2J8RA

Structure of p. aeruginosa acetyltransferase pa4866 solved in complex with l-methionine sulfoximine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
170
structure length
170
Chain Sequence
ASIRDAGVADLPGILAIYNDAVGNTTAIWNETPVDLANRQAWFDARARQGYPILVASDAAGEVLGYASYGDWRPFEGFRGTVEHSVYVRDDQRGKGLGVQLLQALIERARAQGLHVMVAAIESGNAASIGLHRRLGFEISGQMPQVGQKFGRWLDLTFMQLNLDPTRSAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ACETYLTRANSFERASE PA4866 FROM P. AERUGINOSA
publication title L-Methionine Sulfoximine, But not Phosphinothricin, is a Substrate for an Acetyltransferase (Gene Pa4866) from Pseudomonas Aeruginosa: Structural and Functional Studies.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 51
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2j8rA00
2FCKA 2VZYA 2R98A 2REFA 5F47A 4KOSA 4KOUA 1BOBA 2FIAA 3NE7A 2WPWA 1XIXA 5IV0A 4M85A 2FT0A 4B5PB 5EC4A 3BJ8A 3FYNA 4YGOA 1YVOA 4E0AA 2Z10A 3FXTA 3PZJA 3C26A 3F5BA 5J8CA 4PSXA 4QUSA 2P0WA 2Q04A 5IX3A 1IIDA 1YR0A 2Q4VA 1IB1E 4CAWA 1QSRA 2H5MA 3UY5A 2Z0ZA 2DXQA 4B5OA 3JUWA 1CM0A 2G3AA 1R57A 3D2MA 1WWZA 3TT2A 1M4IA 4UWIA 2B58A 5GCNA 1KZFA 1QSNA 5E96A 4U9YA 2REEA 1M1DA 5C82A 1YREA 1NE9A 1NSLA 3W91A 5EBVA 3W6XA 4ONUA 4NEXA 4OAEA 5C88A 1Y7RA 1QSTA 3PP9A 3TE4A 3D2PA 4L89A 4R87A 4FD4A 1IYKA 4CAVA 4EVYA 3EY5A 2VXKA 2GANA 1V0CA 2QMLA 4IUSA 1YVKA 1YX0A 3RYOA 4IF5A 4FD5A 4JD6A 3P2FA 2GE3A 4H6ZA 4L8AA 1S60A 4UBRA 3R1KA 2BL1A 4AVCA 1J4JA 3LODA 4RI1A 3GYAA 4K30A 3IWGA 3I9SA 3R95A 1PUAA 3F8KA 4F0YA 1QSMA 4H6UA 4ORFA 3S6FA 1I12A 2AJ6A 2PSWA 2FXFA 3EO4A 4FD6A 2RC4A 5H86A 1RO5A 2FSRA 2P6EA 2ZW4A 1IICA 1SQHA 3D3SA 3P2HA 3CXQA 1Z4EA 2P6FA 4R9MA 3G8WA 3QB8A 3TCVA 4LX9A 4PV6A 2R8VA 3FBUA 1S7NA 2J8MA 3S6GA 1YK3A 4JXQA 1BO4A 3DDDA 1B6BA 1KUYA 3GY9A 2NMTA 3N7ZA 2B5GA 1S7KA 4MY3A 4X5KA 4AVBA 1NMTA 4E8OA 1Y9WA 2VBQA 1M44A 2R7HA 4JLYA 1VHSA 1M4DA 2Q7BA 3G3SA 1P4NA 2A4NA 3WR7A 3K9UA 3DSBA 4U5YA 2BEIA 3FRMA 4CS0B 2PC1A 2VQYA 2FS5A 3FNCA 3PGPA 1MK4A 5F48A 2HQYA 3TO7A 1I21A 4JWPA 2Q44A 1MJBA 1K4JA 3DNSA 3TOBA 1GHEA 3EXNA 5JQ4A 1N71A 4RS2A 4PK3A 4KVOE 2B4DA 2CNTA 1S3ZA 1Q2CA 4KORA 2F5IA 4II9A 1CJWA 1YGHA 3R9GA 2VZZA 3I3GA 1RXTA 3CXPA 4ZBGA 2B3VA 5FVJA 4OLLA 4U9ZA 4M3SA 4DNCA 3TO9A 1UFHA 2PRBA 3D8PA 1Y9KA 2ARHA 4XPDB 3FB3A 2PQ8A 1YLEA 4OADA 3S6HA 1ON0A 1TIQA 3SXNA 3JVNA 3DR6A 4MJ8A 4KZTA 4KUBA 2BSWA 4NXYA 4QVTA 4XPDC 3FIXA 2OZUA 2G0BA 2AE6A 4MY0A 4UA3A 2CNSA 2G3TA 3VWEA 4FD7A 2B5GB 1MJ9A 2ZW5A 3TO6A 1XE4A 1Z9UA 3R9FA 2BUEA 2IL4A 3R9EA 1PU9A 3EC4A 2I79A 2ZW6A 2R1IA 4YFJA 1KUVA 3B8GA 3BLNA 4AB7A 4AVAA 4KOWA 4QBJA 1QSOA 4LUAA 3T9YA 2CY2A 4KOTA 5ISVA 3W6SA 3V8IA 2B3UA 4KUAA 2Y0MA 4YRHA 4KOXA 3S6KA 5CNPA 2OZHA 1P0HA 2HUZA 3ZJ0A 1S5KA 4MI4A 2PDOA 2GIVA 2KCWA 3ZZIA 4CRZB 3KKWA 1Z4RA 4XNHB 2B4DB 2ATRA 2CNMA 5KTDA 2QECA 4HNWB 5DWNA 2FL4A 1LRZA 4KOYA 3TOAA 5J8FA 2J8NA 5KTCA 4NSQA 2OZGA 4KVXA 1B87A 3EFAA 4B5PA 4Y49B 4R3KA 2Z11A 4XNHC 4KVME 2P6GA 4HNXB 4KLWA 4AG7A 4JJXA 4H89A 2OU2A 2JDCA 2JLMA 2VI7A 4PK2A 5HH1A 1FY7A 1Q2YA 2B4BA 2I00A 1L0CA 4CAXA 3MGDA 2HV2A 4JXRA 4Y49C 4HNYB 1XMTA 2PR1A 4NCZA 5F46A 1XF8A 3IGRA 2J8RA 2ZXVA 1I1DA 2D4OA 2WPXA 5JPHA 2EVNA 2ZPAA 2OB0A 3GKRA 3QAHA 1XEBA 2JDDA 1KUXA 2VEZA 3BJ7A 4NF1A 4QC6A 4MHDA 1VKCA 3TTHA 4BMHA 3T90A 3F0AA 5F49A 4GS4A 4XPLA 4AG9A 2OH1A 2JEVA 3SXOA 1M4GA 2D4PA 2FE7A 4HKFA 1S7LA 2ZW7A 5DWMA 3R96A 2K5TA 4UWJA 5H84A 3VWDA 1WK4A 1OZPA 4I49A 4R3LA 2C27A 3TFYA 4KLVA 4CRYB 5IB0A 4R57A 3CXSA 3DR8A 4XPKA 1Q2DA 3OWCA 4F6AA 5KTAA 3LD2A 4MBUA 3H4QA 4PSWA 3E0KA 4J3GA 4KOVA 2FIWA 1S7FA 2PR8A 5HMNA 4E2AA 2Q4YA 5I0CA 1MJAA 2O28A 1IYLA 2QIRA 3SHPA 2EUIA 2Q0YA 1U6MA 2X7BA 4QB9A
chains in the Genus database with same CATH superfamily
