4AXVA

Biochemical and structural characterization of the mpaa amidase as part of a conserved scavenging pathway for peptidoglycan derived peptides in gamma-proteobacteria
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
241
structure length
241
Chain Sequence
VLFQGPAMSLIPRTERAAFLITPTSYGKSVLGAPLLYFPAQVESNSRGLILAGTHGDETASIAGLSCALRSLPAECLKHDVILSMNPDANQLGTRANANQVDLNRAFPTQNWTEHGTVYRWSSHTPVRDVKVKTGDKEQLEPEVDALISLIELRRPKFVVSFHEPLAFVDDPAHSDLAKWLGKQFNLPIVDDVDYETPGSFGTWCNERQLPCITVELPPISADLTIEKHLDAFIALLQHDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mpaa is a Murein-Tripeptide-Specific Zinc Carboxypeptidase that Functions as Part of a Catabolic Pathway for Peptidoglycan Derived Peptides in Gamma-Proteobacteria.
pubmed doi rcsb
source organism Vibrio harveyi
molecule tags Hydrolase
molecule keywords MPAA
total genus 71
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4axvA00
2ZEGA 2PVWA 1TF8A 2PCUA 3FEEA 1EE3P 2OOTA 3IJ3A 5HVGA 3SI1A 3BHXA 4UIAA 4A39A 1ZLIA 3K9TA 3PFOA 2OR4A 4OC2A 4O23A 3SJGA 1YSJA 2EK8A 1TKHA 1XJOA 1CP6A 1TKFA 2G9DA 2QJ8A 3SJFA 2XEIA 1LANA 1FT7A 2ZEPA 4F9UA 2AFUA 3WC6A 2PVVA 3IFEA 4OKOA 4UEFA 4W9YA 3IEHA 1CX8A 1BPNA 2POKA 3D66A 3LWUA 1IGBA 8CPAA 7CPAA 3CPAA 2VL1A 2CTCA 2PJ1A 5JH9A 4MCRA 1Y7EA 1YW4A 1LAMA 5LYFA 3RZAA 2PJ7A 3KHZA 3KQZA 2J9AA 2IQ6A 4FUUA 2PE3A 1ARLA 3KGQA 4AXVA 1TXRA 5K8PA 4MRIA 2GLJA 1IY7A 2AFWA 4MHNA 3D7FA 3D4UA 5DS0A 1BAVA 4WWVA 3GUXA 3FJUA 4NGQA 4YWYA 1F2OA 3FEDA 3ISXA 3NH5A 5J1QA 2C1CA 3SI0A 2ZEHA 3PB9X 2PRQA 2XEJA 2JEWA 3FMCA 3RBUA 4OC4A 2DEAA 2CF4A 3VARA 3CDXA 5JM6A 4MMOA 4IAVA 4ZY1A 4ZY2A 1VHEA 1CG2A 5HVFA 4Z65A 3B7IA 4NGNA 4NGSA 4OC0A 4ONWA 1ZG9A 2F7VA 3KHXA 4R8FA 3KL9A 2PJAA 4ZX9A 1ELMP 2C6GA 4WJBA 3NH8A 1VHOA 3TC8A 3CT9A 4NGPA 3S9NA 3SI2A 4JYWA 2BOAA 3L2NA 2PJ3A 1CP7A 1QQ9A 3B3CA 4R6TA 5K8OA 4ZY0A 3T8WA 5IB9A 2I3CA 5HVHA 2BO9A 1XMBA 2EWBA 1AMPA 3SJXA 4PXBA 2RB7A 1Z2LA 2ZEOA 4F8ZA 3S9MA 5LRGA 4OC1A 4UEZA 3KR4A 3D67A 2AFOA 3WC5A 5D8NA 2ZELA 2JBKA 4IHMA 3V7ZA 2FVGA 2PJBA 1CPSA 1HDQA 3KASA 4TWEA 3QNVA 4F9VA 2EK9A 1F2PA 3FX6A 1ZLHA 4IK2A 1ARMA 1QMUA 2ABZA 4A94A 2F8HA 2ZEMA 1BLLE 3BI1A 2IMOA 1LOKA 4P4BA 2PJ4A 1YW6A 4MCPA 3DLJA 1PCAA 3H8GA 4GM5A 1LAPA 4TNUA 5LRJA 3DGVA 4X8IA 1BPMA 1Z5RA 3MN8A 3GB0A 1YMEA 3H8EA 4OIDA 4A38A 2ANPA 1GYTA 6CPAA 2O4HA 2NYQA 3BI0A 3HUVA 5K8MA 4X2TA 3PB7X 2AFZA 3WT4A 2RFHA 3FECA 1UWYA 3PB4X 4MCSA 3BXMA 5CPAA 1Z8LA 4EWTA 4ZI6A 4FBEA 3D7DA 3LMSA 4MCQA 3B3WA 4OMEA 2PJ0A 4R76A 4ZX8A 1VGYA 4PXDA 2V77A 1NSAA 3NH4A 4KSIA 1ZG7A 2Q43A 5LYLA 4ZYQA 2XEFA 4H2KA 4MHPA 1XRYA 2QVPA 5I4MA 5HXDA 1XBUA 3ISZA 3PBEA 2AFXA 2AFSA 4P4FA 3FVLA 3KR5A 3HLPA 4CPAA 5CBMA 4LQGA 2ZEEA 1ELLP 2PJ9A 4P4EA 4NGRA 2Q51A 3IIBA 2HB6A 2GU2A 3PB8X 3WC7A 3B3VA 3D68A 1TF9A 3TX8A 3GLJA 4P4DA 1OBRA 2V8VA 5F09A 4P10A 2PJCA 1CBXA 3PEIA 2C6CA 2V8HA 2ZEDA 3VH9A 1HEEA 3VATA 2NSMA 2ZOGA 2ZOFA 1XFOA 4P4JA 1M4LA 3PFEA 3B2YA 1RTQA 4DYOA 2GREA 4NGMA 3V38A 4OIWA 4PQAA 4NFRA 4PXCA 3IWWA 4UF4A 1FNOA 2V8GA 2Q4ZA 4P6YA 4P4IA 2GLFA 2PJ8A 2ZEFA 2BCOA 3NA6A 1PYTB 2JBJA 4X3RA 2CTBA 3KZWA 3PRTA 4NGTA 3B3SA 4PPZA 1KWMA 3PB6X 4MXUA 3JRUA 1R3NA 3RAMA 1AYEA 3FH4A 3KQXA 1HDUA 4MHZA 3NFZA 5ELYA 2CIJA 4K3NA 3KI9A 4R7MA 1LFWA 4NJQA 4FWUA 2ZENA 3N5FA 4EFDA 4DUKA 1DTDA 2HC9A 2AFMA 3I1UA 4OC3A 2PJ6A 4OP4A 2PIYA 4EMEA 5JGFA 3WABA 2PJ5A 2WZNA 4G1PA 2PJ2A 4NJRA 1R43A 3CPXA 1Q7LA 3MRUA 4FAIA 1JQGA 4PXEA 3PBBA 3IO1A 5D29A 4JZ0A 4UIBA 1LCPA 1DE4C 5LYDA 1H8LA 2IJZA 5LYIA 4B6ZA 1YLOA 1Y0RA 4DJLA 4MHYA 3K2KA 3B35A 2C6PA 2PIZA 4A37A 1CPXA 3H8FA 5LRKA 4RUHA 3D7HA 4P45A 3B3TA 3S9LA 4YU9A 4UEEA 2QYVA 1TKJA 1VIXA 4BD9A 1ZG8A 3FF3A 3SJEA 5K8NA 2WYRA 4P44A 5THWA 3D7GA 2O53A 2V8DA 3IC1A 1F57A 4Q7AA 1Y0YA 4OC5A 2XEGA
chains in the Genus database with same CATH superfamily
