4AXVA

Biochemical and structural characterization of the mpaa amidase as part of a conserved scavenging pathway for peptidoglycan derived peptides in gamma-proteobacteria
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
241
structure length
241
Chain Sequence
b'VLFQGPAMSLIPRTERAAFLITPTSYGKSVLGAPLLYFPAQVESNSRGLILAGTHGDETASIAGLSCALRSLPAECLKHDVILSMNPDANQLGTRANANQVDLNRAFPTQNWTEHGTVYRWSSHTPVRDVKVKTGDKEQLEPEVDALISLIELRRPKFVVSFHEPLAFVDDPAHSDLAKWLGKQFNLPIVDDVDYETPGSFGTWCNERQLPCITVELPPISADLTIEKHLDAFIALLQHDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MPAA
publication title Mpaa is a Murein-Tripeptide-Specific Zinc Carboxypeptidase that Functions as Part of a Catabolic Pathway for Peptidoglycan Derived Peptides in Gamma-Proteobacteria.
pubmed doi rcsb
source organism Vibrio harveyi
molecule tags Hydrolase
total genus 71
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2012-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4axvA00
1GYTA 1YLOA 3ISXA 3PB6X 3L2NA 1ZLIA 4R76A 1BLLE 4P6YA 4ZYQA 1Y0YA 4YU9A 3PB7X 2QYVA 2AFSA 4NGSA 2Q51A 3ISZA 3S9LA 1LANA 3IFEA 4WJBA 3BI0A 3RZAA 5JGFA 5LYDA 2ANPA 5CBMA 3IIBA 4MCRA 4FBEA 1LFWA 3TC8A 2OR4A 2QJ8A 1ZLHA 3KGQA 2AFUA 1BPMA 4NGNA 1QQ9A 4F8ZA 2XEJA 1BAVA 2PJ5A 3SJGA 4Z65A 1TKFA 3FVLA 5I4MA 1XBUA 2PIZA 4JYWA 1ZG7A 3KR4A 4PXCA 1KWMA 1TF8A 1Z8LA 4F9UA 4ZI6A 3NA6A 3JRUA 4PXDA 3D7GA 4P10A 3BI1A 1ZG8A 1TKHA 5JH9A 4ZX8A 7CPAA 6CPAA 1TF9A 2CF4A 3FECA 2AFZA 3FX6A 2CIJA 3V38A 4A94A 2CTBA 3NFZA 4F9VA 4H2KA 3H8EA 3DGVA 3PBEA 3FEEA 2EK9A 1Z2LA 4EFDA 2C6PA 4MHZA 4P45A 3D7FA 3BHXA 1CP6A 2Q4ZA 1PYTB 4R6TA 5THWA 5K8NA 4O23A 1UWYA 5HVGA 4LQGA 1VHOA 2V8VA 3B3WA 3D68A 3V7ZA 3VH9A 2IMOA 3SI0A 1FT7A 2F8HA 5K8OA 3D7DA 2BCOA 2F7VA 3IEHA 1F57A 1HDQA 4B6ZA 3D7HA 5LYLA 5F09A 4Q7AA 5D8NA 1LOKA 3KR5A 2PVWA 4A37A 2PE3A 4YWYA 1RTQA 4PXEA 3VATA 2AFOA 1CPXA 3FJUA 2NYQA 3RAMA 1NSAA 3B3CA 5J1QA 3PB4X 3CDXA 2AFWA 4X8IA 3FF3A 4PXBA 5DS0A 1OBRA 3WC7A 4TNUA 3D66A 3GUXA 1YW6A 1TXRA 1CBXA 1XJOA 2RFHA 3K2KA 3SI1A 1R43A 4NJQA 3B35A 4MCPA 4MRIA 3PFOA 3SJXA 4IK2A 4ONWA 4OC5A 4NFRA 2JEWA 2HC9A 3TX8A 3IO1A 1LCPA 4BD9A 1FNOA 4P4EA 4W9YA 2ZENA 4PQAA 2PJAA 2POKA 8CPAA 4P4JA 3HLPA 3FMCA 3CPXA 2ZEDA 2RB7A 2V8GA 3DLJA 3SI2A 2PJ6A 3KQXA 3D4UA 2PJ3A 2JBKA 2GLFA 2ZELA 4FWUA 3PRTA 3KQZA 3QNVA 4MCSA 4UIBA 4UEEA 1ELMP 4P44A 3WC5A 3WT4A 2V8HA 1TKJA 1AMPA 1R3NA 3LWUA 4NJRA 1PCAA 3PEIA 4OC2A 1ARLA 4MXUA 2ZEGA 2ZOGA 4MHYA 4OIDA 2EK8A 4FAIA 4OC4A 2PJCA 2PVVA 2HB6A 1CPSA 4MHPA 3VARA 3I1UA 4K3NA 1Y0RA 2PJ0A 4NGTA 2PJBA 4UIAA 3N5FA 2CTCA 3FEDA 3SJFA 3T8WA 2GU2A 3B7IA 4PPZA 3GB0A 1VIXA 3MRUA 2QVPA 5D29A 2ZEHA 1VGYA 5K8PA 1JQGA 1IGBA 2EWBA 4OMEA 2AFMA 3RBUA 1AYEA 1ELLP 2PRQA 5HVHA 4OC3A 1LAMA 2DEAA 4ZY1A 3WABA 1DE4C 4X3RA 1Z5RA 3LMSA 2JBJA 4KSIA 4JZ0A 1EE3P 2PIYA 3CPAA 2WYRA 5LRKA 3B3TA 5K8MA 3PFEA 3SJEA 5LRJA 4ZY0A 2ZEEA 3NH8A 4MCQA 4OC0A 1HEEA 3IWWA 4UEFA 3H8FA 1M4LA 3MN8A 1VHEA 2PJ8A 2XEGA 1ZG9A 1CX8A 2XEFA 4P4DA 2J9AA 4EWTA 1XRYA 4P4IA 4NGRA 2WZNA 1IY7A 3GLJA 4IAVA 2NSMA 3KZWA 4NGPA 4AXVA 2BO9A 4R8FA 3PBBA 2G9DA 3PB8X 3FH4A 2ZEPA 4OKOA 5LYIA 4P4FA 1CP7A 2C6GA 4WWVA 3BXMA 1F2PA 1XFOA 4RUHA 4A38A 5LRGA 2ZOFA 2VL1A 2PJ9A 3CT9A 2IQ6A 1XMBA 5JM6A 2GLJA 2I3CA 2ABZA 3KL9A 4OIWA 3KHXA 5HVFA 5LYFA 5ELYA 4ZY2A 4CPAA 1F2OA 3S9MA 1DTDA 2XEIA 4P4BA 3NH5A 2BOAA 2AFXA 4DUKA 3IC1A 4NGQA 4EMEA 3S9NA 1HDUA 1YMEA 4TWEA 2C6CA 1Y7EA 1ARMA 3IJ3A 3PB9X 2PJ2A 1QMUA 1BPNA 2ZEMA 3D67A 2Q43A 1YW4A 4GM5A 2C1CA 3B2YA 2IJZA 2GREA 4DJLA 4OC1A 2PJ1A 4UEZA 3HUVA 2PJ4A 4ZX9A 5HXDA 1H8LA 2V8DA 5IB9A 4FUUA 4UF4A 2ZEFA 3KASA 4MHNA 2PJ7A 4OP4A 3B3VA 2FVGA 2PCUA 2ZEOA 4G1PA 4MMOA 2OOTA 3K9TA 4NGMA 2V77A 3WC6A 5CPAA 1LAPA 3B3SA 2O4HA 4IHMA 1YSJA 1Q7LA 1CG2A 3NH4A 4DYOA 2O53A 4X2TA 4R7MA 3KHZA 3H8GA 3KI9A 4A39A
chains in the Genus database with same CATH superfamily
