4AXVA

Biochemical and structural characterization of the mpaa amidase as part of a conserved scavenging pathway for peptidoglycan derived peptides in gamma-proteobacteria
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
241
structure length
241
Chain Sequence
VLFQGPAMSLIPRTERAAFLITPTSYGKSVLGAPLLYFPAQVESNSRGLILAGTHGDETASIAGLSCALRSLPAECLKHDVILSMNPDANQLGTRANANQVDLNRAFPTQNWTEHGTVYRWSSHTPVRDVKVKTGDKEQLEPEVDALISLIELRRPKFVVSFHEPLAFVDDPAHSDLAKWLGKQFNLPIVDDVDYETPGSFGTWCNERQLPCITVELPPISADLTIEKHLDAFIALLQHDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MPAA
publication title Mpaa is a Murein-Tripeptide-Specific Zinc Carboxypeptidase that Functions as Part of a Catabolic Pathway for Peptidoglycan Derived Peptides in Gamma-Proteobacteria.
pubmed doi rcsb
source organism Vibrio harveyi
molecule tags Hydrolase
total genus 71
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4axvA00
2ANPA 3D67A 2HC9A 2I3CA 4OC4A 1EE3P 1LCPA 1VIXA 2PVVA 3PRTA 4MCSA 2CIJA 2ZOFA 4F9VA 1H8LA 2PJ9A 3V7ZA 1LAMA 2GLFA 4MHPA 2PRQA 4DUKA 1XJOA 4IK2A 1F2OA 2JEWA 3GB0A 4ONWA 6CPAA 3H8EA 4F8ZA 2FVGA 2ZEEA 3SJEA 5LYDA 4OP4A 4PQAA 4DYOA 1OBRA 1BLLE 2QVPA 2J9AA 3D7FA 4ZYQA 2PJ2A 3I1UA 4GM5A 4P45A 1QMUA 3PFOA 5HVGA 3DLJA 3SI0A 3K9TA 1UWYA 1LANA 2WZNA 2PE3A 5IB9A 4FWUA 4UIAA 1QQ9A 3B3VA 4LQGA 4MCPA 4W9YA 3H8FA 2EK8A 3IO1A 4EMEA 4NGSA 3FVLA 3NFZA 2O53A 2PCUA 4WWVA 2OOTA 4RUHA 3BHXA 4NFRA 1Y0RA 4MRIA 4MCQA 3BXMA 4UEFA 4TNUA 2PJBA 3B35A 2ZEOA 3B3TA 7CPAA 4OC3A 3SJXA 3KQZA 4CPAA 2BOAA 4OC1A 3V38A 2CTCA 1ZLIA 2VL1A 4ZX8A 2BCOA 4DJLA 2XEIA 3D4UA 2JBKA 4NGTA 4OC2A 4NJQA 1Q7LA 3TX8A 3KHXA 3KASA 3RAMA 2RB7A 3PB6X 3IEHA 2V8VA 2ZEGA 2QYVA 1VHEA 1GYTA 2C6GA 5D29A 3ISXA 1VGYA 1YLOA 2AFOA 2EWBA 1AYEA 2PIZA 2PVWA 3FH4A 2Q43A 3IC1A 4YU9A 2QJ8A 2ZEDA 3WABA 1YW4A 4F9UA 2GREA 4X3RA 1YW6A 4NJRA 1YMEA 3PB8X 3FJUA 3N5FA 1KWMA 2AFXA 2PJCA 3CPXA 4NGRA 3SJGA 1CPSA 3D7GA 5JM6A 3WT4A 3S9LA 1DE4C 1XMBA 3VATA 1FNOA 1ZG9A 2GLJA 2AFMA 2JBJA 4O23A 3WC6A 3FEEA 3IIBA 3TC8A 4BD9A 4MHYA 1CPXA 2EK9A 3KL9A 4A37A 1ARMA 3RBUA 3KZWA 2CTBA 5LYIA 4R7MA 4ZY1A 4PXDA 3ISZA 1Z2LA 3KHZA 2V77A 4R8FA 1R43A 3FECA 2IJZA 4UEEA 5F09A 4ZY0A 1Z5RA 3CPAA 2AFWA 4X2TA 4PPZA 5HVHA 2ZEHA 3WC5A 1TKHA 5ELYA 3IWWA 5CPAA 5JH9A 3S9NA 4ZX9A 1CP6A 3LWUA 4EWTA 3D68A 3D7HA 3VARA 3NH8A 1VHOA 1LAPA 1IY7A 3GLJA 1TKFA 5LRGA 1TXRA 1RTQA 2XEGA 1FT7A 2OR4A 4PXCA 5K8OA 3RZAA 8CPAA 4IHMA 1TF8A 2ZEFA 5LRKA 3B3WA 1XRYA 5CBMA 5K8MA 3NH5A 4KSIA 3K2KA 2NSMA 3T8WA 2PJ1A 4MXUA 4MMOA 2PIYA 2XEFA 1F57A 2IMOA 3IFEA 3FX6A 4B6ZA 1ARLA 3PB9X 4UF4A 1LOKA 3B2YA 2ZEPA 3VH9A 3KQXA 1YSJA 2DEAA 1TF9A 4OIDA 3SI2A 3PEIA 2PJ8A 1ZG8A 4ZI6A 1XBUA 5HVFA 3GUXA 2AFSA 3MRUA 4FUUA 4JYWA 1F2PA 3L2NA 2POKA 3BI1A 2V8DA 1HDQA 2ZEMA 1CX8A 2PJ6A 4P4FA 4R76A 3MN8A 3B3CA 1Y0YA 3NA6A 3S9MA 5LYLA 1CP7A 2G9DA 4ZY2A 5DS0A 5JGFA 1TKJA 5THWA 4OKOA 4A39A 4K3NA 4OC0A 2RFHA 4IAVA 1ELMP 4JZ0A 5LYFA 2PJ7A 3KR5A 4YWYA 1LFWA 2C1CA 3KR4A 2GU2A 4A94A 3D7DA 2O4HA 2BO9A 1AMPA 5HXDA 2IQ6A 2PJ4A 3PBBA 4TWEA 2AFUA 5D8NA 3KGQA 3FMCA 5I4MA 2ZELA 3FEDA 4UEZA 2PJ3A 1HEEA 2NYQA 1Y7EA 3DGVA 4Q7AA 4EFDA 2F8HA 4P10A 3IJ3A 3QNVA 4UIBA 2C6PA 5LRJA 4Z65A 1BPMA 5K8PA 2XEJA 5K8NA 4OMEA 4X8IA 3H8GA 4R6TA 1BPNA 4OC5A 1PYTB 4NGMA 1ZG7A 1XFOA 2PJ5A 2V8HA 1JQGA 4P4IA 1BAVA 1R3NA 1NSAA 1PCAA 4P4BA 2HB6A 4PXBA 1CBXA 1DTDA 3PB7X 4OIWA 2PJAA 3JRUA 4P4JA 4NGQA 3D66A 2V8GA 3PB4X 3HLPA 3FF3A 3PFEA 4AXVA 1HDUA 3BI0A 1CG2A 4WJBA 3PBEA 2ABZA 2Q51A 4PXEA 3WC7A 1Z8LA 3CDXA 2AFZA 2ZOGA 1ZLHA 3KI9A 2C6CA 4FAIA 4A38A 4P4EA 4NGNA 3CT9A 3SJFA 4P4DA 3NH4A 1ELLP 2PJ0A 4P44A 1M4LA 2Q4ZA 1IGBA 2CF4A 2WYRA 2ZENA 4P6YA 2F7VA 4H2KA 4MHZA 4MHNA 4FBEA 4NGPA 4MCRA 3LMSA 4G1PA 5J1QA 3B7IA 3B3SA 3SI1A 3HUVA
chains in the Genus database with same CATH superfamily
