2J8RA

Structure of p. aeruginosa acetyltransferase pa4866 solved in complex with l-methionine sulfoximine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
170
structure length
170
Chain Sequence
ASIRDAGVADLPGILAIYNDAVGNTTAIWNETPVDLANRQAWFDARARQGYPILVASDAAGEVLGYASYGDWRPFEGFRGTVEHSVYVRDDQRGKGLGVQLLQALIERARAQGLHVMVAAIESGNAASIGLHRRLGFEISGQMPQVGQKFGRWLDLTFMQLNLDPTRSAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLTRANSFERASE PA4866 FROM P. AERUGINOSA
publication title L-Methionine Sulfoximine, But not Phosphinothricin, is a Substrate for an Acetyltransferase (Gene Pa4866) from Pseudomonas Aeruginosa: Structural and Functional Studies.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 51
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2j8rA00
4H6ZA 2QIRA 5JPHA 2HUZA 3S6GA 2ZW5A 5ISVA 4CAXA 2B3VA 3R9GA 2R98A 1S60A 3R95A 4FD7A 4DNCA 4CAWA 1S7FA 4Y49B 1BOBA 2CNSA 2Q0YA 3V8IA 3F8KA 2G3AA 2HV2A 2OU2A 2ZW4A 3GKRA 2CNMA 4U9YA 2FIWA 3DR8A 2HQYA 3FBUA 1QSTA 2Z11A 5C82A 2J8MA 4LUAA 3F0AA 4JJXA 3MGDA 4QC6A 1YLEA 2VZYA 4HNXB 2Z0ZA 1SQHA 4KUBA 2OH1A 1WWZA 4F6AA 1QSMA 3SHPA 3TO7A 2P0WA 2WPXA 1VKCA 3R9FA 4MY0A 2QMLA 3GYAA 1FY7A 5IB0A 4H6UA 4UA3A 2J8NA 1WK4A 2EUIA 4XPKA 3UY5A 4KORA 4KVOE 3QAHA 1M1DA 2PR8A 1Y9KA 2BL1A 3EXNA 2Q4VA 4B5OA 1QSNA 2P6GA 4AG7A 2D4PA 2QECA 5H86A 4KLWA 3R9EA 1IYLA 3IGRA 4ORFA 1L0CA 2B5GB 1M4IA 2OZHA 4F0YA 5KTDA 1YREA 1YX0A 4M85A 2DXQA 4M3SA 4E8OA 5KTCA 1ON0A 3G3SA 3D2MA 3W6XA 1M4GA 1RXTA 2FS5A 1Q2YA 3P2FA 2ZW6A 4LX9A 1YGHA 2JEVA 2FE7A 3I9SA 4CRYB 4XPDB 3CXQA 3GY9A 2ARHA 4JXQA 2R1IA 3G8WA 4II9A 1I1DA 2B4DA 2NMTA 3P2HA 1MJBA 4PV6A 3BLNA 1J4JA 4KOUA 1NE9A 2B58A 2KCWA 4OAEA 1KZFA 2X7BA 4NSQA 3QB8A 1IB1E 3KKWA 2A4NA 1M4DA 3ZJ0A 1RO5A 2PRBA 1MJ9A 2AJ6A 2R7HA 5J8FA 4E0AA 3LD2A 3S6FA 3VWDA 2GIVA 4HKFA 5KTAA 3TT2A 2BEIA 4Y49C 4R57A 3R96A 2PQ8A 4IUSA 1I21A 4K30A 1XE4A 4CRZB 2B4BA 3IWGA 4PK2A 4AVCA 3TO6A 2Z10A 2OZUA 3K9UA 3TCVA 3W91A 1TIQA 4ONUA 4R3KA 1S7NA 1PUAA 2FCKA 3TOBA 4CAVA 2O28A 4B5PA 4L89A 2B4DB 1Z4RA 4KZTA 3EO4A 4QBJA 2VBQA 5DWNA 4KOSA 1QSOA 4JXRA 1NMTA 3ZZIA 4AVAA 4YFJA 1YVOA 3R1KA 2ZW7A 4GS4A 3JVNA 2H5MA 4FD5A 4AB7A 4KOXA 4L8AA 5DWMA 3D2PA 2Q44A 2D4OA 3T90A 5FVJA 2PDOA 5C88A 3BJ8A 3E0KA 3EFAA 4XNHB 4UBRA 2VQYA 2Q7BA 3RYOA 3EY5A 3F5BA 4EVYA 1Z9UA 2VI7A 4PSWA 2REFA 1YVKA 4PSXA 5E96A 2OB0A 4MI4A 4KLVA 4IF5A 4RI1A 4MJ8A 2AE6A 2CY2A 3DR6A 4AG9A 4KUAA 2R8VA 4B5PB 4HNWB 1LRZA 3WR7A 1KUYA 2GANA 4JWPA 4X5KA 1XIXA 4KVXA 4XPDC 3C26A 3JUWA 4H89A 3FXTA 4E2AA 3TFYA 1V0CA 3W6SA 4BMHA 5H84A 4KOWA 2CNTA 1QSRA 1NSLA 2VXKA 3OWCA 1Z4EA 4FD6A 1KUVA 1CJWA 3TE4A 4JD6A 1S7LA 1R57A 4YGOA 1M44A 3S6HA 1CM0A 3PZJA 3BJ7A 2JDCA 1KUXA 5F46A 5F49A 1N71A 2I79A 4NF1A 1IICA 4XPLA 4YRHA 1GHEA 2P6EA 4QVTA 4KVME 4NEXA 3NE7A 1B6BA 3TOAA 1MJAA 4KOYA 4RS2A 5HMNA 1U6MA 1Y9WA 1P4NA 2B5GA 4QB9A 3FYNA 1OZPA 1P0HA 3FB3A 3FRMA 2PSWA 1VHSA 3TO9A 1IIDA 2FIAA 3SXOA 2VZZA 1XMTA 5I0CA 4PK3A 3H4QA 3I3GA 4NXYA 2IL4A 2VEZA 2P6FA 2G3TA 3FNCA 2J8RA 4UWIA 2ZPAA 2I00A 3PP9A 5F48A 1K4JA 2Y0MA 1PU9A 1YK3A 1S3ZA 4R3LA 4MHDA 5CNPA 3DSBA 4CS0B 2B3UA 4R87A 5IX3A 3EC4A 1IYKA 2FXFA 3DDDA 4UWJA 3B8GA 1UFHA 3CXSA 3D3SA 4U5YA 5EC4A 2K5TA 2OZGA 4AVBA 2BUEA 1XEBA 2FT0A 1MK4A 4U9ZA 3T9YA 3D8PA 2GE3A 2F5IA 2PR1A 2Q04A 3SXNA 4ZBGA 5F47A 4J3GA 4XNHC 2REEA 1XF8A 2FSRA 2JLMA 2C27A 2EVNA 3DNSA 1Q2DA 2G0BA 2Q4YA 3FIXA 3PGPA 4KOTA 4QUSA 1I12A 2FL4A 2WPWA 2PC1A 3TTHA 4I49A 4FD4A 5J8CA 1BO4A 3LODA 4HNYB 2RC4A 3CXPA 3VWEA 4NCZA 1B87A 5HH1A 5GCNA 4OADA 4KOVA 1Y7RA 2BSWA 5EBVA 5JQ4A 2ZXVA 4OLLA 1Q2CA 4MY3A 4JLYA 1S5KA 2JDDA 3N7ZA 4MBUA 5IV0A 3S6KA 1YR0A 4R9MA 2ATRA 1S7KA
chains in the Genus database with same CATH superfamily
