4PV6A

Crystal structure analysis of ard1 from thermoplasma volcanium
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
154
structure length
154
Chain Sequence
INAVAGTIREFSPKDIESVYRIAQTSLTEYYTQALILDLHREWPESFMVYTVAGSVVGFIVGSKYSRTEARILLFAVDERFRRMGVGSALMDAFLSLCREQNMLSVRLEVRTDNDEAIRFYKKYGFVITAMLPNYYSDSSNAYTMWRIVLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N-terminal acetyltransferase complex subunit [ARD1]
publication title Structure of Thermoplasma volcanium Ard1 belongs to N-acetyltransferase family member suggesting multiple ligand binding modes with acetyl coenzyme A and coenzyme A.
pubmed doi rcsb
source organism Thermoplasma volcanium
total genus 38
structure length 154
sequence length 154
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2014-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4pv6A00
1VKCA 2FIWA 1YVKA 5C88A 1IYLA 3S6FA 4RI1A 1Y9KA 4YFJA 4LX9A 4UA3A 3R1KA 2J8MA 2FS5A 4U9ZA 3DNSA 4AG9A 4XNHB 4JJXA 2Q7BA 2Q44A 2VZYA 2VQYA 5J8FA 1P4NA 3DR8A 3EY5A 4NF1A 1YK3A 3BJ7A 3W6SA 4KOVA 4AVCA 3LD2A 4E8OA 3BJ8A 4CRYB 4QC6A 2FIAA 2JDCA 2FE7A 2ARHA 2PSWA 4ORFA 4XNHC 4HNXB 1GHEA 3CXQA 3S6GA 2P6GA 1IB1E 4R3KA 3GKRA 3EO4A 2ZW5A 3S6KA 1LRZA 4R87A 3R9GA 2B5GA 2FXFA 5F49A 2I00A 1V0CA 1PUAA 3ZZIA 4XPLA 1YX0A 1U6MA 4JD6A 5F46A 3FXTA 4Y49B 4CAVA 3UY5A 1S3ZA 1KUVA 2G3AA 3PZJA 1Q2YA 1P0HA 3TOAA 3CXPA 1XEBA 2IL4A 2B4DA 1XE4A 2HQYA 3C26A 1NSLA 2JLMA 2B4BA 5CNPA 3IGRA 2H5MA 3S6HA 2RC4A 4Y49C 2PRBA 2R7HA 3F5BA 1M4DA 1Q2DA 4YGOA 4L8AA 4KOSA 3T9YA 3EXNA 4AB7A 4M85A 4MHDA 2FT0A 4X5KA 1S7LA 1MJ9A 2D4PA 4KOTA 5IX3A 4HKFA 1FY7A 4H6ZA 2VZZA 4R9MA 5F47A 3EFAA 4EVYA 5H84A 1M4IA 3TCVA 2I79A 4II9A 1B6BA 5FVJA 4OAEA 3PGPA 1UFHA 4KOXA 2ATRA 2OZUA 2GIVA 1BO4A 2X7BA 1KUYA 1CM0A 2R1IA 1NE9A 3FIXA 1S7NA 2B3VA 2BL1A 3FRMA 1KZFA 4JXRA 2FL4A 2VBQA 4KLVA 4NEXA 2P0WA 3TFYA 2PR8A 3SXNA 5F48A 1BOBA 3SHPA 3KKWA 4BMHA 3JVNA 4FD7A 3IWGA 1CJWA 4HNYB 4KOYA 4H89A 1MJBA 4UWJA 4UWIA 2VXKA 2EUIA 1XMTA 3CXSA 4U5YA 2OZGA 5I0CA 2AJ6A 2B3UA 2J8NA 4QVTA 2ZW6A 3RYOA 1QSRA 5EBVA 1Y7RA 3D3SA 4FD6A 4NSQA 3LODA 3QAHA 3TT2A 4IUSA 2QMLA 2KCWA 4OLLA 4KLWA 4MY0A 2VI7A 1M44A 5KTCA 3I3GA 3R95A 3K9UA 4KVXA 4CRZB 3D2MA 3I9SA 3DSBA 4AG7A 2O28A 3N7ZA 2Y0MA 4PSXA 1J4JA 4DNCA 1RXTA 4KUAA 5ISVA 3GY9A 2Q0YA 4R57A 1Y9WA 4E0AA 3NE7A 3F0AA 2VEZA 2PDOA 4QB9A 4PK3A 3R9EA 2BEIA 2R98A 4XPKA 2BSWA 3BLNA 3FYNA 4KUBA 4OADA 4PV6A 2B58A 1QSMA 1VHSA 5DWMA 2PR1A 1Z4EA 4B5PB 4KORA 2F5IA 1XIXA 4PK2A 4H6UA 4CAWA 4ZBGA 4F6AA 5IV0A 2FCKA 4KVOE 5E96A 2Z11A 2JEVA 1QSTA 4J3GA 4JWPA 4KZTA 4CAXA 5H86A 5EC4A 3W6XA 5HH1A 3FBUA 2ZPAA 1M1DA 1KUXA 4MJ8A 2HUZA 2QECA 1S7KA 2EVNA 5HMNA 4YRHA 5DWNA 4U9YA 1YLEA 5C82A 1IIDA 3TO6A 3G3SA 2PQ8A 5JPHA 1YVOA 5IB0A 3GYAA 2C27A 2WPWA 3TOBA 4MBUA 4MI4A 3R9FA 2CNMA 2REEA 4KVME 5JQ4A 1PU9A 4HNWB 4B5OA 1YREA 3P2FA 3W91A 1RO5A 4FD4A 1QSOA 2B5GB 4KOWA 1NMTA 3OWCA 2ZW7A 4QBJA 2CY2A 4RS2A 1B87A 2OZHA 4IF5A 3TE4A 4K30A 1ON0A 3TO7A 5KTAA 1MJAA 1S7FA 4NXYA 4NCZA 3G8WA 2WPXA 1I1DA 2AE6A 2B4DB 3V8IA 3WR7A 1Z4RA 4JLYA 3SXOA 2ZXVA 4LUAA 3DDDA 1N71A 2REFA 1WK4A 2G0BA 3JUWA 4KOUA 4AVAA 3PP9A 1WWZA 2DXQA 3FB3A 3ZJ0A 2HV2A 3MGDA 3P2HA 3VWEA 2Q4YA 4L89A 3B8GA 1IYKA 4ONUA 2OH1A 1L0CA 3TTHA 1YGHA 2BUEA 5GCNA 2Z10A 1IICA 2FSRA 1SQHA 2JDDA 4UBRA 2D4OA 3E0KA 3EC4A 2J8RA 2GANA 4I49A 1S5KA 1S60A 1XF8A 2P6EA 3QB8A 2CNSA 4FD5A 1MK4A 4GS4A 1OZPA 3T90A 3DR6A 2OB0A 1I21A 1TIQA 5J8CA 1Q2CA 2G3TA 2ZW4A 2R8VA 2Q4VA 4F0YA 2NMTA 4QUSA 1Z9UA 4CS0B 4XPDB 5KTDA 1K4JA 4M3SA 3R96A 2PC1A 2QIRA 3TO9A 1M4GA 2CNTA 4MY3A 2A4NA 2GE3A 4PSWA 4XPDC 2Z0ZA 1I12A 3FNCA 4JXQA 2Q04A 1QSNA 1R57A 2OU2A 3D2PA 3VWDA 4R3LA 4B5PA 3F8KA 3D8PA 3H4QA 4E2AA 4AVBA 2P6FA 2K5TA 1YR0A
chains in the Genus database with same CATH superfamily