2P6EA 4QC6A 4UBRA 2ANPA 1TIQA 4CGOA 3D67A 4AVBA 1BO4A 2HC9A 4K30A 2I3CA 4A30A 4KOVA 2ODFA 2JEVA 4OC4A 4C68A 1EE3P 1LCPA 1WK4A 2G0BA 1MJ9A 2PC1A 4M85A 1LRZA 1VIXA 5A28A 4R57A 2PVVA 3PRTA 4MCSA 3JTKA 2CIJA 1Z8TA 4KORA 4CGPA 2ZOFA 4F9VA 1H8LA 2PJ9A 4KS9A 3V7ZA 1LAMA 2GLFA 4MHPA 2PRQA 4FD4A 4DUKA 1PU9A 1XJOA 4IK2A 1F2OA 4M6GA 3E0KA 2JEWA 1VHSA 3GB0A 4ONWA 1NMTA 6CPAA 3H8EA 3R95A 3DNSA 4F8ZA 2FVGA 1U6MA 2ZEEA 3SJEA 5LYDA 1Q2DA 1BOBA 1I12A 1IOFA 2B3VA 4A33A 4PSXA 4KOUA 4OP4A 2KCWA 2P6GA 2WSAA 1AUGA 3BLNA 3P2FA 4PQAA 2BL1A 2FXFA 2Z0ZA 1OBRA 1BLLE 1S60A 3EY5A 4DYOA 2Z10A 2QVPA 4KOYA 4LQ6A 4KVOE 4KLWA 2J9AA 3D7FA 4ZYQA 1RO5A 2PJ2A 1SQHA 3RNZA 1IIDA 3I1UA 4GM5A 4P45A 5G22A 1QMUA 2GANA 2YGWA 3PFOA 4CGMA 2D4PA 3DLJA 4XPLA 5HVGA 2A4NA 3SI0A 3K9TA 1UWYA 4CGLA 1QSMA 2ZXVA 4UCPA 1LANA 2C27A 2B5GB 2PE3A 2WZNA 4FWUA 3BJ8A 1YR0A 1IOIA 5IB9A 4UIAA 2J8NA 5IX3A 4NCZA 2HV2A 1QQ9A 3B3VA 3NE7A 4LQGA 4MCPA 4A32A 2Z3PA 4W9YA 3H8FA 2Q0YA 4H6ZA 2EK8A 1S7LA 3IO1A 3JVNA 4IUSA 1M44A 2JLMA 4EMEA 4NGSA 2JDCA 3FVLA 3NFZA 4A95A 2O53A 2PCUA 1Q2YA 4J3GA 4B13A 4WWVA 3GKRA 3IU2A 2OOTA 4CS0B 1ZO0A 4RUHA 4CRYB 3BHXA 4KOXA 3R1KA 4NFRA 4A2ZA 1A2ZA 1Y0RA 4YGOA 3SHPA 4R9MA 2Q4YA 4MRIA 4MCQA 2R1IA 2Z3LA 3BXMA 2CNMA 2VI7A 5G21A 3K9UA 4XNHC 4UEFA 4MFPA 4TNUA 5C88A 2PJBA 3B35A 1X12A 1P0HA 2ZEOA 3B3TA 7CPAA 4C7HA 4OC3A 3SJXA 3KQZA 4CPAA 2BOAA 3TOAA 1IYLA 1P4NA 4OC1A 3S6FA 1KUYA 5DWNA 5G1ZA 1MJBA 2CTCA 3V38A 1PUAA 2R8VA 4KSAA 1ZLIA 1IB1E 2VL1A 2VEZA 2BCOA 4ZX8A 4DJLA 2XEIA 3IWEA 3D4UA 3D3SA 3FNCA 2JBKA 4Q38A 1M4GA 4MFJA 4NGTA 4OC2A 2VBQA 2EBJA 4GS4A 1YVOA 4B11A 4CYQA 3ZJ0A 4KUAA 3F0AA 4NJQA 1Z4RA 1Q7LA 3TX8A 3KHXA 2PRBA 3KASA 5HH1A 3RAMA 2REEA 3F5BA 2RB7A 2G3TA 3PB6X 3IEHA 2CXAA 2V8VA 2ZEGA 2OZGA 2QYVA 4CAXA 1VHEA 1M4DA 1GYTA 2C6GA 3ZZIA 3FYNA 4KVME 4MFQA 5CNPA 5D29A 3CXQA 3ISXA 1VGYA 1CM0A 1YLOA 2AFOA 2EWBA 2WPWA 4JJXA 1Z4EA 1AYEA 2PIZA 2PVWA 3FH4A 2Q43A 5KTAA 3CXSA 3IC1A 1V0CA 4QBJA 4YU9A 2QJ8A 2ZEDA 3WABA 4CAFA 1YW4A 4F9UA 4YFJA 2DF5A 2GREA 2P6FA 4X3RA 1YW6A 3D2MA 1YMEA 4KOTA 4NJRA 5E96A 3PB8X 3FJUA 4QB9A 4AG7A 3N5FA 1KWMA 1Z9UA 2AFXA 4NXYA 2PJCA 4B10A 2YNCA 1FY7A 2EVNA 3CPXA 4NGRA 3SJGA 1CPSA 4XPKA 5JQ4A 3D7GA 5JM6A 3WT4A 4C7IA 3S9LA 1DE4C 1XMBA 4H6UA 4UFWA 4UWIA 2ZW4A 3IWGA 4RN7A 3VATA 2OZHA 4HNWB 1FNOA 1RXTA 3P2HA 4KZTA 4MFLA 1ZG9A 2GLJA 5AG7A 2ZW5A 2VQYA 2AJ6A 2B58A 3S6HA 2OU2A 4RS2A 4Y49B 3TO7A 2AFMA 3TFYA 2JBJA 4O23A 3WC6A 4ZBGA 4QVTA 1Z8WA 2VZZA 3FEEA 4XPDB 4UFXA 3IIBA 3TC8A 4BD9A 5DWMA 4MHYA 3S6KA 4HNYB 1CPXA 2CNSA 5ISVA 2NMTA 4CAVA 2EK9A 3KL9A 1UFHA 4U5YA 2R7HA 4A37A 2G3AA 1ARMA 4YRHA 3RBUA 3KZWA 2CTBA 5LYIA 4R7MA 4ZY1A 4PXDA 3ISZA 3QAHA 1Z2LA 2K5TA 4PK3A 1YLEA 4JLYA 3SXNA 5G20A 3R9FA 3KHZA 2V77A 4R8FA 1R43A 3FECA 2IJZA 1IYKA 4UEEA 5F09A 3PZJA 4B5PA 3S6GA 4KUBA 4X5KA 4ZY0A 5LRKA 2PDOA 4CYOA 1Z5RA 3CPAA 2AFWA 1ON0A 5H86A 2YNEA 2X7BA 4PPZA 2ZEHA 3G3SA 4X2TA 3WC5A 2ATRA 3CXPA 1TKHA 4NEXA 4R3LA 4C2YA 5ELYA 3IWWA 4RI1A 4UFVA 5CPAA 4E2AA 5JH9A 3S9NA 1XOVA 4ZX9A 4UWJA 1CP6A 3LWUA 4EWTA 1K4JA 4KOSA 3D68A 3D7HA 3VARA 3NH8A 4R3KA 3QAYA 1VHOA 1LAPA 1IY7A 3GLJA 1KZFA 1TKFA 3B8GA 1TXRA 2DPSA 5EC4A 5LRGA 1CJWA 1RTQA 2GFQA 2XEGA 2AE6A 1FT7A 2OR4A 4PXCA 2IL4A 4BINA 5K8OA 3RZAA 2FIAA 8CPAA 3G8WA 4IHMA 4KSFA 3V8IA 5A27A 1TF8A 2ZEFA 4MFKA 3B3WA 2J8RA 1XRYA 2D4OA 2H5MA 5CBMA 3GY9A 5K8MA 4OAEA 3D2PA 3NH5A 4KLVA 1B6BA 5THWA 2HUZA 2OH1A 4KSIA 2YNCC 4OADA 2Q7BA 2DPTA 3TCVA 3LACA 4II9A 3K2KA 2NSMA 1YQEA 1OZPA 3T8WA 2FE7A 5C82A 5J8FA 4UCNA 2PJ1A 2Y0MA 4MMOA 4MXUA 1Y9WA 2EUIA 4BBHA 2PIYA 2XEFA 1F57A 5JPHA 4E8OA 1M1DA 1NSLA 2IMOA 3IFEA 4F0YA 1IICA 4FD6A 3W91A 4CYPA 3FX6A 4B6ZA 1ARLA 3PB9X 4IF5A 4JD6A 1LOKA 4ORFA 4UF4A 2VXKA 2ZEPA 3B2YA 4C2XA 3VH9A 2QIRA 3KQXA 2VZYA 1YSJA 4MHDA 3NE8A 2DEAA 1TF9A 1YK3A 4OIDA 2CY2A 3SI2A 3C26A 2PJ8A 3PEIA 1ZG8A 2GE3A 4F0XA 3OWCA 4ZI6A 1XBUA 5HVFA 3GUXA 4DNCA 2Z3OA 2AFSA 3MRUA 4BMHA 3FIXA 4NSQA 1MJAA 1JWQA 5BWAB 3H4QA 4FUUA 4JYWA 1F2PA 3L2NA 2POKA 2ARHA 5EMIA 3RO0A 5F47A 4JWPA 3BI1A 