2BO9A

Human carboxypeptidase a4 in complex with human latexin.
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
307
structure length
307
Chain Sequence
SSNNFNYGAYHSLEAIYHEMDNIAADFPDLARRVKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITSILEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEVYHGPHANSEVEVKSVVDFIQKHGNFKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELRDTGTYGFLLPANQIIPTAEETWLGLKTIMEHVRDNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CARBOXYPEPTIDASE A4
publication title Structure of Human Carboxypeptidase A4 with its Endogenous Protein Inhibitor, Latexin.
pubmed doi rcsb
source organism Homo sapiens
total genus 118
structure length 307
sequence length 307
chains with identical sequence C
ec nomenclature
pdb deposition date 2005-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2bo9A00
2ZEHA 1PCAA 3NH5A 3D7HA 4PQAA 1TF9A 5K8OA 6CPAA 1Y7EA 1KWMA 3D67A 2AFMA 4UEFA 1CP7A 4NGTA 4X3RA 2AFOA 2V8DA 2O53A 3LMSA 2IJZA 1CBXA 2PCUA 4P10A 3KASA 4WWVA 2PJ5A 5K8MA 4ZX8A 5F09A 1CX8A 2JBJA 3I1UA 3D7DA 4DUKA 4R6TA 2XEGA 3D68A 3H8GA 5J1QA 3CPXA 3KR5A 4FWUA 3RAMA 1F2OA 4OC1A 3PB7X 4NGNA 2PJ3A 1JQGA 2RFHA 3NH4A 5CBMA 3S9LA 2BOAA 4EMEA 4R8FA 4P4DA 3IO1A 1BLLE 4NGQA 2JBKA 2ZEDA 1Y0YA 2CIJA 4PXEA 2PVVA 3ISXA 2PJ1A 1F2PA 2CF4A 4A37A 1DTDA 3IJ3A 3BI0A 2AFZA 3T8WA 4IAVA 2PRQA 4IHMA 3B3TA 3FF3A 2CTBA 4A94A 2DEAA 4UEZA 1BAVA 4P6YA 3WABA 3TX8A 3B7IA 4EFDA 2PJ6A 2PJ4A 1TKJA 3KL9A 3H8EA 3NFZA 4OIWA 2Q51A 1DE4C 4UF4A 4H2KA 3LWUA 4PXCA 5HVFA 3NA6A 1R3NA 1CPXA 2C6PA 2V8HA 1CPSA 2PJCA 4B6ZA 2GREA 4UIAA 1LOKA 3WT4A 1TF8A 3IC1A 4PXBA 2ZEGA 5I4MA 3GB0A 3SJGA 4MCSA 1ZG9A 3SJFA 2ZOGA 5K8NA 1YMEA 2AFWA 3L2NA 4YU9A 4JZ0A 3ISZA 3MN8A 3KI9A 5D29A 3S9NA 2XEJA 4X2TA 4KSIA 1ZLIA 2F8HA 2NYQA 3SJXA 3KR4A 4OP4A 2RB7A 2CTCA 4TWEA 1ZG8A 2PJAA 4OKOA 1BPNA 1Q7LA 5K8PA 3NH8A 2Q4ZA 1YW4A 3HLPA 7CPAA 3DGVA 5JGFA 3PFOA 4DJLA 2POKA 4OC2A 3IWWA 4WJBA 2GLFA 2IQ6A 4ZX9A 3B2YA 4MCQA 3FX6A 1ARMA 5JH9A 2ZEFA 4P4EA 1LAPA 2JEWA 3B3WA 3KZWA 1NSAA 1OBRA 2V8GA 4GM5A 5HVHA 3KHXA 3B3SA 1FT7A 2PJ0A 8CPAA 3V7ZA 3RBUA 3FECA 1ARLA 3K9TA 4MCRA 3VATA 4P4IA 2XEIA 1QMUA 1UWYA 1EE3P 2OOTA 4ZY0A 4OC0A 4JYWA 4P4BA 4P4FA 2PJBA 1XRYA 1VGYA 2C6GA 1R43A 3SI2A 3WC7A 4PPZA 3FMCA 2J9AA 4UIBA 3PBBA 3FJUA 3JRUA 2ANPA 4P44A 4EWTA 2HB6A 2PJ8A 1M4LA 1FNOA 1ZG7A 1XFOA 1LCPA 5LYIA 1XMBA 2I3CA 2C1CA 1YSJA 1LANA 2ZEEA 4F9VA 3KQXA 2O4HA 2EK9A 2NSMA 2ZEPA 1XJOA 5LYDA 1HDUA 4NGSA 1VHEA 3FH4A 3WC6A 5LYFA 4UEEA 3D7FA 3PB6X 2OR4A 2ZENA 5CPAA 1PYTB 3SI1A 2PIZA 4FBEA 4O23A 4A39A 4PXDA 4OC3A 2ZEMA 3SJEA 2C6CA 1GYTA 3KGQA 4YWYA 4NGRA 1Z2LA 4FAIA 4P4JA 4X8IA 1TXRA 1VHOA 4ZI6A 1HDQA 2G9DA 2QJ8A 2Q43A 5D8NA 4MHYA 3K2KA 2PJ9A 4MCPA 3IEHA 4W9YA 1ELLP 3BI1A 3N5FA 4IK2A 3BXMA 3CPAA 3IFEA 3PFEA 2QVPA 4OMEA 5LRKA 3PB9X 4MRIA 5THWA 2ZEOA 3D66A 4NGMA 3CT9A 2GU2A 3SI0A 4G1PA 4NJRA 2EWBA 3RZAA 3PEIA 1BPMA 1CG2A 4A38A 1LAMA 3TC8A 2F7VA 4MXUA 3PBEA 4NFRA 4RUHA 2ZOFA 4MHZA 4MHPA 4CPAA 3S9MA 5IB9A 1YW6A 2HC9A 4NJQA 1ELMP 1CP6A 4F9UA 3FEEA 1Z5RA 3GUXA 5HXDA 4OIDA 2AFXA 3DLJA 4ZY1A 2PJ7A 1XBUA 3IIBA 1IGBA 1TKHA 2AFSA 1AMPA 5LRGA 3KQZA 5DS0A 2WZNA 4NGPA 3B3VA 2IMOA 1HEEA 2QYVA 2PJ2A 2WYRA 1Z8LA 3PB8X 3HUVA 4MHNA 5LRJA 1YLOA 3GLJA 2BO9A 1IY7A 2FVGA 4ZYQA 2PIYA 3B35A 1LFWA 4AXVA 4ONWA 3KHZA 1ZLHA 1Y0RA 4K3NA 4TNUA 4FUUA 3D7GA 4R76A 4OC5A 2PVWA 3FEDA 3H8FA 2ABZA 3VARA 5ELYA 2V8VA 4ZY2A 3V38A 2AFUA 2EK8A 4OC4A 3WC5A 4R7MA 3CDXA 4F8ZA 5LYLA 2GLJA 2V77A 4P45A 4DYOA 3PRTA 2PE3A 4MMOA 1F57A 4LQGA 1QQ9A 2VL1A 3PB4X 2XEFA 1VIXA 3D4UA 4Z65A 5JM6A 1RTQA 3QNVA 1AYEA 3VH9A 1H8LA 3B3CA 4BD9A 5HVGA 3BHXA 2BCOA 2ZELA 3MRUA 4Q7AA 1TKFA 3FVLA
chains in the Genus database with same CATH superfamily