3KL9A 1UWYA 2QVPA 2FCKA 2VZYA 4CGLA 4CYOA 1AUGA 2R98A 2REFA 5F47A 4A94A 4MFPA 4KOSA 3SJEA 2ZEPA 3IWWA 3NFZA 4KOUA 1BOBA 2FIAA 3H8GA 3NE7A 2WPWA 3PBBA 1XIXA 4OIWA 3A9LA 5IV0A 5K8OA 4M85A 2BOAA 2FT0A 1CP7A 4B5PB 5EC4A 2Z3LA 3BJ8A 4DYOA 3LWUA 3FYNA 4YGOA 2EK9A 1YVOA 1X10A 2Z10A 4E0AA 3FXTA 1AYEA 3S9NA 1LAPA 3PZJA 3C26A 4A33A 3F5BA 4ONWA 5J8CA 1ELLP 4JYWA 2EWBA 4MCQA 4PSXA 4QUSA 2F7VA 5AG5A 1XFOA 4MXUA 2P0WA 2Q04A 5IX3A 2PJ0A 1IIDA 2V8DA 1YR0A 3LMSA 2Q4VA 1IB1E 1HDQA 1QSRA 2AFZA 3SJXA 4UEZA 4CAWA 1TKJA 2H5MA 3HLPA 4TWEA 3UY5A 4P4EA 4ZGYB 2Z0ZA 4UIAA 2DXQA 4F9UA 2RB7A 1ARLA 4B5OA 3JUWA 1CM0A 2G3AA 1R57A 3D2MA 1Z8TA 3IU2A 1WWZA 3TT2A 2Z3NA 1M4IA 4FAIA 4UWIA 3FF3A 2B58A 2EBJA 3MRUA 5GCNA 3D68A 2ZEOA 2Z3KA 4A37A 1KZFA 1QSNA 4ZI6A 5E96A 3PB4X 4U9YA 3T8WA 2Q43A 2REEA 1M1DA 3BXMA 5C82A 1YREA 1NE9A 1NSLA 4X3RA 3W91A 5EBVA 4NGRA 3W6XA 1F57A 2AFOA 1YSJA 4ONUA 4NEXA 4MFZA 4OAEA 1IOIA 2PJ3A 5C88A 2DPTA 2YNEA 1Y7RA 3B7IA 1QSTA 3PP9A 1QMUA 5ELYA 4PQAA 3TE4A 3D2PA 3D66A 2JBJA 4L89A 4R87A 5K8PA 4OKOA 3HUVA 2C6GA 4FD4A 1IYKA 1TKHA 4CAVA 4UEEA 4EVYA 3EY5A 3V7ZA 1M4LA 2VXKA 3KR5A 4DUKA 2GANA 1V0CA 2QMLA 4Q36A 4EMEA 4IUSA 1YVKA 4UFXA 5D8NA 4MRIA 3PB7X 3D4UA 1YX0A 3S9LA 3FVLA 3WABA 3RYOA 3H8FA 4NGTA 4IF5A 4FD5A 4JD6A 4CPAA 3P2FA 2GE3A 3RO0A 4H6ZA 4L8AA 1S60A 4UBRA 3R1KA 2BL1A 4AVCA 1J4JA 3LODA 4RI1A 3GYAA 4K30A 3IWGA 4CGMA 2GU2A 3IO1A 3IFEA 1DE4C 3I9SA 3R95A 1PUAA 3F8KA 4F0YA 1QSMA 2PJBA 4H6UA 2F8HA 4P10A 2CIJA 1TKFA 2FVGA 4ORFA 5HVFA 2WYRA 3S6FA 1CX8A 1I12A 2AJ6A 2PSWA 3B3VA 3S9MA 2PJ5A 3VATA 2FXFA 3KZWA 1LAMA 3EO4A 2ZEDA 3PFOA 2RC4A 4FD6A 3KQZA 4ZY2A 4JZ0A 1CPSA 2DF5A 1RO5A 2FSRA 2P6EA 2ZEHA 2ZW4A 5H86A 4PXEA 4Q38A 1IICA 1SQHA 1Z2LA 4ZX8A 5HXDA 1Y0RA 3D3SA 5LYIA 3DLJA 3P2HA 2PJ8A 1Z4EA 2P6FA 3CXQA 3G8WA 3K2KA 4R9MA 3QB8A 4HPSA 4LX9A 4PV6A 3RAMA 3TCVA 2R8VA 3FBUA 3GUXA 4P4BA 4MHNA 1S7NA 2J8MA 3S6GA 5K8MA 3KQXA 4K3NA 1YK3A 1XMBA 3IEHA 4A2ZA 1F2PA 1LANA 2GLJA 4JXQA 3GIUA 4OP4A 4CAFA 4F0XA 3B2YA 4RUHA 1BO4A 3DDDA 1B6BA 1KUYA 3GY9A 2NMTA 3N7ZA 2B5GA 4CYQA 2C6CA 1S7KA 4MY3A 4P45A 4X5KA 2PJ7A 4AVBA 1NMTA 1XRYA 3FECA 5JGFA 4E8OA 1VHOA 4CYNA 3CT9A 4P6YA 1Y9WA 3FH4A 3IWEA 3JTKA 2VBQA 1M44A 2R7HA 3B3WA 4JLYA 5LRGA 4B13A 1LCPA 3D7GA 2HB6A 4C68A 1VIXA 5CBMA 1YW4A 4UFVA 1XBUA 3V38A 1VHSA 1LOKA 1M4DA 4IK2A 2Q7BA 4OC2A 2GREA 4KS9A 3G3SA 1P4NA 3RNZA 3K9TA 4P4IA 2A4NA 3WR7A 3K9UA 3SI0A 4O23A 3DSBA 3B3SA 3NE8A 2HC9A 4U5YA 2AFMA 2BEIA 3FRMA 4C2ZA 4CS0B 2ZENA 2PRQA 1OBRA 2QJ8A 2PC1A 2VQYA 2FS5A 3H5ZA 5A27A 4R6TA 4ZYQA 3FNCA 3PGPA 4C2YA 1MK4A 4KSIA 5F48A 1CPXA 2HQYA 2PIYA 5D29A 5AG7A 5AG6A 5G20A 3TO7A 1I21A 4JWPA 3WC5A 2Q44A 3PRTA 1MJBA 4ZY0A 1K4JA 3DNSA 3TOBA 3IJ3A 1GHEA 1IU8A 4X2TA 3ISXA 2Q51A 3EXNA 4YWYA 2C6PA 5JQ4A 4BD9A 4UEFA 1N71A 4M6HA 4RS2A 4PK3A 4NGQA 3SJGA 5JH9A 4B14A 2Z3PA 4KVOE 5DS0A 2IQ6A 2B4DA 4MHZA 1VHEA 1CG2A 2CNTA 1S3ZA 5G21A 1IOFA 4UCMA 1JWQA 3KR4A 1Q2CA 2EO8A 2V8GA 3FEEA 6CPAA 4KORA 2F5IA 4II9A 1CJWA 1YGHA 2Z3MA 4C2XA 5F09A 3PB8X 3CPXA 1Q7LA 4R76A 4NFRA 4CGPA 3R9GA 2VZZA 3I3GA 3QNVA 1RXTA 4WJBA 4IAVA 3D7DA 2WSAA 3GLJA 3CXPA 4RN7A 2ANPA 2B3VA 3FEDA 4ZBGA 5FVJA 1YQEA 3H8EA 4OLLA 4U9ZA 4M3SA 4DNCA 3TO9A 1UFHA 1ZG9A 2DPSA 2PRBA 1F2OA 2PJ6A 3D8PA 1Y9KA 2ARHA 2WZNA 4XPDB 3FB3A 4G1PA 2PQ8A 1YLEA 3SI1A 4OADA 3QAYA 4A31A 1X12A 2QYVA 2BO9A 1ON0A 1TIQA 3S6HA 3SXNA 3JVNA 1PYTB 3PB6X 2IJZA 4ZX9A 2Q4ZA 3DR6A 3L2NA 4MJ8A 4KZTA 4IHMA 4H2KA 4KUBA 3RZAA 4DJLA 2ZEGA 2BSWA 2XEGA 4NXYA 4MFKA 4LQGA 3NA6A 5AGEA 5IB9A 4KSAA 2XEJA 4QVTA 4A38A 2V8VA 5HVHA 4BINA 1ELMP 4XPDC 1Z8XA 4WWVA 3FIXA 4UF4A 1IY7A 2PJAA 2OZUA 1VGYA 2G0BA 2O4HA 1R3NA 1Z8WA 2AE6A 4MY0A 2PJ2A 1TF9A 1H8LA 1BAVA 3PB9X 2CNSA 4R8FA 4UA3A 4CYPA 4M6IA 2ABZA 4NGMA 2G3TA 2YNCA 3WT4A 1ZLIA 2C1CA 3VWEA 4FD7A 2OR4A 2B5GB 1MJ9A 2ZW5A 3NH8A 3TO6A 2CXAA 1XE4A 2J9AA 3FX6A 1Z9UA 3R9FA 2BUEA 2IL4A 2YNDA 3SI2A 3R9EA 1PU9A 3EC4A 5LYDA 3WC7A 3CDXA 2I79A 2ZW6A 2R1IA 2CTCA 4YFJA 1KUVA 3B8GA 4FUUA 4MFJA 4EFDA 3BLNA 4AB7A 4MCPA 2PJ9A 2IMOA 4AVAA 4KOWA 2ODFA 3BI0A 1Z8LA 3IU1A 4PXDA 4TNUA 4PPZA 4QBJA 1QSOA 2POKA 4MFQA 5HVGA 4LUAA 1FT7A 1KWMA 2CY2A 3T9YA 4KOTA 3B35A 4GXHA 2PJCA 1DTDA 5A28A 2ZEMA 3KHZA 5AG4A 5ISVA 3IC1A 4LQ6A 3V8IA 3PBEA 2B3UA 3W6SA 4B6ZA 4KUAA 3NH4A 2Y0MA 4YRHA 2RFHA 4R7MA 4KOXA 3S6KA 4NGPA 5G22A 5EMIA 3CPAA 2OZHA 5CNPA 4UCNA 4OC0A 1P0HA 2ZEFA 2HUZA 3TX8A 3ZJ0A 1S5KA 1ZO0A 3CZXA 1EE3P 1QQ9A 4MI4A 3PEIA 2PDOA 4AXVA 2GIVA 3ISZA 2KCWA 2PIZA 3ZZIA 