2V8DA 1HDQA 4FD5A 3TOBA 2ZEMA 3R9GA 4Y49C 1CX8A 2FCKA 3MGDA 2PJ6A 4P4FA 4R76A 3MN8A 4XPDC 2CNTA 3B3CA 2ZW6A 3DR8A 3R9EA 2PR1A 1Y0YA 3NA6A 3W6SA 5AG4A 3TO6A 3S9MA 5LYLA 1CP7A 3BJ7A 1YREA 2G9DA 3F8KA 2QMLA 5DS0A 4ZY2A 2B4BA 3DR6A 1TKJA 1KUXA 1XMTA 4KVXA 4M6IA 2EO8A 3H5ZA 2REFA 4OKOA 5AGEA 2FT0A 1L0CA 2P0WA 5F48A 4A39A 2O28A 3GYAA 2HQYA 4EVYA 4K3NA 4MJ8A 4OC0A 2RFHA 4IAVA 1ELMP 4JZ0A 5HVHA 5LYFA 2PJ7A 1R57A 1YGHA 4B5PB 3KR5A 4AVCA 5I0CA 1QSNA 4YWYA 1LFWA 2C1CA 3KR4A 4CAWA 2GU2A 4A94A 2I00A 3D7DA 3N7ZA 4QUSA 3CZXA 2O4HA 2BO9A 3QB8A 2YNDA 3LD2A 1AMPA 4LUAA 5HXDA 2Q44A 2IQ6A 2PJ4A 3VWEA 4U9ZA 3PBBA 4TWEA 2AFUA 5D8NA 2JDDA 3FMCA 3KGQA 5I4MA 2FS5A 4JXQA 1Z8XA 4JXRA 2ZELA 3FEDA 3KKWA 4UEZA 2PJ3A 4CAEA 1HEEA 4PSWA 4HPSA 2NYQA 1VKCA 2Z11A 4ONUA 4M3SA 1YX0A 4AB7A 3DDDA 3JUWA 1Y7EA 3DGVA 5KTDA 3WR7A 4Q7AA 1XE4A 1MK4A 5AG6A 4B12A 4EFDA 2F8HA 2OB0A 2Q7SA 4P10A 3IJ3A 2FIWA 3QNVA 4OLLA 4UIBA 3SXOA 2C6PA 2FSRA 3TTHA 5LRJA 1NE9A 5F49A 1QSOA 4Z65A 1WWZA 4HNXB 1N71A 1BPMA 2BUEA 5K8PA 2BSWA 2XEJA 4ZGYB 5K8NA 4OMEA 4X8IA 3H8GA 2F5IA 4R6TA 3D8PA 2RC4A 1BPNA 4MY0A 4OC5A 1PYTB 3PP9A 4NGMA 1ZG7A 1XFOA 4UA3A 2PJ5A 4CRZB 2V8HA 1M4IA 1JQGA 1QSRA 5AG5A 4P4IA 1BAVA 2B3UA 4FD7A 4U9YA 1R3NA 4UCMA 1XEBA 3TT2A 1NSAA 2I79A 5EBVA 1PCAA 4MI4A 4P4BA 5HMNA 2HB6A 2FL4A 3T90A 4PXBA 4PK2A 1XIXA 1CBXA 1DTDA 1GHEA 3PB7X 4OIWA 2PJAA 1S7KA 3JRUA 3RYOA 3IGRA 4CYNA 4P4JA 5IB0A 1X10A 4NGQA 4HKFA 3TE4A 4C2ZA 3D66A 2V8GA 1KUVA 3PB4X 3HLPA 3FF3A 3PFEA 3EC4A 2GIVA 4AXVA 1HDUA 3BI0A 4MY3A 1CG2A 3T9YA 3PGPA 4AG9A 2B5GA 4WJBA 3EO4A 3PBEA 2ABZA 2Q51A 4M6HA 4I49A 4L89A 3UY5A 3FBUA 4PXEA 3WC7A 4LX9A 4F6AA 4PV6A 1Z8LA 3R96A 4B14A 2OZUA 3CDXA 1S7FA 2AFZA 2BEIA 2J8MA 2Z3NA 1QSTA 1ZLHA 2ZOGA 1Y9KA 3KI9A 3W6XA 2C6CA 3DSBA 3EXNA 4MFZA 4FAIA 2PSWA 5H84A 4A31A 4E0AA 2PR8A 4A38A 4P4EA 1IU8A 4NGNA 3FRMA 5FVJA 3CT9A 2ZPAA 4H89A 3EFAA 4L8AA 4P4DA 3SJFA 5F46A 3NH4A 2WUUA 3FB3A 5J8CA 3I3GA 1ELLP 2B4DB 2PJ0A 4P44A 2R98A 1I21A 1J4JA 1M4LA 2Q4ZA 3I9SA 2Q4VA 2DXQA 2Q04A 5GCNA 1IGBA 1XF8A 1S3ZA 3GIUA 2CF4A 2WYRA 4KOWA 2ZENA 4NF1A 4XNHB 4P6YA 4B5OA 5IV0A 4Q36A 3FXTA 2PQ8A 2ZW7A 4CGNA 3LODA 1S5KA 1YVKA 2F7VA 4H2KA 1B87A 4AVAA 5KTCA 4MHZA 1Q2CA 2WPXA 3IU1A 1I1DA 4MHNA 4FBEA 2QECA 4NGPA 3VWDA 2Z3KA 4MCRA 5JGFA 4R87A 2Z3MA 3LMSA 4GXHA 1S7NA 4G1PA 5J1QA 1Y7RA 3TO9A 3A9LA 3B3SA 3B7IA 4MBUA 3SI1A 2B4DA 3HUVA
chains in the Genus database with same CATH topology
2ANPA 3D67A 2HC9A 2I3CA 4OC4A 1EE3P 1LCPA 1VIXA 2PVVA 3PRTA 4MCSA 2CIJA 2ZOFA 4F9VA 1H8LA 2PJ9A 3V7ZA 1LAMA 2GLFA 4MHPA 2PRQA 4DUKA 1XJOA 4IK2A 1F2OA 2JEWA 3GB0A 4ONWA 6CPAA 3H8EA 4F8ZA 2FVGA 2ZEEA 3SJEA 5LYDA 4OP4A 4PQAA 4DYOA 1OBRA 1BLLE 2QVPA 2J9AA 3D7FA 4ZYQA 2PJ2A 3I1UA 4GM5A 4P45A 1QMUA 3PFOA 5HVGA 3DLJA 3SI0A 3K9TA 1UWYA 1LANA 2WZNA 2PE3A 5IB9A 4FWUA 4UIAA 1QQ9A 3B3VA 4LQGA 4MCPA 4W9YA 3H8FA 2EK8A 3IO1A 4EMEA 4NGSA 3FVLA 3NFZA 2O53A 2PCUA 4WWVA 2OOTA 4RUHA 3BHXA 4NFRA 1Y0RA 4MRIA 4MCQA 3BXMA 4UEFA 4TNUA 2PJBA 3B35A 2ZEOA 3B3TA 7CPAA 4OC3A 3SJXA 3KQZA 4CPAA 2BOAA 4OC1A 3V38A 2CTCA 1ZLIA 2VL1A 4ZX8A 2BCOA 4DJLA 2XEIA 3D4UA 2JBKA 4NGTA 4OC2A 4NJQA 1Q7LA 3TX8A 3KHXA 3KASA 3RAMA 2RB7A 3PB6X 3IEHA 2V8VA 2ZEGA 2QYVA 1VHEA 1GYTA 2C6GA 5D29A 3ISXA 1VGYA 1YLOA 2AFOA 2EWBA 1AYEA 2PIZA 2PVWA 3FH4A 2Q43A 3IC1A 4YU9A 2QJ8A 2ZEDA 3WABA 1YW4A 4F9UA 2GREA 4X3RA 1YW6A 4NJRA 1YMEA 3PB8X 3FJUA 3N5FA 1KWMA 2AFXA 2PJCA 3CPXA 4NGRA 3SJGA 1CPSA 3D7GA 5JM6A 3WT4A 3S9LA 1DE4C 1XMBA 3VATA 1FNOA 1ZG9A 2GLJA 2AFMA 2JBJA 4O23A 3WC6A 3FEEA 3IIBA 3TC8A 4BD9A 4MHYA 1CPXA 2EK9A 3KL9A 4A37A 1ARMA 3RBUA 3KZWA 2CTBA 5LYIA 4R7MA 4ZY1A 4PXDA 3ISZA 1Z2LA 3KHZA 2V77A 4R8FA 1R43A 3FECA 2IJZA 4UEEA 5F09A 4ZY0A 1Z5RA 3CPAA 2AFWA 4X2TA 4PPZA 5HVHA 2ZEHA 3WC5A 1TKHA 5ELYA 3IWWA 5CPAA 5JH9A 3S9NA 4ZX9A 1CP6A 3LWUA 4EWTA 3D68A 3D7HA 3VARA 3NH8A 1VHOA 1LAPA 1IY7A 3GLJA 1TKFA 5LRGA 1TXRA 1RTQA 2XEGA 1FT7A 2OR4A 4PXCA 5K8OA 