4H6ZA 2PJ4A 1XMBA 2QIRA 3IEHA 3SI0A 2HUZA 5JPHA 1Q7LA 3S6GA 2ZW5A 2PJ0A 3JRUA 4UCMA 4IAVA 5ISVA 3PRTA 4PXDA 4CAXA 4UF4A 2B3VA 3R9GA 2R98A 1S60A 3R95A 3ISZA 4FD7A 2HC9A 8CPAA 4P6YA 4DNCA 3FJUA 4CAWA 3FF3A 1S7FA 4Y49B 5CPAA 1BOBA 2CNSA 2Q0YA 2IMOA 2Z3NA 3D68A 4C2XA 3V8IA 4JYWA 4R8FA 4MHPA 3GUXA 5IB9A 1OBRA 2Q43A 3F8KA 3IFEA 3K2KA 5C82A 2G3AA 2HV2A 2C6CA 2OU2A 2ZW4A 3GKRA 4WJBA 1BLLE 3L2NA 2CNMA 4NGNA 4U9YA 2FIWA 3DR8A 2HQYA 2ZOGA 3FBUA 2PJ3A 4GM5A 2POKA 4C2YA 3ISXA 4P4DA 2XEFA 1QSTA 3MN8A 5THWA 5JGFA 2Z11A 1Z2LA 4A95A 3NA6A 2J8MA 3PB8X 1X10A 4LUAA 2NYQA 3F0AA 1AMPA 4MFJA 1Y7EA 3D7DA 3MGDA 4JJXA 2ZEMA 3FX6A 2EBJA 4QC6A 1YLEA 2VZYA 4HNXB 2Z0ZA 1SQHA 3RAMA 1AUGA 2PJ1A 4KUBA 2OH1A 2ZEGA 4NGQA 1PCAA 4PQAA 1WWZA 2ZENA 4F6AA 3WC5A 1QSMA 3SHPA 3TO7A 2EWBA 1YW6A 2GU2A 5HVHA 4P4IA 2P0WA 2WPXA 4KSFA 1LFWA 1VKCA 3R9FA 3D7HA 4MY0A 2QMLA 3IWWA 3GYAA 1FY7A 5IB0A 4H6UA 3LWUA 2J8NA 1IGBA 4UA3A 2PJBA 1WK4A 2EUIA 4XPKA 3UY5A 3WC7A 4KORA 4KVOE 4FAIA 3QAHA 3NE8A 1M1DA 4MHYA 5LRJA 2DEAA 1Y9KA 2GFQA 2JEWA 2BL1A 1XFOA 2PR8A 3EXNA 2Q4VA 3H8EA 1QSNA 2P6GA 4MFZA 3RNZA 2D4PA 3SJGA 4AG7A 2QECA 4BBHA 4FUUA 5H86A 4KLWA 2RFHA 3R9EA 4OIWA 1IYLA 1HDUA 3IGRA 4ORFA 5AGEA 4ZY1A 1L0CA 4P44A 2B5GB 4NGMA 1M4IA 4Q36A 2Z3MA 3GIUA 4P4JA 3S9MA 3VH9A 1CPXA 2OZHA 1TKFA 4PPZA 4F0YA 5KTDA 1LAMA 2Q51A 3BI0A 3B3CA 1IY7A 1XBUA 1YREA 3PFEA 4RN7A 1YX0A 4M85A 3LMSA 4JZ0A 3SJEA 3VARA 2WUUA 5JH9A 2DXQA 4M3SA 4E8OA 3DLJA 5KTCA 2ZEFA 1ON0A 3G3SA 2AFUA 3D2MA 3B7IA 3W6XA 1ARLA 4BD9A 1M4GA 1YSJA 4OIDA 1RXTA 2FS5A 1Q2YA 3P2FA 2ZW6A 4LX9A 1YGHA 4YU9A 2JEVA 1TF8A 4A31A 4GXHA 4KS9A 3FVLA 2ODFA 2AFWA 2FE7A 3PB7X 3I9SA 1IOIA 2PCUA 4NJQA 1CBXA 1XRYA 4ZY2A 4H2KA 1R43A 2CXAA 4XPDB 5D29A 4CRYB 1VGYA 3CXQA 3GY9A 4Q7AA 3LACA 3B3TA 2ARHA 4JXQA 4PXCA 3WABA 2R1IA 4FWUA 1VIXA 3G8WA 4II9A 1I1DA 2B4DA 2J9AA 2PIYA 2NMTA 3P2HA 3KQXA 1ZG8A 5G21A 4DYOA 4A2ZA 1MJBA 4PXEA 1QQ9A 2V8DA 3TC8A 1JWQA 4PV6A 4CGLA 3N5FA 3D7FA 1UWYA 1IOFA 1EE3P 1J4JA 3BLNA 4KOUA 5A28A 2ZEHA 4ZI6A 1NE9A 2B58A 2KCWA 4OAEA 1KZFA 2X7BA 4NSQA 4CAFA 2YGWA 4NGSA 4R7MA 3QB8A 1IB1E 2C6GA 1H8LA 2A4NA 1M4DA 3KKWA 4M6HA 4F8ZA 3ZJ0A 1RO5A 2PRBA 3I1UA 1MJ9A 2AJ6A 2R7HA 1RTQA 4E0AA 2O4HA 5J8FA 4Q38A 2AFOA 3LD2A 3S6FA 3VWDA 1TKJA 4NFRA 2GIVA 4CYQA 2PJ8A 4HKFA 3JTKA 5KTAA 4B6ZA 2AFMA 4CYPA 3TT2A 1CG2A 2AFSA 2BEIA 4TWEA 5I4MA 4MCQA 4MHZA 2GREA 4Y49C 4R57A 4KSAA 2ZEDA 3R96A 2PQ8A 3B3WA 4IUSA 1I21A 2PJCA 1XE4A 4K30A 2BCOA 4X3RA 4CRZB 4DJLA 5AG7A 3D66A 6CPAA 2B4BA 4K3NA 4EMEA 5LYFA 2WZNA 3IWGA 3KR5A 4PK2A 3NFZA 4AVCA 2F7VA 1ZLIA 3TO6A 2Z10A 4UIBA 2OZUA 3K9UA 3TCVA 3W91A 1Z8XA 1XJOA 3B2YA 3KI9A 2EO8A 1TIQA 4ONUA 3V7ZA 1FNOA 4R3KA 1ZG9A 2ABZA 2RB7A 1S7NA 1PUAA 4CGOA 2WYRA 1BPMA 2CTBA 2FCKA 3TOBA 4C7HA 5HVFA 4A38A 4CAVA 2O28A 3NH8A 4B5PA 4L89A 5BWAB 2I3CA 2EK9A 2B4DB 4MCRA 1Z4RA 4KZTA 3EO4A 4O23A 4UFVA 4QBJA 5JM6A 1QMUA 2VBQA 5DWNA 4KOSA 3S9NA 1QSOA 2PJ9A 4JXRA 1VHOA 1NMTA 2QYVA 3ZZIA 4AVAA 4MFQA 3CT9A 2JBKA 4MFKA 4YFJA 1YVOA 3CPAA 1ZO0A 3R1KA 4OC3A 2YNCC 2ZW7A 4GS4A 2F8HA 5HVGA 4MCPA 4MRIA 4CGNA 3JVNA 2H5MA 4FD5A 1HDQA 4AB7A 4LQGA 4OC0A 4KOXA 4L8AA 4UCNA 5J1QA 2QJ8A 5DWMA 4DUKA 3D2PA 4C68A 2Q44A 2D4OA 1YQEA 2IJZA 4B14A 4CYNA 4EFDA 3K9TA 5FVJA 3T90A 2PDOA 1JQGA 4OC5A 3BJ8A 5C88A 2AFZA 3E0KA 3EFAA 4UBRA 1BAVA 4XNHB 4A39A 2VQYA 2Q7BA 3RYOA 2PJ6A 1LOKA 3IC1A 3EY5A 4A37A 3F5BA 3B3VA 4MXUA 1CP7A 4EVYA 1Z9UA 3IU2A 4B11A 2VI7A 2WSAA 4P4FA 2REFA 4PSWA 1YVKA 5EMIA 4UIAA 5K8MA 4PSXA 2PJ5A 5E96A 1R3NA 1AYEA 2YNEA 2OB0A 2DPTA 3H8FA 4UEZA 4RUHA 4MI4A 4Z65A 3IO1A 4KLVA 4IF5A 2PJ2A 4RI1A 4MJ8A 1F2OA 2AE6A 2CY2A 1CX8A 3DR6A 4AG9A 4IK2A 2PRQA 4KUAA 2O53A 1IU8A 5CBMA 1X12A 2ZEPA 1CP6A 3KZWA 2XEGA 2R8VA 4OC2A 4R76A 4FBEA 3IU1A 3D4UA 4B5PB 3NH5A 4HNWB 4M6GA 4B13A 5G1ZA 1LRZA 4G1PA 5AG6A 3WR7A 4ZYQA 5LYDA 1KUYA 4ONWA 2GANA 4JWPA 4X5KA 3WT4A 2ZEEA 1ZLHA 1XIXA 1LAPA 3PBEA 4KVXA 4XPDC 4CAEA 1HEEA 2C6PA 1YLOA 2V8VA 3C26A 5AG5A 3JUWA 5D8NA 1ELLP 3NH4A 4H89A 4P4EA 3PB6X 3FXTA 3CPXA 1TXRA 4IHMA 4W9YA 4E2AA 4ZX8A 3TFYA 1LANA 1V0CA 3PEIA 1XOVA 1Z8TA 3W6SA 4A33A 2ZOFA 3SI2A 2PE3A 4MMOA 1DTDA 4BMHA 2G9DA 5H84A 4WWVA 1YMEA 4KOWA 2CNTA 2GLJA 1QSRA 4OKOA 1NSLA 2VXKA 3OWCA 1CPSA 1Z4EA 2JBJA 2V8GA 4FD6A 5AG4A 1KUVA 3IWEA 5K8NA 1CJWA 3TE4A 1DE4C 2YNCA 4JD6A 3FEDA 1S7LA 1R57A 2PVWA 4YGOA 1M44A 2Q4ZA 3FECA 1CM0A 3FEEA 3PZJA 3S6HA 3BJ7A 2JDCA 3FMCA 4HPSA 1KUXA 5F46A 3WC6A 4MFLA 5F49A 3PB9X 1N71A 2I79A 2PJAA 1IICA 4NF1A 4XPLA 4YRHA 