4PV6A

Crystal structure analysis of ard1 from thermoplasma volcanium
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
154
structure length
154
Chain Sequence
INAVAGTIREFSPKDIESVYRIAQTSLTEYYTQALILDLHREWPESFMVYTVAGSVVGFIVGSKYSRTEARILLFAVDERFRRMGVGSALMDAFLSLCREQNMLSVRLEVRTDNDEAIRFYKKYGFVITAMLPNYYSDSSNAYTMWRIVLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Thermoplasma volcanium Ard1 belongs to N-acetyltransferase family member suggesting multiple ligand binding modes with acetyl coenzyme A and coenzyme A.
pubmed doi rcsb
source organism Thermoplasma volcanium
molecule tags Transferase
molecule keywords N-terminal acetyltransferase complex subunit [ARD1]
total genus 38
structure length 154
sequence length 154
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2014-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4pv6A00
1M4DA 3N7ZA 4NEXA 4AVAA 5HMNA 5J8FA 4QUSA 1QSMA 4E8OA 1M4IA 5KTCA 2PDOA 4XPDB 3DNSA 3SXOA 3TT2A 1IYKA 4LX9A 1Z9UA 4M3SA 5H86A 4IF5A 3IWGA 3H4QA 3D2PA 2X7BA 1GHEA 3LD2A 3S6HA 1XE4A 3D3SA 3FRMA 4U9ZA 2PSWA 2Q44A 2Q4VA 2ZW7A 1B6BA 3FBUA 4U5YA 3TE4A 4RS2A 3G8WA 4UWJA 2O28A 2FSRA 2OU2A 2R8VA 4KLVA 1ON0A 4R9MA 2D4PA 1IIDA 2CNSA 2JDDA 2Z11A 4MY3A 2VZZA 2OZGA 3BJ8A 4ORFA 4YGOA 4PK3A 2P0WA 1OZPA 2R98A 3FNCA 4JXRA 4F6AA 2VBQA 4B5PB 3D8PA 1CJWA 3JVNA 1XMTA 4II9A 3FB3A 4ZBGA 2GE3A 4LUAA 2Z10A 4R87A 4FD7A 3T90A 4Y49B 1I1DA 2OB0A 2WPWA 4B5OA 2B4DB 2CY2A 4HKFA 3TFYA 1NE9A 3BJ7A 4FD5A 2VI7A 2P6FA 2K5TA 2Q04A 4PV6A 1L0CA 1S7LA 3G3SA 1S3ZA 5IV0A 1MJBA 4KVOE 3MGDA 2FS5A 4KUAA 5F46A 4H6ZA 1UFHA 4E2AA 3DDDA 2A4NA 3TO6A 4KORA 2FCKA 4ONUA 2FIWA 3TCVA 2REFA 3EXNA 5I0CA 1IICA 3B8GA 4JWPA 3QAHA 2FT0A 4YRHA 4KVME 4QBJA 2AJ6A 3EC4A 1B87A 2PQ8A 2B4DA 2REEA 4YFJA 1S5KA 5GCNA 4OADA 1XF8A 3SHPA 4CAVA 3R1KA 2Z0ZA 5F47A 1XEBA 1YX0A 1MJAA 4JXQA 5EBVA 2VXKA 1K4JA 4H89A 2RC4A 3VWDA 2ZW6A 2J8RA 2CNTA 3FYNA 4OLLA 3CXPA 4X5KA 3TOAA 4HNWB 1PUAA 2J8MA 3PZJA 1LRZA 5HH1A 3FIXA 2GANA 5KTDA 2B4BA 1YGHA 5E96A 3LODA 1VKCA 2G0BA 4NXYA 3TOBA 1CM0A 4L89A 3R9FA 1Y7RA 3QB8A 3RYOA 4XNHC 2OZHA 2G3AA 1YVKA 2VZYA 5EC4A 2JEVA 3TO7A 4KUBA 1BO4A 4NF1A 4L8AA 4KOXA 3F0AA 1Q2CA 5C82A 4NSQA 2CNMA 2QMLA 1VHSA 1YR0A 4CAXA 4MHDA 3DSBA 4M85A 1PU9A 4CRYB 2BSWA 1NMTA 5C88A 1IB1E 4R3KA 3GKRA 2PR8A 3ZJ0A 2VQYA 1KZFA 1KUXA 3F5BA 4HNXB 1S7KA 2ZW4A 2PR1A 3F8KA 4RI1A 2OZUA 2JLMA 4U9YA 3E0KA 4OAEA 4QB9A 4KOTA 2D4OA 2QIRA 1FY7A 2B58A 3GYAA 2Q4YA 4UBRA 3T9YA 1S7NA 4AG9A 2NMTA 3KKWA 5F49A 1XIXA 1I21A 4F0YA 2VEZA 2KCWA 4KLWA 1Y9WA 2B5GA 3I9SA 1NSLA 1N71A 4CRZB 1QSNA 4AVBA 3TTHA 5DWNA 2HQYA 1QSOA 3NE7A 4B5PA 4XPDC 3VWEA 3DR8A 3DR6A 3D2MA 4MJ8A 4EVYA 5IB0A 2GIVA 5J8CA 5KTAA 1BOBA 3EFAA 1SQHA 4JLYA 1MJ9A 5IX3A 1Q2YA 3P2FA 2PC1A 4KZTA 1QSRA 2P6EA 1U6MA 3W91A 2Y0MA 2R1IA 1YVOA 4GS4A 4UA3A 2BL1A 1I12A 4I49A 2R7HA 1TIQA 4AG7A 2FL4A 2FXFA 2QECA 2EVNA 2HUZA 4PK2A 1YK3A 5ISVA 4PSXA 3R95A 2BUEA 2WPXA 2BEIA 4MI4A 1M44A 5JQ4A 2HV2A 3W6XA 2B3VA 1S60A 4MBUA 3R96A 1M4GA 1KUVA 5DWMA 4KVXA 4NCZA 3W6SA 1YREA 2FIAA 2FE7A 4FD4A 1WK4A 4MY0A 4IUSA 2IL4A 2ZW5A 1Y9KA 1RXTA 2OH1A 3GY9A 3OWCA 1Z4RA 3CXQA 2JDCA 4FD6A 4KOVA 2J8NA 4XPKA 4CS0B 2B3UA 5H84A 3WR7A 4Y49C 3ZZIA 4JJXA 4HNYB 2ZPAA 4R3LA 3UY5A 2C27A 1R57A 4UWIA 3P2HA 4AVCA 4XPLA 2I79A 3EY5A 3JUWA 1P0HA 1Z4EA 3PGPA 4PSWA 3BLNA 3R9GA 4E0AA 3CXSA 2G3TA 2ARHA 4K30A 5FVJA 1MK4A 4J3GA 3S6GA 3V8IA 4H6UA 1V0CA 2ATRA 2H5MA 3K9UA 4KOWA 2I00A 3PP9A 3I3GA 4QVTA 3S6FA 5JPHA 1QSTA 1J4JA 3TO9A 4KOUA 2Q7BA 1P4NA 1M1DA 1YLEA 2PRBA 4JD6A 5CNPA 1KUYA 3R9EA 2AE6A 4CAWA 1RO5A 2EUIA 4QC6A 2F5IA 2P6GA 1Q2DA 4BMHA 1WWZA 2DXQA 4XNHB 3S6KA 1S7FA 2B5GB 3FXTA 3IGRA 3C26A 2ZXVA 4DNCA 2Q0YA 4KOSA 4KOYA 4R57A 3SXNA 3EO4A 5F48A 1IYLA 4AB7A
chains in the Genus database with same CATH superfamily