4CRZB 1YW6A 1Z4RA 3KKWA 2B4DB 4XNHB 4A95A 4CGNA 2ATRA 2CNMA 1R43A 2CTBA 4C7HA 5KTDA 4A39A 4B11A 2QECA 4HNWB 2Q7SA 3KI9A 5DWNA 2FL4A 5CPAA 1LRZA 4KOYA 3VH9A 2ZOGA 3TOAA 4FWUA 2J8NA 5THWA 5BWAB 5J8FA 5KTCA 4NSQA 2OZGA 4UCPA 4PXCA 4BBHA 4KVXA 4OMEA 4Z65A 1B87A 3EFAA 3RBUA 3VARA 4NJRA 3KASA 4R3KA 4Y49B 4YU9A 4B5PA 2Z3OA 2Z11A 2JEWA 4XNHC 4CAEA 2PJ4A 4KVME 2OOTA 2P6GA 4HNXB 4KLWA 4P44A 4JJXA 4AG7A 4H89A 4OC4A 1Y0YA 2NSMA 2PCUA 2OU2A 2PE3A 2JDCA 1Y7EA 2JLMA 2VI7A 4PK2A 3FMCA 5HH1A 1FY7A 2DEAA 4MMOA 1Q2YA 2B4BA 2AFSA 2I00A 3LACA 1L0CA 2YGWA 4CAXA 3MGDA 2G9DA 2HV2A 3D7HA 4JXRA 1YMEA 1HEEA 4OC5A 4Y49C 4HNYB 1XMTA 4NGNA 2PR1A 1AMPA 4NCZA 5F46A 1A2ZA 1FNOA 1XF8A 2J8RA 2ZXVA 3IGRA 4P4FA 3FJUA 3N5FA 1I1DA 4OC3A 4MHYA 2D4OA 2I3CA 4W9YA 3TC8A 2O53A 2V77A 1TXRA 2WPXA 5JPHA 4A32A 2EVNA 2ZPAA 3BI1A 1TF8A 2PVVA 5I4MA 2BCOA 4OIDA 2OB0A 3GKRA 3QAHA 4OC1A 1XEBA 2EK8A 2JDDA 1KUXA 2VEZA 3BJ7A 4NF1A 4QC6A 4MHDA 1VKCA 3TTHA 3D7FA 1CP6A 2GLFA 4BMHA 5K8NA 3T90A 3F0AA 5F49A 4GS4A 4XPLA 5LRJA 4AG9A 4B12A 5J1QA 1Z5RA 4UIBA 2OH1A 2PVWA 2JEVA 3NH5A 3SXOA 4X8IA 1M4GA 2D4PA 4P4JA 2FE7A 4EWTA 4CGOA 4HKFA 2NYQA 4ZY1A 1S7LA 2ZW7A 1ZG7A 5DWMA 3R96A 5LRKA 2K5TA 4UWJA 1JQGA 5H84A 3VWDA 1HDUA 1WK4A 4F8ZA 1OZPA 1PCAA 2CF4A 4UFWA 1LFWA 2XEFA 2JBKA 3PFEA 4I49A 4A30A 4F9VA 4R3LA 4P4DA 1CBXA 2C27A 3TFYA 3D67A 3GB0A 4KLVA 4M6GA 4CRYB 4NGSA 2ZEEA 5IB0A 3B3TA 1IGBA 4NJQA 4R57A 1ZLHA 2YNCC 2WUUA 5LYFA 8CPAA 1NSAA 3CXSA 3DR8A 5G1ZA 4XPKA 4MFLA 1Q2DA 1RTQA 3OWCA 2AFWA 2AFXA 4F6AA 1BPNA 1YLOA 5KTAA 3LD2A 4MBUA 3H4QA 4PSWA 3E0KA 4J3GA 2GFQA 7CPAA 2PJ1A 2ZOFA 4KOVA 2FIWA 1S7FA 2ZELA 2PR8A 4B10A 3KGQA 1ARMA 1BPMA 3SJFA 5HMNA 1XJOA 3I1UA 3JRUA 4MCSA 4E2AA 2Q4YA 3DGVA 2V8HA 4MCRA 4FBEA 5JM6A 5I0CA 3B3CA 1MJAA 2AFUA 1IYLA 2O28A 1GYTA 2VL1A 4Q7AA 3KHXA 2QIRA 4PXBA 3SHPA 2EUIA 3IIBA 4MHPA 3MN8A 2XEIA 4KSFA 2Q0YA 1U6MA 4C7IA 3WC6A 5LYLA 1ZG8A 1BLLE 4GM5A 3BHXA 2X7BA 1XOVA 4QB9A
chains in the Genus database with same CATH topology
2FCKA 2VZYA 4CGLA 4CYOA 2R98A 2REFA 5F47A 4MFPA 4KOSA 4KOUA 1BOBA 2FIAA 3NE7A 2WPWA 1XIXA 3A9LA 5IV0A 4M85A 2FT0A 4B5PB 5EC4A 2Z3LA 3BJ8A 3FYNA 4YGOA 1YVOA 4E0AA 2Z10A 3FXTA 3PZJA 3C26A 4A33A 3F5BA 5J8CA 4PSXA 4QUSA 5AG5A 2P0WA 2Q04A 5IX3A 1IIDA 1YR0A 2Q4VA 1IB1E 4CAWA 1QSRA 4ZGYB 2H5MA 3UY5A 2Z0ZA 2DXQA 4B5OA 3JUWA 1CM0A 2G3AA 1R57A 3D2MA 3IU2A 1WWZA 3TT2A 2Z3NA 1M4IA 4UWIA 2B58A 5GCNA 2Z3KA 1KZFA 1QSNA 5E96A 4U9YA 2REEA 1M1DA 5C82A 1YREA 1NE9A 1NSLA 3W91A 5EBVA 3W6XA 4ONUA 4NEXA 4MFZA 4OAEA 5C88A 2DPTA 2YNEA 1Y7RA 1QSTA 3PP9A 3TE4A 3D2PA 4L89A 4R87A 4FD4A 1IYKA 4CAVA 4EVYA 3EY5A 2VXKA 2GANA 1V0CA 2QMLA 4Q36A 4IUSA 1YVKA 4UFXA 1YX0A 3RYOA 4IF5A 4FD5A 4JD6A 3P2FA 2GE3A 4H6ZA 4L8AA 1S60A 4UBRA 3R1KA 2BL1A 4AVCA 1J4JA 3LODA 4RI1A 3GYAA 4K30A 3IWGA 4CGMA 3I9SA 3R95A 1PUAA 3F8KA 4F0YA 1QSMA 4H6UA 4ORFA 3S6FA 1I12A 2AJ6A 2PSWA 2FXFA 3EO4A 4FD6A 2RC4A 5H86A 1RO5A 2FSRA 2P6EA 2ZW4A 4Q38A 1IICA 1SQHA 3D3SA 3P2HA 3CXQA 1Z4EA 2P6FA 4R9MA 3G8WA 3QB8A 3TCVA 4LX9A 4PV6A 2R8VA 3FBUA 1S7NA 2J8MA 3S6GA 1YK3A 4A2ZA 4JXQA 4CAFA 4F0XA 1BO4A 3DDDA 1B6BA 1KUYA 3GY9A 2NMTA 3N7ZA 2B5GA 4CYQA 1S7KA 4MY3A 4X5KA 4AVBA 1NMTA 4E8OA 4CYNA 3IWEA 3JTKA 1Y9WA 2VBQA 1M44A 2R7HA 4JLYA 4B13A 4C68A 4UFVA 1VHSA 1M4DA 2Q7BA 4KS9A 3G3SA 1P4NA 2A4NA 3WR7A 3K9UA 3DSBA 4U5YA 2BEIA 3FRMA 4C2ZA 4CS0B 2PC1A 2VQYA 2FS5A 3H5ZA 5A27A 3FNCA 3PGPA 4C2YA 1MK4A 5F48A 2HQYA 5AG7A 5AG6A 5G20A 3TO7A 1I21A 4JWPA 2Q44A 1MJBA 1K4JA 3DNSA 3TOBA 1GHEA 3EXNA 5JQ4A 1N71A 4RS2A 4PK3A 4B14A 2Z3PA 4KVOE 2B4DA 2CNTA 1S3ZA 5G21A 4UCMA 1Q2CA 4KORA 2F5IA 4II9A 1CJWA 1YGHA 2Z3MA 4C2XA 4CGPA 3R9GA 2VZZA 3I3GA 1RXTA 2WSAA 3CXPA 4ZBGA 2B3VA 5FVJA 4OLLA 4U9ZA 4M3SA 4DNCA 3TO9A 1UFHA 2DPSA 2PRBA 3D8PA 1Y9KA 2ARHA 4XPDB 3FB3A 2PQ8A 1YLEA 4OADA 4A31A 3S6HA 1ON0A 1TIQA 3SXNA 3JVNA 3DR6A 4MJ8A 4KZTA 4KUBA 2BSWA 4NXYA 4MFKA 5AGEA 4KSAA 4QVTA 4XPDC 3FIXA 2OZUA 2G0BA 2AE6A 4MY0A 4UA3A 2CNSA 4CYPA 2G3TA 2YNCA 3VWEA 4FD7A 2B5GB 1MJ9A 2ZW5A 3TO6A 2CXAA 1XE4A 1Z9UA 3R9FA 2BUEA 2IL4A 2YNDA 3R9EA 1PU9A 3EC4A 2I79A 2ZW6A 2R1IA 4YFJA 