3GB0A 2HB6A 1GHEA 5A27A 3MRUA 2P6EA 4QVTA 4KVME 3V38A 4NEXA 2Z3PA 3NE7A 3RO0A 1B6BA 1NSAA 3TOAA 3A9LA 5K8PA 1MJAA 4KOYA 4RS2A 5HMNA 2CF4A 1TKHA 3B3SA 3D7GA 1U6MA 1KWMA 1ARMA 1P4NA 1Y9WA 2B5GA 3CDXA 4QB9A 3T8WA 3FYNA 1OZPA 1ZG7A 2VL1A 1P0HA 3S9LA 2DF5A 3FB3A 2PSWA 3FRMA 3KHXA 4CPAA 2NSMA 1VHSA 3TO9A 1IIDA 2FIAA 3PBBA 3SXOA 2VZZA 4F0XA 1XMTA 5I0CA 4PK3A 3H4QA 3I3GA 4NXYA 5G22A 2IL4A 2VEZA 2P6FA 5G20A 2G3TA 2ZELA 4YWYA 3FNCA 2J8RA 4UWIA 2ZPAA 2I00A 3PP9A 5F48A 4C2ZA 1K4JA 2AFXA 2Y0MA 1PU9A 4F9UA 3KL9A 1YK3A 1S3ZA 2QVPA 4R3LA 3BXMA 4BINA 2Z3OA 3QNVA 4MHDA 5CNPA 3KR4A 3D67A 3DSBA 4CS0B 2B3UA 2BO9A 4P4BA 1Y0RA 4R87A 3DGVA 2YNDA 3EC4A 4NJRA 4A32A 5IX3A 1IYKA 2FXFA 3DDDA 4MCSA 4NGTA 4X2TA 1F2PA 4UWJA 4CYOA 4ZGYB 3KHZA 3B8GA 1UFHA 3CXSA 3D3SA 3PB4X 4U5YA 4TNUA 5EC4A 3BHXA 2K5TA 2OZGA 4AVBA 2PJ7A 4NGRA 3SJFA 4UEFA 4EWTA 5F09A 1TF9A 2BUEA 2FVGA 1XEBA 2FT0A 1MK4A 2ZEOA 4U9ZA 3IIBA 1Y0YA 3T9YA 3D8PA 2GE3A 3KGQA 2F5IA 2PR1A 4KSIA 1BPNA 2Q04A 4OC4A 3B35A 3SXNA 5LRKA 2CTCA 4ZBGA 3TX8A 2Z3KA 5F47A 2GLFA 3IJ3A 4M6IA 4X8IA 4J3GA 3QAYA 4XNHC 2REEA 2EK8A 1XF8A 2CIJA 2FSRA 4NGPA 3VATA 5ELYA 1VHEA 1Z5RA 4MFPA 3FH4A 2JLMA 2C27A 2EVNA 3DNSA 3KQZA 4A30A 4B10A 1Q2DA 2G0BA 2OR4A 2Q4YA 3FIXA 4ZX9A 3PGPA 3H5ZA 1M4LA 4AXVA 4UFXA 3KASA 3HUVA 4KOTA 4PXBA 4F9VA 2XEJA 4QUSA 4UFWA 2Z3LA 1I12A 2FL4A 7CPAA 2WPWA 2PC1A 3BI1A 1Z8WA 2V8HA 4I49A 4FD4A 3TTHA 5J8CA 4MHNA 4LQ6A 5LYLA 5K8OA 1BO4A 4CGMA 3LODA 4HNYB 4ZY0A 2ANPA 1PYTB 4OP4A 1ELMP 3SI1A 1FT7A 2RC4A 3CXPA 5DS0A 4NCZA 1B87A 4UCPA 3HLPA 3RZAA 3VWEA 4CGPA 2PIZA 5HH1A 1Z8LA 2Q7SA 4P10A 5GCNA 2XEIA 2BOAA 5LRGA 2IQ6A 4OADA 4KOVA 4B5OA 4R6TA 3PFOA 2PVVA 1Y7RA 2OOTA 4OC1A 3SJXA 2BSWA 5EBVA 1F57A 5JQ4A 5LYIA 2ZXVA 1GYTA 4OLLA 1Q2CA 3H8GA 2DPSA 1A2ZA 4P45A 4B12A 1LCPA 4OMEA 4A94A 3GLJA 3CZXA 4MY3A 4C7IA 5HXDA 2C1CA 4JLYA 1S5KA 2JDDA 1YW4A 3N7ZA 4MBUA 5IV0A 3S6KA 1YR0A 4R9MA 2V77A 4UEEA 3RBUA 2ATRA 1S7KA
chains in the Genus database with same CATH topology
4H6ZA 2QIRA 5JPHA 2HUZA 3S6GA 2ZW5A 4UCMA 5ISVA 4CAXA 2B3VA 3R9GA 2R98A 1S60A 3R95A 4FD7A 4DNCA 4CAWA 1S7FA 4Y49B 1BOBA 2CNSA 2Q0YA 2Z3NA 4C2XA 3V8IA 3F8KA 2G3AA 2HV2A 2OU2A 2ZW4A 3GKRA 2CNMA 4U9YA 2FIWA 3DR8A 2HQYA 3FBUA 4C2YA 1QSTA 2Z11A 4A95A 5C82A 2J8MA 4LUAA 3F0AA 4MFJA 4JJXA 3MGDA 4QC6A 1YLEA 2VZYA 4HNXB 2Z0ZA 1SQHA 4KUBA 2OH1A 1WWZA 4F6AA 1QSMA 3SHPA 3TO7A 2P0WA 2WPXA 4KSFA 1VKCA 3R9FA 4MY0A 2QMLA 3GYAA 1FY7A 5IB0A 4H6UA 4UA3A 2J8NA 1WK4A 2EUIA 4XPKA 3UY5A 4KORA 4KVOE 3QAHA 1M1DA 2PR8A 1Y9KA 2BL1A 4MFZA 3EXNA 2Q4VA 4B5OA 1QSNA 2P6GA 4AG7A 2D4PA 2QECA 4BBHA 5H86A 4KLWA 3R9EA 1IYLA 3IGRA 4ORFA 5AGEA 1L0CA 4Q36A 2B5GB 1M4IA 2Z3MA 2OZHA 4F0YA 5KTDA 1YREA 1YX0A 4M85A 2WUUA 2DXQA 4M3SA 4E8OA 5KTCA 1ON0A 3G3SA 3D2MA 3W6XA 1M4GA 1RXTA 2FS5A 1Q2YA 3P2FA 2ZW6A 4LX9A 1YGHA 2JEVA 4A31A 4KS9A 2FE7A 3I9SA 2CXAA 4XPDB 4CRYB 3CXQA 3GY9A 2ARHA 4JXQA 2R1IA 3G8WA 4II9A 1I1DA 2B4DA 2NMTA 3P2HA 5G21A 4A2ZA 1MJBA 4PV6A 4CGLA 3BLNA 5A28A 1J4JA 4KOUA 1NE9A 2B58A 2KCWA 4OAEA 1KZFA 2X7BA 4NSQA 4CAFA 2YGWA 3QB8A 1IB1E 3KKWA 2A4NA 1M4DA 3ZJ0A 1RO5A 2PRBA 1MJ9A 2AJ6A 2R7HA 5J8FA 4E0AA 4Q38A 3LD2A 3S6FA 3VWDA 4CYQA 2GIVA 4HKFA 3JTKA 5KTAA 4CYPA 3TT2A 2BEIA 4Y49C 4R57A 4KSAA 3R96A 2PQ8A 4IUSA 1I21A 4K30A 1XE4A 4CRZB 5AG7A 2B4BA 3IWGA 4PK2A 4AVCA 3TO6A 2Z10A 2OZUA 3K9UA 3TCVA 3W91A 1TIQA 4ONUA 4R3KA 1S7NA 1PUAA 4CGOA 2FCKA 3TOBA 4C7HA 4CAVA 2O28A 4B5PA 5BWAB 4L89A 2B4DB 1Z4RA 4KZTA 3EO4A 4UFVA 4QBJA 2VBQA 5DWNA 4KOSA 1QSOA 4JXRA 1NMTA 3ZZIA 4AVAA 4MFQA 4MFKA 4YFJA 1YVOA 3R1KA 1ZO0A 2YNCC 2ZW7A 4GS4A 4CGNA 3JVNA 2H5MA 4FD5A 4AB7A 4KOXA 4L8AA 4UCNA 5DWMA 3D2PA 4C68A 2Q44A 2D4OA 4B14A 4CYNA 3T90A 5FVJA 2PDOA 5C88A 3BJ8A 3E0KA 3EFAA 4XNHB 4UBRA 2VQYA 2Q7BA 3RYOA 3EY5A 3F5BA 4EVYA 1Z9UA 3IU2A 4B11A 2VI7A 2WSAA 4PSWA 2REFA 1YVKA 4PSXA 5E96A 2YNEA 2OB0A 2DPTA 4MI4A 4KLVA 4IF5A 4RI1A 4MJ8A 2AE6A 2CY2A 3DR6A 4AG9A 4KUAA 2R8VA 3IU1A 4B5PB 4HNWB 4B13A 5G1ZA 1LRZA 5AG6A 3WR7A 1KUYA 2GANA 4JWPA 4X5KA 1XIXA 4KVXA 4XPDC 4CAEA 5AG5A 3C26A 3JUWA 4H89A 3FXTA 4E2AA 3TFYA 1V0CA 3W6SA 4A33A 4BMHA 