4AXVA

Biochemical and structural characterization of the mpaa amidase as part of a conserved scavenging pathway for peptidoglycan derived peptides in gamma-proteobacteria
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
241
structure length
241
Chain Sequence
b'VLFQGPAMSLIPRTERAAFLITPTSYGKSVLGAPLLYFPAQVESNSRGLILAGTHGDETASIAGLSCALRSLPAECLKHDVILSMNPDANQLGTRANANQVDLNRAFPTQNWTEHGTVYRWSSHTPVRDVKVKTGDKEQLEPEVDALISLIELRRPKFVVSFHEPLAFVDDPAHSDLAKWLGKQFNLPIVDDVDYETPGSFGTWCNERQLPCITVELPPISADLTIEKHLDAFIALLQHDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MPAA
molecule tags Hydrolase
source organism Vibrio harveyi
publication title Mpaa is a Murein-Tripeptide-Specific Zinc Carboxypeptidase that Functions as Part of a Catabolic Pathway for Peptidoglycan Derived Peptides in Gamma-Proteobacteria.
pubmed doi rcsb
total genus 71
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4axvA00
4WWVA 3KHZA 3TX8A 1NSAA 2IJZA 4IAVA 1KWMA 3ISXA 1JQGA 3IEHA 1VIXA 4A38A 1Z8LA 4DJLA 4OKOA 3BHXA 1XMBA 2C6CA 3KASA 5I4MA 1TF8A 4YWYA 5LYFA 1LOKA 4JYWA 1TKFA 3KGQA 2PJ0A 1Q7LA 2PVVA 4ZY2A 3N5FA 2PE3A 2PIZA 4OC4A 4TWEA 2RB7A 3RAMA 1TKHA 1UWYA 2VL1A 4UF4A 1HDQA 2PRQA 4FBEA 2PJ1A 3NFZA 2J9AA 5LRJA 1LAMA 2C6GA 5DS0A 4PXCA 1M4LA 4FWUA 1TF9A 2JEWA 2PJ4A 1CX8A 1CPXA 2BOAA 5JH9A 3HLPA 1HDUA 4R76A 3SJEA 4DYOA 3PFOA 1BAVA 5CBMA 3PB8X 2FVGA 1XBUA 1XFOA 4MHNA 3VARA 4MCRA 5K8MA 1XRYA 3B3SA 6CPAA 2PVWA 1PCAA 1H8LA 3FX6A 1FNOA 5D29A 2PJCA 3D68A 4PXEA 1Y7EA 2GREA 4ZX9A 4R8FA 4OC2A 4CPAA 5K8OA 3KQZA 3NH4A 1ZG9A 4NGMA 4UIAA 3D7GA 3VH9A 4ZYQA 4UEZA 3CT9A 4A39A 4MCQA 3WC7A 3FJUA 4F8ZA 4P4JA 2ZEFA 4PQAA 3GB0A 4OC1A 4NGQA 4OC3A 4NJRA 1ZG8A 3WABA 3IC1A 2XEGA 2ZEOA 3K9TA 4P45A 2AFSA 4OC0A 4X3RA 3D66A 3IJ3A 3FMCA 1BLLE 3KR5A 4R6TA 3B3CA 4WJBA 3I1UA 5LYLA 3H8GA 5F09A 4O23A 5K8NA 3D7HA 7CPAA 3IWWA 1LANA 4W9YA 2WZNA 2ZELA 5J1QA 2CF4A 2O53A 2BO9A 4X2TA 2G9DA 2ANPA 2QYVA 4F9VA 3SJXA 4P6YA 4A94A 2PJ7A 3D67A 1F2OA 3KR4A 4NFRA 4DUKA 3SJGA 4PPZA 3WC6A 2PJ8A 4JZ0A 2PJ3A 4X8IA 1YLOA 2JBJA 4TNUA 1LCPA 2QVPA 3TC8A 4FUUA 4K3NA 3FECA 2V8HA 2OOTA 5CPAA 2V77A 4H2KA 3SJFA 2ZOGA 5HVHA 4KSIA 3PBBA 3KQXA 3B7IA 3LWUA 2PIYA 2OR4A 4NGTA 1Y0YA 4YU9A 3S9MA 3PEIA 3KI9A 4NGNA 4ONWA 4P10A 5LYDA 3S9LA 4G1PA 2IQ6A 2HB6A 2ZOFA 3PFEA 3VATA 3B3VA 2F7VA 2ZEPA 3V7ZA 2NSMA 1ELMP 3D4UA 4MHZA 3GLJA 2ZEHA 4A37A 2GLJA 2AFOA 4BD9A 3S9NA 5D8NA 3KL9A 1F2PA 1QQ9A 1ARLA 2PJ2A 4R7MA 1BPMA 2GU2A 4P4IA 4ZX8A 1CPSA 3FH4A 1VHOA 3SI1A 4RUHA 3CPAA 1HEEA 2V8GA 3FEDA 2Q4ZA 1QMUA 4MCSA 2AFUA 2WYRA 4OMEA 4P4FA 4MHYA 4NGPA 1VHEA 2JBKA 5LRGA 4ZI6A 3K2KA 2ZEDA 3D7FA 4P4DA 2AFMA 5K8PA 3NA6A 3FEEA 3PB6X 2PCUA 1IY7A 1CP6A 2BCOA 1Z5RA 5HXDA 3MRUA 3DLJA 3H8EA 4UEEA 3WC5A 2O4HA 4ZY1A 3HUVA 3KZWA 5HVGA 1YW6A 1AMPA 3B35A 3PBEA 2CIJA 4LQGA 4EFDA 3QNVA 2PJ5A 2AFWA 4IHMA 3IO1A 4UIBA 4P4BA 3WT4A 1XJOA 3FVLA 1Z2LA 4OP4A 4OC5A 1Y0RA 2ABZA 3JRUA 4NJQA 1PYTB 4MXUA 3RBUA 2V8VA 3ISZA 3L2NA 4IK2A 3BXMA 1OBRA 1IGBA 3PB4X 3KHXA 4EMEA 2XEFA 3IIBA 3NH8A 2QJ8A 5LRKA 1TKJA 5JM6A 2PJ9A 1AYEA 2NYQA 2CTBA 4PXBA 1BPNA 1TXRA 1R3NA 2ZEEA 3FF3A 4PXDA 4F9UA 2V8DA 2ZENA 4MRIA 3CDXA 1ARMA 2ZEMA 1GYTA 4ZY0A 2I3CA 1F57A 3BI0A 3CPXA 3SI0A 1ZLHA 2XEJA 2HC9A 3BI1A 1LAPA 3NH5A 3PB9X 4Q7AA 2C1CA 4MMOA 3T8WA 3B3WA 1YMEA 4UEFA 3PB7X 8CPAA 2PJ6A 3SI2A 2AFZA 3LMSA 4EWTA 4NGRA 2Q51A 2ZEGA 4P4EA 2POKA 1CG2A 1YW4A 1VGYA 5THWA 5LYIA 3RZAA 1ZG7A 2EK8A 4GM5A 4AXVA 1ZLIA 2Q43A 2CTCA 2C6PA 3IFEA 2EK9A 4Z65A 2AFXA 3MN8A 1RTQA 3B2YA 1YSJA 1ELLP 2GLFA 4OIWA 5JGFA 2PJBA 3H8FA 1DTDA 3B3TA 4NGSA 1LFWA 4FAIA 1CP7A 5IB9A 3GUXA 2PJAA 4MHPA 2RFHA 4OIDA 3D7DA 2IMOA 1EE3P 4P44A 5HVFA 1R43A 2F8HA 3V38A 3DGVA 2EWBA 1CBXA 4B6ZA 2DEAA 1DE4C 4MCPA 2XEIA 1FT7A 3PRTA 5ELYA
chains in the Genus database with same CATH superfamily
