2J8RA

Structure of p. aeruginosa acetyltransferase pa4866 solved in complex with l-methionine sulfoximine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
170
structure length
170
Chain Sequence
b'ASIRDAGVADLPGILAIYNDAVGNTTAIWNETPVDLANRQAWFDARARQGYPILVASDAAGEVLGYASYGDWRPFEGFRGTVEHSVYVRDDQRGKGLGVQLLQALIERARAQGLHVMVAAIESGNAASIGLHRRLGFEISGQMPQVGQKFGRWLDLTFMQLNLDPTRSAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLTRANSFERASE PA4866 FROM P. AERUGINOSA
publication title L-Methionine Sulfoximine, But not Phosphinothricin, is a Substrate for an Acetyltransferase (Gene Pa4866) from Pseudomonas Aeruginosa: Structural and Functional Studies.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 51
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13420 Acetyltransf_4 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2j8rA00
1K4JA 2GIVA 1LRZA 2Q0YA 4NSQA 3EC4A 1NMTA 4M85A 4KLVA 1V0CA 3FB3A 2RC4A 2WPWA 3PP9A 2EUIA 2H5MA 4MBUA 2G3AA 3R1KA 4KVME 1U6MA 2FCKA 3BLNA 3W6SA 3TO7A 3G3SA 4CS0B 1ON0A 1S7FA 1Q2DA 5CNPA 3F5BA 3I9SA 5ISVA 1XE4A 4E2AA 1R57A 4KOUA 1S7NA 3S6FA 4MHDA 3DDDA 3KKWA 2WPXA 1N71A 3MGDA 2ARHA 1S7LA 3LODA 3TTHA 4HKFA 4KUBA 1NE9A 1BOBA 3P2HA 4UA3A 2FS5A 2B5GA 2BUEA 2D4PA 4H6ZA 4LX9A 4R3LA 2HUZA 3FNCA 4QUSA 4JXQA 1QSNA 2PC1A 4FD7A 4Y49B 4AVCA 2PDOA 2OB0A 3BJ7A 5J8CA 4LUAA 4KZTA 4CAXA 1I1DA 2FT0A 2ZW7A 3TT2A 1GHEA 1QSMA 1M4DA 1Z4RA 3QAHA 2P6FA 1Y7RA 4NEXA 2VEZA 4PSXA 2FXFA 3PZJA 4AG7A 1YK3A 1SQHA 4NCZA 4CRZB 2FE7A 3ZJ0A 2OZUA 3N7ZA 2B58A 2OH1A 3EY5A 1YR0A 4U9YA 3CXSA 3TOBA 5EBVA 3VWDA 3PGPA 1Z9UA 5HH1A 5C82A 1M44A 2GE3A 3DR6A 5J8FA 1OZPA 2R7HA 4MJ8A 4IUSA 3S6GA 4KOSA 2OZGA 1I12A 2B4DA 4B5PB 1KUVA 2O28A 1RO5A 3T9YA 4II9A 2OZHA 2JDCA 2Y0MA 5F47A 1CJWA 3GY9A 4HNWB 2EVNA 1B6BA 2IL4A 2D4OA 2VBQA 4IF5A 3TO9A 4UWIA 4CAWA 2BL1A 2K5TA 3NE7A 4CAVA 2FIWA 2GANA 3F8KA 1J4JA 4JD6A 1KUYA 4KOWA 2OU2A 4Y49C 4HNXB 4OAEA 4BMHA 2A4NA 2R1IA 3TCVA 2PQ8A 1Y9WA 1YGHA 1XF8A 4RI1A 4J3GA 4I49A 2BSWA 4EVYA 4PSWA 5C88A 3TFYA 3FBUA 5E96A 5IX3A 5GCNA 4YFJA 2FIAA 2JEVA 2VZYA 4X5KA 3B8GA 3SXNA 4L8AA 2HV2A 3IWGA 1XMTA 4U5YA 3BJ8A 3R95A 3W6XA 3FRMA 1UFHA 4AG9A 2VZZA 4MI4A 4FD4A 1M4IA 4ORFA 1MJBA 1MJAA 5F49A 1S3ZA 4AB7A 1P0HA 1Q2CA 4FD6A 3V8IA 2ZW4A 2G3TA 2Z11A 2Q4YA 2DXQA 2PSWA 5KTCA 4JWPA 2Q44A 5H86A 1IIDA 3RYOA 2X7BA 3K9UA 5FVJA 1NSLA 5JQ4A 1YLEA 3JVNA 2CNSA 4H89A 1M1DA 2FL4A 2AJ6A 3H4QA 1KUXA 1P4NA 2PR1A 1TIQA 1YVKA 1IYLA 2VXKA 4M3SA 2QIRA 4B5PA 3LD2A 3SHPA 4U9ZA 2ATRA 1S60A 2FSRA 1IYKA 1YREA 4PK3A 3WR7A 1WK4A 1QSOA 3DR8A 5EC4A 4JJXA 5DWMA 1FY7A 3D8PA 1B87A 4JXRA 2Z0ZA 2B3VA 4AVAA 2R98A 4QBJA 1KZFA 2P6EA 3D2MA 4K30A 2BEIA 2JLMA 3G8WA 4MY3A 4QVTA 1IB1E 2HQYA 5HMNA 3OWCA 4PV6A 5F46A 4NXYA 4XNHB 2Q4VA 2Z10A 1RXTA 3QB8A 2G0BA 4YGOA 5DWNA 3EFAA 2Q04A 5KTAA 3DSBA 2REFA 3E0KA 3R96A 3I3GA 2B3UA 4XPDB 3UY5A 2J8MA 2J8RA 4KOYA 5F48A 4FD5A 2QECA 2VI7A 4KOVA 4XPKA 4KORA 2NMTA 2R8VA 3C26A 2REEA 4DNCA 2B4DB 2P6GA 1S7KA 2QMLA 4F0YA 3F0AA 1QSTA 4KOTA 4PK2A 4OADA 1Y9KA 3SXOA 3GYAA 1MK4A 4RS2A 3P2FA 5H84A 3GKRA 2JDDA 2Q7BA 3VWEA 4KOXA 4YRHA 4CRYB 1VHSA 2CNMA 2P0WA 3R9EA 4R57A 4R87A 3T90A 5I0CA 3S6KA 2PR8A 4KVXA 4GS4A 1WWZA 1IICA 4UWJA 1PU9A 3TOAA 3EO4A 4XPLA 1CM0A 3EXNA 4E0AA 4KUAA 3R9FA 3TE4A 2F5IA 4F6AA 3CXQA 1PUAA 1XEBA 4UBRA 1I21A 3IGRA 3D3SA 4H6UA 4QC6A 4ZBGA 3TO6A 5IB0A 1S5KA 4QB9A 4XNHC 2VQYA 3DNSA 3S6HA 1VKCA 1QSRA 1MJ9A 4KVOE 2B5GB 2CNTA 2CY2A 1L0CA 2B4BA 3W91A 3JUWA 2PRBA 3ZZIA 2ZW5A 4R9MA 1Z4EA 2I00A 4R3KA 4XPDC 2AE6A 4NF1A 4OLLA 5IV0A 3FIXA 4ONUA 5JPHA 2I79A 1XIXA 2J8NA 2ZXVA 3R9GA 4L89A 4E8OA 5KTDA 1M4GA 2C27A 4AVBA 1Q2YA 2ZW6A 3FXTA 4B5OA 3FYNA 4MY0A 2KCWA 4KLWA 3D2PA 4HNYB 1YX0A 3CXPA 2ZPAA 1BO4A 1YVOA 4JLYA
chains in the Genus database with same CATH superfamily