2ZEGA 2OZUA 4MFJA 2PVWA 1TF8A 2PSWA 2PCUA 4KVME 4QUSA 5AG7A 3FEEA 2Z10A 4R9MA 4RI1A 1IIDA 4RS2A 1EE3P 2OOTA 3IJ3A 4B5PB 2HUZA 3BHXA 3JTKA 4UIAA 3SI1A 4A39A 5HVGA 1ZLIA 1I12A 4NEXA 3K9TA 2K5TA 3PFOA 4Y49B 2OR4A 4CGLA 2Q4VA 4FD6A 4O23A 4OC2A 3ZJ0A 2XEGA 1YVKA 4HPSA 3SJGA 1ON0A 1YSJA 2BSWA 2EK8A 2EBJA 1TKHA 1XJOA 1CP6A 1TKFA 2G9DA 4NCZA 2I00A 2NMTA 2VI7A 2QJ8A 3SJFA 3SHPA 4YGOA 4MFPA 3NE8A 2VZZA 1IB1E 1JWQA 3JVNA 1A2ZA 4RN7A 5E96A 2Q4YA 3RNZA 4M3SA 1MJBA 1IYKA 2EO8A 2XEIA 1LANA 1FT7A 2ZEPA 3TOBA 4F9UA 2ZW7A 2IL4A 1NE9A 3B8GA 2AFUA 3W6XA 3WC6A 1ZO0A 4OADA 1WWZA 2PVVA 3IFEA 2R1IA 4OKOA 3CXSA 3GY9A 4UEFA 4W9YA 4CAWA 1M1DA 3IEHA 1CX8A 3F8KA 1BPNA 3R95A 2BUEA 1K4JA 5F46A 2POKA 2B3UA 3D2MA 3D66A 3LWUA 1IGBA 1Y7RA 3PP9A 1J4JA 4GXHA 4PK2A 2Q7BA 3TO9A 8CPAA 7CPAA 4MFQA 2FL4A 2J8MA 3H4QA 2AE6A 3NE7A 5G22A 3CPAA 2YNDA 1B87A 2VL1A 2CTCA 3DNSA 1M44A 4KOVA 3W91A 4AVBA 2PJ1A 4JD6A 4XNHB 1N71A 4MCRA 1Y7EA 4C7HA 4FD5A 2FCKA 1V0CA 1YW4A 5CNPA 3R9GA 2P0WA 4A30A 1LAMA 4KSAA 5LYFA 3RZAA 2PJ7A 1UFHA 4H6ZA 1B6BA 4AVAA 3KHZA 5JH9A 3KQZA 1Z4EA 2J9AA 2IQ6A 4FUUA 4NXYA 1P0HA 2WPXA 4AG7A 4KUBA 2PE3A 1ARLA 3KGQA 2P6GA 4MFLA 5KTAA 4B11A 4AXVA 1TXRA 5EBVA 5K8PA 4MRIA 2GLJA 1IY7A 2AFWA 4FD7A 4KVOE 4LX9A 2VQYA 4MHNA 2PR1A 4A31A 4JXRA 3D7FA 3D4UA 1YREA 1RXTA 1YR0A 5DS0A 1BAVA 1SQHA 2R98A 3GUXA 4WWVA 3TTHA 3FJUA 4NGQA 4YWYA 2QECA 1F2OA 2FIAA 2R7HA 3FEDA 1PU9A 2Z3PA 3QB8A 3ISXA 3NH5A 5J1QA 4UFVA 2C1CA 3SI0A 2QMLA 2G0BA 5IX3A 3R1KA 1S60A 2ZEHA 3PB9X 2PRQA 4X5KA 5DWNA 1XF8A 2XEJA 2ZXVA 2P6FA 2JEVA 3C26A 3F0AA 5J8CA 2JEWA 3FMCA 4UCNA 3RBUA 2RC4A 4B13A 3TFYA 4CYQA 4OC4A 2DEAA 2CF4A 4BINA 3VARA 3CDXA 5JM6A 4MMOA 2C27A 4IAVA 4ZY1A 2CXAA 3G8WA 4ZY2A 1M4GA 2Z3OA 3BLNA 2ZW5A 5GCNA 1VHEA 5IB0A 1CG2A 4AVCA 3R9EA 5HVFA 3MGDA 3P2HA 5C88A 4Z65A 2YNCA 3B7IA 4NGNA 4NGSA 4OC0A 4ONWA 4EVYA 3GYAA 1ZG9A 2F7VA 3KHXA 4C2ZA 4JJXA 4R8FA 3KL9A 4A95A 2PR8A 3FNCA 2PJAA 4ZX9A 3GKRA 1ELMP 2C6GA 1QSNA 4WJBA 4U9YA 3NH8A 3TOAA 1KUVA 1VHOA 3GIUA 3TC8A 3CT9A 1IICA 4QBJA 2PRBA 4NGPA 3S9NA 3SI2A 3DR8A 3S6KA 4JYWA 1CM0A 2BOAA 1KUYA 4CYPA 4AB7A 3L2NA 2PJ3A 3VWDA 4A2ZA 1CP7A 1QQ9A 3CXQA 3B3CA 4R6TA 5K8OA 2ODFA 4U5YA 1KUXA 1Z8WA 4ZY0A 3T8WA 5IB9A 2I3CA 5HVHA 1IOFA 4NF1A 2BO9A 4A33A 5C82A 3BJ8A 1XMBA 4II9A 3JUWA 2Z0ZA 2EWBA 1AMPA 1Z8XA 2CY2A 3SJXA 4PXBA 4CYOA 2RB7A 3SXOA 1Z2LA 2FS5A 2EUIA 2ZEOA 2EVNA 2Z3KA 3I3GA 4JXQA 4F8ZA 2Y0MA 2CNSA 3S9MA 5LRGA 3FRMA 4XPDC 3CXPA 4OC1A 4R87A 4UEZA 4B10A 3FBUA 3PZJA 3KR4A 3D67A 4Q36A 2AFOA 2B5GB 3WC5A 5D8NA 5HMNA 4HNXB 4UFWA 4KS9A 2OU2A 3UY5A 2ZELA 1M4IA 1M4DA 2JBKA 4IHMA 5KTCA 1Q2DA 3V7ZA 1Y9WA 2FVGA 1TIQA 2PJBA 5J8FA 4XPLA 2DF5A 1CPSA 1HDQA 3KASA 5JQ4A 4TWEA 3QNVA 4CAXA 4F9VA 2BL1A 1VHSA 2EK9A 3LODA 2Q7SA 4M6GA 1F2PA 1RO5A 3FX6A 4IUSA 1ZLHA 4Q38A 4IK2A 3R96A 1ARMA 5AG4A 1YGHA 4FD4A 4C2XA 5H86A 1QMUA 1I1DA 2ABZA 5G20A 3V8IA 4MFKA 4A94A 2F8HA 2ZEMA 4KUAA 1BLLE 3BI1A 1S7FA 2IMOA 1LOKA 4P4BA 2PJ4A 1YW6A 4MCPA 2B58A 3DLJA 1PCAA 3H8GA 4GM5A 1LAPA 4TNUA 5F47A 5LRJA 3T90A 3DGVA 4X8IA 4CYNA 2B4DA 3DDDA 2D4OA 1BPMA 1XMTA 2VXKA 3IWGA 3LD2A 1Z5RA 5EMIA 3MN8A 3GB0A 2J8NA 2R8VA 1YMEA 1MJ9A 3H8EA 4CAEA 3KKWA 4OIDA 4A38A 2ANPA 2O28A 1GYTA 6CPAA 3D8PA 2Z11A 3PGPA 4I49A 2O4HA 2NYQA 2DPSA 5A28A 3A9LA 1BO4A 3BI0A 3HUVA 3IU2A 5K8MA 4M6HA 4JWPA 4X2TA 3PB7X 2AFZA 4CRZB 4ZBGA 4A32A 3WT4A 2RFHA 3FECA 2FE7A 4J3GA 3RO0A 1UWYA 3FB3A 4HNWB 3T9YA 3PB4X 4CAFA 4MCSA 2YNCC 3BXMA 5CPAA 1Z8LA 4EWTA 3EFAA 4CGOA 1XE4A 4MY3A 2GFQA 4F6AA 4ZI6A 2JDDA 1AUGA 3VWEA 5F48A 3D2PA 4FBEA 1XIXA 2B5GA 2CNMA 3D7DA 3LMSA 2KCWA 4MCQA 3B3WA 4QVTA 5AG6A 4OMEA 2PJ0A 2G3TA 2WSAA 2JLMA 4MY0A 1Z9UA 3BJ7A 3IU1A 2H5MA 2OB0A 4R76A 2REEA 4ZX8A 4XPDB 1VGYA 4PXDA 2V77A 1NSAA 2PQ8A 4MJ8A 3NH4A 4KSIA 3FYNA 5F49A 1ZG7A 4KSFA 2AJ6A 2Q43A 5LYLA 2ZPAA 4ZYQA 2XEFA 2DPTA 4H2KA 1FY7A 1QSRA 2WUUA 4KLVA 2HV2A 1QSMA 1PUAA 4MHPA 1XRYA 4UWIA 2FSRA 4ORFA 5K8NA 5H84A 2QVPA 5I4MA 4MBUA 5HXDA 1XBUA 5HH1A 3ZZIA 3FIXA 3ISZA 3PBEA 2AFSA 4BMHA 3DR6A 3FVLA 3FXTA 3KR5A 4P4FA 