3RZAA 8CPAA 4IHMA 1TF8A 2ZEFA 5LRKA 3B3WA 1XRYA 5CBMA 5K8MA 3NH5A 4KSIA 3K2KA 2NSMA 3T8WA 2PJ1A 4MXUA 4MMOA 2PIYA 2XEFA 1F57A 2IMOA 3IFEA 3FX6A 4B6ZA 1ARLA 3PB9X 4UF4A 1LOKA 3B2YA 2ZEPA 3VH9A 3KQXA 1YSJA 2DEAA 1TF9A 4OIDA 3SI2A 3PEIA 2PJ8A 1ZG8A 4ZI6A 1XBUA 5HVFA 3GUXA 2AFSA 3MRUA 4FUUA 4JYWA 1F2PA 3L2NA 2POKA 3BI1A 2V8DA 1HDQA 2ZEMA 1CX8A 2PJ6A 4P4FA 4R76A 3MN8A 3B3CA 1Y0YA 3NA6A 3S9MA 5LYLA 1CP7A 2G9DA 4ZY2A 5DS0A 5JGFA 1TKJA 5THWA 4OKOA 4A39A 4K3NA 4OC0A 2RFHA 4IAVA 1ELMP 4JZ0A 5LYFA 2PJ7A 3KR5A 4YWYA 1LFWA 2C1CA 3KR4A 2GU2A 4A94A 3D7DA 2O4HA 2BO9A 1AMPA 5HXDA 2IQ6A 2PJ4A 3PBBA 4TWEA 2AFUA 5D8NA 3KGQA 3FMCA 5I4MA 2ZELA 3FEDA 4UEZA 2PJ3A 1HEEA 2NYQA 1Y7EA 3DGVA 4Q7AA 4EFDA 2F8HA 4P10A 3IJ3A 3QNVA 4UIBA 2C6PA 5LRJA 4Z65A 1BPMA 5K8PA 2XEJA 5K8NA 4OMEA 4X8IA 3H8GA 4R6TA 1BPNA 4OC5A 1PYTB 4NGMA 1ZG7A 1XFOA 2PJ5A 2V8HA 1JQGA 4P4IA 1BAVA 1R3NA 1NSAA 1PCAA 4P4BA 2HB6A 4PXBA 1CBXA 1DTDA 3PB7X 4OIWA 2PJAA 3JRUA 4P4JA 4NGQA 3D66A 2V8GA 3PB4X 3HLPA 3FF3A 3PFEA 4AXVA 1HDUA 3BI0A 1CG2A 4WJBA 3PBEA 2ABZA 2Q51A 4PXEA 3WC7A 1Z8LA 3CDXA 2AFZA 2ZOGA 1ZLHA 3KI9A 2C6CA 4FAIA 4A38A 4P4EA 4NGNA 3CT9A 3SJFA 4P4DA 3NH4A 1ELLP 2PJ0A 4P44A 1M4LA 2Q4ZA 1IGBA 2CF4A 2WYRA 2ZENA 4P6YA 2F7VA 4H2KA 4MHZA 4MHNA 4FBEA 4NGPA 4MCRA 3LMSA 4G1PA 5J1QA 3B7IA 3B3SA 3SI1A 3HUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ANP A;  3D67 A;  2HC9 A;  2I3C A;  4OC4 A;  1EE3 P;  1LCP A;  1VIX A;  2PVV A;  3PRT A;  4MCS A;  2CIJ A;  2ZOF A;  4F9V A;  1H8L A;  2PJ9 A;  3V7Z A;  1LAM A;  2GLF A;  4MHP A;  2PRQ A;  4DUK A;  1XJO A;  4IK2 A;  1F2O A;  2JEW A;  3GB0 A;  4ONW A;  6CPA A;  3H8E A;  4F8Z A;  2FVG A;  2ZEE A;  3SJE A;  5LYD A;  4OP4 A;  4PQA A;  4DYO A;  1OBR A;  1BLL E;  2QVP A;  2J9A A;  3D7F A;  4ZYQ A;  2PJ2 A;  3I1U A;  4GM5 A;  4P45 A;  1QMU A;  3PFO A;  5HVG A;  3DLJ A;  3SI0 A;  3K9T A;  1UWY A;  1LAN A;  2WZN A;  2PE3 A;  5IB9 A;  4FWU A;  4UIA A;  1QQ9 A;  3B3V A;  4LQG A;  4MCP A;  4W9Y A;  3H8F A;  2EK8 A;  3IO1 A;  4EME A;  4NGS A;  3FVL A;  3NFZ A;  2O53 A;  2PCU A;  4WWV A;  2OOT A;  4RUH A;  3BHX A;  4NFR A;  1Y0R A;  4MRI A;  4MCQ A;  3BXM A;  4UEF A;  4TNU A;  2PJB A;  3B35 A;  2ZEO A;  3B3T A;  7CPA A;  4OC3 A;  3SJX A;  3KQZ A;  4CPA A;  2BOA A;  4OC1 A;  3V38 A;  2CTC A;  1ZLI A;  2VL1 A;  4ZX8 A;  2BCO A;  4DJL A;  2XEI A;  3D4U A;  2JBK A;  4NGT A;  4OC2 A;  4NJQ A;  1Q7L A;  3TX8 A;  3KHX A;  3KAS A;  3RAM A;  2RB7 A;  3PB6 X;  3IEH A;  2V8V A;  2ZEG A;  2QYV A;  1VHE A;  1GYT A;  2C6G A;  5D29 A;  3ISX A;  1VGY A;  1YLO A;  2AFO A;  2EWB A;  1AYE A;  2PIZ A;  2PVW A;  3FH4 A;  2Q43 A;  3IC1 A;  4YU9 A;  2QJ8 A;  2ZED A;  3WAB A;  1YW4 A;  4F9U A;  2GRE A;  4X3R A;  1YW6 A;  4NJR A;  1YME A;  3PB8 X;  3FJU A;  3N5F A;  1KWM A;  2AFX A;  2PJC A;  3CPX A;  4NGR A;  3SJG A;  1CPS A;  3D7G A;  5JM6 A;  3WT4 A;  3S9L A;  1DE4 C;  1XMB A;  3VAT A;  1FNO A;  1ZG9 A;  2GLJ A;  2AFM A;  2JBJ A;  4O23 A;  3WC6 A;  3FEE A;  3IIB A;  3TC8 A;  4BD9 A;  4MHY A;  1CPX A;  2EK9 A;  3KL9 A;  4A37 A;  1ARM A;  3RBU A;  3KZW A;  2CTB A;  5LYI A;  4R7M A;  4ZY1 A;  4PXD A;  3ISZ A;  1Z2L A;  3KHZ A;  2V77 A;  4R8F A;  1R43 A;  3FEC A;  2IJZ A;  4UEE A;  5F09 A;  4ZY0 A;  1Z5R A;  3CPA A;  2AFW A;  4X2T A;  4PPZ A;  5HVH A;  2ZEH A;  3WC5 A;  1TKH A;  5ELY A;  3IWW A;  5CPA A;  5JH9 A;  3S9N A;  4ZX9 A;  1CP6 A;  3LWU A;  4EWT A;  3D68 A;  3D7H A;  3VAR A;  3NH8 A;  1VHO A;  1LAP A;  1IY7 A;  3GLJ A;  1TKF A;  5LRG A;  1TXR A;  1RTQ A;  2XEG A;  1FT7 A;  2OR4 A;  4PXC A;  5K8O A;  3RZA A;  8CPA A;  4IHM A;  1TF8 A;  2ZEF A;  5LRK A;  3B3W A;  1XRY A;  5CBM A;  5K8M A;  3NH5 A;  4KSI A;  3K2K A;  2NSM A;  3T8W A;  2PJ1 A;  4MXU A;  4MMO A;  2PIY A;  2XEF A;  1F57 A;  2IMO A;  3IFE A;  3FX6 A;  4B6Z A;  1ARL A;  3PB9 X;  4UF4 A;  1LOK A;  3B2Y A;  2ZEP A;  3VH9 A;  3KQX A;  