2REEA 2ZEHA 1YQEA 1PCAA 1X10A 4CRYB 3NH5A 4UWJA 1Z8XA 3D7HA 2EO8A 1M44A 4PQAA 3GY9A 1TF9A 1Y7RA 4UFXA 5K8OA 5KTDA 6CPAA 1Y7EA 4E2AA 4KZTA 1KWMA 1FY7A 3D67A 2AFMA 4KOXA 4UBRA 4UEFA 1CP7A 4NGTA 4X3RA 2AFOA 4ZBGA 4M6GA 4MY3A 4AVAA 2V8DA 2YGWA 4NEXA 2FCKA 2O53A 3LMSA 2IJZA 1Z4EA 4L89A 3UY5A 1CBXA 2PCUA 5IV0A 1B87A 4P10A 3CXQA 3KASA 4WWVA 2PJ5A 5K8MA 4ZX8A 4C2YA 2OZGA 3S6HA 5F09A 1CX8A 1CJWA 2JBJA 3I1UA 4CAEA 1M4IA 3D7DA 4DUKA 3S6FA 1YLEA 4ONUA 2FIAA 4R6TA 2XEGA 3D68A 1KUXA 3H8GA 4UCPA 5G22A 4CAXA 5J1QA 2OH1A 1TIQA 4F0YA 4PV6A 3CPXA 3KR5A 4JLYA 1M1DA 4FWUA 3VWEA 3RAMA 1F2OA 3TO9A 4OC1A 3PB7X 4MFLA 4NGNA 3SHPA 2PJ3A 2HV2A 1JQGA 2RFHA 3NH4A 5CBMA 3S9LA 4JWPA 2BOAA 4EMEA 4R8FA 4P4DA 4XPLA 3IO1A 4PK3A 1PUAA 1M4GA 2FS5A 5J8CA 5I0CA 3QAYA 4KSFA 2Q44A 5HXDA 1BLLE 4NGQA 2JBKA 3ZZIA 2VBQA 2F5IA 4Q36A 2ZEDA 3D2PA 2Z3PA 5E96A 1MK4A 3EXNA 1Y0YA 2FE7A 3TT2A 1LRZA 4CGLA 2CIJA 4PXEA 2PVVA 3ISXA 2PJ1A 3CXSA 1F2PA 2CF4A 4A37A 4U9YA 1DTDA 2RC4A 1IIDA 4UFVA 3IJ3A 3BI0A 2AFZA 1SQHA 2FSRA 3T8WA 5EMIA 4M3SA 4IAVA 1NMTA 2PRQA 2FXFA 4FD6A 4IHMA 4CGMA 1S5KA 3B3TA 3FF3A 4A95A 2CTBA 4A94A 4C68A 2DEAA 4UEZA 5KTCA 1BAVA 4P6YA 2B5GA 2WPXA 3WABA 4B5OA 3TX8A 3B7IA 4XNHB 4H6UA 2JDCA 2VEZA 4EFDA 2PJ6A 3OWCA 4MFPA 2PJ4A 2VZYA 2EVNA 1TKJA 2G0BA 2X7BA 3KL9A 3H8EA 3NFZA 2YNDA 2Q51A 4OIWA 2CXAA 2R7HA 4AG9A 1DE4C 4HKFA 3A9LA 4UF4A 4H2KA 1QSTA 3R9EA 3LWUA 4PXCA 2ZW4A 5HVFA 3NA6A 3S6GA 1IOIA 1R3NA 3TTHA 1CPXA 4MFJA 4XPDB 2C6PA 2YNCA 1MJAA 2V8HA 4QC6A 4KUAA 3S6KA 3GKRA 1CPSA 2PJCA 2WUUA 5H86A 2GREA 4PSWA 4B6ZA 4UIAA 2B4DA 1VHSA 1LOKA 3WT4A 3QAHA 4PK2A 1TF8A 1QSOA 2FL4A 1BOBA 3IC1A 4PXBA 1L0CA 2ZEGA 3EC4A 5I4MA 3D8PA 3DNSA 3GB0A 3FNCA 2PC1A 3KKWA 3SJGA 4MCSA 1ZG9A 3LACA 4A31A 2Q04A 1Z9UA 4Y49C 2Y0MA 3SJFA 2Z3OA 2Z3NA 2ZOGA 2VQYA 5K8NA 4KSAA 1YMEA 2I00A 5ISVA 3G3SA 2AFWA 3L2NA 4CGPA 5AG5A 4YU9A 1IYLA 4JZ0A 5G21A 4AB7A 4KS9A 3ISZA 3MN8A 2FT0A 3KI9A 5D29A 3S9NA 1Y9KA 2XEJA 4FD4A 4X2TA 4KSIA 1ZLIA 1QSNA 2DPTA 2F8HA 2NYQA 3SJXA 2O28A 3KR4A 3PGPA 2RB7A 2CTCA 4GXHA 4OP4A 4QUSA 4IF5A 4TWEA 3TOAA 1ZG8A 2PJAA 2Z3MA 5CNPA 4OKOA 2I79A 1YREA 3FYNA 2JDDA 1BPNA 2OU2A 1Q7LA 2ATRA 2Q7SA 4B10A 5AG6A 5K8PA 4R9MA 3NH8A 4MFKA 1YGHA 1YW4A 2Q4ZA 3HLPA 5A27A 3DGVA 7CPAA 5JGFA 3PFOA 4DJLA 2PRBA 2POKA 3R1KA 4A32A 3FIXA 5A28A 4OC2A 3IWWA 2ZXVA 4WJBA 4A2ZA 4HNXB 1Z4RA 4LQ6A 2GLFA 1IYKA 2IQ6A 1I1DA 1QSRA 4A33A 2AJ6A 4ZX9A 3B2YA 3DR6A 2Z10A 3FX6A 4KOYA 4MCQA 3TFYA 4R87A 1ARMA 2G3TA 3RYOA 4NXYA 4RS2A 5JH9A 1IICA 2ZEFA 4P4EA 3T90A 1X12A 1LAPA 2JEWA 3B3WA 3KZWA 3FB3A 3N7ZA 3TE4A 2PQ8A 3JTKA 2J8RA 1I12A 2CNTA 1NSAA 3SXNA 1K4JA 1OBRA 2V8GA 1IOFA 4GM5A 4U5YA 5AG4A 5HVHA 4KOTA 3FRMA 3PP9A 1XOVA 1BO4A 1S7KA 3R95A 2VXKA 1YVOA 2OB0A 3KHXA 4OLLA 1RO5A 3B3SA 3DR8A 4B5PB 1FT7A 2PJ0A 8CPAA 4R57A 3V7ZA 2EUIA 2PR1A 1WK4A 2Z3LA 3IWGA 2HQYA 3DDDA 3RBUA 3FECA 1ARLA 3G8WA 3K9TA 4MCRA 3VATA 2QECA 4P4IA 2GANA 2XEIA 4OADA 4C7IA 1QMUA 1UWYA 3IWEA 4K30A 4A30A 2VZZA 1EE3P 3QB8A 2OOTA 4ZY0A 4OC0A 4JYWA 4P4BA 1S7NA 3EY5A 4FD5A 4P4FA 2PJBA 1XRYA 1VGYA 2C6GA 1R43A 2FIWA 3SI2A 1Y9WA 2PR8A 3WC7A 4PPZA 3FMCA 1YX0A 4HNYB 2J9AA 5F46A 4CS0B 4UIBA 4CAWA 4NF1A 3PBBA 1IU8A 1Q2YA 4CYPA 3WR7A 3FJUA 4B11A 3JRUA 2Q4VA 2CNMA 2ANPA 4P44A 1IB1E 4EWTA 2HB6A 2PJ8A 4KORA 4C7HA 1M4LA 4OAEA 4CYNA 1FNOA 2WPWA 4ORFA 2R98A 4JXRA 1ZG7A 2Q4YA 4B12A 1XFOA 1QSMA 1LCPA 3MGDA 5LYIA 3NE8A 2YNCC 1XMBA 2B3UA 4CRZB 2I3CA 3W6XA 2C1CA 2R1IA 3CXPA 4AG7A 1XF8A 3R9FA 1YSJA 1LANA 1ZO0A 2ZEEA 4Y49B 4F9VA 5HMNA 2ZW7A 4FD7A 1YVKA 3KQXA 2O4HA 2EK9A 4HPSA 2NSMA 2AE6A 5C82A 4MFZA 1PU9A 2ZEPA 1XE4A 1XJOA 3EFAA 1MJBA 5LYDA 1HDUA 2ZW5A 4YGOA 4EVYA 4NGSA 1VHEA 2Z0ZA 3FH4A 1KZFA 3WC6A 5LYFA 4NSQA 3TO6A 4M6HA 3ZJ0A 5GCNA 1YK3A 3W91A 4UEEA 3D7FA 3PB6X 2OR4A 2ZENA 1M4DA 5CPAA 1PYTB 3SI1A 4KVME 3C26A 2CY2A 2PIZA 4HNWB 1AUGA 2JLMA 5AGEA 2CNSA 4FBEA 3JVNA 5F48A 4O23A 4A39A 3JUWA 4KVXA 4OC3A 1KUYA 4PXDA 2ZEMA 3SJEA 2C6CA 4QBJA 4II9A 1GYTA 3KGQA 4YWYA 4KVOE 2Z3KA 4NGRA 1Z2LA 2IL4A 3VWDA 4FAIA 4P4JA 3H5ZA 4BBHA 4X8IA 1TXRA 1VHOA 4ZI6A 1HDQA 1RXTA 2G9DA 