1K4JA 2GIVA 3GUXA 1LRZA 2Q0YA 4NSQA 3EC4A 2RFHA 1NMTA 4M85A 1IU8A 4KLVA 4W9YA 5JGFA 1IOFA 3IC1A 4NGNA 4UCNA 4MCRA 1V0CA 4DYOA 4MXUA 4M6HA 2NYQA 2ODFA 1XRYA 3FB3A 2RC4A 2PJ9A 4UF4A 2WPWA 3PP9A 4PXEA 5AG5A 1HDQA 4IK2A 2PVVA 4OC3A 5THWA 2H5MA 2EUIA 2ZEMA 4F9UA 2GLFA 5A28A 2PJ5A 3H8EA 3B3VA 3DLJA 3IEHA 4MBUA 2G3AA 2CIJA 3MRUA 4NGQA 3R1KA 4OC2A 1BLLE 2O4HA 4UEFA 4KVME 2XEIA 1LOKA 4P4IA 1PCAA 2AFMA 1Z8TA 1U6MA 2FCKA 1XBUA 1JQGA 4A37A 3BLNA 3W6SA 5HVHA 3TO7A 3G3SA 4MFQA 5CPAA 4CS0B 1YMEA 1ON0A 1S7FA 5D8NA 3IWEA 4OC1A 1Q2DA 5CNPA 3F5BA 3I9SA 4F0XA 5ISVA 2V8DA 1XE4A 4E2AA 2YNDA 1R57A 3GB0A 4KOUA 1S7NA 3B3WA 4MFJA 4PXDA 3S6FA 4MHDA 4F8ZA 3DDDA 2DPTA 3KKWA 2WPXA 4JYWA 1N71A 1KWMA 3MGDA 2ARHA 3B3CA 1S7LA 3LODA 2RB7A 2QVPA 3TTHA 2C6PA 5AG6A 1Y7EA 4HKFA 4KUBA 3TX8A 1NE9A 3FEEA 1BOBA 3P2HA 4GXHA 4M6IA 2FS5A 2B5GA 2VL1A 1Z8WA 2WSAA 3H5ZA 2BUEA 3IFEA 4UA3A 2D4PA 1VHOA 4BD9A 4H6ZA 3V7ZA 4LX9A 2AFXA 4R3LA 2HUZA 1ZG7A 3CT9A 3FNCA 4QUSA 4UCPA 4JXQA 3SI2A 1QSNA 2PC1A 4FD7A 2WUUA 3SJXA 1AUGA 3BHXA 4Y49B 1M4LA 1IOIA 2PDOA 3B7IA 4AVCA 2OB0A 3BJ7A 5J8CA 2ZEEA 4LUAA 4KZTA 4CAXA 1I1DA 3BXMA 2FT0A 2ZW7A 3B35A 3TT2A 5JH9A 3FEDA 3SJGA 1GHEA 3PBBA 3TC8A 4A95A 1QMUA 1QSMA 5G21A 1M4DA 5AG7A 1Z4RA 3I1UA 4OIWA 3QAHA 2P6FA 1Y7RA 4NEXA 2VEZA 3DGVA 2CXAA 4JZ0A 4PSXA 2FXFA 1A2ZA 3PZJA 1HEEA 3IO1A 2QJ8A 2Q4ZA 3KZWA 2YNEA 4X8IA 4AG7A 4P4BA 3PFOA 1YK3A 1ELLP 2C6CA 1SQHA 3D66A 4FUUA 4NCZA 3MN8A 2J9AA 2PJ8A 4CRZB 2FE7A 3ZJ0A 2EWBA 3KL9A 2OZUA 3N7ZA 2B58A 2OH1A 3EY5A 4P4DA 3D4UA 1YR0A 4KSAA 4OC4A 3D7DA 4U9YA 3CXSA 4F9VA 2ZELA 4PPZA 3TOBA 4ZY0A 5F09A 4B12A 3PB8X 2PJ3A 4P45A 5EBVA 3VWDA 2V8VA 2YGWA 3PGPA 1Z9UA 2PIYA 4UEZA 5HH1A 3D7HA 3KI9A 5C82A 1M44A 2GE3A 3DR6A 5J8FA 1OZPA 1X10A 2R7HA 3SI0A 4B11A 4MJ8A 2FVGA 4IUSA 2GLJA 1LCPA 4Q7AA 3S6GA 4KOSA 2OZGA 2ZEFA 1I12A 3B3TA 4TWEA 2B4DA 4NJQA 2Z3PA 1KUVA 4B5PB 1XMBA 2NSMA 2O28A 1RO5A 4BBHA 5HVGA 3T9YA 3KASA 2QYVA 4II9A 2OZHA 2JDCA 2Y0MA 5F47A 1CJWA 4B14A 3GY9A 4HNWB 4B10A 2EVNA 4MCSA 2OOTA 1B6BA 2IL4A 2ZEDA 3A9LA 3IU1A 3LMSA 4Q38A 2D4OA 2VBQA 4HPSA 2ZEGA 3ISZA 1CBXA 4IF5A 3KQXA 4P6YA 3TO9A 4CPAA 4UWIA 4CAEA 1BPNA 4CAWA 2BL1A 2K5TA 4DUKA 2CTCA 3NE7A 3FX6A 4CAVA 2I3CA 3FVLA 2FIWA 3IJ3A 2GANA 2PJ0A 3S9MA 2PVWA 3F8KA 1UWYA 3S9NA 1J4JA 4KSIA 2V77A 3CPXA 4JD6A 1KUYA 5G20A 4C7HA 4KOWA 4FBEA 2OU2A 4Y49C 4HNXB 4MFKA 4OAEA 4G1PA 5I4MA 4CAFA 1AYEA 4BMHA 3PB4X 2Q7SA 2A4NA 4Z65A 2R1IA 3TCVA 2PQ8A 1Y9WA 1YGHA 3IIBA 1XF8A 4RI1A 2EK8A 4I49A 2BSWA 4J3GA 4PSWA 4EVYA 5C88A 3TFYA 3FBUA 5K8MA 4DJLA 5E96A 5IX3A 2DPSA 3NH8A 4UFWA 5GCNA 4YFJA 8CPAA 2FIAA 2JEVA 1ELMP 2VZYA 4P44A 4X5KA 3B8GA 3PB9X 3SXNA 2HV2A 3IWGA 4L8AA 1XMTA 4LQ6A 4U5YA 3BJ8A 3GIUA 2IQ6A 1CP7A 3R95A 4CGOA 2AFUA 2YNCC 3W6XA 4CYOA 1DE4C 1ZLHA 2BOAA 4GM5A 4UFVA 7CPAA 4PXCA 3FRMA 4PQAA 1UFHA 4OMEA 2C1CA 2PJCA 2VZZA 4AG9A 5BWAB 4MI4A 1CP6A 1M4IA 4FD4A 2GU2A 4ORFA 1MJBA 4NFRA 3IWWA 1MJAA 5F49A 1S3ZA 4AB7A 1P0HA 1CX8A 4ZYQA 3VATA 1Q2CA 3IU2A 2YNCA 4FD6A 3V8IA 2ZW4A 2G3TA 2Z11A 1Y0RA 2Q4YA 2DXQA 1HDUA 1EE3P 2PSWA 5KTCA 2ZOGA 4JWPA 1H8LA 1ZO0A 2AFZA 3NH4A 2F8HA 2Q44A 4CYNA 5H86A 1FT7A 2Z3MA 4A31A 3WABA 1IIDA 3RYOA 2X7BA 3K9UA 4CGPA 5FVJA 1ZG8A 1NSLA 2ANPA 4NGMA 2Q43A 4CGLA 1AMPA 5JQ4A 1YLEA 3JVNA 1YSJA 2CNSA 4ZX8A 4H89A 1IY7A 3WT4A 1M1DA 4MFPA 1F2PA 2FL4A 2AJ6A 1ZG9A 3H4QA 3WC6A 1KUXA 1P4NA 2PR1A 5LRJA 3K2KA 3KHXA 3D7GA 2Z3OA 4UIBA 4TNUA 5LYLA 1TIQA 1YVKA 1IYLA 2VXKA 2IJZA 1ARMA 4ZGYB 5AG4A 5K8NA 4UFXA 5K8PA 4M3SA 4MHNA 1F57A 2QIRA 4B5PA 1OBRA 1Y0YA 3LD2A 1VGYA 3D68A 3SHPA 4EMEA 1XOVA 3KHZA 4MCPA 1RTQA 1Z5RA 4OP4A 3FF3A 1CG2A 5CBMA 4U9ZA 2ATRA 2GREA 2PCUA 2ZENA 1S60A 2FSRA 2XEGA 1IYKA 2CF4A 1YREA 3T8WA 3PRTA 1Z8LA 1YW4A 3PEIA 5IB9A 4PK3A 4A39A 5G22A 3WR7A 2G9DA 1WK4A 1QSOA 4A33A 3DR8A 4R76A 2JBJA 5EC4A 1BPMA 2Q51A 4JJXA 5DS0A 3H8FA 4K3NA 2ZEHA 3ISXA 5DWMA 1FY7A 3D8PA 3V38A 1B87A 1LANA 4JXRA 3SJFA 2AFSA 4UCMA 4C2ZA 2Z0ZA 2B3VA 3QAYA 4AVAA 1TKHA 1X12A 2R98A 3RAMA 4QBJA 1KZFA 2ZEPA 4OKOA 2P6EA 3D2MA 4K30A 4MRIA 4YU9A 1VHEA 2BEIA 2JLMA 2JBKA 3G8WA 3KGQA 3PBEA 3KQZA 4MY3A 3K9TA 1Z2LA 4QVTA 2XEFA 1YQEA 1IB1E 4YWYA 2HQYA 3RO0A 3N5FA 2PJBA 5HMNA 3CDXA 3OWCA 4M6GA 4PV6A 4RN7A 3LWUA 3CPAA 5F46A 4A32A 4ZY2A 4NXYA 4XNHB 2Q4VA 2Z10A 1RXTA 4OIDA 3QB8A 2G0BA 4B6ZA 4YGOA 4NGSA 3FJUA 1LAPA 3NE8A 5DWNA 2GFQA 2V8GA 4RUHA 4EFDA 2AFOA 3EFAA 3RZAA 2Q04A 5A27A 2PJ6A 5J1QA 2WZNA 4CGMA 5KTAA 