3D8PA 2G3AA 2DF5A 4B14A 1GYTA 1YLOA 3ISXA 2CXAA 2HV2A 4IUSA 3PB6X 4CAFA 4XPKA 3R1KA 3L2NA 1ZLIA 3BJ7A 4R76A 4EVYA 5HH1A 4H6UA 3P2FA 2A4NA 1BLLE 4E2AA 2PRBA 4ORFA 4KSFA 3LODA 2P0WA 4P6YA 3EFAA 4C7HA 4ZYQA 4E0AA 4UFWA 4ZGYB 1Y0YA 4PSWA 4YU9A 3PB7X 2QYVA 5EMIA 4AG7A 1UFHA 5AG4A 2AFSA 4NGSA 2ODFA 2Q51A 3IU2A 4M6HA 1MJ9A 3ISZA 4LUAA 3S9LA 1LANA 5GCNA 3FRMA 3IFEA 2YNEA 4WJBA 3BI0A 3RZAA 4CRYB 5JGFA 3H4QA 2ANPA 4PK2A 1XMTA 5LYDA 3F0AA 5CBMA 4C7IA 3IIBA 4KOUA 4MCRA 2G3TA 4FBEA 1SQHA 4QVTA 1NE9A 1LFWA 3TC8A 4HPSA 1M4IA 3LACA 2Z3MA 2OR4A 3SXNA 3NE7A 1IIDA 2QJ8A 1ZLHA 3T9YA 3E0KA 3KGQA 2AFUA 4CGNA 4A30A 1BPMA 4NGNA 1QQ9A 1KZFA 1CJWA 4UWJA 2XEJA 4F8ZA 5G1ZA 1BAVA 2PJ5A 1QSRA 4KORA 5G22A 2YNCC 3SJGA 4Z65A 2Q04A 3F8KA 1TKFA 3FVLA 4YFJA 5I4MA 4HNWB 1XBUA 4DNCA 2PIZA 4QB9A 3PP9A 2BL1A 2FL4A 2I79A 1IOFA 4KOYA 2P6FA 4R87A 4KOWA 4JYWA 1ZG7A 3KR4A 4PXCA 3DDDA 1KWMA 3PZJA 1TF8A 1Z8LA 4F9UA 4ZI6A 4QC6A 1Q2YA 3NA6A 3JRUA 4PXDA 2OZGA 2O28A 4JJXA 3D7GA 2FE7A 4P10A 2B3UA 3BI1A 3DNSA 1ZG8A 1TKHA 5JH9A 4ZX8A 5F47A 4MFPA 2WPXA 7CPAA 2ZPAA 4NSQA 6CPAA 4H6ZA 4C2YA 2B4DA 1TF9A 2CF4A 3FECA 2AFZA 3FX6A 2CIJA 3RO0A 3V38A 2CTBA 3NFZA 2X7BA 3K9UA 4F9VA 3TOBA 2ZW5A 4H2KA 3H8EA 3A9LA 2D4OA 3DGVA 5JPHA 4CGMA 4CYQA 3PBEA 2NMTA 3FEEA 2EK9A 1Z2LA 2HUZA 4EFDA 2BSWA 1XIXA 2C6PA 3IWGA 2AE6A 4MFZA 4MHZA 4P45A 3D7FA 1L0CA 4RI1A 1Z4RA 3BHXA 4K30A 1CP6A 2Q4ZA 1PYTB 1KUVA 3FBUA 4F0YA 4R6TA 5THWA 4B5PA 5K8NA 1S7LA 4O23A 1UWYA 5HVGA 3RYOA 3QAYA 4LQGA 1VHOA 2V8VA 3B3WA 3D68A 3V7ZA 3VH9A 2R98A 2IMOA 3CZXA 3SI0A 1IICA 3TTHA 1FT7A 4MHDA 4Y49C 2F8HA 4B5OA 4KVME 4AB7A 5AG7A 5K8OA 3D7DA 5KTAA 3PGPA 2ZW6A 4KUAA 4YRHA 3BJ8A 2BCOA 2F7VA 1RO5A 2QMLA 3IEHA 2Q7BA 1F57A 1HDQA 4CGPA 1XOVA 2B58A 5AG5A 4KOTA 4L8AA 1KUYA 1QSNA 4B6ZA 3D7HA 3TE4A 5LYLA 4OAEA 5F09A 2F5IA 5J8FA 1KUXA 2RC4A 4Q7AA 3KKWA 4MFLA 1LOKA 3KR5A 2PVWA 5D8NA 4A37A 1CM0A 2JDDA 2PE3A 4YWYA 4FD5A 2ATRA 1S60A 4JLYA 1RTQA 2D4PA 4PXEA 3VATA 4UWIA 2AFOA 2P6EA 3CXPA 4RN7A 1Z8XA 1CPXA 3FJUA 2NYQA 4JXRA 3RAMA 2REFA 1NSAA 2ZXVA 3B3CA 3W6SA 4M6IA 5J1QA 3PB4X 3CDXA 2AFWA 4X8IA 1QSMA 3B8GA 3FF3A 2B4BA 4PXBA 4AVBA 4AG9A 1Y9WA 1U6MA 5DS0A 1OBRA 3S6KA 3UY5A 3WC7A 3W6XA 3ZJ0A 2Z11A 4UCNA 2OZUA 4TNUA 3D66A 2GFQA 4KLVA 3GUXA 3D2MA 2Z3NA 4Y49B 1YW6A 1TXRA 1CBXA 2Q44A 2WPWA 3I9SA 4RS2A 1Y9KA 1IYLA 1XJOA 2RFHA 3K2KA 1XE4A 4PK3A 1R43A 3SI1A 4NJQA 3B35A 1K4JA 1QSTA 4MCPA 5CNPA 5H86A 1NMTA 4KUBA 4M3SA 4MRIA 3PFOA 2B4DB 3NE8A 4MBUA 3SJXA 1YVOA 4LQ6A 2R1IA 4BMHA 3V8IA 1XF8A 3BLNA 4IK2A 4ONWA 4OC5A 3IGRA 4NFRA 2JEWA 3R95A 3TO6A 2HC9A 3TX8A 3IO1A 1LCPA 2EBJA 5DWNA 3FNCA 4BD9A 1FNOA 1YLEA 4CAXA 3DSBA 4P4EA 3GKRA 3P2HA 2ZENA 4W9YA 5IX3A 4PQAA 2PJAA 4HNYB 2FIAA 1IOIA 4Q38A 4QBJA 2POKA 4BBHA 4MFKA 5F48A 1IU8A 4P4JA 4B5PB 2VI7A 8CPAA 1Q2DA 1Z9UA 2DPTA 3HLPA 2IL4A 3FMCA 2B3VA 3CPXA 2VZYA 2ZEDA 1QSOA 2RB7A 2Q0YA 4KOXA 4MI4A 1NSLA 5IV0A 1PUAA 1S5KA 2V8GA 3DLJA 4LX9A 3SI2A 3R96A 1I21A 4U9YA 1Q2CA 2PJ6A 3KQXA 2BEIA 4X5KA 2VEZA 4A95A 4II9A 3D4UA 3TT2A 4CAEA 2PJ3A 4KSAA 2JBKA 4UFVA 1M4DA 4PV6A 2GLFA 4JWPA 2ZELA 4FWUA 3PRTA 2GANA 4B13A 3KQZA 4UCPA 3FYNA 2R7HA 3QNVA 4MCSA 4UIBA 5J8CA 4XPLA 4UEEA 4A33A 1ELMP 4P44A 3WC5A 4A32A 3WT4A 2V8HA 4KVOE 1TKJA 2K5TA 2YGWA 4UA3A 1AMPA 4FD6A 1B6BA 1LRZA 1R3NA 3LWUA 3H5ZA 1N71A 5DWMA 4NJRA 1PCAA 3PEIA 4OC2A 2VXKA 4R57A 2KCWA 1RXTA 2OZHA 3G3SA 1ARLA 2B5GB 3JVNA 3R9FA 3VWEA 3VWDA 4MXUA 2Z3LA 2ZEGA 3GY9A 5ISVA 2ZOGA 4MHYA 2ZW7A 4OIDA 2EK8A 4FAIA 4OC4A 1S7KA 1YX0A 2QECA 2PJCA 2PVVA 1BO4A 1YVKA 5C88A 2HB6A 4A31A 1CPSA 5KTCA 4A39A 4MHPA 3VARA 2CNTA 3R9EA 3I1UA 2EO8A 2PDOA 4K3NA 1Y0RA 2PJ0A 2OB0A 4NGTA 1Z8WA 3FXTA 2PJBA 4UIAA 4H89A 3TCVA 3N5FA 2CTCA 3FEDA 3SJFA 4KLWA 1V0CA 3T8WA 2GU2A 3B7IA 1S3ZA 2CNMA 4PPZA 4C2ZA 3GB0A 4R9MA 2Q4YA 4E8OA 1VIXA 3MRUA 5A28A 1MJBA 1WK4A 4C68A 4L89A 1YGHA 4GXHA 2QVPA 4HKFA 4UBRA 5D29A 2VQYA 2Z3OA 2H5MA 2ZEHA 3G8WA 1VGYA 4U9ZA 1S7NA 5K8PA 1JQGA 1IGBA 2EWBA 4OMEA 4XPDC 2AFMA 3RBUA 2BUEA 2EUIA 