2PIZA 1VKCA 2GLFA 2Q43A 5JH9A 2FIWA 1YVKA 1ZG9A 2ZEMA 3FJUA 2QYVA 5AG4A 2PJ6A 1IYLA 1CP7A 1PCAA 1UWYA 2BO9A 3KQZA 4P6YA 3S6FA 1EE3P 4RI1A 4JZ0A 3NH8A 3I1UA 3LMSA 2AFUA 4MHZA 4BD9A 4CYPA 1ZG7A 2IJZA 4MRIA 1Y9KA 4YFJA 4LX9A 3KI9A 4UA3A 3R1KA 2ZOFA 2J8MA 3NH4A 4PQAA 4P4IA 3D66A 2V8DA 3BHXA 2FS5A 3GB0A 4U9ZA 5HVGA 3DNSA 4AG9A 4XNHB 4JJXA 2Q7BA 1CPXA 2Q44A 2QJ8A 2VQYA 2VZYA 4F9VA 5J8FA 3VATA 4FBEA 1P4NA 3DR8A 4P4FA 5G21A 3CT9A 1Z8TA 3EY5A 4NF1A 1YK3A 3BJ7A 3PEIA 3W6SA 4KOVA 4AVCA 3LD2A 4E8OA 2FVGA 4ZX9A 3BJ8A 1YSJA 4A31A 4CRYB 4QC6A 2FIAA 2JDCA 3GIUA 2EBJA 2O53A 2FE7A 2ARHA 2PSWA 2OR4A 4ORFA 3IWEA 4XNHC 4HNXB 1GHEA 7CPAA 3CXQA 3S6GA 2P6GA 2NSMA 1TF8A 1IB1E 4PXDA 4WWVA 3BI1A 5IB9A 4M6IA 4NGNA 2GLJA 4P45A 3BI0A 4R3KA 3GKRA 4MHNA 4ONWA 3EO4A 2ZW5A 4CGLA 3S6KA 1CPSA 1LRZA 4R87A 2Z3MA 5JGFA 3R9GA 2B5GA 2FXFA 5F49A 1F2PA 4MHYA 3SI1A 2I00A 1V0CA 1PUAA 5AG7A 3ZZIA 4XPLA 4ZY1A 1YX0A 1U6MA 2DPTA 4CGPA 1KWMA 3JRUA 4JD6A 2F7VA 4F0XA 5K8NA 4B11A 3FXTA 4Y49B 5F46A 4CAVA 3UY5A 1S3ZA 1KUVA 2G3AA 3PZJA 2BCOA 1Q2YA 2AFOA 1P0HA 3CPAA 4KS9A 3TOAA 4OC0A 1DTDA 2Z3LA 3PB4X 3CXPA 1XEBA 2IL4A 1TXRA 2B4DA 3K9TA 1XE4A 2HQYA 2VL1A 2Q4ZA 3C26A 4F8ZA 1NSLA 2JLMA 2XEGA 4OC4A 2B4BA 2ZELA 2WZNA 3IGRA 5CNPA 2H5MA 4M6HA 3S6HA 2RC4A 3V38A 3FF3A 2CIJA 2PRBA 2R7HA 3F5BA 2G9DA 1M4DA 3PB6X 4RN7A 4Y49C 1Q2DA 4P4DA 4L8AA 4KOSA 4YGOA 3T9YA 3EXNA 4AB7A 4M85A 4MHDA 5LRKA 3VH9A 2FT0A 2QVPA 4NFRA 4X5KA 1F57A 2RFHA 3SJXA 1S7LA 3GLJA 4OP4A 1MJ9A 2D4PA 4KOTA 4UFVA 3SJGA 5IX3A 4HKFA 4IHMA 1FY7A 4H6ZA 2F8HA 2ZEHA 2VZZA 1XFOA 4LQ6A 4H2KA 1Z8XA 4IK2A 4R9MA 3MRUA 5F47A 1TKJA 3EFAA 3L2NA 4EVYA 5H84A 2Q51A 3PB7X 1M4IA 3TCVA 2IMOA 4FUUA 4ZY2A 4CAEA 1LAMA 2I79A 1DE4C 4II9A 1B6BA 5FVJA 4OAEA 3IFEA 4OIWA 3PGPA 1UFHA 4KOXA 1PYTB 4O23A 4EWTA 2V8GA 2ATRA 1VGYA 2ZOGA 2OZUA 4PXBA 2V77A 4UF4A 3RAMA 2GIVA 1BO4A 2X7BA 1KUYA 2YNDA 3FECA 1CM0A 2R1IA 1ZG8A 4CAFA 1NE9A 2YNCC 3PRTA 2PVWA 1XRYA 3DGVA 1S7NA 3FIXA 2B3VA 2BL1A 5LRJA 3FRMA 3TC8A 1KZFA 4JXRA 3IJ3A 4W9YA 2FL4A 3FVLA 3RO0A 4M6GA 2VBQA 4C2YA 4KLVA 4NEXA 4UFWA 2C6CA 4B13A 1Y7EA 4Q36A 4GXHA 4KSFA 4CYNA 2P0WA 3IO1A 4Q38A 4X3RA 4AXVA 3TFYA 3D7GA 4MCRA 2YNEA 5G1ZA 5JM6A 5CPAA 4DUKA 4C2ZA 4NGMA 2PR8A 2PJBA 3SXNA 3HLPA 5F48A 1BOBA 1BAVA 3SHPA 3KKWA 4OC3A 4BMHA 3IEHA 3JVNA 5A28A 3JTKA 4FD7A 2JBJA 4R8FA 3IWGA 5AGEA 4B10A 2ZEFA 1CJWA 4HNYB 4OIDA 4KOYA 1CX8A 2ZEDA 1MJBA 4H89A 4FWUA 4UWJA 4OMEA 4UWIA 4TNUA 3ISZA 4G1PA 2VXKA 2EUIA 1XMTA 3CXSA 4LQGA 2OZGA 2PJ9A 2PIYA 4U5YA 5EMIA 4RUHA 5I0CA 2AJ6A 2B3UA 2J8NA 2YGWA 4QVTA 2ZW6A 5AG6A 5C88A 4UCNA 3RYOA 1QSRA 2POKA 3IU1A 1Y7RA 2HC9A 2ZEOA 3D3SA 5EBVA 2CF4A 1Z5RA 3WT4A 4FD6A 4A33A 4A30A 5LYIA 4NSQA 3HUVA 3LODA 3QAHA 4Q7AA 3TT2A 4IUSA 4MFPA 2QMLA 2KCWA 2Z3PA 3KHZA 4OLLA 4KLWA 4MY0A 4R76A 2VI7A 4PXEA 3SJEA 1M44A 5KTCA 3B3VA 3I3GA 2PJ1A 3R95A 3K9UA 4KVXA 4CRZB 3D2MA 3I9SA 3DSBA 2Z3NA 4ZGYB 3H8GA 2DF5A 2O28A 3N7ZA 4AG7A 5BWAB 2Y0MA 4PSXA 1J4JA 4DNCA 1RXTA 3PFEA 4KUAA 5ISVA 8CPAA 1YMEA 3GY9A 1AUGA 2Q0YA 1F2OA 1IGBA 1R43A 4R57A 5I4MA 4B6ZA 4NGTA 1Y9WA 2C6PA 3FEEA 4MXUA 4E0AA 3NE7A 3F0AA 3B3TA 2VEZA 1Z8WA 2PDOA 4ZI6A 3PBBA 1Z8LA 4QB9A 4PK3A 5G22A 3R9EA 2BEIA 2R98A 4UEFA 5J1QA 1LOKA 4XPKA 1TF9A 1M4LA 4R7MA 1XOVA 1IY7A 3KHXA 2BSWA 1Q7LA 3BLNA 3FYNA 3KL9A 4KUBA 4OADA 4PV6A 4HPSA 2B58A 5THWA 1XBUA 1QSMA 3B2YA 1VHSA 4UFXA 1ZO0A 5K8PA 5DWMA 2ZEPA 2Z3OA 4OC1A 3CDXA 3KZWA 3S9LA 3SI2A 2PR1A 5G20A 3NH5A 1CP6A 1Z4EA 3D4UA 4B5PB 4KORA 4OKOA 2F5IA 3S9MA 5A27A 1HDQA 1XIXA 4PK2A 4H6UA 3KR5A 4CAWA 4ZBGA 4DYOA 4Z65A 5F09A 4UIAA 4F6AA 5IV0A 2XEJA 3S9NA 2FCKA 4KVOE 2GU2A 4MCSA 2Z11A 5E96A 1IOIA 2JEVA 3H8FA 1QSTA 1GYTA 4J3GA 4A37A 5HXDA 4JWPA 4KZTA 4CAXA 1VIXA 5H86A 5EC4A 3W6XA 5HVHA 3PB9X 4MCPA 2ANPA 3D7FA 3PBEA 3CZXA 4UCPA 5HH1A 1YW6A 4C2XA 3FBUA 5CBMA 2ZPAA 1M1DA 1QQ9A 4NJRA 1KUXA 2ODFA 4MJ8A 2HUZA 4CGMA 2QECA 4CYOA 1ELMP 1S7KA 2EVNA 5HMNA 1YLOA 2ZENA 4YRHA 3FH4A 4EFDA 5DWNA 4F9UA 4U9YA 1YLEA 2I3CA 3D7DA 3H5ZA 4MCQA 4P44A 1IIDA 5C82A 3RNZA 3TO6A 3G3SA 1BPNA 1IOFA 2PQ8A 4MFKA 5JPHA 4P10A 1YVOA 5IB0A 3RBUA 3GYAA 2C27A 2NYQA 5LYDA 2EO8A 2WPWA 3D67A 3TOBA 5LYFA 1X10A 4MBUA 4MFJA 4MI4A 4NGQA 3R9FA 4X2TA 4MFLA 4CPAA 2CNMA 4C7HA 1IU8A 2REEA 4KVME 4KSAA 3LACA 5JQ4A 3NA6A 1PU9A 4HNWB 4B5OA 1XMBA 2RB7A 2ZEEA 1YREA 2Z3KA 4NGPA 3P2FA 1AYEA 3W91A 4CGNA 1RO5A 1YQEA 4FD4A 1QSOA 2B5GB 4PXCA 4KOWA 1FNOA 2C6GA 1NMTA 2PJ3A 2PJAA 2ZW7A 3OWCA 