3LWUA

Crystal structure of putative succinylglutamate desuccinylase/aspartoacylase (yp_749235.1) from shewanella frigidimarina ncimb 400 at 2.10 a resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
372
structure length
372
Chain Sequence
MTKAIQSSVQVGELATGQALTVPIYSFMGSENSAPSVYIQANVHGAEVQGNAVIYQLMTLLEGYQVLGDITLAPLANPLGINQKSGEFTLGRFDPITGVNWNREYFDHNVDIQNWYAEHQHLTNSELFCAYRSMLVETCQARLTHSFGISTGHRLAVNLQAMAHQADIVLDLHTGPKSCKHLYCPEYDIDAARFFSIPYTLIIPNSFGGAMDEATFCPWWQLTEYATSQGREFSVPVSAFTLELASQERIDLADALEDAKGILAYLSHRGVIAEKVNPASMERFGCYLKDYKKFHAPKAGLIEYCASVGEPLTAGKPLVNILRIDLYGSEQAYQAISLPMDCVPILHFASASVLQGTELYKVMTNVFPLQPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative succinylglutamate desuccinylase/aspartoacylase (YP_749235.1) from Shewanella frigidimarina NCIMB 400 at 2.10 A resolution
rcsb
source organism Shewanella frigidimarina
molecule tags Hydrolase
molecule keywords Succinylglutamate desuccinylase/aspartoacylase
total genus 113
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3lwuA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3lwuA01
1Z7TA 1BAVA 1SMYC 1LOKA 2JBKA 4ONWA 3NH4A 1CI3M 2PE3A 4UIAA 2NSMA 5KNBA 4TWEA 4OO1G 6CPAA 2RB7A 4H2KA 4MHNA 4F9UA 4TNUA 1BPMA 3B2YA 4JZ0A 4GM5A 1YNNC 1Q1BA 3DXJC 3H8FA 3WT4A 1F57A 2EWBA 4MCQA 4DK0A 2I3CA 5K8NA 4UIBA 2EK8A 4IAVA 4KI0A 1IW7C 1TKFA 2NYQA 4P44A 4NGMA 5HXDA 5LRJA 3SJXA 2ZEEA 5K36G 3A8JE 3PBEA 1AYEA 1ELLP 4NJQA 3RBUA 2POKA 1RTQA 1ARMA 5K8PA 1LAPA 4K3NA 1TF9A 4H13C 3U9SA 1B9MA 3NFZA 3PFEA 5DS0A 2PPBC 1LANA 4PQAA 3SJGA 1AMPA 3FF3A 1YW4A 4P4BA 1CBXA 1HEEA 1DE4C 1Y8PB 4MCPA 5C0XH 4P45A 2LMCB 3OPOA 1GJXA 3PUYA 1CPSA 3N6RA 1BDOA 4OIDA 4KMUC 1GYTA 2ZEMA 3NH5A 2ZEPA 4R76A 2B8GA 3I1UA 4OP4A 4KKSA 2JBJA 1YSJA 2O53A 4KKTA 3VR3A 1LCPA 2PJ9A 2PJ8A 1OXVA 2PJBA 3D4UA 4OGQC 1Z6HA 3HGBA 3PUWA 3IO1A 1ZLIA 3V7ZA 2QF7A 4OIWA 1VIXA 1DXMA 4IK2A 2A6ED 4G7HC 3VR2A 1YLOA 4GZYC 4PXBA 2BDOA 2DNCA 1B9NA 2PCFB 4BD9A 3JRUA 3RLFA 4LJZC 1BPNA 2EVBA 5K8OA 1VCIA 3QIAA 2ZOFA 4DUKA 2AFXA 3MRUA 4FUUA 5KNCA 4TQUS 2A6HD 3NH8A 4EFDA 2AFUA 1CTMA 4YU9A 2AFMA 1OXSC 2HB6A 2EK9A 1K8MA 2HC9A 3IEHA 1HCZA 2PNRC 4DNTB 2JEAI 2A68D 1EWHA 1DTDA 