2QJ8A 4MJ8A 2ODFA 2Q43A 5AG7A 3TCVA 4UCMA 5D8NA 4MHYA 3K2KA 3R96A 4R3LA 2PJ9A 4MCPA 3IEHA 4QVTA 4W9YA 1OZPA 1ELLP 3BI1A 4NCZA 3BJ7A 3N5FA 4IK2A 2NMTA 3BXMA 3CPAA 4MI4A 3RO0A 4H6ZA 2ZW6A 3IFEA 3PFEA 2Q7BA 1U6MA 4H89A 4J3GA 2QVPA 5EC4A 4OMEA 4UFWA 3P2FA 5LRKA 5J8FA 4CGOA 1NE9A 3PB9X 4MRIA 5THWA 2ZEOA 3D66A 3F8KA 4NGMA 4ZGYB 2DF5A 2DPSA 3CT9A 2GU2A 3SI0A 3IGRA 4G1PA 4NJRA 2EWBA 3RZAA 4PSXA 2HUZA 3SXOA 3H4QA 2J8MA 3PEIA 4KLWA 1NSLA 4E8OA 1V0CA 1BPMA 1CG2A 2PSWA 4QB9A 4YRHA 4A38A 5BWAB 1LAMA 3TC8A 2F7VA 2H5MA 4MXUA 2ARHA 3I9SA 4F6AA 3FXTA 3TO7A 3LODA 4RI1A 4JJXA 1MJ9A 3PBEA 3F0AA 4JD6A 2B5GB 2YNEA 2ZOFA 4NFRA 4RUHA 1Z8TA 2BEIA 4MHZA 4MHDA 4MHPA 1ON0A 4CPAA 2B3VA 3S9MA 5IB9A 1S7FA 1YW6A 1WWZA 5JPHA 5G1ZA 2HC9A 4NJQA 4AVBA 1ELMP 1CP6A 3PZJA 2P6GA 4F9UA 4DNCA 3T9YA 1KUVA 2DXQA 3FEEA 1Z5RA 2P0WA 2A4NA 2REFA 3GUXA 4OIDA 4XPKA 4LUAA 2AFXA 4IUSA 3DLJA 4ZY1A 1S3ZA 3I3GA 1P4NA 2Z11A 2P6EA 5HH1A 4I49A 4UA3A 2B4DB 2PJ7A 1XBUA 4UCNA 3IIBA 1IGBA 1TKHA 1S60A 2AFSA 2OZHA 3D2MA 1AMPA 1CM0A 5LRGA 4GS4A 1XMTA 3KQZA 5EBVA 4MBUA 3E0KA 5DS0A 3IU1A 2WZNA 3FBUA 4NGPA 3B3VA 3IU2A 2IMOA 1HEEA 2C27A 2QYVA 3TOBA 2PJ2A 4E0AA 4U9ZA 4KUBA 2OZUA 3BLNA 4L8AA 2WYRA 4KOVA 2B58A 1Z8LA 3PB8X 3HUVA 4MHNA 5LRJA 3K9UA 3RNZA 2PDOA 4M6IA 1YLOA 3GLJA 2BL1A 5DWNA 3LD2A 5G20A 2BO9A 4B14A 1IY7A 2QIRA 2ZPAA 2G3AA 2FVGA 4KLVA 4ZYQA 1GHEA 1P0HA 1S7LA 2PIYA 3B35A 3NE7A 1J4JA 3P2HA 1LFWA 4MY0A 5FVJA 3W6SA 3GIUA 4ONWA 4Q38A 4AXVA 4BINA 3KHZA 1ZLHA 1N71A 1Y0RA 4K3NA 4AVCA 4CGNA 4M85A 4TNUA 4FUUA 3D7GA 3CZXA 1R57A 2BUEA 4R76A 1I21A 4OC5A 4C2ZA 5IB0A 1XIXA 5IX3A 2PVWA 4BMHA 1XEBA 4B5PA 3FEDA 3H8FA 2ABZA 3VARA 4CYQA 5ELYA 3DSBA 5C88A 1B6BA 2GFQA 2V8VA 3B8GA 2Q0YA 4ZY2A 4R3KA 4MFQA 2KCWA 3BJ8A 3V38A 1JWQA 4F0XA 2VI7A 2AFUA 2EK8A 4OC4A 3WC5A 4R7MA 3CDXA 4F8ZA 5LYLA 5KTAA 4C2XA 2GLJA 4KOUA 2V77A 4P45A 2JEVA 4DYOA 3PRTA 5F47A 5F49A 2PE3A 2J8NA 2D4PA 2P6FA 3GYAA 4MMOA 1Q2CA 1F57A 1YR0A 4LQGA 1QQ9A 1Z8WA 5JQ4A 4CYOA 3V8IA 2VL1A 2WSAA 3PB4X 2R8VA 2XEFA 4CAFA 4KOWA 2GIVA 1VIXA 3D4UA 4RN7A 1VKCA 4XNHC 2D4OA 5H84A 4Z65A 2QMLA 4UWIA 2K5TA 1UFHA 2B4BA 4LX9A 3EO4A 1RTQA 3QNVA 4JXQA 5JM6A 2EBJA 4KOSA 1AYEA 3VH9A 1H8LA 3B3CA 3F5BA 3R9GA 4BD9A 5HVGA 4YFJA 1A2ZA 3BHXA 2BCOA 4X5KA 2BSWA 2ZELA 2GE3A 3MRUA 5DWMA 4Q7AA 4CAVA 1TKFA 3FVLA 4B13A 1Q2DA 4XPDC 3D3SA
chains in the Genus database with same CATH topology
2ZEHA 1PCAA 3NH5A 3D7HA 4PQAA 1TF9A 5K8OA 6CPAA 1Y7EA 1KWMA 3D67A 2AFMA 4UEFA 1CP7A 4NGTA 4X3RA 2AFOA 2V8DA 2O53A 3LMSA 2IJZA 1CBXA 2PCUA 4P10A 3KASA 4WWVA 2PJ5A 5K8MA 4ZX8A 5F09A 1CX8A 2JBJA 3I1UA 3D7DA 4DUKA 4R6TA 2XEGA 3D68A 3H8GA 5J1QA 3CPXA 3KR5A 4FWUA 3RAMA 1F2OA 4OC1A 3PB7X 4NGNA 2PJ3A 1JQGA 2RFHA 3NH4A 5CBMA 3S9LA 2BOAA 4EMEA 4R8FA 4P4DA 3IO1A 1BLLE 4NGQA 2JBKA 2ZEDA 1Y0YA 2CIJA 4PXEA 2PVVA 3ISXA 2PJ1A 1F2PA 2CF4A 4A37A 1DTDA 3IJ3A 3BI0A 2AFZA 3T8WA 4IAVA 2PRQA 4IHMA 3B3TA 3FF3A 2CTBA 4A94A 2DEAA 4UEZA 1BAVA 4P6YA 3WABA 3TX8A 3B7IA 4EFDA 2PJ6A 2PJ4A 1TKJA 3KL9A 3H8EA 3NFZA 4OIWA 2Q51A 1DE4C 4UF4A 4H2KA 3LWUA 4PXCA 5HVFA 3NA6A 1R3NA 1CPXA 2C6PA 2V8HA 1CPSA 2PJCA 4B6ZA 2GREA 4UIAA 1LOKA 3WT4A 1TF8A 3IC1A 4PXBA 2ZEGA 5I4MA 3GB0A 3SJGA 4MCSA 1ZG9A 3SJFA 2ZOGA 5K8NA 1YMEA 2AFWA 3L2NA 4YU9A 4JZ0A 3ISZA 3MN8A 3KI9A 5D29A 3S9NA 2XEJA 4X2TA 4KSIA 1ZLIA 2F8HA 2NYQA 3SJXA 3KR4A 4OP4A 2RB7A 2CTCA 4TWEA 1ZG8A 2PJAA 4OKOA 1BPNA 1Q7LA 5K8PA 3NH8A 2Q4ZA 1YW4A 3HLPA 7CPAA 3DGVA 5JGFA 3PFOA 4DJLA 2POKA 4OC2A 3IWWA 4WJBA 2GLFA 2IQ6A 4ZX9A 3B2YA 4MCQA 3FX6A 1ARMA 5JH9A 2ZEFA 4P4EA 1LAPA 2JEWA 3B3WA 3KZWA 1NSAA 1OBRA 2V8GA 4GM5A 5HVHA 3KHXA 3B3SA 1FT7A 2PJ0A 8CPAA 3V7ZA 3RBUA 3FECA 1ARLA 3K9TA 4MCRA 3VATA 4P4IA 2XEIA 1QMUA 1UWYA 1EE3P 2OOTA 4ZY0A 4OC0A 4JYWA 4P4BA 4P4FA 2PJBA 1XRYA 1VGYA 2C6GA 1R43A 3SI2A 3WC7A 4PPZA 3FMCA 2J9AA 4UIBA 3PBBA 3FJUA 3JRUA 2ANPA 4P44A 4EWTA 2HB6A 2PJ8A 1M4LA 1FNOA 1ZG7A 1XFOA 1LCPA 5LYIA 1XMBA 