4FAIA 1ZLIA 4QBJA 5D8NA 2CY2A 1CG2A 1B87A 2ABZA 2OZHA 2YNCA 3B3CA 3QNVA 4IF5A 4RS2A 5LRGA 2EK8A 1QMUA 4TWEA 4YWYA 1NSAA 1YW4A 3TE4A 2V8HA 3FEDA 4K30A 4NJQA 1ON0A 3TO7A 4A94A 2IQ6A 3WC5A 5KTAA 1MJAA 1S7FA 4NXYA 2OOTA 4NCZA 3G8WA 2WPXA 1I1DA 2AE6A 2B4DB 1VHOA 3ISXA 3V8IA 3WR7A 1Z4RA 4JYWA 4YU9A 4JLYA 1TKHA 1Y0RA 5HVFA 2ZXVA 4IAVA 4LUAA 3DDDA 3SXOA 4DJLA 3WC7A 1N71A 2REFA 1WK4A 2G0BA 3IWWA 2AFSA 3JUWA 4KOUA 3V7ZA 4ZYQA 4AVAA 3PP9A 4MFZA 4MHPA 2J9AA 4BBHA 1RTQA 4MFQA 1WWZA 2DXQA 2ZEGA 2PE3A 3QAYA 5D29A 3FB3A 3ZJ0A 2HV2A 1Z2LA 3MGDA 3P2HA 3VWEA 2Q4YA 4L89A 3B8GA 1HEEA 2PJ2A 3GUXA 4UEZA 1IYKA 3K2KA 4ONUA 3IIBA 2WUUA 1R3NA 3KASA 3PFOA 3D68A 2OH1A 1CBXA 1L0CA 3TTHA 5AG5A 2PJ5A 2CTBA 1YGHA 2WSAA 4A39A 2XEIA 1ZLHA 3SJFA 2BUEA 3SI0A 5GCNA 2Z10A 2PJCA 4K3NA 4UIBA 1IICA 3WC6A 2AFMA 2FSRA 1SQHA 4GM5A 2JDDA 3KGQA 1JWQA 4UBRA 2D4OA 2DEAA 3E0KA 4P4EA 3EC4A 2J8RA 2XEFA 1ARMA 5ELYA 2GANA 2JBKA 4I49A 2GREA 2C1CA 3D7HA 1S5KA 1S60A 3IU2A 1XF8A 2P6EA 3QB8A 2CNSA 4FD5A 5K8OA 1MK4A 4GS4A 3B3SA 3PB8X 2PJ7A 1OZPA 3DLJA 1A2ZA 3IC1A 3T90A 3DR6A 3NFZA 2OB0A 2GFQA 1I21A 4CYQA 2EK9A 1TIQA 1ARLA 2CTCA 5J8CA 4A32A 2PJ4A 4A2ZA 1AMPA 4X8IA 1Q2CA 2O4HA 2G3TA 1LANA 2ZW4A 3H8EA 2R8VA 1H8LA 2Q4VA 2PJ8A 4F0YA 5DS0A 3B35A 2NMTA 1LCPA 4NGSA 1BLLE 1Z9UA 1TKFA 4P4JA 2AFWA 4QUSA 4CS0B 3VARA 1Y0YA 2PCUA 4XPDB 4BINA 5KTDA 3N5FA 1K4JA 3LWUA 3T8WA 1JQGA 2Q7SA 1LAPA 3B3WA 4M3SA 4ZX8A 3R96A 4WJBA 2PC1A 4OC5A 4KSIA 2QIRA 1FT7A 3WABA 3TO9A 2PRQA 1M4GA 4PPZA 6CPAA 4ZY0A 4A38A 2CNTA 3CPXA 4MY3A 1OBRA 3FX6A 2A4NA 3MN8A 2V8VA 3KR4A 3A9LA 3BXMA 1VHEA 2GE3A 3FMCA 4PSWA 4XPDC 4B14A 4NGRA 4EMEA 4R6TA 3TX8A 1XJOA 2Z0ZA 4B12A 2DPSA 5LYLA 1I12A 5K8MA 2CXAA 2PJ0A 3FNCA 2WYRA 2PVVA 4JXQA 2Q04A 1QSNA 1R57A 2AFXA 2OU2A 3D2PA 4MMOA 4A95A 1BPMA 3VWDA 2JEWA 4R3LA 4C7IA 1LFWA 4B5PA 3F8KA 4C68A 2AFZA 3KQXA 3D8PA 3B7IA 1X12A 3H4QA 1HDUA 4E2AA 4OC2A 4UCMA 1ELLP 2BOAA 2EWBA 3RZAA 4AVBA 3NE8A 4P4BA 2P6FA 2K5TA 4CGOA 1YR0A 4UEEA 2HB6A
chains in the Genus database with same CATH topology
1VKCA 2FIWA 1YVKA 5AG4A 5C88A 1IYLA 3S6FA 4RI1A 4CYPA 1Y9KA 4YFJA 4LX9A 4UA3A 3R1KA 2J8MA 2FS5A 4U9ZA 3DNSA 4AG9A 4XNHB 4JJXA 2Q7BA 2Q44A 2VZYA 2VQYA 5J8FA 1P4NA 3DR8A 5G21A 3EY5A 4NF1A 1YK3A 3BJ7A 3W6SA 4KOVA 4AVCA 3LD2A 4E8OA 3BJ8A 4A31A 4CRYB 4QC6A 2FIAA 2JDCA 2FE7A 2ARHA 2PSWA 4ORFA 4XNHC 3IWEA 4HNXB 1GHEA 3CXQA 3S6GA 2P6GA 1IB1E 4R3KA 3GKRA 3EO4A 2ZW5A 4CGLA 3S6KA 1LRZA 4R87A 2Z3MA 3R9GA 2B5GA 2FXFA 5F49A 2I00A 1V0CA 1PUAA 5AG7A 3ZZIA 4XPLA 1YX0A 1U6MA 2DPTA 4CGPA 4F0XA 4JD6A 4B11A 3FXTA 4Y49B 5F46A 4CAVA 3UY5A 1S3ZA 1KUVA 2G3AA 3PZJA 1Q2YA 1P0HA 4KS9A 3TOAA 2Z3LA 3CXPA 1XEBA 2IL4A 2B4DA 1XE4A 2HQYA 3C26A 1NSLA 2JLMA 2B4BA 5CNPA 3IGRA 2H5MA 3S6HA 2RC4A 4Y49C 2PRBA 2R7HA 3F5BA 1M4DA 1Q2DA 4YGOA 4L8AA 4KOSA 3T9YA 3EXNA 4AB7A 4M85A 4MHDA 2FT0A 4X5KA 1S7LA 1MJ9A 2D4PA 4KOTA 4UFVA 5IX3A 4HKFA 1FY7A 4H6ZA 2VZZA 4R9MA 5F47A 3EFAA 4EVYA 5H84A 1M4IA 3TCVA 4CAEA 2I79A 4II9A 1B6BA 5FVJA 4OAEA 3PGPA 1UFHA 4KOXA 2ATRA 2OZUA 2GIVA 1BO4A 2X7BA 1KUYA 2YNDA 1CM0A 2R1IA 4CAFA 1NE9A 2YNCC 3FIXA 1S7NA 2B3VA 2BL1A 3FRMA 1KZFA 4JXRA 2FL4A 2VBQA 4C2YA 4KLVA 4NEXA 4UFWA 4B13A 4Q36A 4KSFA 4CYNA 2P0WA 4Q38A 3TFYA 2YNEA 5G1ZA 4C2ZA 2PR8A 3SXNA 5F48A 1BOBA 3SHPA 3KKWA 4BMHA 3JVNA 5A28A 3JTKA 4FD7A 5AGEA 3IWGA 4B10A 1CJWA 4HNYB 4KOYA 4H89A 1MJBA 4UWJA 4UWIA 2VXKA 2EUIA 1XMTA 3CXSA 4U5YA 2OZGA 5I0CA 2AJ6A 2B3UA 2J8NA 2YGWA 4QVTA 2ZW6A 5AG6A 4UCNA 3RYOA 1QSRA 3IU1A 1Y7RA 3D3SA 5EBVA 4A33A 4FD6A 4NSQA 3LODA 3QAHA 3TT2A 4IUSA 4MFPA 2QMLA 2KCWA 2Z3PA 4OLLA 4KLWA 4MY0A 2VI7A 1M44A 5KTCA 3I3GA 3R95A 3K9UA 4KVXA 4CRZB 3D2MA 3I9SA 3DSBA 2Z3NA 4ZGYB 4AG7A 2O28A 3N7ZA 5BWAB 2Y0MA 4PSXA 1J4JA 4DNCA 1RXTA 4KUAA 5ISVA 3GY9A 2Q0YA 4R57A 1Y9WA 4E0AA 3NE7A 3F0AA 2VEZA 2PDOA 4QB9A 4PK3A 5G22A 3R9EA 2BEIA 2R98A 4XPKA 2BSWA 3BLNA 3FYNA 4KUBA 4OADA 4PV6A 2B58A 1QSMA 1VHSA 4UFXA 1ZO0A 5DWMA 2Z3OA 2PR1A 5G20A 1Z4EA 4B5PB 5A27A 4KORA 2F5IA 1XIXA 4PK2A 4H6UA 4CAWA 4ZBGA 4F6AA 5IV0A 2FCKA 4KVOE 5E96A 2Z11A 2JEVA 1QSTA 4J3GA 4JWPA 4KZTA 4CAXA 5H86A 5EC4A 3W6XA 