2J8RA

Structure of p. aeruginosa acetyltransferase pa4866 solved in complex with l-methionine sulfoximine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
170
structure length
170
Chain Sequence
ASIRDAGVADLPGILAIYNDAVGNTTAIWNETPVDLANRQAWFDARARQGYPILVASDAAGEVLGYASYGDWRPFEGFRGTVEHSVYVRDDQRGKGLGVQLLQALIERARAQGLHVMVAAIESGNAASIGLHRRLGFEISGQMPQVGQKFGRWLDLTFMQLNLDPTRSAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title L-Methionine Sulfoximine, But not Phosphinothricin, is a Substrate for an Acetyltransferase (Gene Pa4866) from Pseudomonas Aeruginosa: Structural and Functional Studies.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords ACETYLTRANSFERASE PA4866 FROM P. AERUGINOSA
total genus 51
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2j8rA00
4AVCA 1MJ9A 4CAVA 4U5YA 3R1KA 4CAWA 2OZGA 4NCZA 2OZUA 4GS4A 4R3LA 2OH1A 3S6HA 2R7HA 2VEZA 4NXYA 4IF5A 4JWPA 2EVNA 3SXNA 2Z10A 1LRZA 1TIQA 1Y9WA 4UA3A 5IB0A 4CAXA 2GE3A 4MI4A 3MGDA 4M85A 4JJXA 4MBUA 2FS5A 2J8MA 2C27A 1N71A 1U6MA 3W6XA 3BLNA 1Q2YA 4Y49B 1QSTA 3DR6A 3PGPA 3NE7A 4R57A 2Q44A 1VHSA 4KOUA 3OWCA 3TOBA 1YREA 5EC4A 4HNYB 4AG9A 2FIWA 3FBUA 2B4DB 2R1IA 2PR1A 4PK3A 4CS0B 2CNMA 4KOTA 4RI1A 3I9SA 4PSXA 3C26A 4QBJA 4L8AA 1Z4RA 4B5PA 4MJ8A 4OADA 4UWIA 2FCKA 2OB0A 5F48A 2RC4A 3DDDA 1B6BA 2ARHA 2B4DA 2PSWA 4KVME 4JXRA 2G3AA 1I21A 3F0AA 5KTCA 3D2MA 4KUBA 1M4GA 1B87A 4NSQA 1YLEA 4E0AA 5H84A 2F5IA 1PUAA 2FXFA 5IV0A 2WPXA 3FIXA 2B4BA 4DNCA 4E8OA 1YK3A 4KOSA 4MY3A 2GIVA 3W91A 4PK2A 1SQHA 2Z0ZA 2Q4YA 4II9A 3TE4A 5IX3A 3F8KA 3FRMA 5JQ4A 1RXTA 1UFHA 3EC4A 5I0CA 4K30A 1S7LA 3D2PA 2I79A 2AJ6A 4XPLA 3RYOA 3WR7A 3TTHA 4JLYA 4LX9A 4ORFA 4HNWB 4FD4A 5F46A 5E96A 3UY5A 3G8WA 5J8CA 4YRHA 1IYLA 5HH1A 1YVOA 3D3SA 4OLLA 3FNCA 1KUVA 4F6AA 2Q04A 2I00A 4AG7A 2D4OA 2FT0A 4XNHB 2JEVA 3E0KA 5F49A 4RS2A 1NMTA 3R95A 3T9YA 2GANA 1ON0A 4U9YA 4U9ZA 5KTAA 5C88A 4H6UA 1Q2CA 3K9UA 2QIRA 2B3UA 4AVBA 2P6GA 1XF8A 3DNSA 2ZW6A 1MJBA 2BL1A 4FD7A 3R9FA 5H86A 4LUAA 2A4NA 4XNHC 4KUAA 3P2HA 2B5GA 4B5OA 4KZTA 1P0HA 1WK4A 4CRYB 5ISVA 3TT2A 1S5KA 3LD2A 3DSBA 1Q2DA 1XEBA 2Z11A 1YX0A 1KUXA 4XPKA 4XPDC 5C82A 1QSNA 2H5MA 4R9MA 4L89A 2BEIA 4H89A 3BJ7A 2CY2A 3IWGA 3F5BA 2PR8A 1Y9KA 2FSRA 1XIXA 3ZZIA 1MJAA 3CXSA 1M1DA 2P0WA 3TO7A 1Z9UA 2HQYA 2HV2A 4ZBGA 1YGHA 5GCNA 4KOXA 2HUZA 1KUYA 4E2AA 2R8VA 2WPWA 3N7ZA 4QUSA 5DWNA 3ZJ0A 4YFJA 1J4JA 1S3ZA 1S7FA 1S7NA 4NEXA 4ONUA 1IIDA 2VBQA 3W6SA 4R87A 2REFA 5KTDA 1YR0A 1FY7A 4MY0A 4IUSA 3DR8A 2PDOA 2J8RA 2OU2A 2ZW5A 2ZW7A 2CNTA 2BSWA 1IB1E 3GKRA 2B3VA 2P6FA 4OAEA 2X7BA 5FVJA 1QSOA 1RO5A 3SHPA 3TCVA 2FIAA 4PSWA 1Y7RA 1M44A 2CNSA 1I12A 2ZPAA 5F47A 3LODA 4R3KA 5J8FA 3PZJA 3H4QA 1K4JA 5DWMA 4BMHA 3TO9A 3KKWA 1CJWA 5JPHA 2DXQA 3JVNA 4FD6A 2Q7BA 4XPDB 1P4NA 1GHEA 4HNXB 4AVAA 1XMTA 4KOWA 2Y0MA 4KORA 3JUWA 3EY5A 4HKFA 1QSMA 2R98A 4CRZB 4JD6A 3GY9A 3PP9A 4KOYA 5CNPA 3VWEA 2ZXVA 2VZZA 3B8GA 4B5PB 2PC1A 4Y49C 2FL4A 4J3GA 1BO4A 2BUEA 3EFAA 2IL4A 3S6FA 3BJ8A 4FD5A 3R9GA 1QSRA 4KLWA 4UWJA 2G3TA 2D4PA 2ATRA 3FB3A 1IYKA 1IICA 2QECA 2VXKA 4PV6A 3T90A 3TFYA 2PQ8A 1MK4A 2AE6A 3CXPA 3SXOA 3QB8A 3IGRA 3TOAA 4QVTA 1NSLA 1OZPA 4F0YA 4UBRA 4YGOA 5HMNA 1I1DA 2VQYA 2NMTA 4NF1A 2REEA 1BOBA 1WWZA 2Q4VA 2B58A 4QB9A 3I3GA 3FYNA 4QC6A 4AB7A 1PU9A 2FE7A 3EXNA 3FXTA 2J8NA 3S6KA 1R57A 4KOVA 4KVXA 2JDCA 2VZYA 2OZHA 2K5TA 1V0CA 2JDDA 1NE9A 1S7KA 2Q0YA 1S60A 3TO6A 3VWDA 1XE4A 3EO4A 3G3SA 1Z4EA 2EUIA 4JXQA 2PRBA 2QMLA 2B5GB 4MHDA 2VI7A 3D8PA 3QAHA 3R96A 3P2FA 1KZFA 2KCWA 3S6GA 1M4DA 1M4IA 4M3SA 3R9EA 1YVKA 4KLVA 1VKCA 4KVOE 3GYAA 2P6EA 1L0CA 4X5KA 4EVYA 3CXQA 4H6ZA 5EBVA 2O28A 2ZW4A 3V8IA 2JLMA 4I49A 1CM0A 2G0BA
chains in the Genus database with same CATH superfamily