2XEJA 3JTKA 3DSBA 3FH4A 5D29A 5LYFA 2REFA 3E0KA 3R96A 3I3GA 4P10A 4H2KA 3RNZA 2B3UA 4XPDB 2HB6A 3UY5A 2J8MA 2J8RA 4KOYA 4NGPA 3NA6A 2OR4A 4EWTA 4P4JA 3KR4A 2PRQA 4R6TA 4UEEA 5F48A 4FD5A 2QECA 2PJ2A 2VI7A 4KOVA 4XPKA 3KR5A 4KORA 1ARLA 4MFZA 2NMTA 2R8VA 3C26A 5EMIA 4FAIA 2REEA 4AXVA 4DNCA 2B4DB 2P6GA 4NGRA 1GYTA 1S7KA 1YW6A 2QMLA 4F0YA 3PB7X 1TF8A 2ZEOA 1QSTA 2Z3KA 3F0AA 4KOTA 4CYPA 1LAMA 3D7FA 4MMOA 4ZI6A 3S9LA 2PJAA 2C6GA 4C2YA 4P4EA 4PK2A 5AGEA 4OADA 2DEAA 1VIXA 4OC5A 1Y9KA 4WJBA 3SXOA 2HC9A 3SJEA 6CPAA 3JRUA 1YLOA 3QNVA 4A30A 1JWQA 1MK4A 3GYAA 4PXBA 4UIAA 4C2XA 1XFOA 3PFEA 4RS2A 3P2FA 5H84A 3GKRA 4C68A 2JDDA 4KS9A 2Q7BA 4ONWA 4BINA 5K8OA 3D67A 4KOXA 3VWEA 2EK9A 4YRHA 3FECA 4CRYB 1LFWA 1VHSA 1DTDA 1TXRA 2CNMA 3RBUA 1FNOA 2P0WA 3R9EA 2IMOA 3WC5A 4B13A 3CZXA 4R57A 1TF9A 4R87A 3T90A 5I0CA 1CPXA 4Q36A 3S6KA 5LYDA 2PR8A 3HLPA 4KSFA 4KVXA 3VH9A 4A94A 4ZY1A 4GS4A 1WWZA 4R7MA 4A38A 1IICA 1TKJA 3B2YA 2BCOA 4MHYA 1Z8XA 4UWJA 3HUVA 3FMCA 1PU9A 2JEWA 4FWUA 3TOAA 3EO4A 1Q7LA 3GLJA 5LRKA 4XPLA 1CM0A 3EXNA 1PYTB 4E0AA 4KUAA 1TKFA 3R9FA 5HXDA 2F5IA 3TE4A 4F6AA 3H8GA 4WWVA 3CXQA 1PUAA 1XEBA 4UBRA 1I21A 2DF5A 1F2OA 2Z3NA 3IGRA 3D3SA 3L2NA 1IGBA 2WYRA 3BI0A 4H6UA 4IHMA 1ZLIA 4QC6A 4ZBGA 3TO6A 5IB0A 3B3SA 4MCQA 1BAVA 1S5KA 4X2TA 4QB9A 4CYQA 4XNHC 2VQYA 3DNSA 1QQ9A 2PE3A 1VKCA 3S6HA 1QSRA 1MJ9A 4KVOE 2PJ4A 2B5GB 2CNTA 2CY2A 4NJRA 1CPSA 1L0CA 3NH5A 5ELYA 2B4BA 2F7VA 4R8FA 3SI1A 2AFWA 3JUWA 3W91A 4IAVA 4MHZA 2PRBA 4C7IA 3ZZIA 4CGNA 2BO9A 3PB6X 3BI1A 2EO8A 4A2ZA 2ZW5A 4O23A 4R9MA 1Z4EA 3VARA 2ABZA 4NGTA 2I00A 4R3KA 2EBJA 2PJ1A 2PJ7A 2AE6A 4XPDC 4NF1A 4OLLA 5IV0A 3FIXA 4ONUA 3LACA 1XJOA 3WC7A 5JPHA 2O53A 2I79A 1XIXA 2J8NA 2ZXVA 4X3RA 4MHPA 4P4FA 3R9GA 4L89A 4E8OA 2POKA 3NFZA 2V8HA 2ZOFA 1R43A 5JM6A 1M4GA 5KTDA 2C27A 4AVBA 5LYIA 1Q2YA 2ZW6A 2Z3LA 3FXTA 5LRGA 5G1ZA 1NSAA 4B5OA 4MFLA 3FYNA 4LQGA 2PIZA 4MY0A 2KCWA 4KLWA 4OC0A 3D2PA 4ZX9A 4HNYB 5HVFA 1YX0A 1R3NA 3CXPA 2ZPAA 1BO4A 2CTBA 1YVOA 4JLYA
chains in the Genus database with same CATH topology
1K4JA 2GIVA 1LRZA 2Q0YA 4NSQA 3EC4A 1NMTA 4M85A 4KLVA 4UCNA 1V0CA 3FB3A 2RC4A 2WPWA 3PP9A 5AG5A 2EUIA 2H5MA 5A28A 4MBUA 2G3AA 3R1KA 4KVME 1U6MA 2FCKA 3BLNA 3W6SA 3TO7A 3G3SA 4MFQA 4CS0B 1ON0A 1S7FA 3IWEA 1Q2DA 5CNPA 3F5BA 3I9SA 4F0XA 5ISVA 1XE4A 4E2AA 2YNDA 1R57A 4KOUA 1S7NA 4MFJA 3S6FA 4MHDA 3DDDA 2DPTA 3KKWA 2WPXA 1N71A 3MGDA 2ARHA 1S7LA 3LODA 3TTHA 5AG6A 4HKFA 4KUBA 1NE9A 1BOBA 3P2HA 4UA3A 2FS5A 2B5GA 2WSAA 3H5ZA 2BUEA 2D4PA 4H6ZA 4LX9A 4R3LA 2HUZA 3FNCA 4QUSA 4UCPA 4JXQA 1QSNA 2PC1A 4FD7A 2WUUA 4Y49B 4AVCA 2PDOA 2OB0A 3BJ7A 5J8CA 4LUAA 4KZTA 4CAXA 1I1DA 2FT0A 2ZW7A 3TT2A 1GHEA 4A95A 1QSMA 5G21A 1M4DA 5AG7A 1Z4RA 3QAHA 2P6FA 1Y7RA 4NEXA 2VEZA 2CXAA 4PSXA 2FXFA 3PZJA 2YNEA 4AG7A 1YK3A 1SQHA 4NCZA 4CRZB 2FE7A 3ZJ0A 2OZUA 3N7ZA 2B58A 2OH1A 3EY5A 4B14A 4KSAA 1YR0A 4U9YA 3CXSA 3TOBA 4B12A 5EBVA 3VWDA 2YGWA 3PGPA 1Z9UA 5HH1A 5C82A 1M44A 2GE3A 3DR6A 5J8FA 1OZPA 2R7HA 4B11A 4MJ8A 4IUSA 3S6GA 4KOSA 2OZGA 1I12A 2B4DA 2Z3PA 1KUVA 4B5PB 2O28A 4BBHA 1RO5A 3T9YA 4II9A 2OZHA 2JDCA 2Y0MA 5F47A 1CJWA 3GY9A 4HNWB 4B10A 2EVNA 1B6BA 2IL4A 3IU1A 3A9LA 4Q38A 2D4OA 2VBQA 4IF5A 3TO9A 4UWIA 4CAEA 4CAWA 2BL1A 2K5TA 3NE7A 4CAVA 2FIWA 2GANA 3F8KA 1J4JA 4JD6A 1KUYA 5G20A 4C7HA 4KOWA 2OU2A 4Y49C 4HNXB 4MFKA 4OAEA 4CAFA 4BMHA 2A4NA 2R1IA 3TCVA 2PQ8A 1Y9WA 1YGHA 1XF8A 4RI1A 4J3GA 4I49A 2BSWA 4EVYA 4PSWA 5C88A 3TFYA 3FBUA 5E96A 5IX3A 2DPSA 4UFWA 5GCNA 4YFJA 2FIAA 2JEVA 2VZYA 4X5KA 3B8GA 3SXNA 2HV2A 3IWGA 4L8AA 1XMTA 4U5YA 3BJ8A 3R95A 4CGOA 4CYOA 2YNCC 3W6XA 4UFVA 3FRMA 1UFHA 4AG9A 2VZZA 5BWAB 4MI4A 4FD4A 1M4IA 4ORFA 1MJBA 1MJAA 5F49A 1S3ZA 4AB7A 1P0HA 1Q2CA 3IU2A 2YNCA 4FD6A 3V8IA 2ZW4A 2G3TA 2Z11A 2Q4YA 2DXQA 2PSWA 5KTCA 4JWPA 1ZO0A 2Q44A 4CYNA 5H86A 2Z3MA 4A31A 1IIDA 3RYOA 2X7BA 3K9UA 4CGPA 5FVJA 1NSLA 4CGLA 5JQ4A 1YLEA 3JVNA 2CNSA 4H89A 1M1DA 4MFPA 2FL4A 2AJ6A 3H4QA 1KUXA 1P4NA 2PR1A 2Z3OA 1TIQA 1YVKA 1IYLA 2VXKA 4ZGYB 5AG4A 4UFXA 4M3SA 2QIRA 4B5PA 3LD2A 3SHPA 4U9ZA 2ATRA 1S60A 2FSRA 1IYKA 1YREA 4PK3A 5G22A 3WR7A 1WK4A 1QSOA 4A33A 