4A95A 1M4DA 2GFQA 3CPAA 2WYRA 3N7ZA 4UIAA 1FNOA 4NEXA 3VH9A 4AVAA 3FECA 5HMNA 5J8FA 3D4UA 4R6TA 5JGFA 4QUSA 4ZGYB 4NGNA 3CT9A 1LANA 1ZG8A 2PVWA 2ZEOA 1QSMA 3KGQA 4E8OA 1M4IA 5KTCA 5LRKA 3FH4A 5BWAB 3JRUA 1CBXA 1CG2A 2PDOA 4YWYA 4XPDB 2Q43A 3DNSA 3SXOA 3TT2A 4P4EA 2CTBA 4R7MA 4ZX9A 3RZAA 4KSFA 1IYKA 3FEEA 4GXHA 4LX9A 2JBKA 1Z9UA 3GIUA 4M3SA 3T8WA 4MFJA 5H86A 5LRGA 5G1ZA 4H2KA 1QMUA 4MMOA 1H8LA 4IF5A 1AYEA 4MCRA 3IWGA 4G1PA 4UIBA 8CPAA 4MFQA 4UEZA 3H4QA 3D2PA 2X7BA 4X3RA 4A37A 1GHEA 3LD2A 3S6HA 2QVPA 1XE4A 3B35A 3NA6A 3CDXA 5G22A 4A30A 2PJ6A 3S9NA 1XBUA 3NH4A 4P4IA 3D3SA 4W9YA 3FRMA 4U9ZA 4DJLA 1CPSA 3RNZA 1LFWA 3W6SA 2PSWA 4PXEA 1CP6A 2Q44A 2Q4VA 2Q4ZA 1R3NA 2ZW7A 3WC5A 1B6BA 3FBUA 3JTKA 4U5YA 3KZWA 3V38A 2I3CA 3H5ZA 4RS2A 3G8WA 3TE4A 3D67A 4KSIA 4UWJA 2O28A 2FSRA 2PE3A 1HDQA 2OU2A 3KL9A 3GLJA 2R8VA 2NYQA 4KLVA 1ON0A 1LCPA 4FUUA 4R9MA 2D4PA 1IIDA 2CNSA 2JDDA 3D7GA 2Z11A 3GB0A 4MFLA 4EWTA 2OOTA 4MY3A 4CYNA 2VZZA 2OZGA 2POKA 3BJ8A 5IB9A 5JH9A 3PFOA 4ORFA 4YGOA 4B10A 2RFHA 4PK3A 2P0WA 4EMEA 1OZPA 3D7FA 2R98A 3FNCA 4JXRA 1ZLHA 4A38A 4C7IA 2AFWA 4F6AA 2DEAA 2VBQA 4B5PB 2PJ9A 2WSAA 1GYTA 3D8PA 2CIJA 1CJWA 3H8EA 3JVNA 4KS9A 1XMTA 4II9A 2ABZA 1HDUA 3FB3A 3SJGA 4ZBGA 6CPAA 4OC3A 3PB7X 2GE3A 4LUAA 1BLLE 2PJAA 5AG4A 2V8GA 4UFVA 2Z10A 3IU1A 3NH8A 2HC9A 1EE3P 4A32A 5JM6A 4R87A 4FD7A 4RN7A 1QQ9A 4C2XA 3T90A 4Y49B 1I1DA 4MHNA 2OB0A 5A27A 4FWUA 5AG5A 2WPWA 2ZEFA 4B5OA 2ANPA 2B4DB 2CY2A 4HKFA 3TFYA 2F8HA 1NE9A 3B3VA 3BJ7A 3WC6A 4DUKA 2VI7A 2P6FA 2Q04A 2K5TA 4FD5A 4F0XA 4PV6A 4PXBA 1L0CA 1S7LA 1Y0RA 2V8VA 3G3SA 3KR4A 3IIBA 4MXUA 1S3ZA 4BD9A 3FX6A 4CYOA 3LACA 2V77A 3I1UA 3RAMA 5IV0A 3ISXA 5A28A 1MJBA 4ZYQA 4KVOE 3MGDA 2ZEGA 2FS5A 3PEIA 1ARMA 4KUAA 1IGBA 5F46A 4H6ZA 1UFHA 4CGPA 4E2AA 3WC7A 3DDDA 2A4NA 3TO6A 2EBJA 2ZENA 4KORA 3KHZA 4CGNA 2EO8A 2FCKA 2Q51A 2FIWA 4ONUA 2REFA 3EXNA 3TCVA 1IICA 3PB8X 5I0CA 3B8GA 4JWPA 4F9VA 3QAHA 2FT0A 1VHOA 4YRHA 4KVME 4QBJA 1Z2LA 2AJ6A 3EC4A 1YQEA 2O53A 1B87A 1F57A 1Q7LA 1ELMP 2PQ8A 5HVGA 2B4DA 3QAYA 1YW6A 2REEA 1S5KA 2AFOA 4YFJA 5G21A 2GLJA 1R43A 4MFZA 5GCNA 1Y7EA 3BI0A 3BHXA 1TKJA 4P6YA 4OADA 2PJ0A 2C6PA 3FF3A 1XF8A 2YNEA 3PBBA 4IAVA 4O23A 4UCMA 3SHPA 3SI2A 4CAVA 2Z3MA 3R1KA 5CBMA 2V8HA 2Z0ZA 5F47A 3VARA 1XEBA 4NGSA 2PIYA 1DTDA 2CF4A 5K8OA 4C7HA 4OMEA 1JWQA 1YX0A 1MJAA 4JXQA 1ELLP 5EBVA 3SI1A 2AFMA 2VXKA 1K4JA 4H89A 3IFEA 4PXDA 1LAPA 2RC4A 1F2OA 3VWDA 2ZW6A 2J8RA 2CNTA 3FYNA 4OLLA 4UCNA 4A2ZA 3CXPA 4C2YA 1ZO0A 4IK2A 4PPZA 4X5KA 3TOAA 2PRQA 4HNWB 1PUAA 5G20A 3TC8A 2J8MA 1FT7A 3PZJA 2PJ7A 4CYQA 1LRZA 5HH1A 3FIXA 2GANA 2ZEHA 5KTDA 2B4BA 1YGHA 3KQXA 1YLOA 5E96A 3V7ZA 3LODA 3N5FA 1VKCA 3D68A 2G0BA 4OC0A 4NXYA 3B3SA 5LYFA 3TOBA 1CM0A 4L89A 3R9FA 1Y7RA 2NSMA 1TXRA 3QB8A 2ODFA 4ONWA 2AFXA 3RYOA 2FVGA 4XNHC 2OZHA 2G3AA 2OR4A 1Z8LA 1YVKA 4M6GA 4WWVA 1PCAA 2VZYA 5EC4A 2JEVA 4NGPA 3TO7A 1Z8WA 4KUBA 2GREA 1BO4A 3FEDA 3PBEA 4NF1A 4L8AA 1BAVA 2PJ8A 4KOXA 4FBEA 3F0AA 5AGEA 1Q2CA 4CYPA 3IC1A 4ZY2A 4P4FA 5C82A 3B2YA 4NSQA 2CNMA 2QMLA 4M6IA 1IOIA 1VHSA 1ARLA 1YR0A 2PJ3A 4MHDA 4UFXA 3DSBA 3VATA 4CAXA 2C6CA 4M85A 1PU9A 4B6ZA 3BXMA 4CRYB 2BSWA 4CGOA 1YSJA 3SJEA 2Z3LA 4K3NA 2Z3PA 3B3TA 4X2TA 5J1QA 4LQ6A 2IJZA 4A39A 2XEJA 4A94A 1NMTA 5C88A 1IB1E 4NGRA 1YMEA 4R3KA 1NSAA 7CPAA 3GKRA 1RTQA 2PR8A 4FAIA 3B7IA 1TF9A 2VQYA 3ZJ0A 1KZFA 1KUXA 3F5BA 4HNXB 4P10A 4GM5A 2ZEMA 3D7HA 1S7KA 3IWWA 2WUUA 2ZW4A 2PR1A 3F8KA 4OC5A 4RI1A 4YU9A 4DYOA 2OZUA 2JLMA 2PJ4A 4U9YA 3NE8A 3RBUA 3E0KA 2ZEPA 4OAEA 4QB9A 1LAMA 4CPAA 3LMSA 4KOTA 2D4OA 2PVVA 2QIRA 1FY7A 4ZX8A 2B58A 3GYAA 3IO1A 1DE4C 4ZY1A 4OKOA 1IY7A 2Q4YA 4Q38A 4UBRA 3T9YA 1S7NA 4NJQA 4AG9A 4EFDA 2NMTA 3KKWA 5F49A 1XIXA 1I21A 4MFKA 4F0YA 1M4LA 3QNVA 2VEZA 2KCWA 4IHMA 4KLWA 1Y9WA 2B5GA 3I9SA 4KSAA 1N71A 1NSLA 4CRZB 1QSNA 4AVBA 1XRYA 3TTHA 5DWNA 2HQYA 1QSOA 2AFSA 3NE7A 4X8IA 4XPDC 2F7VA 4B5PA 2CXAA 3VWEA 3DR8A 4WJBA 2DPTA 3DR6A 4BINA 3D2MA 2PJ2A 4MJ8A 3H8GA 4EVYA 5IB0A 2PJ1A 2GIVA 3TX8A 1ZLIA 5J8CA 2ZEEA 4MFPA 3H8FA 1BOBA 3EFAA 1SQHA 1VIXA 5I4MA 5KTAA 1XFOA 4JLYA 1MJ9A 2VL1A 5IX3A 1Z8XA 1Q2YA 3P2FA 5ELYA 2PC1A 4JZ0A 2PJBA 4KZTA 4MHPA 1JQGA 2GLFA 2C6GA 1QSRA 4NGMA 5HXDA 3K9TA 4NGTA 2P6EA 1U6MA 3W91A 2Y0MA 4AXVA 3IEHA 2R1IA 1YVOA 2DF5A 1A2ZA 2AFZA 4GS4A 4UA3A 2BL1A 5D8NA 3WT4A 1I12A 4I49A 2R7HA 5CPAA 2Z3NA 3D7DA 4OP4A 1TIQA 3IWEA 4A31A 4AG7A 2FL4A 5AG7A 4B14A 4RUHA 2FXFA 4ZY0A 2QECA 