4AVCA 2PE3A 4CGPA 3PFOA 1MJ9A 4CAVA 4U5YA 3QAYA 3R1KA 4WJBA 3KASA 3CPAA 4B10A 4CAWA 2YNEA 2JBKA 2OZGA 4NCZA 2OZUA 2FVGA 3A9LA 4GS4A 4R3LA 1RTQA 2OH1A 3S6HA 4KSAA 2PJ4A 2R7HA 2PJ3A 2VEZA 2ZEPA 4NXYA 4P4BA 4A32A 4IF5A 4A95A 4OC5A 4JWPA 2EVNA 4KSFA 4MXUA 1BLLE 1ZLIA 2Z10A 3SXNA 1LRZA 3KQZA 2GLJA 5HVFA 1TIQA 2GLFA 1HDUA 1Y9WA 3D7HA 4UA3A 3PEIA 5IB0A 4CAXA 2G9DA 2GE3A 4MI4A 2V77A 3MGDA 2GFQA 3IC1A 4JJXA 4M85A 4MBUA 4TNUA 3SJEA 2FS5A 4CAEA 2J8MA 1XFOA 2J9AA 2C27A 1N71A 1U6MA 3W6XA 2DF5A 1Q2YA 3BLNA 4Y49B 4CGNA 1QSTA 3DR6A 3FMCA 3KI9A 5A27A 5J1QA 2CTBA 3PGPA 2YGWA 1F2PA 3NE7A 4R57A 2I3CA 2Q44A 4FAIA 4H2KA 1VHSA 4JZ0A 4KOUA 4ZY1A 3OWCA 4Z65A 3TOBA 2C6PA 1YREA 5LYFA 5EC4A 4HNYB 4AG9A 2FIWA 3FBUA 4C7IA 5AGEA 2B4DB 3NH5A 2R1IA 4X8IA 2PR1A 4PK3A 4CS0B 1LFWA 6CPAA 1ARLA 2CNMA 4KOTA 4RI1A 2Z3LA 5LRJA 1Y0YA 1XBUA 3H8EA 3I9SA 2O4HA 4TWEA 3WABA 4PSXA 3C26A 1IGBA 3B2YA 3PB9X 2ZEOA 4L8AA 2Z3KA 1Z4RA 4C68A 4CYOA 3KZWA 4B5PA 1Z8TA 2PJ6A 4QBJA 3RO0A 4MJ8A 3I1UA 4OADA 3PBBA 4MCQA 4UWIA 1VHOA 1TKJA 2BCOA 2FCKA 2OB0A 5F48A 5CBMA 2RC4A 3DDDA 1B6BA 2ARHA 2B4DA 4UCMA 1FNOA 4DJLA 2PSWA 4KVME 4YWYA 4JXRA 2G3AA 1I21A 5G21A 3F0AA 4WWVA 5KTCA 1UWYA 3D2MA 4PPZA 4KUBA 1AYEA 1R43A 1M4GA 1B87A 3HUVA 4NSQA 4E2AA 1YLEA 4C7HA 5H84A 4E0AA 4MHYA 2PVWA 2F5IA 1PUAA 2FXFA 2YNDA 2YNCC 4M6GA 5IV0A 1CPSA 1ZG7A 1HEEA 2C6GA 2CIJA 2WPXA 3GLJA 4W9YA 5LYIA 4RUHA 1YLOA 3FIXA 4LQGA 4R7MA 4ZX8A 2C6CA 1XRYA 2QJ8A 4C2XA 2B4BA 4DNCA 1VGYA 4E8OA 1YK3A 4KOSA 4MY3A 2GIVA 2PVVA 1ELMP 4MFZA 3W91A 2OOTA 1F57A 4FBEA 4K3NA 4PK2A 1SQHA 2Z0ZA 2Q4YA 4M6HA 4NGPA 3BI1A 5I4MA 4II9A 3TE4A 3D68A 3B3SA 4ZY2A 5IX3A 3F8KA 4B6ZA 3FRMA 4A30A 1LCPA 2O53A 5JQ4A 1RXTA 1GYTA 1UFHA 4NGTA 4A39A 2F7VA 1Y7EA 4JYWA 3RNZA 2HB6A 3EC4A 4P4DA 5I0CA 4OIDA 2PRQA 4K30A 1S7LA 3D2PA 2I79A 2AJ6A 1TF8A 4XPLA 3RYOA 1ELLP 3CPXA 4P4IA 3WR7A 2NYQA 1OBRA 4JLYA 3TTHA 1Z2LA 4LX9A 4ORFA 4HNWB 5LRKA 3S9NA 4F9VA 4FD4A 1IOIA 3SI1A 5F46A 1EE3P 3H8FA 4UCPA 4IK2A 1YW4A 5E96A 2CXAA 3TX8A 4F8ZA 3KL9A 5HXDA 4ZX9A 3UY5A 2Z3OA 3D7FA 3G8WA 3PFEA 5J8CA 4YRHA 5G1ZA 4MFQA 3NH4A 1IYLA 5HH1A 4EMEA 5JGFA 1YVOA 3D3SA 3IWWA 4OLLA 3FNCA 1KUVA 4F6AA 2Q04A 3KHXA 2I00A 4OIWA 3VATA 4AG7A 2WYRA 2D4OA 2FT0A 4P4FA 4PXBA 2JEVA 4XNHB 2QYVA 3E0KA 3CDXA 5F49A 3PB8X 4RS2A 3VARA 1QQ9A 2IJZA 4UIBA 2HC9A 1NMTA 3D7GA 3R95A 3T9YA 3PB7X 2BO9A 2GANA 1ON0A 1VIXA 4U9YA 2PJ0A 2PJ5A 5HVGA 4U9ZA 5KTAA 5C88A 3CT9A 4H6UA 1YQEA 3DGVA 3JTKA 4MFKA 4ZY0A 5CPAA 1Q2CA 3K9UA 4NJRA 2QIRA 2B3UA 4AVBA 4PXEA 2P6GA 1XF8A 3DNSA 1IU8A 3IWEA 3H8GA 2ZW6A 4R76A 4CPAA 3MRUA 2GREA 1MJBA 4F0XA 2AFWA 5JH9A 1LANA 1R3NA 2Q51A 2BL1A 4FD7A 3R9FA 2EK9A 3WC6A 2POKA 4R6TA 5H86A 2XEFA 3T8WA 4LUAA 2A4NA 3NH8A 4XNHC 4KUAA 2V8HA 4KSIA 3P2HA 2B5GA 4B5OA 4KZTA 1P0HA 2EWBA 3V7ZA 5K8NA 1WK4A 4CRYB 1X12A 5ISVA 5DS0A 2PJCA 3FEDA 3TT2A 1S5KA 3LD2A 3DSBA 1Q2DA 4FUUA 1XEBA 1VHEA 1FT7A 3IO1A 2Z11A 1YX0A 3KHZA 4BBHA 4C2YA 2ZEGA 1KUXA 1ZLHA 4A33A 4XPKA 4XPDC 3BI0A 2RB7A 2Z3NA 5C82A 4NGRA 1QSNA 5D29A 4YU9A 2V8VA 2H5MA 3D4UA 4MHPA 4R9MA 4UEFA 4CYQA 4L89A 2WZNA 2BEIA 4CGOA 4O23A 4H89A 2NSMA 3FJUA 1DTDA 5JM6A 3BJ7A 2CY2A 3IWGA 4LQ6A 1CBXA 3B7IA 2AFSA 3F5BA 4KS9A 4OC4A 2PR8A 2V8GA 3PRTA 4UFWA 4DYOA 1Y9KA 5ELYA 1Z8WA 2FSRA 3FVLA 1ZG9A 1XIXA 1XJOA 3ZZIA 1CP7A 3FECA 1YW6A 1MJAA 3CXSA 3PBEA 1M1DA 2P0WA 3TO7A 2XEGA 4NFRA 1Z9UA 2HQYA 4B14A 5K8PA 2HV2A 4ZBGA 1YGHA 5GCNA 1QMUA 1DE4C 1Z8XA 3NFZA 4KOXA 2HUZA 3FH4A 1KUYA 2CF4A 2Z3MA 2R8VA 2WPWA 3JRUA 3N7ZA 4QUSA 4ONWA 1IY7A 5DWNA 3ZJ0A 4X2TA 4YFJA 1J4JA 1PCAA 1S3ZA 1S7FA 1S7NA 4NEXA 3NA6A 4NGNA 4ONUA 4B13A 1IIDA 1ZO0A 2VBQA 3W6SA 4R87A 2REFA 1PYTB 3CZXA 5KTDA 1ZG8A 1YR0A 2C1CA 4NGSA 1FY7A 4MY0A 4MHZA 4IUSA 3BXMA 3DR8A 2PDOA 2J8RA 2AFUA 2OU2A 1JQGA 2ZW5A 2ZW7A 1TF9A 2CNTA 1Z8LA 2BSWA 2ODFA 3IU1A 1IB1E 3GKRA 2B3VA 1LOKA 2P6FA 4OAEA 2X7BA 5FVJA 4ZI6A 3BHXA 4MHNA 5AG7A 3HLPA 1QSOA 1RO5A 2AFZA 3SHPA 3TCVA 1XMBA 2FIAA 3ISZA 3ISXA 4PSWA 4CGMA 3D67A 1Y7RA 1M44A 2CNSA 1I12A 2ZPAA 5F47A 4UFVA 3B3VA 4MFJA 3PB4X 4AXVA 5K8MA 2PJ1A 3LODA 4R3KA 4HPSA 5J8FA 4Q38A 2RFHA 3PB6X 3H4QA 3PZJA 3SJXA 1KWMA 4F9UA 1K4JA 5DWMA 4BMHA 3B3CA 2IMOA 4ZYQA 5EMIA 3TO9A 3KKWA 2Q43A 1CJWA 8CPAA 4FWUA 2DXQA 5JPHA 2PJ8A 1TKFA 1TXRA 2CTCA 3JVNA 4FD6A 3KR5A 2Q7BA 4XPDB 2WSAA 1P4NA 1GHEA 2ANPA 4HNXB 4AVAA 4EFDA 2AFXA 1AMPA 5THWA 1A2ZA 4DUKA 1XMTA 2QVPA 4OMEA 3D66A 4KOWA 2Y0MA 4M6IA 4OKOA 4KORA 2DPSA 3SI2A 2PIZA 3JUWA 3EY5A 3RZAA 4HKFA 1QSMA 4CAFA 2R98A 