2BO9A

Human carboxypeptidase a4 in complex with human latexin.
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
307
structure length
307
Chain Sequence
SSNNFNYGAYHSLEAIYHEMDNIAADFPDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGPHANSEVEVKSVVDFIQKHGNFKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELRDTGTYGFLLPANQIIPTAEETWLGLKTIMEHVRDNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBOXYPEPTIDASE A4
publication title Structure of Human Carboxypeptidase A4 with its Endogenous Protein Inhibitor, Latexin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 118
structure length 307
sequence length 307
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2bo9A00
5JH9A 2PJAA 3BI0A 3VH9A 4TNUA 3TX8A 4UEZA 4A39A 1HEEA 2EWBA 3H8FA 4P10A 3KZWA 1VGYA 2QVPA 1YW6A 1Z5RA 2GU2A 3PB6X 4CPAA 5LRKA 5LRJA 2EK9A 5THWA 1H8LA 1DTDA 2F8HA 2PCUA 3SI1A 8CPAA 3SI2A 2AFSA 4MHYA 4IHMA 3B2YA 1Y0YA 2XEGA 1JQGA 2ZEFA 5HVHA 3KI9A 1KWMA 4OIDA 4PXEA 2XEFA 2ZEPA 3PFEA 4MHNA 2PJBA 5DS0A 4G1PA 3BXMA 4ZY1A 4A38A 2OR4A 3NH4A 3I1UA 3KGQA 1CP7A 4R76A 2CTCA 2F7VA 1PYTB 2PJ3A 4R7MA 1QQ9A 2ZELA 3B3VA 5K8NA 1VHEA 1ZG9A 3GB0A 4PQAA 2AFUA 3DGVA 1ZLIA 4DYOA 3BI1A 1LFWA 2PJ1A 2VL1A 3CPXA 4R6TA 2O53A 1IY7A 4MCRA 4OC2A 1CG2A 2IMOA 3CPAA 1LANA 1OBRA 3B7IA 2EK8A 5JGFA 2AFOA 2ZOGA 3B35A 2GLFA 2JBJA 2CTBA 2PJ9A 4Q7AA 4FBEA 4OKOA 1LAPA 4P4DA 2PIYA 1ZG7A 3L2NA 3NH8A 3SI0A 2PJCA 1NSAA 2C1CA 5ELYA 2AFXA 1Y0RA 1CPXA 4YU9A 2AFMA 3RBUA 3IWWA 3S9NA 1ELMP 1UWYA 3HUVA 1Y7EA 1Q7LA 4NGRA 2CIJA 2HB6A 1TKJA 4P4FA 3SJGA 2PRQA 3WABA 1HDQA 1ARLA 1XMBA 3B3SA 2HC9A 4P6YA 4ZI6A 4O23A 2C6PA 3KHXA 5LYFA 3FECA 1F2PA 3S9MA 2WZNA 3FF3A 2PJ4A 2IQ6A 4KSIA 2ZEOA 4OC0A 4F9UA 4TWEA 4MHPA 4MCSA 2PVWA 3V38A 5CBMA 3B3TA 3PBBA 5HXDA 4MCPA 2ZEEA 3GUXA 4JYWA 3PBEA 2XEIA 2OOTA 2PJ5A 1AYEA 1GYTA 2DEAA 4UEEA 1TKHA 3D7GA 2PJ8A 3ISXA 2ZEDA 1DE4C 4PXCA 1CBXA 5K8OA 5K8PA 4X8IA 1FT7A 5LYLA 4UIBA 2V77A 3PB4X 3CDXA 4FAIA 1TF8A 1R43A 4A94A 3NFZA 3VATA 4FWUA 2G9DA 1BPMA 3FH4A 4PPZA 3D4UA 2ZOFA 3D68A 3D7FA 4ZYQA 3IC1A 4UF4A 3TC8A 2JBKA 4EMEA 1BPNA 3PEIA 4RUHA 1BLLE 3PB7X 4NGNA 3DLJA 4ZY0A 4P45A 1F57A 1M4LA 2Q43A 3KASA 1Z2LA 3LMSA 1ZLHA 1VIXA 4P4JA 3H8EA 4W9YA 1CPSA 4LQGA 2BO9A 2ZENA 3WC5A 1F2OA 1YW4A 4NGSA 3FMCA 2NYQA 5K8MA 2PJ7A 4P4EA 1TF9A 2PJ6A 4MMOA 4P4BA 4P4IA 4BD9A 3SJEA 4JZ0A 4OP4A 2NSMA 2GLJA 1R3NA 4MHZA 4DJLA 2I3CA 1ELLP 4UEFA 5IB9A 3SJFA 4NGPA 1LAMA 4P44A 3LWUA 4PXBA 4H2KA 3RZAA 3PRTA 2PIZA 4NJRA 5LYDA 3SJXA 3KHZA 3WT4A 2GREA 4R8FA 4X2TA 2V8DA 1TKFA 4NFRA 1VHOA 3S9LA 1CP6A 2PJ0A 3FVLA 3D66A 4ZX9A 3VARA 4FUUA 5F09A 2ABZA 4X3RA 1QMUA 3K9TA 2JEWA 2POKA 5I4MA 2C6GA 4ONWA 3PB9X 4NGMA 2IJZA 3GLJA 3D67A 4MXUA 3PFOA 5D29A 2ZEMA 4OMEA 5CPAA 3BHXA 4WJBA 3FX6A 2QJ8A 4EFDA 1FNOA 1XBUA 2RB7A 1Z8LA 4OC3A 2AFWA 3FJUA 4Z65A 1IGBA 1LCPA 2ZEGA 4EWTA 4MRIA 1RTQA 2FVGA 7CPAA 5JM6A 4K3NA 3KR4A 1XFOA 5HVFA 4MCQA 1ZG8A 1TXRA 1XJOA 3PB8X 4YWYA 1PCAA 4OC1A 4NGQA 4PXDA 2BOAA 2C6CA 2V8HA 2WYRA 4UIAA 4GM5A 2PJ2A 2V8GA 3RAMA 3T8WA 3IIBA 3B3CA 3QNVA 1CX8A 1EE3P 4OC5A 2BCOA 2O4HA 5LYIA 4AXVA 2CF4A 4IK2A 1YMEA 3B3WA 3FEDA 5LRGA 3IJ3A 4DUKA 1YSJA 2J9AA 4OC4A 3JRUA 2XEJA 3CT9A 2ZEHA 2ANPA 2RFHA 3ISZA 1BAVA 4B6ZA 3MRUA 2PE3A 1ARMA 4ZY2A 3MN8A 3D7HA 3N5FA 2Q51A 2QYVA 2Q4ZA 3WC7A 6CPAA 4ZX8A 1HDUA 3KR5A 4OIWA 2V8VA 1YLOA 5HVGA 3IEHA 4NGTA 3H8GA 3NH5A 3KQXA 2AFZA 3IO1A 2PVVA 3FEEA 3HLPA 3K2KA 3KL9A 4IAVA 3WC6A 1XRYA 5D8NA 3IFEA 4NJQA 3NA6A 4F9VA 5J1QA 1LOKA 3D7DA 4F8ZA 4A37A 4WWVA 1AMPA 3KQZA 3V7ZA
chains in the Genus database with same CATH superfamily