2PJ5A 2EVNA 2IMOA 2ZOGA 2C1CA 2HUZA 1BPNA 3PB9X 4PK2A 3KASA 3D66A 1YK3A 4LQGA 4P4BA 5ISVA 2AFUA 4PSXA 4CGLA 3R95A 2BUEA 2WZNA 2WPXA 4TWEA 2JBJA 2HB6A 5K8PA 2BEIA 4MI4A 1M44A 4OC2A 2HV2A 5JQ4A 2Q7SA 3RO0A 3W6XA 4UFWA 3SJXA 4F8ZA 4MRIA 2B3VA 1S60A 4MBUA 3KQZA 3R96A 1UWYA 4B13A 2EWBA 1M4GA 1KUVA 4MCPA 4KVXA 4NCZA 3DLJA 1YREA 4OIDA 5DWMA 2FIAA 2FE7A 1CX8A 1HEEA 3IU2A 3KI9A 4FD4A 4HPSA 1WK4A 4P4DA 2ZEDA 1Y0YA 4IUSA 4MY0A 2IL4A 2ZW5A 4OIWA 2RB7A 4P45A 4UEFA 5THWA 1XMBA 2XEFA 3SI0A 1Y9KA 1RXTA 2OH1A 3GY9A 3OWCA 1Z4RA 5LYIA 5EMIA 3CXQA 4OC1A 2V8DA 5K8NA 2JDCA 4UCPA 1BPMA 1AUGA 3B3CA 4FD6A 3CPXA 4PXCA 5D29A 2Z3OA 4KOVA 2J8NA 5DS0A 2ZOFA 1CPXA 4CAFA 4XPKA 4A33A 4C68A 3A9LA 3PB4X 4CS0B 5LYDA 2B3UA 3PB6X 3LWUA 5H84A 1IU8A 2GU2A 4C2ZA 3WR7A 4Y49C 4NGQA 1Z8TA 3DGVA 3ZZIA 3BI1A 4F9UA 3KHXA 4JJXA 4P4JA 4HNYB 2YGWA 2ZPAA 4R3LA 1XJOA 4R76A 2C27A 3UY5A 3PFEA 1R57A 4UWIA 4B11A 4ZI6A 3P2HA 4MHZA 4AVCA 4XPLA 3L2NA 3NFZA 3NH5A 2I79A 1YW4A 2BOAA 3EY5A 3KR5A 2J9AA 3JUWA 1P0HA 1Z4EA 3PGPA 3WABA 1ZG9A 1AMPA 3SJFA 4PSWA 3BLNA 4Q36A 1OBRA 4MCSA 2DPSA 3R9GA 4E0AA 3CXSA 4UF4A 2G3TA 2ARHA 4PQAA 4Q7AA 4MCQA 3S9MA 4K30A 4NJRA 2QYVA 4BBHA 4Z65A 1CP7A 5FVJA 1MK4A 2Z3KA 4J3GA 4OC4A 3S6GA 4H6UA 3V8IA 1V0CA 1LOKA 1IOFA 2ATRA 2H5MA 3K9UA 2EK8A 4CAEA 2CTCA 2I00A 3ISZA 4KOWA 3PP9A 4CGMA 3HLPA 4R8FA 1VHEA 3FJUA 4TNUA 5LRJA 3PRTA 1TKHA 3K2KA 5HVFA 3I3GA 4QVTA 3GUXA 2YNDA 3HUVA 5AG6A 1X12A 3MRUA 3S6FA 5JPHA 5LYLA 1QSTA 1J4JA 3TO9A 5F09A 2IQ6A 2BO9A 2G9DA 4KOUA 4NFRA 2Q7BA 2QJ8A 1P4NA 1M1DA 2PIZA 2ZELA 1YLEA 2PRBA 4JD6A 5CNPA 1KUYA 1F2PA 2AE6A 3R9EA 2EK9A 1Z5RA 4CAWA 1RO5A 3B3WA 2EUIA 2XEGA 3FMCA 4QC6A 1XOVA 2F5IA 2BCOA 2O4HA 2P6GA 5K8MA 1Q2DA 4BMHA 3FVLA 1WWZA 2DXQA 3CZXA 4XNHB 3S6KA 2PCUA 3IJ3A 1S7FA 3MN8A 2B5GB 3FXTA 3IGRA 4JYWA 2YNCC 4M6HA 3C26A 1TF8A 2ZXVA 4DNCA 1PYTB 1X10A 2Q0YA 4KOSA 4P44A 1ZG7A 4KOYA 4R57A 1TKFA 1VGYA 3SXNA 4MHYA 2PJCA 2XEIA 5F48A 3EO4A 4B12A 3S9LA 2JEWA 5HVHA 4UEEA 2YNCA 1KWMA 1IYLA 4AB7A
chains in the Genus database with same CATH topology
4A95A 1M4DA 3N7ZA 4NEXA 4AVAA 5HMNA 5J8FA 4QUSA 4ZGYB 1QSMA 4E8OA 1M4IA 5KTCA 5BWAB 2PDOA 4XPDB 3DNSA 3SXOA 3TT2A 4KSFA 1IYKA 4LX9A 1Z9UA 4M3SA 4MFJA 5H86A 5G1ZA 4IF5A 3IWGA 4MFQA 3H4QA 3D2PA 2X7BA 1GHEA 3LD2A 3S6HA 1XE4A 5G22A 4A30A 3D3SA 3FRMA 4U9ZA 2PSWA 2Q44A 2Q4VA 2ZW7A 1B6BA 3FBUA 3JTKA 4U5YA 3H5ZA 4RS2A 3G8WA 3TE4A 4UWJA 2O28A 2FSRA 2OU2A 2R8VA 4KLVA 1ON0A 4R9MA 2D4PA 1IIDA 2CNSA 2JDDA 2Z11A 4MFLA 4MY3A 4CYNA 2VZZA 2OZGA 3BJ8A 4ORFA 4YGOA 4B10A 4PK3A 2P0WA 1OZPA 2R98A 3FNCA 4JXRA 4C7IA 4F6AA 2VBQA 4B5PB 2WSAA 3D8PA 1CJWA 3JVNA 4KS9A 1XMTA 4II9A 3FB3A 4ZBGA 2GE3A 4LUAA 5AG4A 4UFVA 2Z10A 3IU1A 4A32A 4R87A 4FD7A 4C2XA 3T90A 4Y49B 1I1DA 2OB0A 5A27A 5AG5A 2WPWA 4B5OA 2B4DB 2CY2A 4HKFA 3TFYA 1NE9A 3BJ7A 4FD5A 2VI7A 2P6FA 2K5TA 2Q04A 4F0XA 4PV6A 1L0CA 1S7LA 3G3SA 1S3ZA 4CYOA 5IV0A 5A28A 1MJBA 4KVOE 3MGDA 2FS5A 4KUAA 5F46A 4H6ZA 1UFHA 4CGPA 4E2AA 3DDDA 2A4NA 3TO6A 4KORA 4CGNA 2FCKA 4ONUA 2FIWA 3TCVA 2REFA 3EXNA 5I0CA 1IICA 3B8GA 4JWPA 3QAHA 2FT0A 4YRHA 4KVME 4QBJA 2AJ6A 3EC4A 1B87A 2PQ8A 2B4DA 2REEA 4YFJA 1S5KA 5G21A 4MFZA 5GCNA 4OADA 1XF8A 2YNEA 4UCMA 3SHPA 4CAVA 2Z3MA 3R1KA 2Z0ZA 5F47A 1XEBA 1YX0A 1MJAA 4JXQA 5EBVA 2VXKA 1K4JA 4H89A 2RC4A 3VWDA 2ZW6A 2J8RA 2CNTA 3FYNA 4OLLA 4UCNA 4A2ZA 3CXPA 4C2YA 1ZO0A 4X5KA 3TOAA 4HNWB 1PUAA 5G20A 2J8MA 3PZJA 4CYQA 1LRZA 5HH1A 3FIXA 2GANA 5KTDA 2B4BA 1YGHA 5E96A 3LODA 1VKCA 2G0BA 4NXYA 3TOBA 1CM0A 4L89A 3R9FA 1Y7RA 3QB8A 3RYOA 4XNHC 2OZHA 2G3AA 1YVKA 2VZYA 5EC4A 2JEVA 3TO7A 4KUBA 1BO4A 4NF1A 4L8AA 4KOXA 3F0AA 5AGEA 1Q2CA 4CYPA 5C82A 4NSQA 2CNMA 2QMLA 1VHSA 4UFXA 1YR0A 4CAXA 4MHDA 3DSBA 4M85A 1PU9A 4CRYB 2BSWA 4CGOA 2Z3LA 2Z3PA 1NMTA 5C88A 1IB1E 4R3KA 3GKRA 2PR8A 3ZJ0A 2VQYA 1KZFA 1KUXA 3F5BA 4HNXB 1S7KA 2WUUA 2ZW4A 2PR1A 3F8KA 4RI1A 2OZUA 2JLMA 4U9YA 3E0KA 4OAEA 4QB9A 4KOTA 2D4OA 2QIRA 1FY7A 2B58A 3GYAA 2Q4YA 4Q38A 4UBRA 3T9YA 1S7NA 4AG9A 2NMTA 3KKWA 5F49A 1XIXA 1I21A 4MFKA 4F0YA 2VEZA 2KCWA 4KLWA 1Y9WA 2B5GA 3I9SA 4KSAA 1N71A 1NSLA 4CRZB 1QSNA 4AVBA 3TTHA 5DWNA 2HQYA 1QSOA 3NE7A 4B5PA 4XPDC 2CXAA 3VWEA 3DR8A 2DPTA 3DR6A 3D2MA 4MJ8A 4EVYA 5IB0A 2GIVA 5J8CA 4MFPA 5KTAA 1BOBA 3EFAA 1SQHA 4JLYA 1MJ9A 5IX3A 1Q2YA 3P2FA 2PC1A 4KZTA 1QSRA 2P6EA 1U6MA 3W91A 2Y0MA 2R1IA 1YVOA 4GS4A 4UA3A 2BL1A 1I12A 4I49A 2R7HA 2Z3NA 1TIQA 3IWEA 4A31A 4AG7A 2FL4A 5AG7A 4B14A 2FXFA 2QECA 2EVNA 2HUZA 4PK2A 1YK3A 5ISVA 4PSXA 4CGLA 3R95A 2BUEA 2WPXA 2BEIA 4MI4A 1M44A 5JQ4A 2HV2A 3W6XA 4UFWA 4B13A 2B3VA 1S60A 4MBUA 3R96A 1M4GA 1KUVA 5DWMA 4KVXA 4NCZA 3W6SA 1YREA 4C7HA 2FIAA 2FE7A 3IU2A 4FD4A 1WK4A 4MY0A 4IUSA 2IL4A 2ZW5A 1Y9KA 1RXTA 2OH1A 3GY9A 3OWCA 1Z4RA 3CXQA 2JDCA 4UCPA 4FD6A 2Z3OA 4KOVA 2J8NA 4CAFA 4XPKA 4A33A 4C68A 3A9LA 4CS0B 2B3UA 5H84A 4C2ZA 3WR7A 4Y49C 3ZZIA 4JJXA 4HNYB 2YGWA 2ZPAA 4R3LA 3UY5A 2C27A 1R57A 4UWIA 4B11A 3P2HA 4AVCA 4XPLA 2I79A 3EY5A 3JUWA 1P0HA 1Z4EA 3PGPA 4PSWA 3BLNA 4Q36A 2DPSA 3R9GA 4E0AA 3CXSA 2G3TA 2ARHA 4K30A 4BBHA 5FVJA 1MK4A 2Z3KA 4J3GA 3S6GA 3V8IA 4H6UA 1V0CA 2ATRA 2H5MA 3K9UA 4CAEA 4KOWA 2I00A 3PP9A 4CGMA 3I3GA 4QVTA 5AG6A 2YNDA 3S6FA 5JPHA 1QSTA 1J4JA 3TO9A 4KOUA 2Q7BA 1P4NA 1M1DA 1YLEA 2PRBA 4JD6A 5CNPA 1KUYA 3R9EA 2AE6A 4CAWA 1RO5A 2EUIA 4QC6A 2F5IA 2P6GA 1Q2DA 4BMHA 1WWZA 2DXQA 4XNHB 3S6KA 1S7FA 2B5GB 3FXTA 3IGRA 2YNCC 3C26A 2ZXVA 4DNCA 2Q0YA 4KOSA 4KOYA 4R57A 3SXNA 3EO4A 4B12A 2YNCA 5F48A 1IYLA 4AB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M4D A;  3N7Z A;  4NEX A;  4AVA A;  5HMN A;  5J8F A;  4QUS A;  1QSM A;  4E8O A;  1M4I A;  5KTC A;  2PDO A;  4XPD B;  3DNS A;  3SXO A;  3TT2 A;  1IYK A;  4LX9 A;  1Z9U A;  4M3S A;  5H86 A;  4IF5 A;  3IWG A;  3H4Q A;  3D2P A;  2X7B A;  1GHE A;  3LD2 A;  3S6H A;  1XE4 A;  3D3S A;  3FRM A;  4U9Z A;  2PSW A;  2Q44 A;  2Q4V A;  2ZW7 A;  1B6B A;  3FBU A;  4U5Y A;  3TE4 A;  4RS2 A;  3G8W A;  4UWJ A;  2O28 A;  2FSR A;  2OU2 A;  2R8V A;  4KLV A;  1ON0 A;  4R9M A;  2D4P A;  1IID A;  2CNS A;  2JDD A;  2Z11 A;  4MY3 A;  2VZZ A;  2OZG A;  3BJ8 A;  4ORF A;  4YGO A;  4PK3 A;  2P0W A;  1OZP A;  2R98 A;  3FNC A;  4JXR A;  4F6A A;  2VBQ A;  4B5P B;  3D8P A;  1CJW A;  3JVN A;  1XMT A;  4II9 A;  3FB3 A;  4ZBG A;  2GE3 A;  4LUA A;  2Z10 A;  4R87 A;  4FD7 A;  3T90 A;  4Y49 B;  1I1D A;  2OB0 A;  2WPW A;  4B5O A;  2B4D B;  2CY2 A;  4HKF A;  3TFY A;  1NE9 A;  3BJ7 A;  4FD5 A;  2VI7 A;  2P6F A;  2K5T A;  2Q04 A;  4PV6 A;  1L0C A;  1S7L A;  3G3S A;  1S3Z A;  5IV0 A;  1MJB A;  4KVO E;  3MGD A;  2FS5 A;  4KUA A;  5F46 A;  4H6Z A;  1UFH A;  4E2A A;  3DDD A;  2A4N A;  3TO6 A;  4KOR A;  2FCK A;  4ONU A;  2FIW A;  3TCV A;  2REF A;  3EXN A;  5I0C A;  1IIC A;  3B8G A;  4JWP A;  3QAH A;  2FT0 A;  4YRH A;  4KVM E;  4QBJ A;  2AJ6 A;  3EC4 A;  1B87 A;  2PQ8 A;  2B4D A;  2REE A;  4YFJ A;  1S5K A;  5GCN A;  4OAD A;  1XF8 A;  3SHP A;  4CAV A;  3R1K A;  2Z0Z A;  5F47 A;  1XEB A;  1YX0 A;  1MJA A;  4JXQ A;  5EBV A;  2VXK A;  1K4J A;  4H89 A;  2RC4 A;  3VWD A;  2ZW6 A;  2J8R A;  2CNT A;  3FYN A;  4OLL A;  3CXP A;  4X5K A;  3TOA A;  4HNW B;  1PUA A;  2J8M A;  3PZJ A;  1LRZ A;  5HH1 A;  3FIX A;  2GAN A;  5KTD A;  2B4B A;  1YGH A;  5E96 A;  3LOD A;  1VKC A;  2G0B A;  4NXY A;  3TOB A;  1CM0 A;  4L89 A;  3R9F A;  1Y7R A;  3QB8 A;  3RYO A;  4XNH C;  2OZH A;  2G3A A;  1YVK A;  2VZY A;  5EC4 A;  2JEV A;  3TO7 A;  4KUB A;  1BO4 A;  4NF1 A;  4L8A A;  4KOX A;  3F0A A;  1Q2C A;  5C82 A;  4NSQ A;  2CNM A;  2QML A;  1VHS A;  1YR0 A;  4CAX A;  4MHD A;  3DSB A;  4M85 A;  1PU9 A;  4CRY B;  2BSW A;  1NMT A;  5C88 A;  1IB1 E;  4R3K A;  3GKR A;  2PR8 A;  3ZJ0 A;  2VQY A;  1KZF A;  1KUX A;  3F5B A;  4HNX B;  1S7K A;  2ZW4 A;  2PR1 A;  3F8K A;  4RI1 A;  2OZU A;  2JLM A;  4U9Y A;  3E0K A;  4OAE A;  4QB9 A;  4KOT A;  2D4O A;  2QIR A;  1FY7 A;  2B58 A;  3GYA A;  2Q4Y A;  4UBR A;  3T9Y A;  1S7N A;  4AG9 A;  2NMT A;  3KKW A;  5F49 A;  1XIX A;  1I21 A;  4F0Y A;  2VEZ A;  2KCW A;  4KLW A;  1Y9W A;  2B5G A;  3I9S A;  1NSL A;  1N71 A;  4CRZ B;  1QSN A;  4AVB A;  3TTH A;  5DWN A;  2HQY A;  1QSO A;  3NE7 A;  4B5P A;  4XPD C;  3VWE A;  3DR8 A;  3DR6 A;  3D2M A;  4MJ8 A;  4EVY A;  5IB0 A;  2GIV A;  5J8C A;  