  2AJ6 A;  3EY5 A;  5F47 A;  4H6U A;  4KZT A;  1M44 A;  4MJ8 A;  2C27 A;  4GS4 A;  3W6X A;  3SXO A;  2BEI A;  1S7L A;  1VKC A;  5KTD A;  1YK3 A;  4KUA A;  4JXR A;  3WR7 A;  2Q7B A;  2VZZ A;  3FRM A;  3PP9 A;  3FB3 A;  4H6Z A;  5C82 A;  4FD7 A;  5F48 A;  4E0A A;  4QBJ A;  4B5P B;  4ORF A;  1P4N A;  3VWE A;  4XNH C;  1RXT A;  2ARH A;  4UBR A;  5J8F A;  3R96 A;  1N71 A;  2HV2 A;  1B6B A;  2ZW4 A;  3D8P A;  3FNC A;  4R3K A;  2NMT A;  3PZJ A;  4ZBG A;  4U9Y A;  1QSN A;  1YGH A;  1L0C A;  4KOV A;  1NE9 A;  4RS2 A;  5C88 A;  4FD5 A;  4KOR A;  3R1K A;  4QVT A;  5E96 A;  5H86 A;  4AG7 A;  3TFY A;  2Q4V A;  3F0A A;  1MK4 A;  1SQH A;  2P6G A;  2GAN A;  4PK3 A;  5F46 A;  4M85 A;  2GIV A;  2O28 A;  3EXN A;  5IV0 A;  3EC4 A;  3IWG A;  3W6S A;  4R87 A;  5KTA A;  3OWC A;  4EVY A;  2JLM A;  4XPL A;  1Y7R A;  2B3V A;  2DXQ A;  1I21 A;  4HNX B;  2ZW5 A;  1YRE A;  3N7Z A; 
#chains in the Genus database with same CATH topology
 2EUI A;  2Y0M A;  2Q51 A;  4B12 A;  3G3S A;  3PEI A;  1M4D A;  2YNE A;  4OKO A;  1YW6 A;  2JBK A;  4AG9 A;  3TCV A;  3G8W A;  4MFJ A;  2V77 A;  2DF5 A;  4H89 A;  3I9S A;  3NE8 A;  1TF8 A;  3S6F A;  1YR0 A;  3B8G A;  4RI1 A;  5D29 A;  3CXP A;  2Q0Y A;  3R9G A;  4ONW A;  4MXU A;  1VHS A;  2PSW A;  2EWB A;  3LMS A;  2Q04 A;  4MHD A;  4Y49 B;  1YX0 A;  4U9Z A;  4UF4 A;  3N5F A;  2ZEG A;  3KHX A;  3JRU A;  4AVB A;  3WC5 A;  1YW4 A;  2QJ8 A;  5LYL A;  2J9A A;  3WT4 A;  1VIX A;  1ZG8 A;  3MRU A;  3D7H A;  4XPK A;  2ZEO A;  4C2Y A;  2HB6 A;  2ZEP A;  2D4O A;  3K2K A;  5IX3 A;  2PIZ A;  4EFD A;  3IO1 A;  2PJ5 A;  2HQY A;  1AMP A;  2Q44 A;  2VBQ A;  1QST A;  4L8A A;  1RO5 A;  2X7B A;  4PXB A;  3S9M A;  4A94 A;  2AFX A;  1DTD A;  1Y7E A;  5HVG A;  5F49 A;  4AXV A;  1QMU A;  4GM5 A;  2IQ6 A;  4IUS A;  3H8E A;  2ZPA A;  4MI4 A;  2ATR A;  4JWP A;  2GFQ A;  4HKF A;  2B4D B;  5I0C A;  1A2Z A;  4B5P A;  2JBJ A;  2AFM A;  1MJ9 A;  2GE3 A;  4GXH A;  4ONU A;  1CP7 A;  3IGR A;  2EVN A;  2V8H A;  3TO6 A;  4IHM A;  2ZOF A;  3SJE A;  3FF3 A;  1PCA A;  2OB0 A;  2PJB A;  2J8N A;  1Z8X A;  2CTC A;  3D7D A;  4MBU A;  4NJQ A;  5HVH A;  2ZW6 A;  1I12 A;  4KOX A;  1LCP A;  4OC4 A;  2PJ6 A;  1I1D A;  4YWY A;  2FSR A;  1B87 A;  