3IU2A 4CGMA 2ODFA 1MJAA 4AVCA 1MJBA 4XPKA 2I79A 1M44A 2G3AA 4WWVA 3KHZA 3TX8A 1YVOA 2Z3MA 1NSAA 2IJZA 4IAVA 1KWMA 1Q2DA 3ISXA 1JQGA 2BL1A 2C27A 3IEHA 1VIXA 4A38A 1Z8LA 2I00A 4DJLA 4JXRA 4OKOA 3BHXA 4QC6A 1XMBA 5AG7A 2C6CA 3JUWA 3KASA 2RC4A 5I4MA 4B14A 1TF8A 2CXAA 4YWYA 5LYFA 5AG6A 3DR6A 1LOKA 2O28A 4JYWA 1TKFA 2G3TA 3KGQA 3LD2A 4Y49C 2PJ0A 1IYLA 5G21A 1Q7LA 2PVVA 4ZY2A 3N5FA 2PIZA 2PE3A 4OC4A 4TWEA 2RB7A 1S7LA 3RAMA 2PR8A 1TKHA 3QAHA 2CNSA 1UWYA 2VL1A 3CXPA 1IICA 5ISVA 4UF4A 1HDQA 2B4DA 1XMTA 2B5GB 2PRQA 5J8FA 2R98A 2DPTA 2Z3LA 2PJ1A 3LODA 4FBEA 4KOTA 3DDDA 3NFZA 4F0XA 2DF5A 1GHEA 2J9AA 1YX0A 2YGWA 1Y9WA 2Z0ZA 4KOSA 4KUBA 5LRJA 1LAMA 2C6GA 3D8PA 3CXSA 4XNHC 5DS0A 2PSWA 4PXCA 2D4OA 2GIVA 3W6XA 3DNSA 4LUAA 1YGHA 1M4LA 4FD5A 4FWUA 1TF9A 2Z3NA 1XEBA 2JEWA 2PJ4A 4AG9A 1CX8A 1CPXA 4B5PB 4R3LA 1M1DA 2BOAA 2F5IA 2R7HA 5IV0A 5JH9A 3P2HA 4BINA 1YREA 3HLPA 2EUIA 4MFJA 1HDUA 1S7KA 4R76A 3SJEA 4DYOA 3DSBA 3PFOA 1BAVA 3DR8A 5KTAA 2X7BA 3PB8X 5CBMA 4QUSA 3D2MA 2FVGA 2OZGA 1J4JA 1Q2CA 1XBUA 2PRBA 4RI1A 4CYPA 1N71A 1XFOA 4MHNA 4FD7A 2YNDA 5KTDA 4B13A 2ZW4A 3VARA 4MCRA 1PUAA 2JLMA 4E8OA 4CYNA 5K8MA 3IGRA 5EC4A 1IOFA 1XRYA 3B3SA 4ZBGA 4UCNA 3WR7A 4CGOA 1KUVA 4KOYA 4CS0B 3F5BA 2PVWA 1PCAA 1XOVA 4ONUA 5KTCA 1H8LA 4NXYA 2P0WA 3FX6A 1FNOA 5D29A 1WK4A 2PJCA 3D68A 4Q38A 4PXEA 1XIXA 1Y7EA 2GREA 4JD6A 4ZX9A 4JWPA 4R8FA 4OC2A 4CPAA 1NMTA 3KQZA 2HV2A 3NH4A 5K8OA 5AG5A 1B6BA 1ZG9A 4NGMA 4UIAA 3D7GA 4HNXB 4B11A 3VH9A 4ZYQA 4C7IA 2EBJA 2JDCA 4MJ8A 4UEZA 2VEZA 3CT9A 4A39A 4MCQA 3S6HA 4AVAA 3QAYA 5JQ4A 3WC7A 1Y9KA 2Q4VA 3FJUA 4F8ZA 2Z11A 4P4JA 2ZEFA 4PQAA 4K30A 3GB0A 4OC1A 4NGQA 1YVKA 4OC3A 5F47A 4NJRA 1ZG8A 1P0HA 3SHPA 4MFLA 3EC4A 3WABA 3IC1A 4AVBA 2EO8A 2XEGA 2ZEOA 4A32A 3K9TA 4P45A 4CAXA 4MFKA 2AFSA 4C2YA 4B5PA 4OC0A 4X3RA 3D2PA 4CGLA 3VWDA 3D66A 3IJ3A 2B58A 3FMCA 1I1DA 4XNHB 1BLLE 2FT0A 3KR5A 4PV6A 5A27A 5IB0A 4R6TA 2VXKA 2FXFA 2VZYA 2Z3OA 2P6GA 3B3CA 4F6AA 4A31A 4U5YA 4WJBA 1P4NA 3I1UA 5LYLA 3EFAA 3H8GA 5F09A 3TFYA 4R57A 4CAEA 4L8AA 2GFQA 4O23A 4UBRA 3FYNA 4PSXA 5K8NA 2Q44A 4E0AA 3D7HA 2D4PA 2P6EA 5F48A 1NE9A 3BJ7A 3E0KA 4ZGYB 3IWWA 7CPAA 2H5MA 1LANA 4KORA 3W91A 4W9YA 2K5TA 2PDOA 3QB8A 4KVOE 4BMHA 1IOIA 2WZNA 2ZELA 1M4IA 5J1QA 2CF4A 2O53A 5E96A 2OU2A 2BO9A 4X2TA 5CNPA 3NE8A 4II9A 4MBUA 4HNYB 1Z9UA 4NSQA 2G9DA 2QECA 2ANPA 2QYVA 4F9VA 3SJXA 1KUXA 1SQHA 4P6YA 4A94A 2B3VA 3FIXA 3GKRA 3PGPA 2PJ7A 2Q0YA 1V0CA 3D67A 1F2OA 4KS9A 2OB0A 3KR4A 3H5ZA 4NFRA 2WUUA 1AUGA 4DUKA 3SJGA 4M6GA 1Z8WA 4PPZA 2AE6A 2PJ8A 3WC6A 2QMLA 4PSWA 4YFJA 4CYOA 3CXQA 4JZ0A 2PJ3A 4XPLA 4X8IA 3S6GA 5C82A 1YLOA 2JBJA 4TNUA 1LCPA 2QVPA 1IU8A 3TC8A 1BO4A 4FUUA 4K3NA 3FECA 3FNCA 5J8CA 1A2ZA 4MY3A 4A95A 1S7NA 1MJ9A 5HH1A 5A28A 2V8HA 1ON0A 5CPAA 2OOTA 2V77A 2ZXVA 2B4DB 4H2KA 4QVTA 3SJFA 2ZOGA 2REEA 2IL4A 4NEXA 1RO5A 1RXTA 4R3KA 1Y7RA 5HVHA 4KSIA 3PBBA 4KOXA 2Q7BA 3KQXA 4MY0A 2VZZA 3IU1A 3H4QA 1KUYA 2FE7A 3B7IA 3LWUA 4KVXA 2B4BA 3CZXA 2REFA 4Q36A 2PIYA 2OR4A 1I21A 4NGTA 1Y0YA 1VHSA 4YU9A 4RS2A 5DWMA 3S9MA 4HKFA 3PEIA 3KI9A 2PR1A 4NGNA 4ONWA 4P10A 2YNEA 5LYDA 5I0CA 4CRYB 4QB9A 2GE3A 4G1PA 3TTHA 3S9LA 5JPHA 2IQ6A 1IB1E 3BLNA 1VKCA 2HB6A 5HMNA 2ZOFA 3PFEA 4GXHA 2VBQA 3R9EA 4YGOA 3VATA 2ARHA 2HQYA 5G22A 3B3VA 3TO7A 2F7VA 3NE7A 2ZEPA 3V7ZA 1PU9A 2NSMA 1ELMP 3D4UA 4GS4A 4KLWA 4MHZA 3G3SA 3GLJA 2ZEHA 4A37A 2GLJA 4R87A 2ZW6A 2AFOA 2B3UA 3W6SA 1S7FA 4ORFA 3EXNA 3GIUA 2OZUA 3F8KA 4BD9A 5D8NA 3S9NA 2J8NA 3KL9A 4CAFA 4UCPA 3JTKA 4Y49B 1F2PA 3ZJ0A 1QQ9A 1XF8A 3B8GA 5H84A 1ARLA 3SXOA 2ATRA 1XE4A 1MK4A 1YQEA 2PJ2A 4R7MA 1BPMA 3R95A 3TCVA 2GU2A 4P4IA 5FVJA 4PK2A 4ZX8A 3ZZIA 1CPSA 4XPDC 4LX9A 2FL4A 1VHOA 2BUEA 2VI7A 3FH4A 3SI1A 4RUHA 3CPAA 4KOWA 3N7ZA 2ZW7A 4UWIA 1HEEA 2Q4YA 2V8GA 4UA3A 3FEDA 3KKWA 2Q4ZA 1QMUA 3SXNA 1UFHA 4MCSA 2AFUA 4C68A 4U9ZA 2WYRA 1Z8XA 3EY5A 3C26A 4MHYA 4OMEA 4P4FA 2FIAA 4NGPA 1VHEA 1I12A 2JBKA 5LRGA 4ZI6A 3A9LA 2QIRA 5IX3A 2A4NA 4A33A 4UFWA 3K2KA 4MFPA 4J3GA 2ZEDA 1CM0A 2KCWA 3D7FA 4P4DA 2AFMA 1QSTA 5K8PA 4OADA 