1KUVA 3B8GA 4MFJA 3BLNA 4AB7A 4AVAA 4KOWA 3IU1A 4QBJA 1QSOA 4MFQA 4LUAA 3T9YA 2CY2A 4KOTA 5A28A 5AG4A 5ISVA 3W6SA 3V8IA 2B3UA 4KUAA 2Y0MA 4YRHA 4KOXA 3S6KA 5G22A 5CNPA 2OZHA 4UCNA 1P0HA 2HUZA 3ZJ0A 1S5KA 1ZO0A 4MI4A 2PDOA 2GIVA 2KCWA 3ZZIA 4CRZB 3KKWA 1Z4RA 4XNHB 2B4DB 4A95A 4CGNA 2ATRA 2CNMA 5KTDA 4C7HA 4B11A 2QECA 4HNWB 5DWNA 2FL4A 1LRZA 4KOYA 3TOAA 5J8FA 2J8NA 5BWAB 5KTCA 4NSQA 2OZGA 4UCPA 4BBHA 4KVXA 1B87A 3EFAA 4B5PA 4Y49B 4R3KA 2Z3OA 2Z11A 4XNHC 4CAEA 4KVME 2P6GA 4HNXB 4KLWA 4AG7A 4JJXA 4H89A 2OU2A 2JDCA 2JLMA 2VI7A 4PK2A 5HH1A 1FY7A 1Q2YA 2B4BA 2I00A 1L0CA 2YGWA 4CAXA 3MGDA 2HV2A 4JXRA 4Y49C 4HNYB 1XMTA 2PR1A 4NCZA 5F46A 1XF8A 3IGRA 2J8RA 2ZXVA 1I1DA 2D4OA 2WPXA 5JPHA 4A32A 2EVNA 2ZPAA 2OB0A 3GKRA 3QAHA 1XEBA 2JDDA 1KUXA 2VEZA 3BJ7A 4NF1A 4QC6A 4MHDA 1VKCA 3TTHA 4BMHA 3T90A 3F0AA 5F49A 4GS4A 4XPLA 4AG9A 4B12A 2OH1A 2JEVA 3SXOA 1M4GA 2D4PA 2FE7A 4CGOA 4HKFA 1S7LA 2ZW7A 5DWMA 3R96A 2K5TA 4UWJA 5H84A 3VWDA 1WK4A 1OZPA 4A30A 4UFWA 4I49A 4R3LA 2C27A 3TFYA 4KLVA 4CRYB 5IB0A 4R57A 2YNCC 2WUUA 3CXSA 3DR8A 5G1ZA 4XPKA 4MFLA 1Q2DA 3OWCA 4F6AA 5KTAA 3LD2A 4MBUA 3H4QA 4PSWA 3E0KA 4J3GA 4KOVA 2FIWA 1S7FA 2PR8A 4B10A 5HMNA 4E2AA 2Q4YA 5I0CA 1MJAA 2O28A 1IYLA 2QIRA 3SHPA 2EUIA 4KSFA 2Q0YA 1U6MA 4C7IA 2X7BA 4QB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCK A;  2VZY A;  2R98 A;  2REF A;  5F47 A;  4KOS A;  4KOU A;  1BOB A;  2FIA A;  3NE7 A;  2WPW A;  1XIX A;  5IV0 A;  4M85 A;  2FT0 A;  4B5P B;  5EC4 A;  3BJ8 A;  3FYN A;  4YGO A;  1YVO A;  4E0A A;  2Z10 A;  3FXT A;  3PZJ A;  3C26 A;  3F5B A;  5J8C A;  4PSX A;  4QUS A;  2P0W A;  2Q04 A;  5IX3 A;  1IID A;  1YR0 A;  2Q4V A;  1IB1 E;  4CAW A;  1QSR A;  2H5M A;  3UY5 A;  2Z0Z A;  2DXQ A;  4B5O A;  3JUW A;  1CM0 A;  2G3A A;  1R57 A;  3D2M A;  1WWZ A;  3TT2 A;  1M4I A;  4UWI A;  2B58 A;  5GCN A;  1KZF A;  1QSN A;  5E96 A;  4U9Y A;  2REE A;  1M1D A;  5C82 A;  1YRE A;  1NE9 A;  1NSL A;  3W91 A;  5EBV A;  3W6X A;  4ONU A;  4NEX A;  4OAE A;  5C88 A;  1Y7R A;  1QST A;  3PP9 A;  3TE4 A;  3D2P A;  4L89 A;  4R87 A;  4FD4 A;  1IYK A;  4CAV A;  4EVY A;  3EY5 A;  2VXK A;  2GAN A;  1V0C A;  2QML A;  4IUS A;  1YVK A;  1YX0 A;  3RYO A;  4IF5 A;  4FD5 A;  4JD6 A;  3P2F A;  2GE3 A;  4H6Z A;  4L8A A;  1S60 A;  4UBR A;  3R1K A;  2BL1 A;  4AVC A;  1J4J A;  3LOD A;  4RI1 A;  3GYA A;  4K30 A;  3IWG A;  3I9S A;  3R95 A;  1PUA A;  3F8K A;  4F0Y A;  1QSM A;  4H6U A;  4ORF A;  3S6F A;  1I12 A;  2AJ6 A;  2PSW A;  2FXF A;  3EO4 A;  4FD6 A;  2RC4 A;  5H86 A;  1RO5 A;  2FSR A;  2P6E A;  2ZW4 A;  1IIC A;  1SQH A;  3D3S A;  3P2H A;  3CXQ A;  1Z4E A;  2P6F A;  4R9M A;  3G8W A;  3QB8 A;  3TCV A;  4LX9 A;  4PV6 A;  2R8V A;  3FBU A;  1S7N A;  2J8M A;  3S6G A;  1YK3 A;  4JXQ A;  1BO4 A;  3DDD A;  1B6B A;  1KUY A;  3GY9 A;  2NMT A;  3N7Z A;  2B5G A;  1S7K A;  4MY3 A;  4X5K A;  4AVB A;  1NMT A;  4E8O A;  1Y9W A;  2VBQ A;  1M44 A;  2R7H A;  4JLY A;  1VHS A;  1M4D A;  2Q7B A;  3G3S A;  1P4N A;  2A4N A;  3WR7 A;  3K9U A;  3DSB A;  4U5Y A;  2BEI A;  3FRM A;  4CS0 B;  2PC1 A;  2VQY A;  2FS5 A;  3FNC A;  3PGP A;  1MK4 A;  5F48 A;  2HQY A;  3TO7 A;  1I21 A;  4JWP A;  2Q44 A;  1MJB A;  1K4J A;  3DNS A;  3TOB A;  1GHE A;  3EXN A;  5JQ4 A;  1N71 A;  4RS2 A;  4PK3 A;  4KVO E;  2B4D A;  2CNT A;  1S3Z A;  1Q2C A;  4KOR A;  2F5I A;  4II9 A;  1CJW A;  1YGH A;  3R9G A;  2VZZ A;  3I3G A;  1RXT A;  3CXP A;  4ZBG A;  2B3V A;  5FVJ A;  4OLL A;  4U9Z A;  4M3S A;  4DNC A;  3TO9 A;  1UFH A;  2PRB A;  3D8P A;  1Y9K A;  2ARH A;  4XPD B;  3FB3 A;  2PQ8 A;  1YLE A;  4OAD A;  3S6H A;  1ON0 A;  1TIQ A;  3SXN A;  3JVN A;  3DR6 A;  4MJ8 A;  4KZT A;  4KUB A;  2BSW A;  4NXY A;  4QVT A;  4XPD C;  3FIX A;  2OZU A;  2G0B A;  2AE6 A;  4MY0 A;  4UA3 A;  2CNS A;  2G3T A;  3VWE A;  4FD7 A;  2B5G B;  1MJ9 A;  2ZW5 A;  3TO6 A;  1XE4 A;  1Z9U A;  3R9F A;  2BUE A;  2IL4 A;  3R9E A;  1PU9 A;  3EC4 A;  2I79 A;  2ZW6 A;  2R1I A;  4YFJ A;  1KUV A;  3B8G A;  3BLN A;  4AB7 A;  4AVA A;  4KOW A;  4QBJ A;  1QSO A;  4LUA A;  3T9Y A;  2CY2 A;  4KOT A;  5ISV A;  3W6S