1QQ9 A;  2OZH A;  4KOT A;  3DR6 A;  3S6G A;  4KSF A;  1KZF A;  4LUA A;  3NA6 A;  5G22 A;  2V8G A;  2YNC A;  5BWA B;  4UIA A;  2PJ7 A;  4P4B A;  1IB1 E;  8CPA A;  3JUW A;  2D4P A;  4FD6 A;  1WK4 A;  1XFO A;  4MFQ A;  4K30 A;  3QAH A;  1XEB A;  2ZEN A;  4K3N A;  3V7Z A;  2JDC A;  3HUV A;  3DLJ A;  2KCW A;  2XEG A;  1DE4 C;  4YRH A;  4C7H A;  2CF4 A;  2OR4 A;  5HXD A;  3KI9 A;  1S7F A;  2XEF A;  3SJF A;  1XE4 A;  3VWD A;  1UFH A;  2JEW A;  4TWE A;  1IIC A;  4RUH A;  1TIQ A;  1Z4R A;  1Q2D A;  5DWM A;  4A2Z A;  1ZLI A;  2Z3P A;  4C2Z A;  2RC4 A;  1TKH A;  3PBE A;  1LFW A;  4OC2 A;  2R7H A;  4WJB A;  4CRZ B;  2FT0 A;  1AUG A;  1Q2C A;  1Z8T A;  2FIW A;  2O53 A;  2YGW A;  4NGT A;  4UEE A;  4A30 A;  5EBV A;  4UA3 A;  2BCO A;  1Z9U A;  2PJA A;  2Q7S A;  2J8M A;  1YVO A;  1JQG A;  4NGN A;  1YVK A;  3IJ3 A;  3CXQ A;  5AG5 A;  4PV6 A;  5LYD A;  4R6T A;  4QB9 A;  2PJ1 A;  2FIA A;  3PFE A;  1S7K A;  4KSI A;  4KOY A;  2B5G B;  3PRT A;  5GCN A;  3C26 A;  3LWU A;  4Y49 C;  4NCZ A;  2AFO A;  5JQ4 A;  3KL9 A;  2H5M A;  2VQY A;  1QSR A;  2I79 A;  3LAC A;  1MJA A;  2P0W A;  3MGD A;  1S3Z A;  4HNY B;  2ANP A;  3FIX A;  4UFX A;  3VH9 A;  5K8M A;  4HPS A;  4L89 A;  4M6I A;  4XPD B;  3RAM A;  4C68 A;  1K4J A;  4A33 A;  1Z8W A;  5LYF A;  2CIJ A;  3TE4 A;  2CY2 A;  4KS9 A;  3A9L A;  3SI2 A;  3I3G A;  5IB0 A;  3KR4 A;  3D2M A;  1XRY A;  4CYN A;  4CRY B;  4NGQ A;  4KOS A;  4F9U A;  3KQZ A;  4CAV A;  1KUV A;  2VXK A;  5D8N A;  4J3G A;  3P2H A;  4ZI6 A;  3IWW A;  4MRI A;  3TO7 A;  4M3S A;  2Z3N A;  1KWM A;  2Z3M A;  2EBJ A;  1CM0 A;  1XJO A;  5J1Q A;  1S7N A;  4UEF A;  4R8F A;  3PFO A;  5FVJ A;  2OZG A;  2ZEF A;  5F46 A;  2QIR A;  3B35 A;  2REE A;  4CGP A;  2DEA A;  2VI7 A;  4UFW A;  1CBX A;  2FE7 A;  1VHO A;  1ARL A;  3D2P A;  4NXY A;  5DS0 A;  2OU2 A;  6CPA A;  4R7M A;  3EO4 A;  1Z4E A;  4KLV A;  4PQA A;  4JZ0 A;  1J4J A;  2REF A;  3FED A;  1CX8 A;  2B4D A;  3V8I A;  4P10 A;  1PUA A;  2CTB A;  2ZEM A;  3FBU A;  3NH8 A;  2G3A A;  3KGQ A;  3KHZ A;  4PXC A;  5A28 A;  4KVX A;  2WPX A;  4OAE A;  4JYW A;  3TT2 A;  5KTC A;  3GKR A;  3H4Q A;  3JVN A;  2PCU A;  4AVA A;  2OH1 A;  4YU9 A;  5LRJ A;  4ZY1 A;  4OC5 A;  3K9T A;  4JJX A;  