3NA6A 3FEEA 3P2FA 2PCUA 3PB6X 1IY7A 4OAEA 1QSNA 1QSMA 1CP6A 2BCOA 4U9YA 2Z3PA 1Z5RA 5HXDA 3MRUA 1S3ZA 2Z10A 3DLJA 3H8EA 4R9MA 4UEEA 3TO6A 5EBVA 4CGNA 3WC5A 2O4HA 4ZY1A 3HUVA 6CPAA 1Z4EA 4OLLA 2DPSA 3FRMA 3D3SA 3KZWA 1NSLA 4CGPA 2CNTA 4CAWA 2BEIA 4CRZB 5HVGA 1YW6A 3VWEA 2Z3KA 1AMPA 3B35A 3PBEA 2CIJA 2YNCC 4HNWB 4LQGA 4AG7A 4KOVA 4EFDA 3QNVA 2PJ5A 2YNCA 3I9SA 2FCKA 4MHDA 2AFWA 2P6FA 4IHMA 3IO1A 3S6KA 4UIBA 4P4BA 5AG4A 3WT4A 3R1KA 1XJOA 3OWCA 4FD4A 3FVLA 3T9YA 1Z2LA 4OP4A 4OC5A 3GYAA 4BBHA 3FB3A 3TO9A 1Y0RA 4MI4A 2ABZA 4I49A 4H6UA 3JRUA 4NJQA 1PYTB 2CY2A 4MXUA 1K4JA 3RNZA 3RBUA 3R9FA 2V8VA 4YRHA 3ISZA 3L2NA 4IK2A 4UWJA 4HPSA 2FSRA 3BJ8A 4DNCA 3G8WA 2NMTA 3BXMA 1OBRA 4L89A 1IGBA 4M6HA 3MGDA 3PB4X 4F0YA 4UFXA 1L0CA 5DWNA 3KHXA 4EMEA 4JXQA 1QSOA 5G1ZA 2XEFA 5F49A 3IIBA 3NH8A 3PP9A 2QJ8A 5C88A 5LRKA 1TKJA 2FS5A 4UFVA 5JM6A 2PJ9A 1R57A 1KZFA 3JVNA 4C7HA 1X12A 1AYEA 2B5GA 2PC1A 4M85A 2NYQA 2CTBA 2WPXA 4PXBA 3UY5A 1BPNA 4CYQA 1TXRA 1R3NA 2ZEEA 1QSRA 3FF3A 4JLYA 2V8DA 4PXDA 2ZENA 4B5OA 4KOUA 4F9UA 4MRIA 3RO0A 4UCMA 3IWGA 3CDXA 3K9UA 1ARMA 1U6MA 2ZEMA 2Y0MA 1GYTA 2G0BA 4MFZA 2ZW5A 4ZY0A 2I3CA 1F57A 3R9GA 3BI0A 3CPXA 3RYOA 3SI0A 1ZLHA 1S60A 2XEJA 2HC9A 3BI1A 1LAPA 1B87A 1ZO0A 3NH5A 3PB9X 4KSFA 4Q7AA 2C1CA 1IYKA 2BSWA 3R96A 4MMOA 1TIQA 2DXQA 2GANA 3T8WA 1Z4RA 1LRZA 1YMEA 3B3WA 3TT2A 4UEFA 1X10A 1Z8TA 3PB7X 8CPAA 4M3SA 3V8IA 4XPDB 2PJ6A 3I3GA 5BWAB 3SI2A 5EMIA 2AFZA 3LMSA 4C2XA 4B10A 4EWTA 4EVYA 4KZTA 3LACA 4IUSA 1M4DA 2Q04A 1Q2YA 1YR0A 2Q51A 4MFQA 4NGRA 2ZPAA 2ZEGA 4P4EA 2FIWA 2POKA 1CG2A 1YW4A 1VGYA 3FBUA 2JEVA 2J8MA 3T90A 1YLEA 5G20A 4RN7A 5THWA 1IIDA 2R1IA 4H6ZA 5LYIA 3RZAA 1ZG7A 2EK8A 2WPWA 4GM5A 4AXVA 4E2AA 1ZLIA 2Q43A 2CTCA 2C6PA 4JJXA 1WWZA 3IFEA 4KSAA 1CJWA 2EK9A 4C2ZA 4Z65A 2AFXA 3MN8A 1RTQA 3B2YA 1YSJA 1ELLP 1JWQA 3IWEA 1BOBA 2GLFA 1S5KA 2JDDA 4OIWA 4PK3A 2Q7SA 5JGFA 4LQ6A 5GCNA 2PJBA 4H89A 3H8FA 1DTDA 1OZPA 2OZHA 1FY7A 1LFWA 3B3TA 4NGSA 3TOBA 1CP7A 4FAIA 5IB9A 4AB7A 3GUXA 2PJAA 2VQYA 2CNMA 4IF5A 3TE4A 1YK3A 3S6FA 3F0AA 3FXTA 2WSAA 2RFHA 4MHPA 2R8VA 4B12A 2AJ6A 4OIDA 4NF1A 2J8RA 3D7DA 4KLVA 5H86A 4KVME 4FD6A 2IMOA 1EE3P 4P44A 3EO4A 5HVFA 4KUAA 1R43A 4CAVA 2F8HA 3V38A 3DGVA 4M6IA 4A2ZA 2EWBA 4QBJA 1M4GA 1CBXA 2PQ8A 5AGEA 4A30A 4B6ZA 2DEAA 3TOAA 2HUZA 1DE4C 3GY9A 2OH1A 4MCPA 5F46A 2XEIA 4X5KA 2EVNA 1FT7A 3PRTA 3PZJA 4NCZA 5ELYA
chains in the Genus database with same CATH topology
4WWVA 3KHZA 3TX8A 1NSAA 2IJZA 4IAVA 1KWMA 3ISXA 1JQGA 3IEHA 1VIXA 4A38A 1Z8LA 4DJLA 4OKOA 3BHXA 1XMBA 2C6CA 3KASA 5I4MA 1TF8A 4YWYA 5LYFA 1LOKA 4JYWA 1TKFA 3KGQA 2PJ0A 1Q7LA 2PVVA 4ZY2A 3N5FA 2PE3A 2PIZA 4OC4A 4TWEA 2RB7A 3RAMA 1TKHA 1UWYA 2VL1A 4UF4A 1HDQA 2PRQA 4FBEA 2PJ1A 3NFZA 2J9AA 5LRJA 1LAMA 2C6GA 5DS0A 4PXCA 1M4LA 4FWUA 1TF9A 2JEWA 2PJ4A 1CX8A 1CPXA 2BOAA 5JH9A 3HLPA 1HDUA 4R76A 3SJEA 4DYOA 3PFOA 1BAVA 5CBMA 3PB8X 2FVGA 1XBUA 1XFOA 4MHNA 3VARA 4MCRA 5K8MA 1XRYA 3B3SA 6CPAA 2PVWA 1PCAA 1H8LA 3FX6A 1FNOA 5D29A 2PJCA 3D68A 4PXEA 1Y7EA 2GREA 4ZX9A 4R8FA 4OC2A 4CPAA 5K8OA 3KQZA 3NH4A 1ZG9A 4NGMA 4UIAA 3D7GA 3VH9A 4ZYQA 4UEZA 3CT9A 4A39A 4MCQA 3WC7A 3FJUA 4F8ZA 4P4JA 2ZEFA 4PQAA 3GB0A 4OC1A 4NGQA 4OC3A 4NJRA 1ZG8A 3WABA 3IC1A 2XEGA 2ZEOA 3K9TA 4P45A 2AFSA 4OC0A 4X3RA 3D66A 3IJ3A 3FMCA 1BLLE 3KR5A 4R6TA 3B3CA 4WJBA 3I1UA 5LYLA 3H8GA 5F09A 4O23A 5K8NA 3D7HA 7CPAA 3IWWA 1LANA 4W9YA 2WZNA 2ZELA 5J1QA 2CF4A 2O53A 2BO9A 4X2TA 2G9DA 2ANPA 2QYVA 4F9VA 3SJXA 4P6YA 4A94A 2PJ7A 3D67A 1F2OA 3KR4A 4NFRA 4DUKA 3SJGA 4PPZA 3WC6A 2PJ8A 4JZ0A 2PJ3A 4X8IA 1YLOA 2JBJA 4TNUA 1LCPA 2QVPA 3TC8A 4FUUA 4K3NA 3FECA 2V8HA 2OOTA 5CPAA 2V77A 4H2KA 3SJFA 2ZOGA 5HVHA 4KSIA 3PBBA 3KQXA 3B7IA 3LWUA 2PIYA 2OR4A 4NGTA 1Y0YA 4YU9A 3S9MA 3PEIA 3KI9A 4NGNA 4ONWA 4P10A 5LYDA 3S9LA 4G1PA 2IQ6A 2HB6A 2ZOFA 3PFEA 3VATA 3B3VA 2F7VA 2ZEPA 3V7ZA 2NSMA 1ELMP 3D4UA 4MHZA 3GLJA 2ZEHA 4A37A 2GLJA 2AFOA 4BD9A 3S9NA 5D8NA 3KL9A 