4CRZB 2ZOGA 5LYLA 1XOVA 4JD6A 5F09A 5BWAB 2AFOA 3KR4A 3GY9A 5AG4A 4ZGYB 4MCPA 2IQ6A 3PP9A 4A94A 4KOYA 3IU2A 4OP4A 5CNPA 4G1PA 4CYPA 4OC2A 4PQAA 4PXCA 4UF4A 3VWEA 3IFEA 2ZXVA 2VZZA 5IB9A 1M4LA 3B8GA 3V38A 4B5PB 1YMEA 2PC1A 2XEIA 4Y49C 2FL4A 3D7DA 4J3GA 3L2NA 1BO4A 4P6YA 1F2OA 2BUEA 3WC7A 1NSAA 2IL4A 2PJ7A 3EFAA 3S6FA 3FF3A 3BJ8A 4FD5A 3TC8A 3R9GA 2ABZA 1QSRA 4KLWA 4UWJA 3KGQA 4Q36A 4B11A 2G3TA 5G22A 2D4PA 4BINA 4CYNA 3SI0A 4A38A 1Z5RA 3S9MA 4MCSA 5D8NA 4PXDA 2ATRA 3FB3A 1IYKA 1TKHA 5K8OA 4P10A 4B12A 3S9LA 3KQXA 2GU2A 2ZEMA 1IICA 1X10A 2QECA 2VXKA 4PV6A 1Y0RA 2BOAA 3T90A 4R8FA 4C2ZA 1AUGA 3TFYA 2PQ8A 1IOFA 4A37A 1MK4A 3LMSA 2AE6A 3CXPA 3SJFA 3SXOA 1HDQA 3QB8A 5AG6A 3IGRA 1H8LA 4OC0A 4GM5A 3TOAA 4QVTA 2JEWA 5AG5A 1NSLA 2Q4ZA 1OZPA 3LWUA 3FX6A 1JWQA 4UBRA 4YGOA 3LACA 2ZEFA 4UEEA 1Q7LA 4F0YA 5HMNA 1CX8A 1I1DA 2VQYA 4UFXA 5LRGA 4MCRA 3B35A 2NMTA 3WT4A 4NF1A 2PJBA 1BPNA 2REEA 4MFPA 1BOBA 3DLJA 1WWZA 1ARMA 2Q4VA 4NGMA 4CGLA 3B3WA 3RAMA 2B58A 2DPTA 4QB9A 3K9TA 3I3GA 4UIAA 4IAVA 3FYNA 4NGQA 3FEEA 2PJ9A 2AFMA 4QC6A 4AB7A 1PU9A 3IEHA 4BD9A 3H5ZA 1YSJA 2WUUA 2PCUA 2FE7A 3EXNA 3FXTA 4MRIA 2J8NA 4P44A 3SJGA 3S6KA 2PJAA 3IIBA 1R57A 3N5FA 5G20A 4KOVA 2OR4A 4KVXA 2JDCA 2VZYA 2OZHA 2ZELA 2K5TA 3GUXA 1V0CA 2JDDA 1NE9A 1S7KA 4RN7A 2Q0YA 4Q7AA 1S60A 3TO6A 2VL1A 2EK8A 3VWDA 3WC5A 1XE4A 3EO4A 3G3SA 5HVHA 2ZEEA 1Z4EA 3GIUA 2EUIA 2ZOFA 2JBJA 4JXQA 2PRBA 2QMLA 4UCNA 2B5GB 3B3TA 4MHDA 4UEZA 2Z3PA 2VI7A 2ZEDA 3D8PA 4MFLA 2YNCA 4NJQA 2Q7SA 3QAHA 1LAMA 7CPAA 3R96A 3P2FA 1KZFA 4OC3A 2KCWA 3S6GA 1M4DA 1M4IA 4M3SA 5LYDA 3R9EA 3VH9A 2EBJA 1YVKA 3GB0A 3RBUA 4MMOA 2PJ2A 2ZEHA 1CPXA 3IJ3A 4KLVA 1BPMA 3QNVA 1VKCA 2PIYA 4OC1A 4KVOE 3GYAA 2P6EA 4A2ZA 2DEAA 1L0CA 4X5KA 1LAPA 4EVYA 2XEJA 3CXQA 4H6ZA 4A31A 5EBVA 4P4EA 3K2KA 4P4JA 2V8DA 2O28A 2ZW4A 4P45A 3V8IA 2ZENA 2JLMA 4I49A 4X3RA 1BAVA 3MN8A 5A28A 1CM0A 1CP6A 2F8HA 2G0BA 4IHMA 4GXHA 1CG2A 2EO8A 4EWTA 3NE8A
chains in the Genus database with same CATH topology
4AVCA 4CGPA 1MJ9A 4CAVA 4U5YA 3R1KA 4B10A 4CAWA 2YNEA 2OZGA 4NCZA 2OZUA 3A9LA 4GS4A 4R3LA 2OH1A 3S6HA 4KSAA 2R7HA 2VEZA 4NXYA 4A32A 4A95A 4IF5A 4JWPA 2EVNA 4KSFA 3SXNA 2Z10A 1LRZA 1TIQA 1Y9WA 4UA3A 5IB0A 4CAXA 2GE3A 4MI4A 3MGDA 4M85A 4JJXA 4MBUA 4CAEA 2FS5A 2J8MA 2C27A 1N71A 1U6MA 3W6XA 3BLNA 1Q2YA 4Y49B 4CGNA 1QSTA 3DR6A 5A27A 3PGPA 2YGWA 3NE7A 4R57A 2Q44A 1VHSA 4KOUA 3OWCA 3TOBA 1YREA 5EC4A 4HNYB 4AG9A 2FIWA 3FBUA 4C7IA 5AGEA 2B4DB 2R1IA 2PR1A 4PK3A 4CS0B 2CNMA 4KOTA 4RI1A 2Z3LA 3I9SA 4PSXA 3C26A 4CYOA 4QBJA 4L8AA 2Z3KA 1Z4RA 4C68A 4B5PA 4MJ8A 4OADA 4UWIA 2FCKA 2OB0A 5F48A 2RC4A 3DDDA 1B6BA 2ARHA 2B4DA 4UCMA 2PSWA 4KVME 4JXRA 2G3AA 1I21A 5G21A 3F0AA 5KTCA 3D2MA 4KUBA 1M4GA 1B87A 4NSQA 1YLEA 4C7HA 5H84A 4E0AA 2YNCC 2F5IA 1PUAA 2FXFA 2YNDA 5IV0A 2WPXA 3FIXA 4C2XA 2B4BA 4DNCA 4E8OA 1YK3A 4KOSA 4MY3A 2GIVA 4MFZA 3W91A 4PK2A 1SQHA 2Z0ZA 2Q4YA 4II9A 3TE4A 5IX3A 3F8KA 3FRMA 4A30A 5JQ4A 1RXTA 1UFHA 3EC4A 5I0CA 4K30A 1S7LA 3D2PA 2I79A 2AJ6A 4XPLA 3RYOA 3WR7A 3TTHA 4JLYA 4LX9A 4ORFA 4HNWB 4FD4A 5F46A 4UCPA 5E96A 2CXAA 3UY5A 2Z3OA 3G8WA 5J8CA 4YRHA 5G1ZA 4MFQA 1IYLA 5HH1A 1YVOA 3D3SA 4OLLA 3FNCA 1KUVA 4F6AA 2Q04A 2I00A 4AG7A 2D4OA 2FT0A 4XNHB 2JEVA 3E0KA 5F49A 4RS2A 1NMTA 3R95A 3T9YA 2GANA 1ON0A 4U9YA 4U9ZA 5KTAA 5C88A 4H6UA 3JTKA 4MFKA 1Q2CA 3K9UA 2QIRA 2B3UA 4AVBA 2P6GA 1XF8A 3DNSA 3IWEA 2ZW6A 4F0XA 1MJBA 2BL1A 4FD7A 3R9FA 5H86A 4LUAA 2A4NA 4XNHC 4KUAA 3P2HA 2B5GA 4B5OA 4KZTA 1P0HA 1WK4A 4CRYB 5ISVA 3TT2A 1S5KA 3LD2A 3DSBA 1Q2DA 1XEBA 2Z11A 1YX0A 4BBHA 4C2YA 1KUXA 4A33A 4XPKA 4XPDC 2Z3NA 5C82A 1QSNA 2H5MA 4CYQA 4R9MA 4L89A 4CGOA 2BEIA 4H89A 3BJ7A 2CY2A 3IWGA 3F5BA 4KS9A 2PR8A 4UFWA 1Y9KA 2FSRA 1XIXA 3ZZIA 1MJAA 3CXSA 1M1DA 2P0WA 3TO7A 1Z9UA 2HQYA 4B14A 2HV2A 4ZBGA 1YGHA 5GCNA 4KOXA 2HUZA 1KUYA 2Z3MA 4E2AA 2R8VA 2WPWA 3N7ZA 4QUSA 5DWNA 3ZJ0A 4YFJA 1J4JA 1S3ZA 1S7FA 1S7NA 4NEXA 4B13A 4ONUA 1IIDA 1ZO0A 2VBQA 3W6SA 4R87A 2REFA 5KTDA 1YR0A 1FY7A 4MY0A 4IUSA 3DR8A 2PDOA 2J8RA 2OU2A 2ZW5A 2ZW7A 2CNTA 2BSWA 3IU1A 1IB1E 3GKRA 2B3VA 2P6FA 4OAEA 2X7BA 5FVJA 5AG7A 