1YSJ A;  2DEA A;  1TF9 A;  4OID A;  3SI2 A;  3PEI A;  2PJ8 A;  1ZG8 A;  4ZI6 A;  1XBU A;  5HVF A;  3GUX A;  2AFS A;  3MRU A;  4FUU A;  4JYW A;  1F2P A;  3L2N A;  2POK A;  3BI1 A;  2V8D A;  1HDQ A;  2ZEM A;  1CX8 A;  2PJ6 A;  4P4F A;  4R76 A;  3MN8 A;  3B3C A;  1Y0Y A;  3NA6 A;  3S9M A;  5LYL A;  1CP7 A;  2G9D A;  4ZY2 A;  5DS0 A;  5JGF A;  1TKJ A;  5THW A;  4OKO A;  4A39 A;  4K3N A;  4OC0 A;  2RFH A;  4IAV A;  1ELM P;  4JZ0 A;  5LYF A;  2PJ7 A;  3KR5 A;  4YWY A;  1LFW A;  2C1C A;  3KR4 A;  2GU2 A;  4A94 A;  3D7D A;  2O4H A;  2BO9 A;  1AMP A;  5HXD A;  2IQ6 A;  2PJ4 A;  3PBB A;  4TWE A;  2AFU A;  5D8N A;  3KGQ A;  3FMC A;  5I4M A;  2ZEL A;  3FED A;  4UEZ A;  2PJ3 A;  1HEE A;  2NYQ A;  1Y7E A;  3DGV A;  4Q7A A;  4EFD A;  2F8H A;  4P10 A;  3IJ3 A;  3QNV A;  4UIB A;  2C6P A;  5LRJ A;  4Z65 A;  1BPM A;  5K8P A;  2XEJ A;  5K8N A;  4OME A;  4X8I A;  3H8G A;  4R6T A;  1BPN A;  4OC5 A;  1PYT B;  4NGM A;  1ZG7 A;  1XFO A;  2PJ5 A;  2V8H A;  1JQG A;  4P4I A;  1BAV A;  1R3N A;  1NSA A;  1PCA A;  4P4B A;  2HB6 A;  4PXB A;  1CBX A;  1DTD A;  3PB7 X;  4OIW A;  2PJA A;  3JRU A;  4P4J A;  4NGQ A;  3D66 A;  2V8G A;  3PB4 X;  3HLP A;  3FF3 A;  3PFE A;  4AXV A;  1HDU A;  3BI0 A;  1CG2 A;  4WJB A;  3PBE A;  2ABZ A;  2Q51 A;  4PXE A;  3WC7 A;  1Z8L A;  3CDX A;  2AFZ A;  2ZOG A;  1ZLH A;  3KI9 A;  2C6C A;  4FAI A;  4A38 A;  4P4E A;  4NGN A;  3CT9 A;  3SJF A;  4P4D A;  3NH4 A;  1ELL P;  2PJ0 A;  4P44 A;  1M4L A;  2Q4Z A;  1IGB A;  2CF4 A;  2WYR A;  2ZEN A;  4P6Y A;  2F7V A;  4H2K A;  4MHZ A;  4MHN A;  4FBE A;  4NGP A;  4MCR A;  3LMS A;  4G1P A;  5J1Q A;  3B7I A;  3B3S A;  3SI1 A;  3HUV A; 
#chains in the Genus database with same CATH topology
 2P6E A;  4QC6 A;  4UBR A;  2ANP A;  1TIQ A;  4CGO A;  3D67 A;  4AVB A;  1BO4 A;  2HC9 A;  4K30 A;  2I3C A;  4A30 A;  4KOV A;  2ODF A;  2JEV A;  4OC4 A;  4C68 A;  1EE3 P;  1LCP A;  1WK4 A;  2G0B A;  1MJ9 A;  2PC1 A;  4M85 A;  1LRZ A;  1VIX A;  5A28 A;  4R57 A;  2PVV A;  3PRT A;  4MCS A;  3JTK A;  2CIJ A;  1Z8T A;  4KOR A;  4CGP A;  2ZOF A;  4F9V A;  1H8L A;  2PJ9 A;  4KS9 A;  3V7Z A;  1LAM A;  2GLF A;  4MHP A;  2PRQ A;  4FD4 A;  4DUK A;  1PU9 A;  1XJO A;  4IK2 A;  1F2O A;  4M6G A;  3E0K A;  2JEW A;  1VHS A;  3GB0 A;  4ONW A;  1NMT A;  6CPA A;  3H8E A;  3R95 A;  3DNS A;  4F8Z A;  2FVG A;  1U6M A;  2ZEE A;  3SJE A;  5LYD A;  1Q2D A;  1BOB A;  1I12 A;  1IOF A;  2B3V A;  4A33 A;  4PSX A;  4KOU A;  4OP4 A;  2KCW A;  2P6G A;  2WSA A;  1AUG A;  3BLN A;  3P2F A;  4PQA A;  2BL1 A;  2FXF A;  2Z0Z A;  1OBR A;  1BLL E;  1S60 A;  3EY5 A;  4DYO A;  2Z10 A;  2QVP A;  4KOY A;  4LQ6 A;  4KVO E;  4KLW A;  2J9A A;  3D7F A;  4ZYQ A;  1RO5 A;  2PJ2 A;  1SQH A;  3RNZ A;  1IID A;  3I1U A;  4GM5 A;  4P45 A;  5G22 A;  1QMU A;  2GAN A;  2YGW A;  3PFO A;  4CGM A;  2D4P A;  3DLJ A;  4XPL A;  5HVG A;  2A4N A;  3SI0 A;  3K9T A;  1UWY A;  4CGL A;  1QSM A;  2ZXV A;  4UCP A;  1LAN A;  2C27 A;  2B5G B;  2PE3 A;  2WZN A;  4FWU A;  3BJ8 A;  1YR0 A;  1IOI A;  5IB9 A;  4UIA A;  2J8N A;  5IX3 A;  4NCZ A;  2HV2 A;  1QQ9 A;  3B3V A;  3NE7 A;  4LQG A;  4MCP A;  4A32 A;  2Z3P A;  4W9Y A;  3H8F A;  2Q0Y A;  4H6Z A;  2EK8 A;  1S7L A;  3IO1 A;  3JVN A;  4IUS A;  1M44 A;  2JLM A;  4EME A;  4NGS A;  2JDC A;  3FVL A;  3NFZ A;  4A95 A;  2O53 A;  2PCU A;  1Q2Y A;  4J3G A;  4B13 A;  4WWV A;  3GKR A;  3IU2 A;  2OOT A;  4CS0 B;  1ZO0 A;  4RUH A;  4CRY B;  3BHX A;  4KOX A;  3R1K A;  4NFR A;  4A2Z A;  1A2Z A;  1Y0R A;  4YGO A;  3SHP A;  4R9M A;  2Q4Y A;  4MRI A;  4MCQ A;  2R1I A;  2Z3L A;  3BXM A;  2CNM A;  2VI7 A;  5G21 A;  3K9U A;  4XNH C;  4UEF A;  4MFP A;  4TNU A;  5C88 A;  2PJB A;  3B35 A;  1X12 A;  1P0H A;  2ZEO A;  3B3T A;  7CPA A;  4C7H A;  4OC3 A;  3SJX A;  3KQZ A;  4CPA A;  2BOA A;  3TOA A;  1IYL A;  1P4N A;  4OC1 A;  3S6F A;  1KUY A;  5DWN A;  5G1Z A;  1MJB A;  2CTC A;  3V38 A;  