1F2PA 1QQ9A 1ARLA 2PJ2A 4R7MA 1BPMA 2GU2A 4P4IA 4ZX8A 1CPSA 3FH4A 1VHOA 3SI1A 4RUHA 3CPAA 1HEEA 2V8GA 3FEDA 2Q4ZA 1QMUA 4MCSA 2AFUA 2WYRA 4OMEA 4P4FA 4MHYA 4NGPA 1VHEA 2JBKA 5LRGA 4ZI6A 3K2KA 2ZEDA 3D7FA 4P4DA 2AFMA 5K8PA 3NA6A 3FEEA 3PB6X 2PCUA 1IY7A 1CP6A 2BCOA 1Z5RA 5HXDA 3MRUA 3DLJA 3H8EA 4UEEA 3WC5A 2O4HA 4ZY1A 3HUVA 3KZWA 5HVGA 1YW6A 1AMPA 3B35A 3PBEA 2CIJA 4LQGA 4EFDA 3QNVA 2PJ5A 2AFWA 4IHMA 3IO1A 4UIBA 4P4BA 3WT4A 1XJOA 3FVLA 1Z2LA 4OP4A 4OC5A 1Y0RA 2ABZA 3JRUA 4NJQA 1PYTB 4MXUA 3RBUA 2V8VA 3ISZA 3L2NA 4IK2A 3BXMA 1OBRA 1IGBA 3PB4X 3KHXA 4EMEA 2XEFA 3IIBA 3NH8A 2QJ8A 5LRKA 1TKJA 5JM6A 2PJ9A 1AYEA 2NYQA 2CTBA 4PXBA 1BPNA 1TXRA 1R3NA 2ZEEA 3FF3A 4PXDA 4F9UA 2V8DA 2ZENA 4MRIA 3CDXA 1ARMA 2ZEMA 1GYTA 4ZY0A 2I3CA 1F57A 3BI0A 3CPXA 3SI0A 1ZLHA 2XEJA 2HC9A 3BI1A 1LAPA 3NH5A 3PB9X 4Q7AA 2C1CA 4MMOA 3T8WA 3B3WA 1YMEA 4UEFA 3PB7X 8CPAA 2PJ6A 3SI2A 2AFZA 3LMSA 4EWTA 4NGRA 2Q51A 2ZEGA 4P4EA 2POKA 1CG2A 1YW4A 1VGYA 5THWA 5LYIA 3RZAA 1ZG7A 2EK8A 4GM5A 4AXVA 1ZLIA 2Q43A 2CTCA 2C6PA 3IFEA 2EK9A 4Z65A 2AFXA 3MN8A 1RTQA 3B2YA 1YSJA 1ELLP 2GLFA 4OIWA 5JGFA 2PJBA 3H8FA 1DTDA 3B3TA 4NGSA 1LFWA 4FAIA 1CP7A 5IB9A 3GUXA 2PJAA 4MHPA 2RFHA 4OIDA 3D7DA 2IMOA 1EE3P 4P44A 5HVFA 1R43A 2F8HA 3V38A 3DGVA 2EWBA 1CBXA 4B6ZA 2DEAA 1DE4C 4MCPA 2XEIA 1FT7A 3PRTA 5ELYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WWV A;  3KHZ A;  3TX8 A;  1NSA A;  2IJZ A;  4IAV A;  1KWM A;  3ISX A;  1JQG A;  3IEH A;  1VIX A;  4A38 A;  1Z8L A;  4DJL A;  4OKO A;  3BHX A;  1XMB A;  2C6C A;  3KAS A;  5I4M A;  1TF8 A;  4YWY A;  5LYF A;  1LOK A;  4JYW A;  1TKF A;  3KGQ A;  2PJ0 A;  1Q7L A;  2PVV A;  4ZY2 A;  3N5F A;  2PE3 A;  2PIZ A;  4OC4 A;  4TWE A;  2RB7 A;  3RAM A;  1TKH A;  1UWY A;  2VL1 A;  4UF4 A;  1HDQ A;  2PRQ A;  4FBE A;  2PJ1 A;  3NFZ A;  2J9A A;  5LRJ A;  1LAM A;  2C6G A;  5DS0 A;  4PXC A;  1M4L A;  4FWU A;  1TF9 A;  2JEW A;  2PJ4 A;  1CX8 A;  1CPX A;  2BOA A;  5JH9 A;  3HLP A;  1HDU A;  4R76 A;  3SJE A;  4DYO A;  3PFO A;  1BAV A;  5CBM A;  3PB8 X;  2FVG A;  1XBU A;  1XFO A;  4MHN A;  3VAR A;  4MCR A;  5K8M A;  1XRY A;  3B3S A;  6CPA A;  2PVW A;  1PCA A;  1H8L A;  3FX6 A;  1FNO A;  5D29 A;  2PJC A;  3D68 A;  4PXE A;  1Y7E A;  2GRE A;  4ZX9 A;  4R8F A;  4OC2 A;  4CPA A;  5K8O A;  3KQZ A;  3NH4 A;  1ZG9 A;  4NGM A;  4UIA A;  3D7G A;  3VH9 A;  4ZYQ A;  4UEZ A;  3CT9 A;  4A39 A;  4MCQ A;  3WC7 A;  3FJU A;  4F8Z A;  4P4J A;  2ZEF A;  4PQA A;  3GB0 A;  4OC1 A;  4NGQ A;  4OC3 A;  4NJR A;  1ZG8 A;  3WAB A;  3IC1 A;  2XEG A;  2ZEO A;  3K9T A;  4P45 A;  2AFS A;  4OC0 A;  4X3R A;  3D66 A;  3IJ3 A;  3FMC A;  1BLL E;  3KR5 A;  4R6T A;  3B3C A;  4WJB A;  3I1U A;  5LYL A;  3H8G A;  5F09 A;  4O23 A;  5K8N A;  3D7H A;  7CPA A;  3IWW A;  1LAN A;  4W9Y A;  2WZN A;  2ZEL A;  5J1Q A;  2CF4 A;  2O53 A;  2BO9 A;  4X2T A;  2G9D A;  2ANP A;  2QYV A;  4F9V A;  3SJX A;  4P6Y A;  4A94 A;  2PJ7 A;  3D67 A;  1F2O A;  3KR4 A;  4NFR A;  4DUK A;  3SJG A;  4PPZ A;  3WC6 A;  2PJ8 A;  4JZ0 A;  2PJ3 A;  4X8I A;  1YLO A;  2JBJ A;  4TNU A;  1LCP A;  2QVP A;  3TC8 A;  4FUU A;  4K3N A;  3FEC A;  2V8H A;  2OOT A;  5CPA A;  2V77 A;  4H2K A;  3SJF A;  2ZOG A;  5HVH A;  4KSI A;  3PBB A;  3KQX A;  3B7I A;  3LWU A;  2PIY A;  2OR4 A;  4NGT A;  1Y0Y A;  4YU9 A;  3S9M A;  3PEI A;  3KI9 A;  4NGN A;  4ONW A;  4P10 A;  5LYD A;  3S9L A;  4G1P A;  2IQ6 A;  2HB6 A;  2ZOF A;  3PFE A;  3VAT A;  3B3V A;  2F7V A;  2ZEP A;  3V7Z A;  2NSM A;  1ELM P;  3D4U A;  4MHZ A;  3GLJ A;  2ZEH A;  4A37 A;  2GLJ A;  2AFO A;  4BD9 A;  3S9N A;  5D8N A;  3KL9 A;  1F2P A;  1QQ9 A;  1ARL A;  2PJ2 A;  4R7M A;  1BPM A;  2GU2 A;  4P4I A;  4ZX8 A;  1CPS A;  3FH4 A;  1VHO A;  3SI1 A;  4RUH A;  3CPA A;  1HEE A;  2V8G A;  3FED A;  2Q4Z A;  1QMU A;  4MCS A;  2AFU A;  2WYR A;  4OME A;  4P4F A;  4MHY A;  4NGP A;  1VHE A;  2JBK A;  5LRG A;  4ZI6 A;  3K2K A;  2ZED A;  