5KTA A;  1BOB A;  3EFA A;  1SQH A;  4JLY A;  1MJ9 A;  5IX3 A;  1Q2Y A;  3P2F A;  2PC1 A;  4KZT A;  1QSR A;  2P6E A;  1U6M A;  3W91 A;  2Y0M A;  2R1I A;  1YVO A;  4GS4 A;  4UA3 A;  2BL1 A;  1I12 A;  4I49 A;  2R7H A;  1TIQ A;  4AG7 A;  2FL4 A;  2FXF A;  2QEC A;  2EVN A;  2HUZ A;  4PK2 A;  1YK3 A;  5ISV A;  4PSX A;  3R95 A;  2BUE A;  2WPX A;  2BEI A;  4MI4 A;  1M44 A;  5JQ4 A;  2HV2 A;  3W6X A;  2B3V A;  1S60 A;  4MBU A;  3R96 A;  1M4G A;  1KUV A;  5DWM A;  4KVX A;  4NCZ A;  3W6S A;  1YRE A;  2FIA A;  2FE7 A;  4FD4 A;  1WK4 A;  4MY0 A;  4IUS A;  2IL4 A;  2ZW5 A;  1Y9K A;  1RXT A;  2OH1 A;  3GY9 A;  3OWC A;  1Z4R A;  3CXQ A;  2JDC A;  4FD6 A;  4KOV A;  2J8N A;  4XPK A;  4CS0 B;  2B3U A;  5H84 A;  3WR7 A;  4Y49 C;  3ZZI A;  4JJX A;  4HNY B;  2ZPA A;  4R3L A;  3UY5 A;  2C27 A;  1R57 A;  4UWI A;  3P2H A;  4AVC A;  4XPL A;  2I79 A;  3EY5 A;  3JUW A;  1P0H A;  1Z4E A;  3PGP A;  4PSW A;  3BLN A;  3R9G A;  4E0A A;  3CXS A;  2G3T A;  2ARH A;  4K30 A;  5FVJ A;  1MK4 A;  4J3G A;  3S6G A;  3V8I A;  4H6U A;  1V0C A;  2ATR A;  2H5M A;  3K9U A;  4KOW A;  2I00 A;  3PP9 A;  3I3G A;  4QVT A;  3S6F A;  5JPH A;  1QST A;  1J4J A;  3TO9 A;  4KOU A;  2Q7B A;  1P4N A;  1M1D A;  1YLE A;  2PRB A;  4JD6 A;  5CNP A;  1KUY A;  3R9E A;  2AE6 A;  4CAW A;  1RO5 A;  2EUI A;  4QC6 A;  2F5I A;  2P6G A;  1Q2D A;  4BMH A;  1WWZ A;  2DXQ A;  4XNH B;  3S6K A;  1S7F A;  2B5G B;  3FXT A;  3IGR A;  3C26 A;  2ZXV A;  4DNC A;  2Q0Y A;  4KOS A;  4KOY A;  4R57 A;  3SXN A;  3EO4 A;  5F48 A;  1IYL A;  4AB7 A; 
#chains in the Genus database with same CATH topology
 4A95 A;  1M4D A;  2GFQ A;  3CPA A;  2WYR A;  3N7Z A;  4UIA A;  1FNO A;  4NEX A;  3VH9 A;  4AVA A;  3FEC A;  5HMN A;  5J8F A;  3D4U A;  4R6T A;  5JGF A;  4QUS A;  4ZGY B;  4NGN A;  3CT9 A;  1LAN A;  1ZG8 A;  2PVW A;  2ZEO A;  1QSM A;  3KGQ A;  4E8O A;  1M4I A;  5KTC A;  5LRK A;  3FH4 A;  5BWA B;  3JRU A;  1CBX A;  1CG2 A;  2PDO A;  4YWY A;  4XPD B;  2Q43 A;  3DNS A;  3SXO A;  3TT2 A;  4P4E A;  2CTB A;  4R7M A;  4ZX9 A;  3RZA A;  4KSF A;  1IYK A;  3FEE A;  4GXH A;  4LX9 A;  2JBK A;  1Z9U A;  3GIU A;  4M3S A;  3T8W A;  4MFJ A;  5H86 A;  5LRG A;  5G1Z A;  4H2K A;  1QMU A;  4MMO A;  1H8L A;  4IF5 A;  1AYE A;  4MCR A;  3IWG A;  4G1P A;  4UIB A;  8CPA A;  4MFQ A;  4UEZ A;  3H4Q A;  3D2P A;  2X7B A;  4X3R A;  4A37 A;  1GHE A;  3LD2 A;  3S6H A;  2QVP A;  1XE4 A;  3B35 A;  3NA6 A;  3CDX A;  5G22 A;  4A30 A;  2PJ6 A;  3S9N A;  1XBU A;  3NH4 A;  4P4I A;  3D3S A;  4W9Y A;  3FRM A;  4U9Z A;  4DJL A;  1CPS A;  3RNZ A;  1LFW A;  3W6S A;  2PSW A;  4PXE A;  1CP6 A;  2Q44 A;  2Q4V A;  2Q4Z A;  1R3N A;  2ZW7 A;  3WC5 A;  1B6B A;  3FBU A;  3JTK A;  4U5Y A;  3KZW A;  3V38 A;  2I3C A;  3H5Z A;  4RS2 A;  3G8W A;  3TE4 A;  3D67 A;  4KSI A;  4UWJ A;  2O28 A;  2FSR A;  2PE3 A;  1HDQ A;  2OU2 A;  3KL9 A;  3GLJ A;  2R8V A;  2NYQ A;  4KLV A;  1ON0 A;  1LCP A;  4FUU A;  4R9M A;  2D4P A;  1IID A;  2CNS A;  2JDD A;  3D7G A;  2Z11 A;  3GB0 A;  4MFL A;  4EWT A;  2OOT A;  4MY3 A;  4CYN A;  2VZZ A;  2OZG A;  2POK A;  3BJ8 A;  5IB9 A;  5JH9 A;  3PFO A;  4ORF A;  4YGO A;  4B10 A;  2RFH A;  4PK3 A;  2P0W A;  4EME A;  1OZP A;  3D7F A;  2R98 A;  3FNC A;  4JXR A;  1ZLH A;  4A38 A;  4C7I A;  2AFW A;  4F6A A;  2DEA A;  2VBQ A;  4B5P B;  2PJ9 A;  2WSA A;  1GYT A;  3D8P A;  2CIJ A;  1CJW A;  3H8E A;  3JVN A;  4KS9 A;  1XMT A;  4II9 A;  2ABZ A;  1HDU A;  3FB3 A;  3SJG A;  4ZBG A;  6CPA A;  4OC3 A;  3PB7 X;  2GE3 A;  4LUA A;  1BLL E;  2PJA A;  5AG4 A;  2V8G A;  4UFV A;  2Z10 A;  3IU1 A;  3NH8 A;  2HC9 A;  1EE3 P;  4A32 A;  5JM6 A;  4R87 A;  4FD7 A;  4RN7 A;  1QQ9 A;  4C2X A;  3T90 A;  4Y49 B;  1I1D A;  4MHN A;  2OB0 A;  5A27 A;  4FWU A;  5AG5 A;  2WPW A;  2ZEF A;  4B5O A;  2ANP A;  2B4D B;  2CY2 A;  4HKF A;  3TFY A;  2F8H A;  1NE9 A;  3B3V A;  3BJ7 A;  3WC6 A;  4DUK A;  2VI7 A;  2P6F A;  2Q04 A;  2K5T A;  4FD5 A;  4F0X A;  4PV6 A;  4PXB A;  1L0C A;  1S7L A;  1Y0R A;  2V8V A;  3G3S A;  3KR4 A;  3IIB A;  4MXU A;  1S3Z A;  4BD9 A;  3FX6 A;  4CYO A;  3LAC A;  2V77 