5HH1A 4UCPA 4C2XA 3FBUA 2ZPAA 1M1DA 1KUXA 4MJ8A 4CGMA 2HUZA 4CYOA 2QECA 1S7KA 2EVNA 5HMNA 4YRHA 5DWNA 4U9YA 1YLEA 3H5ZA 5C82A 1IIDA 3TO6A 3G3SA 2PQ8A 4MFKA 5JPHA 1YVOA 5IB0A 3GYAA 2C27A 2WPWA 3TOBA 4MBUA 4MFJA 4MI4A 3R9FA 4MFLA 2CNMA 4C7HA 2REEA 4KVME 4KSAA 5JQ4A 1PU9A 4HNWB 4B5OA 1YREA 2Z3KA 3P2FA 3W91A 4CGNA 1RO5A 4FD4A 1QSOA 2B5GB 4KOWA 1NMTA 3OWCA 2ZW7A 4QBJA 2YNCA 2CY2A 1B87A 2OZHA 4RS2A 4IF5A 3TE4A 4K30A 1ON0A 3TO7A 5KTAA 1MJAA 1S7FA 4NXYA 4NCZA 3G8WA 2WPXA 1I1DA 2AE6A 2B4DB 3V8IA 3WR7A 1Z4RA 4JLYA 3SXOA 2ZXVA 4LUAA 3DDDA 1N71A 2REFA 1WK4A 2G0BA 3JUWA 4KOUA 4AVAA 3PP9A 4MFZA 4BBHA 4MFQA 1WWZA 2DXQA 3FB3A 3ZJ0A 2HV2A 3MGDA 3P2HA 3VWEA 2Q4YA 4L89A 3B8GA 1IYKA 4ONUA 2WUUA 2OH1A 1L0CA 3TTHA 5AG5A 2WSAA 1YGHA 2BUEA 5GCNA 2Z10A 1IICA 2FSRA 1SQHA 2JDDA 4UBRA 2D4OA 3E0KA 3EC4A 2J8RA 2GANA 4I49A 1S5KA 1S60A 3IU2A 1XF8A 2P6EA 3QB8A 2CNSA 4FD5A 1MK4A 4GS4A 1OZPA 3T90A 3DR6A 2OB0A 1I21A 4CYQA 1TIQA 5J8CA 4A32A 4A2ZA 1Q2CA 2G3TA 2ZW4A 2R8VA 2Q4VA 4F0YA 2NMTA 4QUSA 1Z9UA 4CS0B 4XPDB 5KTDA 1K4JA 4M3SA 3R96A 2PC1A 2QIRA 3TO9A 1M4GA 2CNTA 4MY3A 2A4NA 4B14A 3A9LA 2GE3A 4PSWA 4XPDC 2Z0ZA 4B12A 2DPSA 1I12A 2CXAA 3FNCA 4JXQA 2Q04A 1QSNA 1R57A 2OU2A 3D2PA 4A95A 3VWDA 4R3LA 4C7IA 4B5PA 3F8KA 4C68A 3D8PA 3H4QA 4E2AA 4UCMA 4AVBA 4A30A 2P6FA 2K5TA 4CGOA 1YR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VKC A;  2FIW A;  1YVK A;  5C88 A;  1IYL A;  3S6F A;  4RI1 A;  1Y9K A;  4YFJ A;  4LX9 A;  4UA3 A;  3R1K A;  2J8M A;  2FS5 A;  4U9Z A;  3DNS A;  4AG9 A;  4XNH B;  4JJX A;  2Q7B A;  2Q44 A;  2VZY A;  2VQY A;  5J8F A;  1P4N A;  3DR8 A;  3EY5 A;  4NF1 A;  1YK3 A;  3BJ7 A;  3W6S A;  4KOV A;  4AVC A;  3LD2 A;  4E8O A;  3BJ8 A;  4CRY B;  4QC6 A;  2FIA A;  2JDC A;  2FE7 A;  2ARH A;  2PSW A;  4ORF A;  4XNH C;  4HNX B;  1GHE A;  3CXQ A;  3S6G A;  2P6G A;  1IB1 E;  4R3K A;  3GKR A;  3EO4 A;  2ZW5 A;  3S6K A;  1LRZ A;  4R87 A;  3R9G A;  2B5G A;  2FXF A;  5F49 A;  2I00 A;  1V0C A;  1PUA A;  3ZZI A;  4XPL A;  1YX0 A;  1U6M A;  4JD6 A;  5F46 A;  3FXT A;  4Y49 B;  4CAV A;  3UY5 A;  1S3Z A;  1KUV A;  2G3A A;  3PZJ A;  1Q2Y A;  1P0H A;  3TOA A;  3CXP A;  1XEB A;  2IL4 A;  2B4D A;  1XE4 A;  2HQY A;  3C26 A;  1NSL A;  2JLM A;  2B4B A;  5CNP A;  3IGR A;  2H5M A;  3S6H A;  2RC4 A;  4Y49 C;  2PRB A;  2R7H A;  3F5B A;  1M4D A;  1Q2D A;  4YGO A;  4L8A A;  4KOS A;  3T9Y A;  3EXN A;  4AB7 A;  4M85 A;  4MHD A;  2FT0 A;  4X5K A;  1S7L A;  1MJ9 A;  2D4P A;  4KOT A;  5IX3 A;  4HKF A;  1FY7 A;  4H6Z A;  2VZZ A;  4R9M A;  5F47 A;  3EFA A;  4EVY A;  5H84 A;  1M4I A;  3TCV A;  2I79 A;  4II9 A;  1B6B A;  5FVJ A;  4OAE A;  3PGP A;  1UFH A;  4KOX A;  2ATR A;  2OZU A;  2GIV A;  1BO4 A;  2X7B A;  1KUY A;  1CM0 A;  2R1I A;  1NE9 A;  3FIX A;  1S7N A;  2B3V A;  2BL1 A;  3FRM A;  1KZF A;  4JXR A;  2FL4 A;  2VBQ A;  4KLV A;  4NEX A;  2P0W A;  3TFY A;  2PR8 A;  3SXN A;  5F48 A;  1BOB A;  3SHP A;  3KKW A;  4BMH A;  3JVN A;  4FD7 A;  3IWG A;  1CJW A;  4HNY B;  4KOY A;  4H89 A;  1MJB A;  4UWJ A;  4UWI A;  2VXK A;  2EUI A;  1XMT A;  3CXS A;  4U5Y A;  2OZG A;  5I0C A;  2AJ6 A;  2B3U A;  2J8N A;  4QVT A;  2ZW6 A;  3RYO A;  1QSR A;  5EBV A;  1Y7R A;  3D3S A;  4FD6 A;  4NSQ A;  3LOD A;  3QAH A;  3TT2 A;  4IUS A;  2QML A;  2KCW A;  4OLL A;  4KLW A;  4MY0 A;  2VI7 A;  1M44 A;  5KTC A;  3I3G A;  3R95 A;  3K9U A;  4KVX A;  4CRZ B;  3D2M A;  3I9S A;  3DSB A;  4AG7 A;  2O28 A;  3N7Z A;  2Y0M A;  4PSX A;  1J4J A;  4DNC A;  1RXT A;  4KUA A;  5ISV A;  3GY9 A;  2Q0Y A;  4R57 A;  1Y9W A;  4E0A A;  3NE7 A;  3F0A A;  2VEZ A;  2PDO A;  4QB9 A;  4PK3 A;  3R9E A;  2BEI A;  2R98 A;  4XPK A;  2BSW A;  3BLN A;  3FYN A;  4KUB A;  4OAD A;  4PV6 A;  2B58 A;  1QSM A;  1VHS A;  5DWM A;  2PR1 A;  1Z4E A;  4B5P B;  4KOR A;  2F5I A;  1XIX A;  4PK2 A;  4H6U A;  4CAW A;  4ZBG A;  4F6A A;  5IV0 A;  2FCK A;  4KVO E;  5E96 A;  2Z11 A;  2JEV A;  1QST A;  4J3G A;  4JWP A;  4KZT A;  4CAX A;  5H86 A;  5EC4 A;  3W6X A;  5HH1 A;  3FBU A;  2ZPA A;  1M1D A;  1KUX A;  4MJ8 A;  2HUZ A;  2QEC A;  1S7K A;  2EVN A;  5HMN A;  4YRH A;  