4CRYB 3HLPA 1X10A 5AG5A 4CPAA 4CGNA 4HKFA 4LQGA 5CBMA 5A27A 2ZEEA 4OLLA 1ELLP 2PJ9A 4P4EA 4LQ6A 4NGRA 2JDCA 1Q2YA 2Q51A 2CNTA 4MI4A 2PDOA 4GS4A 3IIBA 4UFXA 3WR7A 2HB6A 2GU2A 1NSLA 4IF5A 3PB8X 3WC7A 2D4PA 3B3VA 5KTDA 3D68A 1TF9A 3EO4A 1LRZA 1MK4A 3TX8A 1GHEA 4M85A 4UCPA 4XNHC 3TT2A 3GLJA 4P4DA 4NSQA 1OBRA 2V8VA 5F09A 3TE4A 2OH1A 1Z8TA 4P10A 1X12A 4ONUA 2PJCA 4B12A 1CBXA 3PEIA 1S7LA 3R9FA 2C6CA 2V8HA 4KLWA 3IGRA 2ZEDA 3VH9A 2ATRA 3E0KA 1HEEA 3VATA 2B3VA 2NSMA 1WK4A 2ZOGA 1YVOA 2FIWA 2GE3A 4YRHA 3EXNA 2ZOFA 2PC1A 1XFOA 4P4JA 1YQEA 1Q2CA 1M4LA 3CZXA 5DWMA 3TO7A 3QAHA 4UWJA 4KOSA 5G1ZA 1IOIA 3PFEA 3B2YA 1RTQA 4DYOA 4L8AA 4F0YA 2GREA 4KOTA 4NGMA 5EC4A 4U9ZA 3V38A 4OIWA 4PQAA 4NFRA 4PXCA 3RYOA 1Z4RA 4PV6A 3IWWA 4UF4A 4CGPA 2OZGA 4B5PA 1FNOA 2V8GA 2P6EA 2Q4ZA 2VZYA 4P6YA 4QB9A 4P4IA 1YX0A 2GLFA 4C7IA 2PJ8A 2ZEFA 2BCOA 3EY5A 3NA6A 2Z3MA 1PYTB 3G3SA 3TCVA 2JBJA 1S3ZA 2I79A 4X3RA 1R57A 1L0CA 2CTBA 4JLYA 3KZWA 3PRTA 4NGTA 4R57A 5FVJA 3B3SA 1S7KA 4UA3A 4KOUA 1VKCA 2GANA 4H6UA 4PPZA 1BOBA 2HQYA 4PSWA 1KWMA 2YGWA 3DSBA 3PB6X 4M6IA 4MFZA 4MXUA 3JRUA 2Q0YA 1R3NA 2REFA 1AYEA 3RAMA 3FH4A 5JPHA 4F0XA 4B5OA 1IU8A 1HDUA 3KQXA 4MHZA 3NFZA 5ELYA 2DXQA 2OZHA 2CIJA 4K3NA 1P4NA 3KI9A 3S6FA 4R7MA 4C2YA 2A4NA 4UCMA 1LFWA 1OZPA 2Q44A 1IYLA 4H89A 4NJQA 4FWUA 2ZENA 3N5FA 3N7ZA 4EFDA 5BWAB 4DUKA 4UBRA 1CJWA 1DTDA 2ZW6A 4MHDA 2HC9A 1S5KA 4LUAA 2AFMA 3I1UA 4OC3A 2PJ6A 2FT0A 4OP4A 2ZW4A 2PIYA 4EMEA 4KORA 5JGFA 3WABA 3S6HA 2PJ5A 4CS0B 2WZNA 4G1PA 2G3AA 4HNYB 4KZTA 3W6SA 4ZGYB 2PJ2A 4C68A 4NJRA 4KOXA 2Q04A 2X7BA 4XPKA 4E8OA 1R43A 3CPXA 2FXFA 1XEBA 1Y9KA 5G21A 1Q7LA 3EC4A 3MRUA 4FAIA 5IV0A 4DNCA 1JQGA 4PXEA 2BEIA 2J8RA 3PBBA 3IO1A 1MJAA 1NMTA 4PK3A 2B4BA 2VEZA 2Z3LA 5D29A 2GIVA 3P2FA 1LCPA 4JZ0A 1DE4C 4L89A 2QIRA 4UIBA 4K30A 4CGMA 4YFJA 1YK3A 5LYDA 1H8LA 2IJZA 5LYIA 4B6ZA 2WPWA 1YLOA 1Y0RA 4AG9A 4DJLA 5AGEA 3H5ZA 4QC6A 4KVXA 1XOVA 1QSOA 4MHYA 3K2KA 3B35A 2C6PA 2PIZA 4A37A 3D3SA 2Z3NA 1CPXA 1I21A 3F5BA 3H8FA 4OAEA 3S6GA 3OWCA 4E0AA 5LRKA 4RUHA 2F5IA 3D7HA 4KOYA 1QSTA 1U6MA 4P45A 3B3TA 3S9LA 4YU9A 4UEEA 4BBHA 3IWEA 2QYVA 3TO6A 1TKJA 1VIXA 4BD9A 1KZFA 4Y49C 1ZG8A 3FF3A 3SJEA 2YNEA 3K9UA 2WYRA 4P44A 5THWA 3SXNA 3I9SA 4KOWA 3D7GA 4PSXA 4R3LA 2O53A 2VBQA 4E2AA 1YLEA 5ISVA 2V8DA 3IC1A 2ARHA 4B14A 3QAYA 1F57A 4R3KA 4Q7AA 2B4DB 4CAVA 5I0CA 1S7NA 1Y0YA 4OC5A 2AFXA 3LACA
chains in the Genus database with same CATH topology
2ZEGA 2PVWA 1TF8A 2PCUA 3FEEA 1EE3P 2OOTA 3IJ3A 5HVGA 3SI1A 3BHXA 4UIAA 4A39A 1ZLIA 3K9TA 3PFOA 2OR4A 4OC2A 4O23A 3SJGA 1YSJA 2EK8A 1TKHA 1XJOA 1CP6A 1TKFA 2G9DA 2QJ8A 3SJFA 2XEIA 1LANA 1FT7A 2ZEPA 4F9UA 2AFUA 3WC6A 2PVVA 3IFEA 4OKOA 4UEFA 4W9YA 3IEHA 1CX8A 1BPNA 2POKA 3D66A 3LWUA 1IGBA 8CPAA 7CPAA 3CPAA 2VL1A 2CTCA 2PJ1A 5JH9A 4MCRA 1Y7EA 1YW4A 1LAMA 5LYFA 3RZAA 2PJ7A 3KHZA 3KQZA 2J9AA 2IQ6A 4FUUA 2PE3A 1ARLA 3KGQA 4AXVA 1TXRA 5K8PA 4MRIA 2GLJA 1IY7A 2AFWA 4MHNA 3D7FA 3D4UA 5DS0A 1BAVA 4WWVA 3GUXA 3FJUA 4NGQA 4YWYA 1F2OA 3FEDA 3ISXA 3NH5A 5J1QA 2C1CA 3SI0A 2ZEHA 3PB9X 2PRQA 2XEJA 2JEWA 3FMCA 3RBUA 4OC4A 2DEAA 2CF4A 3VARA 3CDXA 5JM6A 4MMOA 4IAVA 4ZY1A 4ZY2A 1VHEA 1CG2A 5HVFA 4Z65A 3B7IA 4NGNA 4NGSA 4OC0A 4ONWA 1ZG9A 2F7VA 3KHXA 4R8FA 3KL9A 2PJAA 4ZX9A 1ELMP 2C6GA 4WJBA 3NH8A 1VHOA 3TC8A 3CT9A 4NGPA 3S9NA 3SI2A 4JYWA 2BOAA 3L2NA 2PJ3A 1CP7A 1QQ9A 3B3CA 4R6TA 5K8OA 4ZY0A 3T8WA 5IB9A 2I3CA 5HVHA 2BO9A 1XMBA 2EWBA 1AMPA 3SJXA 4PXBA 2RB7A 1Z2LA 2ZEOA 4F8ZA 3S9MA 5LRGA 4OC1A 4UEZA 3KR4A 3D67A 2AFOA 3WC5A 5D8NA 2ZELA 2JBKA 4IHMA 3V7ZA 2FVGA 2PJBA 1CPSA 1HDQA 3KASA 4TWEA 3QNVA 4F9VA 2EK9A 1F2PA 3FX6A 1ZLHA 4IK2A 1ARMA 1QMUA 2ABZA 4A94A 2F8HA 2ZEMA 1BLLE 3BI1A 2IMOA 1LOKA 4P4BA 2PJ4A 1YW6A 4MCPA 3DLJA 1PCAA 3H8GA 4GM5A 1LAPA 4TNUA 5LRJA 3DGVA 4X8IA 1BPMA 1Z5RA 3MN8A 3GB0A 1YMEA 3H8EA 4OIDA 4A38A 2ANPA 1GYTA 6CPAA 2O4HA 2NYQA 3BI0A 3HUVA 5K8MA 4X2TA 3PB7X 2AFZA 3WT4A 2RFHA 3FECA 1UWYA 3PB4X 