2B4DA 4U9YA 5JH9A 2YGWA 4JLYA 2PJAA 5DWMA 3BI0A 4DNCA 3VH9A 4TNUA 2PR1A 3TX8A 1P4NA 3IU1A 4KOTA 4UEZA 4MFLA 4A39A 1HEEA 2EWBA 2Z11A 2PR8A 3H8FA 4KSFA 4A95A 4P10A 3KZWA 1VGYA 2QVPA 3I9SA 2WPWA 1YW6A 1Z5RA 2OU2A 2Q4YA 2GU2A 2EUIA 3PB6X 3TT2A 4CPAA 5LRKA 5J8FA 1RO5A 4AB7A 5LRJA 4L8AA 1QSNA 3EO4A 4XPDC 2EK9A 5DWNA 3QAHA 4MI4A 5THWA 2Q44A 3F8KA 1H8LA 1DTDA 2F8HA 3P2FA 3OWCA 2PCUA 3SI1A 2P6GA 8CPAA 4FD5A 4KOYA 4R9MA 2VXKA 4H6UA 3SI2A 2AFSA 4MHYA 4IHMA 3B2YA 3IWEA 1Y0YA 4QC6A 2B3VA 2PDOA 2XEGA 3CXPA 1JQGA 2ZW6A 2ZEFA 2HV2A 2OZGA 2QIRA 5HVHA 3KI9A 1KWMA 1IIDA 4OIDA 4FD4A 4PXEA 1YX0A 2XEFA 2ZEPA 3PFEA 4MHNA 2PJBA 1VHSA 3PZJA 5DS0A 4UFXA 4G1PA 3E0KA 4GXHA 1IOFA 3BXMA 5AG7A 4A38A 4E0AA 4ZY1A 2OR4A 1Q2DA 2BSWA 3NH4A 3I1UA 1XEBA 1KZFA 3KGQA 1CP7A 3TFYA 4R76A 3FB3A 2CTCA 3D2MA 4MFJA 2F7VA 1PYTB 2JDDA 3ZZIA 2PJ3A 4BINA 4R7MA 1QQ9A 3DR6A 2ZELA 2YNCA 1IU8A 2D4PA 3GY9A 3B3VA 4QBJA 5K8NA 1VHEA 2R8VA 3FNCA 1ZG9A 3GB0A 4KOVA 4PQAA 2AFUA 3S6FA 3W91A 4A2ZA 1ZO0A 4X5KA 4KVME 1JWQA 4RS2A 3DGVA 1ZLIA 4DYOA 2CY2A 3BI1A 1LFWA 2PJ1A 2PRBA 2VL1A 3CPXA 3FXTA 2O53A 4R6TA 1IY7A 1Z8XA 3FBUA 2Q7SA 2REFA 3VWDA 3SHPA 4II9A 4GS4A 3C26A 4F6AA 4MCRA 4OC2A 4XPLA 4OADA 1CG2A 4PSWA 4B12A 5GCNA 4F0XA 2IMOA 1IOIA 3CPAA 2OZHA 4R57A 4IF5A 4CAEA 5AGEA 4B11A 3EFAA 1LANA 2Z0ZA 2Q7BA 3MGDA 2OH1A 5HH1A 4B13A 3H5ZA 1I21A 4L89A 1OBRA 3B7IA 4KUBA 1AUGA 4R3LA 2EK8A 5JGFA 2AFOA 4KZTA 4J3GA 4XPKA 4LQ6A 2ZOGA 3B35A 2GLFA 2JBJA 2QMLA 2CTBA 5C82A 2PJ9A 3UY5A 4KVOE 4H6ZA 4Q7AA 4OKOA 1LAPA 4UCPA 3CZXA 3IU2A 4FBEA 2OB0A 3W6XA 4P4DA 2PIYA 2PC1A 1ZG7A 2PSWA 4BMHA 2FS5A 3L2NA 3SXNA 1B6BA 2WUUA 3NH8A 3SI0A 3R9EA 2PJCA 1NSAA 2EVNA 4AVBA 4HNXB 2C1CA 3P2HA 5ELYA 2AFXA 1Y0RA 1CPXA 2FT0A 2Q4VA 4YU9A 2AFMA 3RBUA 3IWWA 3S9NA 1CJWA 1ELMP 1UWYA 1Z8WA 3HUVA 4UWJA 3D8PA 4AVCA 4C2ZA 1Y7EA 1Q7LA 1BO4A 1XMTA 2FL4A 2O28A 3CXQA 4NGRA 5G1ZA 4B5PB 4BD9A 2VZYA 5G21A 5IX3A 4PV6A 2CIJA 2HB6A 1TKJA 1IYKA 2J8RA 4P4FA 3SJGA 1V0CA 2PRQA 4KLVA 4CAFA 4HNWB 3TTHA 4U9ZA 4MFZA 4EVYA 1YR0A 2DXQA 3WABA 3R9GA 1HDQA 4E8OA 1ARLA 1XMBA 3B3SA 2HC9A 1Z9UA 2B5GB 2VI7A 4P6YA 4XNHC 4CYQA 4ZI6A 4HPSA 4O23A 2C6PA 3KHXA 5LYFA 3FECA 1F2PA 5BWAB 3S9MA 1NE9A 2WZNA 2Z3MA 3FF3A 1GHEA 3F5BA 1Q2CA 4M6GA 2FSRA 2PJ4A 2IQ6A 1S7KA 3EXNA 3N7ZA 4KSIA 1VKCA 2ZEOA 1YREA 4KOUA 4ZGYB 2KCWA 3TCVA 2Z3OA 3TO6A 4OC0A 4F9UA 1Z4RA 3R96A 4TWEA 3VWEA 4RN7A 4MHPA 4MCSA 2PVWA 4MFQA 3V38A 5A27A 5CBMA 1S7LA 4UWIA 3B3TA 3CXSA 3PBBA 5HXDA 3BJ7A 4M85A 4FD7A 4KVXA 2C27A 4MCPA 2ZEEA 3A9LA 3GUXA 1X10A 1NSLA 3JUWA 4JYWA 3PBEA 1Q2YA 2XEIA 2OOTA 1S5KA 2PJ5A 3K9UA 1AYEA 1GYTA 2DEAA 1FY7A 5CNPA 3I3GA 4AG9A 2F5IA 1WWZA 2JLMA 2Z3NA 4QUSA 4UEEA 3BLNA 1N71A 3D2PA 5F49A 4C2XA 4B14A 1TKHA 4C7HA 2BEIA 4KORA 3D7GA 2PJ8A 4NXYA 3ISXA 2ZEDA 1DE4C 4PXCA 4CGNA 1CBXA 3TOAA 5K8OA 4QB9A 3TOBA 3IGRA 5K8PA 3FIXA 5E96A 4UBRA 4KLWA 4X8IA 1FT7A 4PSXA 5LYLA 4UIBA 4CAXA 1QSRA 2V77A 3CDXA 2B4DB 3GYAA 3PB4X 2DPSA 2VQYA 4PK3A 1TF8A 1R43A 4A94A 2I79A 4FAIA 2GIVA 3NFZA 4MFKA 3VATA 2G9DA 4FWUA 1BPMA 4XNHB 1Y9WA 2Z10A 5F47A 3FH4A 2VEZA 4PPZA 2J8MA 3D4UA 2ZOFA 3D68A 3PP9A 3D7FA 3T9YA 4ZYQA 3IC1A 3W6SA 4FD6A 4F0YA 4E2AA 4UF4A 3TC8A 2HQYA 2JBKA 4EMEA 1BPNA 3PEIA 2G3AA 3TO9A 4RUHA 1BLLE 3NE8A 3PB7X 4NGNA 2ARHA 3DLJA 1M1DA 2K5TA 1MJ9A 4ZY0A 4P45A 5I0CA 5JQ4A 2B58A 2ZPAA 1F57A 1Y9KA 1M4LA 2Q43A 3KASA 4IUSA 1XOVA 4LX9A 1Z2LA 3LMSA 2JDCA 1ZLHA 3RYOA 2BL1A 1M44A 2ZXVA 1VIXA 4P4JA 4CGLA 3H8EA 2RC4A 4W9YA 1CPSA 1M4IA 4CGMA 2P6EA 4LQGA 2BO9A 2ZENA 3WC5A 1IICA 1LRZA 4A30A 2AJ6A 1F2OA 1YW4A 2BUEA 4NGSA 3FMCA 4KOWA 2NYQA 1PUAA 5K8MA 4JXQA 4C68A 2PJ7A 3S6GA 4P4EA 1A2ZA 1TF9A 1YK3A 4CAWA 4OLLA 1YQEA 2PJ6A 3FRMA 2CXAA 2REEA 3GIUA 4MMOA 4P4BA 4P4IA 1KUXA 4JZ0A 2FIWA 2HUZA 4OP4A 3SJEA 2CNMA 1R57A 4MJ8A 2NSMA 2Z3KA 2GLJA 3R95A 3DR8A 1R3NA 4MHZA 2FCKA 3B8GA 4KUAA 4JJXA 4A33A 1YGHA 4DJLA 4A31A 1CM0A 2I3CA 4CYNA 2P6FA 1ELLP 5G20A 4UEFA 5AG6A 5EMIA 2G3TA 5IB9A 3G8WA 4RI1A 3SJFA 3DNSA 1B87A 4NGPA 1M4GA 1LAMA 4P44A 3PGPA 4CYPA 3LWUA 4PXBA 2I00A 1KUVA 4H2KA 5KTCA 1S7FA 5HMNA 3RZAA 3PRTA 2J8NA 2PIZA 1S3ZA 2B4BA 2Z3PA 4NJRA 3LD2A 3RO0A 5LYDA 2Q0YA 4UFWA 3SJXA 2R7HA 2VZZA 5H86A 1U6MA 3KHZA 3WT4A 2GREA 4KOSA 