1NMT A;  2PR1 A;  2I00 A;  2PRB A;  3RYO A;  1FY7 A;  4CAF A;  1FT7 A;  5CNP A;  3RNZ A;  3CDX A;  1V0C A;  3CT9 A;  3RO0 A;  1ELM P;  4NFR A;  2PJ8 A;  1IID A;  3F8K A;  4ZX9 A;  3R9F A;  1S60 A;  2BOA A;  2CNT A;  2GLJ A;  5AGE A;  3FJU A;  3VAT A;  5EMI A;  2F5I A;  2JDD A;  4NSQ A;  4X5K A;  4DNC A;  3T9Y A;  4EME A;  3PBB A;  3R9E A;  1CG2 A;  4I49 A;  4MHZ A;  1F2O A;  3B2Y A;  4A39 A;  3I1U A;  1Y0Y A;  2WZN A;  3GB0 A;  4JD6 A;  3SHP A;  3IEH A;  3K9U A;  2DPT A;  5EC4 A;  1YQE A;  2QEC A;  4U5Y A;  3EFA A;  2BL1 A;  2FXF A;  5ISV A;  3BI0 A;  3GYA A;  4IF5 A;  1FNO A;  2A4N A;  4NGM A;  5JPH A;  3CPA A;  1CPS A;  3UY5 A;  4A95 A;  4OLL A;  1BLL E;  2EK9 A;  4QUS A;  4R76 A;  3KQX A;  2ZOG A;  3SI0 A;  4B5O A;  4DUK A;  1XMT A;  4PPZ A;  3FMC A;  1NSA A;  5H84 A;  2VZY A;  3TTH A;  4F8Z A;  4MFK A;  5CBM A;  3RZA A;  4MFP A;  1LAM A;  2Z3L A;  5THW A;  5F09 A;  4CS0 B;  2OZU A;  5A27 A;  1M4L A;  4E2A A;  1YLE A;  4OME A;  1HEE A;  3PB8 X;  3PGP A;  4UFV A;  4OC1 A;  4II9 A;  4NGP A;  3FX6 A;  4P45 A;  2R8V A;  4KUB A;  1PYT B;  2V8D A;  4JXQ A;  2QML A;  4F6A A;  4B11 A;  4ZGY B;  3FXT A;  1BPN A;  1XOV A;  3QAY A;  1LRZ A;  3TX8 A;  2B4B A;  3KAS A;  4CAW A;  4CPA A;  3IIB A;  4XPD C;  3VAR A;  1EE3 P;  2B5G A;  4W9Y A;  4ZY2 A;  3S6K A;  1RTQ A;  3GY9 A;  2CNM A;  1VGY A;  3B3V A;  3FEE A;  4IK2 A;  4NGR A;  3LD2 A;  1M4G A;  2B3U A;  2PJ0 A;  4KSA A;  3PB9 X;  3B3W A;  1JWQ A;  3TO9 A;  2VEZ A;  4UCP A;  3IFE A;  4H2K A;  3V38 A;  4MHY A;  3IC1 A;  1R57 A;  2PQ8 A;  4CYP A;  4YFJ A;  1QSO A;  4KOU A;  4UIB A;  4CGM A;  4R9M A;  1TKJ A;  2PR8 A;  1TKF A;  4R57 A;  4UEZ A;  1M1D A;  3F5B A;  2ZEH A;  4P4F A;  4CAX A;  4LX9 A;  2PVW A;  1KUY A;  1QSM A;  4BD9 A;  1Q2Y A;  4MFL A;  4P44 A;  5K8O A;  3ZJ0 A;  3NH5 A;  1BO4 A;  3CXS A;  2ZXV A;  4MY3 A;  2I3C A;  2RB7 A;  1YSJ A;  3DGV A;  4AB7 A;  4FUU A;  4B10 A;  2PJC A;  4IAV A;  2GRE A;  2R1I A;  1Q7L A;  4AVC A;  2V8V A;  4JLY A;  1Z2L A;  2PJ3 A;  4MHP A;  4M6H A;  4B13 A;  3GLJ A;  1PU9 A;  1M4I A;  1WWZ A;  3QB8 A;  5DWN A;  1AYE A;  4OP4 A;  3LOD A;  5HMN A;  3NE7 A;  3IU1 A;  1BPM A;  1LOK A;  2WYR A;  3DNS A;  2YND A;  5G21 A;  4KOW