A;  3I1U A;  3RAM A;  5IV0 A;  3ISX A;  5A28 A;  1MJB A;  4ZYQ A;  4KVO E;  3MGD A;  2ZEG A;  2FS5 A;  3PEI A;  1ARM A;  4KUA A;  1IGB A;  5F46 A;  4H6Z A;  1UFH A;  4CGP A;  4E2A A;  3WC7 A;  3DDD A;  2A4N A;  3TO6 A;  2EBJ A;  2ZEN A;  4KOR A;  3KHZ A;  4CGN A;  2EO8 A;  2FCK A;  2Q51 A;  2FIW A;  4ONU A;  2REF A;  3EXN A;  3TCV A;  1IIC A;  3PB8 X;  5I0C A;  3B8G A;  4JWP A;  4F9V A;  3QAH A;  2FT0 A;  1VHO A;  4YRH A;  4KVM E;  4QBJ A;  1Z2L A;  2AJ6 A;  3EC4 A;  1YQE A;  2O53 A;  1B87 A;  1F57 A;  1Q7L A;  1ELM P;  2PQ8 A;  5HVG A;  2B4D A;  3QAY A;  1YW6 A;  2REE A;  1S5K A;  2AFO A;  4YFJ A;  5G21 A;  2GLJ A;  1R43 A;  4MFZ A;  5GCN A;  1Y7E A;  3BI0 A;  3BHX A;  1TKJ A;  4P6Y A;  4OAD A;  2PJ0 A;  2C6P A;  3FF3 A;  1XF8 A;  2YNE A;  3PBB A;  4IAV A;  4O23 A;  4UCM A;  3SHP A;  3SI2 A;  4CAV A;  2Z3M A;  3R1K A;  5CBM A;  2V8H A;  2Z0Z A;  5F47 A;  3VAR A;  1XEB A;  4NGS A;  2PIY A;  1DTD A;  2CF4 A;  5K8O A;  4C7H A;  4OME A;  1JWQ A;  1YX0 A;  1MJA A;  4JXQ A;  1ELL P;  5EBV A;  3SI1 A;  2AFM A;  2VXK A;  1K4J A;  4H89 A;  3IFE A;  4PXD A;  1LAP A;  2RC4 A;  1F2O A;  3VWD A;  2ZW6 A;  2J8R A;  2CNT A;  3FYN A;  4OLL A;  4UCN A;  4A2Z A;  3CXP A;  4C2Y A;  1ZO0 A;  4IK2 A;  4PPZ A;  4X5K A;  3TOA A;  2PRQ A;  4HNW B;  1PUA A;  5G20 A;  3TC8 A;  2J8M A;  1FT7 A;  3PZJ A;  2PJ7 A;  4CYQ A;  1LRZ A;  5HH1 A;  3FIX A;  2GAN A;  2ZEH A;  5KTD A;  2B4B A;  1YGH A;  3KQX A;  1YLO A;  5E96 A;  3V7Z A;  3LOD A;  3N5F A;  1VKC A;  3D68 A;  2G0B A;  4OC0 A;  4NXY A;  3B3S A;  5LYF A;  3TOB A;  1CM0 A;  4L89 A;  3R9F A;  1Y7R A;  2NSM A;  1TXR A;  3QB8 A;  2ODF A;  4ONW A;  2AFX A;  3RYO A;  2FVG A;  4XNH C;  2OZH A;  2G3A A;  2OR4 A;  1Z8L A;  1YVK A;  4M6G A;  4WWV A;  1PCA A;  2VZY A;  5EC4 A;  2JEV A;  4NGP A;  3TO7 A;  1Z8W A;  4KUB A;  2GRE A;  1BO4 A;  3FED A;  3PBE A;  4NF1 A;  4L8A A;  1BAV A;  2PJ8 A;  4KOX A;  4FBE A;  3F0A A;  5AGE A;  1Q2C A;  4CYP A;  3IC1 A;  4ZY2 A;  4P4F A;  5C82 A;  3B2Y A;  4NSQ A;  2CNM A;  2QML A;  4M6I A;  1IOI A;  1VHS A;  1ARL A;  1YR0 A;  2PJ3 A;  4MHD A;  4UFX A;  3DSB A;  3VAT A;  4CAX A;  2C6C A;  4M85 A;  1PU9 A;  4B6Z A;  3BXM A;  4CRY B;  2BSW A;  4CGO A;  1YSJ A;  3SJE A;  2Z3L A;  4K3N A;  2Z3P A;  3B3T A;  4X2T A;  5J1Q A;  4LQ6 A;  2IJZ A;  4A39 A;  2XEJ A;  4A94 A;  1NMT A;  5C88 A;  1IB1 E;  4NGR A;  1YME A;  4R3K A;  1NSA A;  7CPA A;  3GKR A;  1RTQ A;  2PR8 A;  4FAI A;  3B7I A;  1TF9 A;  2VQY A;  3ZJ0 A;  1KZF A;  1KUX A;  3F5B A;  4HNX B;  4P10 A;  4GM5 A;  2ZEM A;  3D7H A;  1S7K A;  3IWW A;  2WUU A;  2ZW4 A;  2PR1 A;  3F8K A;  4OC5 A;  4RI1 A;  4YU9 A;  4DYO A;  2OZU A;  2JLM A;  2PJ4 A;  4U9Y A;  3NE8 A;  3RBU A;  3E0K A;  2ZEP A;  4OAE A;  4QB9 A;  1LAM A;  4CPA A;  3LMS A;  4KOT A;  2D4O A;  2PVV A;  2QIR A;  1FY7 A;  4ZX8 A;  2B58 A;  3GYA A;  3IO1 A;  1DE4 C;  4ZY1 A;  4OKO A;  1IY7 A;  2Q4Y A;  4Q38 A;  4UBR A;  3T9Y A;  1S7N A;  4NJQ A;  4AG9 A;  4EFD A;  2NMT A;  3KKW A;  5F49 A;  1XIX A;  1I21 A;  4MFK A;  4F0Y A;  1M4L A;  3QNV A;  2VEZ A;  2KCW A;  4IHM A;  4KLW A;  1Y9W A;  2B5G A;  3I9S A;  4KSA A;  1N71 A;  1NSL A;  4CRZ B;  1QSN A;  4AVB A;  1XRY A;  3TTH A;  5DWN A;  2HQY A;  1QSO A;  2AFS A;  3NE7 A;  4X8I A;  4XPD C;  2F7V A;  4B5P A;  2CXA A;  3VWE A;  3DR8 A;  4WJB A;  2DPT A;  3DR6 A;  4BIN A;  3D2M A;  2PJ2 A;  4MJ8 A;  3H8G A;  4EVY A;  5IB0 A;  2PJ1 A;  2GIV A;  3TX8 A;  1ZLI A;  5J8C A;  2ZEE A;  4MFP A;  3H8F A;  1BOB A;  3EFA A;  1SQH A;  1VIX A;  5I4M A;  5KTA A;  1XFO A;  4JLY A;  1MJ9 A;  2VL1 A;  5IX3 A;  1Z8X A;  1Q2Y A;  3P2F A;  5ELY A;  2PC1 A;  4JZ0 A;  2PJB A;  4KZT A;  4MHP A;  1JQG A;  2GLF A;  2C6G A;  1QSR A;  4NGM A;  5HXD A;  3K9T A;  4NGT A;  2P6E A;  1U6M A;  3W91 A;  2Y0M A;  4AXV A;  3IEH A;  2R1I A;  1YVO A;  2DF5 A;  1A2Z A;  2AFZ A;  4GS4 A;  4UA3 A;  2BL1 A;  5D8N A;  3WT4 A;  1I12 A;  4I49 A;  2R7H A;  5CPA A;  2Z3N A;  3D7D A;  4OP4 A;  1TIQ A;  3IWE A;  4A31 A;  4AG7 A;  2FL4 A;  5AG7 A;  4B14 A;  4RUH A;  2FXF A;  