1PUA A;  2R8V A;  4KSA A;  1ZLI A;  1IB1 E;  2VL1 A;  2VEZ A;  2BCO A;  4ZX8 A;  4DJL A;  2XEI A;  3IWE A;  3D4U A;  3D3S A;  3FNC A;  2JBK A;  4Q38 A;  1M4G A;  4MFJ A;  4NGT A;  4OC2 A;  2VBQ A;  2EBJ A;  4GS4 A;  1YVO A;  4B11 A;  4CYQ A;  3ZJ0 A;  4KUA A;  3F0A A;  4NJQ A;  1Z4R A;  1Q7L A;  3TX8 A;  3KHX A;  2PRB A;  3KAS A;  5HH1 A;  3RAM A;  2REE A;  3F5B A;  2RB7 A;  2G3T A;  3PB6 X;  3IEH A;  2CXA A;  2V8V A;  2ZEG A;  2OZG A;  2QYV A;  4CAX A;  1VHE A;  1M4D A;  1GYT A;  2C6G A;  3ZZI A;  3FYN A;  4KVM E;  4MFQ A;  5CNP A;  5D29 A;  3CXQ A;  3ISX A;  1VGY A;  1CM0 A;  1YLO A;  2AFO A;  2EWB A;  2WPW A;  4JJX A;  1Z4E A;  1AYE A;  2PIZ A;  2PVW A;  3FH4 A;  2Q43 A;  5KTA A;  3CXS A;  3IC1 A;  1V0C A;  4QBJ A;  4YU9 A;  2QJ8 A;  2ZED A;  3WAB A;  4CAF A;  1YW4 A;  4F9U A;  4YFJ A;  2DF5 A;  2GRE A;  2P6F A;  4X3R A;  1YW6 A;  3D2M A;  1YME A;  4KOT A;  4NJR A;  5E96 A;  3PB8 X;  3FJU A;  4QB9 A;  4AG7 A;  3N5F A;  1KWM A;  1Z9U A;  2AFX A;  4NXY A;  2PJC A;  4B10 A;  2YNC A;  1FY7 A;  2EVN A;  3CPX A;  4NGR A;  3SJG A;  1CPS A;  4XPK A;  5JQ4 A;  3D7G A;  5JM6 A;  3WT4 A;  4C7I A;  3S9L A;  1DE4 C;  1XMB A;  4H6U A;  4UFW A;  4UWI A;  2ZW4 A;  3IWG A;  4RN7 A;  3VAT A;  2OZH A;  4HNW B;  1FNO A;  1RXT A;  3P2H A;  4KZT A;  4MFL A;  1ZG9 A;  2GLJ A;  5AG7 A;  2ZW5 A;  2VQY A;  2AJ6 A;  2B58 A;  3S6H A;  2OU2 A;  4RS2 A;  4Y49 B;  3TO7 A;  2AFM A;  3TFY A;  2JBJ A;  4O23 A;  3WC6 A;  4ZBG A;  4QVT A;  1Z8W A;  2VZZ A;  3FEE A;  4XPD B;  4UFX A;  3IIB A;  3TC8 A;  4BD9 A;  5DWM A;  4MHY A;  3S6K A;  4HNY B;  1CPX A;  2CNS A;  5ISV A;  2NMT A;  4CAV A;  2EK9 A;  3KL9 A;  1UFH A;  4U5Y A;  2R7H A;  4A37 A;  2G3A A;  1ARM A;  4YRH A;  3RBU A;  3KZW A;  2CTB A;  5LYI A;  4R7M A;  4ZY1 A;  4PXD A;  3ISZ A;  3QAH A;  1Z2L A;  2K5T A;  4PK3 A;  1YLE A;  4JLY A;  3SXN A;  5G20 A;  3R9F A;  3KHZ A;  2V77 A;  4R8F A;  1R43 A;  3FEC A;  2IJZ A;  1IYK A;  4UEE A;  5F09 A;  3PZJ A;  4B5P A;  3S6G A;  4KUB A;  4X5K A;  4ZY0 A;  5LRK A;  2PDO A;  4CYO A;  1Z5R A;  3CPA A;  2AFW A;  1ON0 A;  5H86 A;  2YNE A;  2X7B A;  4PPZ A;  2ZEH A;  3G3S A;  4X2T A;  3WC5 A;  2ATR A;  3CXP A;  1TKH A;  4NEX A;  4R3L A;  4C2Y A;  5ELY A;  3IWW A;  4RI1 A;  4UFV A;  5CPA A;  4E2A A;  5JH9 A;  3S9N A;  1XOV A;  4ZX9 A;  4UWJ A;  1CP6 A;  3LWU A;  4EWT A;  1K4J A;  4KOS A;  3D68 A;  3D7H A;  3VAR A;  3NH8 A;  4R3K A;  3QAY A;  1VHO A;  1LAP A;  1IY7 A;  3GLJ A;  1KZF A;  1TKF A;  3B8G A;  1TXR A;  2DPS A;  5EC4 A;  5LRG A;  1CJW A;  1RTQ A;  2GFQ A;  2XEG A;  2AE6 A;  1FT7 A;  2OR4 A;  4PXC A;  2IL4 A;  4BIN A;  5K8O A;  3RZA A;  2FIA A;  8CPA A;  3G8W A;  4IHM A;  4KSF A;  3V8I A;  5A27 A;  1TF8 A;  2ZEF A;  4MFK A;  3B3W A;  2J8R A;  1XRY A;  2D4O A;  2H5M A;  5CBM A;  3GY9 A;  5K8M A;  4OAE A;  3D2P A;  3NH5 A;  4KLV A;  1B6B A;  5THW A;  2HUZ A;  2OH1 A;  4KSI A;  2YNC C;  4OAD A;  2Q7B A;  2DPT A;  3TCV A;  3LAC A;  4II9 A;  3K2K A;  2NSM A;  1YQE A;  1OZP A;  3T8W A;  2FE7 A;  5C82 A;  5J8F A;  4UCN A;  2PJ1 A;  2Y0M A;  4MMO A;  4MXU A;  1Y9W A;  2EUI A;  4BBH A;  2PIY A;  2XEF A;  1F57 A;  5JPH A;  4E8O A;  1M1D A;  1NSL A;  2IMO A;  3IFE A;  4F0Y A;  1IIC A;  4FD6 A;  3W91 A;  4CYP A;  3FX6 A;  4B6Z A;  1ARL A;  3PB9 X;  4IF5 A;  4JD6 A;  1LOK A;  4ORF A;  4UF4 A;  2VXK A;  2ZEP A;  3B2Y A;  4C2X A;  3VH9 A;  2QIR A;  3KQX A;  2VZY A;  1YSJ A;  4MHD A;  3NE8 A;  2DEA A;  1TF9 A;  1YK3 A;  4OID A;  2CY2 A;  3SI2 A;  3C26 A;  2PJ8 A;  3PEI A;  1ZG8 A;  2GE3 A;  4F0X A;  3OWC A;  4ZI6 A;  1XBU A;  5HVF A;  3GUX A;  4DNC A;  2Z3O A;  2AFS A;  3MRU A;  4BMH A;  3FIX A;  4NSQ A;  1MJA A;  1JWQ A;  5BWA B;  3H4Q A;  4FUU A;  4JYW A;  1F2P A;  3L2N A;  2POK A;  2ARH A;  5EMI A;  3RO0 A;  5F47 A;  4JWP A;  3BI1 A;  2V8D A;  1HDQ A;  4FD5 A;  3TOB A;  2ZEM A;  3R9G A;  4Y49 C;  