A;  3SI1 A;  2FS5 A;  4FAI A;  4KVO E;  4R3L A;  5LYI A;  1XIX A;  2PJ4 A;  3KZW A;  3WC6 A;  3DSB A;  1GHE A;  5G20 A;  2BUE A;  4X8I A;  3NFZ A;  4UWI A;  2NYQ A;  1ZO0 A;  3HLP A;  2AFU A;  3PB6 X;  4MY0 A;  2PIY A;  4P4I A;  1NSL A;  4MFZ A;  4Z65 A;  2WSA A;  2ZEE A;  1IU8 A;  4P6Y A;  4YGO A;  4KVM E;  3D3S A;  4PSX A;  1Y9K A;  1IYK A;  2PDO A;  3IWE A;  7CPA A;  2B58 A;  4MCS A;  1YME A;  2Z3K A;  4QC6 A;  4HNW B;  4PXD A;  3TOA A;  4PK2 A;  4UWJ A;  4XNH B;  1IOI A;  4MMO A;  4NGS A;  4ZY0 A;  4KLW A;  1P0H A;  2AFZ A;  2ZED A;  5LRK A;  3KKW A;  2DPS A;  2Z0Z A;  4OAD A;  2C6P A;  1YLO A;  3IU2 A;  2CXA A;  5HVF A;  4OID A;  4P4J A;  3TC8 A;  1U6M A;  2P6F A;  1MJB A;  2ABZ A;  1BAV A;  2BSW A;  4NJR A;  4A37 A;  2AFW A;  2G0B A;  3T8W A;  2J8R A;  4P4D A;  1ZG9 A;  3H5Z A;  2R98 A;  4WWV A;  3B3T A;  2C6C A;  2WPW A;  3DR8 A;  4E8O A;  2XEJ A;  4ZYQ A;  2VL1 A;  1OZP A;  2AE6 A;  3E0K A;  3GUX A;  4NF1 A;  3FYN A;  5ELY A;  2IL4 A;  4NEX A;  1LAN A;  3QNV A;  3T90 A;  4FD4 A;  1XF8 A;  4OIW A;  3PB4 X;  5JGF A;  4CAE A;  4DJL A;  4RN7 A;  3S9L A;  3TOB A;  2RFH A;  4MCP A;  2HUZ A;  2C6G A;  3BJ7 A;  1ON0 A;  3BXM A;  4ZX8 A;  2FCK A;  4C2X A;  4CGO A;  3SXN A;  1HDQ A;  1Y9W A;  1IY7 A;  1CJW A;  2XEI A;  1KUX A;  5HH1 A;  3CPX A;  3S6H A;  3BHX A;  2Q4Z A;  4MHN A;  5G1Z A;  5CPA A;  4A38 A;  4F0Y A;  3P2F A;  3R95 A;  3ZZI A;  4LQ6 A;  2PE3 A;  2Q4Y A;  3S9N A;  2P6E A;  3NH4 A;  2HC9 A;  2Z10 A;  2K5T A;  4FWU A;  4Q38 A;  3W91 A;  1IYL A;  2G3T A;  4PSW A;  1TF9 A;  3ISZ A;  4MCR A;  1ELL P;  1VHE A;  3WC7 A;  2PC1 A;  4BMH A;  5JM6 A;  3D66 A;  4X3R A;  4PXE A;  4BBH A;  4CGN A;  4F9V A;  2QVP A;  1S5K A;  1R43 A;  1Z8L A;  3SJG A;  2CNS A;  4O23 A;  3DDD A;  4B14 A;  2WUU A;  1CPX A;  1BOB A;  3FEC A;  4TNU A;  5AG4 A;  4MCQ A;  4CYQ A;  1LAP A;  2FL4 A;  3D67 A;  3BJ8 A;  2ZW7 A;  3BLN A;  3KR5 A;  5AG6 A;  1UWY A;  2C1C A;  4DYO A;  2IMO A;  4UCN A;  1F57 A;  4P4E A;  2JEV A;  2Z11 A;  5J8C A;  2AJ6 A;  2PRQ A;  3EY5 A;  5F47 A;  4B6Z A;  2QYV A;  2YNC C;  3PB7 X;  4H6U A;  4KZT A;  1M44 A;  4MJ8 A;  2C27 A;  4GS4 A;  2OOT A;  1TXR A;  3SXO A;  2G9D A;  3W6X A;  2BEI A;  5JH9 A;  