1XE4A 3TO7A 2PQ8A 2YNEA 1SQHA 1WK4A 5JPHA 4R8FA 4PK2A 2ODFA 2ZW7A 4X2TA 1Z4EA 1TKFA 2V8DA 2ZW5A 4YRHA 4CGPA 4NFRA 3QAYA 1IB1E 5EC4A 1VHOA 2Q04A 4ONUA 3S9LA 2GE3A 1CP6A 4MBUA 2PJ0A 3FVLA 3D66A 2VBQA 2WPXA 4ZX9A 3VARA 5IV0A 4FUUA 1NMTA 4CAVA 5F09A 3H4QA 3D3SA 5EBVA 1XIXA 4NSQA 2R98A 2ABZA 3GKRA 4M6IA 1QMUA 3K9TA 4X3RA 2CNTA 4CS0B 2JEWA 4JXRA 2FE7A 2POKA 4JWPA 1J4JA 5KTAA 5AG5A 5I4MA 2C6GA 4R87A 4ONWA 3PB9X 4NGMA 2IJZA 4QVTA 3T90A 4B5OA 3GLJA 3D67A 4MXUA 1PU9A 3PFOA 5D29A 1OZPA 2ZEMA 2ATRA 4OMEA 5CPAA 2Z3LA 5AG4A 1BOBA 1I12A 3BHXA 3S6KA 2FIAA 4WJBA 3FX6A 2QJ8A 4EFDA 1FNOA 4C2YA 3R9FA 2Y0MA 1XBUA 2RB7A 4BBHA 1Z8LA 2EO8A 4OC3A 3DDDA 2AFWA 3FJUA 4HKFA 1I1DA 1QSTA 4HNYB 4Z65A 5C88A 3FYNA 3ZJ0A 1IGBA 1LCPA 1L0CA 2QECA 2ZEGA 4MFPA 4MRIA 4NF1A 1IYLA 4EWTA 1RTQA 4C7IA 2FVGA 1MJAA 7CPAA 2CNSA 5JM6A 4K3NA 3KR4A 1XFOA 4Y49B 5HVFA 2EBJA 4MCQA 1M4DA 1ZG8A 1TXRA 1XJOA 3PB8X 4YWYA 2DF5A 4UCNA 4UFVA 5KTDA 1PCAA 2YNCC 4OC1A 4NGQA 4PXDA 4NEXA 2BOAA 2C6CA 4UA3A 2D4OA 5G22A 2V8HA 3JVNA 2WYRA 4UIAA 1RXTA 3DSBA 4GM5A 3TE4A 2PJ2A 2V8GA 3RAMA 3V8IA 3T8WA 1QSMA 1MK4A 3IIBA 1Y7RA 1Z8TA 3B3CA 3QNVA 3QB8A 1CX8A 1EE3P 4M3SA 2IL4A 4OC5A 2BCOA 4B5PA 2O4HA 1QSOA 4KS9A 1KUYA 2ZW4A 4MY3A 1S7NA 1S60A 2AE6A 4H89A 4R3KA 5LYIA 4ORFA 4KSAA 4AXVA 2CF4A 4IK2A 5FVJA 1YMEA 3B3WA 1ON0A 3FEDA 3IJ3A 5LRGA 4MY0A 4AVAA 4CGOA 1YSJA 2J9AA 4DUKA 2B5GA 2GFQA 4OC4A 3JRUA 4UCMA 2XEJA 4Q38A 1YLEA 3CT9A 4OAEA 4XPDB 5F48A 2YNDA 2FXFA 1XF8A 4Q36A 2ZEHA 2ANPA 5F46A 3JTKA 2RFHA 3ISZA 1BAVA 4U5YA 1MJBA 4B6ZA 5H84A 3MRUA 3RNZA 4CRYB 3SXOA 2PE3A 4NCZA 1K4JA 1YVKA 3EC4A 4KOXA 1ARMA 4A32A 2WSAA 1YVOA 2H5MA 4MHDA 3MN8A 4ZY2A 3D7HA 3N5FA 3R1KA 2Q51A 2QYVA 2Q4ZA 3WC7A 2P0WA 2DPTA 4LUAA 2NMTA 6CPAA 4ZX8A 1HDUA 3WR7A 3KR5A 4OIWA 2V8VA 1YLOA 4AG7A 5HVGA 1UFHA 5ISVA 3IEHA 3KKWA 4YFJA 4NGTA 2A4NA 4K30A 2X7BA 3H8GA 1X12A 1TIQA 3NH5A 3KQXA 3F0AA 2AFZA 3IO1A 2PVVA 2B3UA 3FEEA 3HLPA 3K2KA 2R1IA 2GANA 3KL9A 4CYOA 3G3SA 3IWGA 4IAVA 3WC6A 4Y49C 2G0BA 1XRYA 5D8NA 4JD6A 3IFEA 2JEVA 3LODA 4NJQA 3NA6A 5A28A 4F9VA 4M6HA 5J1QA 1LOKA 3EY5A 4I49A 3D7DA 4F8ZA 3BJ8A 3LACA 4ZBGA 2OZUA 4A37A 4B10A 4CRZB 3NE7A 5IB0A 4WWVA 1AMPA 3KQZA 3S6HA 3V7ZA 1P0HA 4YGOA 5J8CA
chains in the Genus database with same CATH topology
5JH9A 2PJAA 3BI0A 3VH9A 4TNUA 3TX8A 4UEZA 4A39A 1HEEA 2EWBA 3H8FA 4P10A 3KZWA 1VGYA 2QVPA 1YW6A 1Z5RA 2GU2A 3PB6X 4CPAA 5LRKA 5LRJA 2EK9A 5THWA 1H8LA 1DTDA 2F8HA 2PCUA 3SI1A 8CPAA 3SI2A 2AFSA 4MHYA 4IHMA 3B2YA 1Y0YA 2XEGA 1JQGA 2ZEFA 5HVHA 3KI9A 1KWMA 4OIDA 4PXEA 2XEFA 2ZEPA 3PFEA 4MHNA 2PJBA 5DS0A 4G1PA 3BXMA 4ZY1A 4A38A 2OR4A 3NH4A 3I1UA 3KGQA 1CP7A 4R76A 2CTCA 2F7VA 1PYTB 2PJ3A 4R7MA 1QQ9A 2ZELA 3B3VA 5K8NA 1VHEA 1ZG9A 3GB0A 4PQAA 2AFUA 3DGVA 1ZLIA 4DYOA 3BI1A 1LFWA 2PJ1A 2VL1A 3CPXA 4R6TA 2O53A 1IY7A 4MCRA 4OC2A 1CG2A 2IMOA 3CPAA 1LANA 1OBRA 3B7IA 2EK8A 5JGFA 2AFOA 2ZOGA 3B35A 2GLFA 2JBJA 2CTBA 2PJ9A 4Q7AA 4FBEA 4OKOA 1LAPA 4P4DA 2PIYA 1ZG7A 3L2NA 3NH8A 3SI0A 2PJCA 1NSAA 2C1CA 5ELYA 2AFXA 1Y0RA 1CPXA 4YU9A 2AFMA 3RBUA 3IWWA 3S9NA 1ELMP 1UWYA 3HUVA 1Y7EA 1Q7LA 4NGRA 2CIJA 2HB6A 1TKJA 4P4FA 3SJGA 2PRQA 3WABA 1HDQA 1ARLA 1XMBA 3B3SA 2HC9A 4P6YA 4ZI6A 4O23A 2C6PA 3KHXA 5LYFA 3FECA 1F2PA 3S9MA 2WZNA 3FF3A 2PJ4A 2IQ6A 4KSIA 2ZEOA 4OC0A 4F9UA 4TWEA 4MHPA 4MCSA 2PVWA 3V38A 5CBMA 3B3TA 3PBBA 5HXDA 4MCPA 2ZEEA 3GUXA 4JYWA 3PBEA 2XEIA 2OOTA 2PJ5A 1AYEA 1GYTA 2DEAA 4UEEA 1TKHA 3D7GA 2PJ8A 3ISXA 2ZEDA 1DE4C 4PXCA 1CBXA 5K8OA 5K8PA 4X8IA 1FT7A 5LYLA 4UIBA 2V77A 3PB4X 3CDXA 4FAIA 1TF8A 1R43A 4A94A 3NFZA 3VATA 4FWUA 2G9DA 1BPMA 3FH4A 4PPZA 3D4UA 2ZOFA 3D68A 3D7FA 4ZYQA 3IC1A 4UF4A 3TC8A 2JBKA 4EMEA 1BPNA 3PEIA 4RUHA 1BLLE 3PB7X 4NGNA 3DLJA 4ZY0A 4P45A 1F57A 1M4LA 2Q43A 3KASA 1Z2LA 3LMSA 1ZLHA 1VIXA 4P4JA 3H8EA 4W9YA 1CPSA 4LQGA 2BO9A 2ZENA 3WC5A 1F2OA 1YW4A 4NGSA 3FMCA 2NYQA 5K8MA 2PJ7A 4P4EA 1TF9A 2PJ6A 4MMOA 4P4BA 