2I3CA 2C1CA 1YSJA 1LANA 2ZEEA 4F9VA 3KQXA 2O4HA 2EK9A 2NSMA 2ZEPA 1XJOA 5LYDA 1HDUA 4NGSA 1VHEA 3FH4A 3WC6A 5LYFA 4UEEA 3D7FA 3PB6X 2OR4A 2ZENA 5CPAA 1PYTB 3SI1A 2PIZA 4FBEA 4O23A 4A39A 4PXDA 4OC3A 2ZEMA 3SJEA 2C6CA 1GYTA 3KGQA 4YWYA 4NGRA 1Z2LA 4FAIA 4P4JA 4X8IA 1TXRA 1VHOA 4ZI6A 1HDQA 2G9DA 2QJ8A 2Q43A 5D8NA 4MHYA 3K2KA 2PJ9A 4MCPA 3IEHA 4W9YA 1ELLP 3BI1A 3N5FA 4IK2A 3BXMA 3CPAA 3IFEA 3PFEA 2QVPA 4OMEA 5LRKA 3PB9X 4MRIA 5THWA 2ZEOA 3D66A 4NGMA 3CT9A 2GU2A 3SI0A 4G1PA 4NJRA 2EWBA 3RZAA 3PEIA 1BPMA 1CG2A 4A38A 1LAMA 3TC8A 2F7VA 4MXUA 3PBEA 4NFRA 4RUHA 2ZOFA 4MHZA 4MHPA 4CPAA 3S9MA 5IB9A 1YW6A 2HC9A 4NJQA 1ELMP 1CP6A 4F9UA 3FEEA 1Z5RA 3GUXA 5HXDA 4OIDA 2AFXA 3DLJA 4ZY1A 2PJ7A 1XBUA 3IIBA 1IGBA 1TKHA 2AFSA 1AMPA 5LRGA 3KQZA 5DS0A 2WZNA 4NGPA 3B3VA 2IMOA 1HEEA 2QYVA 2PJ2A 2WYRA 1Z8LA 3PB8X 3HUVA 4MHNA 5LRJA 1YLOA 3GLJA 2BO9A 1IY7A 2FVGA 4ZYQA 2PIYA 3B35A 1LFWA 4AXVA 4ONWA 3KHZA 1ZLHA 1Y0RA 4K3NA 4TNUA 4FUUA 3D7GA 4R76A 4OC5A 2PVWA 3FEDA 3H8FA 2ABZA 3VARA 5ELYA 2V8VA 4ZY2A 3V38A 2AFUA 2EK8A 4OC4A 3WC5A 4R7MA 3CDXA 4F8ZA 5LYLA 2GLJA 2V77A 4P45A 4DYOA 3PRTA 2PE3A 4MMOA 1F57A 4LQGA 1QQ9A 2VL1A 3PB4X 2XEFA 1VIXA 3D4UA 4Z65A 5JM6A 1RTQA 3QNVA 1AYEA 3VH9A 1H8LA 3B3CA 4BD9A 5HVGA 3BHXA 2BCOA 2ZELA 3MRUA 4Q7AA 1TKFA 3FVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEH A;  1PCA A;  3NH5 A;  3D7H A;  4PQA A;  1TF9 A;  5K8O A;  6CPA A;  1Y7E A;  1KWM A;  3D67 A;  2AFM A;  4UEF A;  1CP7 A;  4NGT A;  4X3R A;  2AFO A;  2V8D A;  2O53 A;  3LMS A;  2IJZ A;  1CBX A;  2PCU A;  4P10 A;  3KAS A;  4WWV A;  2PJ5 A;  5K8M A;  4ZX8 A;  5F09 A;  1CX8 A;  2JBJ A;  3I1U A;  3D7D A;  4DUK A;  4R6T A;  2XEG A;  3D68 A;  3H8G A;  5J1Q A;  3CPX A;  3KR5 A;  4FWU A;  3RAM A;  1F2O A;  4OC1 A;  3PB7 X;  4NGN A;  2PJ3 A;  1JQG A;  2RFH A;  3NH4 A;  5CBM A;  3S9L A;  2BOA A;  4EME A;  4R8F A;  4P4D A;  3IO1 A;  1BLL E;  4NGQ A;  2JBK A;  2ZED A;  1Y0Y A;  2CIJ A;  4PXE A;  2PVV A;  3ISX A;  2PJ1 A;  1F2P A;  2CF4 A;  4A37 A;  1DTD A;  3IJ3 A;  3BI0 A;  2AFZ A;  3T8W A;  4IAV A;  2PRQ A;  4IHM A;  3B3T A;  3FF3 A;  2CTB A;  4A94 A;  2DEA A;  4UEZ A;  1BAV A;  4P6Y A;  3WAB A;  3TX8 A;  3B7I A;  4EFD A;  2PJ6 A;  2PJ4 A;  1TKJ A;  3KL9 A;  3H8E A;  3NFZ A;  4OIW A;  2Q51 A;  1DE4 C;  4UF4 A;  4H2K A;  3LWU A;  4PXC A;  5HVF A;  3NA6 A;  1R3N A;  1CPX A;  2C6P A;  2V8H A;  1CPS A;  2PJC A;  4B6Z A;  2GRE A;  4UIA A;  1LOK A;  3WT4 A;  1TF8 A;  3IC1 A;  4PXB A;  2ZEG A;  5I4M A;  3GB0 A;  3SJG A;  4MCS A;  1ZG9 A;  3SJF A;  2ZOG A;  5K8N A;  1YME A;  2AFW A;  3L2N A;  4YU9 A;  4JZ0 A;  3ISZ A;  3MN8 A;  3KI9 A;  5D29 A;  3S9N A;  2XEJ A;  4X2T A;  4KSI A;  1ZLI A;  2F8H A;  2NYQ A;  3SJX A;  3KR4 A;  4OP4 A;  2RB7 A;  2CTC A;  4TWE A;  1ZG8 A;  2PJA A;  4OKO A;  1BPN A;  1Q7L A;  5K8P A;  3NH8 A;  2Q4Z A;  1YW4 A;  3HLP A;  7CPA A;  3DGV A;  5JGF A;  3PFO A;  4DJL A;  2POK A;  4OC2 A;  3IWW A;  4WJB A;  2GLF A;  2IQ6 A;  4ZX9 A;  3B2Y A;  4MCQ A;  3FX6 A;  1ARM A;  5JH9 A;  2ZEF A;  4P4E A;  1LAP A;  2JEW A;  3B3W A;  3KZW A;  1NSA A;  1OBR A;  2V8G A;  4GM5 A;  5HVH A;  3KHX A;  3B3S A;  1FT7 A;  2PJ0 A;  8CPA A;  3V7Z A;  3RBU A;  3FEC A;  1ARL A;  3K9T A;  4MCR A;  3VAT A;  4P4I A;  2XEI A;  1QMU A;  1UWY A;  1EE3 P;  2OOT A;  4ZY0 A;  4OC0 A;  4JYW A;  4P4B A;  4P4F A;  2PJB A;  1XRY A;  1VGY A;  2C6G A;  1R43 A;  3SI2 A;  3WC7 A;  4PPZ A;  3FMC A;  2J9A A;  4UIB A;  3PBB A;  3FJU A;  3JRU A;  2ANP A;  4P44 A;  4EWT A;  2HB6 A;  2PJ8 A;  1M4L A;  1FNO A;  1ZG7 A;  1XFO A;  1LCP A;  5LYI A;  1XMB A;  2I3C A;  2C1C A;  1YSJ A;  1LAN A;  2ZEE A;  4F9V A;  3KQX A;  2O4H A;  2EK9 A;  2NSM A;  2ZEP A;  1XJO A;  5LYD A;  1HDU A;  4NGS A;  1VHE A;  3FH4 A;  3WC6 A;  5LYF A;  4UEE A;  3D7F A;  3PB6 X;  2OR4 A;  2ZEN A;  5CPA A;  1PYT B;  3SI1 A;  2PIZ A;  4FBE A;  4O23 A;  4A39 A;  4PXD