4UCM A;  1S7L A;  1VKC A;  5KTD A;  4C7I A;  1YK3 A;  4KUA A;  1Y0R A;  4JXR A;  3WR7 A;  5K8N A;  2Q7B A;  3BI1 A;  2VZZ A;  3JTK A;  3FRM A;  3PP9 A;  1F2P A;  3FB3 A;  2F8H A;  4H6Z A;  5C82 A;  1X12 A;  4FD7 A;  2ODF A;  2POK A;  3D7F A;  5F48 A;  4E0A A;  1ZG7 A;  4QBJ A;  4A32 A;  5I4M A;  3MN8 A;  4B5P B;  2PJ2 A;  1ZLH A;  4ORF A;  1P4N A;  3VWE A;  1R3N A;  4XNH C;  5LRG A;  3ISX A;  1RXT A;  2ARH A;  2FVG A;  2IJZ A;  3FH4 A;  3D68 A;  4F0X A;  3D7G A;  4UBR A;  5J8F A;  3B3C A;  3R96 A;  4X2T A;  1N71 A;  4Q7A A;  2HV2 A;  4CGL A;  1B6B A;  1X10 A;  5AG7 A;  2ZW4 A;  4BIN A;  3D8P A;  5IB9 A;  3FNC A;  4R3K A;  4EWT A;  2NMT A;  3B3S A;  3PZJ A;  1ARM A;  4ZBG A;  5K8P A;  4G1P A;  1GYT A;  4U9Y A;  1QSN A;  1YGH A;  4CYO A;  1L0C A;  4KOV A;  1NE9 A;  4RS2 A;  3FVL A;  3L2N A;  5C88 A;  4FD5 A;  4OC3 A;  4KOR A;  3RBU A;  4FBE A;  1XBU A;  3B7I A;  1IGB A;  4LQG A;  1OBR A;  2PJ9 A;  3R1K A;  4QVT A;  5E96 A;  5H86 A;  4AG7 A;  3TFY A;  2Z3O A;  3H8F A;  2Q4V A;  3F0A A;  1MK4 A;  1SQH A;  2P6G A;  2GAN A;  2ZEL A;  1Z5R A;  3H8G A;  4M85 A;  1XMB A;  2GIV A;  2Q43 A;  3GIU A;  4PK3 A;  2O28 A;  3SJX A;  3EXN A;  5IV0 A;  2BO9 A;  1CP6 A;  3EC4 A;  3IWG A;  3W6S A;  1H8L A;  4R87 A;  4OC0 A;  5KTA A;  3OWC A;  4M6G A;  2O4H A;  3WAB A;  4EVY A;  2JLM A;  1IOF A;  2GU2 A;  1HDU A;  4XPL A;  1Y7R A;  2PVV A;  2B3V A;  4A31 A;  2EO8 A;  2DXQ A;  1I21 A;  4HNX B;  4Q36 A;  3CZX A;  3D4U A;  2GLF A;  2F7V A;  2NSM A;  2AFS A;  2ZW5 A;  1YRE A;  2EK8 A;  3N7Z A; 
#chains in the Genus database with same CATH homology
 2EUI A;  2Y0M A;  4B12 A;  3G3S A;  1M4D A;  2YNE A;  4AG9 A;  3TCV A;  3G8W A;  4MFJ A;  4H89 A;  3I9S A;  3S6F A;  1YR0 A;  3B8G A;  4RI1 A;  3CXP A;  2Q0Y A;  3R9G A;  1VHS A;  2PSW A;  2Q04 A;  4MHD A;  4Y49 B;  1YX0 A;  4U9Z A;  4AVB A;  4XPK A;  4C2Y A;  2D4O A;  5IX3 A;  2HQY A;  2Q44 A;  2VBQ A;  1QST A;  4L8A A;  1RO5 A;  2X7B A;  5F49 A;  4IUS A;  4MI4 A;  2ZPA A;  2ATR A;  4JWP A;  4HKF A;  2B4D B;  5I0C A;  4B5P A;  1MJ9 A;  2GE3 A;  4ONU A;  3IGR A;  2EVN A;  3TO6 A;  2OB0 A;  2J8N A;  4MBU A;  2ZW6 A;  1I12 A;  4KOX A;  1I1D A;  2FSR A;  1B87 A;  2OZH A;  4KOT A;  