4P4IA 4BD9A 3SJEA 4JZ0A 4OP4A 2NSMA 2GLJA 1R3NA 4MHZA 4DJLA 2I3CA 1ELLP 4UEFA 5IB9A 3SJFA 4NGPA 1LAMA 4P44A 3LWUA 4PXBA 4H2KA 3RZAA 3PRTA 2PIZA 4NJRA 5LYDA 3SJXA 3KHZA 3WT4A 2GREA 4R8FA 4X2TA 2V8DA 1TKFA 4NFRA 1VHOA 3S9LA 1CP6A 2PJ0A 3FVLA 3D66A 4ZX9A 3VARA 4FUUA 5F09A 2ABZA 4X3RA 1QMUA 3K9TA 2JEWA 2POKA 5I4MA 2C6GA 4ONWA 3PB9X 4NGMA 2IJZA 3GLJA 3D67A 4MXUA 3PFOA 5D29A 2ZEMA 4OMEA 5CPAA 3BHXA 4WJBA 3FX6A 2QJ8A 4EFDA 1FNOA 1XBUA 2RB7A 1Z8LA 4OC3A 2AFWA 3FJUA 4Z65A 1IGBA 1LCPA 2ZEGA 4EWTA 4MRIA 1RTQA 2FVGA 7CPAA 5JM6A 4K3NA 3KR4A 1XFOA 5HVFA 4MCQA 1ZG8A 1TXRA 1XJOA 3PB8X 4YWYA 1PCAA 4OC1A 4NGQA 4PXDA 2BOAA 2C6CA 2V8HA 2WYRA 4UIAA 4GM5A 2PJ2A 2V8GA 3RAMA 3T8WA 3IIBA 3B3CA 3QNVA 1CX8A 1EE3P 4OC5A 2BCOA 2O4HA 5LYIA 4AXVA 2CF4A 4IK2A 1YMEA 3B3WA 3FEDA 5LRGA 3IJ3A 4DUKA 1YSJA 2J9AA 4OC4A 3JRUA 2XEJA 3CT9A 2ZEHA 2ANPA 2RFHA 3ISZA 1BAVA 4B6ZA 3MRUA 2PE3A 1ARMA 4ZY2A 3MN8A 3D7HA 3N5FA 2Q51A 2QYVA 2Q4ZA 3WC7A 6CPAA 4ZX8A 1HDUA 3KR5A 4OIWA 2V8VA 1YLOA 5HVGA 3IEHA 4NGTA 3H8GA 3NH5A 3KQXA 2AFZA 3IO1A 2PVVA 3FEEA 3HLPA 3K2KA 3KL9A 4IAVA 3WC6A 1XRYA 5D8NA 3IFEA 4NJQA 3NA6A 4F9VA 5J1QA 1LOKA 3D7DA 4F8ZA 4A37A 4WWVA 1AMPA 3KQZA 3V7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JH9 A;  2PJA A;  3BI0 A;  3VH9 A;  4TNU A;  3TX8 A;  4UEZ A;  4A39 A;  1HEE A;  2EWB A;  3H8F A;  4P10 A;  3KZW A;  1VGY A;  2QVP A;  1YW6 A;  1Z5R A;  2GU2 A;  3PB6 X;  4CPA A;  5LRK A;  5LRJ A;  2EK9 A;  5THW A;  1H8L A;  1DTD A;  2F8H A;  2PCU A;  3SI1 A;  8CPA A;  3SI2 A;  2AFS A;  4MHY A;  4IHM A;  3B2Y A;  1Y0Y A;  2XEG A;  1JQG A;  2ZEF A;  5HVH A;  3KI9 A;  1KWM A;  4OID A;  4PXE A;  2XEF A;  2ZEP A;  3PFE A;  4MHN A;  2PJB A;  5DS0 A;  4G1P A;  3BXM A;  4ZY1 A;  4A38 A;  2OR4 A;  3NH4 A;  3I1U A;  3KGQ A;  1CP7 A;  4R76 A;  2CTC A;  2F7V A;  1PYT B;  2PJ3 A;  4R7M A;  1QQ9 A;  2ZEL A;  3B3V A;  5K8N A;  1VHE A;  1ZG9 A;  3GB0 A;  4PQA A;  2AFU A;  3DGV A;  1ZLI A;  4DYO A;  3BI1 A;  1LFW A;  2PJ1 A;  2VL1 A;  3CPX A;  4R6T A;  2O53 A;  1IY7 A;  4MCR A;  4OC2 A;  1CG2 A;  2IMO A;  3CPA A;  1LAN A;  1OBR A;  3B7I A;  2EK8 A;  5JGF A;  2AFO A;  2ZOG A;  3B35 A;  2GLF A;  2JBJ A;  2CTB A;  2PJ9 A;  4Q7A A;  4FBE A;  4OKO A;  1LAP A;  4P4D A;  2PIY A;  1ZG7 A;  3L2N A;  3NH8 A;  3SI0 A;  2PJC A;  1NSA A;  2C1C A;  5ELY A;  2AFX A;  1Y0R A;  1CPX A;  4YU9 A;  2AFM A;  3RBU A;  3IWW A;  3S9N A;  1ELM P;  1UWY A;  3HUV A;  1Y7E A;  1Q7L A;  4NGR A;  2CIJ A;  2HB6 A;  1TKJ A;  4P4F A;  3SJG A;  2PRQ A;  3WAB A;  1HDQ A;  1ARL A;  1XMB A;  3B3S A;  2HC9 A;  4P6Y A;  4ZI6 A;  4O23 A;  2C6P A;  3KHX A;  5LYF A;  3FEC A;  1F2P A;  3S9M A;  2WZN A;  3FF3 A;  2PJ4 A;  2IQ6 A;  4KSI A;  2ZEO A;  4OC0 A;  4F9U A;  4TWE A;  4MHP A;  4MCS A;  2PVW A;  3V38 A;  5CBM A;  3B3T A;  3PBB A;  5HXD A;  4MCP A;  2ZEE A;  3GUX A;  4JYW A;  3PBE A;  2XEI A;  2OOT A;  2PJ5 A;  1AYE A;  1GYT A;  2DEA A;  4UEE A;  1TKH A;  3D7G A;  2PJ8 A;  3ISX A;  2ZED A;  1DE4 C;  4PXC A;  1CBX A;  5K8O A;  5K8P A;  4X8I A;  1FT7 A;  5LYL A;  4UIB A;  2V77 A;  3PB4 X;  3CDX A;  4FAI A;  1TF8 A;  1R43 A;  4A94 A;  3NFZ A;  3VAT A;  4FWU A;  2G9D A;  1BPM A;  3FH4 A;  4PPZ A;  3D4U A;  2ZOF A;  3D68 A;  3D7F A;  4ZYQ A;  3IC1 A;  4UF4 A;  3TC8 A;  2JBK A;  4EME A;  1BPN A;  3PEI A;  4RUH A;  1BLL E;  3PB7 X;  4NGN A;  3DLJ A;  4ZY0 A;  4P45 A;  1F57 A;  1M4L A;  2Q43 A;  3KAS A;  1Z2L A;  3LMS A;  1ZLH A;  1VIX A;  4P4J A;  3H8E A;  4W9Y A;  1CPS A;  4LQG A;  2BO9 A;  2ZEN A;  3WC5 A;  1F2O A;  1YW4 A;  4NGS A;  3FMC A;  2NYQ A;  5K8M A;  2PJ7 A;  4P4E A;  1TF9 A;  2PJ6 A;  4MMO A;  4P4B A;  4P4I A;  4BD9 A;  3SJE A;  4JZ0 A;  4OP4 A;  2NSM A;  2GLJ A;  1R3N A;  4MHZ A;  4DJL A;  2I3C A;  1ELL P;  4UEF A;  5IB9 A;  3SJF A;  4NGP A;  1LAM A;  4P44 A;  3LWU A;  4PXB A;  4H2K A;  3RZA A;  3PRT A;  2PIZ A;  4NJR A;  5LYD A;  3SJX A;  3KHZ A;  3WT4 A;  2GRE A;  4R8F A;  4X2T A;  2V8D A;  1TKF A;  4NFR A;  1VHO A;  3S9L A;  1CP6 A;  2PJ0 A;  3FVL A;  3D66 A;  4ZX9 A;  3VAR A;  4FUU A;  5F09 A;  2ABZ A;  4X3R A;  1QMU A;  3K9T A;  2JEW A;  2POK A;  5I4M A;  2C6G A;  4ONW A;  3PB9 X;  4NGM A;  2IJZ A;  3GLJ A;  3D67 A;  4MXU A;  3PFO A;  5D29 A;  2ZEM A;  4OME A;  5CPA A;  3BHX A;  4WJB A;  3FX6 A;  2QJ8 A;  4EFD A;  1FNO A;  1XBU A;  2RB7 A;  1Z8L A;  4OC3 A;  2AFW A;  3FJU A;  4Z65 A;  1IGB A;  1LCP A;  2ZEG A;  4EWT A;  4MRI A;  1RTQ A;  2FVG A;  7CPA A;  5JM6 A;  4K3N A;  3KR4 A;  1XFO A;  5HVF A;  4MCQ A;  1ZG8 A;  1TXR A;  1XJO A;  3PB8 X;  4YWY A;  1PCA A;  4OC1 A;  4NGQ A;  4PXD A;  2BOA A;  2C6C A;  2V8H A;  2WYR A;  4UIA A;  4GM5 A;  2PJ2 A;  2V8G A;  3RAM A;  3T8W A;  3IIB A;  3B3C A;  3QNV A;  1CX8 A;  1EE3 P;  4OC5 A;  2BCO A;  2O4H A;  5LYI A;  4AXV A;  2CF4 A;  4IK2 A;  1YME A;  3B3W A;  3FED A;  5LRG A;  3IJ3 A;  4DUK A;  1YSJ A;  2J9A A;  4OC4 A;  3JRU A;  2XEJ A;  3CT9 A;  2ZEH A;  2ANP A;  2RFH A;  3ISZ A;  1BAV A;  4B6Z A;  3MRU A;  2PE3 A;  1ARM A;  4ZY2 A;  3MN8 A;  3D7H A;  3N5F A;  2Q51 A;  2QYV A;  2Q4Z A;  3WC7 A;  6CPA A;  4ZX8 A;  1HDU A;  3KR5 A;  4OIW A;  2V8V A;  1YLO A;  5HVG A;  3IEH A;  4NGT A;  3H8G A;  3NH5 A;  3KQX A;  2AFZ A;  3IO1 A;  2PVV A;  3FEE A;  3HLP A;  3K2K A;  3KL9 A;  4IAV A;  3WC6 A;  1XRY A;  5D8N A;  3IFE A;  4NJQ A;  3NA6 A;  4F9V A;  5J1Q A;  1LOK A;  3D7D A;  4F8Z A;  4A37 A;  4WWV A;  1AMP A;  3KQZ A;  3V7Z A; 
#chains in the Genus database with same CATH topology
 2B4D A;  4U9Y A;  5JH9 A;  2YGW A;  4JLY A;  2PJA A;  5DWM A;  3BI0 A;  4DNC A;  3VH9 A;  4TNU A;  2PR1 A;  3TX8 A;  1P4N A;  3IU1 A;  4KOT A;  4UEZ A;  4MFL A;  4A39 A;  1HEE A;  2EWB A;  2Z11 A;  2PR8 A;  3H8F A;  4KSF A;  4A95 A;  4P10 A;  3KZW A;  1VGY A;  2QVP A;  3I9S A;  2WPW A;  1YW6 A;  1Z5R A;  2OU2 A;  2Q4Y A;  2GU2 A;  2EUI A;  3PB6 X;  3TT2 A;  4CPA A;  5LRK A;  5J8F A;  1RO5 A;  4AB7 A;  5LRJ A;  4L8A A;  1QSN A;  3EO4 A;  4XPD C;  2EK9 A;  5DWN A;  3QAH A;  4MI4 A;  5THW A;  2Q44 A;  3F8K A;  1H8L A;  1DTD A;  2F8H A;  3P2F A;  3OWC A;  2PCU A;  3SI1 A;  2P6G A;  8CPA A;  4FD5 A;  4KOY A;  4R9M A;  2VXK A;  4H6U A;  3SI2 A;  2AFS A;  4MHY A;  4IHM A;  3B2Y A;  3IWE A;  1Y0Y A;  4QC6 A;  2B3V A;  2PDO A;  2XEG A;  3CXP A;  1JQG A;  2ZW6 A;  2ZEF A;  2HV2 A;  2OZG A;  2QIR A;  5HVH A;  3KI9 A;  1KWM A;  1IID A;  4OID A;  4FD4 A;  4PXE A;  1YX0 A;  2XEF A;  2ZEP A;  3PFE A;  4MHN A;  2PJB A;  1VHS A;  3PZJ A;  5DS0 A;  4UFX A;  4G1P A;  3E0K A;  4GXH A;  1IOF A;  3BXM A;  5AG7 A;  4A38 A;  4E0A A;  4ZY1 A;  2OR4 A;  1Q2D A;  2BSW A;  3NH4 A;  3I1U A;  1XEB A;  1KZF A;  3KGQ A;  1CP7 A;  3TFY A;  4R76 A;  3FB3 A;  2CTC A;  3D2M A;  4MFJ A;  2F7V A;  1PYT B;  2JDD A;  3ZZI A;  2PJ3 A;  4BIN A;  4R7M A;  1QQ9 A;  3DR6 A;  2ZEL A;  2YNC A;  1IU8 A;  2D4P A;  3GY9 A;  3B3V A;  4QBJ A;  5K8N A;  1VHE A;  2R8V A;  3FNC A;  1ZG9 A;  3GB0 A;  4KOV A;  4PQA A;  2AFU A;  3S6F A;  3W91 A;  4A2Z A;  1ZO0 A;  4X5K A;  4KVM E;  1JWQ A;  4RS2 A;  3DGV A;  1ZLI A;  4DYO A;  2CY2 A;  3BI1 A;  1LFW A;  2PJ1 A;  2PRB A;  2VL1 A;  3CPX A;  3FXT A;  2O53 A;  4R6T A;  1IY7 A;  1Z8X A;  3FBU A;  2Q7S A;  2REF A;  3VWD A;  3SHP A;  4II9 A;  4GS4 A;  3C26 A;  4F6A A;  4MCR A;  4OC2 A;  4XPL A;  4OAD A;  1CG2 A;  4PSW A;  4B12 A;  5GCN A;  4F0X A;  2IMO A;  1IOI A;  3CPA A;  2OZH A;  4R57 A;  4IF5 A;  4CAE A;  5AGE A;  4B11 A;  3EFA A;  1LAN A;  2Z0Z A;  2Q7B A;  3MGD A;  2OH1 A;  5HH1 A;  4B13 A;  3H5Z A;  1I21 A;  4L89 A;  1OBR A;  3B7I A;  4KUB A;  1AUG A;  4R3L A;  2EK8 A;  5JGF A;  2AFO A;  4KZT A;  4J3G A;  4XPK A;  4LQ6 A;  2ZOG A;  3B35 A;  2GLF A;  2JBJ A;  2QML A;  2CTB A;  5C82 A;  2PJ9 A;  3UY5 A;  4KVO E;  4H6Z