A;  3V8I A;  2B3U A;  4KUA A;  2Y0M A;  4YRH A;  4KOX A;  3S6K A;  5CNP A;  2OZH A;  1P0H A;  2HUZ A;  3ZJ0 A;  1S5K A;  4MI4 A;  2PDO A;  2GIV A;  2KCW A;  3ZZI A;  4CRZ B;  3KKW A;  1Z4R A;  4XNH B;  2B4D B;  2ATR A;  2CNM A;  5KTD A;  2QEC A;  4HNW B;  5DWN A;  2FL4 A;  1LRZ A;  4KOY A;  3TOA A;  5J8F A;  2J8N A;  5KTC A;  4NSQ A;  2OZG A;  4KVX A;  1B87 A;  3EFA A;  4B5P A;  4Y49 B;  4R3K A;  2Z11 A;  4XNH C;  4KVM E;  2P6G A;  4HNX B;  4KLW A;  4AG7 A;  4JJX A;  4H89 A;  2OU2 A;  2JDC A;  2JLM A;  2VI7 A;  4PK2 A;  5HH1 A;  1FY7 A;  1Q2Y A;  2B4B A;  2I00 A;  1L0C A;  4CAX A;  3MGD A;  2HV2 A;  4JXR A;  4Y49 C;  4HNY B;  1XMT A;  2PR1 A;  4NCZ A;  5F46 A;  1XF8 A;  3IGR A;  2J8R A;  2ZXV A;  1I1D A;  2D4O A;  2WPX A;  5JPH A;  2EVN A;  2ZPA A;  2OB0 A;  3GKR A;  3QAH A;  1XEB A;  2JDD A;  1KUX A;  2VEZ A;  3BJ7 A;  4NF1 A;  4QC6 A;  4MHD A;  1VKC A;  3TTH A;  4BMH A;  3T90 A;  3F0A A;  5F49 A;  4GS4 A;  4XPL A;  4AG9 A;  2OH1 A;  2JEV A;  3SXO A;  1M4G A;  2D4P A;  2FE7 A;  4HKF A;  1S7L A;  2ZW7 A;  5DWM A;  3R96 A;  2K5T A;  4UWJ A;  5H84 A;  3VWD A;  1WK4 A;  1OZP A;  4I49 A;  4R3L A;  2C27 A;  3TFY A;  4KLV A;  4CRY B;  5IB0 A;  4R57 A;  3CXS A;  3DR8 A;  4XPK A;  1Q2D A;  3OWC A;  4F6A A;  5KTA A;  3LD2 A;  4MBU A;  3H4Q A;  4PSW A;  3E0K A;  4J3G A;  4KOV A;  2FIW A;  1S7F A;  2PR8 A;  5HMN A;  4E2A A;  2Q4Y A;  5I0C A;  1MJA A;  2O28 A;  1IYL A;  2QIR A;  3SHP A;  2EUI A;  2Q0Y A;  1U6M A;  2X7B A;  4QB9 A; 
#chains in the Genus database with same CATH topology
 3KL9 A;  1UWY A;  2QVP A;  2FCK A;  2VZY A;  4CGL A;  4CYO A;  1AUG A;  2R98 A;  2REF A;  5F47 A;  4A94 A;  4MFP A;  4KOS A;  3SJE A;  2ZEP A;  3IWW A;  3NFZ A;  4KOU A;  1BOB A;  2FIA A;  3H8G A;  3NE7 A;  2WPW A;  3PBB A;  1XIX A;  4OIW A;  3A9L A;  5IV0 A;  5K8O A;  4M85 A;  2BOA A;  2FT0 A;  1CP7 A;  4B5P B;  5EC4 A;  2Z3L A;  3BJ8 A;  4DYO A;  3LWU A;  3FYN A;  4YGO A;  2EK9 A;  1YVO A;  1X10 A;  2Z10 A;  4E0A A;  3FXT A;  1AYE A;  3S9N A;  1LAP A;  3PZJ A;  3C26 A;  4A33 A;  3F5B A;  4ONW A;  5J8C A;  1ELL P;  4JYW A;  2EWB A;  4MCQ A;  4PSX A;  4QUS A;  2F7V A;  5AG5 A;  1XFO A;  4MXU A;  2P0W A;  2Q04 A;  5IX3 A;  2PJ0 A;  1IID A;  2V8D A;  1YR0 A;  3LMS A;  2Q4V A;  1IB1 E;  1HDQ A;  1QSR A;  2AFZ A;  3SJX A;  4UEZ A;  4CAW A;  1TKJ A;  2H5M A;  3HLP A;  4TWE A;  3UY5 A;  4P4E A;  4ZGY B;  2Z0Z A;  4UIA A;  2DXQ A;  4F9U A;  2RB7 A;  1ARL A;  4B5O A;  3JUW A;  1CM0 A;  2G3A A;  1R57 A;  3D2M A;  1Z8T A;  3IU2 A;  1WWZ A;  3TT2 A;  2Z3N A;  1M4I A;  4FAI A;  4UWI A;  3FF3 A;  2B58 A;  2EBJ A;  3MRU A;  5GCN A;  3D68 A;  2ZEO A;  2Z3K A;  4A37 A;  1KZF A;  1QSN A;  4ZI6 A;  5E96 A;  3PB4 X;  4U9Y A;  3T8W A;  2Q43 A;  2REE A;  1M1D A;  3BXM A;  5C82 A;  1YRE A;  1NE9 A;  1NSL A;  4X3R A;  3W91 A;  5EBV A;  4NGR A;  3W6X A;  1F57 A;  2AFO A;  1YSJ A;  4ONU A;  4NEX A;  4MFZ A;  4OAE A;  1IOI A;  2PJ3 A;  5C88 A;  2DPT A;  2YNE A;  1Y7R A;  3B7I A;  1QST A;  3PP9 A;  1QMU A;  5ELY A;  4PQA A;  3TE4 A;  3D2P A;  3D66 A;  2JBJ A;  4L89 A;  4R87 A;  5K8P A;  4OKO A;  3HUV A;  2C6G A;  4FD4 A;  1IYK A;  1TKH A;  4CAV A;  4UEE A;  4EVY A;  3EY5 A;  3V7Z A;  1M4L A;  2VXK A;  3KR5 A;  4DUK A;  2GAN A;  1V0C A;  2QML A;  4Q36 A;  4EME A;  4IUS A;  1YVK A;  4UFX A;  5D8N A;  4MRI A;  3PB7 X;  3D4U A;  1YX0 A;  3S9L A;  3FVL A;  3WAB A;  3RYO A;  3H8F A;  4NGT A;  4IF5 A;  4FD5 A;  4JD6 A;  4CPA A;  3P2F A;  2GE3 A;  3RO0 A;  4H6Z A;  4L8A A;  1S60 A;  4UBR A;  3R1K A;  2BL1 A;  4AVC A;  1J4J A;  3LOD A;  4RI1 A;  3GYA A;  4K30 A;  3IWG A;  4CGM A;  2GU2 A;  3IO1 A;  3IFE A;  1DE4 C;  3I9S A;  3R95 A;  1PUA A;  3F8K A;  4F0Y A;  1QSM A;  2PJB A;  4H6U A;  2F8H A;  4P10 A;  2CIJ A;  1TKF A;  2FVG A;  4ORF A;  5HVF A;  2WYR A;  3S6F A;  1CX8 A;  1I12 A;  2AJ6 A;  2PSW A;  3B3V A;  3S9M A;  2PJ5 A;  3VAT A;  2FXF A;  3KZW A;  1LAM A;  3EO4 A;  2ZED A;  3PFO A;  2RC4 A;  4FD6 A;  3KQZ A;  4ZY2 A;  4JZ0 A;  1CPS A;  2DF5 A;  1RO5 A;  2FSR A;  2P6E