1QSOA 1RO5A 3SHPA 3TCVA 2FIAA 4PSWA 4CGMA 1Y7RA 1M44A 2CNSA 1I12A 2ZPAA 5F47A 4UFVA 4MFJA 3LODA 4R3KA 5J8FA 4Q38A 3PZJA 3H4QA 1K4JA 5DWMA 4BMHA 3TO9A 3KKWA 1CJWA 5JPHA 2DXQA 3JVNA 4FD6A 2Q7BA 4XPDB 2WSAA 1P4NA 1GHEA 4HNXB 4AVAA 1XMTA 4KOWA 2Y0MA 4KORA 2DPSA 3JUWA 3EY5A 4HKFA 1QSMA 4CAFA 2R98A 4CRZB 4JD6A 5BWAB 3GY9A 5AG4A 4ZGYB 3PP9A 4KOYA 3IU2A 5CNPA 4CYPA 3VWEA 2ZXVA 2VZZA 3B8GA 4B5PB 2PC1A 4Y49C 2FL4A 4J3GA 1BO4A 2BUEA 3EFAA 2IL4A 3S6FA 3BJ8A 4FD5A 3R9GA 1QSRA 4KLWA 4UWJA 4Q36A 4B11A 2G3TA 5G22A 2D4PA 4CYNA 2ATRA 3FB3A 1IYKA 4B12A 1IICA 2QECA 2VXKA 4PV6A 3T90A 4C2ZA 3TFYA 2PQ8A 1MK4A 2AE6A 3CXPA 3SXOA 3QB8A 5AG6A 3IGRA 3TOAA 4QVTA 5AG5A 1NSLA 1OZPA 4F0YA 4UBRA 4YGOA 5HMNA 1I1DA 2VQYA 4UFXA 2NMTA 4NF1A 2REEA 4MFPA 1BOBA 1WWZA 2Q4VA 4CGLA 2B58A 2DPTA 4QB9A 3I3GA 3FYNA 4QC6A 4AB7A 1PU9A 3H5ZA 2WUUA 2FE7A 3EXNA 3FXTA 2J8NA 3S6KA 1R57A 5G20A 4KOVA 4KVXA 2JDCA 2VZYA 2OZHA 2K5TA 1V0CA 2JDDA 1NE9A 1S7KA 2Q0YA 1S60A 3TO6A 3VWDA 1XE4A 3EO4A 3G3SA 1Z4EA 2EUIA 4JXQA 2PRBA 2QMLA 4UCNA 2B5GB 4MHDA 2Z3PA 2VI7A 3D8PA 4MFLA 2YNCA 3QAHA 3R96A 3P2FA 1KZFA 2KCWA 3S6GA 1M4DA 1M4IA 4M3SA 3R9EA 1YVKA 4KLVA 1VKCA 4KVOE 3GYAA 2P6EA 4A2ZA 1L0CA 4X5KA 4EVYA 3CXQA 4H6ZA 4A31A 5EBVA 2O28A 2ZW4A 3V8IA 2JLMA 4I49A 5A28A 1CM0A 2G0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AVC A;  1MJ9 A;  4CAV A;  4U5Y A;  3R1K A;  4CAW A;  2OZG A;  4NCZ A;  2OZU A;  4GS4 A;  4R3L A;  2OH1 A;  3S6H A;  2R7H A;  2VEZ A;  4NXY A;  4IF5 A;  4JWP A;  2EVN A;  3SXN A;  2Z10 A;  1LRZ A;  1TIQ A;  1Y9W A;  4UA3 A;  5IB0 A;  4CAX A;  2GE3 A;  4MI4 A;  3MGD A;  4M85 A;  4JJX A;  4MBU A;  2FS5 A;  2J8M A;  2C27 A;  1N71 A;  1U6M A;  3W6X A;  3BLN A;  1Q2Y A;  4Y49 B;  1QST A;  3DR6 A;  3PGP A;  3NE7 A;  4R57 A;  2Q44 A;  1VHS A;  4KOU A;  3OWC A;  3TOB A;  1YRE A;  5EC4 A;  4HNY B;  4AG9 A;  2FIW A;  3FBU A;  2B4D B;  2R1I A;  2PR1 A;  4PK3 A;  4CS0 B;  2CNM A;  4KOT A;  4RI1 A;  3I9S A;  4PSX A;  3C26 A;  4QBJ A;  4L8A A;  1Z4R A;  4B5P A;  4MJ8 A;  4OAD A;  4UWI A;  2FCK A;  2OB0 A;  5F48 A;  2RC4 A;  3DDD A;  1B6B A;  2ARH A;  2B4D A;  2PSW A;  4KVM E;  4JXR A;  2G3A A;  1I21 A;  3F0A A;  5KTC A;  3D2M A;  4KUB A;  1M4G A;  1B87 A;  4NSQ A;  1YLE A;  4E0A A;  5H84 A;  2F5I A;  1PUA A;  2FXF A;  5IV0 A;  2WPX A;  3FIX A;  2B4B A;  4DNC A;  4E8O A;  1YK3 A;  4KOS A;  4MY3 A;  2GIV A;  3W91 A;  4PK2 A;  1SQH A;  2Z0Z A;  2Q4Y A;  4II9 A;  3TE4 A;  5IX3 A;  3F8K A;  3FRM A;  5JQ4 A;  1RXT A;  1UFH A;  3EC4 A;  5I0C A;  4K30 A;  1S7L A;  3D2P A;  2I79 A;  2AJ6 A;  4XPL A;  3RYO A;  3WR7 A;  3TTH A;  4JLY A;  4LX9 A;  4ORF A;  4HNW B;  4FD4 A;  5F46 A;  5E96 A;  3UY5 A;  3G8W A;  5J8C A;  4YRH A;  1IYL A;  5HH1 A;  1YVO A;  3D3S A;  4OLL A;  3FNC A;  1KUV A;  4F6A A;  2Q04 A;  2I00 A;  4AG7 A;  2D4O A;  2FT0 A;  4XNH B;  2JEV A;  3E0K A;  5F49 A;  4RS2 A;  1NMT A;  3R95 A;  3T9Y A;  2GAN A;  1ON0 A;  4U9Y A;  4U9Z A;  5KTA A;  5C88 A;  4H6U A;  1Q2C A;  3K9U A;  2QIR A;  2B3U A;  4AVB A;  2P6G A;  1XF8 A;  3DNS A;  2ZW6 A;  1MJB A;  2BL1 A;  4FD7 A;  3R9F A;  5H86 A;  4LUA A;  2A4N A;  4XNH C;  4KUA A;  3P2H A;  2B5G A;  4B5O A;  4KZT A;  1P0H A;  1WK4 A;  4CRY B;  5ISV A;  3TT2 A;  1S5K A;  3LD2 A;  3DSB A;  1Q2D A;  1XEB A;  2Z11 A;  1YX0 A;  1KUX A;  4XPK A;  4XPD C;  5C82 A;  1QSN A;  2H5M A;  4R9M A;  4L89 A;  2BEI A;  4H89 A;  3BJ7 A;  2CY2 A;  3IWG A;  3F5B A;  2PR8 A;  1Y9K A;  2FSR A;  1XIX A;  3ZZI A;  1MJA A;  3CXS A;  1M1D A;  2P0W A;  3TO7 A;  1Z9U A;  2HQY A;  2HV2 A;  4ZBG A;  1YGH A;  5GCN A;  4KOX A;  2HUZ A;  1KUY A;  4E2A A;  2R8V A;  2WPW A;  3N7Z A;  4QUS A;  5DWN A;  3ZJ0 A;  4YFJ A;  1J4J A;  1S3Z A;  1S7F A;  1S7N A;  4NEX A;  4ONU A;  1IID A;  2VBQ A;  3W6S A;  4R87 A;  2REF A;  5KTD A;  1YR0 A;  1FY7 A;  4MY0 A;  4IUS A;  3DR8 A;  2PDO A;  2J8R A;  2OU2 A;  2ZW5 A;  2ZW7 A;  2CNT A;  2BSW A;  1IB1 E;  3GKR A;  2B3V A;  2P6F A;  4OAE A;  2X7B A;  5FVJ A;  1QSO A;  1RO5 A;  3SHP A;  3TCV A;  2FIA A;  4PSW A;  1Y7R A;  1M44 A;  2CNS A;  