A;  4Q7A A;  4OKO A;  1LAP A;  4UCP A;  3CZX A;  3IU2 A;  4FBE A;  2OB0 A;  3W6X A;  4P4D A;  2PIY A;  2PC1 A;  1ZG7 A;  2PSW A;  4BMH A;  2FS5 A;  3L2N A;  3SXN A;  1B6B A;  2WUU A;  3NH8 A;  3SI0 A;  3R9E A;  2PJC A;  1NSA A;  2EVN A;  4AVB A;  4HNX B;  2C1C A;  3P2H A;  5ELY A;  2AFX A;  1Y0R A;  1CPX A;  2FT0 A;  2Q4V A;  4YU9 A;  2AFM A;  3RBU A;  3IWW A;  3S9N A;  1CJW A;  1ELM P;  1UWY A;  1Z8W A;  3HUV A;  4UWJ A;  3D8P A;  4AVC A;  4C2Z A;  1Y7E A;  1Q7L A;  1BO4 A;  1XMT A;  2FL4 A;  2O28 A;  3CXQ A;  4NGR A;  5G1Z A;  4B5P B;  4BD9 A;  2VZY A;  5G21 A;  5IX3 A;  4PV6 A;  2CIJ A;  2HB6 A;  1TKJ A;  1IYK A;  2J8R A;  4P4F A;  3SJG A;  1V0C A;  2PRQ A;  4KLV A;  4CAF A;  4HNW B;  3TTH A;  4U9Z A;  4MFZ A;  4EVY A;  1YR0 A;  2DXQ A;  3WAB A;  3R9G A;  1HDQ A;  4E8O A;  1ARL A;  1XMB A;  3B3S A;  2HC9 A;  1Z9U A;  2B5G B;  2VI7 A;  4P6Y A;  4XNH C;  4CYQ A;  4ZI6 A;  4HPS A;  4O23 A;  2C6P A;  3KHX A;  5LYF A;  3FEC A;  1F2P A;  5BWA B;  3S9M A;  1NE9 A;  2WZN A;  2Z3M A;  3FF3 A;  1GHE A;  3F5B A;  1Q2C A;  4M6G A;  2FSR A;  2PJ4 A;  2IQ6 A;  1S7K A;  3EXN A;  3N7Z A;  4KSI A;  1VKC A;  2ZEO A;  1YRE A;  4KOU A;  4ZGY B;  2KCW A;  3TCV A;  2Z3O A;  3TO6 A;  4OC0 A;  4F9U A;  1Z4R A;  3R96 A;  4TWE A;  3VWE A;  4RN7 A;  4MHP A;  4MCS A;  2PVW A;  4MFQ A;  3V38 A;  5A27 A;  5CBM A;  1S7L A;  4UWI A;  3B3T A;  3CXS A;  3PBB A;  5HXD A;  3BJ7 A;  4M85 A;  4FD7 A;  4KVX A;  2C27 A;  4MCP A;  2ZEE A;  3A9L A;  3GUX A;  1X10 A;  1NSL A;  3JUW A;  4JYW A;  3PBE A;  1Q2Y A;  2XEI A;  2OOT A;  1S5K A;  2PJ5 A;  3K9U A;  1AYE A;  1GYT A;  2DEA A;  1FY7 A;  5CNP A;  3I3G A;  4AG9 A;  2F5I A;  1WWZ A;  2JLM A;  2Z3N A;  4QUS A;  4UEE A;  3BLN A;  1N71 A;  3D2P A;  5F49 A;  4C2X A;  4B14 A;  1TKH A;  4C7H A;  2BEI A;  4KOR A;  3D7G A;  2PJ8 A;  4NXY A;  3ISX A;  2ZED A;  1DE4 C;  4PXC A;  4CGN A;  1CBX A;  3TOA A;  5K8O A;  4QB9 A;  3TOB A;  3IGR A;  5K8P A;  3FIX A;  5E96 A;  4UBR A;  4KLW A;  4X8I A;  1FT7 A;  4PSX A;  5LYL A;  4UIB A;  4CAX A;  1QSR A;  2V77 A;  3CDX A;  2B4D B;  3GYA A;  3PB4 X;  2DPS A;  2VQY A;  4PK3 A;  1TF8 A;  1R43 A;  4A94 A;  2I79 A;  4FAI A;  2GIV A;  3NFZ A;  4MFK A;  3VAT A;  2G9D A;  4FWU A;  1BPM A;  4XNH B;  1Y9W A;  2Z10 A;  5F47 A;  3FH4 A;  2VEZ A;  4PPZ A;  2J8M A;  3D4U A;  2ZOF A;  3D68 A;  3PP9 A;  3D7F A;  3T9Y A;  4ZYQ A;  3IC1 A;  3W6S A;  4FD6 A;  4F0Y A;  4E2A A;  4UF4 A;  3TC8 A;  2HQY A;  2JBK A;  4EME A;  1BPN A;  3PEI A;  2G3A A;  3TO9 A;  4RUH A;  1BLL E;  3NE8 A;  3PB7 X;  4NGN A;  2ARH A;  3DLJ A;  1M1D A;  2K5T A;  1MJ9 A;  4ZY0 A;  4P45 A;  5I0C A;  5JQ4 A;  2B58 A;  2ZPA A;  1F57 A;  1Y9K A;  1M4L A;  2Q43 A;  3KAS A;  4IUS A;  1XOV A;  4LX9 A;  1Z2L A;  3LMS A;  2JDC A;  1ZLH A;  3RYO A;  2BL1 A;  1M44 A;  2ZXV A;  1VIX A;  4P4J A;  4CGL A;  3H8E A;  2RC4 A;  4W9Y A;  1CPS A;  1M4I A;  4CGM A;  2P6E A;  4LQG A;  2BO9 A;  2ZEN A;  3WC5 A;  1IIC A;  1LRZ A;  4A30 A;  2AJ6 A;  1F2O A;  1YW4 A;  2BUE A;  4NGS A;  3FMC A;  4KOW A;  2NYQ A;  1PUA A;  5K8M A;  4JXQ A;  4C68 A;  2PJ7 A;  3S6G A;  4P4E A;  1A2Z A;  1TF9 A;  1YK3 A;  4CAW A;  4OLL A;  1YQE A;  2PJ6 A;  3FRM A;  2CXA A;  2REE A;  3GIU A;  4MMO A;  4P4B A;  4P4I A;  1KUX A;  4JZ0 A;  2FIW A;  2HUZ A;  4OP4 A;  3SJE A;  2CNM A;  1R57 A;  4MJ8 A;  2NSM A;  2Z3K A;  2GLJ A;  3R95 A;  3DR8 A;  1R3N A;  4MHZ A;  2FCK A;  3B8G A;  4KUA A;  4JJX A;  4A33 A;  1YGH A;  4DJL A;  4A31 A;  1CM0 A;  2I3C A;  4CYN A;  2P6F A;  1ELL P;  5G20 A;  4UEF A;  5AG6 A;  5EMI A;  2G3T A;  5IB9 A;  3G8W A;  4RI1 A;  3SJF A;  3DNS A;  1B87 A;  4NGP A;  1M4G A;  1LAM A;  4P44 A;  3PGP A;  4CYP A;  3LWU A;  4PXB A;  2I00 A;  1KUV A;  4H2K A;  5KTC A;  1S7F A;  5HMN A;  3RZA A;  3PRT A;  2J8N A;  2PIZ A;  1S3Z A;  2B4B A;  2Z3P A;  4NJR A;  3LD2 