1AYEA 1ELLP 2PRQA 3CXQA 4U5YA 5HVHA 4OC3A 1LAMA 4KZTA 3I3GA 2DEAA 4ZY1A 4A2ZA 3WABA 2J8MA 1DE4C 2FT0A 4X3RA 2J8RA 1M44A 1Z5RA 2HQYA 2OH1A 1Z4EA 4UCMA 4A94A 3LMSA 2JBJA 5H84A 4KSIA 2EVNA 4JZ0A 1EE3P 3TOAA 5IB0A 2PIYA 3CPAA 2WYRA 1I12A 3D2PA 5LRKA 1M4GA 3B3TA 4OLLA 1S7FA 5K8MA 3PFEA 3SJEA 5G21A 4IF5A 2PQ8A 4QUSA 5LRJA 4ZY0A 2YNCA 2ZEEA 3NH8A 1Z8TA 1BOBA 2ZW4A 4CAVA 4MCQA 3RNZA 3F5BA 2DXQA 4OC0A 1HEEA 4JXQA 1FY7A 3IWWA 4UEFA 3DR6A 3H8FA 1M4LA 3MN8A 1XEBA 1OZPA 3C26A 2AJ6A 3TO9A 1VHEA 2Z3KA 2PJ8A 4MFJA 2XEGA 1ZG9A 4XPDB 1CX8A 2XEFA 3JTKA 2C27A 4CAWA 4P4DA 1YK3A 2J9AA 4EWTA 1P4NA 2PSWA 1B87A 1XRYA 2J8NA 4UFXA 3TFYA 3SXOA 4P4IA 5G20A 4B12A 1WWZA 4NGRA 2WZNA 4MJ8A 1IY7A 3S6GA 4CGOA 3GLJA 4IAVA 1GHEA 1YQEA 5AG6A 2NSMA 3KZWA 4NGPA 4AXVA 4YGOA 4MFQA 5F46A 2BO9A 3MGDA 1MJAA 4R8FA 4AVCA 3PBBA 4B10A 2G9DA 3PB8X 2I00A 2FXFA 4GS4A 3FH4A 2ZEPA 5EC4A 4R3LA 4OKOA 4MY3A 5LYIA 4P4FA 4B11A 1CP7A 2C6GA 4WWVA 1ON0A 3BXMA 1F2PA 1XFOA 4M85A 1IB1E 4A38A 5LRGA 4CYPA 2ZOFA 4RUHA 2GIVA 2VL1A 2PJ9A 5C82A 1YR0A 3CT9A 3IU1A 2IQ6A 1R57A 1ZO0A 4M6GA 1XMBA 3LD2A 1MK4A 5JM6A 2GLJA 4NEXA 4OADA 3FIXA 4NCZA 2Z0ZA 4CRZB 2I3CA 1X10A 2ABZA 3D3SA 3JUWA 2FSRA 3GIUA 1I1DA 1VKCA 3KL9A 4I49A 3R9GA 1JWQA 4OIWA 3KHXA 5HVFA 5LYFA 5ELYA 4ZY2A 1VHSA 4Q36A 2PR1A 5F49A 1YREA 3EY5A 4KOSA 1X12A 2DPSA 4CPAA 1F2OA 3DR8A 2GE3A 3EO4A 1DTDA 2XEIA 4P4BA 3S9MA 4CS0B 4CYNA 3NH5A 2BOAA 2R8VA 4KS9A 2AFXA 4AVAA 2G0BA 5E96A 4DUKA 3IC1A 4NGQA 4XNHC 2CY2A 4EMEA 1HDUA 1YMEA 4TWEA 2C6CA 3S9NA 1Y7EA 4NF1A 1ARMA 3TO7A 2REEA 3IJ3A 3PB9X 2PJ2A 1QMUA 4HNXB 4ONUA 1BPNA 2PR8A 3N7ZA 3IWEA 4BINA 2VZZA 4R3KA 3QB8A 2FCKA 2ZEMA 1M1DA 3T90A 4NXYA 5JQ4A 2VBQA 3D67A 5KTDA 2ARHA 2Q43A 5HMNA 1YW4A 5AGEA 2Y0MA 2C1CA 4GM5A 3B2YA 4J3GA 2IJZA 2GREA 4KVXA 5I0CA 4DJLA 4OC1A 4ZBGA 4CGLA 2PJ1A 4UEZA 1TIQA 3HUVA 2WUUA 3W91A 2PJ4A 4ZX9A 1P0HA 1H8LA 5HXDA 2V8DA 3S6HA 3EC4A 4FUUA 3ZZIA 5IB9A 3FB3A 4UF4A 3WR7A 2ZEFA 3KASA 4MHNA 2PJ7A 5EBVA 4OP4A 2FS5A 2YNDA 3S6FA 3B3VA 2FVGA 4F6AA 2PCUA 2ZEOA 5FVJA 1J4JA 1PU9A 1Y7RA 4G1PA 4KOVA 4MMOA 4JD6A 4F0XA 2P6GA 2OOTA 3K9TA 4NGMA 2OU2A 4FD7A 2V77A 3SHPA 3WC6A 5CPAA 1LAPA 3B3SA 2O4HA 2QIRA 1YSJA 4IHMA 4XNHB 2WSAA 2Q7SA 1Q7LA 2Z10A 3OWCA 2CNSA 4C2XA 1CG2A 3NH4A 4DYOA 2O53A 4X2TA 2JDCA 4R7MA 2JLMA 1IYKA 2Q4VA 1A2ZA 5A27A 2Z3PA 1AUGA 2JEVA 2PC1A 2FIWA 2B5GA 3CXSA 3H8GA 3EXNA 3KHZA 3KI9A 3QAHA 4MY0A 4CYOA 5BWAB 4PSXA 4FD4A 3GYAA
chains in the Genus database with same CATH topology
1GYTA 1YLOA 3ISXA 3PB6X 3L2NA 1ZLIA 4R76A 1BLLE 4P6YA 4ZYQA 1Y0YA 4YU9A 3PB7X 2QYVA 2AFSA 4NGSA 2Q51A 3ISZA 3S9LA 1LANA 3IFEA 4WJBA 3BI0A 3RZAA 5JGFA 5LYDA 2ANPA 5CBMA 3IIBA 4MCRA 4FBEA 1LFWA 3TC8A 2OR4A 2QJ8A 1ZLHA 3KGQA 2AFUA 1BPMA 4NGNA 1QQ9A 4F8ZA 2XEJA 1BAVA 2PJ5A 3SJGA 4Z65A 1TKFA 3FVLA 5I4MA 1XBUA 2PIZA 4JYWA 1ZG7A 3KR4A 4PXCA 1KWMA 1TF8A 1Z8LA 4F9UA 4ZI6A 3NA6A 3JRUA 4PXDA 3D7GA 4P10A 3BI1A 1ZG8A 1TKHA 5JH9A 4ZX8A 7CPAA 6CPAA 1TF9A 2CF4A 3FECA 2AFZA 3FX6A 2CIJA 3V38A 4A94A 2CTBA 3NFZA 4F9VA 4H2KA 3H8EA 3DGVA 3PBEA 3FEEA 2EK9A 1Z2LA 4EFDA 2C6PA 4MHZA 4P45A 3D7FA 3BHXA 1CP6A 2Q4ZA 1PYTB 4R6TA 5THWA 5K8NA 4O23A 1UWYA 5HVGA 4LQGA 1VHOA 2V8VA 3B3WA 3D68A 3V7ZA 3VH9A 2IMOA 3SI0A 1FT7A 2F8HA 5K8OA 3D7DA 2BCOA 2F7VA 3IEHA 1F57A 1HDQA 4B6ZA 3D7HA 5LYLA 5F09A 4Q7AA 5D8NA 1LOKA 3KR5A 2PVWA 4A37A 2PE3A 4YWYA 1RTQA 4PXEA 3VATA 2AFOA 1CPXA 3FJUA 2NYQA 3RAMA 1NSAA 3B3CA 5J1QA 3PB4X 3CDXA 2AFWA 4X8IA 3FF3A 4PXBA 5DS0A 1OBRA 3WC7A 4TNUA 3D66A 3GUXA 1YW6A 1TXRA 1CBXA 1XJOA 2RFHA 3K2KA 3SI1A 1R43A 4NJQA 3B35A 4MCPA 4MRIA 3PFOA 3SJXA 4IK2A 4ONWA 4OC5A 4NFRA 2JEWA 2HC9A 3TX8A 3IO1A 1LCPA 4BD9A 1FNOA 4P4EA 4W9YA 2ZENA 4PQAA 2PJAA 2POKA 8CPAA 4P4JA 3HLPA 3FMCA 3CPXA 2ZEDA 2RB7A 2V8GA 3DLJA 3SI2A 2PJ6A 3KQXA 3D4UA 2PJ3A 2JBKA 2GLFA 2ZELA 4FWUA 3PRTA 3KQZA 3QNVA 4MCSA 4UIBA 4UEEA 1ELMP 4P44A 3WC5A 3WT4A 2V8HA 1TKJA 1AMPA 1R3NA 3LWUA 4NJRA 1PCAA 3PEIA 4OC2A 1ARLA 