A;  4OC3 A;  2ZEM A;  3SJE A;  2C6C A;  1GYT A;  3KGQ A;  4YWY A;  4NGR A;  1Z2L A;  4FAI A;  4P4J A;  4X8I A;  1TXR A;  1VHO A;  4ZI6 A;  1HDQ A;  2G9D A;  2QJ8 A;  2Q43 A;  5D8N A;  4MHY A;  3K2K A;  2PJ9 A;  4MCP A;  3IEH A;  4W9Y A;  1ELL P;  3BI1 A;  3N5F A;  4IK2 A;  3BXM A;  3CPA A;  3IFE A;  3PFE A;  2QVP A;  4OME A;  5LRK A;  3PB9 X;  4MRI A;  5THW A;  2ZEO A;  3D66 A;  4NGM A;  3CT9 A;  2GU2 A;  3SI0 A;  4G1P A;  4NJR A;  2EWB A;  3RZA A;  3PEI A;  1BPM A;  1CG2 A;  4A38 A;  1LAM A;  3TC8 A;  2F7V A;  4MXU A;  3PBE A;  4NFR A;  4RUH A;  2ZOF A;  4MHZ A;  4MHP A;  4CPA A;  3S9M A;  5IB9 A;  1YW6 A;  2HC9 A;  4NJQ A;  1ELM P;  1CP6 A;  4F9U A;  3FEE A;  1Z5R A;  3GUX A;  5HXD A;  4OID A;  2AFX A;  3DLJ A;  4ZY1 A;  2PJ7 A;  1XBU A;  3IIB A;  1IGB A;  1TKH A;  2AFS A;  1AMP A;  5LRG A;  3KQZ A;  5DS0 A;  2WZN A;  4NGP A;  3B3V A;  2IMO A;  1HEE A;  2QYV A;  2PJ2 A;  2WYR A;  1Z8L A;  3PB8 X;  3HUV A;  4MHN A;  5LRJ A;  1YLO A;  3GLJ A;  2BO9 A;  1IY7 A;  2FVG A;  4ZYQ A;  2PIY A;  3B35 A;  1LFW A;  4AXV A;  4ONW A;  3KHZ A;  1ZLH A;  1Y0R A;  4K3N A;  4TNU A;  4FUU A;  3D7G A;  4R76 A;  4OC5 A;  2PVW A;  3FED A;  3H8F A;  2ABZ A;  3VAR A;  5ELY A;  2V8V A;  4ZY2 A;  3V38 A;  2AFU A;  2EK8 A;  4OC4 A;  3WC5 A;  4R7M A;  3CDX A;  4F8Z A;  5LYL A;  2GLJ A;  2V77 A;  4P45 A;  4DYO A;  3PRT A;  2PE3 A;  4MMO A;  1F57 A;  4LQG A;  1QQ9 A;  2VL1 A;  3PB4 X;  2XEF A;  1VIX A;  3D4U A;  4Z65 A;  5JM6 A;  1RTQ A;  3QNV A;  1AYE A;  3VH9 A;  1H8L A;  3B3C A;  4BD9 A;  5HVG A;  3BHX A;  2BCO A;  2ZEL A;  3MRU A;  4Q7A A;  1TKF A;  3FVL A; 
#chains in the Genus database with same CATH topology
 2REE A;  2ZEH A;  1YQE A;  1PCA A;  1X10 A;  4CRY B;  3NH5 A;  4UWJ A;  1Z8X A;  3D7H A;  2EO8 A;  1M44 A;  4PQA A;  3GY9 A;  1TF9 A;  1Y7R A;  4UFX A;  5K8O A;  5KTD A;  6CPA A;  1Y7E A;  4E2A A;  4KZT A;  1KWM A;  1FY7 A;  3D67 A;  2AFM A;  4KOX A;  4UBR A;  4UEF A;  1CP7 A;  4NGT A;  4X3R A;  2AFO A;  4ZBG A;  4M6G A;  4MY3 A;  4AVA A;  2V8D A;  2YGW A;  4NEX A;  2FCK A;  2O53 A;  3LMS A;  2IJZ A;  1Z4E A;  4L89 A;  3UY5 A;  1CBX A;  2PCU A;  5IV0 A;  1B87 A;  4P10 A;  3CXQ A;  3KAS A;  4WWV A;  2PJ5 A;  5K8M A;  4ZX8 A;  4C2Y A;  2OZG A;  3S6H A;  5F09 A;  1CX8 A;  1CJW A;  2JBJ A;  3I1U A;  4CAE A;  1M4I A;  3D7D A;  4DUK A;  3S6F A;  1YLE A;  4ONU A;  2FIA A;  4R6T A;  2XEG A;  3D68 A;  1KUX A;  3H8G A;  4UCP A;  5G22 A;  4CAX A;  5J1Q A;  2OH1 A;  1TIQ A;  4F0Y A;  4PV6 A;  3CPX A;  3KR5 A;  4JLY A;  1M1D A;  4FWU A;  3VWE A;  3RAM A;  1F2O A;  3TO9 A;  4OC1 A;  3PB7 X;  4MFL A;  4NGN A;  3SHP A;  2PJ3 A;  2HV2 A;  1JQG A;  2RFH A;  3NH4 A;  5CBM A;  3S9L A;  4JWP A;  2BOA A;  4EME A;  4R8F A;  4P4D A;  4XPL A;  3IO1 A;  4PK3 A;  1PUA A;  1M4G A;  2FS5 A;  5J8C A;  5I0C A;  3QAY A;  4KSF A;  2Q44 A;  5HXD A;  1BLL E;  4NGQ A;  2JBK A;  3ZZI A;  2VBQ A;  2F5I A;  4Q36 A;  2ZED A;  3D2P A;  2Z3P A;  5E96 A;  1MK4 A;  3EXN A;  1Y0Y A;  2FE7 A;  3TT2 A;  1LRZ A;  4CGL A;  2CIJ A;  4PXE A;  2PVV A;  3ISX A;  2PJ1 A;  3CXS A;  1F2P A;  2CF4 A;  4A37 A;  4U9Y A;  1DTD A;  2RC4 A;  1IID A;  4UFV A;  3IJ3 A;  3BI0 A;  2AFZ A;  1SQH A;  2FSR A;  3T8W A;  5EMI A;  4M3S A;  4IAV A;  1NMT A;  2PRQ A;  2FXF A;  4FD6 A;  4IHM A;  4CGM A;  1S5K A;  3B3T A;  3FF3 A;  4A95 A;  2CTB A;  4A94 A;  4C68 A;  2DEA A;  4UEZ A;  5KTC A;  1BAV A;  4P6Y A;  2B5G A;  2WPX A;  3WAB A;  4B5O A;  3TX8 A;  3B7I A;  4XNH B;  4H6U A;  2JDC A;  2VEZ A;  4EFD A;  2PJ6 A;  3OWC A;  4MFP A;  2PJ4 A;  2VZY A;  2EVN A;  1TKJ A;  2G0B A;  2X7B A;  3KL9 A;  3H8E A;  3NFZ A;  2YND A;  2Q51 A;  4OIW A;  2CXA A;  2R7H A;  4AG9 A;  1DE4 C;  4HKF A;  3A9L A;  4UF4 A;  4H2K A;  1QST A;  3R9E A;  3LWU A;  4PXC A;  2ZW4 A;  5HVF A;  3NA6 A;  3S6G A;  1IOI A;  1R3N A;  3TTH A;  1CPX A;  4MFJ A;  4XPD