3D7F A;  4P4D A;  2AFM A;  5K8P A;  3NA6 A;  3FEE A;  3PB6 X;  2PCU A;  1IY7 A;  1CP6 A;  2BCO A;  1Z5R A;  5HXD A;  3MRU A;  3DLJ A;  3H8E A;  4UEE A;  3WC5 A;  2O4H A;  4ZY1 A;  3HUV A;  3KZW A;  5HVG A;  1YW6 A;  1AMP A;  3B35 A;  3PBE A;  2CIJ A;  4LQG A;  4EFD A;  3QNV A;  2PJ5 A;  2AFW A;  4IHM A;  3IO1 A;  4UIB A;  4P4B A;  3WT4 A;  1XJO A;  3FVL A;  1Z2L A;  4OP4 A;  4OC5 A;  1Y0R A;  2ABZ A;  3JRU A;  4NJQ A;  1PYT B;  4MXU A;  3RBU A;  2V8V A;  3ISZ A;  3L2N A;  4IK2 A;  3BXM A;  1OBR A;  1IGB A;  3PB4 X;  3KHX A;  4EME A;  2XEF A;  3IIB A;  3NH8 A;  2QJ8 A;  5LRK A;  1TKJ A;  5JM6 A;  2PJ9 A;  1AYE A;  2NYQ A;  2CTB A;  4PXB A;  1BPN A;  1TXR A;  1R3N A;  2ZEE A;  3FF3 A;  4PXD A;  4F9U A;  2V8D A;  2ZEN A;  4MRI A;  3CDX A;  1ARM A;  2ZEM A;  1GYT A;  4ZY0 A;  2I3C A;  1F57 A;  3BI0 A;  3CPX A;  3SI0 A;  1ZLH A;  2XEJ A;  2HC9 A;  3BI1 A;  1LAP A;  3NH5 A;  3PB9 X;  4Q7A A;  2C1C A;  4MMO A;  3T8W A;  3B3W A;  1YME A;  4UEF A;  3PB7 X;  8CPA A;  2PJ6 A;  3SI2 A;  2AFZ A;  3LMS A;  4EWT A;  4NGR A;  2Q51 A;  2ZEG A;  4P4E A;  2POK A;  1CG2 A;  1YW4 A;  1VGY A;  5THW A;  5LYI A;  3RZA A;  1ZG7 A;  2EK8 A;  4GM5 A;  4AXV A;  1ZLI A;  2Q43 A;  2CTC A;  2C6P A;  3IFE A;  2EK9 A;  4Z65 A;  2AFX A;  3MN8 A;  1RTQ A;  3B2Y A;  1YSJ A;  1ELL P;  2GLF A;  4OIW A;  5JGF A;  2PJB A;  3H8F A;  1DTD A;  3B3T A;  4NGS A;  1LFW A;  4FAI A;  1CP7 A;  5IB9 A;  3GUX A;  2PJA A;  4MHP A;  2RFH A;  4OID A;  3D7D A;  2IMO A;  1EE3 P;  4P44 A;  5HVF A;  1R43 A;  2F8H A;  3V38 A;  3DGV A;  2EWB A;  1CBX A;  4B6Z A;  2DEA A;  1DE4 C;  4MCP A;  2XEI A;  1FT7 A;  3PRT A;  5ELY A; 
#chains in the Genus database with same CATH topology
 3IU2 A;  4CGM A;  2ODF A;  1MJA A;  4AVC A;  1MJB A;  4XPK A;  2I79 A;  1M44 A;  2G3A A;  4WWV A;  3KHZ A;  3TX8 A;  1YVO A;  2Z3M A;  1NSA A;  2IJZ A;  4IAV A;  1KWM A;  1Q2D A;  3ISX A;  1JQG A;  2BL1 A;  2C27 A;  3IEH A;  1VIX A;  4A38 A;  1Z8L A;  2I00 A;  4DJL A;  4JXR A;  4OKO A;  3BHX A;  4QC6 A;  1XMB A;  5AG7 A;  2C6C A;  3JUW A;  3KAS A;  2RC4 A;  5I4M A;  4B14 A;  1TF8 A;  2CXA A;  4YWY A;  5LYF A;  5AG6 A;  3DR6 A;  1LOK A;  2O28 A;  4JYW A;  1TKF A;  2G3T A;  3KGQ A;  3LD2 A;  4Y49 C;  2PJ0 A;  1IYL A;  5G21 A;  1Q7L A;  2PVV A;  4ZY2 A;  3N5F A;  2PIZ A;  2PE3 A;  4OC4 A;  4TWE A;  2RB7 A;  1S7L A;  3RAM A;  2PR8 A;  1TKH A;  3QAH A;  2CNS A;  1UWY A;  2VL1 A;  3CXP A;  1IIC A;  5ISV A;  4UF4 A;  1HDQ A;  2B4D A;  1XMT A;  2B5G B;  2PRQ A;  5J8F A;  2R98 A;  2DPT A;  2Z3L A;  2PJ1 A;  3LOD A;  4FBE A;  4KOT A;  3DDD A;  3NFZ A;  4F0X A;  2DF5 A;  1GHE A;  2J9A A;  1YX0 A;  2YGW A;  1Y9W A;  2Z0Z A;  4KOS A;  4KUB A;  5LRJ A;  1LAM A;  2C6G A;  3D8P A;  3CXS A;  4XNH C;  5DS0 A;  2PSW A;  4PXC A;  2D4O A;  2GIV A;  3W6X A;  3DNS A;  4LUA A;  1YGH A;  1M4L A;  4FD5 A;  4FWU A;  1TF9 A;  2Z3N A;  1XEB A;  2JEW A;  2PJ4 A;  4AG9 A;  1CX8 A;  1CPX A;  4B5P B;  4R3L A;  1M1D A;  2BOA A;  2F5I A;  2R7H A;  5IV0 A;  5JH9 A;  3P2H A;  4BIN A;  1YRE A;  3HLP A;  2EUI A;  4MFJ A;  1HDU A;  1S7K A;  4R76 A;  3SJE A;  4DYO A;  3DSB A;  3PFO A;  1BAV A;  3DR8 A;  5KTA A;  2X7B A;  3PB8 X;  5CBM A;  4QUS A;  3D2M A;  2FVG A;  2OZG A;  1J4J A;  1Q2C A;  1XBU A;  2PRB A;  4RI1 A;  4CYP A;  1N71 A;  1XFO A;  4MHN A;  4FD7 A;  2YND A;  5KTD A;  4B13 A;  2ZW4 A;  3VAR A;  4MCR A;  1PUA A;  2JLM A;  4E8O A;  4CYN A;  5K8M A;  3IGR A;  5EC4 A;  1IOF A;  1XRY A;  3B3S A;  4ZBG A;  4UCN A;  3WR7 A;  4CGO A;  1KUV A;  4KOY A;  4CS0 B;  3F5B A;  2PVW A;  1PCA A;  1XOV A;  4ONU A;  5KTC A;  1H8L A;  4NXY A;  2P0W A;  3FX6 A;  1FNO A;  5D29 A;  1WK4 A;  2PJC A;  3D68 A;  4Q38 A;  4PXE A;  1XIX A;  1Y7E A;  2GRE A;  4JD6 A;  4ZX9 A;  4JWP A;  4R8F A;  4OC2 A;  4CPA A;  1NMT A;  3KQZ A;  2HV2 A;  3NH4 A;  5K8O A;  5AG5 A;  1B6B A;  1ZG9 A;  4NGM A;  