4MXUA 2ZEGA 2ZOGA 4MHYA 4OIDA 2EK8A 4FAIA 4OC4A 2PJCA 2PVVA 2HB6A 1CPSA 4MHPA 3VARA 3I1UA 4K3NA 1Y0RA 2PJ0A 4NGTA 2PJBA 4UIAA 3N5FA 2CTCA 3FEDA 3SJFA 3T8WA 2GU2A 3B7IA 4PPZA 3GB0A 1VIXA 3MRUA 2QVPA 5D29A 2ZEHA 1VGYA 5K8PA 1JQGA 1IGBA 2EWBA 4OMEA 2AFMA 3RBUA 1AYEA 1ELLP 2PRQA 5HVHA 4OC3A 1LAMA 2DEAA 4ZY1A 3WABA 1DE4C 4X3RA 1Z5RA 3LMSA 2JBJA 4KSIA 4JZ0A 1EE3P 2PIYA 3CPAA 2WYRA 5LRKA 3B3TA 5K8MA 3PFEA 3SJEA 5LRJA 4ZY0A 2ZEEA 3NH8A 4MCQA 4OC0A 1HEEA 3IWWA 4UEFA 3H8FA 1M4LA 3MN8A 1VHEA 2PJ8A 2XEGA 1ZG9A 1CX8A 2XEFA 4P4DA 2J9AA 4EWTA 1XRYA 4P4IA 4NGRA 2WZNA 1IY7A 3GLJA 4IAVA 2NSMA 3KZWA 4NGPA 4AXVA 2BO9A 4R8FA 3PBBA 2G9DA 3PB8X 3FH4A 2ZEPA 4OKOA 5LYIA 4P4FA 1CP7A 2C6GA 4WWVA 3BXMA 1F2PA 1XFOA 4RUHA 4A38A 5LRGA 2ZOFA 2VL1A 2PJ9A 3CT9A 2IQ6A 1XMBA 5JM6A 2GLJA 2I3CA 2ABZA 3KL9A 4OIWA 3KHXA 5HVFA 5LYFA 5ELYA 4ZY2A 4CPAA 1F2OA 3S9MA 1DTDA 2XEIA 4P4BA 3NH5A 2BOAA 2AFXA 4DUKA 3IC1A 4NGQA 4EMEA 3S9NA 1HDUA 1YMEA 4TWEA 2C6CA 1Y7EA 1ARMA 3IJ3A 3PB9X 2PJ2A 1QMUA 1BPNA 2ZEMA 3D67A 2Q43A 1YW4A 4GM5A 2C1CA 3B2YA 2IJZA 2GREA 4DJLA 4OC1A 2PJ1A 4UEZA 3HUVA 2PJ4A 4ZX9A 5HXDA 1H8LA 2V8DA 5IB9A 4FUUA 4UF4A 2ZEFA 3KASA 4MHNA 2PJ7A 4OP4A 3B3VA 2FVGA 2PCUA 2ZEOA 4G1PA 4MMOA 2OOTA 3K9TA 4NGMA 2V77A 3WC6A 5CPAA 1LAPA 3B3SA 2O4HA 4IHMA 1YSJA 1Q7LA 1CG2A 3NH4A 4DYOA 2O53A 4X2TA 4R7MA 3KHZA 3H8GA 3KI9A 4A39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GYT A;  1YLO A;  3ISX A;  3PB6 X;  3L2N A;  1ZLI A;  4R76 A;  1BLL E;  4P6Y A;  4ZYQ A;  1Y0Y A;  4YU9 A;  3PB7 X;  2QYV A;  2AFS A;  4NGS A;  2Q51 A;  3ISZ A;  3S9L A;  1LAN A;  3IFE A;  4WJB A;  3BI0 A;  3RZA A;  5JGF A;  5LYD A;  2ANP A;  5CBM A;  3IIB A;  4MCR A;  4FBE A;  1LFW A;  3TC8 A;  2OR4 A;  2QJ8 A;  1ZLH A;  3KGQ A;  2AFU A;  1BPM A;  4NGN A;  1QQ9 A;  4F8Z A;  2XEJ A;  1BAV A;  2PJ5 A;  3SJG A;  4Z65 A;  1TKF A;  3FVL A;  5I4M A;  1XBU A;  2PIZ A;  4JYW A;  1ZG7 A;  3KR4 A;  4PXC A;  1KWM A;  1TF8 A;  1Z8L A;  4F9U A;  4ZI6 A;  3NA6 A;  3JRU A;  4PXD A;  3D7G A;  4P10 A;  3BI1 A;  1ZG8 A;  1TKH A;  5JH9 A;  4ZX8 A;  7CPA A;  6CPA A;  1TF9 A;  2CF4 A;  3FEC A;  2AFZ A;  3FX6 A;  2CIJ A;  3V38 A;  4A94 A;  2CTB A;  3NFZ A;  4F9V A;  4H2K A;  3H8E A;  3DGV A;  3PBE A;  3FEE A;  2EK9 A;  1Z2L A;  4EFD A;  2C6P A;  4MHZ A;  4P45 A;  3D7F A;  3BHX A;  1CP6 A;  2Q4Z A;  1PYT B;  4R6T A;  5THW A;  5K8N A;  4O23 A;  1UWY A;  5HVG A;  4LQG A;  1VHO A;  2V8V A;  3B3W A;  3D68 A;  3V7Z A;  3VH9 A;  2IMO A;  3SI0 A;  1FT7 A;  2F8H A;  5K8O A;  3D7D A;  2BCO A;  2F7V A;  3IEH A;  1F57 A;  1HDQ A;  4B6Z A;  3D7H A;  5LYL A;  5F09 A;  4Q7A A;  5D8N A;  1LOK A;  3KR5 A;  2PVW A;  4A37 A;  2PE3 A;  4YWY A;  1RTQ A;  4PXE A;  3VAT A;  2AFO A;  1CPX A;  3FJU A;  2NYQ A;  3RAM A;  1NSA A;  3B3C A;  5J1Q A;  3PB4 X;  3CDX A;  2AFW A;  4X8I A;  3FF3 A;  4PXB A;  5DS0 A;  1OBR A;  3WC7 A;  4TNU A;  3D66 A;  3GUX A;  1YW6 A;  1TXR A;  1CBX A;  1XJO A;  2RFH A;  3K2K A;  3SI1 A;  1R43 A;  4NJQ A;  3B35 A;  4MCP A;  4MRI A;  3PFO A;  3SJX A;  4IK2 A;  4ONW A;  4OC5 A;  4NFR A;  2JEW A;  2HC9 A;  3TX8 A;  3IO1 A;  1LCP A;  4BD9 A;  1FNO A;  4P4E A;  4W9Y A;  2ZEN A;  4PQA A;  2PJA A;  2POK A;  8CPA A;  4P4J A;  3HLP A;  3FMC A;  3CPX A;  2ZED A;  2RB7 A;  2V8G A;  3DLJ A;  3SI2 A;  2PJ6 A;  3KQX A;  3D4U A;  2PJ3 A;  2JBK A;  2GLF A;  2ZEL A;  4FWU A;  3PRT A;  3KQZ A;  3QNV A;  4MCS A;  4UIB A;  4UEE A;  1ELM P;  4P44 A;  3WC5 A;  3WT4 A;  2V8H A;  1TKJ A;  1AMP A;  1R3N A;  3LWU A;  4NJR A;  1PCA A;  3PEI A;  4OC2 A;  1ARL A;  4MXU A;  2ZEG A;  2ZOG A;  4MHY A;  4OID A;  2EK8 A;  4FAI A;  4OC4 A;  2PJC A;  2PVV A;  2HB6 A;  1CPS A;  4MHP A;  3VAR A;  3I1U A;  4K3N A;  1Y0R A;  2PJ0 A;  4NGT A;  2PJB A;  4UIA A;  3N5F A;  2CTC A;  3FED A;  3SJF A;  3T8W A;  2GU2 A;  3B7I A;  4PPZ A;  3GB0 A;  1VIX A;  3MRU A;  2QVP A;  5D29 A;  2ZEH A;  1VGY A;  