A;  2ZEH A;  2ZW4 A;  5H86 A;  4PXE A;  4Q38 A;  1IIC A;  1SQH A;  1Z2L A;  4ZX8 A;  5HXD A;  1Y0R A;  3D3S A;  5LYI A;  3DLJ A;  3P2H A;  2PJ8 A;  1Z4E A;  2P6F A;  3CXQ A;  3G8W A;  3K2K A;  4R9M A;  3QB8 A;  4HPS A;  4LX9 A;  4PV6 A;  3RAM A;  3TCV A;  2R8V A;  3FBU A;  3GUX A;  4P4B A;  4MHN A;  1S7N A;  2J8M A;  3S6G A;  5K8M A;  3KQX A;  4K3N A;  1YK3 A;  1XMB A;  3IEH A;  4A2Z A;  1F2P A;  1LAN A;  2GLJ A;  4JXQ A;  3GIU A;  4OP4 A;  4CAF A;  4F0X A;  3B2Y A;  4RUH A;  1BO4 A;  3DDD A;  1B6B A;  1KUY A;  3GY9 A;  2NMT A;  3N7Z A;  2B5G A;  4CYQ A;  2C6C A;  1S7K A;  4MY3 A;  4P45 A;  4X5K A;  2PJ7 A;  4AVB A;  1NMT A;  1XRY A;  3FEC A;  5JGF A;  4E8O A;  1VHO A;  4CYN A;  3CT9 A;  4P6Y A;  1Y9W A;  3FH4 A;  3IWE A;  3JTK A;  2VBQ A;  1M44 A;  2R7H A;  3B3W A;  4JLY A;  5LRG A;  4B13 A;  1LCP A;  3D7G A;  2HB6 A;  4C68 A;  1VIX A;  5CBM A;  1YW4 A;  4UFV A;  1XBU A;  3V38 A;  1VHS A;  1LOK A;  1M4D A;  4IK2 A;  2Q7B A;  4OC2 A;  2GRE A;  4KS9 A;  3G3S A;  1P4N A;  3RNZ A;  3K9T A;  4P4I A;  2A4N A;  3WR7 A;  3K9U A;  3SI0 A;  4O23 A;  3DSB A;  3B3S A;  3NE8 A;  2HC9 A;  4U5Y A;  2AFM A;  2BEI A;  3FRM A;  4C2Z A;  4CS0 B;  2ZEN A;  2PRQ A;  1OBR A;  2QJ8 A;  2PC1 A;  2VQY A;  2FS5 A;  3H5Z A;  5A27 A;  4R6T A;  4ZYQ A;  3FNC A;  3PGP A;  4C2Y A;  1MK4 A;  4KSI A;  5F48 A;  1CPX A;  2HQY A;  2PIY A;  5D29 A;  5AG7 A;  5AG6 A;  5G20 A;  3TO7 A;  1I21 A;  4JWP A;  3WC5 A;  2Q44 A;  3PRT A;  1MJB A;  4ZY0 A;  1K4J A;  3DNS A;  3TOB A;  3IJ3 A;  1GHE A;  1IU8 A;  4X2T A;  3ISX A;  2Q51 A;  3EXN A;  4YWY A;  2C6P A;  5JQ4 A;  4BD9 A;  4UEF A;  1N71 A;  4M6H A;  4RS2 A;  4PK3 A;  4NGQ A;  3SJG A;  5JH9 A;  4B14 A;  2Z3P A;  4KVO E;  5DS0 A;  2IQ6 A;  2B4D A;  4MHZ A;  1VHE A;  1CG2 A;  2CNT A;  1S3Z A;  5G21 A;  1IOF A;  4UCM A;  1JWQ A;  3KR4 A;  1Q2C A;  2EO8 A;  2V8G A;  3FEE A;  6CPA A;  4KOR A;  2F5I A;  4II9 A;  1CJW A;  1YGH A;  2Z3M A;  4C2X A;  5F09 A;  3PB8 X;  3CPX A;  1Q7L A;  4R76 A;  4NFR A;  4CGP A;  3R9G A;  2VZZ A;  3I3G A;  3QNV A;  1RXT A;  4WJB A;  4IAV A;  3D7D A;  2WSA A;  3GLJ A;  3CXP A;  4RN7 A;  2ANP A;  2B3V A;  3FED A;  4ZBG A;  5FVJ A;  1YQE A;  3H8E A;  4OLL A;  4U9Z A;  4M3S A;  4DNC A;  3TO9 A;  1UFH A;  1ZG9 A;  2DPS A;  2PRB A;  1F2O A;  2PJ6 A;  3D8P A;  1Y9K A;  2ARH A;  2WZN A;  4XPD B;  3FB3 A;  4G1P A;  2PQ8 A;  1YLE A;  3SI1 A;  4OAD A;  3QAY A;  4A31 A;  1X12 A;  2QYV A;  2BO9 A;  1ON0 A;  1TIQ A;  3S6H A;  3SXN A;  3JVN A;  1PYT B;  3PB6 X;  2IJZ A;  4ZX9 A;  2Q4Z A;  3DR6 A;  3L2N A;  4MJ8 A;  4KZT A;  4IHM A;  4H2K A;  4KUB A;  3RZA A;  4DJL A;  2ZEG A;  2BSW A;  2XEG A;  4NXY A;  4MFK A;  4LQG A;  3NA6 A;  5AGE A;  5IB9 A;  4KSA A;  2XEJ A;  4QVT A;  4A38 A;  2V8V A;  5HVH A;  4BIN A;  1ELM P;  4XPD C;  1Z8X A;  4WWV A;  3FIX A;  4UF4 A;  1IY7 A;  2PJA A;  2OZU A;  1VGY A;  2G0B A;  2O4H A;  1R3N A;  1Z8W A;  2AE6 A;  4MY0 A;  2PJ2 A;  1TF9 A;  1H8L A;  1BAV A;  3PB9 X;  2CNS A;  4R8F A;  4UA3 A;  4CYP A;  4M6I A;  2ABZ A;  4NGM A;  2G3T A;  2YNC A;  3WT4 A;  1ZLI A;  2C1C A;  3VWE A;  4FD7 A;  2OR4 A;  2B5G B;  1MJ9 A;  2ZW5 A;  3NH8 A;  3TO6 A;  2CXA A;  1XE4 A;  2J9A A;  3FX6 A;  1Z9U A;  3R9F A;  2BUE A;  2IL4 A;  2YND A;  3SI2 A;  3R9E A;  1PU9 A;  3EC4 A;  5LYD A;  3WC7 A;  3CDX A;  2I79 A;  2ZW6 A;  2R1I A;  2CTC A;  4YFJ A;  1KUV A;  3B8G A;  4FUU A;  4MFJ A;  4EFD A;  3BLN A;  4AB7 A;  4MCP A;  2PJ9 A;  2IMO A;  4AVA A;  4KOW A;  2ODF A;  3BI0 A;  1Z8L A;  3IU1 A;  4PXD A;  4TNU A;  4PPZ A;  4QBJ A;  1QSO A;  2POK A;  4MFQ A;  5HVG A;  4LUA A;  1FT7 A;  1KWM A;  2CY2 A;  3T9Y A;  4KOT A;  3B35 A;  4GXH A;  2PJC A;  1DTD A;  5A28 A;  2ZEM A;  3KHZ A;  5AG4 A;  5ISV A;  3IC1 A;  4LQ6 A;  3V8I A;  3PBE A;  2B3U A;  3W6S A;  4B6Z A;  4KUA A;  3NH4 A;  2Y0M A;  4YRH A;  2RFH A;  4R7M A;  4KOX A;  3S6K A;  4NGP A;  5G22 A;  5EMI A;  3CPA A;  2OZH A;  5CNP A;  4UCN A;  4OC0 A;  1P0H A;  2ZEF A;  2HUZ A;  3TX8 A;  3ZJ0 A;  1S5K A;  1ZO0 A;  3CZX A;  1EE3 P;  1QQ9 A;  