5DWN A;  4U9Y A;  1YLE A;  5C82 A;  1IID A;  3TO6 A;  3G3S A;  2PQ8 A;  5JPH A;  1YVO A;  5IB0 A;  3GYA A;  2C27 A;  2WPW A;  3TOB A;  4MBU A;  4MI4 A;  3R9F A;  2CNM A;  2REE A;  4KVM E;  5JQ4 A;  1PU9 A;  4HNW B;  4B5O A;  1YRE A;  3P2F A;  3W91 A;  1RO5 A;  4FD4 A;  1QSO A;  2B5G B;  4KOW A;  1NMT A;  3OWC A;  2ZW7 A;  4QBJ A;  2CY2 A;  4RS2 A;  1B87 A;  2OZH A;  4IF5 A;  3TE4 A;  4K30 A;  1ON0 A;  3TO7 A;  5KTA A;  1MJA A;  1S7F A;  4NXY A;  4NCZ A;  3G8W A;  2WPX A;  1I1D A;  2AE6 A;  2B4D B;  3V8I A;  3WR7 A;  1Z4R A;  4JLY A;  3SXO A;  2ZXV A;  4LUA A;  3DDD A;  1N71 A;  2REF A;  1WK4 A;  2G0B A;  3JUW A;  4KOU A;  4AVA A;  3PP9 A;  1WWZ A;  2DXQ A;  3FB3 A;  3ZJ0 A;  2HV2 A;  3MGD A;  3P2H A;  3VWE A;  2Q4Y A;  4L89 A;  3B8G A;  1IYK A;  4ONU A;  2OH1 A;  1L0C A;  3TTH A;  1YGH A;  2BUE A;  5GCN A;  2Z10 A;  1IIC A;  2FSR A;  1SQH A;  2JDD A;  4UBR A;  2D4O A;  3E0K A;  3EC4 A;  2J8R A;  2GAN A;  4I49 A;  1S5K A;  1S60 A;  1XF8 A;  2P6E A;  3QB8 A;  2CNS A;  4FD5 A;  1MK4 A;  4GS4 A;  1OZP A;  3T90 A;  3DR6 A;  2OB0 A;  1I21 A;  1TIQ A;  5J8C A;  1Q2C A;  2G3T A;  2ZW4 A;  2R8V A;  2Q4V A;  4F0Y A;  2NMT A;  4QUS A;  1Z9U A;  4CS0 B;  4XPD B;  5KTD A;  1K4J A;  4M3S A;  3R96 A;  2PC1 A;  2QIR A;  3TO9 A;  1M4G A;  2CNT A;  4MY3 A;  2A4N A;  2GE3 A;  4PSW A;  4XPD C;  2Z0Z A;  1I12 A;  3FNC A;  4JXQ A;  2Q04 A;  1QSN A;  1R57 A;  2OU2 A;  3D2P A;  3VWD A;  4R3L A;  4B5P A;  3F8K A;  3D8P A;  3H4Q A;  4E2A A;  4AVB A;  2P6F A;  2K5T A;  1YR0 A; 
#chains in the Genus database with same CATH topology
 2PIZ A;  1VKC A;  2GLF A;  2Q43 A;  5JH9 A;  2FIW A;  1YVK A;  1ZG9 A;  2ZEM A;  3FJU A;  2QYV A;  5AG4 A;  2PJ6 A;  1IYL A;  1CP7 A;  1PCA A;  1UWY A;  2BO9 A;  3KQZ A;  4P6Y A;  3S6F A;  1EE3 P;  4RI1 A;  4JZ0 A;  3NH8 A;  3I1U A;  3LMS A;  2AFU A;  4MHZ A;  4BD9 A;  4CYP A;  1ZG7 A;  2IJZ A;  4MRI A;  1Y9K A;  4YFJ A;  4LX9 A;  3KI9 A;  4UA3 A;  3R1K A;  2ZOF A;  2J8M A;  3NH4 A;  4PQA A;  4P4I A;  3D66 A;  2V8D A;  3BHX A;  2FS5 A;  3GB0 A;  4U9Z A;  5HVG A;  3DNS A;  4AG9 A;  4XNH B;  4JJX A;  2Q7B A;  1CPX A;  2Q44 A;  2QJ8 A;  2VQY A;  2VZY A;  4F9V A;  5J8F A;  3VAT A;  4FBE A;  1P4N A;  3DR8 A;  4P4F A;  5G21 A;  3CT9 A;  1Z8T A;  3EY5 A;  4NF1 A;  1YK3 A;  3BJ7 A;  3PEI A;  3W6S A;  4KOV A;  4AVC A;  3LD2 A;  4E8O A;  2FVG A;  4ZX9 A;  3BJ8 A;  1YSJ A;  4A31 A;  4CRY B;  4QC6 A;  2FIA A;  2JDC A;  3GIU A;  2EBJ A;  2O53 A;  2FE7 A;  2ARH A;  2PSW A;  2OR4 A;  4ORF A;  3IWE A;  4XNH C;  4HNX B;  1GHE A;  7CPA A;  3CXQ A;  3S6G A;  2P6G A;  2NSM A;  1TF8 A;  1IB1 E;  4PXD A;  4WWV A;  3BI1 A;  5IB9 A;  4M6I A;  4NGN A;  2GLJ A;  4P45 A;  3BI0 A;  4R3K A;  3GKR A;  4MHN A;  4ONW A;  3EO4 A;  2ZW5 A;  4CGL A;  3S6K A;  1CPS A;  1LRZ A;  4R87 A;  2Z3M A;  5JGF A;  3R9G A;  2B5G A;  2FXF A;  5F49 A;  1F2P A;  4MHY A;  3SI1 A;  2I00 A;  1V0C A;  1PUA A;  5AG7 A;  3ZZI A;  4XPL A;  4ZY1 A;  1YX0 A;  1U6M A;  2DPT A;  4CGP A;  1KWM A;  3JRU A;  4JD6 A;  2F7V A;  4F0X A;  5K8N A;  4B11 A;  3FXT A;  4Y49 B;  5F46 A;  4CAV A;  3UY5 A;  1S3Z A;  1KUV A;  2G3A A;  3PZJ A;  2BCO A;  1Q2Y A;  2AFO A;  1P0H A;  3CPA A;  4KS9 A;  3TOA A;  4OC0 A;  1DTD A;  2Z3L A;  3PB4 X;  3CXP A;  1XEB A;  2IL4 A;  1TXR A;  2B4D A;  3K9T A;  1XE4 A;  2HQY A;  2VL1 A;  2Q4Z A;  3C26 A;  4F8Z A;  1NSL A;  2JLM A;  2XEG A;  4OC4 A;  2B4B A;  2ZEL A;  2WZN A;  3IGR A;  5CNP A;  2H5M A;  4M6H A;  3S6H A;  2RC4 A;  3V38 A;  3FF3 A;  2CIJ A;  2PRB A;  2R7H A;  3F5B A;  2G9D A;  1M4D A;  3PB6 X;  4RN7 A;  4Y49 C;  1Q2D A;  4P4D A;  4L8A A;  4KOS A;  4YGO A;  3T9Y A;  3EXN A;  4AB7 A;  4M85 A;  4MHD A;  5LRK A;  3VH9 A;  2FT0 A;  2QVP A;  4NFR A;  4X5K A;  1F57 A;  2RFH A;  3SJX A;  1S7L A;  3GLJ A;  4OP4 A;  1MJ9 A;  2D4P A;  4KOT A;  4UFV A;  3SJG A;  5IX3 A;  4HKF A;  4IHM A;  1FY7 A;  4H6Z A;  2F8H A;  2ZEH A;  2VZZ A;  1XFO A;  4LQ6 A;  4H2K A;  1Z8X A;  4IK2 A;  4R9M A;  3MRU A;  5F47 A;  1TKJ A;  3EFA A;  3L2N A;  4EVY A;  5H84 A;  2Q51 A;  