5K8P A;  1JQG A;  1IGB A;  2EWB A;  4OME A;  2AFM A;  3RBU A;  1AYE A;  1ELL P;  2PRQ A;  5HVH A;  4OC3 A;  1LAM A;  2DEA A;  4ZY1 A;  3WAB A;  1DE4 C;  4X3R A;  1Z5R A;  3LMS A;  2JBJ A;  4KSI A;  4JZ0 A;  1EE3 P;  2PIY A;  3CPA A;  2WYR A;  5LRK A;  3B3T A;  5K8M A;  3PFE A;  3SJE A;  5LRJ A;  4ZY0 A;  2ZEE A;  3NH8 A;  4MCQ A;  4OC0 A;  1HEE A;  3IWW A;  4UEF A;  3H8F A;  1M4L A;  3MN8 A;  1VHE A;  2PJ8 A;  2XEG A;  1ZG9 A;  1CX8 A;  2XEF A;  4P4D A;  2J9A A;  4EWT A;  1XRY A;  4P4I A;  4NGR A;  2WZN A;  1IY7 A;  3GLJ A;  4IAV A;  2NSM A;  3KZW A;  4NGP A;  4AXV A;  2BO9 A;  4R8F A;  3PBB A;  2G9D A;  3PB8 X;  3FH4 A;  2ZEP A;  4OKO A;  5LYI A;  4P4F A;  1CP7 A;  2C6G A;  4WWV A;  3BXM A;  1F2P A;  1XFO A;  4RUH A;  4A38 A;  5LRG A;  2ZOF A;  2VL1 A;  2PJ9 A;  3CT9 A;  2IQ6 A;  1XMB A;  5JM6 A;  2GLJ A;  2I3C A;  2ABZ A;  3KL9 A;  4OIW A;  3KHX A;  5HVF A;  5LYF A;  5ELY A;  4ZY2 A;  4CPA A;  1F2O A;  3S9M A;  1DTD A;  2XEI A;  4P4B A;  3NH5 A;  2BOA A;  2AFX A;  4DUK A;  3IC1 A;  4NGQ A;  4EME A;  3S9N A;  1HDU A;  1YME A;  4TWE A;  2C6C A;  1Y7E A;  1ARM A;  3IJ3 A;  3PB9 X;  2PJ2 A;  1QMU A;  1BPN A;  2ZEM A;  3D67 A;  2Q43 A;  1YW4 A;  4GM5 A;  2C1C A;  3B2Y A;  2IJZ A;  2GRE A;  4DJL A;  4OC1 A;  2PJ1 A;  4UEZ A;  3HUV A;  2PJ4 A;  4ZX9 A;  5HXD A;  1H8L A;  2V8D A;  5IB9 A;  4FUU A;  4UF4 A;  2ZEF A;  3KAS A;  4MHN A;  2PJ7 A;  4OP4 A;  3B3V A;  2FVG A;  2PCU A;  2ZEO A;  4G1P A;  4MMO A;  2OOT A;  3K9T A;  4NGM A;  2V77 A;  3WC6 A;  5CPA A;  1LAP A;  3B3S A;  2O4H A;  4IHM A;  1YSJ A;  1Q7L A;  1CG2 A;  3NH4 A;  4DYO A;  2O53 A;  4X2T A;  4R7M A;  3KHZ A;  3H8G A;  3KI9 A;  4A39 A; 
#chains in the Genus database with same CATH topology
 3D8P A;  2G3A A;  2DF5 A;  4B14 A;  1GYT A;  1YLO A;  3ISX A;  2CXA A;  2HV2 A;  4IUS A;  3PB6 X;  4CAF A;  4XPK A;  3R1K A;  3L2N A;  1ZLI A;  3BJ7 A;  4R76 A;  4EVY A;  5HH1 A;  4H6U A;  3P2F A;  2A4N A;  1BLL E;  4E2A A;  2PRB A;  4ORF A;  4KSF A;  3LOD A;  2P0W A;  4P6Y A;  3EFA A;  4C7H A;  4ZYQ A;  4E0A A;  4UFW A;  4ZGY B;  1Y0Y A;  4PSW A;  4YU9 A;  3PB7 X;  2QYV A;  5EMI A;  4AG7 A;  1UFH A;  5AG4 A;  2AFS A;  4NGS A;  2ODF A;  2Q51 A;  3IU2 A;  4M6H A;  1MJ9 A;  3ISZ A;  4LUA A;  3S9L A;  1LAN A;  5GCN A;  3FRM A;  3IFE A;  2YNE A;  4WJB A;  3BI0 A;  3RZA A;  4CRY B;  5JGF A;  3H4Q A;  2ANP A;  4PK2 A;  1XMT A;  5LYD A;  3F0A A;  5CBM A;  4C7I A;  3IIB A;  4KOU A;  4MCR A;  2G3T A;  4FBE A;  1SQH A;  4QVT A;  1NE9 A;  1LFW A;  3TC8 A;  4HPS A;  1M4I A;  3LAC A;  2Z3M A;  2OR4 A;  3SXN A;  3NE7 A;  1IID A;  2QJ8 A;  1ZLH A;  3T9Y A;  3E0K A;  3KGQ A;  2AFU A;  4CGN A;  4A30 A;  1BPM A;  4NGN A;  1QQ9 A;  1KZF A;  1CJW A;  4UWJ A;  2XEJ A;  4F8Z A;  5G1Z A;  1BAV A;  2PJ5 A;  1QSR A;  4KOR A;  5G22 A;  2YNC C;  3SJG A;  4Z65 A;  2Q04 A;  3F8K A;  1TKF A;  3FVL A;  4YFJ A;  5I4M A;  4HNW B;  1XBU A;  4DNC A;  2PIZ A;  4QB9 A;  3PP9 A;  2BL1 A;  2FL4 A;  2I79 A;  1IOF A;  4KOY A;  2P6F A;  4R87 A;  4KOW A;  4JYW A;  1ZG7 A;  3KR4 A;  4PXC A;  3DDD A;  1KWM A;  3PZJ A;  1TF8 A;  1Z8L A;  4F9U A;  4ZI6 A;  4QC6 A;  1Q2Y A;  3NA6 A;  3JRU A;  4PXD A;  2OZG A;  2O28 A;  4JJX A;  3D7G A;  2FE7 A;  4P10 A;  2B3U A;  3BI1 A;  3DNS A;  1ZG8 A;  1TKH A;  5JH9 A;  4ZX8 A;  5F47 A;  4MFP A;  2WPX A;  7CPA A;  2ZPA A;  4NSQ A;  6CPA A;  4H6Z A;  4C2Y A;  2B4D A;  1TF9 A;  2CF4 A;  3FEC A;  2AFZ A;  3FX6 A;  2CIJ A;  3RO0 A;  3V38 A;  2CTB A;  3NFZ A;  2X7B A;  3K9U A;  4F9V A;  3TOB A;  2ZW5 A;  4H2K A;  3H8E A;  3A9L A;  2D4O A;  3DGV A;  5JPH A;  4CGM A;  4CYQ A;  3PBE A;  2NMT A;  3FEE A;  2EK9 A;  1Z2L A;  2HUZ A;  4EFD A;  2BSW A;  1XIX A;  2C6P A;  3IWG A;  2AE6 A;  4MFZ A;  4MHZ A;  4P45 A;  3D7F A;  1L0C A;  4RI1 A;  1Z4R A;  3BHX A;  4K30 A;  1CP6 A;  2Q4Z A;  1PYT B;  1KUV A;  3FBU A;  4F0Y A;  4R6T A;  5THW