A;  3RO0 A;  5LYD A;  2Q0Y A;  4UFW A;  3SJX A;  2R7H A;  2VZZ A;  5H86 A;  1U6M A;  3KHZ A;  3WT4 A;  2GRE A;  4KOS A;  1XE4 A;  3TO7 A;  2PQ8 A;  2YNE A;  1SQH A;  1WK4 A;  5JPH A;  4R8F A;  4PK2 A;  2ODF A;  2ZW7 A;  4X2T A;  1Z4E A;  1TKF A;  2V8D A;  2ZW5 A;  4YRH A;  4CGP A;  4NFR A;  3QAY A;  1IB1 E;  5EC4 A;  1VHO A;  2Q04 A;  4ONU A;  3S9L A;  2GE3 A;  1CP6 A;  4MBU A;  2PJ0 A;  3FVL A;  3D66 A;  2VBQ A;  2WPX A;  4ZX9 A;  3VAR A;  5IV0 A;  4FUU A;  1NMT A;  4CAV A;  5F09 A;  3H4Q A;  3D3S A;  5EBV A;  1XIX A;  4NSQ A;  2R98 A;  2ABZ A;  3GKR A;  4M6I A;  1QMU A;  3K9T A;  4X3R A;  2CNT A;  4CS0 B;  2JEW A;  4JXR A;  2FE7 A;  2POK A;  4JWP A;  1J4J A;  5KTA A;  5AG5 A;  5I4M A;  2C6G A;  4R87 A;  4ONW A;  3PB9 X;  4NGM A;  2IJZ A;  4QVT A;  3T90 A;  4B5O A;  3GLJ A;  3D67 A;  4MXU A;  1PU9 A;  3PFO A;  5D29 A;  1OZP A;  2ZEM A;  2ATR A;  4OME A;  5CPA A;  2Z3L A;  5AG4 A;  1BOB A;  1I12 A;  3BHX A;  3S6K A;  2FIA A;  4WJB A;  3FX6 A;  2QJ8 A;  4EFD A;  1FNO A;  4C2Y A;  3R9F A;  2Y0M A;  1XBU A;  2RB7 A;  4BBH A;  1Z8L A;  2EO8 A;  4OC3 A;  3DDD A;  2AFW A;  3FJU A;  4HKF A;  1I1D A;  1QST A;  4HNY B;  4Z65 A;  5C88 A;  3FYN A;  3ZJ0 A;  1IGB A;  1LCP A;  1L0C A;  2QEC A;  2ZEG A;  4MFP A;  4MRI A;  4NF1 A;  1IYL A;  4EWT A;  1RTQ A;  4C7I A;  2FVG A;  1MJA A;  7CPA A;  2CNS A;  5JM6 A;  4K3N A;  3KR4 A;  1XFO A;  4Y49 B;  5HVF A;  2EBJ A;  4MCQ A;  1M4D A;  1ZG8 A;  1TXR A;  1XJO A;  3PB8 X;  4YWY A;  2DF5 A;  4UCN A;  4UFV A;  5KTD A;  1PCA A;  2YNC C;  4OC1 A;  4NGQ A;  4PXD A;  4NEX A;  2BOA A;  2C6C A;  4UA3 A;  2D4O A;  5G22 A;  2V8H A;  3JVN A;  2WYR A;  4UIA A;  1RXT A;  3DSB A;  4GM5 A;  3TE4 A;  2PJ2 A;  2V8G A;  3RAM A;  3V8I A;  3T8W A;  1QSM A;  1MK4 A;  3IIB A;  1Y7R A;  1Z8T A;  3B3C A;  3QNV A;  3QB8 A;  1CX8 A;  1EE3 P;  4M3S A;  2IL4 A;  4OC5 A;  2BCO A;  4B5P A;  2O4H A;  1QSO A;  4KS9 A;  1KUY A;  2ZW4 A;  4MY3 A;  1S7N A;  1S60 A;  2AE6 A;  4H89 A;  4R3K A;  5LYI A;  4ORF A;  4KSA A;  4AXV A;  2CF4 A;  4IK2 A;  5FVJ A;  1YME A;  3B3W A;  1ON0 A;  3FED A;  3IJ3 A;  5LRG A;  4MY0 A;  4AVA A;  4CGO A;  1YSJ A;  2J9A A;  4DUK A;  2B5G A;  2GFQ A;  4OC4 A;  3JRU A;  4UCM A;  2XEJ A;  4Q38 A;  1YLE A;  3CT9 A;  4OAE A;  4XPD B;  5F48 A;  2YND A;  2FXF A;  1XF8 A;  4Q36 A;  2ZEH A;  2ANP A;  5F46 A;  3JTK A;  2RFH A;  3ISZ A;  1BAV A;  4U5Y A;  1MJB A;  4B6Z A;  5H84 A;  3MRU A;  3RNZ A;  4CRY B;  3SXO A;  2PE3 A;  4NCZ A;  1K4J A;  1YVK A;  3EC4 A;  4KOX A;  1ARM A;  4A32 A;  2WSA A;  1YVO A;  2H5M A;  4MHD A;  3MN8 A;  4ZY2 A;  3D7H A;  3N5F A;  3R1K A;  2Q51 A;  2QYV A;  2Q4Z A;  3WC7 A;  2P0W A;  2DPT A;  4LUA A;  2NMT A;  6CPA A;  4ZX8 A;  1HDU A;  3WR7 A;  3KR5 A;  4OIW A;  2V8V A;  1YLO A;  4AG7 A;  5HVG A;  1UFH A;  5ISV A;  3IEH A;  3KKW A;  4YFJ A;  4NGT A;  2A4N A;  4K30 A;  2X7B A;  3H8G A;  1X12 A;  1TIQ A;  3NH5 A;  3KQX A;  3F0A A;  2AFZ A;  3IO1 A;  2PVV A;  2B3U A;  3FEE A;  3HLP A;  3K2K A;  2R1I A;  2GAN A;  3KL9 A;  4CYO A;  3G3S A;  3IWG A;  4IAV A;  3WC6 A;  4Y49 C;  2G0B A;  1XRY A;  5D8N A;  4JD6 A;  3IFE A;  2JEV A;  3LOD A;  4NJQ A;  3NA6 A;  5A28 A;  4F9V A;  4M6H A;  5J1Q A;  1LOK A;  3EY5 A;  4I49 A;  3D7D A;  4F8Z A;  3BJ8 A;  3LAC A;  4ZBG A;  2OZU A;  4A37 A;  4B10 A;  4CRZ B;  3NE7 A;  5IB0 A;  4WWV A;  1AMP A;  3KQZ A;  3S6H A;  3V7Z A;  1P0H A;  4YGO A;  5J8C A; 
#chains in the Genus database with same CATH homology