1I12 A;  2ZPA A;  5F47 A;  3LOD A;  4R3K A;  5J8F A;  3PZJ A;  3H4Q A;  1K4J A;  5DWM A;  4BMH A;  3TO9 A;  3KKW A;  1CJW A;  5JPH A;  2DXQ A;  3JVN A;  4FD6 A;  2Q7B A;  4XPD B;  1P4N A;  1GHE A;  4HNX B;  4AVA A;  1XMT A;  4KOW A;  2Y0M A;  4KOR A;  3JUW A;  3EY5 A;  4HKF A;  1QSM A;  2R98 A;  4CRZ B;  4JD6 A;  3GY9 A;  3PP9 A;  4KOY A;  5CNP A;  3VWE A;  2ZXV A;  2VZZ A;  3B8G A;  4B5P B;  2PC1 A;  4Y49 C;  2FL4 A;  4J3G A;  1BO4 A;  2BUE A;  3EFA A;  2IL4 A;  3S6F A;  3BJ8 A;  4FD5 A;  3R9G A;  1QSR A;  4KLW A;  4UWJ A;  2G3T A;  2D4P A;  2ATR A;  3FB3 A;  1IYK A;  1IIC A;  2QEC A;  2VXK A;  4PV6 A;  3T90 A;  3TFY A;  2PQ8 A;  1MK4 A;  2AE6 A;  3CXP A;  3SXO A;  3QB8 A;  3IGR A;  3TOA A;  4QVT A;  1NSL A;  1OZP A;  4F0Y A;  4UBR A;  4YGO A;  5HMN A;  1I1D A;  2VQY A;  2NMT A;  4NF1 A;  2REE A;  1BOB A;  1WWZ A;  2Q4V A;  2B58 A;  4QB9 A;  3I3G A;  3FYN A;  4QC6 A;  4AB7 A;  1PU9 A;  2FE7 A;  3EXN A;  3FXT A;  2J8N A;  3S6K A;  1R57 A;  4KOV A;  4KVX A;  2JDC A;  2VZY A;  2OZH A;  2K5T A;  1V0C A;  2JDD A;  1NE9 A;  1S7K A;  2Q0Y A;  1S60 A;  3TO6 A;  3VWD A;  1XE4 A;  3EO4 A;  3G3S A;  1Z4E A;  2EUI A;  4JXQ A;  2PRB A;  2QML A;  2B5G B;  4MHD A;  2VI7 A;  3D8P A;  3QAH A;  3R96 A;  3P2F A;  1KZF A;  2KCW A;  3S6G A;  1M4D A;  1M4I A;  4M3S A;  3R9E A;  1YVK A;  4KLV A;  1VKC A;  4KVO E;  3GYA A;  2P6E A;  1L0C A;  4X5K A;  4EVY A;  3CXQ A;  4H6Z A;  5EBV A;  2O28 A;  2ZW4 A;  3V8I A;  2JLM A;  4I49 A;  1CM0 A;  2G0B A; 
#chains in the Genus database with same CATH topology
 4AVC A;  2PE3 A;  4CGP A;  3PFO A;  1MJ9 A;  4CAV A;  4U5Y A;  3QAY A;  3R1K A;  4WJB A;  3KAS A;  3CPA A;  4B10 A;  4CAW A;  2YNE A;  2JBK A;  2OZG A;  4NCZ A;  2OZU A;  2FVG A;  3A9L A;  4GS4 A;  4R3L A;  1RTQ A;  2OH1 A;  3S6H A;  4KSA A;  2PJ4 A;  2R7H A;  2PJ3 A;  2VEZ A;  2ZEP A;  4NXY A;  4P4B A;  4A32 A;  4IF5 A;  4A95 A;  4OC5 A;  4JWP A;  2EVN A;  4KSF A;  4MXU A;  1BLL E;  1ZLI A;  2Z10 A;  3SXN A;  1LRZ A;  3KQZ A;  2GLJ A;  5HVF A;  1TIQ A;  2GLF A;  1HDU A;  1Y9W A;  3D7H A;  4UA3 A;  3PEI A;  5IB0 A;  4CAX A;  2G9D A;  2GE3 A;  4MI4 A;  2V77 A;  3MGD A;  2GFQ A;  3IC1 A;  4JJX A;  4M85 A;  4MBU A;  4TNU A;  3SJE A;  2FS5 A;  4CAE A;  2J8M A;  1XFO A;  2J9A A;  2C27 A;  1N71 A;  1U6M A;  3W6X A;  2DF5 A;  1Q2Y A;  3BLN A;  4Y49 B;  4CGN A;  1QST A;  3DR6 A;  3FMC A;  3KI9 A;  5A27 A;  5J1Q A;  2CTB A;  3PGP A;  2YGW A;  1F2P A;  3NE7 A;  4R57 A;  2I3C A;  2Q44 A;  4FAI A;  4H2K A;  1VHS A;  4JZ0 A;  4KOU A;  4ZY1 A;  3OWC A;  4Z65 A;  3TOB A;  2C6P A;  1YRE A;  5LYF A;  5EC4 A;  4HNY B;  4AG9 A;  2FIW A;  3FBU A;  4C7I A;  5AGE A;  2B4D B;  3NH5 A;  2R1I A;  4X8I A;  2PR1 A;  4PK3 A;  4CS0 B;  1LFW A;  6CPA A;  1ARL A;  2CNM A;  4KOT A;  4RI1 A;  2Z3L A;  5LRJ A;  1Y0Y A;  1XBU A;  3H8E A;  3I9S A;  2O4H A;  4TWE A;  3WAB A;  4PSX A;  3C26 A;  1IGB A;  3B2Y A;  3PB9 X;  2ZEO A;  4L8A A;  2Z3K A;  1Z4R A;  4C68 A;  4CYO A;  3KZW A;  4B5P A;  1Z8T A;  2PJ6 A;  4QBJ A;  3RO0 A;  4MJ8 A;  3I1U A;  4OAD A;  3PBB A;  4MCQ A;  4UWI A;  1VHO A;  1TKJ A;  2BCO A;  2FCK A;  2OB0 A;  5F48 A;  5CBM A;  2RC4 A;  3DDD A;  1B6B A;  2ARH A;  2B4D A;  4UCM A;  1FNO A;  4DJL A;  2PSW A;  4KVM E;  4YWY A;  4JXR A;  2G3A A;  1I21 A;  5G21 A;  3F0A A;  4WWV A;  5KTC A;  1UWY A;  3D2M A;  4PPZ A;  4KUB A;  1AYE A;  1R43 A;  1M4G A;  1B87 A;  3HUV A;  4NSQ A;  4E2A A;  1YLE A;  4C7H A;  5H84 A;  4E0A A;  4MHY A;  2PVW A;  2F5I A;  1PUA A;  2FXF A;  2YND A;  2YNC C;  4M6G A;  5IV0 A;  1CPS A;  1ZG7 A;  1HEE A;  2C6G A;  2CIJ A;  2WPX A;  3GLJ A;  4W9Y A;  5LYI A;  4RUH A;  1YLO A;  3FIX A;  4LQG A;  4R7M A;  4ZX8 A;  2C6C A;  1XRY A;  2QJ8 A;  4C2X A;  2B4B A;  4DNC A;  1VGY A;  4E8O A;  1YK3 A;  4KOS A;  4MY3 A;  2GIV A;  2PVV A;  1ELM P;  4MFZ A;  3W91 A;  2OOT A;  1F57 A;  4FBE A;  4K3N A;  4PK2 A;  1SQH A;  2Z0Z A;  2Q4Y A;  4M6H A;  4NGP A;  3BI1 A;  5I4M A;  4II9 A;  3TE4 A;  3D68 A;  3B3S A;  4ZY2 A;  5IX3 A;  3F8K A;  4B6Z A;  3FRM A;  4A30 