1CX8 A;  2FCK A;  3MGD A;  2PJ6 A;  4P4F A;  4R76 A;  3MN8 A;  4XPD C;  2CNT A;  3B3C A;  2ZW6 A;  3DR8 A;  3R9E A;  2PR1 A;  1Y0Y A;  3NA6 A;  3W6S A;  5AG4 A;  3TO6 A;  3S9M A;  5LYL A;  1CP7 A;  3BJ7 A;  1YRE A;  2G9D A;  3F8K A;  2QML A;  5DS0 A;  4ZY2 A;  2B4B A;  3DR6 A;  1TKJ A;  1KUX A;  1XMT A;  4KVX A;  4M6I A;  2EO8 A;  3H5Z A;  2REF A;  4OKO A;  5AGE A;  2FT0 A;  1L0C A;  2P0W A;  5F48 A;  4A39 A;  2O28 A;  3GYA A;  2HQY A;  4EVY A;  4K3N A;  4MJ8 A;  4OC0 A;  2RFH A;  4IAV A;  1ELM P;  4JZ0 A;  5HVH A;  5LYF A;  2PJ7 A;  1R57 A;  1YGH A;  4B5P B;  3KR5 A;  4AVC A;  5I0C A;  1QSN A;  4YWY A;  1LFW A;  2C1C A;  3KR4 A;  4CAW A;  2GU2 A;  4A94 A;  2I00 A;  3D7D A;  3N7Z A;  4QUS A;  3CZX A;  2O4H A;  2BO9 A;  3QB8 A;  2YND A;  3LD2 A;  1AMP A;  4LUA A;  5HXD A;  2Q44 A;  2IQ6 A;  2PJ4 A;  3VWE A;  4U9Z A;  3PBB A;  4TWE A;  2AFU A;  5D8N A;  2JDD A;  3FMC A;  3KGQ A;  5I4M A;  2FS5 A;  4JXQ A;  1Z8X A;  4JXR A;  2ZEL A;  3FED A;  3KKW A;  4UEZ A;  2PJ3 A;  4CAE A;  1HEE A;  4PSW A;  4HPS A;  2NYQ A;  1VKC A;  2Z11 A;  4ONU A;  4M3S A;  1YX0 A;  4AB7 A;  3DDD A;  3JUW A;  1Y7E A;  3DGV A;  5KTD A;  3WR7 A;  4Q7A A;  1XE4 A;  1MK4 A;  5AG6 A;  4B12 A;  4EFD A;  2F8H A;  2OB0 A;  2Q7S A;  4P10 A;  3IJ3 A;  2FIW A;  3QNV A;  4OLL A;  4UIB A;  3SXO A;  2C6P A;  2FSR A;  3TTH A;  5LRJ A;  1NE9 A;  5F49 A;  1QSO A;  4Z65 A;  1WWZ A;  4HNX B;  1N71 A;  1BPM A;  2BUE A;  5K8P A;  2BSW A;  2XEJ A;  4ZGY B;  5K8N A;  4OME A;  4X8I A;  3H8G A;  2F5I A;  4R6T A;  3D8P A;  2RC4 A;  1BPN A;  4MY0 A;  4OC5 A;  1PYT B;  3PP9 A;  4NGM A;  1ZG7 A;  1XFO A;  4UA3 A;  2PJ5 A;  4CRZ B;  2V8H A;  1M4I A;  1JQG A;  1QSR A;  5AG5 A;  4P4I A;  1BAV A;  2B3U A;  4FD7 A;  4U9Y A;  1R3N A;  4UCM A;  1XEB A;  3TT2 A;  1NSA A;  2I79 A;  5EBV A;  1PCA A;  4MI4 A;  4P4B A;  5HMN A;  2HB6 A;  2FL4 A;  3T90 A;  4PXB A;  4PK2 A;  1XIX A;  1CBX A;  1DTD A;  1GHE A;  3PB7 X;  4OIW A;  2PJA A;  1S7K A;  3JRU A;  3RYO A;  3IGR A;  4CYN A;  4P4J A;  5IB0 A;  1X10 A;  4NGQ A;  4HKF A;  3TE4 A;  4C2Z A;  3D66 A;  2V8G A;  1KUV A;  3PB4 X;  3HLP A;  3FF3 A;  3PFE A;  3EC4 A;  2GIV A;  4AXV A;  1HDU A;  3BI0 A;  4MY3 A;  1CG2 A;  3T9Y A;  3PGP A;  4AG9 A;  2B5G A;  4WJB A;  3EO4 A;  3PBE A;  2ABZ A;  2Q51 A;  4M6H A;  4I49 A;  4L89 A;  3UY5 A;  3FBU A;  4PXE A;  3WC7 A;  4LX9 A;  4F6A A;  4PV6 A;  1Z8L A;  3R96 A;  4B14 A;  2OZU A;  3CDX A;  1S7F A;  2AFZ A;  2BEI A;  2J8M A;  2Z3N A;  1QST A;  1ZLH A;  2ZOG A;  1Y9K A;  3KI9 A;  3W6X A;  2C6C A;  3DSB A;  3EXN A;  4MFZ A;  4FAI A;  2PSW A;  5H84 A;  4A31 A;  4E0A A;  2PR8 A;  4A38 A;  4P4E A;  1IU8 A;  4NGN A;  3FRM A;  5FVJ A;  3CT9 A;  2ZPA A;  4H89 A;  3EFA A;  4L8A A;  4P4D A;  3SJF A;  5F46 A;  3NH4 A;  2WUU A;  3FB3 A;  5J8C A;  3I3G A;  1ELL P;  2B4D B;  2PJ0 A;  4P44 A;  2R98 A;  1I21 A;  1J4J A;  1M4L A;  2Q4Z A;  3I9S A;  2Q4V A;  2DXQ A;  2Q04 A;  5GCN A;  1IGB A;  1XF8 A;  1S3Z A;  3GIU A;  2CF4 A;  2WYR A;  4KOW A;  2ZEN A;  4NF1 A;  4XNH B;  4P6Y A;  4B5O A;  5IV0 A;  4Q36 A;  3FXT A;  2PQ8 A;  2ZW7 A;  4CGN A;  3LOD A;  1S5K A;  1YVK A;  2F7V A;  4H2K A;  1B87 A;  4AVA A;  5KTC A;  4MHZ A;  1Q2C A;  2WPX A;  3IU1 A;  1I1D A;  4MHN A;  4FBE A;  2QEC A;  4NGP A;  3VWD A;  2Z3K A;  4MCR A;  5JGF A;  4R87 A;  2Z3M A;  3LMS A;  4GXH A;  1S7N A;  4G1P A;  5J1Q A;  1Y7R A;  3TO9 A;  3A9L A;  3B3S A;  3B7I A;  4MBU A;  3SI1 A;  2B4D A;  3HUV A; 
#chains in the Genus database with same CATH homology