3PB7 X;  1M4I A;  3TCV A;  2IMO A;  4FUU A;  4ZY2 A;  4CAE A;  1LAM A;  2I79 A;  1DE4 C;  4II9 A;  1B6B A;  5FVJ A;  4OAE A;  3IFE A;  4OIW A;  3PGP A;  1UFH A;  4KOX A;  1PYT B;  4O23 A;  4EWT A;  2V8G A;  2ATR A;  1VGY A;  2ZOG A;  2OZU A;  4PXB A;  2V77 A;  4UF4 A;  3RAM A;  2GIV A;  1BO4 A;  2X7B A;  1KUY A;  2YND A;  3FEC A;  1CM0 A;  2R1I A;  1ZG8 A;  4CAF A;  1NE9 A;  2YNC C;  3PRT A;  2PVW A;  1XRY A;  3DGV A;  1S7N A;  3FIX A;  2B3V A;  2BL1 A;  5LRJ A;  3FRM A;  3TC8 A;  1KZF A;  4JXR A;  3IJ3 A;  4W9Y A;  2FL4 A;  3FVL A;  3RO0 A;  4M6G A;  2VBQ A;  4C2Y A;  4KLV A;  4NEX A;  4UFW A;  2C6C A;  4B13 A;  1Y7E A;  4Q36 A;  4GXH A;  4KSF A;  4CYN A;  2P0W A;  3IO1 A;  4Q38 A;  4X3R A;  4AXV A;  3TFY A;  3D7G A;  4MCR A;  2YNE A;  5G1Z A;  5JM6 A;  5CPA A;  4DUK A;  4C2Z A;  4NGM A;  2PR8 A;  2PJB A;  3SXN A;  3HLP A;  5F48 A;  1BOB A;  1BAV A;  3SHP A;  3KKW A;  4OC3 A;  4BMH A;  3IEH A;  3JVN A;  5A28 A;  3JTK A;  4FD7 A;  2JBJ A;  4R8F A;  3IWG A;  5AGE A;  4B10 A;  2ZEF A;  1CJW A;  4HNY B;  4OID A;  4KOY A;  1CX8 A;  2ZED A;  1MJB A;  4H89 A;  4FWU A;  4UWJ A;  4OME A;  4UWI A;  4TNU A;  3ISZ A;  4G1P A;  2VXK A;  2EUI A;  1XMT A;  3CXS A;  4LQG A;  2OZG A;  2PJ9 A;  2PIY A;  4U5Y A;  5EMI A;  4RUH A;  5I0C A;  2AJ6 A;  2B3U A;  2J8N A;  2YGW A;  4QVT A;  2ZW6 A;  5AG6 A;  5C88 A;  4UCN A;  3RYO A;  1QSR A;  2POK A;  3IU1 A;  1Y7R A;  2HC9 A;  2ZEO A;  3D3S A;  5EBV A;  2CF4 A;  1Z5R A;  3WT4 A;  4FD6 A;  4A33 A;  4A30 A;  5LYI A;  4NSQ A;  3HUV A;  3LOD A;  3QAH A;  4Q7A A;  3TT2 A;  4IUS A;  4MFP A;  2QML A;  2KCW A;  2Z3P A;  3KHZ A;  4OLL A;  4KLW A;  4MY0 A;  4R76 A;  2VI7 A;  4PXE A;  3SJE A;  1M44 A;  5KTC A;  3B3V A;  3I3G A;  2PJ1 A;  3R95 A;  3K9U A;  4KVX A;  4CRZ B;  3D2M A;  3I9S A;  3DSB A;  2Z3N A;  4ZGY B;  3H8G A;  2DF5 A;  2O28 A;  3N7Z A;  4AG7 A;  5BWA B;  2Y0M A;  4PSX A;  1J4J A;  4DNC A;  1RXT A;  3PFE A;  4KUA A;  5ISV A;  8CPA A;  1YME A;  3GY9 A;  1AUG A;  2Q0Y A;  1F2O A;  1IGB A;  1R43 A;  4R57 A;  5I4M A;  4B6Z A;  4NGT A;  1Y9W A;  2C6P A;  3FEE A;  4MXU A;  4E0A A;  3NE7 A;  3F0A A;  3B3T A;  2VEZ A;  1Z8W A;  2PDO A;  4ZI6 A;  3PBB A;  1Z8L A;  4QB9 A;  4PK3 A;  5G22 A;  3R9E A;  2BEI A;  2R98 A;  4UEF A;  5J1Q A;  1LOK A;  4XPK A;  1TF9 A;  1M4L A;  4R7M A;  1XOV A;  1IY7 A;  3KHX A;  2BSW A;  1Q7L A;  3BLN A;  3FYN A;  3KL9 A;  4KUB A;  4OAD A;  4PV6 A;  4HPS A;  2B58 A;  5THW A;  1XBU A;  1QSM A;  3B2Y A;  1VHS A;  4UFX A;  1ZO0 A;  5K8P A;  5DWM A;  2ZEP A;  2Z3O A;  4OC1 A;  3CDX A;  3KZW A;  3S9L A;  3SI2 A;  2PR1 A;  5G20 A;  3NH5 A;  1CP6 A;  1Z4E A;  3D4U A;  4B5P B;  4KOR A;  4OKO A;  2F5I A;  3S9M A;  5A27 A;  1HDQ A;  1XIX A;  4PK2 A;  4H6U A;  3KR5 A;  4CAW A;  4ZBG A;  4DYO A;  4Z65 A;  5F09 A;  4UIA A;  4F6A A;  5IV0 A;  2XEJ A;  3S9N A;  2FCK A;  4KVO E;  2GU2 A;  4MCS A;  2Z11 A;  5E96 A;  1IOI A;  2JEV A;  3H8F A;  1QST A;  1GYT A;  4J3G A;  4A37 A;  5HXD A;  4JWP A;  4KZT A;  4CAX A;  1VIX A;  5H86 A;  5EC4 A;  3W6X A;  5HVH A;  3PB9 X;  4MCP A;  2ANP A;  3D7F A;  3PBE A;  3CZX A;  4UCP A;  5HH1 A;  1YW6 A;  4C2X A;  3FBU A;  5CBM A;  2ZPA A;  1M1D A;  1QQ9 A;  4NJR A;  1KUX A;  2ODF A;  4MJ8 A;  2HUZ A;  4CGM A;  2QEC A;  4CYO A;  1ELM P;  1S7K A;  2EVN A;  5HMN A;  1YLO A;  2ZEN A;  4YRH A;  3FH4 A;  4EFD A;  5DWN A;  4F9U A;  4U9Y A;  1YLE A;  2I3C A;  3D7D A;  3H5Z A;  4MCQ A;  4P44 A;  1IID A;  5C82 A;  3RNZ A;  3TO6 A;  3G3S A;  1BPN A;  1IOF A;  2PQ8 A;  4MFK A;  5JPH A;  4P10 A;  1YVO A;  5IB0 A;  3RBU A;  3GYA A;  2C27 A;  2NYQ A;  5LYD A;  2EO8 A;  2WPW A;  3D67 A;  3TOB A;  5LYF A;  1X10 A;  4MBU A;  4MFJ A;  4MI4 A;  4NGQ A;  3R9F A;  4X2T A;  4MFL A;  4CPA A;  2CNM A;  4C7H A;  1IU8 A;  2REE A;  4KVM E;  4KSA A;  3LAC A;  5JQ4 A;  3NA6 A;  1PU9 A;  4HNW B;  4B5O A;  1XMB A;  2RB7 A;  2ZEE A;  1YRE A;  2Z3K A;  4NGP A;  3P2F A;  1AYE A;  3W91 A;  4CGN A;  1RO5 A;  1YQE A;  4FD4 A;  1QSO A;  2B5G B;  4PXC A;  4KOW A;  1FNO A;  2C6G A;  1NMT A;  