A;  4B5P A;  5K8N A;  1S7L A;  4O23 A;  1UWY A;  5HVG A;  3RYO A;  3QAY A;  4LQG A;  1VHO A;  2V8V A;  3B3W A;  3D68 A;  3V7Z A;  3VH9 A;  2R98 A;  2IMO A;  3CZX A;  3SI0 A;  1IIC A;  3TTH A;  1FT7 A;  4MHD A;  4Y49 C;  2F8H A;  4B5O A;  4KVM E;  4AB7 A;  5AG7 A;  5K8O A;  3D7D A;  5KTA A;  3PGP A;  2ZW6 A;  4KUA A;  4YRH A;  3BJ8 A;  2BCO A;  2F7V A;  1RO5 A;  2QML A;  3IEH A;  2Q7B A;  1F57 A;  1HDQ A;  4CGP A;  1XOV A;  2B58 A;  5AG5 A;  4KOT A;  4L8A A;  1KUY A;  1QSN A;  4B6Z A;  3D7H A;  3TE4 A;  5LYL A;  4OAE A;  5F09 A;  2F5I A;  5J8F A;  1KUX A;  2RC4 A;  4Q7A A;  3KKW A;  4MFL A;  1LOK A;  3KR5 A;  2PVW A;  5D8N A;  4A37 A;  1CM0 A;  2JDD A;  2PE3 A;  4YWY A;  4FD5 A;  2ATR A;  1S60 A;  4JLY A;  1RTQ A;  2D4P A;  4PXE A;  3VAT A;  4UWI A;  2AFO A;  2P6E A;  3CXP A;  4RN7 A;  1Z8X A;  1CPX A;  3FJU A;  2NYQ A;  4JXR A;  3RAM A;  2REF A;  1NSA A;  2ZXV A;  3B3C A;  3W6S A;  4M6I A;  5J1Q A;  3PB4 X;  3CDX A;  2AFW A;  4X8I A;  1QSM A;  3B8G A;  3FF3 A;  2B4B A;  4PXB A;  4AVB A;  4AG9 A;  1Y9W A;  1U6M A;  5DS0 A;  1OBR A;  3S6K A;  3UY5 A;  3WC7 A;  3W6X A;  3ZJ0 A;  2Z11 A;  4UCN A;  2OZU A;  4TNU A;  3D66 A;  2GFQ A;  4KLV A;  3GUX A;  3D2M A;  2Z3N A;  4Y49 B;  1YW6 A;  1TXR A;  1CBX A;  2Q44 A;  2WPW A;  3I9S A;  4RS2 A;  1Y9K A;  1IYL A;  1XJO A;  2RFH A;  3K2K A;  1XE4 A;  4PK3 A;  1R43 A;  3SI1 A;  4NJQ A;  3B35 A;  1K4J A;  1QST A;  4MCP A;  5CNP A;  5H86 A;  1NMT A;  4KUB A;  4M3S A;  4MRI A;  3PFO A;  2B4D B;  3NE8 A;  4MBU A;  3SJX A;  1YVO A;  4LQ6 A;  2R1I A;  4BMH A;  3V8I A;  1XF8 A;  3BLN A;  4IK2 A;  4ONW A;  4OC5 A;  3IGR A;  4NFR A;  2JEW A;  3R95 A;  3TO6 A;  2HC9 A;  3TX8 A;  3IO1 A;  1LCP A;  2EBJ A;  5DWN A;  3FNC A;  4BD9 A;  1FNO A;  1YLE A;  4CAX A;  3DSB A;  4P4E A;  3GKR A;  3P2H A;  2ZEN A;  4W9Y A;  5IX3 A;  4PQA A;  2PJA A;  4HNY B;  2FIA A;  1IOI A;  4Q38 A;  4QBJ A;  2POK A;  4BBH A;  4MFK A;  5F48 A;  1IU8 A;  4P4J A;  4B5P B;  2VI7 A;  8CPA A;  1Q2D A;  1Z9U A;  2DPT A;  3HLP A;  2IL4 A;  3FMC A;  2B3V A;  3CPX A;  2VZY A;  2ZED A;  1QSO A;  2RB7 A;  2Q0Y A;  4KOX A;  4MI4 A;  1NSL A;  5IV0 A;  1PUA A;  1S5K A;  2V8G A;  3DLJ A;  4LX9 A;  3SI2 A;  3R96 A;  1I21 A;  4U9Y A;  1Q2C A;  2PJ6 A;  3KQX A;  2BEI A;  4X5K A;  2VEZ A;  4A95 A;  4II9 A;  3D4U A;  3TT2 A;  4CAE A;  2PJ3 A;  4KSA A;  2JBK A;  4UFV A;  1M4D A;  4PV6 A;  2GLF A;  4JWP A;  2ZEL A;  4FWU A;  3PRT A;  2GAN A;  4B13 A;  3KQZ A;  4UCP A;  3FYN A;  2R7H A;  3QNV A;  4MCS A;  4UIB A;  5J8C A;  4XPL A;  4UEE A;  4A33 A;  1ELM P;  4P44 A;  3WC5 A;  4A32 A;  3WT4 A;  2V8H A;  4KVO E;  1TKJ A;  2K5T A;  2YGW A;  4UA3 A;  1AMP A;  4FD6 A;  1B6B A;  1LRZ A;  1R3N A;  3LWU A;  3H5Z A;  1N71 A;  5DWM A;  4NJR A;  1PCA A;  3PEI A;  4OC2 A;  2VXK A;  4R57 A;  2KCW A;  1RXT A;  2OZH A;  3G3S A;  1ARL A;  2B5G B;  3JVN A;  3R9F A;  3VWE A;  3VWD A;  4MXU A;  2Z3L A;  2ZEG A;  3GY9 A;  5ISV A;  2ZOG A;  4MHY A;  2ZW7 A;  4OID A;  2EK8 A;  4FAI A;  4OC4 A;  1S7K A;  1YX0 A;  2QEC A;  2PJC A;  2PVV A;  1BO4 A;  1YVK A;  5C88 A;  2HB6 A;  4A31 A;  1CPS A;  5KTC A;  4A39 A;  4MHP A;  3VAR A;  2CNT A;  3R9E A;  3I1U A;  2EO8 A;  2PDO A;  4K3N A;  1Y0R A;  2PJ0 A;  2OB0 A;  4NGT A;  1Z8W A;  3FXT A;  2PJB A;  4UIA A;  4H89 A;  3TCV A;  3N5F A;  2CTC A;  3FED A;  3SJF A;  4KLW A;  1V0C A;  3T8W A;  2GU2 A;  3B7I A;  1S3Z A;  2CNM A;  4PPZ A;  4C2Z A;  3GB0 A;  4R9M A;  2Q4Y A;  4E8O A;  1VIX A;  3MRU A;  5A28 A;  1MJB A;  1WK4 A;  4C68 A;  4L89 A;  1YGH A;  4GXH A;  2QVP A;  4HKF A;  4UBR A;  5D29 A;  2VQY A;  2Z3O A;  2H5M A;  2ZEH A;  3G8W A;  1VGY A;  4U9Z A;  1S7N A;  5K8P A;  1JQG A;  1IGB A;  2EWB A;  4OME A;  4XPD C;  2AFM A;  3RBU A;  2BUE A;  2EUI A;  1AYE A;  1ELL P;  2PRQ A;  3CXQ A;  4U5Y A;  5HVH A;  4OC3 A;  1LAM A;  4KZT A;  3I3G A;  2DEA A;  4ZY1 A;  4A2Z