4MI4 A;  3PEI A;  2PDO A;  4AXV A;  2GIV A;  3ISZ A;  2KCW A;  2PIZ A;  3ZZI A;  4CRZ B;  1YW6 A;  1Z4R A;  3KKW A;  2B4D B;  4XNH B;  4A95 A;  4CGN A;  2ATR A;  2CNM A;  1R43 A;  2CTB A;  4C7H A;  5KTD A;  4A39 A;  4B11 A;  2QEC A;  4HNW B;  2Q7S A;  3KI9 A;  5DWN A;  2FL4 A;  5CPA A;  1LRZ A;  4KOY A;  3VH9 A;  2ZOG A;  3TOA A;  4FWU A;  2J8N A;  5THW A;  5BWA B;  5J8F A;  5KTC A;  4NSQ A;  2OZG A;  4UCP A;  4PXC A;  4BBH A;  4KVX A;  4OME A;  4Z65 A;  1B87 A;  3EFA A;  3RBU A;  3VAR A;  4NJR A;  3KAS A;  4R3K A;  4Y49 B;  4YU9 A;  4B5P A;  2Z3O A;  2Z11 A;  2JEW A;  4XNH C;  4CAE A;  2PJ4 A;  4KVM E;  2OOT A;  2P6G A;  4HNX B;  4KLW A;  4P44 A;  4JJX A;  4AG7 A;  4H89 A;  4OC4 A;  1Y0Y A;  2NSM A;  2PCU A;  2OU2 A;  2PE3 A;  2JDC A;  1Y7E A;  2JLM A;  2VI7 A;  4PK2 A;  3FMC A;  5HH1 A;  1FY7 A;  2DEA A;  4MMO A;  1Q2Y A;  2B4B A;  2AFS A;  2I00 A;  3LAC A;  1L0C A;  2YGW A;  4CAX A;  3MGD A;  2G9D A;  2HV2 A;  3D7H A;  4JXR A;  1YME A;  1HEE A;  4OC5 A;  4Y49 C;  4HNY B;  1XMT A;  4NGN A;  2PR1 A;  1AMP A;  4NCZ A;  5F46 A;  1A2Z A;  1FNO A;  1XF8 A;  2J8R A;  2ZXV A;  3IGR A;  4P4F A;  3FJU A;  3N5F A;  1I1D A;  4OC3 A;  4MHY A;  2D4O A;  2I3C A;  4W9Y A;  3TC8 A;  2O53 A;  2V77 A;  1TXR A;  2WPX A;  5JPH A;  4A32 A;  2EVN A;  2ZPA A;  3BI1 A;  1TF8 A;  2PVV A;  5I4M A;  2BCO A;  4OID A;  2OB0 A;  3GKR A;  3QAH A;  4OC1 A;  1XEB A;  2EK8 A;  2JDD A;  1KUX A;  2VEZ A;  3BJ7 A;  4NF1 A;  4QC6 A;  4MHD A;  1VKC A;  3TTH A;  3D7F A;  1CP6 A;  2GLF A;  4BMH A;  5K8N A;  3T90 A;  3F0A A;  5F49 A;  4GS4 A;  4XPL A;  5LRJ A;  4AG9 A;  4B12 A;  5J1Q A;  1Z5R A;  4UIB A;  2OH1 A;  2PVW A;  2JEV A;  3NH5 A;  3SXO A;  4X8I A;  1M4G A;  2D4P A;  4P4J A;  2FE7 A;  4EWT A;  4CGO A;  4HKF A;  2NYQ A;  4ZY1 A;  1S7L A;  2ZW7 A;  1ZG7 A;  5DWM A;  3R96 A;  5LRK A;  2K5T A;  4UWJ A;  1JQG A;  5H84 A;  3VWD A;  1HDU A;  1WK4 A;  4F8Z A;  1OZP A;  1PCA A;  2CF4 A;  4UFW A;  1LFW A;  2XEF A;  2JBK A;  3PFE A;  4I49 A;  4A30 A;  4F9V A;  4R3L A;  4P4D A;  1CBX A;  2C27 A;  3TFY A;  3D67 A;  3GB0 A;  4KLV A;  4M6G A;  4CRY B;  4NGS A;  2ZEE A;  5IB0 A;  3B3T A;  1IGB A;  4NJQ A;  4R57 A;  1ZLH A;  2YNC C;  2WUU A;  5LYF A;  8CPA A;  1NSA A;  3CXS A;  3DR8 A;  5G1Z A;  4XPK A;  4MFL A;  1Q2D A;  1RTQ A;  3OWC A;  2AFW A;  2AFX A;  4F6A A;  1BPN A;  1YLO A;  5KTA A;  3LD2 A;  4MBU A;  3H4Q A;  4PSW A;  3E0K A;  4J3G A;  2GFQ A;  7CPA A;  2PJ1 A;  2ZOF A;  4KOV A;  2FIW A;  1S7F A;  2ZEL A;  2PR8 A;  4B10 A;  3KGQ A;  1ARM A;  1BPM A;  3SJF A;  5HMN A;  1XJO A;  3I1U A;  3JRU A;  4MCS A;  4E2A A;  2Q4Y A;  3DGV A;  2V8H A;  4MCR A;  4FBE A;  5JM6 A;  5I0C A;  3B3C A;  1MJA A;  2AFU A;  1IYL A;  2O28 A;  1GYT A;  2VL1 A;  4Q7A A;  3KHX A;  2QIR A;  4PXB A;  3SHP A;  2EUI A;  3IIB A;  4MHP A;  3MN8 A;  2XEI A;  4KSF A;  2Q0Y A;  1U6M A;  4C7I A;  3WC6 A;  5LYL A;  1ZG8 A;  1BLL E;  4GM5 A;  3BHX A;  2X7B A;  1XOV A;  4QB9 A; 
#chains in the Genus database with same CATH homology
 2FCK A;  2VZY A;  4CGL A;  4CYO A;  2R98 A;  2REF A;  5F47 A;  4MFP A;  4KOS A;  4KOU A;  1BOB A;  2FIA A;  3NE7 A;  2WPW A;  1XIX A;  3A9L A;  5IV0 A;  4M85 A;  2FT0 A;  4B5P B;  5EC4 A;  2Z3L A;  3BJ8 A;  3FYN A;  4YGO A;  1YVO A;  4E0A A;  2Z10 A;  3FXT A;  3PZJ A;  3C26 A;  4A33 A;  3F5B A;  5J8C A;  4PSX A;  4QUS A;  5AG5 A;  2P0W A;  2Q04 A;  5IX3 A;  1IID A;  1YR0 A;  2Q4V A;  1IB1 E;  4CAW A;  1QSR A;  4ZGY B;  2H5M A;  3UY5 A;  2Z0Z A;  2DXQ A;  4B5O A;  3JUW A;  1CM0 A;  2G3A A;  1R57 A;  3D2M A;  3IU2 A;  1WWZ A;  3TT2 A;  2Z3N A;  1M4I A;  4UWI A;  2B58 A;  5GCN A;  2Z3K A;  1KZF A;  1QSN A;  5E96 A;  4U9Y A;  2REE A;  1M1D A;  5C82 A;  1YRE A;  1NE9 A;  1NSL A;  3W91 A;  5EBV A;  3W6X A;  4ONU A;  4NEX A;  4MFZ A;  4OAE A;  5C88 A;  2DPT A;  2YNE A;  1Y7R A;  1QST A;  3PP9 A;  3TE4 A;  3D2P A;  4L89 A;  4R87 A;  4FD4 A;  1IYK A;  4CAV A;  4EVY A;  3EY5 A;  2VXK A;  2GAN A;  1V0C A;  2QML A;  4Q36 A;  4IUS A;  1YVK A;  4UFX A;  1YX0 A;  3RYO A;  