 5JH9 A;  2PJA A;  3BI0 A;  3VH9 A;  4TNU A;  3TX8 A;  4UEZ A;  4A39 A;  1HEE A;  2EWB A;  3H8F A;  4P10 A;  3KZW A;  1VGY A;  2QVP A;  1YW6 A;  1Z5R A;  2GU2 A;  3PB6 X;  4CPA A;  5LRK A;  5LRJ A;  2EK9 A;  5THW A;  1H8L A;  1DTD A;  2F8H A;  2PCU A;  3SI1 A;  8CPA A;  3SI2 A;  2AFS A;  4MHY A;  4IHM A;  3B2Y A;  1Y0Y A;  2XEG A;  1JQG A;  2ZEF A;  5HVH A;  3KI9 A;  1KWM A;  4OID A;  4PXE A;  2XEF A;  2ZEP A;  3PFE A;  4MHN A;  2PJB A;  5DS0 A;  4G1P A;  3BXM A;  4ZY1 A;  4A38 A;  2OR4 A;  3NH4 A;  3I1U A;  3KGQ A;  1CP7 A;  4R76 A;  2CTC A;  2F7V A;  1PYT B;  2PJ3 A;  4R7M A;  1QQ9 A;  2ZEL A;  3B3V A;  5K8N A;  1VHE A;  1ZG9 A;  3GB0 A;  4PQA A;  2AFU A;  3DGV A;  1ZLI A;  4DYO A;  3BI1 A;  1LFW A;  2PJ1 A;  2VL1 A;  3CPX A;  4R6T A;  2O53 A;  1IY7 A;  4MCR A;  4OC2 A;  1CG2 A;  2IMO A;  3CPA A;  1LAN A;  1OBR A;  3B7I A;  2EK8 A;  5JGF A;  2AFO A;  2ZOG A;  3B35 A;  2GLF A;  2JBJ A;  2CTB A;  2PJ9 A;  4Q7A A;  4FBE A;  4OKO A;  1LAP A;  4P4D A;  2PIY A;  1ZG7 A;  3L2N A;  3NH8 A;  3SI0 A;  2PJC A;  1NSA A;  2C1C A;  5ELY A;  2AFX A;  1Y0R A;  1CPX A;  4YU9 A;  2AFM A;  3RBU A;  3IWW A;  3S9N A;  1ELM P;  1UWY A;  3HUV A;  1Y7E A;  1Q7L A;  4NGR A;  2CIJ A;  2HB6 A;  1TKJ A;  4P4F A;  3SJG A;  2PRQ A;  3WAB A;  1HDQ A;  1ARL A;  1XMB A;  3B3S A;  2HC9 A;  4P6Y A;  4ZI6 A;  4O23 A;  2C6P A;  3KHX A;  5LYF A;  3FEC A;  1F2P A;  3S9M A;  2WZN A;  3FF3 A;  2PJ4 A;  2IQ6 A;  4KSI A;  2ZEO A;  4OC0 A;  4F9U A;  4TWE A;  4MHP A;  4MCS A;  2PVW A;  3V38 A;  5CBM A;  3B3T A;  3PBB A;  5HXD A;  4MCP A;  2ZEE A;  3GUX A;  4JYW A;  3PBE A;  2XEI A;  2OOT A;  2PJ5 A;  1AYE A;  1GYT A;  2DEA A;  4UEE A;  1TKH A;  3D7G A;  2PJ8 A;  3ISX A;  2ZED A;  1DE4 C;  4PXC A;  1CBX A;  5K8O A;  5K8P A;  4X8I A;  1FT7 A;  5LYL A;  4UIB A;  2V77 A;  3PB4 X;  3CDX A;  4FAI A;  1TF8 A;  1R43 A;  4A94 A;  3NFZ A;  3VAT A;  4FWU A;  2G9D A;  1BPM A;  3FH4 A;  4PPZ A;  3D4U A;  2ZOF A;  3D68 A;  3D7F A;  4ZYQ A;  3IC1 A;  4UF4 A;  3TC8 A;  2JBK A;  4EME A;  1BPN A;  3PEI A;  4RUH A;  1BLL E;  3PB7 X;  4NGN A;  3DLJ A;  4ZY0 A;  4P45 A;  1F57 A;  1M4L A;  2Q43 A;  3KAS A;  1Z2L A;  3LMS A;  1ZLH A;  1VIX A;  4P4J A;  3H8E A;  4W9Y A;  1CPS A;  4LQG A;  2BO9 A;  2ZEN A;  3WC5 A;  1F2O A;  1YW4 A;  4NGS A;  3FMC A;  2NYQ A;  5K8M A;  2PJ7 A;  4P4E A;  1TF9 A;  2PJ6 A;  4MMO A;  4P4B A;  4P4I A;  4BD9 A;  3SJE A;  4JZ0 A;  4OP4 A;  2NSM A;  2GLJ A;  1R3N A;  4MHZ A;  4DJL A;  2I3C A;  1ELL P;  4UEF A;  5IB9 A;  3SJF A;  4NGP A;  1LAM A;  4P44 A;  3LWU A;  4PXB A;  4H2K A;  3RZA A;  3PRT A;  2PIZ A;  4NJR A;  5LYD A;  3SJX A;  3KHZ A;  3WT4 A;  2GRE A;  4R8F A;  4X2T A;  2V8D A;  1TKF A;  4NFR A;  1VHO A;  3S9L A;  1CP6 A;  2PJ0 A;  3FVL A;  3D66 A;  4ZX9 A;  3VAR A;  4FUU A;  5F09 A;  2ABZ A;  4X3R A;  1QMU A;  3K9T A;  2JEW A;  2POK A;  5I4M A;  2C6G A;  4ONW A;  3PB9 X;  4NGM A;  2IJZ A;  3GLJ A;  3D67 A;  4MXU A;  3PFO A;  5D29 A;  2ZEM A;  4OME A;  5CPA A;  3BHX A;  4WJB A;  3FX6 A;  2QJ8 A;  4EFD A;  1FNO A;  1XBU A;  2RB7 A;  1Z8L A;  4OC3 A;  2AFW A;  3FJU A;  4Z65 A;  1IGB A;  1LCP A;  2ZEG A;  4EWT A;  4MRI A;  1RTQ A;  2FVG A;  7CPA A;  5JM6 A;  4K3N A;  3KR4 A;  1XFO A;  5HVF A;  4MCQ A;  1ZG8 A;  1TXR A;  1XJO A;  3PB8 X;  4YWY A;  1PCA A;  4OC1 A;  4NGQ A;  4PXD A;  2BOA A;  2C6C A;  2V8H A;  2WYR A;  4UIA A;  4GM5 A;  2PJ2 A;  2V8G A;  3RAM A;  3T8W A;  3IIB A;  3B3C A;  3QNV A;  1CX8 A;  1EE3 P;  4OC5 A;  2BCO A;  2O4H A;  5LYI A;  4AXV A;  2CF4 A;  4IK2 A;  1YME A;  3B3W A;  3FED A;  5LRG A;  3IJ3 A;  4DUK A;  1YSJ A;  2J9A A;  4OC4 A;  3JRU A;  2XEJ A;  3CT9 A;  2ZEH A;  2ANP A;  2RFH A;  3ISZ A;  1BAV A;  4B6Z A;  3MRU A;  2PE3 A;  1ARM A;  4ZY2 A;  3MN8 A;  3D7H A;  3N5F A;  2Q51 A;  2QYV A;  2Q4Z A;  3WC7 A;  6CPA A;  4ZX8 A;  1HDU A;  3KR5 A;  4OIW A;  2V8V A;  1YLO A;  5HVG A;  3IEH A;  4NGT A;  3H8G A;  3NH5 A;  3KQX A;  2AFZ A;  3IO1 A;  2PVV A;  3FEE A;  3HLP A;  3K2K A;  3KL9 A;  4IAV A;  3WC6 A;  1XRY A;  5D8N A;  3IFE A;  4NJQ A;  3NA6 A;  4F9V A;  5J1Q A;  1LOK A;  3D7D A;  4F8Z A;  4A37 A;  4WWV A;  1AMP A;  3KQZ A;  3V7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...