5H84A 4KOWA 2CNTA 1QSRA 1NSLA 2VXKA 3OWCA 1Z4EA 5AG4A 4FD6A 1KUVA 3IWEA 1CJWA 3TE4A 2YNCA 4JD6A 1S7LA 1R57A 4YGOA 1M44A 3S6HA 1CM0A 3PZJA 3BJ7A 2JDCA 1KUXA 5F46A 4MFLA 5F49A 1N71A 2I79A 4NF1A 1IICA 4XPLA 4YRHA 1GHEA 5A27A 2P6EA 4QVTA 4KVME 4NEXA 2Z3PA 3NE7A 1B6BA 3TOAA 3A9LA 1MJAA 4KOYA 4RS2A 5HMNA 1U6MA 1Y9WA 1P4NA 2B5GA 4QB9A 3FYNA 1OZPA 1P0HA 3FB3A 3FRMA 2PSWA 1VHSA 3TO9A 1IIDA 2FIAA 3SXOA 2VZZA 4F0XA 1XMTA 5I0CA 4PK3A 3H4QA 3I3GA 4NXYA 5G22A 2IL4A 2VEZA 2P6FA 5G20A 2G3TA 3FNCA 2J8RA 4UWIA 2ZPAA 2I00A 3PP9A 5F48A 4C2ZA 1K4JA 2Y0MA 1PU9A 1YK3A 1S3ZA 4R3LA 2Z3OA 4MHDA 5CNPA 3DSBA 4CS0B 2B3UA 4R87A 5IX3A 2YNDA 3EC4A 4A32A 1IYKA 2FXFA 3DDDA 4UWJA 4CYOA 4ZGYB 3B8GA 1UFHA 3CXSA 3D3SA 4U5YA 5EC4A 2K5TA 2OZGA 4AVBA 2BUEA 1XEBA 2FT0A 1MK4A 4U9ZA 3T9YA 3D8PA 2GE3A 2F5IA 2PR1A 2Q04A 3SXNA 4ZBGA 2Z3KA 5F47A 4J3GA 4XNHC 2REEA 1XF8A 2FSRA 4MFPA 2JLMA 2C27A 2EVNA 3DNSA 4A30A 4B10A 1Q2DA 2G0BA 2Q4YA 3FIXA 3PGPA 3H5ZA 4UFXA 4KOTA 4QUSA 4UFWA 2Z3LA 1I12A 2FL4A 2WPWA 2PC1A 3TTHA 4I49A 4FD4A 5J8CA 1BO4A 4CGMA 3LODA 4HNYB 2RC4A 3CXPA 3VWEA 4NCZA 1B87A 4UCPA 4CGPA 5HH1A 5GCNA 4OADA 4KOVA 1Y7RA 2BSWA 5EBVA 5JQ4A 2ZXVA 4OLLA 1Q2CA 2DPSA 4B12A 4MY3A 4C7IA 4JLYA 1S5KA 2JDDA 3N7ZA 4MBUA 5IV0A 3S6KA 1YR0A 4R9MA 2ATRA 1S7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H6Z A;  2QIR A;  5JPH A;  2HUZ A;  3S6G A;  2ZW5 A;  5ISV A;  4CAX A;  2B3V A;  3R9G A;  2R98 A;  1S60 A;  3R95 A;  4FD7 A;  4DNC A;  4CAW A;  1S7F A;  4Y49 B;  1BOB A;  2CNS A;  2Q0Y A;  3V8I A;  3F8K A;  2G3A A;  2HV2 A;  2OU2 A;  2ZW4 A;  3GKR A;  2CNM A;  4U9Y A;  2FIW A;  3DR8 A;  2HQY A;  3FBU A;  1QST A;  2Z11 A;  5C82 A;  2J8M A;  4LUA A;  3F0A A;  4JJX A;  3MGD A;  4QC6 A;  1YLE A;  2VZY A;  4HNX B;  2Z0Z A;  1SQH A;  4KUB A;  2OH1 A;  1WWZ A;  4F6A A;  1QSM A;  3SHP A;  3TO7 A;  2P0W A;  2WPX A;  1VKC A;  3R9F A;  4MY0 A;  2QML A;  3GYA A;  1FY7 A;  5IB0 A;  4H6U A;  4UA3 A;  2J8N A;  1WK4 A;  2EUI A;  4XPK A;  3UY5 A;  4KOR A;  4KVO E;  3QAH A;  1M1D A;  2PR8 A;  1Y9K A;  2BL1 A;  3EXN A;  2Q4V A;  4B5O A;  1QSN A;  2P6G A;  4AG7 A;  2D4P A;  2QEC A;  5H86 A;  4KLW A;  3R9E A;  1IYL A;  3IGR A;  4ORF A;  1L0C A;  2B5G B;  1M4I A;  2OZH A;  4F0Y A;  5KTD A;  1YRE A;  1YX0 A;  4M85 A;  2DXQ A;  4M3S A;  4E8O A;  5KTC A;  1ON0 A;  3G3S A;  3D2M A;  3W6X A;  1M4G A;  1RXT A;  2FS5 A;  1Q2Y A;  3P2F A;  2ZW6 A;  4LX9 A;  1YGH A;  2JEV A;  2FE7 A;  3I9S A;  4CRY B;  4XPD B;  3CXQ A;  3GY9 A;  2ARH A;  4JXQ A;  2R1I A;  3G8W A;  4II9 A;  1I1D A;  2B4D A;  2NMT A;  3P2H A;  1MJB A;  4PV6 A;  3BLN A;  1J4J A;  4KOU A;  1NE9 A;  2B58 A;  2KCW A;  4OAE A;  1KZF A;  2X7B A;  4NSQ A;  3QB8 A;  1IB1 E;  3KKW A;  2A4N A;  1M4D A;  3ZJ0 A;  1RO5 A;  2PRB A;  1MJ9 A;  2AJ6 A;  2R7H A;  5J8F A;  4E0A A;  3LD2 A;  3S6F A;  3VWD A;  2GIV A;  4HKF A;  5KTA A;  3TT2 A;  2BEI A;  4Y49 C;  4R57 A;  3R96 A;  2PQ8 A;  4IUS A;  1I21 A;  4K30 A;  1XE4 A;  4CRZ B;  2B4B A;  3IWG A;  4PK2 A;  4AVC A;  3TO6 A;  2Z10 A;  2OZU A;  3K9U A;  3TCV A;  3W91 A;  1TIQ A;  4ONU A;  4R3K A;  1S7N A;  1PUA A;  2FCK A;  3TOB A;  4CAV A;  2O28 A;  4B5P A;  4L89 A;  2B4D B;  1Z4R A;  4KZT A;  3EO4 A;  4QBJ A;  2VBQ A;  5DWN A;  4KOS A;  1QSO A;  4JXR A;  1NMT A;  3ZZI A;  4AVA A;  4YFJ A;  1YVO A;  3R1K A;  2ZW7 A;  4GS4 A;  3JVN A;  2H5M A;  4FD5 A;  4AB7 A;  4KOX A;  4L8A A;  5DWM A;  3D2P A;  2Q44 A;  2D4O A;  3T90 A;  5FVJ A;  2PDO A;  5C88 A;  3BJ8 A;  3E0K A;  3EFA A;  4XNH B;  4UBR A;  2VQY A;  2Q7B A;  3RYO A;  3EY5 A;  3F5B A;  4EVY A;  1Z9U A;  2VI7 A;  4PSW A;  2REF A;  1YVK A;  4PSX A;  5E96 A;  2OB0 A;  4MI4 A;  4KLV A;  4IF5 A;  4RI1 A;  4MJ8 A;  2AE6 A;  2CY2 A;  3DR6 A;  4AG9 A;  4KUA A;  2R8V A;  4B5P B;  4HNW B;  1LRZ A;  3WR7 A;  1KUY A;  2GAN A;  4JWP A;  4X5K A;  1XIX A;  4KVX A;  4XPD C;  3C26 A;  3JUW A;  4H89 A;  3FXT A;  4E2A A;  3TFY A;  1V0C A;  3W6S A;  4BMH A;  5H84 A;  4KOW A;  2CNT A;  1QSR A;  1NSL A;  2VXK A;  3OWC A;  1Z4E A;  4FD6 A;  1KUV A;  1CJW A;  3TE4 A;  4JD6 