A;  1LCP A;  2O53 A;  5JQ4 A;  1RXT A;  1GYT A;  1UFH A;  4NGT A;  4A39 A;  2F7V A;  1Y7E A;  4JYW A;  3RNZ A;  2HB6 A;  3EC4 A;  4P4D A;  5I0C A;  4OID A;  2PRQ A;  4K30 A;  1S7L A;  3D2P A;  2I79 A;  2AJ6 A;  1TF8 A;  4XPL A;  3RYO A;  1ELL P;  3CPX A;  4P4I A;  3WR7 A;  2NYQ A;  1OBR A;  4JLY A;  3TTH A;  1Z2L A;  4LX9 A;  4ORF A;  4HNW B;  5LRK A;  3S9N A;  4F9V A;  4FD4 A;  1IOI A;  3SI1 A;  5F46 A;  1EE3 P;  3H8F A;  4UCP A;  4IK2 A;  1YW4 A;  5E96 A;  2CXA A;  3TX8 A;  4F8Z A;  3KL9 A;  5HXD A;  4ZX9 A;  3UY5 A;  2Z3O A;  3D7F A;  3G8W A;  3PFE A;  5J8C A;  4YRH A;  5G1Z A;  4MFQ A;  3NH4 A;  1IYL A;  5HH1 A;  4EME A;  5JGF A;  1YVO A;  3D3S A;  3IWW A;  4OLL A;  3FNC A;  1KUV A;  4F6A A;  2Q04 A;  3KHX A;  2I00 A;  4OIW A;  3VAT A;  4AG7 A;  2WYR A;  2D4O A;  2FT0 A;  4P4F A;  4PXB A;  2JEV A;  4XNH B;  2QYV A;  3E0K A;  3CDX A;  5F49 A;  3PB8 X;  4RS2 A;  3VAR A;  1QQ9 A;  2IJZ A;  4UIB A;  2HC9 A;  1NMT A;  3D7G A;  3R95 A;  3T9Y A;  3PB7 X;  2BO9 A;  2GAN A;  1ON0 A;  1VIX A;  4U9Y A;  2PJ0 A;  2PJ5 A;  5HVG A;  4U9Z A;  5KTA A;  5C88 A;  3CT9 A;  4H6U A;  1YQE A;  3DGV A;  3JTK A;  4MFK A;  4ZY0 A;  5CPA A;  1Q2C A;  3K9U A;  4NJR A;  2QIR A;  2B3U A;  4AVB A;  4PXE A;  2P6G A;  1XF8 A;  3DNS A;  1IU8 A;  3IWE A;  3H8G A;  2ZW6 A;  4R76 A;  4CPA A;  3MRU A;  2GRE A;  1MJB A;  4F0X A;  2AFW A;  5JH9 A;  1LAN A;  1R3N A;  2Q51 A;  2BL1 A;  4FD7 A;  3R9F A;  2EK9 A;  3WC6 A;  2POK A;  4R6T A;  5H86 A;  2XEF A;  3T8W A;  4LUA A;  2A4N A;  3NH8 A;  4XNH C;  4KUA A;  2V8H A;  4KSI A;  3P2H A;  2B5G A;  4B5O A;  4KZT A;  1P0H A;  2EWB A;  3V7Z A;  5K8N A;  1WK4 A;  4CRY B;  1X12 A;  5ISV A;  5DS0 A;  2PJC A;  3FED A;  3TT2 A;  1S5K A;  3LD2 A;  3DSB A;  1Q2D A;  4FUU A;  1XEB A;  1VHE A;  1FT7 A;  3IO1 A;  2Z11 A;  1YX0 A;  3KHZ A;  4BBH A;  4C2Y A;  2ZEG A;  1KUX A;  1ZLH A;  4A33 A;  4XPK A;  4XPD C;  3BI0 A;  2RB7 A;  2Z3N A;  5C82 A;  4NGR A;  1QSN A;  5D29 A;  4YU9 A;  2V8V A;  2H5M A;  3D4U A;  4MHP A;  4R9M A;  4UEF A;  4CYQ A;  4L89 A;  2WZN A;  2BEI A;  4CGO A;  4O23 A;  4H89 A;  2NSM A;  3FJU A;  1DTD A;  5JM6 A;  3BJ7 A;  2CY2 A;  3IWG A;  4LQ6 A;  1CBX A;  3B7I A;  2AFS A;  3F5B A;  4KS9 A;  4OC4 A;  2PR8 A;  2V8G A;  3PRT A;  4UFW A;  4DYO A;  1Y9K A;  5ELY A;  1Z8W A;  2FSR A;  3FVL A;  1ZG9 A;  1XIX A;  1XJO A;  3ZZI A;  1CP7 A;  3FEC A;  1YW6 A;  1MJA A;  3CXS A;  3PBE A;  1M1D A;  2P0W A;  3TO7 A;  2XEG A;  4NFR A;  1Z9U A;  2HQY A;  4B14 A;  5K8P A;  2HV2 A;  4ZBG A;  1YGH A;  5GCN A;  1QMU A;  1DE4 C;  1Z8X A;  3NFZ A;  4KOX A;  2HUZ A;  3FH4 A;  1KUY A;  2CF4 A;  2Z3M A;  2R8V A;  2WPW A;  3JRU A;  3N7Z A;  4QUS A;  4ONW A;  1IY7 A;  5DWN A;  3ZJ0 A;  4X2T A;  4YFJ A;  1J4J A;  1PCA A;  1S3Z A;  1S7F A;  1S7N A;  4NEX A;  3NA6 A;  4NGN A;  4ONU A;  4B13 A;  1IID A;  1ZO0 A;  2VBQ A;  3W6S A;  4R87 A;  2REF A;  1PYT B;  3CZX A;  5KTD A;  1ZG8 A;  1YR0 A;  2C1C A;  4NGS A;  1FY7 A;  4MY0 A;  4MHZ A;  4IUS A;  3BXM A;  3DR8 A;  2PDO A;  2J8R A;  2AFU A;  2OU2 A;  1JQG A;  2ZW5 A;  2ZW7 A;  1TF9 A;  2CNT A;  1Z8L A;  2BSW A;  2ODF A;  3IU1 A;  1IB1 E;  3GKR A;  2B3V A;  1LOK A;  2P6F A;  4OAE A;  2X7B A;  5FVJ A;  4ZI6 A;  3BHX A;  4MHN A;  5AG7 A;  3HLP A;  1QSO A;  1RO5 A;  2AFZ A;  3SHP A;  3TCV A;  1XMB A;  2FIA A;  3ISZ A;  3ISX A;  4PSW A;  4CGM A;  3D67 A;  1Y7R A;  1M44 A;  2CNS A;  1I12 A;  2ZPA A;  5F47 A;  4UFV A;  3B3V A;  4MFJ A;  3PB4 X;  4AXV A;  5K8M A;  2PJ1 A;  3LOD A;  4R3K A;  4HPS A;  5J8F A;  4Q38 A;  2RFH A;  3PB6 X;  3H4Q A;  3PZJ A;  3SJX A;  1KWM A;  4F9U A;  1K4J A;  5DWM A;  4BMH A;  3B3C A;  2IMO A;  4ZYQ A;  5EMI A;  3TO9 A;  3KKW A;  2Q43 A;  1CJW A;  8CPA A;  4FWU A;  2DXQ A;  5JPH A;  2PJ8 A;  1TKF A;  1TXR A;  2CTC A;  3JVN A;  4FD6 A;  3KR5 A;  2Q7B A;  4XPD B;  2WSA A;  1P4N A;  1GHE A;  2ANP A;  4HNX B;  4AVA A;  4EFD A;  2AFX A;  1AMP A;  5THW A;  1A2Z A;  4DUK A;  1XMT A;  2QVP A;  4OME A;  3D66 A;  4KOW A;  2Y0M A;  4M6I A;  4OKO A;  4KOR A;  2DPS A;  