4MCSA 3BXMA 5CPAA 1Z8LA 4EWTA 4ZI6A 4FBEA 3D7DA 3LMSA 4MCQA 3B3WA 4OMEA 2PJ0A 4R76A 4ZX8A 1VGYA 4PXDA 2V77A 1NSAA 3NH4A 4KSIA 1ZG7A 2Q43A 5LYLA 4ZYQA 2XEFA 4H2KA 4MHPA 1XRYA 2QVPA 5I4MA 5HXDA 1XBUA 3ISZA 3PBEA 2AFXA 2AFSA 4P4FA 3FVLA 3KR5A 3HLPA 4CPAA 5CBMA 4LQGA 2ZEEA 1ELLP 2PJ9A 4P4EA 4NGRA 2Q51A 3IIBA 2HB6A 2GU2A 3PB8X 3WC7A 3B3VA 3D68A 1TF9A 3TX8A 3GLJA 4P4DA 1OBRA 2V8VA 5F09A 4P10A 2PJCA 1CBXA 3PEIA 2C6CA 2V8HA 2ZEDA 3VH9A 1HEEA 3VATA 2NSMA 2ZOGA 2ZOFA 1XFOA 4P4JA 1M4LA 3PFEA 3B2YA 1RTQA 4DYOA 2GREA 4NGMA 3V38A 4OIWA 4PQAA 4NFRA 4PXCA 3IWWA 4UF4A 1FNOA 2V8GA 2Q4ZA 4P6YA 4P4IA 2GLFA 2PJ8A 2ZEFA 2BCOA 3NA6A 1PYTB 2JBJA 4X3RA 2CTBA 3KZWA 3PRTA 4NGTA 3B3SA 4PPZA 1KWMA 3PB6X 4MXUA 3JRUA 1R3NA 3RAMA 1AYEA 3FH4A 3KQXA 1HDUA 4MHZA 3NFZA 5ELYA 2CIJA 4K3NA 3KI9A 4R7MA 1LFWA 4NJQA 4FWUA 2ZENA 3N5FA 4EFDA 4DUKA 1DTDA 2HC9A 2AFMA 3I1UA 4OC3A 2PJ6A 4OP4A 2PIYA 4EMEA 5JGFA 3WABA 2PJ5A 2WZNA 4G1PA 2PJ2A 4NJRA 1R43A 3CPXA 1Q7LA 3MRUA 4FAIA 1JQGA 4PXEA 3PBBA 3IO1A 5D29A 4JZ0A 4UIBA 1LCPA 1DE4C 5LYDA 1H8LA 2IJZA 5LYIA 4B6ZA 1YLOA 1Y0RA 4DJLA 4MHYA 3K2KA 3B35A 2C6PA 2PIZA 4A37A 1CPXA 3H8FA 5LRKA 4RUHA 3D7HA 4P45A 3B3TA 3S9LA 4YU9A 4UEEA 2QYVA 1TKJA 1VIXA 4BD9A 1ZG8A 3FF3A 3SJEA 5K8NA 2WYRA 4P44A 5THWA 3D7GA 2O53A 2V8DA 3IC1A 1F57A 4Q7AA 1Y0YA 4OC5A 2XEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZEG A;  2PVW A;  1TF8 A;  2PCU A;  3FEE A;  1EE3 P;  2OOT A;  3IJ3 A;  5HVG A;  3SI1 A;  3BHX A;  4UIA A;  4A39 A;  1ZLI A;  3K9T A;  3PFO A;  2OR4 A;  4OC2 A;  4O23 A;  3SJG A;  1YSJ A;  2EK8 A;  1TKH A;  1XJO A;  1CP6 A;  1TKF A;  2G9D A;  2QJ8 A;  3SJF A;  2XEI A;  1LAN A;  1FT7 A;  2ZEP A;  4F9U A;  2AFU A;  3WC6 A;  2PVV A;  3IFE A;  4OKO A;  4UEF A;  4W9Y A;  3IEH A;  1CX8 A;  1BPN A;  2POK A;  3D66 A;  3LWU A;  1IGB A;  8CPA A;  7CPA A;  3CPA A;  2VL1 A;  2CTC A;  2PJ1 A;  5JH9 A;  4MCR A;  1Y7E A;  1YW4 A;  1LAM A;  5LYF A;  3RZA A;  2PJ7 A;  3KHZ A;  3KQZ A;  2J9A A;  2IQ6 A;  4FUU A;  2PE3 A;  1ARL A;  3KGQ A;  4AXV A;  1TXR A;  5K8P A;  4MRI A;  2GLJ A;  1IY7 A;  2AFW A;  4MHN A;  3D7F A;  3D4U A;  5DS0 A;  1BAV A;  4WWV A;  3GUX A;  3FJU A;  4NGQ A;  4YWY A;  1F2O A;  3FED A;  3ISX A;  3NH5 A;  5J1Q A;  2C1C A;  3SI0 A;  2ZEH A;  3PB9 X;  2PRQ A;  2XEJ A;  2JEW A;  3FMC A;  3RBU A;  4OC4 A;  2DEA A;  2CF4 A;  3VAR A;  3CDX A;  5JM6 A;  4MMO A;  4IAV A;  4ZY1 A;  4ZY2 A;  1VHE A;  1CG2 A;  5HVF A;  4Z65 A;  3B7I A;  4NGN A;  4NGS A;  4OC0 A;  4ONW A;  1ZG9 A;  2F7V A;  3KHX A;  4R8F A;  3KL9 A;  2PJA A;  4ZX9 A;  1ELM P;  2C6G A;  4WJB A;  3NH8 A;  1VHO A;  3TC8 A;  3CT9 A;  4NGP A;  3S9N A;  3SI2 A;  4JYW A;  2BOA A;  3L2N A;  2PJ3 A;  1CP7 A;  1QQ9 A;  3B3C A;  4R6T A;  5K8O A;  4ZY0 A;  3T8W A;  5IB9 A;  2I3C A;  5HVH A;  2BO9 A;  1XMB A;  2EWB A;  1AMP A;  3SJX A;  4PXB A;  2RB7 A;  1Z2L A;  2ZEO A;  4F8Z A;  3S9M A;  5LRG A;  4OC1 A;  4UEZ A;  3KR4 A;  3D67 A;  2AFO A;  3WC5 A;  5D8N A;  2ZEL A;  2JBK A;  4IHM A;  3V7Z A;  2FVG A;  2PJB A;  1CPS A;  1HDQ A;  3KAS A;  4TWE A;  3QNV A;  4F9V A;  2EK9 A;  1F2P A;  3FX6 A;  1ZLH A;  4IK2 A;  1ARM A;  1QMU A;  2ABZ A;  4A94 A;  2F8H A;  2ZEM A;  1BLL E;  3BI1 A;  2IMO A;  1LOK A;  4P4B A;  2PJ4 A;  1YW6 A;  4MCP A;  3DLJ A;  1PCA A;  3H8G A;  4GM5 A;  1LAP A;  4TNU A;  5LRJ A;  3DGV A;  4X8I A;  1BPM A;  1Z5R A;  3MN8 A;  3GB0 A;  1YME A;  3H8E A;  4OID A;  4A38 A;  2ANP A;  1GYT A;  6CPA A;  2O4H A;  2NYQ A;  3BI0 A;  3HUV A;  5K8M A;  4X2T A;  3PB7 X;  2AFZ A;  3WT4 A;  2RFH A;  3FEC A;  1UWY A;  3PB4 X;  4MCS A;  3BXM A;  5CPA A;  1Z8L A;  4EWT A;  4ZI6 A;  4FBE A;  3D7D A;  3LMS A;  4MCQ A;  3B3W A;  4OME A;  2PJ0 A;  4R76 A;  4ZX8 A;  1VGY A;  4PXD A;  2V77 A;  1NSA A;  3NH4 A;  4KSI A;  1ZG7 A;  2Q43 A;  5LYL A;  4ZYQ A;  2XEF A;  4H2K A;  4MHP A;  1XRY A;  2QVP A;  5I4M A;  5HXD A;  1XBU A;  