A;  1S7L A;  1R57 A;  4YGO A;  1M44 A;  3S6H A;  1CM0 A;  3PZJ A;  3BJ7 A;  2JDC A;  1KUX A;  5F46 A;  5F49 A;  1N71 A;  2I79 A;  4NF1 A;  1IIC A;  4XPL A;  4YRH A;  1GHE A;  2P6E A;  4QVT A;  4KVM E;  4NEX A;  3NE7 A;  1B6B A;  3TOA A;  1MJA A;  4KOY A;  4RS2 A;  5HMN A;  1U6M A;  1Y9W A;  1P4N A;  2B5G A;  4QB9 A;  3FYN A;  1OZP A;  1P0H A;  3FB3 A;  3FRM A;  2PSW A;  1VHS A;  3TO9 A;  1IID A;  2FIA A;  3SXO A;  2VZZ A;  1XMT A;  5I0C A;  4PK3 A;  3H4Q A;  3I3G A;  4NXY A;  2IL4 A;  2VEZ A;  2P6F A;  2G3T A;  3FNC A;  2J8R A;  4UWI A;  2ZPA A;  2I00 A;  3PP9 A;  5F48 A;  1K4J A;  2Y0M A;  1PU9 A;  1YK3 A;  1S3Z A;  4R3L A;  4MHD A;  5CNP A;  3DSB A;  4CS0 B;  2B3U A;  4R87 A;  5IX3 A;  3EC4 A;  1IYK A;  2FXF A;  3DDD A;  4UWJ A;  3B8G A;  1UFH A;  3CXS A;  3D3S A;  4U5Y A;  5EC4 A;  2K5T A;  2OZG A;  4AVB A;  2BUE A;  1XEB A;  2FT0 A;  1MK4 A;  4U9Z A;  3T9Y A;  3D8P A;  2GE3 A;  2F5I A;  2PR1 A;  2Q04 A;  3SXN A;  4ZBG A;  5F47 A;  4J3G A;  4XNH C;  2REE A;  1XF8 A;  2FSR A;  2JLM A;  2C27 A;  2EVN A;  3DNS A;  1Q2D A;  2G0B A;  2Q4Y A;  3FIX A;  3PGP A;  4KOT A;  4QUS A;  1I12 A;  2FL4 A;  2WPW A;  2PC1 A;  3TTH A;  4I49 A;  4FD4 A;  5J8C A;  1BO4 A;  3LOD A;  4HNY B;  2RC4 A;  3CXP A;  3VWE A;  4NCZ A;  1B87 A;  5HH1 A;  5GCN A;  4OAD A;  4KOV A;  1Y7R A;  2BSW A;  5EBV A;  5JQ4 A;  2ZXV A;  4OLL A;  1Q2C A;  4MY3 A;  4JLY A;  1S5K A;  2JDD A;  3N7Z A;  4MBU A;  5IV0 A;  3S6K A;  1YR0 A;  4R9M A;  2ATR A;  1S7K A; 
#chains in the Genus database with same CATH topology
 4H6Z A;  2PJ4 A;  1XMB A;  2QIR A;  3IEH A;  3SI0 A;  2HUZ A;  5JPH A;  1Q7L A;  3S6G A;  2ZW5 A;  2PJ0 A;  3JRU A;  4UCM A;  4IAV A;  5ISV A;  3PRT A;  4PXD A;  4CAX A;  4UF4 A;  2B3V A;  3R9G A;  2R98 A;  1S60 A;  3R95 A;  3ISZ A;  4FD7 A;  2HC9 A;  8CPA A;  4P6Y A;  4DNC A;  3FJU A;  4CAW A;  3FF3 A;  1S7F A;  4Y49 B;  5CPA A;  1BOB A;  2CNS A;  2Q0Y A;  2IMO A;  2Z3N A;  3D68 A;  4C2X A;  3V8I A;  4JYW A;  4R8F A;  4MHP A;  3GUX A;  5IB9 A;  1OBR A;  2Q43 A;  3F8K A;  3IFE A;  3K2K A;  5C82 A;  2G3A A;  2HV2 A;  2C6C A;  2OU2 A;  2ZW4 A;  3GKR A;  4WJB A;  1BLL E;  3L2N A;  2CNM A;  4NGN A;  4U9Y A;  2FIW A;  3DR8 A;  2HQY A;  2ZOG A;  3FBU A;  2PJ3 A;  4GM5 A;  2POK A;  4C2Y A;  3ISX A;  4P4D A;  2XEF A;  1QST A;  3MN8 A;  5THW A;  5JGF A;  2Z11 A;  1Z2L A;  4A95 A;  3NA6 A;  2J8M A;  3PB8 X;  1X10 A;  4LUA A;  2NYQ A;  3F0A A;  1AMP A;  4MFJ A;  1Y7E A;  3D7D A;  3MGD A;  4JJX A;  2ZEM A;  3FX6 A;  2EBJ A;  4QC6 A;  1YLE A;  2VZY A;  4HNX B;  2Z0Z A;  1SQH A;  3RAM A;  1AUG A;  2PJ1 A;  4KUB A;  2OH1 A;  2ZEG A;  4NGQ A;  1PCA A;  4PQA A;  1WWZ A;  2ZEN A;  4F6A A;  3WC5 A;  1QSM A;  3SHP A;  3TO7 A;  2EWB A;  1YW6 A;  2GU2 A;  5HVH A;  4P4I A;  2P0W A;  2WPX A;  4KSF A;  1LFW A;  1VKC A;  3R9F A;  3D7H A;  4MY0 A;  2QML A;  3IWW A;  3GYA A;  1FY7 A;  5IB0 A;  4H6U A;  3LWU A;  2J8N A;  1IGB A;  4UA3 A;  2PJB A;  1WK4 A;  2EUI A;  4XPK A;  3UY5 A;  3WC7 A;  4KOR A;  4KVO E;  4FAI A;  3QAH A;  3NE8 A;  1M1D A;  4MHY A;  5LRJ A;  2DEA A;  1Y9K A;  2GFQ A;  2JEW A;  2BL1 A;  1XFO A;  2PR8 A;  3EXN A;  2Q4V A;  3H8E A;  1QSN A;  2P6G A;  4MFZ A;  3RNZ A;  2D4P A;  3SJG A;  4AG7 A;  2QEC A;  4BBH A;  4FUU A;  5H86 A;  4KLW A;  2RFH A;  3R9E A;  4OIW A;  1IYL A;  1HDU A;  3IGR A;  4ORF A;  5AGE A;  4ZY1 A;  1L0C A;  4P44 A;  2B5G B;  4NGM A;  1M4I A;  4Q36 A;  2Z3M A;  3GIU A;  4P4J A;  3S9M A;  3VH9 A;  1CPX A;  2OZH A;  1TKF A;  4PPZ A;  4F0Y A;  5KTD A;  1LAM A;  2Q51 A;  3BI0 A;  3B3C A;  1IY7 A;  1XBU A;  1YRE A;  3PFE A;  4RN7 A;  1YX0 A;  4M85 A;  3LMS A;  4JZ0 A;  3SJE A;  3VAR A;  2WUU A;  5JH9 A;  2DXQ A;  4M3S A;  4E8O A;  3DLJ A;  5KTC A;  2ZEF A;  1ON0 A;  3G3S A;  2AFU A;  3D2M A;  3B7I A;  3W6X A;  1ARL A;  4BD9 A;  1M4G A;  1YSJ A;  4OID A;  1RXT A;  2FS5 A;  1Q2Y A;  3P2F A;  2ZW6 A;  4LX9 A;  1YGH A;  4YU9 A;  2JEV A;  1TF8 A;  4A31 A;  4GXH A;  4KS9 A;  3FVL A;  2ODF A;  2AFW A;  2FE7 A;  3PB7 X;  3I9S A;  1IOI A;  2PCU