3DR8A 5EC4A 4JJXA 5DWMA 1FY7A 3D8PA 4C2ZA 1B87A 4JXRA 4UCMA 2Z0ZA 2B3VA 4AVAA 2R98A 4QBJA 1KZFA 2P6EA 3D2MA 4K30A 2BEIA 2JLMA 3G8WA 4MY3A 4QVTA 1IB1E 2HQYA 5HMNA 3OWCA 4PV6A 5F46A 4A32A 4NXYA 4XNHB 2Q4VA 2Z10A 1RXTA 3QB8A 2G0BA 4YGOA 5DWNA 3EFAA 5A27A 2Q04A 4CGMA 5KTAA 3JTKA 3DSBA 2REFA 3E0KA 3R96A 3I3GA 2B3UA 4XPDB 3UY5A 2J8MA 2J8RA 4KOYA 5F48A 4FD5A 2QECA 2VI7A 4KOVA 4XPKA 4KORA 4MFZA 2NMTA 2R8VA 3C26A 2REEA 4DNCA 2B4DB 2P6GA 1S7KA 2QMLA 4F0YA 3F0AA 1QSTA 2Z3KA 4KOTA 4CYPA 4C2YA 4PK2A 5AGEA 4OADA 1Y9KA 3SXOA 4A30A 3GYAA 1MK4A 4C2XA 4RS2A 3P2FA 5H84A 3GKRA 4C68A 2JDDA 4KS9A 2Q7BA 3VWEA 4KOXA 4YRHA 4CRYB 1VHSA 2CNMA 2P0WA 3R9EA 4B13A 4R57A 4R87A 3T90A 5I0CA 4Q36A 3S6KA 2PR8A 4KSFA 4KVXA 4GS4A 1WWZA 1IICA 4UWJA 1PU9A 3TOAA 3EO4A 4XPLA 1CM0A 3EXNA 4E0AA 4KUAA 3R9FA 3TE4A 2F5IA 4F6AA 3CXQA 1PUAA 1XEBA 4UBRA 1I21A 2Z3NA 3IGRA 3D3SA 4H6UA 4QC6A 4ZBGA 3TO6A 5IB0A 1S5KA 4QB9A 4CYQA 4XNHC 2VQYA 3DNSA 3S6HA 1VKCA 1QSRA 1MJ9A 4KVOE 2B5GB 2CNTA 2CY2A 1L0CA 2B4BA 4C7IA 3W91A 3JUWA 4CGNA 2PRBA 3ZZIA 4A2ZA 2ZW5A 4R9MA 1Z4EA 2I00A 4R3KA 4XPDC 2AE6A 4NF1A 4OLLA 5IV0A 3FIXA 4ONUA 5JPHA 2I79A 1XIXA 2J8NA 2ZXVA 3R9GA 4L89A 4E8OA 5KTDA 1M4GA 2C27A 4AVBA 1Q2YA 2ZW6A 2Z3LA 3FXTA 5G1ZA 4B5OA 4MFLA 3FYNA 4MY0A 2KCWA 4KLWA 3D2PA 4HNYB 1YX0A 3CXPA 2ZPAA 1BO4A 1YVOA 4JLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4J A;  2GIV A;  1LRZ A;  2Q0Y A;  4NSQ A;  3EC4 A;  1NMT A;  4M85 A;  4KLV A;  1V0C A;  3FB3 A;  2RC4 A;  2WPW A;  3PP9 A;  2EUI A;  2H5M A;  4MBU A;  2G3A A;  3R1K A;  4KVM E;  1U6M A;  2FCK A;  3BLN A;  3W6S A;  3TO7 A;  3G3S A;  4CS0 B;  1ON0 A;  1S7F A;  1Q2D A;  5CNP A;  3F5B A;  3I9S A;  5ISV A;  1XE4 A;  4E2A A;  1R57 A;  4KOU A;  1S7N A;  3S6F A;  4MHD A;  3DDD A;  3KKW A;  2WPX A;  1N71 A;  3MGD A;  2ARH A;  1S7L A;  3LOD A;  3TTH A;  4HKF A;  4KUB A;  1NE9 A;  1BOB A;  3P2H A;  4UA3 A;  2FS5 A;  2B5G A;  2BUE A;  2D4P A;  4H6Z A;  4LX9 A;  4R3L A;  2HUZ A;  3FNC A;  4QUS A;  4JXQ A;  1QSN A;  2PC1 A;  4FD7 A;  4Y49 B;  4AVC A;  2PDO A;  2OB0 A;  3BJ7 A;  5J8C A;  4LUA A;  4KZT A;  4CAX A;  1I1D A;  2FT0 A;  2ZW7 A;  3TT2 A;  1GHE A;  1QSM A;  1M4D A;  1Z4R A;  3QAH A;  2P6F A;  1Y7R A;  4NEX A;  2VEZ A;  4PSX A;  2FXF A;  3PZJ A;  4AG7 A;  1YK3 A;  1SQH A;  4NCZ A;  4CRZ B;  2FE7 A;  3ZJ0 A;  2OZU A;  3N7Z A;  2B58 A;  2OH1 A;  3EY5 A;  1YR0 A;  4U9Y A;  3CXS A;  3TOB A;  5EBV A;  3VWD A;  3PGP A;  1Z9U A;  5HH1 A;  5C82 A;  1M44 A;  2GE3 A;  3DR6 A;  5J8F A;  1OZP A;  2R7H A;  4MJ8 A;  4IUS A;  3S6G A;  4KOS A;  2OZG A;  1I12 A;  2B4D A;  4B5P B;  1KUV A;  2O28 A;  1RO5 A;  3T9Y A;  4II9 A;  2OZH A;  2JDC A;  2Y0M A;  5F47 A;  1CJW A;  3GY9 A;  4HNW B;  2EVN A;  1B6B A;  2IL4 A;  2D4O A;  2VBQ A;  4IF5 A;  3TO9 A;  4UWI A;  4CAW A;  2BL1 A;  2K5T A;  3NE7 A;  4CAV A;  2FIW A;  2GAN A;  3F8K A;  1J4J A;  4JD6 A;  1KUY A;  4KOW A;  2OU2 A;  4Y49 C;  4HNX B;  4OAE A;  4BMH A;  2A4N A;  2R1I A;  3TCV A;  2PQ8 A;  1Y9W A;  1YGH A;  1XF8 A;  4RI1 A;  4J3G A;  4I49 A;  2BSW A;  4EVY A;  4PSW A;  5C88 A;  3TFY A;  3FBU A;  5E96 A;  5IX3 A;  5GCN A;  4YFJ A;  2FIA A;  2JEV A;  2VZY A;  4X5K A;  3B8G A;  3SXN A;  4L8A A;  2HV2 A;  3IWG A;  1XMT A;  4U5Y A;  3BJ8 A;  3R95 A;  3W6X A;  3FRM A;  1UFH A;  4AG9 A;  2VZZ A;  4MI4 A;  4FD4 A;  1M4I A;  4ORF A;  1MJB A;  1MJA A;  5F49 A;  1S3Z A;  4AB7 A;  1P0H A;  1Q2C A;  4FD6 A;  3V8I A;  2ZW4 A;  2G3T A;  2Z11 A;  2Q4Y A;  2DXQ A;  2PSW A;  5KTC A;  4JWP A;  2Q44 A;  5H86 A;  1IID A;  3RYO A;  2X7B A;  3K9U A;  5FVJ A;  1NSL A;  5JQ4 A;  1YLE A;  3JVN A;  2CNS A;  4H89 A;  1M1D A;  2FL4 A;  2AJ6 A;  3H4Q A;  1KUX A;  1P4N A;  2PR1 A;  1TIQ A;  1YVK A;  1IYL A;  2VXK A;  4M3S A;  2QIR A;  4B5P A;  3LD2 A;  3SHP A;  4U9Z A;  2ATR A;  1S60 A;  2FSR A;  1IYK A;  1YRE A;  4PK3 A;  3WR7 A;  1WK4 A;  1QSO A;  3DR8 A;  5EC4 A;  4JJX A;  5DWM A;  1FY7 A;  3D8P A;  1B87 A;  4JXR A;  2Z0Z A;  2B3V A;  4AVA A;  2R98 A;  4QBJ A;  1KZF A;  2P6E A;  3D2M A;  4K30 A;  2BEI A;  2JLM A;  3G8W A;  4MY3 