3ISZ A;  3PBE A;  2AFX A;  2AFS A;  4P4F A;  3FVL A;  3KR5 A;  3HLP A;  4CPA A;  5CBM A;  4LQG A;  2ZEE A;  1ELL P;  2PJ9 A;  4P4E A;  4NGR A;  2Q51 A;  3IIB A;  2HB6 A;  2GU2 A;  3PB8 X;  3WC7 A;  3B3V A;  3D68 A;  1TF9 A;  3TX8 A;  3GLJ A;  4P4D A;  1OBR A;  2V8V A;  5F09 A;  4P10 A;  2PJC A;  1CBX A;  3PEI A;  2C6C A;  2V8H A;  2ZED A;  3VH9 A;  1HEE A;  3VAT A;  2NSM A;  2ZOG A;  2ZOF A;  1XFO A;  4P4J A;  1M4L A;  3PFE A;  3B2Y A;  1RTQ A;  4DYO A;  2GRE A;  4NGM A;  3V38 A;  4OIW A;  4PQA A;  4NFR A;  4PXC A;  3IWW A;  4UF4 A;  1FNO A;  2V8G A;  2Q4Z A;  4P6Y A;  4P4I A;  2GLF A;  2PJ8 A;  2ZEF A;  2BCO A;  3NA6 A;  1PYT B;  2JBJ A;  4X3R A;  2CTB A;  3KZW A;  3PRT A;  4NGT A;  3B3S A;  4PPZ A;  1KWM A;  3PB6 X;  4MXU A;  3JRU A;  1R3N A;  3RAM A;  1AYE A;  3FH4 A;  3KQX A;  1HDU A;  4MHZ A;  3NFZ A;  5ELY A;  2CIJ A;  4K3N A;  3KI9 A;  4R7M A;  1LFW A;  4NJQ A;  4FWU A;  2ZEN A;  3N5F A;  4EFD A;  4DUK A;  1DTD A;  2HC9 A;  2AFM A;  3I1U A;  4OC3 A;  2PJ6 A;  4OP4 A;  2PIY A;  4EME A;  5JGF A;  3WAB A;  2PJ5 A;  2WZN A;  4G1P A;  2PJ2 A;  4NJR A;  1R43 A;  3CPX A;  1Q7L A;  3MRU A;  4FAI A;  1JQG A;  4PXE A;  3PBB A;  3IO1 A;  5D29 A;  4JZ0 A;  4UIB A;  1LCP A;  1DE4 C;  5LYD A;  1H8L A;  2IJZ A;  5LYI A;  4B6Z A;  1YLO A;  1Y0R A;  4DJL A;  4MHY A;  3K2K A;  3B35 A;  2C6P A;  2PIZ A;  4A37 A;  1CPX A;  3H8F A;  5LRK A;  4RUH A;  3D7H A;  4P45 A;  3B3T A;  3S9L A;  4YU9 A;  4UEE A;  2QYV A;  1TKJ A;  1VIX A;  4BD9 A;  1ZG8 A;  3FF3 A;  3SJE A;  5K8N A;  2WYR A;  4P44 A;  5THW A;  3D7G A;  2O53 A;  2V8D A;  3IC1 A;  1F57 A;  4Q7A A;  1Y0Y A;  4OC5 A;  2XEG A; 
#chains in the Genus database with same CATH topology
 2ZEG A;  2OZU A;  4MFJ A;  2PVW A;  1TF8 A;  2PSW A;  2PCU A;  4KVM E;  4QUS A;  5AG7 A;  3FEE A;  2Z10 A;  4R9M A;  4RI1 A;  1IID A;  4RS2 A;  1EE3 P;  2OOT A;  3IJ3 A;  4B5P B;  2HUZ A;  3BHX A;  3JTK A;  4UIA A;  3SI1 A;  4A39 A;  5HVG A;  1ZLI A;  1I12 A;  4NEX A;  3K9T A;  2K5T A;  3PFO A;  4Y49 B;  2OR4 A;  4CGL A;  2Q4V A;  4FD6 A;  4O23 A;  4OC2 A;  3ZJ0 A;  2XEG A;  1YVK A;  4HPS A;  3SJG A;  1ON0 A;  1YSJ A;  2BSW A;  2EK8 A;  2EBJ A;  1TKH A;  1XJO A;  1CP6 A;  1TKF A;  2G9D A;  4NCZ A;  2I00 A;  2NMT A;  2VI7 A;  2QJ8 A;  3SJF A;  3SHP A;  4YGO A;  4MFP A;  3NE8 A;  2VZZ A;  1IB1 E;  1JWQ A;  3JVN A;  1A2Z A;  4RN7 A;  5E96 A;  2Q4Y A;  3RNZ A;  4M3S A;  1MJB A;  1IYK A;  2EO8 A;  2XEI A;  1LAN A;  1FT7 A;  2ZEP A;  3TOB A;  4F9U A;  2ZW7 A;  2IL4 A;  1NE9 A;  3B8G A;  2AFU A;  3W6X A;  3WC6 A;  1ZO0 A;  4OAD A;  1WWZ A;  2PVV A;  3IFE A;  2R1I A;  4OKO A;  3CXS A;  3GY9 A;  4UEF A;  4W9Y A;  4CAW A;  1M1D A;  3IEH A;  1CX8 A;  3F8K A;  1BPN A;  3R95 A;  2BUE A;  1K4J A;  5F46 A;  2POK A;  2B3U A;  3D2M A;  3D66 A;  3LWU A;  1IGB A;  1Y7R A;  3PP9 A;  1J4J A;  4GXH A;  4PK2 A;  2Q7B A;  3TO9 A;  8CPA A;  7CPA A;  4MFQ A;  2FL4 A;  2J8M A;  3H4Q A;  2AE6 A;  3NE7 A;  5G22 A;  3CPA A;  2YND A;  1B87 A;  2VL1 A;  2CTC A;  3DNS A;  1M44 A;  4KOV A;  3W91 A;  4AVB A;  2PJ1 A;  4JD6 A;  4XNH B;  1N71 A;  4MCR A;  1Y7E A;  4C7H A;  4FD5 A;  2FCK A;  1V0C A;  1YW4 A;  5CNP A;  3R9G A;  2P0W A;  4A30 A;  1LAM A;  4KSA A;  5LYF A;  3RZA A;  2PJ7 A;  1UFH A;  4H6Z A;  1B6B A;  4AVA A;  3KHZ A;  5JH9 A;  3KQZ A;  1Z4E A;  2J9A A;  2IQ6 A;  4FUU A;  4NXY A;  1P0H A;  2WPX A;  4AG7 A;  4KUB A;  2PE3 A;  1ARL A;  3KGQ A;  2P6G A;  4MFL A;  5KTA A;  4B11 A;  4AXV A;  1TXR A;  5EBV A;  5K8P A;  4MRI A;  2GLJ A;  1IY7 A;  2AFW A;  4FD7 A;  4KVO E;  4LX9 A;  2VQY A;  4MHN A;  2PR1 A;  4A31 A;  4JXR A;  3D7F A;  3D4U A;  1YRE A;  1RXT A;  1YR0 A;  5DS0 A;  1BAV A;  1SQH A;  2R98 A;  3GUX A;  4WWV A;  3TTH A;  3FJU A;  4NGQ A;  4YWY A;  2QEC A;  1F2O A;  2FIA A;  2R7H A;  3FED A;  1PU9 A;  2Z3P A;  3QB8 A;  3ISX A;  3NH5 A;  5J1Q A;  4UFV A;  