A;  4NJQ A;  1CBX A;  1XRY A;  4ZY2 A;  4H2K A;  1R43 A;  2CXA A;  4XPD B;  5D29 A;  4CRY B;  1VGY A;  3CXQ A;  3GY9 A;  4Q7A A;  3LAC A;  3B3T A;  2ARH A;  4JXQ A;  4PXC A;  3WAB A;  2R1I A;  4FWU A;  1VIX A;  3G8W A;  4II9 A;  1I1D A;  2B4D A;  2J9A A;  2PIY A;  2NMT A;  3P2H A;  3KQX A;  1ZG8 A;  5G21 A;  4DYO A;  4A2Z A;  1MJB A;  4PXE A;  1QQ9 A;  2V8D A;  3TC8 A;  1JWQ A;  4PV6 A;  4CGL A;  3N5F A;  3D7F A;  1UWY A;  1IOF A;  1EE3 P;  1J4J A;  3BLN A;  4KOU A;  5A28 A;  2ZEH A;  4ZI6 A;  1NE9 A;  2B58 A;  2KCW A;  4OAE A;  1KZF A;  2X7B A;  4NSQ A;  4CAF A;  2YGW A;  4NGS A;  4R7M A;  3QB8 A;  1IB1 E;  2C6G A;  1H8L A;  2A4N A;  1M4D A;  3KKW A;  4M6H A;  4F8Z A;  3ZJ0 A;  1RO5 A;  2PRB A;  3I1U A;  1MJ9 A;  2AJ6 A;  2R7H A;  1RTQ A;  4E0A A;  2O4H A;  5J8F A;  4Q38 A;  2AFO A;  3LD2 A;  3S6F A;  3VWD A;  1TKJ A;  4NFR A;  2GIV A;  4CYQ A;  2PJ8 A;  4HKF A;  3JTK A;  5KTA A;  4B6Z A;  2AFM A;  4CYP A;  3TT2 A;  1CG2 A;  2AFS A;  2BEI A;  4TWE A;  5I4M A;  4MCQ A;  4MHZ A;  2GRE A;  4Y49 C;  4R57 A;  4KSA A;  2ZED A;  3R96 A;  2PQ8 A;  3B3W A;  4IUS A;  1I21 A;  2PJC A;  1XE4 A;  4K30 A;  2BCO A;  4X3R A;  4CRZ B;  4DJL A;  5AG7 A;  3D66 A;  6CPA A;  2B4B A;  4K3N A;  4EME A;  5LYF A;  2WZN A;  3IWG A;  3KR5 A;  4PK2 A;  3NFZ A;  4AVC A;  2F7V A;  1ZLI A;  3TO6 A;  2Z10 A;  4UIB A;  2OZU A;  3K9U A;  3TCV A;  3W91 A;  1Z8X A;  1XJO A;  3B2Y A;  3KI9 A;  2EO8 A;  1TIQ A;  4ONU A;  3V7Z A;  1FNO A;  4R3K A;  1ZG9 A;  2ABZ A;  2RB7 A;  1S7N A;  1PUA A;  4CGO A;  2WYR A;  1BPM A;  2CTB A;  2FCK A;  3TOB A;  4C7H A;  5HVF A;  4A38 A;  4CAV A;  2O28 A;  3NH8 A;  4B5P A;  4L89 A;  5BWA B;  2I3C A;  2EK9 A;  2B4D B;  4MCR A;  1Z4R A;  4KZT A;  3EO4 A;  4O23 A;  4UFV A;  4QBJ A;  5JM6 A;  1QMU A;  2VBQ A;  5DWN A;  4KOS A;  3S9N A;  1QSO A;  2PJ9 A;  4JXR A;  1VHO A;  1NMT A;  2QYV A;  3ZZI A;  4AVA A;  4MFQ A;  3CT9 A;  2JBK A;  4MFK A;  4YFJ A;  1YVO A;  3CPA A;  1ZO0 A;  3R1K A;  4OC3 A;  2YNC C;  2ZW7 A;  4GS4 A;  2F8H A;  5HVG A;  4MCP A;  4MRI A;  4CGN A;  3JVN A;  2H5M A;  4FD5 A;  1HDQ A;  4AB7 A;  4LQG A;  4OC0 A;  4KOX A;  4L8A A;  4UCN A;  5J1Q A;  2QJ8 A;  5DWM A;  4DUK A;  3D2P A;  4C68 A;  2Q44 A;  2D4O A;  1YQE A;  2IJZ A;  4B14 A;  4CYN A;  4EFD A;  3K9T A;  5FVJ A;  3T90 A;  2PDO A;  1JQG A;  4OC5 A;  3BJ8 A;  5C88 A;  2AFZ A;  3E0K A;  3EFA A;  4UBR A;  1BAV A;  4XNH B;  4A39 A;  2VQY A;  2Q7B A;  3RYO A;  2PJ6 A;  1LOK A;  3IC1 A;  3EY5 A;  4A37 A;  3F5B A;  3B3V A;  4MXU A;  1CP7 A;  4EVY A;  1Z9U A;  3IU2 A;  4B11 A;  2VI7 A;  2WSA A;  4P4F A;  2REF A;  4PSW A;  1YVK A;  5EMI A;  4UIA A;  5K8M A;  4PSX A;  2PJ5 A;  5E96 A;  1R3N A;  1AYE A;  2YNE A;  2OB0 A;  2DPT A;  3H8F A;  4UEZ A;  4RUH A;  4MI4 A;  4Z65 A;  3IO1 A;  4KLV A;  4IF5 A;  2PJ2 A;  4RI1 A;  4MJ8 A;  1F2O A;  2AE6 A;  2CY2 A;  1CX8 A;  3DR6 A;  4AG9 A;  4IK2 A;  2PRQ A;  4KUA A;  2O53 A;  1IU8 A;  5CBM A;  1X12 A;  2ZEP A;  1CP6 A;  3KZW A;  2XEG A;  2R8V A;  4OC2 A;  4R76 A;  4FBE A;  3IU1 A;  3D4U A;  4B5P B;  3NH5 A;  4HNW B;  4M6G A;  4B13 A;  5G1Z A;  1LRZ A;  4G1P A;  5AG6 A;  3WR7 A;  4ZYQ A;  5LYD A;  1KUY A;  4ONW A;  2GAN A;  4JWP A;  4X5K A;  3WT4 A;  2ZEE A;  1ZLH A;  1XIX A;  1LAP A;  3PBE A;  4KVX A;  4XPD C;  4CAE A;  1HEE A;  2C6P A;  1YLO A;  2V8V A;  3C26 A;  5AG5 A;  3JUW A;  5D8N A;  1ELL P;  3NH4 A;  4H89 A;  4P4E A;  3PB6 X;  3FXT A;  3CPX A;  1TXR A;  4IHM A;  4W9Y A;  4E2A A;  4ZX8 A;  3TFY A;  1LAN A;  1V0C A;  3PEI A;  1XOV A;  1Z8T A;  3W6S A;  4A33 A;  2ZOF A;  3SI2 A;  2PE3 A;  4MMO A;  1DTD A;  4BMH A;  2G9D A;  5H84 A;  4WWV A;  1YME A;  4KOW A;  2CNT A;  2GLJ A;  1QSR A;  4OKO A;  1NSL A;  2VXK A;  3OWC A;  1CPS A;  1Z4E A;  2JBJ A;  2V8G A;  4FD6 A;  5AG4 A;  1KUV A;  3IWE A;  5K8N A;  1CJW A;  3TE4 A;  1DE4 C;  2YNC A;  4JD6 A;  3FED A;  1S7L A;  1R57 A;  2PVW A;  4YGO A;  1M44 A;  2Q4Z A;  3FEC A;  1CM0 A;  3FEE A;  3PZJ A;  3S6H A;  3BJ7 A;  2JDC A;  3FMC A;  4HPS A;  1KUX A;  5F46 A;  3WC6 A;  