A;  3WAB A;  2J8M A;  1DE4 C;  2FT0 A;  4X3R A;  2J8R A;  1M44 A;  1Z5R A;  2HQY A;  2OH1 A;  1Z4E A;  4UCM A;  4A94 A;  3LMS A;  2JBJ A;  5H84 A;  4KSI A;  2EVN A;  4JZ0 A;  1EE3 P;  3TOA A;  5IB0 A;  2PIY A;  3CPA A;  2WYR A;  1I12 A;  3D2P A;  5LRK A;  1M4G A;  3B3T A;  4OLL A;  1S7F A;  5K8M A;  3PFE A;  3SJE A;  5G21 A;  4IF5 A;  2PQ8 A;  4QUS A;  5LRJ A;  4ZY0 A;  2YNC A;  2ZEE A;  3NH8 A;  1Z8T A;  1BOB A;  2ZW4 A;  4CAV A;  4MCQ A;  3RNZ A;  3F5B A;  2DXQ A;  4OC0 A;  1HEE A;  4JXQ A;  1FY7 A;  3IWW A;  4UEF A;  3DR6 A;  3H8F A;  1M4L A;  3MN8 A;  1XEB A;  1OZP A;  3C26 A;  2AJ6 A;  3TO9 A;  1VHE A;  2Z3K A;  2PJ8 A;  4MFJ A;  2XEG A;  1ZG9 A;  4XPD B;  1CX8 A;  2XEF A;  3JTK A;  2C27 A;  4CAW A;  4P4D A;  1YK3 A;  2J9A A;  4EWT A;  1P4N A;  2PSW A;  1B87 A;  1XRY A;  2J8N A;  4UFX A;  3TFY A;  3SXO A;  4P4I A;  5G20 A;  4B12 A;  1WWZ A;  4NGR A;  2WZN A;  4MJ8 A;  1IY7 A;  3S6G A;  4CGO A;  3GLJ A;  4IAV A;  1GHE A;  1YQE A;  5AG6 A;  2NSM A;  3KZW A;  4NGP A;  4AXV A;  4YGO A;  4MFQ A;  5F46 A;  2BO9 A;  3MGD A;  1MJA A;  4R8F A;  4AVC A;  3PBB A;  4B10 A;  2G9D A;  3PB8 X;  2I00 A;  2FXF A;  4GS4 A;  3FH4 A;  2ZEP A;  5EC4 A;  4R3L A;  4OKO A;  4MY3 A;  5LYI A;  4P4F A;  4B11 A;  1CP7 A;  2C6G A;  4WWV A;  1ON0 A;  3BXM A;  1F2P A;  1XFO A;  4M85 A;  1IB1 E;  4A38 A;  5LRG A;  4CYP A;  2ZOF A;  4RUH A;  2GIV A;  2VL1 A;  2PJ9 A;  5C82 A;  1YR0 A;  3CT9 A;  3IU1 A;  2IQ6 A;  1R57 A;  1ZO0 A;  4M6G A;  1XMB A;  3LD2 A;  1MK4 A;  5JM6 A;  2GLJ A;  4NEX A;  4OAD A;  3FIX A;  4NCZ A;  2Z0Z A;  4CRZ B;  2I3C A;  1X10 A;  2ABZ A;  3D3S A;  3JUW A;  2FSR A;  3GIU A;  1I1D A;  1VKC A;  3KL9 A;  4I49 A;  3R9G A;  1JWQ A;  4OIW A;  3KHX A;  5HVF A;  5LYF A;  5ELY A;  4ZY2 A;  1VHS A;  4Q36 A;  2PR1 A;  5F49 A;  1YRE A;  3EY5 A;  4KOS A;  1X12 A;  2DPS A;  4CPA A;  1F2O A;  3DR8 A;  2GE3 A;  3EO4 A;  1DTD A;  2XEI A;  4P4B A;  3S9M A;  4CS0 B;  4CYN A;  3NH5 A;  2BOA A;  2R8V A;  4KS9 A;  2AFX A;  4AVA A;  2G0B A;  5E96 A;  4DUK A;  3IC1 A;  4NGQ A;  4XNH C;  2CY2 A;  4EME A;  1HDU A;  1YME A;  4TWE A;  2C6C A;  3S9N A;  1Y7E A;  4NF1 A;  1ARM A;  3TO7 A;  2REE A;  3IJ3 A;  3PB9 X;  2PJ2 A;  1QMU A;  4HNX B;  4ONU A;  1BPN A;  2PR8 A;  3N7Z A;  3IWE A;  4BIN A;  2VZZ A;  4R3K A;  3QB8 A;  2FCK A;  2ZEM A;  1M1D A;  3T90 A;  4NXY A;  5JQ4 A;  2VBQ A;  3D67 A;  5KTD A;  2ARH A;  2Q43 A;  5HMN A;  1YW4 A;  5AGE A;  2Y0M A;  2C1C A;  4GM5 A;  3B2Y A;  4J3G A;  2IJZ A;  2GRE A;  4KVX A;  5I0C A;  4DJL A;  4OC1 A;  4ZBG A;  4CGL A;  2PJ1 A;  4UEZ A;  1TIQ A;  3HUV A;  2WUU A;  3W91 A;  2PJ4 A;  4ZX9 A;  1P0H A;  1H8L A;  5HXD A;  2V8D A;  3S6H A;  3EC4 A;  4FUU A;  3ZZI A;  5IB9 A;  3FB3 A;  4UF4 A;  3WR7 A;  2ZEF A;  3KAS A;  4MHN A;  2PJ7 A;  5EBV A;  4OP4 A;  2FS5 A;  2YND A;  3S6F A;  3B3V A;  2FVG A;  4F6A A;  2PCU A;  2ZEO A;  5FVJ A;  1J4J A;  1PU9 A;  1Y7R A;  4G1P A;  4KOV A;  4MMO A;  4JD6 A;  4F0X A;  2P6G A;  2OOT A;  3K9T A;  4NGM A;  2OU2 A;  4FD7 A;  2V77 A;  3SHP A;  3WC6 A;  5CPA A;  1LAP A;  3B3S A;  2O4H A;  2QIR A;  1YSJ A;  4IHM A;  4XNH B;  2WSA A;  2Q7S A;  1Q7L A;  2Z10 A;  3OWC A;  2CNS A;  4C2X A;  1CG2 A;  3NH4 A;  4DYO A;  2O53 A;  4X2T A;  2JDC A;  4R7M A;  2JLM A;  1IYK A;  2Q4V A;  1A2Z A;  5A27 A;  2Z3P A;  1AUG A;  2JEV A;  2PC1 A;  2FIW A;  2B5G A;  3CXS A;  3H8G A;  3EXN A;  3KHZ A;  3KI9 A;  3QAH A;  4MY0 A;  4CYO A;  5BWA B;  4PSX A;  4FD4 A;  3GYA A; 
#chains in the Genus database with same CATH homology