3S6G A;  3DR6 A;  4KSF A;  1KZF A;  4LUA A;  5G22 A;  2YNC A;  5BWA B;  1IB1 E;  3JUW A;  2D4P A;  4FD6 A;  1WK4 A;  4MFQ A;  4K30 A;  3QAH A;  1XEB A;  2JDC A;  2KCW A;  4YRH A;  4C7H A;  1S7F A;  1XE4 A;  3VWD A;  1UFH A;  1IIC A;  1TIQ A;  1Z4R A;  1Q2D A;  5DWM A;  4A2Z A;  2Z3P A;  4C2Z A;  2RC4 A;  2R7H A;  4CRZ B;  2FT0 A;  1Q2C A;  2FIW A;  2YGW A;  4A30 A;  5EBV A;  4UA3 A;  1Z9U A;  1YVO A;  2J8M A;  1YVK A;  5AG5 A;  3CXQ A;  4PV6 A;  4QB9 A;  2FIA A;  1S7K A;  4KOY A;  2B5G B;  5GCN A;  3C26 A;  4Y49 C;  4NCZ A;  5JQ4 A;  2H5M A;  2VQY A;  1QSR A;  2I79 A;  1MJA A;  2P0W A;  3MGD A;  1S3Z A;  4HNY B;  4UFX A;  3FIX A;  4L89 A;  4XPD B;  4C68 A;  1K4J A;  4A33 A;  3TE4 A;  2CY2 A;  4KS9 A;  3A9L A;  3I3G A;  5IB0 A;  3D2M A;  4CYN A;  4CRY B;  4KOS A;  4CAV A;  1KUV A;  2VXK A;  4J3G A;  3P2H A;  3TO7 A;  4M3S A;  2Z3N A;  2Z3M A;  1CM0 A;  1S7N A;  5FVJ A;  2OZG A;  2QIR A;  2REE A;  4CGP A;  2VI7 A;  4UFW A;  2FE7 A;  4NXY A;  3D2P A;  2OU2 A;  3EO4 A;  1Z4E A;  4KLV A;  1J4J A;  2REF A;  3V8I A;  2B4D A;  1PUA A;  3FBU A;  2G3A A;  5A28 A;  4KVX A;  2WPX A;  4OAE A;  5KTC A;  3TT2 A;  3GKR A;  3H4Q A;  3JVN A;  4AVA A;  2OH1 A;  4JJX A;  1NMT A;  2PR1 A;  2I00 A;  2PRB A;  3RYO A;  1FY7 A;  4CAF A;  5CNP A;  1V0C A;  1IID A;  3F8K A;  3R9F A;  1S60 A;  2CNT A;  5AGE A;  2F5I A;  2JDD A;  4NSQ A;  4X5K A;  4DNC A;  3T9Y A;  3R9E A;  4I49 A;  4JD6 A;  3SHP A;  3K9U A;  2DPT A;  5EC4 A;  2QEC A;  4U5Y A;  3EFA A;  2BL1 A;  2FXF A;  5ISV A;  3GYA A;  4IF5 A;  2A4N A;  5JPH A;  3UY5 A;  4A95 A;  4OLL A;  4B5O A;  4QUS A;  1XMT A;  5H84 A;  2VZY A;  3TTH A;  4MFK A;  4MFP A;  2Z3L A;  4CS0 B;  2OZU A;  5A27 A;  4E2A A;  1YLE A;  3PGP A;  4UFV A;  4II9 A;  2R8V A;  4KUB A;  4JXQ A;  2QML A;  4F6A A;  4B11 A;  4ZGY B;  3FXT A;  1LRZ A;  2B4B A;  4CAW A;  4XPD C;  2B5G A;  3S6K A;  3GY9 A;  2CNM A;  3LD2 A;  1M4G A;  2B3U A;  4KSA A;  3TO9 A;  2VEZ A;  4UCP A;  4CYP A;  1R57 A;  2PQ8 A;  4YFJ A;  1QSO A;  4KOU A;  4CGM A;  4R9M A;  2PR8 A;  4R57 A;  1M1D A;  3F5B A;  4CAX A;  4LX9 A;  1KUY A;  1QSM A;  1Q2Y A;  4MFL A;  3ZJ0 A;  1BO4 A;  3CXS A;  2ZXV A;  4MY3 A;  4AB7 A;  4B10 A;  2R1I A;  