2PJ3 A;  2PJA A;  2ZW7 A;  3OWC A;  4FAI A;  1ZLI A;  4QBJ A;  5D8N A;  2CY2 A;  1CG2 A;  1B87 A;  2ABZ A;  2OZH A;  2YNC A;  3B3C A;  3QNV A;  4IF5 A;  4RS2 A;  5LRG A;  2EK8 A;  1QMU A;  4TWE A;  4YWY A;  1NSA A;  1YW4 A;  3TE4 A;  2V8H A;  3FED A;  4K30 A;  4NJQ A;  1ON0 A;  3TO7 A;  4A94 A;  2IQ6 A;  3WC5 A;  5KTA A;  1MJA A;  1S7F A;  4NXY A;  2OOT A;  4NCZ A;  3G8W A;  2WPX A;  1I1D A;  2AE6 A;  2B4D B;  1VHO A;  3ISX A;  3V8I A;  3WR7 A;  1Z4R A;  4JYW A;  4YU9 A;  4JLY A;  1TKH A;  1Y0R A;  5HVF A;  2ZXV A;  4IAV A;  4LUA A;  3DDD A;  3SXO A;  4DJL A;  3WC7 A;  1N71 A;  2REF A;  1WK4 A;  2G0B A;  3IWW A;  2AFS A;  3JUW A;  4KOU A;  3V7Z A;  4ZYQ A;  4AVA A;  3PP9 A;  4MFZ A;  4MHP A;  2J9A A;  4BBH A;  1RTQ A;  4MFQ A;  1WWZ A;  2DXQ A;  2ZEG A;  2PE3 A;  3QAY A;  5D29 A;  3FB3 A;  3ZJ0 A;  2HV2 A;  1Z2L A;  3MGD A;  3P2H A;  3VWE A;  2Q4Y A;  4L89 A;  3B8G A;  1HEE A;  2PJ2 A;  3GUX A;  4UEZ A;  1IYK A;  3K2K A;  4ONU A;  3IIB A;  2WUU A;  1R3N A;  3KAS A;  3PFO A;  3D68 A;  2OH1 A;  1CBX A;  1L0C A;  3TTH A;  5AG5 A;  2PJ5 A;  2CTB A;  1YGH A;  2WSA A;  4A39 A;  2XEI A;  1ZLH A;  3SJF A;  2BUE A;  3SI0 A;  5GCN A;  2Z10 A;  2PJC A;  4K3N A;  4UIB A;  1IIC A;  3WC6 A;  2AFM A;  2FSR A;  1SQH A;  4GM5 A;  2JDD A;  3KGQ A;  1JWQ A;  4UBR A;  2D4O A;  2DEA A;  3E0K A;  4P4E A;  3EC4 A;  2J8R A;  2XEF A;  1ARM A;  5ELY A;  2GAN A;  2JBK A;  4I49 A;  2GRE A;  2C1C A;  3D7H A;  1S5K A;  1S60 A;  3IU2 A;  1XF8 A;  2P6E A;  3QB8 A;  2CNS A;  4FD5 A;  5K8O A;  1MK4 A;  4GS4 A;  3B3S A;  3PB8 X;  2PJ7 A;  1OZP A;  3DLJ A;  1A2Z A;  3IC1 A;  3T90 A;  3DR6 A;  3NFZ A;  2OB0 A;  2GFQ A;  1I21 A;  4CYQ A;  2EK9 A;  1TIQ A;  1ARL A;  2CTC A;  5J8C A;  4A32 A;  2PJ4 A;  4A2Z A;  1AMP A;  4X8I A;  1Q2C A;  2O4H A;  2G3T A;  1LAN A;  2ZW4 A;  3H8E A;  2R8V A;  1H8L A;  2Q4V A;  2PJ8 A;  4F0Y A;  5DS0 A;  3B35 A;  2NMT A;  1LCP A;  4NGS A;  1BLL E;  1Z9U A;  1TKF A;  4P4J A;  2AFW A;  4QUS A;  4CS0 B;  3VAR A;  1Y0Y A;  2PCU A;  4XPD B;  4BIN A;  5KTD A;  3N5F A;  1K4J A;  3LWU A;  3T8W A;  1JQG A;  2Q7S A;  1LAP A;  3B3W A;  4M3S A;  4ZX8 A;  3R96 A;  4WJB A;  2PC1 A;  4OC5 A;  4KSI A;  2QIR A;  1FT7 A;  3WAB A;  3TO9 A;  2PRQ A;  1M4G A;  4PPZ A;  6CPA A;  4ZY0 A;  4A38 A;  2CNT A;  3CPX A;  4MY3 A;  1OBR A;  3FX6 A;  2A4N A;  3MN8 A;  2V8V A;  3KR4 A;  3A9L A;  3BXM A;  1VHE A;  2GE3 A;  3FMC A;  4PSW A;  4XPD C;  4B14 A;  4NGR A;  4EME A;  4R6T A;  3TX8 A;  1XJO A;  2Z0Z A;  4B12 A;  2DPS A;  5LYL A;  1I12 A;  5K8M A;  2CXA A;  2PJ0 A;  3FNC A;  2WYR A;  2PVV A;  4JXQ A;  2Q04 A;  1QSN A;  1R57 A;  2AFX A;  2OU2 A;  3D2P A;  4MMO A;  4A95 A;  1BPM A;  3VWD A;  2JEW A;  4R3L A;  4C7I A;  1LFW A;  4B5P A;  3F8K A;  4C68 A;  2AFZ A;  3KQX A;  3D8P A;  3B7I A;  1X12 A;  3H4Q A;  1HDU A;  4E2A A;  4OC2 A;  4UCM A;  1ELL P;  2BOA A;  2EWB A;  3RZA A;  4AVB A;  3NE8 A;  4P4B A;  2P6F A;  2K5T A;  4CGO A;  1YR0 A;  4UEE A;  2HB6 A; 
#chains in the Genus database with same CATH homology
 1VKC A;  2FIW A;  1YVK A;  5AG4 A;  5C88 A;  1IYL A;  3S6F A;  4RI1 A;  4CYP A;  1Y9K A;  4YFJ A;  4LX9 A;  4UA3 A;  3R1K A;  2J8M A;  2FS5 A;  4U9Z A;  3DNS A;  4AG9 A;  4XNH B;  4JJX A;  2Q7B A;  2Q44 A;  2VZY A;  2VQY A;  5J8F A;  1P4N A;  3DR8 A;  5G21 A;  3EY5 A;  4NF1 A;  1YK3 A;  3BJ7 A;  3W6S A;  4KOV A;  4AVC A;  3LD2 A;  4E8O A;  3BJ8 A;  4A31 A;  4CRY B;  4QC6 A;  2FIA A;  2JDC A;  2FE7 A;  2ARH A;  2PSW A;  4ORF A;  4XNH C;  3IWE A;  4HNX B;  1GHE A;  3CXQ A;  3S6G A;  2P6G A;  1IB1 E;  4R3K A;  3GKR A;  3EO4 A;  2ZW5 A;  4CGL A;  3S6K A;  1LRZ A;  4R87 A;  2Z3M A;  3R9G A;  2B5G A;  2FXF A;  5F49 A;  2I00 A;  1V0C A;  1PUA A;  5AG7 A;  3ZZI A;  4XPL A;  1YX0 A;  1U6M A;  2DPT A;  4CGP A;  4F0X A;  4JD6 A;  4B11 A;  3FXT A;  4Y49 B;  5F46 A;  4CAV A;  3UY5 A;  1S3Z A;  1KUV A;  2G3A A;  3PZJ A;  1Q2Y A;  1P0H A;  4KS9 A;  3TOA A;  2Z3L A;  3CXP A;  1XEB A;  2IL4 A;  2B4D A;  1XE4 A;  2HQY A;  3C26 A;  1NSL A;  2JLM A;  2B4B A;  5CNP A;  3IGR