4IF5 A;  4FD5 A;  4JD6 A;  3P2F A;  2GE3 A;  4H6Z A;  4L8A A;  1S60 A;  4UBR A;  3R1K A;  2BL1 A;  4AVC A;  1J4J A;  3LOD A;  4RI1 A;  3GYA A;  4K30 A;  3IWG A;  4CGM A;  3I9S A;  3R95 A;  1PUA A;  3F8K A;  4F0Y A;  1QSM A;  4H6U A;  4ORF A;  3S6F A;  1I12 A;  2AJ6 A;  2PSW A;  2FXF A;  3EO4 A;  4FD6 A;  2RC4 A;  5H86 A;  1RO5 A;  2FSR A;  2P6E A;  2ZW4 A;  4Q38 A;  1IIC A;  1SQH A;  3D3S A;  3P2H A;  3CXQ A;  1Z4E A;  2P6F A;  4R9M A;  3G8W A;  3QB8 A;  3TCV A;  4LX9 A;  4PV6 A;  2R8V A;  3FBU A;  1S7N A;  2J8M A;  3S6G A;  1YK3 A;  4A2Z A;  4JXQ A;  4CAF A;  4F0X A;  1BO4 A;  3DDD A;  1B6B A;  1KUY A;  3GY9 A;  2NMT A;  3N7Z A;  2B5G A;  4CYQ A;  1S7K A;  4MY3 A;  4X5K A;  4AVB A;  1NMT A;  4E8O A;  4CYN A;  3IWE A;  3JTK A;  1Y9W A;  2VBQ A;  1M44 A;  2R7H A;  4JLY A;  4B13 A;  4C68 A;  4UFV A;  1VHS A;  1M4D A;  2Q7B A;  4KS9 A;  3G3S A;  1P4N A;  2A4N A;  3WR7 A;  3K9U A;  3DSB A;  4U5Y A;  2BEI A;  3FRM A;  4C2Z A;  4CS0 B;  2PC1 A;  2VQY A;  2FS5 A;  3H5Z A;  5A27 A;  3FNC A;  3PGP A;  4C2Y A;  1MK4 A;  5F48 A;  2HQY A;  5AG7 A;  5AG6 A;  5G20 A;  3TO7 A;  1I21 A;  4JWP A;  2Q44 A;  1MJB A;  1K4J A;  3DNS A;  3TOB A;  1GHE A;  3EXN A;  5JQ4 A;  1N71 A;  4RS2 A;  4PK3 A;  4B14 A;  2Z3P A;  4KVO E;  2B4D A;  2CNT A;  1S3Z A;  5G21 A;  4UCM A;  1Q2C A;  4KOR A;  2F5I A;  4II9 A;  1CJW A;  1YGH A;  2Z3M A;  4C2X A;  4CGP A;  3R9G A;  2VZZ A;  3I3G A;  1RXT A;  2WSA A;  3CXP A;  4ZBG A;  2B3V A;  5FVJ A;  4OLL A;  4U9Z A;  4M3S A;  4DNC A;  3TO9 A;  1UFH A;  2DPS A;  2PRB A;  3D8P A;  1Y9K A;  2ARH A;  4XPD B;  3FB3 A;  2PQ8 A;  1YLE A;  4OAD A;  4A31 A;  3S6H A;  1ON0 A;  1TIQ A;  3SXN A;  3JVN A;  3DR6 A;  4MJ8 A;  4KZT A;  4KUB A;  2BSW A;  4NXY A;  4MFK A;  5AGE A;  4KSA A;  4QVT A;  4XPD C;  3FIX A;  2OZU A;  2G0B A;  2AE6 A;  4MY0 A;  4UA3 A;  2CNS A;  4CYP A;  2G3T A;  2YNC A;  3VWE A;  4FD7 A;  2B5G B;  1MJ9 A;  2ZW5 A;  3TO6 A;  2CXA A;  1XE4 A;  1Z9U A;  3R9F A;  2BUE A;  2IL4 A;  2YND A;  3R9E A;  1PU9 A;  3EC4 A;  2I79 A;  2ZW6 A;  2R1I A;  4YFJ A;  1KUV A;  3B8G A;  4MFJ A;  3BLN A;  4AB7 A;  4AVA A;  4KOW A;  3IU1 A;  4QBJ A;  1QSO A;  4MFQ A;  4LUA A;  3T9Y A;  2CY2 A;  4KOT A;  5A28 A;  5AG4 A;  5ISV A;  3W6S A;  3V8I A;  2B3U A;  4KUA A;  2Y0M A;  4YRH A;  4KOX A;  3S6K A;  5G22 A;  5CNP A;  2OZH A;  4UCN A;  1P0H A;  2HUZ A;  3ZJ0 A;  1S5K A;  1ZO0 A;  4MI4 A;  2PDO A;  2GIV A;  2KCW A;  3ZZI A;  4CRZ B;  3KKW A;  1Z4R A;  4XNH B;  2B4D B;  4A95 A;  4CGN A;  2ATR A;  2CNM A;  5KTD A;  4C7H A;  4B11 A;  2QEC A;  4HNW B;  5DWN A;  2FL4 A;  1LRZ A;  4KOY A;  3TOA A;  5J8F A;  2J8N A;  5BWA B;  5KTC A;  4NSQ A;  2OZG A;  4UCP A;  4BBH A;  4KVX A;  1B87 A;  3EFA A;  4B5P A;  4Y49 B;  4R3K A;  2Z3O A;  2Z11 A;  4XNH C;  4CAE A;  4KVM E;  2P6G A;  4HNX B;  4KLW A;  4AG7 A;  4JJX A;  4H89 A;  2OU2 A;  2JDC A;  2JLM A;  2VI7 A;  4PK2 A;  5HH1 A;  1FY7 A;  1Q2Y A;  2B4B A;  2I00 A;  1L0C A;  2YGW A;  4CAX A;  3MGD A;  2HV2 A;  4JXR A;  4Y49 C;  4HNY B;  1XMT A;  2PR1 A;  4NCZ A;  5F46 A;  1XF8 A;  3IGR A;  2J8R A;  2ZXV A;  1I1D A;  2D4O A;  2WPX A;  5JPH A;  4A32 A;  2EVN A;  2ZPA A;  2OB0 A;  3GKR A;  3QAH A;  1XEB A;  2JDD A;  1KUX A;  2VEZ A;  3BJ7 A;  4NF1 A;  4QC6 A;  4MHD A;  1VKC A;  3TTH A;  4BMH A;  3T90 A;  3F0A A;  5F49 A;  4GS4 A;  4XPL A;  4AG9 A;  4B12 A;  2OH1 A;  2JEV A;  3SXO A;  1M4G A;  2D4P A;  2FE7 A;  4CGO A;  4HKF A;  1S7L A;  2ZW7 A;  5DWM A;  3R96 A;  2K5T A;  4UWJ A;  5H84 A;  3VWD A;  1WK4 A;  1OZP A;  4A30 A;  4UFW A;  4I49 A;  4R3L A;  2C27 A;  3TFY A;  4KLV A;  4CRY B;  5IB0 A;  4R57 A;  2YNC C;  2WUU A;  3CXS A;  3DR8 A;  5G1Z A;  4XPK A;  4MFL A;  1Q2D A;  3OWC A;  4F6A A;  5KTA A;  3LD2 A;  4MBU A;  3H4Q A;  4PSW A;  3E0K A;  4J3G A;  4KOV A;  2FIW A;  1S7F A;  2PR8 A;  4B10 A;  5HMN A;  4E2A A;  2Q4Y A;  5I0C A;  1MJA A;  2O28 A;  1IYL A;  2QIR A;  3SHP A;  2EUI A;  4KSF A;  2Q0Y A;  1U6M A;  4C7I A;  2X7B A;  4QB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...