A;  4QVT A;  1IB1 E;  2HQY A;  5HMN A;  3OWC A;  4PV6 A;  5F46 A;  4NXY A;  4XNH B;  2Q4V A;  2Z10 A;  1RXT A;  3QB8 A;  2G0B A;  4YGO A;  5DWN A;  3EFA A;  2Q04 A;  5KTA A;  3DSB A;  2REF A;  3E0K A;  3R96 A;  3I3G A;  2B3U A;  4XPD B;  3UY5 A;  2J8M A;  2J8R A;  4KOY A;  5F48 A;  4FD5 A;  2QEC A;  2VI7 A;  4KOV A;  4XPK A;  4KOR A;  2NMT A;  2R8V A;  3C26 A;  2REE A;  4DNC A;  2B4D B;  2P6G A;  1S7K A;  2QML A;  4F0Y A;  3F0A A;  1QST A;  4KOT A;  4PK2 A;  4OAD A;  1Y9K A;  3SXO A;  3GYA A;  1MK4 A;  4RS2 A;  3P2F A;  5H84 A;  3GKR A;  2JDD A;  2Q7B A;  3VWE A;  4KOX A;  4YRH A;  4CRY B;  1VHS A;  2CNM A;  2P0W A;  3R9E A;  4R57 A;  4R87 A;  3T90 A;  5I0C A;  3S6K A;  2PR8 A;  4KVX A;  4GS4 A;  1WWZ A;  1IIC A;  4UWJ A;  1PU9 A;  3TOA A;  3EO4 A;  4XPL A;  1CM0 A;  3EXN A;  4E0A A;  4KUA A;  3R9F A;  3TE4 A;  2F5I A;  4F6A A;  3CXQ A;  1PUA A;  1XEB A;  4UBR A;  1I21 A;  3IGR A;  3D3S A;  4H6U A;  4QC6 A;  4ZBG A;  3TO6 A;  5IB0 A;  1S5K A;  4QB9 A;  4XNH C;  2VQY A;  3DNS A;  3S6H A;  1VKC A;  1QSR A;  1MJ9 A;  4KVO E;  2B5G B;  2CNT A;  2CY2 A;  1L0C A;  2B4B A;  3W91 A;  3JUW A;  2PRB A;  3ZZI A;  2ZW5 A;  4R9M A;  1Z4E A;  2I00 A;  4R3K A;  4XPD C;  2AE6 A;  4NF1 A;  4OLL A;  5IV0 A;  3FIX A;  4ONU A;  5JPH A;  2I79 A;  1XIX A;  2J8N A;  2ZXV A;  3R9G A;  4L89 A;  4E8O A;  5KTD A;  1M4G A;  2C27 A;  4AVB A;  1Q2Y A;  2ZW6 A;  3FXT A;  4B5O A;  3FYN A;  4MY0 A;  2KCW A;  4KLW A;  3D2P A;  4HNY B;  1YX0 A;  3CXP A;  2ZPA A;  1BO4 A;  1YVO A;  4JLY A; 
#chains in the Genus database with same CATH topology
 1K4J A;  2GIV A;  3GUX A;  1LRZ A;  2Q0Y A;  4NSQ A;  3EC4 A;  2RFH A;  1NMT A;  4M85 A;  1IU8 A;  4KLV A;  4W9Y A;  5JGF A;  1IOF A;  3IC1 A;  4NGN A;  4UCN A;  4MCR A;  1V0C A;  4DYO A;  4MXU A;  4M6H A;  2NYQ A;  2ODF A;  1XRY A;  3FB3 A;  2RC4 A;  2PJ9 A;  4UF4 A;  2WPW A;  3PP9 A;  4PXE A;  5AG5 A;  1HDQ A;  4IK2 A;  2PVV A;  4OC3 A;  5THW A;  2H5M A;  2EUI A;  2ZEM A;  4F9U A;  2GLF A;  5A28 A;  2PJ5 A;  3H8E A;  3B3V A;  3DLJ A;  3IEH A;  4MBU A;  2G3A A;  2CIJ A;  3MRU A;  4NGQ A;  3R1K A;  4OC2 A;  1BLL E;  2O4H A;  4UEF A;  4KVM E;  2XEI A;  1LOK A;  4P4I A;  1PCA A;  2AFM A;  1Z8T A;  1U6M A;  2FCK A;  1XBU A;  1JQG A;  4A37 A;  3BLN A;  3W6S A;  5HVH A;  3TO7 A;  3G3S A;  4MFQ A;  5CPA A;  4CS0 B;  1YME A;  1ON0 A;  1S7F A;  5D8N A;  3IWE A;  4OC1 A;  1Q2D A;  5CNP A;  3F5B A;  3I9S A;  4F0X A;  5ISV A;  2V8D A;  1XE4 A;  4E2A A;  2YND A;  1R57 A;  3GB0 A;  4KOU A;  1S7N A;  3B3W A;  4MFJ A;  4PXD A;  3S6F A;  4MHD A;  4F8Z A;  3DDD A;  2DPT A;  3KKW A;  2WPX A;  4JYW A;  1N71 A;  1KWM A;  3MGD A;  2ARH A;  3B3C A;  1S7L A;  3LOD A;  2RB7 A;  2QVP A;  3TTH A;  2C6P A;  5AG6 A;  1Y7E A;  4HKF A;  4KUB A;  3TX8 A;  1NE9 A;  3FEE A;  1BOB A;  3P2H A;  4GXH A;  4M6I A;  2FS5 A;  2B5G A;  2VL1 A;  1Z8W A;  2WSA A;  3H5Z A;  2BUE A;  3IFE A;  4UA3 A;  2D4P A;  1VHO A;  4BD9 A;  4H6Z A;  3V7Z A;  4LX9 A;  2AFX A;  4R3L A;  2HUZ A;  1ZG7 A;  3CT9 A;  3FNC A;  4QUS A;  4UCP A;  4JXQ A;  3SI2 A;  1QSN A;  2PC1 A;  4FD7 A;  2WUU A;  3SJX A;  1AUG A;  3BHX A;  4Y49 B;  1M4L A;  1IOI A;  2PDO A;  3B7I A;  4AVC A;  2OB0 A;  3BJ7 A;  5J8C A;  2ZEE A;  4LUA A;  4KZT A;  4CAX A;  1I1D A;  3BXM A;  2FT0 A;  2ZW7 A;  3B35 A;  3TT2 A;  5JH9 A;  3FED A;  3SJG A;  1GHE A;  3PBB A;  3TC8 A;  4A95 A;  1QMU A;  1QSM A;  5G21 A;  1M4D A;  5AG7 A;  1Z4R A;  3I1U A;  4OIW A;  3QAH A;  2P6F A;  1Y7R A;  4NEX A;  2VEZ A;  3DGV A;  2CXA A;  4JZ0 A;  4PSX A;  2FXF A;  1A2Z A;  3PZJ A;  1HEE A;  3IO1 A;  2QJ8 A;  2Q4Z A;  3KZW A;  2YNE A;  4X8I A;  4AG7 A;  4P4B A;  3PFO A;  1YK3 A;  1ELL P;  2C6C A;  1SQH A;  3D66 A;  4FUU A;  4NCZ A;  3MN8 A;  2J9A A;  2PJ8 A;  4CRZ B;  2FE7 A;  3ZJ0 A;  2EWB A;  3KL9 A;  2OZU A;  3N7Z A;  2B58 A;  2OH1 A;  3EY5 A;  4P4D A;  3D4U A;  1YR0 A;  4KSA A;  4OC4 A;  3D7D A;  4U9Y A;  3CXS A;  4F9V A;  2ZEL A;  4PPZ A;  3TOB A;  4ZY0 A;  5F09 A;  4B12 A;  3PB8 X;  2PJ3 A;  4P45 A;  5EBV A;  3VWD A;  2V8V