 1GYT A;  1YLO A;  3ISX A;  3PB6 X;  3L2N A;  1ZLI A;  4R76 A;  1BLL E;  4P6Y A;  4ZYQ A;  1Y0Y A;  4YU9 A;  3PB7 X;  2QYV A;  2AFS A;  4NGS A;  2Q51 A;  3ISZ A;  3S9L A;  1LAN A;  3IFE A;  4WJB A;  3BI0 A;  3RZA A;  5JGF A;  5LYD A;  2ANP A;  5CBM A;  3IIB A;  4MCR A;  4FBE A;  1LFW A;  3TC8 A;  2OR4 A;  2QJ8 A;  1ZLH A;  3KGQ A;  2AFU A;  1BPM A;  4NGN A;  1QQ9 A;  4F8Z A;  2XEJ A;  1BAV A;  2PJ5 A;  3SJG A;  4Z65 A;  1TKF A;  3FVL A;  5I4M A;  1XBU A;  2PIZ A;  4JYW A;  1ZG7 A;  3KR4 A;  4PXC A;  1KWM A;  1TF8 A;  1Z8L A;  4F9U A;  4ZI6 A;  3NA6 A;  3JRU A;  4PXD A;  3D7G A;  4P10 A;  3BI1 A;  1ZG8 A;  1TKH A;  5JH9 A;  4ZX8 A;  7CPA A;  6CPA A;  1TF9 A;  2CF4 A;  3FEC A;  2AFZ A;  3FX6 A;  2CIJ A;  3V38 A;  4A94 A;  2CTB A;  3NFZ A;  4F9V A;  4H2K A;  3H8E A;  3DGV A;  3PBE A;  3FEE A;  2EK9 A;  1Z2L A;  4EFD A;  2C6P A;  4MHZ A;  4P45 A;  3D7F A;  3BHX A;  1CP6 A;  2Q4Z A;  1PYT B;  4R6T A;  5THW A;  5K8N A;  4O23 A;  1UWY A;  5HVG A;  4LQG A;  1VHO A;  2V8V A;  3B3W A;  3D68 A;  3V7Z A;  3VH9 A;  2IMO A;  3SI0 A;  1FT7 A;  2F8H A;  5K8O A;  3D7D A;  2BCO A;  2F7V A;  3IEH A;  1F57 A;  1HDQ A;  4B6Z A;  3D7H A;  5LYL A;  5F09 A;  4Q7A A;  5D8N A;  1LOK A;  3KR5 A;  2PVW A;  4A37 A;  2PE3 A;  4YWY A;  1RTQ A;  4PXE A;  3VAT A;  2AFO A;  1CPX A;  3FJU A;  2NYQ A;  3RAM A;  1NSA A;  3B3C A;  5J1Q A;  3PB4 X;  3CDX A;  2AFW A;  4X8I A;  3FF3 A;  4PXB A;  5DS0 A;  1OBR A;  3WC7 A;  4TNU A;  3D66 A;  3GUX A;  1YW6 A;  1TXR A;  1CBX A;  1XJO A;  2RFH A;  3K2K A;  3SI1 A;  1R43 A;  4NJQ A;  3B35 A;  4MCP A;  4MRI A;  3PFO A;  3SJX A;  4IK2 A;  4ONW A;  4OC5 A;  4NFR A;  2JEW A;  2HC9 A;  3TX8 A;  3IO1 A;  1LCP A;  4BD9 A;  1FNO A;  4P4E A;  4W9Y A;  2ZEN A;  4PQA A;  2PJA A;  2POK A;  8CPA A;  4P4J A;  3HLP A;  3FMC A;  3CPX A;  2ZED A;  2RB7 A;  2V8G A;  3DLJ A;  3SI2 A;  2PJ6 A;  3KQX A;  3D4U A;  2PJ3 A;  2JBK A;  2GLF A;  2ZEL A;  4FWU A;  3PRT A;  3KQZ A;  3QNV A;  4MCS A;  4UIB A;  4UEE A;  1ELM P;  4P44 A;  3WC5 A;  3WT4 A;  2V8H A;  1TKJ A;  1AMP A;  1R3N A;  3LWU A;  4NJR A;  1PCA A;  3PEI A;  4OC2 A;  1ARL A;  4MXU A;  2ZEG A;  2ZOG A;  4MHY A;  4OID A;  2EK8 A;  4FAI A;  4OC4 A;  2PJC A;  2PVV A;  2HB6 A;  1CPS A;  4MHP A;  3VAR A;  3I1U A;  4K3N A;  1Y0R A;  2PJ0 A;  4NGT A;  2PJB A;  4UIA A;  3N5F A;  2CTC A;  3FED A;  3SJF A;  3T8W A;  2GU2 A;  3B7I A;  4PPZ A;  3GB0 A;  1VIX A;  3MRU A;  2QVP A;  5D29 A;  2ZEH A;  1VGY A;  5K8P A;  1JQG A;  1IGB A;  2EWB A;  4OME A;  2AFM A;  3RBU A;  1AYE A;  1ELL P;  2PRQ A;  5HVH A;  4OC3 A;  1LAM A;  2DEA A;  4ZY1 A;  3WAB A;  1DE4 C;  4X3R A;  1Z5R A;  3LMS A;  2JBJ A;  4KSI A;  4JZ0 A;  1EE3 P;  2PIY A;  3CPA A;  2WYR A;  5LRK A;  3B3T A;  5K8M A;  3PFE A;  3SJE A;  5LRJ A;  4ZY0 A;  2ZEE A;  3NH8 A;  4MCQ A;  4OC0 A;  1HEE A;  3IWW A;  4UEF A;  3H8F A;  1M4L A;  3MN8 A;  1VHE A;  2PJ8 A;  2XEG A;  1ZG9 A;  1CX8 A;  2XEF A;  4P4D A;  2J9A A;  4EWT A;  1XRY A;  4P4I A;  4NGR A;  2WZN A;  1IY7 A;  3GLJ A;  4IAV A;  2NSM A;  3KZW A;  4NGP A;  4AXV A;  2BO9 A;  4R8F A;  3PBB A;  2G9D A;  3PB8 X;  3FH4 A;  2ZEP A;  4OKO A;  5LYI A;  4P4F A;  1CP7 A;  2C6G A;  4WWV A;  3BXM A;  1F2P A;  1XFO A;  4RUH A;  4A38 A;  5LRG A;  2ZOF A;  2VL1 A;  2PJ9 A;  3CT9 A;  2IQ6 A;  1XMB A;  5JM6 A;  2GLJ A;  2I3C A;  2ABZ A;  3KL9 A;  4OIW A;  3KHX A;  5HVF A;  5LYF A;  5ELY A;  4ZY2 A;  4CPA A;  1F2O A;  3S9M A;  1DTD A;  2XEI A;  4P4B A;  3NH5 A;  2BOA A;  2AFX A;  4DUK A;  3IC1 A;  4NGQ A;  4EME A;  3S9N A;  1HDU A;  1YME A;  4TWE A;  2C6C A;  1Y7E A;  1ARM A;  3IJ3 A;  3PB9 X;  2PJ2 A;  1QMU A;  1BPN A;  2ZEM A;  3D67 A;  2Q43 A;  1YW4 A;  4GM5 A;  2C1C A;  3B2Y A;  2IJZ A;  2GRE A;  4DJL A;  4OC1 A;  2PJ1 A;  4UEZ A;  3HUV A;  2PJ4 A;  4ZX9 A;  5HXD A;  1H8L A;  2V8D A;  5IB9 A;  4FUU A;  4UF4 A;  2ZEF A;  3KAS A;  4MHN A;  2PJ7 A;  4OP4 A;  3B3V A;  2FVG A;  2PCU A;  2ZEO A;  4G1P A;  4MMO A;  2OOT A;  3K9T A;  4NGM A;  2V77 A;  3WC6 A;  5CPA A;  1LAP A;  3B3S A;  2O4H A;  4IHM A;  1YSJ A;  1Q7L A;  1CG2 A;  3NH4 A;  4DYO A;  2O53 A;  4X2T A;  4R7M A;  3KHZ A;  3H8G A;  3KI9 A;  4A39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...