A;  2H5M A;  3S6H A;  2RC4 A;  4Y49 C;  2PRB A;  2R7H A;  3F5B A;  1M4D A;  1Q2D A;  4YGO A;  4L8A A;  4KOS A;  3T9Y A;  3EXN A;  4AB7 A;  4M85 A;  4MHD A;  2FT0 A;  4X5K A;  1S7L A;  1MJ9 A;  2D4P A;  4KOT A;  4UFV A;  5IX3 A;  4HKF A;  1FY7 A;  4H6Z A;  2VZZ A;  4R9M A;  5F47 A;  3EFA A;  4EVY A;  5H84 A;  1M4I A;  3TCV A;  4CAE A;  2I79 A;  4II9 A;  1B6B A;  5FVJ A;  4OAE A;  3PGP A;  1UFH A;  4KOX A;  2ATR A;  2OZU A;  2GIV A;  1BO4 A;  2X7B A;  1KUY A;  2YND A;  1CM0 A;  2R1I A;  4CAF A;  1NE9 A;  2YNC C;  3FIX A;  1S7N A;  2B3V A;  2BL1 A;  3FRM A;  1KZF A;  4JXR A;  2FL4 A;  2VBQ A;  4C2Y A;  4KLV A;  4NEX A;  4UFW A;  4B13 A;  4Q36 A;  4KSF A;  4CYN A;  2P0W A;  4Q38 A;  3TFY A;  2YNE A;  5G1Z A;  4C2Z A;  2PR8 A;  3SXN A;  5F48 A;  1BOB A;  3SHP A;  3KKW A;  4BMH A;  3JVN A;  5A28 A;  3JTK A;  4FD7 A;  5AGE A;  3IWG A;  4B10 A;  1CJW A;  4HNY B;  4KOY A;  4H89 A;  1MJB A;  4UWJ A;  4UWI A;  2VXK A;  2EUI A;  1XMT A;  3CXS A;  4U5Y A;  2OZG A;  5I0C A;  2AJ6 A;  2B3U A;  2J8N A;  2YGW A;  4QVT A;  2ZW6 A;  5AG6 A;  4UCN A;  3RYO A;  1QSR A;  3IU1 A;  1Y7R A;  3D3S A;  5EBV A;  4A33 A;  4FD6 A;  4NSQ A;  3LOD A;  3QAH A;  3TT2 A;  4IUS A;  4MFP A;  2QML A;  2KCW A;  2Z3P A;  4OLL A;  4KLW A;  4MY0 A;  2VI7 A;  1M44 A;  5KTC A;  3I3G A;  3R95 A;  3K9U A;  4KVX A;  4CRZ B;  3D2M A;  3I9S A;  3DSB A;  2Z3N A;  4ZGY B;  4AG7 A;  2O28 A;  3N7Z A;  5BWA B;  2Y0M A;  4PSX A;  1J4J A;  4DNC A;  1RXT A;  4KUA A;  5ISV A;  3GY9 A;  2Q0Y A;  4R57 A;  1Y9W A;  4E0A A;  3NE7 A;  3F0A A;  2VEZ A;  2PDO A;  4QB9 A;  4PK3 A;  5G22 A;  3R9E A;  2BEI A;  2R98 A;  4XPK A;  2BSW A;  3BLN A;  3FYN A;  4KUB A;  4OAD A;  4PV6 A;  2B58 A;  1QSM A;  1VHS A;  4UFX A;  1ZO0 A;  5DWM A;  2Z3O A;  2PR1 A;  5G20 A;  1Z4E A;  4B5P B;  5A27 A;  4KOR A;  2F5I A;  1XIX A;  4PK2 A;  4H6U A;  4CAW A;  4ZBG A;  4F6A A;  5IV0 A;  2FCK A;  4KVO E;  5E96 A;  2Z11 A;  2JEV A;  1QST A;  4J3G A;  4JWP A;  4KZT A;  4CAX A;  5H86 A;  5EC4 A;  3W6X A;  5HH1 A;  4UCP A;  4C2X A;  3FBU A;  2ZPA A;  1M1D A;  1KUX A;  4MJ8 A;  4CGM A;  2HUZ A;  4CYO A;  2QEC A;  1S7K A;  2EVN A;  5HMN A;  4YRH A;  5DWN A;  4U9Y A;  1YLE A;  3H5Z A;  5C82 A;  1IID A;  3TO6 A;  3G3S A;  2PQ8 A;  4MFK A;  5JPH A;  1YVO A;  5IB0 A;  3GYA A;  2C27 A;  2WPW A;  3TOB A;  4MBU A;  4MFJ A;  4MI4 A;  3R9F A;  4MFL A;  2CNM A;  4C7H A;  2REE A;  4KVM E;  4KSA A;  5JQ4 A;  1PU9 A;  4HNW B;  4B5O A;  1YRE A;  2Z3K A;  3P2F A;  3W91 A;  4CGN A;  1RO5 A;  4FD4 A;  1QSO A;  2B5G B;  4KOW A;  1NMT A;  3OWC A;  2ZW7 A;  4QBJ A;  2YNC A;  2CY2 A;  1B87 A;  2OZH A;  4RS2 A;  4IF5 A;  3TE4 A;  4K30 A;  1ON0 A;  3TO7 A;  5KTA A;  1MJA A;  1S7F A;  4NXY A;  4NCZ A;  3G8W A;  2WPX A;  1I1D A;  2AE6 A;  2B4D B;  3V8I A;  3WR7 A;  1Z4R A;  4JLY A;  3SXO A;  2ZXV A;  4LUA A;  3DDD A;  1N71 A;  2REF A;  1WK4 A;  2G0B A;  3JUW A;  4KOU A;  4AVA A;  3PP9 A;  4MFZ A;  4BBH A;  4MFQ A;  1WWZ A;  2DXQ A;  3FB3 A;  3ZJ0 A;  2HV2 A;  3MGD A;  3P2H A;  3VWE A;  2Q4Y A;  4L89 A;  3B8G A;  1IYK A;  4ONU A;  2WUU A;  2OH1 A;  1L0C A;  3TTH A;  5AG5 A;  2WSA A;  1YGH A;  2BUE A;  5GCN A;  2Z10 A;  1IIC A;  2FSR A;  1SQH A;  2JDD A;  4UBR A;  2D4O A;  3E0K A;  3EC4 A;  2J8R A;  2GAN A;  4I49 A;  1S5K A;  1S60 A;  3IU2 A;  1XF8 A;  2P6E A;  3QB8 A;  2CNS A;  4FD5 A;  1MK4 A;  4GS4 A;  1OZP A;  3T90 A;  3DR6 A;  2OB0 A;  1I21 A;  4CYQ A;  1TIQ A;  5J8C A;  4A32 A;  4A2Z A;  1Q2C A;  2G3T A;  2ZW4 A;  2R8V A;  2Q4V A;  4F0Y A;  2NMT A;  4QUS A;  1Z9U A;  4CS0 B;  4XPD B;  5KTD A;  1K4J A;  4M3S A;  3R96 A;  2PC1 A;  2QIR A;  3TO9 A;  1M4G A;  2CNT A;  4MY3 A;  2A4N A;  4B14 A;  3A9L A;  2GE3 A;  4PSW A;  4XPD C;  2Z0Z A;  4B12 A;  2DPS A;  1I12 A;  2CXA A;  3FNC A;  4JXQ A;  2Q04 A;  1QSN A;  1R57 A;  2OU2 A;  3D2P A;  4A95 A;  3VWD A;  4R3L A;  4C7I A;  4B5P A;  3F8K A;  4C68 A;  3D8P A;  3H4Q A;  4E2A A;  4UCM A;  4AVB A;  4A30 A;  2P6F A;  2K5T A;  4CGO A;  1YR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...