3SI2 A;  2PIZ A;  3JUW A;  3EY5 A;  3RZA A;  4HKF A;  1QSM A;  4CAF A;  2R98 A;  4CRZ B;  2ZOG A;  5LYL A;  1XOV A;  4JD6 A;  5F09 A;  5BWA B;  2AFO A;  3KR4 A;  3GY9 A;  5AG4 A;  4ZGY B;  4MCP A;  2IQ6 A;  3PP9 A;  4A94 A;  4KOY A;  3IU2 A;  4OP4 A;  5CNP A;  4G1P A;  4CYP A;  4OC2 A;  4PQA A;  4PXC A;  4UF4 A;  3VWE A;  3IFE A;  2ZXV A;  2VZZ A;  5IB9 A;  1M4L A;  3B8G A;  3V38 A;  4B5P B;  1YME A;  2PC1 A;  2XEI A;  4Y49 C;  2FL4 A;  3D7D A;  4J3G A;  3L2N A;  1BO4 A;  4P6Y A;  1F2O A;  2BUE A;  3WC7 A;  1NSA A;  2IL4 A;  2PJ7 A;  3EFA A;  3S6F A;  3FF3 A;  3BJ8 A;  4FD5 A;  3TC8 A;  3R9G A;  2ABZ A;  1QSR A;  4KLW A;  4UWJ A;  3KGQ A;  4Q36 A;  4B11 A;  2G3T A;  5G22 A;  2D4P A;  4BIN A;  4CYN A;  3SI0 A;  4A38 A;  1Z5R A;  3S9M A;  4MCS A;  5D8N A;  4PXD A;  2ATR A;  3FB3 A;  1IYK A;  1TKH A;  5K8O A;  4P10 A;  4B12 A;  3S9L A;  3KQX A;  2GU2 A;  2ZEM A;  1IIC A;  1X10 A;  2QEC A;  2VXK A;  4PV6 A;  1Y0R A;  2BOA A;  3T90 A;  4R8F A;  4C2Z A;  1AUG A;  3TFY A;  2PQ8 A;  1IOF A;  4A37 A;  1MK4 A;  3LMS A;  2AE6 A;  3CXP A;  3SJF A;  3SXO A;  1HDQ A;  3QB8 A;  5AG6 A;  3IGR A;  1H8L A;  4OC0 A;  4GM5 A;  3TOA A;  4QVT A;  2JEW A;  5AG5 A;  1NSL A;  2Q4Z A;  1OZP A;  3LWU A;  3FX6 A;  1JWQ A;  4UBR A;  4YGO A;  3LAC A;  2ZEF A;  4UEE A;  1Q7L A;  4F0Y A;  5HMN A;  1CX8 A;  1I1D A;  2VQY A;  4UFX A;  5LRG A;  4MCR A;  3B35 A;  2NMT A;  3WT4 A;  4NF1 A;  2PJB A;  1BPN A;  2REE A;  4MFP A;  1BOB A;  3DLJ A;  1WWZ A;  1ARM A;  2Q4V A;  4NGM A;  4CGL A;  3B3W A;  3RAM A;  2B58 A;  2DPT A;  4QB9 A;  3K9T A;  3I3G A;  4UIA A;  4IAV A;  3FYN A;  4NGQ A;  3FEE A;  2PJ9 A;  2AFM A;  4QC6 A;  4AB7 A;  1PU9 A;  3IEH A;  4BD9 A;  3H5Z A;  1YSJ A;  2WUU A;  2PCU A;  2FE7 A;  3EXN A;  3FXT A;  4MRI A;  2J8N A;  4P44 A;  3SJG A;  3S6K A;  2PJA A;  3IIB A;  1R57 A;  3N5F A;  5G20 A;  4KOV A;  2OR4 A;  4KVX A;  2JDC A;  2VZY A;  2OZH A;  2ZEL A;  2K5T A;  3GUX A;  1V0C A;  2JDD A;  1NE9 A;  1S7K A;  4RN7 A;  2Q0Y A;  4Q7A A;  1S60 A;  3TO6 A;  2VL1 A;  2EK8 A;  3VWD A;  3WC5 A;  1XE4 A;  3EO4 A;  3G3S A;  5HVH A;  2ZEE A;  1Z4E A;  3GIU A;  2EUI A;  2ZOF A;  2JBJ A;  4JXQ A;  2PRB A;  2QML A;  4UCN A;  2B5G B;  3B3T A;  4MHD A;  4UEZ A;  2Z3P A;  2VI7 A;  2ZED A;  3D8P A;  4MFL A;  2YNC A;  4NJQ A;  2Q7S A;  3QAH A;  1LAM A;  7CPA A;  3R96 A;  3P2F A;  1KZF A;  4OC3 A;  2KCW A;  3S6G A;  1M4D A;  1M4I A;  4M3S A;  5LYD A;  3R9E A;  3VH9 A;  2EBJ A;  1YVK A;  3GB0 A;  3RBU A;  4MMO A;  2PJ2 A;  2ZEH A;  1CPX A;  3IJ3 A;  4KLV A;  1BPM A;  3QNV A;  1VKC A;  2PIY A;  4OC1 A;  4KVO E;  3GYA A;  2P6E A;  4A2Z A;  2DEA A;  1L0C A;  4X5K A;  1LAP A;  4EVY A;  2XEJ A;  3CXQ A;  4H6Z A;  4A31 A;  5EBV A;  4P4E A;  3K2K A;  4P4J A;  2V8D A;  2O28 A;  2ZW4 A;  4P45 A;  3V8I A;  2ZEN A;  2JLM A;  4I49 A;  4X3R A;  1BAV A;  3MN8 A;  5A28 A;  1CM0 A;  1CP6 A;  2F8H A;  2G0B A;  4IHM A;  4GXH A;  1CG2 A;  2EO8 A;  4EWT A;  3NE8 A; 
#chains in the Genus database with same CATH homology
 4AVC A;  4CGP A;  1MJ9 A;  4CAV A;  4U5Y A;  3R1K A;  4B10 A;  4CAW A;  2YNE A;  2OZG A;  4NCZ A;  2OZU A;  3A9L A;  4GS4 A;  4R3L A;  2OH1 A;  3S6H A;  4KSA A;  2R7H A;  2VEZ A;  4NXY A;  4A32 A;  4A95 A;  4IF5 A;  4JWP A;  2EVN A;  4KSF A;  3SXN A;  2Z10 A;  1LRZ A;  1TIQ A;  1Y9W A;  4UA3 A;  5IB0 A;  4CAX A;  2GE3 A;  4MI4 A;  3MGD A;  4M85 A;  4JJX A;  4MBU A;  4CAE A;  2FS5 A;  2J8M A;  2C27 A;  1N71 A;  1U6M A;  3W6X A;  3BLN A;  1Q2Y A;  4Y49 B;  4CGN A;  1QST A;  3DR6 A;  5A27 A;  3PGP A;  2YGW A;  3NE7 A;  4R57 A;  2Q44 A;  1VHS A;  4KOU A;  3OWC A;  3TOB A;  1YRE A;  5EC4 A;  4HNY B;  4AG9 A;  2FIW A;  3FBU A;  4C7I A;  5AGE A;  2B4D B;  2R1I A;  2PR1 A;  4PK3 A;  4CS0 B;  2CNM A;  4KOT A;  4RI1 A;  2Z3L A;  3I9S A;  4PSX A;  3C26 A;  4CYO A;  4QBJ A;  4L8A A;  2Z3K A;  1Z4R A;  4C68 A;  4B5P A;  4MJ8 A;  4OAD A;  4UWI A;  2FCK A;  2OB0 A;  5F48 A;  2RC4 A;  3DDD A;  1B6B A;  2ARH A;  2B4D A;  4UCM A;  2PSW A;  4KVM E;  4JXR A;  2G3A A;  1I21 A;  