4MFL A;  5F49 A;  3PB9 X;  1N71 A;  2I79 A;  2PJA A;  1IIC A;  4NF1 A;  4XPL A;  4YRH A;  3GB0 A;  2HB6 A;  1GHE A;  5A27 A;  3MRU A;  2P6E A;  4QVT A;  4KVM E;  3V38 A;  4NEX A;  2Z3P A;  3NE7 A;  3RO0 A;  1B6B A;  1NSA A;  3TOA A;  3A9L A;  5K8P A;  1MJA A;  4KOY A;  4RS2 A;  5HMN A;  2CF4 A;  1TKH A;  3B3S A;  3D7G A;  1U6M A;  1KWM A;  1ARM A;  1P4N A;  1Y9W A;  2B5G A;  3CDX A;  4QB9 A;  3T8W A;  3FYN A;  1OZP A;  1ZG7 A;  2VL1 A;  1P0H A;  3S9L A;  2DF5 A;  3FB3 A;  2PSW A;  3FRM A;  3KHX A;  4CPA A;  2NSM A;  1VHS A;  3TO9 A;  1IID A;  2FIA A;  3PBB A;  3SXO A;  2VZZ A;  4F0X A;  1XMT A;  5I0C A;  4PK3 A;  3H4Q A;  3I3G A;  4NXY A;  5G22 A;  2IL4 A;  2VEZ A;  2P6F A;  5G20 A;  2G3T A;  2ZEL A;  4YWY A;  3FNC A;  2J8R A;  4UWI A;  2ZPA A;  2I00 A;  3PP9 A;  5F48 A;  4C2Z A;  1K4J A;  2AFX A;  2Y0M A;  1PU9 A;  4F9U A;  3KL9 A;  1YK3 A;  1S3Z A;  2QVP A;  4R3L A;  3BXM A;  4BIN A;  2Z3O A;  3QNV A;  4MHD A;  5CNP A;  3KR4 A;  3D67 A;  3DSB A;  4CS0 B;  2B3U A;  2BO9 A;  4P4B A;  1Y0R A;  4R87 A;  3DGV A;  2YND A;  3EC4 A;  4NJR A;  4A32 A;  5IX3 A;  1IYK A;  2FXF A;  3DDD A;  4MCS A;  4NGT A;  4X2T A;  1F2P A;  4UWJ A;  4CYO A;  4ZGY B;  3KHZ A;  3B8G A;  1UFH A;  3CXS A;  3D3S A;  3PB4 X;  4U5Y A;  4TNU A;  5EC4 A;  3BHX A;  2K5T A;  2OZG A;  4AVB A;  2PJ7 A;  4NGR A;  3SJF A;  4UEF A;  4EWT A;  5F09 A;  1TF9 A;  2BUE A;  2FVG A;  1XEB A;  2FT0 A;  1MK4 A;  2ZEO A;  4U9Z A;  3IIB A;  1Y0Y A;  3T9Y A;  3D8P A;  2GE3 A;  3KGQ A;  2F5I A;  2PR1 A;  4KSI A;  1BPN A;  2Q04 A;  4OC4 A;  3B35 A;  3SXN A;  5LRK A;  2CTC A;  4ZBG A;  3TX8 A;  2Z3K A;  5F47 A;  2GLF A;  3IJ3 A;  4M6I A;  4X8I A;  4J3G A;  3QAY A;  4XNH C;  2REE A;  2EK8 A;  1XF8 A;  2CIJ A;  2FSR A;  4NGP A;  3VAT A;  5ELY A;  1VHE A;  1Z5R A;  4MFP A;  3FH4 A;  2JLM A;  2C27 A;  2EVN A;  3DNS A;  3KQZ A;  4A30 A;  4B10 A;  1Q2D A;  2G0B A;  2OR4 A;  2Q4Y A;  3FIX A;  4ZX9 A;  3PGP A;  3H5Z A;  1M4L A;  4AXV A;  4UFX A;  3KAS A;  3HUV A;  4KOT A;  4PXB A;  4F9V A;  2XEJ A;  4QUS A;  4UFW A;  2Z3L A;  1I12 A;  2FL4 A;  7CPA A;  2WPW A;  2PC1 A;  3BI1 A;  1Z8W A;  2V8H A;  4I49 A;  4FD4 A;  3TTH A;  5J8C A;  4MHN A;  4LQ6 A;  5LYL A;  5K8O A;  1BO4 A;  4CGM A;  3LOD A;  4HNY B;  4ZY0 A;  2ANP A;  1PYT B;  4OP4 A;  1ELM P;  3SI1 A;  1FT7 A;  2RC4 A;  3CXP A;  5DS0 A;  4NCZ A;  1B87 A;  4UCP A;  3HLP A;  3RZA A;  3VWE A;  4CGP A;  2PIZ A;  5HH1 A;  1Z8L A;  2Q7S A;  4P10 A;  5GCN A;  2XEI A;  2BOA A;  5LRG A;  2IQ6 A;  4OAD A;  4KOV A;  4B5O A;  4R6T A;  3PFO A;  2PVV A;  1Y7R A;  2OOT A;  4OC1 A;  3SJX A;  2BSW A;  5EBV A;  1F57 A;  5JQ4 A;  5LYI A;  2ZXV A;  1GYT A;  4OLL A;  1Q2C A;  3H8G A;  2DPS A;  1A2Z A;  4P45 A;  4B12 A;  1LCP A;  4OME A;  4A94 A;  3GLJ A;  3CZX A;  4MY3 A;  4C7I A;  5HXD A;  2C1C A;  4JLY A;  1S5K A;  2JDD A;  1YW4 A;  3N7Z A;  4MBU A;  5IV0 A;  3S6K A;  1YR0 A;  4R9M A;  2V77 A;  4UEE A;  3RBU A;  2ATR A;  1S7K A; 
#chains in the Genus database with same CATH homology
 4H6Z A;  2QIR A;  5JPH A;  2HUZ A;  3S6G A;  2ZW5 A;  4UCM A;  5ISV A;  4CAX A;  2B3V A;  3R9G A;  2R98 A;  1S60 A;  3R95 A;  4FD7 A;  4DNC A;  4CAW A;  1S7F A;  4Y49 B;  1BOB A;  2CNS A;  2Q0Y A;  2Z3N A;  4C2X A;  3V8I A;  3F8K A;  2G3A A;  2HV2 A;  2OU2 A;  2ZW4 A;  3GKR A;  2CNM A;  4U9Y A;  2FIW A;  3DR8 A;  2HQY A;  3FBU A;  4C2Y A;  1QST A;  2Z11 A;  4A95 A;  5C82 A;  2J8M A;  4LUA A;  3F0A A;  4MFJ A;  4JJX A;  3MGD A;  4QC6 A;  1YLE A;  2VZY A;  4HNX B;  2Z0Z A;  1SQH A;  4KUB A;  2OH1 A;  1WWZ A;  4F6A A;  1QSM A;  3SHP A;  3TO7 A;  2P0W A;  2WPX A;  4KSF A;  1VKC A;  3R9F A;  4MY0 A;  2QML A;  3GYA A;  1FY7 A;  5IB0 A;  4H6U A;  4UA3 A;  2J8N A;  1WK4 A;  2EUI A;  4XPK A;  3UY5 A;  4KOR A;  4KVO E;  3QAH A;  1M1D A;  2PR8 A;  1Y9K A;  2BL1 A;  4MFZ A;  3EXN A;  2Q4V A;  4B5O A;  1QSN A;  2P6G A;  4AG7 A;  2D4P A;  2QEC A;  4BBH A;  5H86 A;  4KLW A;  3R9E A;  1IYL A;  3IGR A;  4ORF A;  5AGE A;  1L0C A;  4Q36 A;  2B5G B;  1M4I A;  2Z3M A;  2OZH A;  