4UIA A;  3D7G A;  4HNX B;  4B11 A;  3VH9 A;  4ZYQ A;  4C7I A;  2EBJ A;  2JDC A;  4MJ8 A;  4UEZ A;  2VEZ A;  3CT9 A;  4A39 A;  4MCQ A;  3S6H A;  4AVA A;  3QAY A;  5JQ4 A;  3WC7 A;  1Y9K A;  2Q4V A;  3FJU A;  4F8Z A;  2Z11 A;  4P4J A;  2ZEF A;  4PQA A;  4K30 A;  3GB0 A;  4OC1 A;  4NGQ A;  1YVK A;  4OC3 A;  5F47 A;  4NJR A;  1ZG8 A;  1P0H A;  3SHP A;  4MFL A;  3EC4 A;  3WAB A;  3IC1 A;  4AVB A;  2EO8 A;  2XEG A;  2ZEO A;  4A32 A;  3K9T A;  4P45 A;  4CAX A;  4MFK A;  2AFS A;  4C2Y A;  4B5P A;  4OC0 A;  4X3R A;  3D2P A;  4CGL A;  3VWD A;  3D66 A;  3IJ3 A;  2B58 A;  3FMC A;  1I1D A;  4XNH B;  1BLL E;  2FT0 A;  3KR5 A;  4PV6 A;  5A27 A;  5IB0 A;  4R6T A;  2VXK A;  2FXF A;  2VZY A;  2Z3O A;  2P6G A;  3B3C A;  4F6A A;  4A31 A;  4U5Y A;  4WJB A;  1P4N A;  3I1U A;  5LYL A;  3EFA A;  3H8G A;  5F09 A;  3TFY A;  4R57 A;  4CAE A;  4L8A A;  2GFQ A;  4O23 A;  4UBR A;  3FYN A;  4PSX A;  5K8N A;  2Q44 A;  4E0A A;  3D7H A;  2D4P A;  2P6E A;  5F48 A;  1NE9 A;  3BJ7 A;  3E0K A;  4ZGY B;  3IWW A;  7CPA A;  2H5M A;  1LAN A;  4KOR A;  3W91 A;  4W9Y A;  2K5T A;  2PDO A;  3QB8 A;  4KVO E;  4BMH A;  1IOI A;  2WZN A;  2ZEL A;  1M4I A;  5J1Q A;  2CF4 A;  2O53 A;  5E96 A;  2OU2 A;  2BO9 A;  4X2T A;  5CNP A;  3NE8 A;  4II9 A;  4MBU A;  4HNY B;  1Z9U A;  4NSQ A;  2G9D A;  2QEC A;  2ANP A;  2QYV A;  4F9V A;  3SJX A;  1KUX A;  1SQH A;  4P6Y A;  4A94 A;  2B3V A;  3FIX A;  3GKR A;  3PGP A;  2PJ7 A;  2Q0Y A;  1V0C A;  3D67 A;  1F2O A;  4KS9 A;  2OB0 A;  3KR4 A;  3H5Z A;  4NFR A;  2WUU A;  1AUG A;  4DUK A;  3SJG A;  4M6G A;  1Z8W A;  4PPZ A;  2AE6 A;  2PJ8 A;  3WC6 A;  2QML A;  4PSW A;  4YFJ A;  4CYO A;  3CXQ A;  4JZ0 A;  2PJ3 A;  4XPL A;  4X8I A;  3S6G A;  5C82 A;  1YLO A;  2JBJ A;  4TNU A;  1LCP A;  2QVP A;  1IU8 A;  3TC8 A;  1BO4 A;  4FUU A;  4K3N A;  3FEC A;  3FNC A;  5J8C A;  1A2Z A;  4MY3 A;  4A95 A;  1S7N A;  1MJ9 A;  5HH1 A;  5A28 A;  2V8H A;  1ON0 A;  5CPA A;  2OOT A;  2V77 A;  2ZXV A;  2B4D B;  4H2K A;  4QVT A;  3SJF A;  2ZOG A;  2REE A;  2IL4 A;  4NEX A;  1RO5 A;  1RXT A;  4R3K A;  1Y7R A;  5HVH A;  4KSI A;  3PBB A;  4KOX A;  2Q7B A;  3KQX A;  4MY0 A;  2VZZ A;  3IU1 A;  3H4Q A;  1KUY A;  2FE7 A;  3B7I A;  3LWU A;  4KVX A;  2B4B A;  3CZX A;  2REF A;  4Q36 A;  2PIY A;  2OR4 A;  1I21 A;  4NGT A;  1Y0Y A;  1VHS A;  4YU9 A;  4RS2 A;  5DWM A;  3S9M A;  4HKF A;  3PEI A;  3KI9 A;  2PR1 A;  4NGN A;  4ONW A;  4P10 A;  2YNE A;  5LYD A;  5I0C A;  4CRY B;  4QB9 A;  2GE3 A;  4G1P A;  3TTH A;  3S9L A;  5JPH A;  2IQ6 A;  1IB1 E;  3BLN A;  1VKC A;  2HB6 A;  5HMN A;  2ZOF A;  3PFE A;  4GXH A;  2VBQ A;  3R9E A;  4YGO A;  3VAT A;  2ARH A;  2HQY A;  5G22 A;  3B3V A;  3TO7 A;  2F7V A;  3NE7 A;  2ZEP A;  3V7Z A;  1PU9 A;  2NSM A;  1ELM P;  3D4U A;  4GS4 A;  4KLW A;  4MHZ A;  3G3S A;  3GLJ A;  2ZEH A;  4A37 A;  2GLJ A;  4R87 A;  2ZW6 A;  2AFO A;  2B3U A;  3W6S A;  1S7F A;  4ORF A;  3EXN A;  3GIU A;  2OZU A;  3F8K A;  4BD9 A;  5D8N A;  3S9N A;  2J8N A;  3KL9 A;  4CAF A;  4UCP A;  3JTK A;  4Y49 B;  1F2P A;  3ZJ0 A;  1QQ9 A;  1XF8 A;  3B8G A;  5H84 A;  1ARL A;  3SXO A;  2ATR A;  1XE4 A;  1MK4 A;  1YQE A;  2PJ2 A;  4R7M A;  1BPM A;  3R95 A;  3TCV A;  2GU2 A;  4P4I A;  5FVJ A;  4PK2 A;  4ZX8 A;  3ZZI A;  1CPS A;  4XPD C;  4LX9 A;  2FL4 A;  1VHO A;  2BUE A;  2VI7 A;  3FH4 A;  3SI1 A;  4RUH A;  3CPA A;  4KOW A;  3N7Z A;  2ZW7 A;  4UWI A;  1HEE A;  2Q4Y A;  2V8G A;  4UA3 A;  3FED A;  3KKW A;  2Q4Z A;  1QMU A;  3SXN A;  1UFH A;  4MCS A;  2AFU A;  4C68 A;  4U9Z A;  2WYR A;  1Z8X A;  3EY5 A;  3C26 A;  4MHY A;  4OME A;  4P4F A;  2FIA A;  4NGP A;  1VHE A;  1I12 A;  2JBK A;  5LRG A;  4ZI6 A;  3A9L A;  2QIR A;  5IX3 A;  2A4N A;  4A33 A;  4UFW A;  3K2K A;  4MFP A;  4J3G A;  2ZED A;  1CM0 A;  2KCW A;  3D7F A;  4P4D A;  2AFM A;  1QST A;  5K8P A;  4OAD A;  3NA6 A;  3FEE A;  3P2F A;  2PCU A;  3PB6 X;  1IY7 A;  4OAE A;  