4ZY0 A;  2QEC A;  2PJ5 A;  2EVN A;  2IMO A;  2ZOG A;  2C1C A;  2HUZ A;  1BPN A;  3PB9 X;  4PK2 A;  3KAS A;  3D66 A;  1YK3 A;  4LQG A;  4P4B A;  5ISV A;  2AFU A;  4PSX A;  4CGL A;  3R95 A;  2BUE A;  2WZN A;  2WPX A;  4TWE A;  2JBJ A;  2HB6 A;  5K8P A;  2BEI A;  4MI4 A;  1M44 A;  4OC2 A;  2HV2 A;  5JQ4 A;  2Q7S A;  3RO0 A;  3W6X A;  4UFW A;  3SJX A;  4F8Z A;  4MRI A;  2B3V A;  1S60 A;  4MBU A;  3KQZ A;  3R96 A;  1UWY A;  4B13 A;  2EWB A;  1M4G A;  1KUV A;  4MCP A;  4KVX A;  4NCZ A;  3DLJ A;  1YRE A;  4OID A;  5DWM A;  2FIA A;  2FE7 A;  1CX8 A;  1HEE A;  3IU2 A;  3KI9 A;  4FD4 A;  4HPS A;  1WK4 A;  4P4D A;  2ZED A;  1Y0Y A;  4IUS A;  4MY0 A;  2IL4 A;  2ZW5 A;  4OIW A;  2RB7 A;  4P45 A;  4UEF A;  5THW A;  1XMB A;  2XEF A;  3SI0 A;  1Y9K A;  1RXT A;  2OH1 A;  3GY9 A;  3OWC A;  1Z4R A;  5LYI A;  5EMI A;  3CXQ A;  4OC1 A;  2V8D A;  5K8N A;  2JDC A;  4UCP A;  1BPM A;  1AUG A;  3B3C A;  4FD6 A;  3CPX A;  4PXC A;  5D29 A;  2Z3O A;  4KOV A;  2J8N A;  5DS0 A;  2ZOF A;  1CPX A;  4CAF A;  4XPK A;  4A33 A;  4C68 A;  3A9L A;  3PB4 X;  4CS0 B;  5LYD A;  2B3U A;  3PB6 X;  3LWU A;  5H84 A;  1IU8 A;  2GU2 A;  4C2Z A;  3WR7 A;  4Y49 C;  4NGQ A;  1Z8T A;  3DGV A;  3ZZI A;  3BI1 A;  4F9U A;  3KHX A;  4JJX A;  4P4J A;  4HNY B;  2YGW A;  2ZPA A;  4R3L A;  1XJO A;  4R76 A;  2C27 A;  3UY5 A;  3PFE A;  1R57 A;  4UWI A;  4B11 A;  4ZI6 A;  3P2H A;  4MHZ A;  4AVC A;  4XPL A;  3L2N A;  3NFZ A;  3NH5 A;  2I79 A;  1YW4 A;  2BOA A;  3EY5 A;  3KR5 A;  2J9A A;  3JUW A;  1P0H A;  1Z4E A;  3PGP A;  3WAB A;  1ZG9 A;  1AMP A;  3SJF A;  4PSW A;  3BLN A;  4Q36 A;  1OBR A;  4MCS A;  2DPS A;  3R9G A;  4E0A A;  3CXS A;  4UF4 A;  2G3T A;  2ARH A;  4PQA A;  4Q7A A;  4MCQ A;  3S9M A;  4K30 A;  4NJR A;  2QYV A;  4BBH A;  4Z65 A;  1CP7 A;  5FVJ A;  1MK4 A;  2Z3K A;  4J3G A;  4OC4 A;  3S6G A;  4H6U A;  3V8I A;  1V0C A;  1LOK A;  1IOF A;  2ATR A;  2H5M A;  3K9U A;  2EK8 A;  4CAE A;  2CTC A;  2I00 A;  3ISZ A;  4KOW A;  3PP9 A;  4CGM A;  3HLP A;  4R8F A;  1VHE A;  3FJU A;  4TNU A;  5LRJ A;  3PRT A;  1TKH A;  3K2K A;  5HVF A;  3I3G A;  4QVT A;  3GUX A;  2YND A;  3HUV A;  5AG6 A;  1X12 A;  3MRU A;  3S6F A;  5JPH A;  5LYL A;  1QST A;  1J4J A;  3TO9 A;  5F09 A;  2IQ6 A;  2BO9 A;  2G9D A;  4KOU A;  4NFR A;  2Q7B A;  2QJ8 A;  1P4N A;  1M1D A;  2PIZ A;  2ZEL A;  1YLE A;  2PRB A;  4JD6 A;  5CNP A;  1KUY A;  1F2P A;  2AE6 A;  3R9E A;  2EK9 A;  1Z5R A;  4CAW A;  1RO5 A;  3B3W A;  2EUI A;  2XEG A;  3FMC A;  4QC6 A;  1XOV A;  2F5I A;  2BCO A;  2O4H A;  2P6G A;  5K8M A;  1Q2D A;  4BMH A;  3FVL A;  1WWZ A;  2DXQ A;  3CZX A;  4XNH B;  3S6K A;  2PCU A;  3IJ3 A;  1S7F A;  3MN8 A;  2B5G B;  3FXT A;  3IGR A;  4JYW A;  2YNC C;  4M6H A;  3C26 A;  1TF8 A;  2ZXV A;  4DNC A;  1PYT B;  1X10 A;  2Q0Y A;  4KOS A;  4P44 A;  1ZG7 A;  4KOY A;  4R57 A;  1TKF A;  1VGY A;  3SXN A;  4MHY A;  2PJC A;  2XEI A;  5F48 A;  3EO4 A;  4B12 A;  3S9L A;  2JEW A;  5HVH A;  4UEE A;  2YNC A;  1KWM A;  1IYL A;  4AB7 A; 
#chains in the Genus database with same CATH homology
 4A95 A;  1M4D A;  3N7Z A;  4NEX A;  4AVA A;  5HMN A;  5J8F A;  4QUS A;  4ZGY B;  1QSM A;  4E8O A;  1M4I A;  5KTC A;  5BWA B;  2PDO A;  4XPD B;  3DNS A;  3SXO A;  3TT2 A;  4KSF A;  1IYK A;  4LX9 A;  1Z9U A;  4M3S A;  4MFJ A;  5H86 A;  5G1Z A;  4IF5 A;  3IWG A;  4MFQ A;  3H4Q A;  3D2P A;  2X7B A;  1GHE A;  3LD2 A;  3S6H A;  1XE4 A;  5G22 A;  4A30 A;  3D3S A;  3FRM A;  4U9Z A;  2PSW A;  2Q44 A;  2Q4V A;  2ZW7 A;  1B6B A;  3FBU A;  3JTK A;  4U5Y A;  3H5Z A;  4RS2 A;  3G8W A;  3TE4 A;  4UWJ A;  2O28 A;  2FSR A;  2OU2 A;  2R8V A;  4KLV A;  1ON0 A;  4R9M A;  2D4P A;  1IID A;  2CNS A;  2JDD A;  2Z11 A;  4MFL A;  4MY3 A;  4CYN A;  2VZZ A;  2OZG A;  3BJ8 A;  4ORF A;  4YGO A;  4B10 A;  4PK3 A;  2P0W A;  1OZP A;  2R98 A;  3FNC A;  4JXR A;  4C7I A;  4F6A A;  2VBQ A;  4B5P B;  2WSA A;  3D8P A;  1CJW A;  3JVN A;  4KS9 A;  1XMT A;  4II9 A;  3FB3 A;  4ZBG A;  2GE3 A;  4LUA A;  5AG4 A;  4UFV A;  2Z10 A;  3IU1 A;  4A32 A;  4R87 A;  4FD7 A;  4C2X A;  3T90 A;  4Y49 B;  