A;  2YGW A;  3PGP A;  1Z9U A;  2PIY A;  4UEZ A;  5HH1 A;  3D7H A;  3KI9 A;  5C82 A;  1M44 A;  2GE3 A;  3DR6 A;  5J8F A;  1OZP A;  1X10 A;  2R7H A;  3SI0 A;  4B11 A;  4MJ8 A;  2FVG A;  4IUS A;  2GLJ A;  1LCP A;  4Q7A A;  3S6G A;  4KOS A;  2OZG A;  2ZEF A;  1I12 A;  3B3T A;  4TWE A;  2B4D A;  4NJQ A;  2Z3P A;  1KUV A;  4B5P B;  1XMB A;  2NSM A;  2O28 A;  1RO5 A;  4BBH A;  5HVG A;  3T9Y A;  3KAS A;  2QYV A;  4II9 A;  2OZH A;  2JDC A;  2Y0M A;  5F47 A;  1CJW A;  4B14 A;  3GY9 A;  4HNW B;  4B10 A;  2EVN A;  4MCS A;  2OOT A;  1B6B A;  2IL4 A;  2ZED A;  3A9L A;  3IU1 A;  3LMS A;  4Q38 A;  2D4O A;  2VBQ A;  4HPS A;  2ZEG A;  3ISZ A;  1CBX A;  4IF5 A;  3KQX A;  4P6Y A;  3TO9 A;  4CPA A;  4UWI A;  4CAE A;  1BPN A;  4CAW A;  2BL1 A;  2K5T A;  4DUK A;  2CTC A;  3NE7 A;  3FX6 A;  4CAV A;  2I3C A;  3FVL A;  2FIW A;  3IJ3 A;  2GAN A;  2PJ0 A;  3S9M A;  2PVW A;  3F8K A;  1UWY A;  3S9N A;  1J4J A;  4KSI A;  2V77 A;  3CPX A;  4JD6 A;  1KUY A;  5G20 A;  4C7H A;  4KOW A;  4FBE A;  2OU2 A;  4Y49 C;  4HNX B;  4MFK A;  4OAE A;  4G1P A;  5I4M A;  4CAF A;  1AYE A;  4BMH A;  3PB4 X;  2Q7S A;  2A4N A;  4Z65 A;  2R1I A;  3TCV A;  2PQ8 A;  1Y9W A;  1YGH A;  3IIB A;  1XF8 A;  4RI1 A;  2EK8 A;  4I49 A;  2BSW A;  4J3G A;  4PSW A;  4EVY A;  5C88 A;  3TFY A;  3FBU A;  5K8M A;  4DJL A;  5E96 A;  5IX3 A;  2DPS A;  3NH8 A;  4UFW A;  5GCN A;  4YFJ A;  8CPA A;  2FIA A;  2JEV A;  1ELM P;  2VZY A;  4P44 A;  4X5K A;  3B8G A;  3PB9 X;  3SXN A;  2HV2 A;  3IWG A;  4L8A A;  1XMT A;  4LQ6 A;  4U5Y A;  3BJ8 A;  3GIU A;  2IQ6 A;  1CP7 A;  3R95 A;  4CGO A;  2AFU A;  2YNC C;  3W6X A;  4CYO A;  1DE4 C;  1ZLH A;  2BOA A;  4GM5 A;  4UFV A;  7CPA A;  4PXC A;  3FRM A;  4PQA A;  1UFH A;  4OME A;  2C1C A;  2PJC A;  2VZZ A;  4AG9 A;  5BWA B;  4MI4 A;  1CP6 A;  1M4I A;  4FD4 A;  2GU2 A;  4ORF A;  1MJB A;  4NFR A;  3IWW A;  1MJA A;  5F49 A;  1S3Z A;  4AB7 A;  1P0H A;  1CX8 A;  4ZYQ A;  3VAT A;  1Q2C A;  3IU2 A;  2YNC A;  4FD6 A;  3V8I A;  2ZW4 A;  2G3T A;  2Z11 A;  1Y0R A;  2Q4Y A;  2DXQ A;  1HDU A;  1EE3 P;  2PSW A;  5KTC A;  2ZOG A;  4JWP A;  1H8L A;  1ZO0 A;  2AFZ A;  3NH4 A;  2F8H A;  2Q44 A;  4CYN A;  5H86 A;  1FT7 A;  2Z3M A;  4A31 A;  3WAB A;  1IID A;  3RYO A;  2X7B A;  3K9U A;  4CGP A;  5FVJ A;  1ZG8 A;  1NSL A;  2ANP A;  4NGM A;  2Q43 A;  4CGL A;  1AMP A;  5JQ4 A;  1YLE A;  3JVN A;  1YSJ A;  2CNS A;  4ZX8 A;  4H89 A;  1IY7 A;  3WT4 A;  1M1D A;  4MFP A;  1F2P A;  2FL4 A;  2AJ6 A;  1ZG9 A;  3H4Q A;  3WC6 A;  1KUX A;  1P4N A;  2PR1 A;  5LRJ A;  3K2K A;  3KHX A;  3D7G A;  2Z3O A;  4UIB A;  4TNU A;  5LYL A;  1TIQ A;  1YVK A;  1IYL A;  2VXK A;  2IJZ A;  1ARM A;  4ZGY B;  5AG4 A;  5K8N A;  4UFX A;  5K8P A;  4M3S A;  4MHN A;  1F57 A;  2QIR A;  4B5P A;  1OBR A;  1Y0Y A;  3LD2 A;  1VGY A;  3D68 A;  3SHP A;  4EME A;  1XOV A;  3KHZ A;  4MCP A;  1RTQ A;  1Z5R A;  4OP4 A;  3FF3 A;  1CG2 A;  5CBM A;  4U9Z A;  2ATR A;  2GRE A;  2PCU A;  2ZEN A;  1S60 A;  2FSR A;  2XEG A;  1IYK A;  2CF4 A;  1YRE A;  3T8W A;  3PRT A;  1Z8L A;  1YW4 A;  3PEI A;  5IB9 A;  4PK3 A;  4A39 A;  5G22 A;  3WR7 A;  2G9D A;  1WK4 A;  1QSO A;  4A33 A;  3DR8 A;  4R76 A;  2JBJ A;  5EC4 A;  1BPM A;  2Q51 A;  4JJX A;  5DS0 A;  3H8F A;  4K3N A;  2ZEH A;  3ISX A;  5DWM A;  1FY7 A;  3D8P A;  3V38 A;  1B87 A;  1LAN A;  4JXR A;  3SJF A;  2AFS A;  4UCM A;  4C2Z A;  2Z0Z A;  2B3V A;  3QAY A;  4AVA A;  1TKH A;  1X12 A;  2R98 A;  3RAM A;  4QBJ A;  1KZF A;  2ZEP A;  4OKO A;  2P6E A;  3D2M A;  4K30 A;  4MRI A;  4YU9 A;  1VHE A;  2BEI A;  2JLM A;  2JBK A;  3G8W A;  3KGQ A;  3PBE A;  3KQZ A;  4MY3 A;  3K9T A;  1Z2L A;  4QVT A;  2XEF A;  1YQE A;  1IB1 E;  4YWY A;  2HQY A;  3RO0 A;  3N5F A;  2PJB A;  5HMN A;  3CDX A;  3OWC A;  4M6G A;  4PV6 A;  4RN7 A;  3LWU A;  3CPA A;  5F46 A;  4A32 A;  4ZY2 A;  4NXY A;  4XNH B;  2Q4V A;  2Z10 A;  1RXT A;  4OID A;  3QB8 A;  2G0B A;  4B6Z A;  4YGO A;  4NGS A;  3FJU A;  1LAP A;  3NE8 A;  5DWN A;  2GFQ A;  2V8G A;  4RUH A;  4EFD A;  2AFO A;  3EFA A;  3RZA A;  2Q04 A;  5A27 A;  2PJ6 A;  5J1Q A;  2WZN A;  