B;  2C6P A;  2YNC A;  1MJA A;  2V8H A;  4QC6 A;  4KUA A;  3S6K A;  3GKR A;  1CPS A;  2PJC A;  2WUU A;  5H86 A;  2GRE A;  4PSW A;  4B6Z A;  4UIA A;  2B4D A;  1VHS A;  1LOK A;  3WT4 A;  3QAH A;  4PK2 A;  1TF8 A;  1QSO A;  2FL4 A;  1BOB A;  3IC1 A;  4PXB A;  1L0C A;  2ZEG A;  3EC4 A;  5I4M A;  3D8P A;  3DNS A;  3GB0 A;  3FNC A;  2PC1 A;  3KKW A;  3SJG A;  4MCS A;  1ZG9 A;  3LAC A;  4A31 A;  2Q04 A;  1Z9U A;  4Y49 C;  2Y0M A;  3SJF A;  2Z3O A;  2Z3N A;  2ZOG A;  2VQY A;  5K8N A;  4KSA A;  1YME A;  2I00 A;  5ISV A;  3G3S A;  2AFW A;  3L2N A;  4CGP A;  5AG5 A;  4YU9 A;  1IYL A;  4JZ0 A;  5G21 A;  4AB7 A;  4KS9 A;  3ISZ A;  3MN8 A;  2FT0 A;  3KI9 A;  5D29 A;  3S9N A;  1Y9K A;  2XEJ A;  4FD4 A;  4X2T A;  4KSI A;  1ZLI A;  1QSN A;  2DPT A;  2F8H A;  2NYQ A;  3SJX A;  2O28 A;  3KR4 A;  3PGP A;  2RB7 A;  2CTC A;  4GXH A;  4OP4 A;  4QUS A;  4IF5 A;  4TWE A;  3TOA A;  1ZG8 A;  2PJA A;  2Z3M A;  5CNP A;  4OKO A;  2I79 A;  1YRE A;  3FYN A;  2JDD A;  1BPN A;  2OU2 A;  1Q7L A;  2ATR A;  2Q7S A;  4B10 A;  5AG6 A;  5K8P A;  4R9M A;  3NH8 A;  4MFK A;  1YGH A;  1YW4 A;  2Q4Z A;  3HLP A;  5A27 A;  3DGV A;  7CPA A;  5JGF A;  3PFO A;  4DJL A;  2PRB A;  2POK A;  3R1K A;  4A32 A;  3FIX A;  5A28 A;  4OC2 A;  3IWW A;  2ZXV A;  4WJB A;  4A2Z A;  4HNX B;  1Z4R A;  4LQ6 A;  2GLF A;  1IYK A;  2IQ6 A;  1I1D A;  1QSR A;  4A33 A;  2AJ6 A;  4ZX9 A;  3B2Y A;  3DR6 A;  2Z10 A;  3FX6 A;  4KOY A;  4MCQ A;  3TFY A;  4R87 A;  1ARM A;  2G3T A;  3RYO A;  4NXY A;  4RS2 A;  5JH9 A;  1IIC A;  2ZEF A;  4P4E A;  3T90 A;  1X12 A;  1LAP A;  2JEW A;  3B3W A;  3KZW A;  3FB3 A;  3N7Z A;  3TE4 A;  2PQ8 A;  3JTK A;  2J8R A;  1I12 A;  2CNT A;  1NSA A;  3SXN A;  1K4J A;  1OBR A;  2V8G A;  1IOF A;  4GM5 A;  4U5Y A;  5AG4 A;  5HVH A;  4KOT A;  3FRM A;  3PP9 A;  1XOV A;  1BO4 A;  1S7K A;  3R95 A;  2VXK A;  1YVO A;  2OB0 A;  3KHX A;  4OLL A;  1RO5 A;  3B3S A;  3DR8 A;  4B5P B;  1FT7 A;  2PJ0 A;  8CPA A;  4R57 A;  3V7Z A;  2EUI A;  2PR1 A;  1WK4 A;  2Z3L A;  3IWG A;  2HQY A;  3DDD A;  3RBU A;  3FEC A;  1ARL A;  3G8W A;  3K9T A;  4MCR A;  3VAT A;  2QEC A;  4P4I A;  2GAN A;  2XEI A;  4OAD A;  4C7I A;  1QMU A;  1UWY A;  3IWE A;  4K30 A;  4A30 A;  2VZZ A;  1EE3 P;  3QB8 A;  2OOT A;  4ZY0 A;  4OC0 A;  4JYW A;  4P4B A;  1S7N A;  3EY5 A;  4FD5 A;  4P4F A;  2PJB A;  1XRY A;  1VGY A;  2C6G A;  1R43 A;  2FIW A;  3SI2 A;  1Y9W A;  2PR8 A;  3WC7 A;  4PPZ A;  3FMC A;  1YX0 A;  4HNY B;  2J9A A;  5F46 A;  4CS0 B;  4UIB A;  4CAW A;  4NF1 A;  3PBB A;  1IU8 A;  1Q2Y A;  4CYP A;  3WR7 A;  3FJU A;  4B11 A;  3JRU A;  2Q4V A;  2CNM A;  2ANP A;  4P44 A;  1IB1 E;  4EWT A;  2HB6 A;  2PJ8 A;  4KOR A;  4C7H A;  1M4L A;  4OAE A;  4CYN A;  1FNO A;  2WPW A;  4ORF A;  2R98 A;  4JXR A;  1ZG7 A;  2Q4Y A;  4B12 A;  1XFO A;  1QSM A;  1LCP A;  3MGD A;  5LYI A;  3NE8 A;  2YNC C;  1XMB A;  2B3U A;  4CRZ B;  2I3C A;  3W6X A;  2C1C A;  2R1I A;  3CXP A;  4AG7 A;  1XF8 A;  3R9F A;  1YSJ A;  1LAN A;  1ZO0 A;  2ZEE A;  4Y49 B;  4F9V A;  5HMN A;  2ZW7 A;  4FD7 A;  1YVK A;  3KQX A;  2O4H A;  2EK9 A;  4HPS A;  2NSM A;  2AE6 A;  5C82 A;  4MFZ A;  1PU9 A;  2ZEP A;  1XE4 A;  1XJO A;  3EFA A;  1MJB A;  5LYD A;  1HDU A;  2ZW5 A;  4YGO A;  4EVY A;  4NGS A;  1VHE A;  2Z0Z A;  3FH4 A;  1KZF A;  3WC6 A;  5LYF A;  4NSQ A;  3TO6 A;  4M6H A;  3ZJ0 A;  5GCN A;  1YK3 A;  3W91 A;  4UEE A;  3D7F A;  3PB6 X;  2OR4 A;  2ZEN A;  1M4D A;  5CPA A;  1PYT B;  3SI1 A;  4KVM E;  3C26 A;  2CY2 A;  2PIZ A;  4HNW B;  1AUG A;  2JLM A;  5AGE A;  2CNS A;  4FBE A;  3JVN A;  5F48 A;  4O23 A;  4A39 A;  3JUW A;  4KVX A;  4OC3 A;  1KUY A;  4PXD A;  2ZEM A;  3SJE A;  2C6C A;  4QBJ A;  4II9 A;  1GYT A;  3KGQ A;  4YWY A;  4KVO E;  2Z3K A;  4NGR A;  1Z2L A;  2IL4 A;  3VWD A;  4FAI A;  4P4J A;  3H5Z A;  4BBH A;  4X8I A;  1TXR A;  1VHO A;  4ZI6 A;  1HDQ A;  1RXT A;  2G9D A;  2QJ8 A;  4MJ8 