1I1D A;  2OB0 A;  5A27 A;  5AG5 A;  2WPW A;  4B5O A;  2B4D B;  2CY2 A;  4HKF A;  3TFY A;  1NE9 A;  3BJ7 A;  4FD5 A;  2VI7 A;  2P6F A;  2K5T A;  2Q04 A;  4F0X A;  4PV6 A;  1L0C A;  1S7L A;  3G3S A;  1S3Z A;  4CYO A;  5IV0 A;  5A28 A;  1MJB A;  4KVO E;  3MGD A;  2FS5 A;  4KUA A;  5F46 A;  4H6Z A;  1UFH A;  4CGP A;  4E2A A;  3DDD A;  2A4N A;  3TO6 A;  4KOR A;  4CGN A;  2FCK A;  4ONU A;  2FIW A;  3TCV A;  2REF A;  3EXN A;  5I0C A;  1IIC A;  3B8G A;  4JWP A;  3QAH A;  2FT0 A;  4YRH A;  4KVM E;  4QBJ A;  2AJ6 A;  3EC4 A;  1B87 A;  2PQ8 A;  2B4D A;  2REE A;  4YFJ A;  1S5K A;  5G21 A;  4MFZ A;  5GCN A;  4OAD A;  1XF8 A;  2YNE A;  4UCM A;  3SHP A;  4CAV A;  2Z3M A;  3R1K A;  2Z0Z A;  5F47 A;  1XEB A;  1YX0 A;  1MJA A;  4JXQ A;  5EBV A;  2VXK A;  1K4J A;  4H89 A;  2RC4 A;  3VWD A;  2ZW6 A;  2J8R A;  2CNT A;  3FYN A;  4OLL A;  4UCN A;  4A2Z A;  3CXP A;  4C2Y A;  1ZO0 A;  4X5K A;  3TOA A;  4HNW B;  1PUA A;  5G20 A;  2J8M A;  3PZJ A;  4CYQ A;  1LRZ A;  5HH1 A;  3FIX A;  2GAN A;  5KTD A;  2B4B A;  1YGH A;  5E96 A;  3LOD A;  1VKC A;  2G0B A;  4NXY A;  3TOB A;  1CM0 A;  4L89 A;  3R9F A;  1Y7R A;  3QB8 A;  3RYO A;  4XNH C;  2OZH A;  2G3A A;  1YVK A;  2VZY A;  5EC4 A;  2JEV A;  3TO7 A;  4KUB A;  1BO4 A;  4NF1 A;  4L8A A;  4KOX A;  3F0A A;  5AGE A;  1Q2C A;  4CYP A;  5C82 A;  4NSQ A;  2CNM A;  2QML A;  1VHS A;  4UFX A;  1YR0 A;  4CAX A;  4MHD A;  3DSB A;  4M85 A;  1PU9 A;  4CRY B;  2BSW A;  4CGO A;  2Z3L A;  2Z3P A;  1NMT A;  5C88 A;  1IB1 E;  4R3K A;  3GKR A;  2PR8 A;  3ZJ0 A;  2VQY A;  1KZF A;  1KUX A;  3F5B A;  4HNX B;  1S7K A;  2WUU A;  2ZW4 A;  2PR1 A;  3F8K A;  4RI1 A;  2OZU A;  2JLM A;  4U9Y A;  3E0K A;  4OAE A;  4QB9 A;  4KOT A;  2D4O A;  2QIR A;  1FY7 A;  2B58 A;  3GYA A;  2Q4Y A;  4Q38 A;  4UBR A;  3T9Y A;  1S7N A;  4AG9 A;  2NMT A;  3KKW A;  5F49 A;  1XIX A;  1I21 A;  4MFK A;  4F0Y A;  2VEZ A;  2KCW A;  4KLW A;  1Y9W A;  2B5G A;  3I9S A;  4KSA A;  1N71 A;  1NSL A;  4CRZ B;  1QSN A;  4AVB A;  3TTH A;  5DWN A;  2HQY A;  1QSO A;  3NE7 A;  4B5P A;  4XPD C;  2CXA A;  3VWE A;  3DR8 A;  2DPT A;  3DR6 A;  3D2M A;  4MJ8 A;  4EVY A;  5IB0 A;  2GIV A;  5J8C A;  4MFP A;  5KTA A;  1BOB A;  3EFA A;  1SQH A;  4JLY A;  1MJ9 A;  5IX3 A;  1Q2Y A;  3P2F A;  2PC1 A;  4KZT A;  1QSR A;  2P6E A;  1U6M A;  3W91 A;  2Y0M A;  2R1I A;  1YVO A;  4GS4 A;  4UA3 A;  2BL1 A;  1I12 A;  4I49 A;  2R7H A;  2Z3N A;  1TIQ A;  3IWE A;  4A31 A;  4AG7 A;  2FL4 A;  5AG7 A;  4B14 A;  2FXF A;  2QEC A;  2EVN A;  2HUZ A;  4PK2 A;  1YK3 A;  5ISV A;  4PSX A;  4CGL A;  3R95 A;  2BUE A;  2WPX A;  2BEI A;  4MI4 A;  1M44 A;  5JQ4 A;  2HV2 A;  3W6X A;  4UFW A;  4B13 A;  2B3V A;  1S60 A;  4MBU A;  3R96 A;  1M4G A;  1KUV A;  5DWM A;  4KVX A;  4NCZ A;  3W6S A;  1YRE A;  4C7H A;  2FIA A;  2FE7 A;  3IU2 A;  4FD4 A;  1WK4 A;  4MY0 A;  4IUS A;  2IL4 A;  2ZW5 A;  1Y9K A;  1RXT A;  2OH1 A;  3GY9 A;  3OWC A;  1Z4R A;  3CXQ A;  2JDC A;  4UCP A;  4FD6 A;  2Z3O A;  4KOV A;  2J8N A;  4CAF A;  4XPK A;  4A33 A;  4C68 A;  3A9L A;  4CS0 B;  2B3U A;  5H84 A;  4C2Z A;  3WR7 A;  4Y49 C;  3ZZI A;  4JJX A;  4HNY B;  2YGW A;  2ZPA A;  4R3L A;  3UY5 A;  2C27 A;  1R57 A;  4UWI A;  4B11 A;  3P2H A;  4AVC A;  4XPL A;  2I79 A;  3EY5 A;  3JUW A;  1P0H A;  1Z4E A;  3PGP A;  4PSW A;  3BLN A;  4Q36 A;  2DPS A;  3R9G A;  4E0A A;  3CXS A;  2G3T A;  2ARH A;  4K30 A;  4BBH A;  5FVJ A;  1MK4 A;  2Z3K A;  4J3G A;  3S6G A;  3V8I A;  4H6U A;  1V0C A;  2ATR A;  2H5M A;  3K9U A;  4CAE A;  4KOW A;  2I00 A;  3PP9 A;  4CGM A;  3I3G A;  4QVT A;  5AG6 A;  2YND A;  3S6F A;  5JPH A;  1QST A;  1J4J A;  3TO9 A;  4KOU A;  2Q7B A;  1P4N A;  1M1D A;  1YLE A;  2PRB A;  4JD6 A;  5CNP A;  1KUY A;  3R9E A;  2AE6 A;  4CAW A;  1RO5 A;  2EUI A;  4QC6 A;  2F5I A;  2P6G A;  1Q2D A;  4BMH A;  1WWZ A;  2DXQ A;  4XNH B;  3S6K A;  1S7F A;  2B5G B;  3FXT A;  3IGR A;  2YNC C;  3C26 A;  2ZXV A;  4DNC A;  2Q0Y A;  4KOS A;  4KOY A;  4R57 A;  3SXN A;  3EO4 A;  4B12 A;  2YNC A;  5F48 A;  1IYL A;  4AB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...