5G21 A;  3F0A A;  5KTC A;  3D2M A;  4KUB A;  1M4G A;  1B87 A;  4NSQ A;  1YLE A;  4C7H A;  5H84 A;  4E0A A;  2YNC C;  2F5I A;  1PUA A;  2FXF A;  2YND A;  5IV0 A;  2WPX A;  3FIX A;  4C2X A;  2B4B A;  4DNC A;  4E8O A;  1YK3 A;  4KOS A;  4MY3 A;  2GIV A;  4MFZ A;  3W91 A;  4PK2 A;  1SQH A;  2Z0Z A;  2Q4Y A;  4II9 A;  3TE4 A;  5IX3 A;  3F8K A;  3FRM A;  4A30 A;  5JQ4 A;  1RXT A;  1UFH A;  3EC4 A;  5I0C A;  4K30 A;  1S7L A;  3D2P A;  2I79 A;  2AJ6 A;  4XPL A;  3RYO A;  3WR7 A;  3TTH A;  4JLY A;  4LX9 A;  4ORF A;  4HNW B;  4FD4 A;  5F46 A;  4UCP A;  5E96 A;  2CXA A;  3UY5 A;  2Z3O A;  3G8W A;  5J8C A;  4YRH A;  5G1Z A;  4MFQ A;  1IYL A;  5HH1 A;  1YVO A;  3D3S A;  4OLL A;  3FNC A;  1KUV A;  4F6A A;  2Q04 A;  2I00 A;  4AG7 A;  2D4O A;  2FT0 A;  4XNH B;  2JEV A;  3E0K A;  5F49 A;  4RS2 A;  1NMT A;  3R95 A;  3T9Y A;  2GAN A;  1ON0 A;  4U9Y A;  4U9Z A;  5KTA A;  5C88 A;  4H6U A;  3JTK A;  4MFK A;  1Q2C A;  3K9U A;  2QIR A;  2B3U A;  4AVB A;  2P6G A;  1XF8 A;  3DNS A;  3IWE A;  2ZW6 A;  4F0X A;  1MJB A;  2BL1 A;  4FD7 A;  3R9F A;  5H86 A;  4LUA A;  2A4N A;  4XNH C;  4KUA A;  3P2H A;  2B5G A;  4B5O A;  4KZT A;  1P0H A;  1WK4 A;  4CRY B;  5ISV A;  3TT2 A;  1S5K A;  3LD2 A;  3DSB A;  1Q2D A;  1XEB A;  2Z11 A;  1YX0 A;  4BBH A;  4C2Y A;  1KUX A;  4A33 A;  4XPK A;  4XPD C;  2Z3N A;  5C82 A;  1QSN A;  2H5M A;  4CYQ A;  4R9M A;  4L89 A;  4CGO A;  2BEI A;  4H89 A;  3BJ7 A;  2CY2 A;  3IWG A;  3F5B A;  4KS9 A;  2PR8 A;  4UFW A;  1Y9K A;  2FSR A;  1XIX A;  3ZZI A;  1MJA A;  3CXS A;  1M1D A;  2P0W A;  3TO7 A;  1Z9U A;  2HQY A;  4B14 A;  2HV2 A;  4ZBG A;  1YGH A;  5GCN A;  4KOX A;  2HUZ A;  1KUY A;  2Z3M A;  4E2A A;  2R8V A;  2WPW A;  3N7Z A;  4QUS A;  5DWN A;  3ZJ0 A;  4YFJ A;  1J4J A;  1S3Z A;  1S7F A;  1S7N A;  4NEX A;  4B13 A;  4ONU A;  1IID A;  1ZO0 A;  2VBQ A;  3W6S A;  4R87 A;  2REF A;  5KTD A;  1YR0 A;  1FY7 A;  4MY0 A;  4IUS A;  3DR8 A;  2PDO A;  2J8R A;  2OU2 A;  2ZW5 A;  2ZW7 A;  2CNT A;  2BSW A;  3IU1 A;  1IB1 E;  3GKR A;  2B3V A;  2P6F A;  4OAE A;  2X7B A;  5FVJ A;  5AG7 A;  1QSO A;  1RO5 A;  3SHP A;  3TCV A;  2FIA A;  4PSW A;  4CGM A;  1Y7R A;  1M44 A;  2CNS A;  1I12 A;  2ZPA A;  5F47 A;  4UFV A;  4MFJ A;  3LOD A;  4R3K A;  5J8F A;  4Q38 A;  3PZJ A;  3H4Q A;  1K4J A;  5DWM A;  4BMH A;  3TO9 A;  3KKW A;  1CJW A;  5JPH A;  2DXQ A;  3JVN A;  4FD6 A;  2Q7B A;  4XPD B;  2WSA A;  1P4N A;  1GHE A;  4HNX B;  4AVA A;  1XMT A;  4KOW A;  2Y0M A;  4KOR A;  2DPS A;  3JUW A;  3EY5 A;  4HKF A;  1QSM A;  4CAF A;  2R98 A;  4CRZ B;  4JD6 A;  5BWA B;  3GY9 A;  5AG4 A;  4ZGY B;  3PP9 A;  4KOY A;  3IU2 A;  5CNP A;  4CYP A;  3VWE A;  2ZXV A;  2VZZ A;  3B8G A;  4B5P B;  2PC1 A;  4Y49 C;  2FL4 A;  4J3G A;  1BO4 A;  2BUE A;  3EFA A;  2IL4 A;  3S6F A;  3BJ8 A;  4FD5 A;  3R9G A;  1QSR A;  4KLW A;  4UWJ A;  4Q36 A;  4B11 A;  2G3T A;  5G22 A;  2D4P A;  4CYN A;  2ATR A;  3FB3 A;  1IYK A;  4B12 A;  1IIC A;  2QEC A;  2VXK A;  4PV6 A;  3T90 A;  4C2Z A;  3TFY A;  2PQ8 A;  1MK4 A;  2AE6 A;  3CXP A;  3SXO A;  3QB8 A;  5AG6 A;  3IGR A;  3TOA A;  4QVT A;  5AG5 A;  1NSL A;  1OZP A;  4F0Y A;  4UBR A;  4YGO A;  5HMN A;  1I1D A;  2VQY A;  4UFX A;  2NMT A;  4NF1 A;  2REE A;  4MFP A;  1BOB A;  1WWZ A;  2Q4V A;  4CGL A;  2B58 A;  2DPT A;  4QB9 A;  3I3G A;  3FYN A;  4QC6 A;  4AB7 A;  1PU9 A;  3H5Z A;  2WUU A;  2FE7 A;  3EXN A;  3FXT A;  2J8N A;  3S6K A;  1R57 A;  5G20 A;  4KOV A;  4KVX A;  2JDC A;  2VZY A;  2OZH A;  2K5T A;  1V0C A;  2JDD A;  1NE9 A;  1S7K A;  2Q0Y A;  1S60 A;  3TO6 A;  3VWD A;  1XE4 A;  3EO4 A;  3G3S A;  1Z4E A;  2EUI A;  4JXQ A;  2PRB A;  2QML A;  4UCN A;  2B5G B;  4MHD A;  2Z3P A;  2VI7 A;  3D8P A;  4MFL A;  2YNC A;  3QAH A;  3R96 A;  3P2F A;  1KZF A;  2KCW A;  3S6G A;  1M4D A;  1M4I A;  4M3S A;  3R9E A;  1YVK A;  4KLV A;  1VKC A;  4KVO E;  3GYA A;  2P6E A;  4A2Z A;  1L0C A;  4X5K A;  4EVY A;  3CXQ A;  4H6Z A;  4A31 A;  5EBV A;  2O28 A;  2ZW4 A;  3V8I A;  2JLM A;  4I49 A;  5A28 A;  1CM0 A;  2G0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...