4CGM A;  5KTA A;  2XEJ A;  3JTK A;  3DSB A;  3FH4 A;  5D29 A;  5LYF A;  2REF A;  3E0K A;  3R96 A;  3I3G A;  4P10 A;  4H2K A;  3RNZ A;  2B3U A;  4XPD B;  2HB6 A;  3UY5 A;  2J8M A;  2J8R A;  4KOY A;  4NGP A;  3NA6 A;  2OR4 A;  4EWT A;  4P4J A;  3KR4 A;  2PRQ A;  4R6T A;  4UEE A;  5F48 A;  4FD5 A;  2QEC A;  2PJ2 A;  2VI7 A;  4KOV A;  4XPK A;  3KR5 A;  4KOR A;  1ARL A;  4MFZ A;  2NMT A;  2R8V A;  3C26 A;  5EMI A;  4FAI A;  2REE A;  4AXV A;  4DNC A;  2B4D B;  2P6G A;  4NGR A;  1GYT A;  1S7K A;  1YW6 A;  2QML A;  4F0Y A;  3PB7 X;  1TF8 A;  2ZEO A;  1QST A;  2Z3K A;  3F0A A;  4KOT A;  4CYP A;  1LAM A;  3D7F A;  4MMO A;  4ZI6 A;  3S9L A;  2PJA A;  2C6G A;  4C2Y A;  4P4E A;  4PK2 A;  5AGE A;  4OAD A;  2DEA A;  1VIX A;  4OC5 A;  1Y9K A;  4WJB A;  3SXO A;  2HC9 A;  3SJE A;  6CPA A;  3JRU A;  1YLO A;  3QNV A;  4A30 A;  1JWQ A;  1MK4 A;  3GYA A;  4PXB A;  4UIA A;  4C2X A;  1XFO A;  3PFE A;  4RS2 A;  3P2F A;  5H84 A;  3GKR A;  4C68 A;  2JDD A;  4KS9 A;  2Q7B A;  4ONW A;  4BIN A;  5K8O A;  3D67 A;  4KOX A;  3VWE A;  2EK9 A;  4YRH A;  3FEC A;  4CRY B;  1LFW A;  1VHS A;  1DTD A;  1TXR A;  2CNM A;  3RBU A;  1FNO A;  2P0W A;  3R9E A;  2IMO A;  3WC5 A;  4B13 A;  3CZX A;  4R57 A;  1TF9 A;  4R87 A;  3T90 A;  5I0C A;  1CPX A;  4Q36 A;  3S6K A;  5LYD A;  2PR8 A;  3HLP A;  4KSF A;  4KVX A;  3VH9 A;  4A94 A;  4ZY1 A;  4GS4 A;  1WWZ A;  4R7M A;  4A38 A;  1IIC A;  1TKJ A;  3B2Y A;  2BCO A;  4MHY A;  1Z8X A;  4UWJ A;  3HUV A;  3FMC A;  1PU9 A;  2JEW A;  4FWU A;  3TOA A;  3EO4 A;  1Q7L A;  3GLJ A;  5LRK A;  4XPL A;  1CM0 A;  3EXN A;  1PYT B;  4E0A A;  4KUA A;  1TKF A;  3R9F A;  5HXD A;  2F5I A;  3TE4 A;  4F6A A;  3H8G A;  4WWV A;  3CXQ A;  1PUA A;  1XEB A;  4UBR A;  1I21 A;  2DF5 A;  1F2O A;  2Z3N A;  3IGR A;  3D3S A;  3L2N A;  1IGB A;  2WYR A;  3BI0 A;  4H6U A;  4IHM A;  1ZLI A;  4QC6 A;  4ZBG A;  3TO6 A;  5IB0 A;  3B3S A;  4MCQ A;  1BAV A;  1S5K A;  4X2T A;  4QB9 A;  4CYQ A;  4XNH C;  2VQY A;  3DNS A;  1QQ9 A;  2PE3 A;  1VKC A;  3S6H A;  1QSR A;  1MJ9 A;  4KVO E;  2PJ4 A;  2B5G B;  2CNT A;  2CY2 A;  4NJR A;  1CPS A;  1L0C A;  3NH5 A;  5ELY A;  2B4B A;  2F7V A;  4R8F A;  3SI1 A;  2AFW A;  3JUW A;  3W91 A;  4IAV A;  4MHZ A;  2PRB A;  4C7I A;  3ZZI A;  4CGN A;  2BO9 A;  3PB6 X;  3BI1 A;  2EO8 A;  4A2Z A;  2ZW5 A;  4O23 A;  4R9M A;  1Z4E A;  3VAR A;  2ABZ A;  4NGT A;  2I00 A;  4R3K A;  2EBJ A;  2PJ1 A;  2PJ7 A;  2AE6 A;  4XPD C;  4NF1 A;  4OLL A;  5IV0 A;  3FIX A;  4ONU A;  3LAC A;  1XJO A;  3WC7 A;  5JPH A;  2O53 A;  2I79 A;  1XIX A;  2J8N A;  2ZXV A;  4X3R A;  4MHP A;  4P4F A;  3R9G A;  4L89 A;  4E8O A;  2POK A;  3NFZ A;  2V8H A;  2ZOF A;  1R43 A;  5JM6 A;  1M4G A;  5KTD A;  2C27 A;  4AVB A;  5LYI A;  1Q2Y A;  2ZW6 A;  2Z3L A;  3FXT A;  5LRG A;  5G1Z A;  1NSA A;  4B5O A;  4MFL A;  3FYN A;  4LQG A;  2PIZ A;  4MY0 A;  2KCW A;  4KLW A;  4OC0 A;  3D2P A;  4ZX9 A;  4HNY B;  5HVF A;  1YX0 A;  1R3N A;  3CXP A;  2ZPA A;  1BO4 A;  2CTB A;  1YVO A;  4JLY A; 
#chains in the Genus database with same CATH homology
 1K4J A;  2GIV A;  1LRZ A;  2Q0Y A;  4NSQ A;  3EC4 A;  1NMT A;  4M85 A;  4KLV A;  4UCN A;  1V0C A;  3FB3 A;  2RC4 A;  2WPW A;  3PP9 A;  5AG5 A;  2EUI A;  2H5M A;  5A28 A;  4MBU A;  2G3A A;  3R1K A;  4KVM E;  1U6M A;  2FCK A;  3BLN A;  3W6S A;  3TO7 A;  3G3S A;  4MFQ A;  4CS0 B;  1ON0 A;  1S7F A;  3IWE A;  1Q2D A;  5CNP A;  3F5B A;  3I9S A;  4F0X A;  5ISV A;  1XE4 A;  4E2A A;  2YND A;  1R57 A;  4KOU A;  1S7N A;  4MFJ A;  3S6F A;  4MHD A;  3DDD A;  2DPT A;  3KKW A;  2WPX A;  1N71 A;  3MGD A;  2ARH A;  1S7L A;  3LOD A;  3TTH A;  5AG6 A;  4HKF A;  4KUB A;  1NE9 A;  1BOB A;  3P2H A;  4UA3 A;  2FS5 A;  2B5G A;  2WSA A;  3H5Z A;  2BUE A;  2D4P A;  4H6Z A;  4LX9 A;  4R3L A;  2HUZ A;  3FNC A;  4QUS A;  4UCP A;  4JXQ A;  1QSN A;  2PC1 A;  4FD7 A;  2WUU A;  4Y49 B;  4AVC A;  2PDO A;  2OB0 A;  3BJ7 A;  5J8C A;  4LUA A;  4KZT A;  4CAX A;  1I1D A;  2FT0 A;  2ZW7 A;  3TT2 A;  1GHE A;  4A95 A;  1QSM A;  5G21 A;  1M4D A;  5AG7 A;  1Z4R A;  3QAH A;  2P6F A;  1Y7R A;  