2C1C A;  3SI0 A;  2QML A;  2G0B A;  5IX3 A;  3R1K A;  1S60 A;  2ZEH A;  3PB9 X;  2PRQ A;  4X5K A;  5DWN A;  1XF8 A;  2XEJ A;  2ZXV A;  2P6F A;  2JEV A;  3C26 A;  3F0A A;  5J8C A;  2JEW A;  3FMC A;  4UCN A;  3RBU A;  2RC4 A;  4B13 A;  3TFY A;  4CYQ A;  4OC4 A;  2DEA A;  2CF4 A;  4BIN A;  3VAR A;  3CDX A;  5JM6 A;  4MMO A;  2C27 A;  4IAV A;  4ZY1 A;  2CXA A;  3G8W A;  4ZY2 A;  1M4G A;  2Z3O A;  3BLN A;  2ZW5 A;  5GCN A;  1VHE A;  5IB0 A;  1CG2 A;  4AVC A;  3R9E A;  5HVF A;  3MGD A;  3P2H A;  5C88 A;  4Z65 A;  2YNC A;  3B7I A;  4NGN A;  4NGS A;  4OC0 A;  4ONW A;  4EVY A;  3GYA A;  1ZG9 A;  2F7V A;  3KHX A;  4C2Z A;  4JJX A;  4R8F A;  3KL9 A;  4A95 A;  2PR8 A;  3FNC A;  2PJA A;  4ZX9 A;  3GKR A;  1ELM P;  2C6G A;  1QSN A;  4WJB A;  4U9Y A;  3NH8 A;  3TOA A;  1KUV A;  1VHO A;  3GIU A;  3TC8 A;  3CT9 A;  1IIC A;  4QBJ A;  2PRB A;  4NGP A;  3S9N A;  3SI2 A;  3DR8 A;  3S6K A;  4JYW A;  1CM0 A;  2BOA A;  1KUY A;  4CYP A;  4AB7 A;  3L2N A;  2PJ3 A;  3VWD A;  4A2Z A;  1CP7 A;  1QQ9 A;  3CXQ A;  3B3C A;  4R6T A;  5K8O A;  2ODF A;  4U5Y A;  1KUX A;  1Z8W A;  4ZY0 A;  3T8W A;  5IB9 A;  2I3C A;  5HVH A;  1IOF A;  4NF1 A;  2BO9 A;  4A33 A;  5C82 A;  3BJ8 A;  1XMB A;  4II9 A;  3JUW A;  2Z0Z A;  2EWB A;  1AMP A;  1Z8X A;  2CY2 A;  3SJX A;  4PXB A;  4CYO A;  2RB7 A;  3SXO A;  1Z2L A;  2FS5 A;  2EUI A;  2ZEO A;  2EVN A;  2Z3K A;  3I3G A;  4JXQ A;  4F8Z A;  2Y0M A;  2CNS A;  3S9M A;  5LRG A;  3FRM A;  4XPD C;  3CXP A;  4OC1 A;  4R87 A;  4UEZ A;  4B10 A;  3FBU A;  3PZJ A;  3KR4 A;  3D67 A;  4Q36 A;  2AFO A;  2B5G B;  3WC5 A;  5D8N A;  5HMN A;  4HNX B;  4UFW A;  4KS9 A;  2OU2 A;  3UY5 A;  2ZEL A;  1M4I A;  1M4D A;  2JBK A;  4IHM A;  5KTC A;  1Q2D A;  3V7Z A;  1Y9W A;  2FVG A;  1TIQ A;  2PJB A;  5J8F A;  4XPL A;  2DF5 A;  1CPS A;  1HDQ A;  3KAS A;  5JQ4 A;  4TWE A;  3QNV A;  4CAX A;  4F9V A;  2BL1 A;  1VHS A;  2EK9 A;  3LOD A;  2Q7S A;  4M6G A;  1F2P A;  1RO5 A;  3FX6 A;  4IUS A;  1ZLH A;  4Q38 A;  4IK2 A;  3R96 A;  1ARM A;  5AG4 A;  1YGH A;  4FD4 A;  4C2X A;  5H86 A;  1QMU A;  1I1D A;  2ABZ A;  5G20 A;  3V8I A;  4MFK A;  4A94 A;  2F8H A;  2ZEM A;  4KUA A;  1BLL E;  3BI1 A;  1S7F A;  2IMO A;  1LOK A;  4P4B A;  2PJ4 A;  1YW6 A;  4MCP A;  2B58 A;  3DLJ A;  1PCA A;  3H8G A;  4GM5 A;  1LAP A;  4TNU A;  5F47 A;  5LRJ A;  3T90 A;  3DGV A;  4X8I A;  4CYN A;  2B4D A;  3DDD A;  2D4O A;  1BPM A;  1XMT A;  2VXK A;  3IWG A;  3LD2 A;  1Z5R A;  5EMI A;  3MN8 A;  3GB0 A;  2J8N A;  2R8V A;  1YME A;  1MJ9 A;  3H8E A;  4CAE A;  3KKW A;  4OID A;  4A38 A;  2ANP A;  2O28 A;  1GYT A;  6CPA A;  3D8P A;  2Z11 A;  3PGP A;  4I49 A;  2O4H A;  2NYQ A;  2DPS A;  5A28 A;  3A9L A;  1BO4 A;  3BI0 A;  3HUV A;  3IU2 A;  5K8M A;  4M6H A;  4JWP A;  4X2T A;  3PB7 X;  2AFZ A;  4CRZ B;  4ZBG A;  4A32 A;  3WT4 A;  2RFH A;  3FEC A;  2FE7 A;  4J3G A;  3RO0 A;  1UWY A;  3FB3 A;  4HNW B;  3T9Y A;  3PB4 X;  4CAF A;  4MCS A;  2YNC C;  3BXM A;  5CPA A;  1Z8L A;  4EWT A;  3EFA A;  4CGO A;  1XE4 A;  4MY3 A;  2GFQ A;  4F6A A;  4ZI6 A;  2JDD A;  1AUG A;  3VWE A;  5F48 A;  3D2P A;  4FBE A;  1XIX A;  2B5G A;  2CNM A;  3D7D A;  3LMS A;  2KCW A;  4MCQ A;  3B3W A;  4QVT A;  5AG6 A;  4OME A;  2PJ0 A;  2G3T A;  2WSA A;  2JLM A;  4MY0 A;  1Z9U A;  3BJ7 A;  3IU1 A;  2H5M A;  2OB0 A;  4R76 A;  2REE A;  4ZX8 A;  4XPD B;  1VGY A;  4PXD A;  2V77 A;  1NSA A;  2PQ8 A;  4MJ8 A;  3NH4 A;  4KSI A;  3FYN A;  5F49 A;  1ZG7 A;  4KSF A;  2AJ6 A;  2Q43 A;  5LYL A;  2ZPA A;  4ZYQ A;  2XEF A;  2DPT A;  4H2K A;  1FY7 A;  1QSR A;  2WUU A;  4KLV A;  2HV2 A;  1QSM A;  1PUA A;  4MHP A;  1XRY A;  4UWI A;  2FSR A;  4ORF A;  5K8N A;  5H84 A;  2QVP A;  5I4M A;  4MBU A;  5HXD A;  1XBU A;  5HH1 A;  3ZZI A;  3FIX A;  3ISZ A;  3PBE A;  2AFS A;  4BMH A;  3DR6 A;  3FVL A;  3FXT A;  3KR5 A;  4P4F A;  4CRY B;  3HLP A;  1X10 A;  5AG5 A;  4CPA A;  4CGN A;  4HKF A;  