 2ANP A;  3D67 A;  2HC9 A;  2I3C A;  4OC4 A;  1EE3 P;  1LCP A;  1VIX A;  2PVV A;  3PRT A;  4MCS A;  2CIJ A;  2ZOF A;  4F9V A;  1H8L A;  2PJ9 A;  3V7Z A;  1LAM A;  2GLF A;  4MHP A;  2PRQ A;  4DUK A;  1XJO A;  4IK2 A;  1F2O A;  2JEW A;  3GB0 A;  4ONW A;  6CPA A;  3H8E A;  4F8Z A;  2FVG A;  2ZEE A;  3SJE A;  5LYD A;  4OP4 A;  4PQA A;  4DYO A;  1OBR A;  1BLL E;  2QVP A;  2J9A A;  3D7F A;  4ZYQ A;  2PJ2 A;  3I1U A;  4GM5 A;  4P45 A;  1QMU A;  3PFO A;  5HVG A;  3DLJ A;  3SI0 A;  3K9T A;  1UWY A;  1LAN A;  2WZN A;  2PE3 A;  5IB9 A;  4FWU A;  4UIA A;  1QQ9 A;  3B3V A;  4LQG A;  4MCP A;  4W9Y A;  3H8F A;  2EK8 A;  3IO1 A;  4EME A;  4NGS A;  3FVL A;  3NFZ A;  2O53 A;  2PCU A;  4WWV A;  2OOT A;  4RUH A;  3BHX A;  4NFR A;  1Y0R A;  4MRI A;  4MCQ A;  3BXM A;  4UEF A;  4TNU A;  2PJB A;  3B35 A;  2ZEO A;  3B3T A;  7CPA A;  4OC3 A;  3SJX A;  3KQZ A;  4CPA A;  2BOA A;  4OC1 A;  3V38 A;  2CTC A;  1ZLI A;  2VL1 A;  4ZX8 A;  2BCO A;  4DJL A;  2XEI A;  3D4U A;  2JBK A;  4NGT A;  4OC2 A;  4NJQ A;  1Q7L A;  3TX8 A;  3KHX A;  3KAS A;  3RAM A;  2RB7 A;  3PB6 X;  3IEH A;  2V8V A;  2ZEG A;  2QYV A;  1VHE A;  1GYT A;  2C6G A;  5D29 A;  3ISX A;  1VGY A;  1YLO A;  2AFO A;  2EWB A;  1AYE A;  2PIZ A;  2PVW A;  3FH4 A;  2Q43 A;  3IC1 A;  4YU9 A;  2QJ8 A;  2ZED A;  3WAB A;  1YW4 A;  4F9U A;  2GRE A;  4X3R A;  1YW6 A;  4NJR A;  1YME A;  3PB8 X;  3FJU A;  3N5F A;  1KWM A;  2AFX A;  2PJC A;  3CPX A;  4NGR A;  3SJG A;  1CPS A;  3D7G A;  5JM6 A;  3WT4 A;  3S9L A;  1DE4 C;  1XMB A;  3VAT A;  1FNO A;  1ZG9 A;  2GLJ A;  2AFM A;  2JBJ A;  4O23 A;  3WC6 A;  3FEE A;  3IIB A;  3TC8 A;  4BD9 A;  4MHY A;  1CPX A;  2EK9 A;  3KL9 A;  4A37 A;  1ARM A;  3RBU A;  3KZW A;  2CTB A;  5LYI A;  4R7M A;  4ZY1 A;  4PXD A;  3ISZ A;  1Z2L A;  3KHZ A;  2V77 A;  4R8F A;  1R43 A;  3FEC A;  2IJZ A;  4UEE A;  5F09 A;  4ZY0 A;  1Z5R A;  3CPA A;  2AFW A;  4X2T A;  4PPZ A;  5HVH A;  2ZEH A;  3WC5 A;  1TKH A;  5ELY A;  3IWW A;  5CPA A;  5JH9 A;  3S9N A;  4ZX9 A;  1CP6 A;  3LWU A;  4EWT A;  3D68 A;  3D7H A;  3VAR A;  3NH8 A;  1VHO A;  1LAP A;  1IY7 A;  3GLJ A;  1TKF A;  5LRG A;  1TXR A;  1RTQ A;  2XEG A;  1FT7 A;  2OR4 A;  4PXC A;  5K8O A;  3RZA A;  8CPA A;  4IHM A;  1TF8 A;  2ZEF A;  5LRK A;  3B3W A;  1XRY A;  5CBM A;  5K8M A;  3NH5 A;  4KSI A;  3K2K A;  2NSM A;  3T8W A;  2PJ1 A;  4MXU A;  4MMO A;  2PIY A;  2XEF A;  1F57 A;  2IMO A;  3IFE A;  3FX6 A;  4B6Z A;  1ARL A;  3PB9 X;  4UF4 A;  1LOK A;  3B2Y A;  2ZEP A;  3VH9 A;  3KQX A;  1YSJ A;  2DEA A;  1TF9 A;  4OID A;  3SI2 A;  3PEI A;  2PJ8 A;  1ZG8 A;  4ZI6 A;  1XBU A;  5HVF A;  3GUX A;  2AFS A;  3MRU A;  4FUU A;  4JYW A;  1F2P A;  3L2N A;  2POK A;  3BI1 A;  2V8D A;  1HDQ A;  2ZEM A;  1CX8 A;  2PJ6 A;  4P4F A;  4R76 A;  3MN8 A;  3B3C A;  1Y0Y A;  3NA6 A;  3S9M A;  5LYL A;  1CP7 A;  2G9D A;  4ZY2 A;  5DS0 A;  5JGF A;  1TKJ A;  5THW A;  4OKO A;  4A39 A;  4K3N A;  4OC0 A;  2RFH A;  4IAV A;  1ELM P;  4JZ0 A;  5LYF A;  2PJ7 A;  3KR5 A;  4YWY A;  1LFW A;  2C1C A;  3KR4 A;  2GU2 A;  4A94 A;  3D7D A;  2O4H A;  2BO9 A;  1AMP A;  5HXD A;  2IQ6 A;  2PJ4 A;  3PBB A;  4TWE A;  2AFU A;  5D8N A;  3KGQ A;  3FMC A;  5I4M A;  2ZEL A;  3FED A;  4UEZ A;  2PJ3 A;  1HEE A;  2NYQ A;  1Y7E A;  3DGV A;  4Q7A A;  4EFD A;  2F8H A;  4P10 A;  3IJ3 A;  3QNV A;  4UIB A;  2C6P A;  5LRJ A;  4Z65 A;  1BPM A;  5K8P A;  2XEJ A;  5K8N A;  4OME A;  4X8I A;  3H8G A;  4R6T A;  1BPN A;  4OC5 A;  1PYT B;  4NGM A;  1ZG7 A;  1XFO A;  2PJ5 A;  2V8H A;  1JQG A;  4P4I A;  1BAV A;  1R3N A;  1NSA A;  1PCA A;  4P4B A;  2HB6 A;  4PXB A;  1CBX A;  1DTD A;  3PB7 X;  4OIW A;  2PJA A;  3JRU A;  4P4J A;  4NGQ A;  3D66 A;  2V8G A;  3PB4 X;  3HLP A;  3FF3 A;  3PFE A;  4AXV A;  1HDU A;  3BI0 A;  1CG2 A;  4WJB A;  3PBE A;  2ABZ A;  2Q51 A;  4PXE A;  3WC7 A;  1Z8L A;  3CDX A;  2AFZ A;  2ZOG A;  1ZLH A;  3KI9 A;  2C6C A;  4FAI A;  4A38 A;  4P4E A;  4NGN A;  3CT9 A;  3SJF A;  4P4D A;  3NH4 A;  1ELL P;  2PJ0 A;  4P44 A;  1M4L A;  2Q4Z A;  1IGB A;  2CF4 A;  2WYR A;  2ZEN A;  4P6Y A;  2F7V A;  4H2K A;  4MHZ A;  4MHN A;  4FBE A;  4NGP A;  4MCR A;  3LMS A;  4G1P A;  5J1Q A;  3B7I A;  3B3S A;  3SI1 A;  3HUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...