A;  2ODF A;  2Q43 A;  5AG7 A;  3TCV A;  4UCM A;  5D8N A;  4MHY A;  3K2K A;  3R96 A;  4R3L A;  2PJ9 A;  4MCP A;  3IEH A;  4QVT A;  4W9Y A;  1OZP A;  1ELL P;  3BI1 A;  4NCZ A;  3BJ7 A;  3N5F A;  4IK2 A;  2NMT A;  3BXM A;  3CPA A;  4MI4 A;  3RO0 A;  4H6Z A;  2ZW6 A;  3IFE A;  3PFE A;  2Q7B A;  1U6M A;  4H89 A;  4J3G A;  2QVP A;  5EC4 A;  4OME A;  4UFW A;  3P2F A;  5LRK A;  5J8F A;  4CGO A;  1NE9 A;  3PB9 X;  4MRI A;  5THW A;  2ZEO A;  3D66 A;  3F8K A;  4NGM A;  4ZGY B;  2DF5 A;  2DPS A;  3CT9 A;  2GU2 A;  3SI0 A;  3IGR A;  4G1P A;  4NJR A;  2EWB A;  3RZA A;  4PSX A;  2HUZ A;  3SXO A;  3H4Q A;  2J8M A;  3PEI A;  4KLW A;  1NSL A;  4E8O A;  1V0C A;  1BPM A;  1CG2 A;  2PSW A;  4QB9 A;  4YRH A;  4A38 A;  5BWA B;  1LAM A;  3TC8 A;  2F7V A;  2H5M A;  4MXU A;  2ARH A;  3I9S A;  4F6A A;  3FXT A;  3TO7 A;  3LOD A;  4RI1 A;  4JJX A;  1MJ9 A;  3PBE A;  3F0A A;  4JD6 A;  2B5G B;  2YNE A;  2ZOF A;  4NFR A;  4RUH A;  1Z8T A;  2BEI A;  4MHZ A;  4MHD A;  4MHP A;  1ON0 A;  4CPA A;  2B3V A;  3S9M A;  5IB9 A;  1S7F A;  1YW6 A;  1WWZ A;  5JPH A;  5G1Z A;  2HC9 A;  4NJQ A;  4AVB A;  1ELM P;  1CP6 A;  3PZJ A;  2P6G A;  4F9U A;  4DNC A;  3T9Y A;  1KUV A;  2DXQ A;  3FEE A;  1Z5R A;  2P0W A;  2A4N A;  2REF A;  3GUX A;  4OID A;  4XPK A;  4LUA A;  2AFX A;  4IUS A;  3DLJ A;  4ZY1 A;  1S3Z A;  3I3G A;  1P4N A;  2Z11 A;  2P6E A;  5HH1 A;  4I49 A;  4UA3 A;  2B4D B;  2PJ7 A;  1XBU A;  4UCN A;  3IIB A;  1IGB A;  1TKH A;  1S60 A;  2AFS A;  2OZH A;  3D2M A;  1AMP A;  1CM0 A;  5LRG A;  4GS4 A;  1XMT A;  3KQZ A;  5EBV A;  4MBU A;  3E0K A;  5DS0 A;  3IU1 A;  2WZN A;  3FBU A;  4NGP A;  3B3V A;  3IU2 A;  2IMO A;  1HEE A;  2C27 A;  2QYV A;  3TOB A;  2PJ2 A;  4E0A A;  4U9Z A;  4KUB A;  2OZU A;  3BLN A;  4L8A A;  2WYR A;  4KOV A;  2B58 A;  1Z8L A;  3PB8 X;  3HUV A;  4MHN A;  5LRJ A;  3K9U A;  3RNZ A;  2PDO A;  4M6I A;  1YLO A;  3GLJ A;  2BL1 A;  5DWN A;  3LD2 A;  5G20 A;  2BO9 A;  4B14 A;  1IY7 A;  2QIR A;  2ZPA A;  2G3A A;  2FVG A;  4KLV A;  4ZYQ A;  1GHE A;  1P0H A;  1S7L A;  2PIY A;  3B35 A;  3NE7 A;  1J4J A;  3P2H A;  1LFW A;  4MY0 A;  5FVJ A;  3W6S A;  3GIU A;  4ONW A;  4Q38 A;  4AXV A;  4BIN A;  3KHZ A;  1ZLH A;  1N71 A;  1Y0R A;  4K3N A;  4AVC A;  4CGN A;  4M85 A;  4TNU A;  4FUU A;  3D7G A;  3CZX A;  1R57 A;  2BUE A;  4R76 A;  1I21 A;  4OC5 A;  4C2Z A;  5IB0 A;  1XIX A;  5IX3 A;  2PVW A;  4BMH A;  1XEB A;  4B5P A;  3FED A;  3H8F A;  2ABZ A;  3VAR A;  4CYQ A;  5ELY A;  3DSB A;  5C88 A;  1B6B A;  2GFQ A;  2V8V A;  3B8G A;  2Q0Y A;  4ZY2 A;  4R3K A;  4MFQ A;  2KCW A;  3BJ8 A;  3V38 A;  1JWQ A;  4F0X A;  2VI7 A;  2AFU A;  2EK8 A;  4OC4 A;  3WC5 A;  4R7M A;  3CDX A;  4F8Z A;  5LYL A;  5KTA A;  4C2X A;  2GLJ A;  4KOU A;  2V77 A;  4P45 A;  2JEV A;  4DYO A;  3PRT A;  5F47 A;  5F49 A;  2PE3 A;  2J8N A;  2D4P A;  2P6F A;  3GYA A;  4MMO A;  1Q2C A;  1F57 A;  1YR0 A;  4LQG A;  1QQ9 A;  1Z8W A;  5JQ4 A;  4CYO A;  3V8I A;  2VL1 A;  2WSA A;  3PB4 X;  2R8V A;  2XEF A;  4CAF A;  4KOW A;  2GIV A;  1VIX A;  3D4U A;  4RN7 A;  1VKC A;  4XNH C;  2D4O A;  5H84 A;  4Z65 A;  2QML A;  4UWI A;  2K5T A;  1UFH A;  2B4B A;  4LX9 A;  3EO4 A;  1RTQ A;  3QNV A;  4JXQ A;  5JM6 A;  2EBJ A;  4KOS A;  1AYE A;  3VH9 A;  1H8L A;  3B3C A;  3F5B A;  3R9G A;  4BD9 A;  5HVG A;  4YFJ A;  1A2Z A;  3BHX A;  2BCO A;  4X5K A;  2BSW A;  2ZEL A;  2GE3 A;  3MRU A;  5DWM A;  4Q7A A;  4CAV A;  1TKF A;  3FVL A;  4B13 A;  1Q2D A;  4XPD C;  3D3S A; 
#chains in the Genus database with same CATH homology