4F0Y A;  5KTD A;  1YRE A;  1YX0 A;  4M85 A;  2WUU A;  2DXQ A;  4M3S A;  4E8O A;  5KTC A;  1ON0 A;  3G3S A;  3D2M A;  3W6X A;  1M4G A;  1RXT A;  2FS5 A;  1Q2Y A;  3P2F A;  2ZW6 A;  4LX9 A;  1YGH A;  2JEV A;  4A31 A;  4KS9 A;  2FE7 A;  3I9S A;  2CXA A;  4XPD B;  4CRY B;  3CXQ A;  3GY9 A;  2ARH A;  4JXQ A;  2R1I A;  3G8W A;  4II9 A;  1I1D A;  2B4D A;  2NMT A;  3P2H A;  5G21 A;  4A2Z A;  1MJB A;  4PV6 A;  4CGL A;  3BLN A;  5A28 A;  1J4J A;  4KOU A;  1NE9 A;  2B58 A;  2KCW A;  4OAE A;  1KZF A;  2X7B A;  4NSQ A;  4CAF A;  2YGW A;  3QB8 A;  1IB1 E;  3KKW A;  2A4N A;  1M4D A;  3ZJ0 A;  1RO5 A;  2PRB A;  1MJ9 A;  2AJ6 A;  2R7H A;  5J8F A;  4E0A A;  4Q38 A;  3LD2 A;  3S6F A;  3VWD A;  4CYQ A;  2GIV A;  4HKF A;  3JTK A;  5KTA A;  4CYP A;  3TT2 A;  2BEI A;  4Y49 C;  4R57 A;  4KSA A;  3R96 A;  2PQ8 A;  4IUS A;  1I21 A;  4K30 A;  1XE4 A;  4CRZ B;  5AG7 A;  2B4B A;  3IWG A;  4PK2 A;  4AVC A;  3TO6 A;  2Z10 A;  2OZU A;  3K9U A;  3TCV A;  3W91 A;  1TIQ A;  4ONU A;  4R3K A;  1S7N A;  1PUA A;  4CGO A;  2FCK A;  3TOB A;  4C7H A;  4CAV A;  2O28 A;  4B5P A;  5BWA B;  4L89 A;  2B4D B;  1Z4R A;  4KZT A;  3EO4 A;  4UFV A;  4QBJ A;  2VBQ A;  5DWN A;  4KOS A;  1QSO A;  4JXR A;  1NMT A;  3ZZI A;  4AVA A;  4MFQ A;  4MFK A;  4YFJ A;  1YVO A;  3R1K A;  1ZO0 A;  2YNC C;  2ZW7 A;  4GS4 A;  4CGN A;  3JVN A;  2H5M A;  4FD5 A;  4AB7 A;  4KOX A;  4L8A A;  4UCN A;  5DWM A;  3D2P A;  4C68 A;  2Q44 A;  2D4O A;  4B14 A;  4CYN A;  3T90 A;  5FVJ A;  2PDO A;  5C88 A;  3BJ8 A;  3E0K A;  3EFA A;  4XNH B;  4UBR A;  2VQY A;  2Q7B A;  3RYO A;  3EY5 A;  3F5B A;  4EVY A;  1Z9U A;  3IU2 A;  4B11 A;  2VI7 A;  2WSA A;  4PSW A;  2REF A;  1YVK A;  4PSX A;  5E96 A;  2YNE A;  2OB0 A;  2DPT A;  4MI4 A;  4KLV A;  4IF5 A;  4RI1 A;  4MJ8 A;  2AE6 A;  2CY2 A;  3DR6 A;  4AG9 A;  4KUA A;  2R8V A;  3IU1 A;  4B5P B;  4HNW B;  4B13 A;  5G1Z A;  1LRZ A;  5AG6 A;  3WR7 A;  1KUY A;  2GAN A;  4JWP A;  4X5K A;  1XIX A;  4KVX A;  4XPD C;  4CAE A;  5AG5 A;  3C26 A;  3JUW A;  4H89 A;  3FXT A;  4E2A A;  3TFY A;  1V0C A;  3W6S A;  4A33 A;  4BMH A;  5H84 A;  4KOW A;  2CNT A;  1QSR A;  1NSL A;  2VXK A;  3OWC A;  1Z4E A;  5AG4 A;  4FD6 A;  1KUV A;  3IWE A;  1CJW A;  3TE4 A;  2YNC A;  4JD6 A;  1S7L A;  1R57 A;  4YGO A;  1M44 A;  3S6H A;  1CM0 A;  3PZJ A;  3BJ7 A;  2JDC A;  1KUX A;  5F46 A;  4MFL A;  5F49 A;  1N71 A;  2I79 A;  4NF1 A;  1IIC A;  4XPL A;  4YRH A;  1GHE A;  5A27 A;  2P6E A;  4QVT A;  4KVM E;  4NEX A;  2Z3P A;  3NE7 A;  1B6B A;  3TOA A;  3A9L A;  1MJA A;  4KOY A;  4RS2 A;  5HMN A;  1U6M A;  1Y9W A;  1P4N A;  2B5G A;  4QB9 A;  3FYN A;  1OZP A;  1P0H A;  3FB3 A;  3FRM A;  2PSW A;  1VHS A;  3TO9 A;  1IID A;  2FIA A;  3SXO A;  2VZZ A;  4F0X A;  1XMT A;  5I0C A;  4PK3 A;  3H4Q A;  3I3G A;  4NXY A;  5G22 A;  2IL4 A;  2VEZ A;  2P6F A;  5G20 A;  2G3T A;  3FNC A;  2J8R A;  4UWI A;  2ZPA A;  2I00 A;  3PP9 A;  5F48 A;  4C2Z A;  1K4J A;  2Y0M A;  1PU9 A;  1YK3 A;  1S3Z A;  4R3L A;  2Z3O A;  4MHD A;  5CNP A;  3DSB A;  4CS0 B;  2B3U A;  4R87 A;  5IX3 A;  2YND A;  3EC4 A;  4A32 A;  1IYK A;  2FXF A;  3DDD A;  4UWJ A;  4CYO A;  4ZGY B;  3B8G A;  1UFH A;  3CXS A;  3D3S A;  4U5Y A;  5EC4 A;  2K5T A;  2OZG A;  4AVB A;  2BUE A;  1XEB A;  2FT0 A;  1MK4 A;  4U9Z A;  3T9Y A;  3D8P A;  2GE3 A;  2F5I A;  2PR1 A;  2Q04 A;  3SXN A;  4ZBG A;  2Z3K A;  5F47 A;  4J3G A;  4XNH C;  2REE A;  1XF8 A;  2FSR A;  4MFP A;  2JLM A;  2C27 A;  2EVN A;  3DNS A;  4A30 A;  4B10 A;  1Q2D A;  2G0B A;  2Q4Y A;  3FIX A;  3PGP A;  3H5Z A;  4UFX A;  4KOT A;  4QUS A;  4UFW A;  2Z3L A;  1I12 A;  2FL4 A;  2WPW A;  2PC1 A;  3TTH A;  4I49 A;  4FD4 A;  5J8C A;  1BO4 A;  4CGM A;  3LOD A;  4HNY B;  2RC4 A;  3CXP A;  3VWE A;  4NCZ A;  1B87 A;  4UCP A;  4CGP A;  5HH1 A;  5GCN A;  4OAD A;  4KOV A;  1Y7R A;  2BSW A;  5EBV A;  5JQ4 A;  2ZXV A;  4OLL A;  1Q2C A;  2DPS A;  4B12 A;  4MY3 A;  4C7I A;  4JLY A;  1S5K A;  2JDD A;  3N7Z A;  4MBU A;  5IV0 A;  3S6K A;  1YR0 A;  4R9M A;  2ATR A;  1S7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...