4AVC A;  4JLY A;  4B13 A;  1PU9 A;  1M4I A;  1WWZ A;  3QB8 A;  5DWN A;  5HMN A;  3LOD A;  3NE7 A;  3IU1 A;  5G21 A;  3DNS A;  2YND A;  4KOW A;  2FS5 A;  4KVO E;  4R3L A;  1XIX A;  3DSB A;  1GHE A;  5G20 A;  2BUE A;  4UWI A;  1ZO0 A;  4MY0 A;  1NSL A;  4MFZ A;  2WSA A;  4YGO A;  4KVM E;  3D3S A;  4PSX A;  1Y9K A;  1IYK A;  2PDO A;  3IWE A;  2B58 A;  2Z3K A;  4QC6 A;  4HNW B;  3TOA A;  4PK2 A;  4UWJ A;  4XNH B;  4KLW A;  1P0H A;  3KKW A;  2DPS A;  2Z0Z A;  4OAD A;  3IU2 A;  2CXA A;  1U6M A;  2P6F A;  1MJB A;  2BSW A;  2G0B A;  2J8R A;  3H5Z A;  2R98 A;  3DR8 A;  2WPW A;  4E8O A;  1OZP A;  2AE6 A;  3E0K A;  4NF1 A;  3FYN A;  2IL4 A;  4NEX A;  3T90 A;  4FD4 A;  1XF8 A;  4CAE A;  3TOB A;  2HUZ A;  3BJ7 A;  1ON0 A;  2FCK A;  4C2X A;  4CGO A;  3SXN A;  1Y9W A;  1CJW A;  1KUX A;  5HH1 A;  3S6H A;  5G1Z A;  4F0Y A;  3P2F A;  3R95 A;  3ZZI A;  2Q4Y A;  2P6E A;  2Z10 A;  2K5T A;  4Q38 A;  3W91 A;  1IYL A;  2G3T A;  4PSW A;  2PC1 A;  4BMH A;  4BBH A;  4CGN A;  1S5K A;  4B14 A;  2CNS A;  3DDD A;  2WUU A;  1BOB A;  5AG4 A;  4CYQ A;  2FL4 A;  3BJ8 A;  2ZW7 A;  3BLN A;  5AG6 A;  4UCN A;  2JEV A;  2Z11 A;  5J8C A;  2AJ6 A;  3EY5 A;  5F47 A;  4H6U A;  2YNC C;  4KZT A;  1M44 A;  4MJ8 A;  2C27 A;  4GS4 A;  3W6X A;  3SXO A;  2BEI A;  4UCM A;  1S7L A;  1VKC A;  5KTD A;  4C7I A;  1YK3 A;  4KUA A;  4JXR A;  3WR7 A;  2Q7B A;  2VZZ A;  3JTK A;  3FRM A;  3PP9 A;  3FB3 A;  4H6Z A;  5C82 A;  4FD7 A;  5F48 A;  4E0A A;  4QBJ A;  4A32 A;  4B5P B;  4ORF A;  1P4N A;  3VWE A;  4XNH C;  1RXT A;  2ARH A;  4F0X A;  4UBR A;  5J8F A;  3R96 A;  1N71 A;  4CGL A;  2HV2 A;  1B6B A;  5AG7 A;  2ZW4 A;  3D8P A;  3FNC A;  4R3K A;  2NMT A;  3PZJ A;  4ZBG A;  4U9Y A;  1QSN A;  1YGH A;  4CYO A;  1L0C A;  4KOV A;  1NE9 A;  4RS2 A;  5C88 A;  4FD5 A;  4KOR A;  3R1K A;  4QVT A;  5E96 A;  5H86 A;  4AG7 A;  3TFY A;  2Z3O A;  2Q4V A;  3F0A A;  1MK4 A;  1SQH A;  2P6G A;  2GAN A;  4PK3 A;  5F46 A;  4M85 A;  2GIV A;  2O28 A;  3EXN A;  5IV0 A;  3EC4 A;  3IWG A;  3W6S A;  4R87 A;  5KTA A;  3OWC A;  4EVY A;  2JLM A;  4XPL A;  1Y7R A;  2B3V A;  4A31 A;  2DXQ A;  1I21 A;  4HNX B;  4Q36 A;  2ZW5 A;  1YRE A;  3N7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...