 2ZEH A;  1PCA A;  3NH5 A;  3D7H A;  4PQA A;  1TF9 A;  5K8O A;  6CPA A;  1Y7E A;  1KWM A;  3D67 A;  2AFM A;  4UEF A;  1CP7 A;  4NGT A;  4X3R A;  2AFO A;  2V8D A;  2O53 A;  3LMS A;  2IJZ A;  1CBX A;  2PCU A;  4P10 A;  3KAS A;  4WWV A;  2PJ5 A;  5K8M A;  4ZX8 A;  5F09 A;  1CX8 A;  2JBJ A;  3I1U A;  3D7D A;  4DUK A;  4R6T A;  2XEG A;  3D68 A;  3H8G A;  5J1Q A;  3CPX A;  3KR5 A;  4FWU A;  3RAM A;  1F2O A;  4OC1 A;  3PB7 X;  4NGN A;  2PJ3 A;  1JQG A;  2RFH A;  3NH4 A;  5CBM A;  3S9L A;  2BOA A;  4EME A;  4R8F A;  4P4D A;  3IO1 A;  1BLL E;  4NGQ A;  2JBK A;  2ZED A;  1Y0Y A;  2CIJ A;  4PXE A;  2PVV A;  3ISX A;  2PJ1 A;  1F2P A;  2CF4 A;  4A37 A;  1DTD A;  3IJ3 A;  3BI0 A;  2AFZ A;  3T8W A;  4IAV A;  2PRQ A;  4IHM A;  3B3T A;  3FF3 A;  2CTB A;  4A94 A;  2DEA A;  4UEZ A;  1BAV A;  4P6Y A;  3WAB A;  3TX8 A;  3B7I A;  4EFD A;  2PJ6 A;  2PJ4 A;  1TKJ A;  3KL9 A;  3H8E A;  3NFZ A;  4OIW A;  2Q51 A;  1DE4 C;  4UF4 A;  4H2K A;  3LWU A;  4PXC A;  5HVF A;  3NA6 A;  1R3N A;  1CPX A;  2C6P A;  2V8H A;  1CPS A;  2PJC A;  4B6Z A;  2GRE A;  4UIA A;  1LOK A;  3WT4 A;  1TF8 A;  3IC1 A;  4PXB A;  2ZEG A;  5I4M A;  3GB0 A;  3SJG A;  4MCS A;  1ZG9 A;  3SJF A;  2ZOG A;  5K8N A;  1YME A;  2AFW A;  3L2N A;  4YU9 A;  4JZ0 A;  3ISZ A;  3MN8 A;  3KI9 A;  5D29 A;  3S9N A;  2XEJ A;  4X2T A;  4KSI A;  1ZLI A;  2F8H A;  2NYQ A;  3SJX A;  3KR4 A;  4OP4 A;  2RB7 A;  2CTC A;  4TWE A;  1ZG8 A;  2PJA A;  4OKO A;  1BPN A;  1Q7L A;  5K8P A;  3NH8 A;  2Q4Z A;  1YW4 A;  3HLP A;  7CPA A;  3DGV A;  5JGF A;  3PFO A;  4DJL A;  2POK A;  4OC2 A;  3IWW A;  4WJB A;  2GLF A;  2IQ6 A;  4ZX9 A;  3B2Y A;  4MCQ A;  3FX6 A;  1ARM A;  5JH9 A;  2ZEF A;  4P4E A;  1LAP A;  2JEW A;  3B3W A;  3KZW A;  1NSA A;  1OBR A;  2V8G A;  4GM5 A;  5HVH A;  3KHX A;  3B3S A;  1FT7 A;  2PJ0 A;  8CPA A;  3V7Z A;  3RBU A;  3FEC A;  1ARL A;  3K9T A;  4MCR A;  3VAT A;  4P4I A;  2XEI A;  1QMU A;  1UWY A;  1EE3 P;  2OOT A;  4ZY0 A;  4OC0 A;  4JYW A;  4P4B A;  4P4F A;  2PJB A;  1XRY A;  1VGY A;  2C6G A;  1R43 A;  3SI2 A;  3WC7 A;  4PPZ A;  3FMC A;  2J9A A;  4UIB A;  3PBB A;  3FJU A;  3JRU A;  2ANP A;  4P44 A;  4EWT A;  2HB6 A;  2PJ8 A;  1M4L A;  1FNO A;  1ZG7 A;  1XFO A;  1LCP A;  5LYI A;  1XMB A;  2I3C A;  2C1C A;  1YSJ A;  1LAN A;  2ZEE A;  4F9V A;  3KQX A;  2O4H A;  2EK9 A;  2NSM A;  2ZEP A;  1XJO A;  5LYD A;  1HDU A;  4NGS A;  1VHE A;  3FH4 A;  3WC6 A;  5LYF A;  4UEE A;  3D7F A;  3PB6 X;  2OR4 A;  2ZEN A;  5CPA A;  1PYT B;  3SI1 A;  2PIZ A;  4FBE A;  4O23 A;  4A39 A;  4PXD A;  4OC3 A;  2ZEM A;  3SJE A;  2C6C A;  1GYT A;  3KGQ A;  4YWY A;  4NGR A;  1Z2L A;  4FAI A;  4P4J A;  4X8I A;  1TXR A;  1VHO A;  4ZI6 A;  1HDQ A;  2G9D A;  2QJ8 A;  2Q43 A;  5D8N A;  4MHY A;  3K2K A;  2PJ9 A;  4MCP A;  3IEH A;  4W9Y A;  1ELL P;  3BI1 A;  3N5F A;  4IK2 A;  3BXM A;  3CPA A;  3IFE A;  3PFE A;  2QVP A;  4OME A;  5LRK A;  3PB9 X;  4MRI A;  5THW A;  2ZEO A;  3D66 A;  4NGM A;  3CT9 A;  2GU2 A;  3SI0 A;  4G1P A;  4NJR A;  2EWB A;  3RZA A;  3PEI A;  1BPM A;  1CG2 A;  4A38 A;  1LAM A;  3TC8 A;  2F7V A;  4MXU A;  3PBE A;  4NFR A;  4RUH A;  2ZOF A;  4MHZ A;  4MHP A;  4CPA A;  3S9M A;  5IB9 A;  1YW6 A;  2HC9 A;  4NJQ A;  1ELM P;  1CP6 A;  4F9U A;  3FEE A;  1Z5R A;  3GUX A;  5HXD A;  4OID A;  2AFX A;  3DLJ A;  4ZY1 A;  2PJ7 A;  1XBU A;  3IIB A;  1IGB A;  1TKH A;  2AFS A;  1AMP A;  5LRG A;  3KQZ A;  5DS0 A;  2WZN A;  4NGP A;  3B3V A;  2IMO A;  1HEE A;  2QYV A;  2PJ2 A;  2WYR A;  1Z8L A;  3PB8 X;  3HUV A;  4MHN A;  5LRJ A;  1YLO A;  3GLJ A;  2BO9 A;  1IY7 A;  2FVG A;  4ZYQ A;  2PIY A;  3B35 A;  1LFW A;  4AXV A;  4ONW A;  3KHZ A;  1ZLH A;  1Y0R A;  4K3N A;  4TNU A;  4FUU A;  3D7G A;  4R76 A;  4OC5 A;  2PVW A;  3FED A;  3H8F A;  2ABZ A;  3VAR A;  5ELY A;  2V8V A;  4ZY2 A;  3V38 A;  2AFU A;  2EK8 A;  4OC4 A;  3WC5 A;  4R7M A;  3CDX A;  4F8Z A;  5LYL A;  2GLJ A;  2V77 A;  4P45 A;  4DYO A;  3PRT A;  2PE3 A;  4MMO A;  1F57 A;  4LQG A;  1QQ9 A;  2VL1 A;  3PB4 X;  2XEF A;  1VIX A;  3D4U A;  4Z65 A;  5JM6 A;  1RTQ A;  3QNV A;  1AYE A;  3VH9 A;  1H8L A;  3B3C A;  4BD9 A;  5HVG A;  3BHX A;  2BCO A;  2ZEL A;  3MRU A;  4Q7A A;  1TKF A;  3FVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...