1QSN A;  1QSM A;  1CP6 A;  2BCO A;  4U9Y A;  2Z3P A;  1Z5R A;  5HXD A;  3MRU A;  1S3Z A;  2Z10 A;  3DLJ A;  3H8E A;  4R9M A;  4UEE A;  3TO6 A;  5EBV A;  4CGN A;  3WC5 A;  2O4H A;  4ZY1 A;  3HUV A;  6CPA A;  1Z4E A;  4OLL A;  2DPS A;  3FRM A;  3D3S A;  3KZW A;  1NSL A;  4CGP A;  2CNT A;  4CAW A;  2BEI A;  4CRZ B;  5HVG A;  1YW6 A;  3VWE A;  2Z3K A;  1AMP A;  3B35 A;  3PBE A;  2CIJ A;  2YNC C;  4HNW B;  4LQG A;  4AG7 A;  4KOV A;  4EFD A;  3QNV A;  2PJ5 A;  2YNC A;  3I9S A;  2FCK A;  4MHD A;  2AFW A;  2P6F A;  4IHM A;  3IO1 A;  3S6K A;  4UIB A;  4P4B A;  5AG4 A;  3WT4 A;  3R1K A;  1XJO A;  3OWC A;  4FD4 A;  3FVL A;  3T9Y A;  1Z2L A;  4OP4 A;  4OC5 A;  3GYA A;  4BBH A;  3FB3 A;  3TO9 A;  1Y0R A;  4MI4 A;  2ABZ A;  4I49 A;  4H6U A;  3JRU A;  4NJQ A;  1PYT B;  2CY2 A;  4MXU A;  1K4J A;  3RNZ A;  3RBU A;  3R9F A;  2V8V A;  4YRH A;  3ISZ A;  3L2N A;  4IK2 A;  4UWJ A;  4HPS A;  2FSR A;  3BJ8 A;  4DNC A;  3G8W A;  2NMT A;  3BXM A;  1OBR A;  4L89 A;  1IGB A;  4M6H A;  3MGD A;  3PB4 X;  4F0Y A;  4UFX A;  1L0C A;  5DWN A;  3KHX A;  4EME A;  4JXQ A;  1QSO A;  5G1Z A;  2XEF A;  5F49 A;  3IIB A;  3NH8 A;  3PP9 A;  2QJ8 A;  5C88 A;  5LRK A;  1TKJ A;  2FS5 A;  4UFV A;  5JM6 A;  2PJ9 A;  1R57 A;  1KZF A;  3JVN A;  4C7H A;  1X12 A;  1AYE A;  2B5G A;  2PC1 A;  4M85 A;  2NYQ A;  2CTB A;  2WPX A;  4PXB A;  3UY5 A;  1BPN A;  4CYQ A;  1TXR A;  1R3N A;  2ZEE A;  1QSR A;  3FF3 A;  4JLY A;  2V8D A;  4PXD A;  2ZEN A;  4B5O A;  4KOU A;  4F9U A;  4MRI A;  3RO0 A;  4UCM A;  3IWG A;  3CDX A;  3K9U A;  1ARM A;  1U6M A;  2ZEM A;  2Y0M A;  1GYT A;  2G0B A;  4MFZ A;  2ZW5 A;  4ZY0 A;  2I3C A;  1F57 A;  3R9G A;  3BI0 A;  3CPX A;  3RYO A;  3SI0 A;  1ZLH A;  1S60 A;  2XEJ A;  2HC9 A;  3BI1 A;  1LAP A;  1B87 A;  1ZO0 A;  3NH5 A;  3PB9 X;  4KSF A;  4Q7A A;  2C1C A;  1IYK A;  2BSW A;  3R96 A;  4MMO A;  1TIQ A;  2DXQ A;  2GAN A;  3T8W A;  1Z4R A;  1LRZ A;  1YME A;  3B3W A;  3TT2 A;  4UEF A;  1X10 A;  1Z8T A;  3PB7 X;  8CPA A;  4M3S A;  3V8I A;  4XPD B;  2PJ6 A;  3I3G A;  5BWA B;  3SI2 A;  5EMI A;  2AFZ A;  3LMS A;  4C2X A;  4B10 A;  4EWT A;  4EVY A;  4KZT A;  3LAC A;  4IUS A;  1M4D A;  2Q04 A;  1Q2Y A;  1YR0 A;  2Q51 A;  4MFQ A;  4NGR A;  2ZPA A;  2ZEG A;  4P4E A;  2FIW A;  2POK A;  1CG2 A;  1YW4 A;  1VGY A;  3FBU A;  2JEV A;  2J8M A;  3T90 A;  1YLE A;  5G20 A;  4RN7 A;  5THW A;  1IID A;  2R1I A;  4H6Z A;  5LYI A;  3RZA A;  1ZG7 A;  2EK8 A;  2WPW A;  4GM5 A;  4AXV A;  4E2A A;  1ZLI A;  2Q43 A;  2CTC A;  2C6P A;  4JJX A;  1WWZ A;  3IFE A;  4KSA A;  1CJW A;  2EK9 A;  4C2Z A;  4Z65 A;  2AFX A;  3MN8 A;  1RTQ A;  3B2Y A;  1YSJ A;  1ELL P;  1JWQ A;  3IWE A;  1BOB A;  2GLF A;  1S5K A;  2JDD A;  4OIW A;  4PK3 A;  2Q7S A;  5JGF A;  4LQ6 A;  5GCN A;  2PJB A;  4H89 A;  3H8F A;  1DTD A;  1OZP A;  2OZH A;  1FY7 A;  1LFW A;  3B3T A;  4NGS A;  3TOB A;  1CP7 A;  4FAI A;  5IB9 A;  4AB7 A;  3GUX A;  2PJA A;  2VQY A;  2CNM A;  4IF5 A;  3TE4 A;  1YK3 A;  3S6F A;  3F0A A;  3FXT A;  2WSA A;  2RFH A;  4MHP A;  2R8V A;  4B12 A;  2AJ6 A;  4OID A;  4NF1 A;  2J8R A;  3D7D A;  4KLV A;  5H86 A;  4KVM E;  4FD6 A;  2IMO A;  1EE3 P;  4P44 A;  3EO4 A;  5HVF A;  4KUA A;  1R43 A;  4CAV A;  2F8H A;  3V38 A;  3DGV A;  4M6I A;  4A2Z A;  2EWB A;  4QBJ A;  1M4G A;  1CBX A;  2PQ8 A;  5AGE A;  4A30 A;  4B6Z A;  2DEA A;  3TOA A;  2HUZ A;  1DE4 C;  3GY9 A;  2OH1 A;  4MCP A;  5F46 A;  2XEI A;  4X5K A;  2EVN A;  1FT7 A;  3PRT A;  3PZJ A;  4NCZ A;  5ELY A; 
#chains in the Genus database with same CATH homology