4LQG A;  5CBM A;  5A27 A;  2ZEE A;  4OLL A;  1ELL P;  2PJ9 A;  4P4E A;  4LQ6 A;  4NGR A;  2JDC A;  1Q2Y A;  2Q51 A;  2CNT A;  4MI4 A;  2PDO A;  4GS4 A;  3IIB A;  4UFX A;  3WR7 A;  2HB6 A;  2GU2 A;  1NSL A;  4IF5 A;  3PB8 X;  3WC7 A;  2D4P A;  3B3V A;  5KTD A;  3D68 A;  1TF9 A;  3EO4 A;  1LRZ A;  1MK4 A;  3TX8 A;  1GHE A;  4M85 A;  4UCP A;  4XNH C;  3TT2 A;  3GLJ A;  4P4D A;  4NSQ A;  1OBR A;  2V8V A;  5F09 A;  3TE4 A;  2OH1 A;  1Z8T A;  4P10 A;  1X12 A;  4ONU A;  2PJC A;  4B12 A;  1CBX A;  3PEI A;  1S7L A;  3R9F A;  2C6C A;  2V8H A;  4KLW A;  3IGR A;  2ZED A;  3VH9 A;  2ATR A;  3E0K A;  1HEE A;  3VAT A;  2B3V A;  2NSM A;  1WK4 A;  2ZOG A;  1YVO A;  2FIW A;  2GE3 A;  4YRH A;  3EXN A;  2ZOF A;  2PC1 A;  1XFO A;  4P4J A;  1YQE A;  1Q2C A;  1M4L A;  3CZX A;  5DWM A;  3TO7 A;  3QAH A;  4UWJ A;  4KOS A;  5G1Z A;  1IOI A;  3PFE A;  3B2Y A;  1RTQ A;  4DYO A;  4L8A A;  4F0Y A;  2GRE A;  4KOT A;  4NGM A;  5EC4 A;  4U9Z A;  3V38 A;  4OIW A;  4PQA A;  4NFR A;  4PXC A;  3RYO A;  1Z4R A;  4PV6 A;  3IWW A;  4UF4 A;  4CGP A;  2OZG A;  4B5P A;  1FNO A;  2V8G A;  2P6E A;  2Q4Z A;  2VZY A;  4P6Y A;  4QB9 A;  4P4I A;  1YX0 A;  2GLF A;  4C7I A;  2PJ8 A;  2ZEF A;  2BCO A;  3EY5 A;  3NA6 A;  2Z3M A;  1PYT B;  3G3S A;  3TCV A;  2JBJ A;  1S3Z A;  2I79 A;  4X3R A;  1R57 A;  1L0C A;  2CTB A;  4JLY A;  3KZW A;  3PRT A;  4NGT A;  4R57 A;  5FVJ A;  3B3S A;  1S7K A;  4UA3 A;  4KOU A;  1VKC A;  2GAN A;  4H6U A;  4PPZ A;  1BOB A;  2HQY A;  4PSW A;  1KWM A;  2YGW A;  3DSB A;  3PB6 X;  4M6I A;  4MFZ A;  4MXU A;  3JRU A;  2Q0Y A;  1R3N A;  2REF A;  1AYE A;  3RAM A;  3FH4 A;  5JPH A;  4F0X A;  4B5O A;  1IU8 A;  1HDU A;  3KQX A;  4MHZ A;  3NFZ A;  5ELY A;  2DXQ A;  2OZH A;  2CIJ A;  4K3N A;  1P4N A;  3KI9 A;  3S6F A;  4R7M A;  4C2Y A;  2A4N A;  4UCM A;  1LFW A;  1OZP A;  2Q44 A;  1IYL A;  4H89 A;  4NJQ A;  4FWU A;  2ZEN A;  3N5F A;  3N7Z A;  4EFD A;  5BWA B;  4DUK A;  4UBR A;  1CJW A;  1DTD A;  2ZW6 A;  4MHD A;  2HC9 A;  1S5K A;  4LUA A;  2AFM A;  3I1U A;  4OC3 A;  2PJ6 A;  2FT0 A;  4OP4 A;  2ZW4 A;  2PIY A;  4EME A;  4KOR A;  5JGF A;  3WAB A;  3S6H A;  2PJ5 A;  4CS0 B;  2WZN A;  4G1P A;  2G3A A;  4HNY B;  4KZT A;  3W6S A;  4ZGY B;  2PJ2 A;  4C68 A;  4NJR A;  4KOX A;  2Q04 A;  2X7B A;  4XPK A;  4E8O A;  1R43 A;  3CPX A;  2FXF A;  1XEB A;  1Y9K A;  5G21 A;  1Q7L A;  3EC4 A;  3MRU A;  4FAI A;  5IV0 A;  4DNC A;  1JQG A;  4PXE A;  2BEI A;  2J8R A;  3PBB A;  3IO1 A;  1MJA A;  1NMT A;  4PK3 A;  2B4B A;  2VEZ A;  2Z3L A;  5D29 A;  2GIV A;  3P2F A;  1LCP A;  4JZ0 A;  1DE4 C;  4L89 A;  2QIR A;  4UIB A;  4K30 A;  4CGM A;  4YFJ A;  1YK3 A;  5LYD A;  1H8L A;  2IJZ A;  5LYI A;  4B6Z A;  2WPW A;  1YLO A;  1Y0R A;  4AG9 A;  4DJL A;  5AGE A;  3H5Z A;  4QC6 A;  4KVX A;  1XOV A;  1QSO A;  4MHY A;  3K2K A;  3B35 A;  2C6P A;  2PIZ A;  4A37 A;  3D3S A;  2Z3N A;  1CPX A;  1I21 A;  3F5B A;  3H8F A;  4OAE A;  3S6G A;  3OWC A;  4E0A A;  5LRK A;  4RUH A;  2F5I A;  3D7H A;  4KOY A;  1QST A;  1U6M A;  4P45 A;  3B3T A;  3S9L A;  4YU9 A;  4UEE A;  4BBH A;  3IWE A;  2QYV A;  3TO6 A;  1TKJ A;  1VIX A;  4BD9 A;  1KZF A;  4Y49 C;  1ZG8 A;  3FF3 A;  3SJE A;  2YNE A;  3K9U A;  2WYR A;  4P44 A;  5THW A;  3SXN A;  3I9S A;  4KOW A;  3D7G A;  4PSX A;  4R3L A;  2O53 A;  2VBQ A;  4E2A A;  1YLE A;  5ISV A;  2V8D A;  3IC1 A;  2ARH A;  4B14 A;  3QAY A;  1F57 A;  4R3K A;  4Q7A A;  2B4D B;  4CAV A;  5I0C A;  1S7N A;  1Y0Y A;  4OC5 A;  2AFX A;  3LAC A; 
#chains in the Genus database with same CATH homology