4NEX A;  2VEZ A;  2CXA A;  4PSX A;  2FXF A;  3PZJ A;  2YNE A;  4AG7 A;  1YK3 A;  1SQH A;  4NCZ A;  4CRZ B;  2FE7 A;  3ZJ0 A;  2OZU A;  3N7Z A;  2B58 A;  2OH1 A;  3EY5 A;  4B14 A;  4KSA A;  1YR0 A;  4U9Y A;  3CXS A;  3TOB A;  4B12 A;  5EBV A;  3VWD A;  2YGW A;  3PGP A;  1Z9U A;  5HH1 A;  5C82 A;  1M44 A;  2GE3 A;  3DR6 A;  5J8F A;  1OZP A;  2R7H A;  4B11 A;  4MJ8 A;  4IUS A;  3S6G A;  4KOS A;  2OZG A;  1I12 A;  2B4D A;  2Z3P A;  1KUV A;  4B5P B;  2O28 A;  4BBH A;  1RO5 A;  3T9Y A;  4II9 A;  2OZH A;  2JDC A;  2Y0M A;  5F47 A;  1CJW A;  3GY9 A;  4HNW B;  4B10 A;  2EVN A;  1B6B A;  2IL4 A;  3IU1 A;  3A9L A;  4Q38 A;  2D4O A;  2VBQ A;  4IF5 A;  3TO9 A;  4UWI A;  4CAE A;  4CAW A;  2BL1 A;  2K5T A;  3NE7 A;  4CAV A;  2FIW A;  2GAN A;  3F8K A;  1J4J A;  4JD6 A;  1KUY A;  5G20 A;  4C7H A;  4KOW A;  2OU2 A;  4Y49 C;  4HNX B;  4MFK A;  4OAE A;  4CAF A;  4BMH A;  2A4N A;  2R1I A;  3TCV A;  2PQ8 A;  1Y9W A;  1YGH A;  1XF8 A;  4RI1 A;  4J3G A;  4I49 A;  2BSW A;  4EVY A;  4PSW A;  5C88 A;  3TFY A;  3FBU A;  5E96 A;  5IX3 A;  2DPS A;  4UFW A;  5GCN A;  4YFJ A;  2FIA A;  2JEV A;  2VZY A;  4X5K A;  3B8G A;  3SXN A;  2HV2 A;  3IWG A;  4L8A A;  1XMT A;  4U5Y A;  3BJ8 A;  3R95 A;  4CGO A;  4CYO A;  2YNC C;  3W6X A;  4UFV A;  3FRM A;  1UFH A;  4AG9 A;  2VZZ A;  5BWA B;  4MI4 A;  4FD4 A;  1M4I A;  4ORF A;  1MJB A;  1MJA A;  5F49 A;  1S3Z A;  4AB7 A;  1P0H A;  1Q2C A;  3IU2 A;  2YNC A;  4FD6 A;  3V8I A;  2ZW4 A;  2G3T A;  2Z11 A;  2Q4Y A;  2DXQ A;  2PSW A;  5KTC A;  4JWP A;  1ZO0 A;  2Q44 A;  4CYN A;  5H86 A;  2Z3M A;  4A31 A;  1IID A;  3RYO A;  2X7B A;  3K9U A;  4CGP A;  5FVJ A;  1NSL A;  4CGL A;  5JQ4 A;  1YLE A;  3JVN A;  2CNS A;  4H89 A;  1M1D A;  4MFP A;  2FL4 A;  2AJ6 A;  3H4Q A;  1KUX A;  1P4N A;  2PR1 A;  2Z3O A;  1TIQ A;  1YVK A;  1IYL A;  2VXK A;  4ZGY B;  5AG4 A;  4UFX A;  4M3S A;  2QIR A;  4B5P A;  3LD2 A;  3SHP A;  4U9Z A;  2ATR A;  1S60 A;  2FSR A;  1IYK A;  1YRE A;  4PK3 A;  5G22 A;  3WR7 A;  1WK4 A;  1QSO A;  4A33 A;  3DR8 A;  5EC4 A;  4JJX A;  5DWM A;  1FY7 A;  3D8P A;  4C2Z A;  1B87 A;  4JXR A;  4UCM A;  2Z0Z A;  2B3V A;  4AVA A;  2R98 A;  4QBJ A;  1KZF A;  2P6E A;  3D2M A;  4K30 A;  2BEI A;  2JLM A;  3G8W A;  4MY3 A;  4QVT A;  1IB1 E;  2HQY A;  5HMN A;  3OWC A;  4PV6 A;  5F46 A;  4A32 A;  4NXY A;  4XNH B;  2Q4V A;  2Z10 A;  1RXT A;  3QB8 A;  2G0B A;  4YGO A;  5DWN A;  3EFA A;  5A27 A;  2Q04 A;  4CGM A;  5KTA A;  3JTK A;  3DSB A;  2REF A;  3E0K A;  3R96 A;  3I3G A;  2B3U A;  4XPD B;  3UY5 A;  2J8M A;  2J8R A;  4KOY A;  5F48 A;  4FD5 A;  2QEC A;  2VI7 A;  4KOV A;  4XPK A;  4KOR A;  4MFZ A;  2NMT A;  2R8V A;  3C26 A;  2REE A;  4DNC A;  2B4D B;  2P6G A;  1S7K A;  2QML A;  4F0Y A;  3F0A A;  1QST A;  2Z3K A;  4KOT A;  4CYP A;  4C2Y A;  4PK2 A;  5AGE A;  4OAD A;  1Y9K A;  3SXO A;  4A30 A;  3GYA A;  1MK4 A;  4C2X A;  4RS2 A;  3P2F A;  5H84 A;  3GKR A;  4C68 A;  2JDD A;  4KS9 A;  2Q7B A;  3VWE A;  4KOX A;  4YRH A;  4CRY B;  1VHS A;  2CNM A;  2P0W A;  3R9E A;  4B13 A;  4R57 A;  4R87 A;  3T90 A;  5I0C A;  4Q36 A;  3S6K A;  2PR8 A;  4KSF A;  4KVX A;  4GS4 A;  1WWZ A;  1IIC A;  4UWJ A;  1PU9 A;  3TOA A;  3EO4 A;  4XPL A;  1CM0 A;  3EXN A;  4E0A A;  4KUA A;  3R9F A;  3TE4 A;  2F5I A;  4F6A A;  3CXQ A;  1PUA A;  1XEB A;  4UBR A;  1I21 A;  2Z3N A;  3IGR A;  3D3S A;  4H6U A;  4QC6 A;  4ZBG A;  3TO6 A;  5IB0 A;  1S5K A;  4QB9 A;  4CYQ A;  4XNH C;  2VQY A;  3DNS A;  3S6H A;  1VKC A;  1QSR A;  1MJ9 A;  4KVO E;  2B5G B;  2CNT A;  2CY2 A;  1L0C A;  2B4B A;  4C7I A;  3W91 A;  3JUW A;  4CGN A;  2PRB A;  3ZZI A;  4A2Z A;  2ZW5 A;  4R9M A;  1Z4E A;  2I00 A;  4R3K A;  4XPD C;  2AE6 A;  4NF1 A;  4OLL A;  5IV0 A;  3FIX A;  4ONU A;  5JPH A;  2I79 A;  1XIX A;  2J8N A;  2ZXV A;  3R9G A;  4L89 A;  4E8O A;  5KTD A;  1M4G A;  2C27 A;  4AVB A;  1Q2Y A;  2ZW6 A;  2Z3L A;  3FXT A;  5G1Z A;  4B5O A;  4MFL A;  3FYN A;  4MY0 A;  2KCW A;  4KLW A;  3D2P A;  4HNY B;  1YX0 A;  3CXP A;  2ZPA A;  1BO4 A;  1YVO A;  4JLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...