 4WWV A;  3KHZ A;  3TX8 A;  1NSA A;  2IJZ A;  4IAV A;  1KWM A;  3ISX A;  1JQG A;  3IEH A;  1VIX A;  4A38 A;  1Z8L A;  4DJL A;  4OKO A;  3BHX A;  1XMB A;  2C6C A;  3KAS A;  5I4M A;  1TF8 A;  4YWY A;  5LYF A;  1LOK A;  4JYW A;  1TKF A;  3KGQ A;  2PJ0 A;  1Q7L A;  2PVV A;  4ZY2 A;  3N5F A;  2PE3 A;  2PIZ A;  4OC4 A;  4TWE A;  2RB7 A;  3RAM A;  1TKH A;  1UWY A;  2VL1 A;  4UF4 A;  1HDQ A;  2PRQ A;  4FBE A;  2PJ1 A;  3NFZ A;  2J9A A;  5LRJ A;  1LAM A;  2C6G A;  5DS0 A;  4PXC A;  1M4L A;  4FWU A;  1TF9 A;  2JEW A;  2PJ4 A;  1CX8 A;  1CPX A;  2BOA A;  5JH9 A;  3HLP A;  1HDU A;  4R76 A;  3SJE A;  4DYO A;  3PFO A;  1BAV A;  5CBM A;  3PB8 X;  2FVG A;  1XBU A;  1XFO A;  4MHN A;  3VAR A;  4MCR A;  5K8M A;  1XRY A;  3B3S A;  6CPA A;  2PVW A;  1PCA A;  1H8L A;  3FX6 A;  1FNO A;  5D29 A;  2PJC A;  3D68 A;  4PXE A;  1Y7E A;  2GRE A;  4ZX9 A;  4R8F A;  4OC2 A;  4CPA A;  5K8O A;  3KQZ A;  3NH4 A;  1ZG9 A;  4NGM A;  4UIA A;  3D7G A;  3VH9 A;  4ZYQ A;  4UEZ A;  3CT9 A;  4A39 A;  4MCQ A;  3WC7 A;  3FJU A;  4F8Z A;  4P4J A;  2ZEF A;  4PQA A;  3GB0 A;  4OC1 A;  4NGQ A;  4OC3 A;  4NJR A;  1ZG8 A;  3WAB A;  3IC1 A;  2XEG A;  2ZEO A;  3K9T A;  4P45 A;  2AFS A;  4OC0 A;  4X3R A;  3D66 A;  3IJ3 A;  3FMC A;  1BLL E;  3KR5 A;  4R6T A;  3B3C A;  4WJB A;  3I1U A;  5LYL A;  3H8G A;  5F09 A;  4O23 A;  5K8N A;  3D7H A;  7CPA A;  3IWW A;  1LAN A;  4W9Y A;  2WZN A;  2ZEL A;  5J1Q A;  2CF4 A;  2O53 A;  2BO9 A;  4X2T A;  2G9D A;  2ANP A;  2QYV A;  4F9V A;  3SJX A;  4P6Y A;  4A94 A;  2PJ7 A;  3D67 A;  1F2O A;  3KR4 A;  4NFR A;  4DUK A;  3SJG A;  4PPZ A;  3WC6 A;  2PJ8 A;  4JZ0 A;  2PJ3 A;  4X8I A;  1YLO A;  2JBJ A;  4TNU A;  1LCP A;  2QVP A;  3TC8 A;  4FUU A;  4K3N A;  3FEC A;  2V8H A;  2OOT A;  5CPA A;  2V77 A;  4H2K A;  3SJF A;  2ZOG A;  5HVH A;  4KSI A;  3PBB A;  3KQX A;  3B7I A;  3LWU A;  2PIY A;  2OR4 A;  4NGT A;  1Y0Y A;  4YU9 A;  3S9M A;  3PEI A;  3KI9 A;  4NGN A;  4ONW A;  4P10 A;  5LYD A;  3S9L A;  4G1P A;  2IQ6 A;  2HB6 A;  2ZOF A;  3PFE A;  3VAT A;  3B3V A;  2F7V A;  2ZEP A;  3V7Z A;  2NSM A;  1ELM P;  3D4U A;  4MHZ A;  3GLJ A;  2ZEH A;  4A37 A;  2GLJ A;  2AFO A;  4BD9 A;  3S9N A;  5D8N A;  3KL9 A;  1F2P A;  1QQ9 A;  1ARL A;  2PJ2 A;  4R7M A;  1BPM A;  2GU2 A;  4P4I A;  4ZX8 A;  1CPS A;  3FH4 A;  1VHO A;  3SI1 A;  4RUH A;  3CPA A;  1HEE A;  2V8G A;  3FED A;  2Q4Z A;  1QMU A;  4MCS A;  2AFU A;  2WYR A;  4OME A;  4P4F A;  4MHY A;  4NGP A;  1VHE A;  2JBK A;  5LRG A;  4ZI6 A;  3K2K A;  2ZED A;  3D7F A;  4P4D A;  2AFM A;  5K8P A;  3NA6 A;  3FEE A;  3PB6 X;  2PCU A;  1IY7 A;  1CP6 A;  2BCO A;  1Z5R A;  5HXD A;  3MRU A;  3DLJ A;  3H8E A;  4UEE A;  3WC5 A;  2O4H A;  4ZY1 A;  3HUV A;  3KZW A;  5HVG A;  1YW6 A;  1AMP A;  3B35 A;  3PBE A;  2CIJ A;  4LQG A;  4EFD A;  3QNV A;  2PJ5 A;  2AFW A;  4IHM A;  3IO1 A;  4UIB A;  4P4B A;  3WT4 A;  1XJO A;  3FVL A;  1Z2L A;  4OP4 A;  4OC5 A;  1Y0R A;  2ABZ A;  3JRU A;  4NJQ A;  1PYT B;  4MXU A;  3RBU A;  2V8V A;  3ISZ A;  3L2N A;  4IK2 A;  3BXM A;  1OBR A;  1IGB A;  3PB4 X;  3KHX A;  4EME A;  2XEF A;  3IIB A;  3NH8 A;  2QJ8 A;  5LRK A;  1TKJ A;  5JM6 A;  2PJ9 A;  1AYE A;  2NYQ A;  2CTB A;  4PXB A;  1BPN A;  1TXR A;  1R3N A;  2ZEE A;  3FF3 A;  4PXD A;  4F9U A;  2V8D A;  2ZEN A;  4MRI A;  3CDX A;  1ARM A;  2ZEM A;  1GYT A;  4ZY0 A;  2I3C A;  1F57 A;  3BI0 A;  3CPX A;  3SI0 A;  1ZLH A;  2XEJ A;  2HC9 A;  3BI1 A;  1LAP A;  3NH5 A;  3PB9 X;  4Q7A A;  2C1C A;  4MMO A;  3T8W A;  3B3W A;  1YME A;  4UEF A;  3PB7 X;  8CPA A;  2PJ6 A;  3SI2 A;  2AFZ A;  3LMS A;  4EWT A;  4NGR A;  2Q51 A;  2ZEG A;  4P4E A;  2POK A;  1CG2 A;  1YW4 A;  1VGY A;  5THW A;  5LYI A;  3RZA A;  1ZG7 A;  2EK8 A;  4GM5 A;  4AXV A;  1ZLI A;  2Q43 A;  2CTC A;  2C6P A;  3IFE A;  2EK9 A;  4Z65 A;  2AFX A;  3MN8 A;  1RTQ A;  3B2Y A;  1YSJ A;  1ELL P;  2GLF A;  4OIW A;  5JGF A;  2PJB A;  3H8F A;  1DTD A;  3B3T A;  4NGS A;  1LFW A;  4FAI A;  1CP7 A;  5IB9 A;  3GUX A;  2PJA A;  4MHP A;  2RFH A;  4OID A;  3D7D A;  2IMO A;  1EE3 P;  4P44 A;  5HVF A;  1R43 A;  2F8H A;  3V38 A;  3DGV A;  2EWB A;  1CBX A;  4B6Z A;  2DEA A;  1DE4 C;  4MCP A;  2XEI A;  1FT7 A;  3PRT A;  5ELY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...