 2ZEG A;  2PVW A;  1TF8 A;  2PCU A;  3FEE A;  1EE3 P;  2OOT A;  3IJ3 A;  5HVG A;  3SI1 A;  3BHX A;  4UIA A;  4A39 A;  1ZLI A;  3K9T A;  3PFO A;  2OR4 A;  4OC2 A;  4O23 A;  3SJG A;  1YSJ A;  2EK8 A;  1TKH A;  1XJO A;  1CP6 A;  1TKF A;  2G9D A;  2QJ8 A;  3SJF A;  2XEI A;  1LAN A;  1FT7 A;  2ZEP A;  4F9U A;  2AFU A;  3WC6 A;  2PVV A;  3IFE A;  4OKO A;  4UEF A;  4W9Y A;  3IEH A;  1CX8 A;  1BPN A;  2POK A;  3D66 A;  3LWU A;  1IGB A;  8CPA A;  7CPA A;  3CPA A;  2VL1 A;  2CTC A;  2PJ1 A;  5JH9 A;  4MCR A;  1Y7E A;  1YW4 A;  1LAM A;  5LYF A;  3RZA A;  2PJ7 A;  3KHZ A;  3KQZ A;  2J9A A;  2IQ6 A;  4FUU A;  2PE3 A;  1ARL A;  3KGQ A;  4AXV A;  1TXR A;  5K8P A;  4MRI A;  2GLJ A;  1IY7 A;  2AFW A;  4MHN A;  3D7F A;  3D4U A;  5DS0 A;  1BAV A;  4WWV A;  3GUX A;  3FJU A;  4NGQ A;  4YWY A;  1F2O A;  3FED A;  3ISX A;  3NH5 A;  5J1Q A;  2C1C A;  3SI0 A;  2ZEH A;  3PB9 X;  2PRQ A;  2XEJ A;  2JEW A;  3FMC A;  3RBU A;  4OC4 A;  2DEA A;  2CF4 A;  3VAR A;  3CDX A;  5JM6 A;  4MMO A;  4IAV A;  4ZY1 A;  4ZY2 A;  1VHE A;  1CG2 A;  5HVF A;  4Z65 A;  3B7I A;  4NGN A;  4NGS A;  4OC0 A;  4ONW A;  1ZG9 A;  2F7V A;  3KHX A;  4R8F A;  3KL9 A;  2PJA A;  4ZX9 A;  1ELM P;  2C6G A;  4WJB A;  3NH8 A;  1VHO A;  3TC8 A;  3CT9 A;  4NGP A;  3S9N A;  3SI2 A;  4JYW A;  2BOA A;  3L2N A;  2PJ3 A;  1CP7 A;  1QQ9 A;  3B3C A;  4R6T A;  5K8O A;  4ZY0 A;  3T8W A;  5IB9 A;  2I3C A;  5HVH A;  2BO9 A;  1XMB A;  2EWB A;  1AMP A;  3SJX A;  4PXB A;  2RB7 A;  1Z2L A;  2ZEO A;  4F8Z A;  3S9M A;  5LRG A;  4OC1 A;  4UEZ A;  3KR4 A;  3D67 A;  2AFO A;  3WC5 A;  5D8N A;  2ZEL A;  2JBK A;  4IHM A;  3V7Z A;  2FVG A;  2PJB A;  1CPS A;  1HDQ A;  3KAS A;  4TWE A;  3QNV A;  4F9V A;  2EK9 A;  1F2P A;  3FX6 A;  1ZLH A;  4IK2 A;  1ARM A;  1QMU A;  2ABZ A;  4A94 A;  2F8H A;  2ZEM A;  1BLL E;  3BI1 A;  2IMO A;  1LOK A;  4P4B A;  2PJ4 A;  1YW6 A;  4MCP A;  3DLJ A;  1PCA A;  3H8G A;  4GM5 A;  1LAP A;  4TNU A;  5LRJ A;  3DGV A;  4X8I A;  1BPM A;  1Z5R A;  3MN8 A;  3GB0 A;  1YME A;  3H8E A;  4OID A;  4A38 A;  2ANP A;  1GYT A;  6CPA A;  2O4H A;  2NYQ A;  3BI0 A;  3HUV A;  5K8M A;  4X2T A;  3PB7 X;  2AFZ A;  3WT4 A;  2RFH A;  3FEC A;  1UWY A;  3PB4 X;  4MCS A;  3BXM A;  5CPA A;  1Z8L A;  4EWT A;  4ZI6 A;  4FBE A;  3D7D A;  3LMS A;  4MCQ A;  3B3W A;  4OME A;  2PJ0 A;  4R76 A;  4ZX8 A;  1VGY A;  4PXD A;  2V77 A;  1NSA A;  3NH4 A;  4KSI A;  1ZG7 A;  2Q43 A;  5LYL A;  4ZYQ A;  2XEF A;  4H2K A;  4MHP A;  1XRY A;  2QVP A;  5I4M A;  5HXD A;  1XBU A;  3ISZ A;  3PBE A;  2AFX A;  2AFS A;  4P4F A;  3FVL A;  3KR5 A;  3HLP A;  4CPA A;  5CBM A;  4LQG A;  2ZEE A;  1ELL P;  2PJ9 A;  4P4E A;  4NGR A;  2Q51 A;  3IIB A;  2HB6 A;  2GU2 A;  3PB8 X;  3WC7 A;  3B3V A;  3D68 A;  1TF9 A;  3TX8 A;  3GLJ A;  4P4D A;  1OBR A;  2V8V A;  5F09 A;  4P10 A;  2PJC A;  1CBX A;  3PEI A;  2C6C A;  2V8H A;  2ZED A;  3VH9 A;  1HEE A;  3VAT A;  2NSM A;  2ZOG A;  2ZOF A;  1XFO A;  4P4J A;  1M4L A;  3PFE A;  3B2Y A;  1RTQ A;  4DYO A;  2GRE A;  4NGM A;  3V38 A;  4OIW A;  4PQA A;  4NFR A;  4PXC A;  3IWW A;  4UF4 A;  1FNO A;  2V8G A;  2Q4Z A;  4P6Y A;  4P4I A;  2GLF A;  2PJ8 A;  2ZEF A;  2BCO A;  3NA6 A;  1PYT B;  2JBJ A;  4X3R A;  2CTB A;  3KZW A;  3PRT A;  4NGT A;  3B3S A;  4PPZ A;  1KWM A;  3PB6 X;  4MXU A;  3JRU A;  1R3N A;  3RAM A;  1AYE A;  3FH4 A;  3KQX A;  1HDU A;  4MHZ A;  3NFZ A;  5ELY A;  2CIJ A;  4K3N A;  3KI9 A;  4R7M A;  1LFW A;  4NJQ A;  4FWU A;  2ZEN A;  3N5F A;  4EFD A;  4DUK A;  1DTD A;  2HC9 A;  2AFM A;  3I1U A;  4OC3 A;  2PJ6 A;  4OP4 A;  2PIY A;  4EME A;  5JGF A;  3WAB A;  2PJ5 A;  2WZN A;  4G1P A;  2PJ2 A;  4NJR A;  1R43 A;  3CPX A;  1Q7L A;  3MRU A;  4FAI A;  1JQG A;  4PXE A;  3PBB A;  3IO1 A;  5D29 A;  4JZ0 A;  4UIB A;  1LCP A;  1DE4 C;  5LYD A;  1H8L A;  2IJZ A;  5LYI A;  4B6Z A;  1YLO A;  1Y0R A;  4DJL A;  4MHY A;  3K2K A;  3B35 A;  2C6P A;  2PIZ A;  4A37 A;  1CPX A;  3H8F A;  5LRK A;  4RUH A;  3D7H A;  4P45 A;  3B3T A;  3S9L A;  4YU9 A;  4UEE A;  2QYV A;  1TKJ A;  1VIX A;  4BD9 A;  1ZG8 A;  3FF3 A;  3SJE A;  5K8N A;  2WYR A;  4P44 A;  5THW A;  3D7G A;  2O53 A;  2V8D A;  3IC1 A;  1F57 A;  4Q7A A;  1Y0Y A;  4OC5 A;  2XEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...