1H9KA 1OXXK 1TKJA 2BOAA 5HVHA 1Y0RA 1CPXA 3SI0A 5LYFA 5HVFA 1F2PA 3WC5A 2AWOA 3VR6A 1FT7A 1ARLA 3PB6X 2JEWA 3NA6A 3D4RA 4Q7AA 3GQBA 3L2NA 3M85A 5JEAG 2Q51A 1CG2A 4X2TA 4ZYQA 1CX8A 4LK1C 2C6CA 4LQGA 3IFTA 1HTPA 2F1MA 1PMRA 1TF8A 1QMUA 2V8DA 1I6VC 1DCZA 3B3VA 2EJFC 2PIYA 4BA1I 1PYTB 2XEJA 2ZOGA 5LRGA 5IB9A 4P4DA 1GUOA 3BI1A 4W9YA 5HVGA 4UEFA 1JQGA 1YMEA 4PXEA 2O5IC 4X8IA 3I72A 1XBUA 3D7HA 4UF4A 1M4LA 5JGFA 4UEEA 3OOCA 3FJUA 1YW6A 2O4HA 1GHKA 1TKWB 3QNVA 2AFWA 4ZX8A 3BDOA 2VL1A 3SI2A 5K8MA 4NGRA 1CP6A 3S9LA 4CPAA 1XMBA 1H8LA 1QJOA 4OC2A 3SE0A 3D66A 5BN3A 1FR3A 2IQ6A 1R3NA 4O23A 2AUKA 3VR5A 5BN5A 1H9JA 3PB9X 3KASA 2B8FA 4G7OC 4HR7B 2A69C 3NE5B 4NFRA 2XEIA 2ABZA 5LRKA 1H9MA 2R6GA 4G7ZC 2PIZA 4WWVA 4JBWA 4P4IA 4PXDA 4P4FA 1Q90A 2BE5D 4IHMA 4KKUA 3IJ3A 1A6XA 2V77A 2PJCA 3VH9A 2EJGC 1H9SA 4NGQA 3PB8X 3K9TA 1IW7D 3CPAA 2D2CC 3T56B 2QVPA 4AXVA 2E75C 4YWYA 3KL9A 1QQ9A 3MXUA 4MHPA 4RUHA 5D29A 3PB4X 1LFWA 2F7VA 2DNEA 1KWMA 2Q43A 2Q8IB 4NGNA 8CPAA 1VDZA 2XEGA 3V38A 2IT1A 3QG1A 3B3CA 3QJYA 4BA2I 3D68A 3A8IE 2GLFA 4DK1A 3N5FA 3SI1A 3PUXA 1LABA 3B3SA 3GB0A 4F8ZA 3KZWA 4JYWA 2FVGA 3BG3A 5BN4A 3VA7A 1F2OA 4PXCA 4JK1C 2OOTA 3PEIA 3B3WA 1Q7LA 3PRTA 2KA7A 2AFOA 2PJ4A 3FVLA 2XEFA 3KR5A 2YYZA 3M4YA 1XRYA 1ELMP 1IY7A 2PJ2A 4UEZA 4XTCS 1IYUA 3IWWA 2NN6G 4MRIA 1T5EA 2K7VA 3BHXA 5F09A 3A7AB 3CPXA 1Z2LA 1UWYA 3KQZA 3D67A 1HPCA 4DNRB 1V43A 2AFSA 2ZEGA 2NN6I 2A6EC 5JH9A 1Q12A 1E2VA 2ZENA 1LAMA 4KN4C 2A69D 2PVWA 2L5TA 3KR4A 3CRKC 3DGVA 1HDUA 2ZEHA 2V8GA 4KN7C 3IKJA 4R7MA 3FMCA 5KNDA 5D8NA 4I7ZC 2IJZA 3BI0A 3WC6A 3S9NA 4L8JA 1TKHA 2BE5C 1XJOA 4R8FA 1CP7A 1ZYRC 4NGSA 2A6HC 3MFYA 4R6TA 1K8OA 2F8HA 5CBMA 3DLJA 4IFDH 3FX6A 2PRQA 3B35A 5K36H 3PBBA 3D31A 5A35A 2G9DA 3H94A 1OBRA 1Y0YA 3D7GA 1VHOA 2CIJA 2ZEFA 3WC7A 5ELYA 1Y7EA 2GU2A 3W3AA 4IQZA 4OC5A 3P20A 3FEEA 2ZEDA 2PJAA 3LMSA 1ONLA 1OXTA 1V8QA 4IFDG 3WDNA 2C1CA 3GLJA 4OC1A 4ZI6A 4RCNA 3VR4A 2CTCA 3CDXA 3A7LA 3I4LA 2V8HA 3T51B 2D5DA 2PJ0A 4MMOA 2DEAA 4P10A 4B6ZA 2JEBI 1Y69U 1H9RA 3ND8A 3HUVA 4MHYA 3PFOA 4NGTA 2PJ3A 4ZY2A 2KCCA 2ZT9C 2V4DA 2PJ5A 4DJLA 3FEDA 1EE3P 3ISZA 3MN8A 4KHZA 4H44C 5LYIA 3SJFA 3IFEA 3TX8A 1Y8OB 1IYVA 1XFOA 4P4EA 1R43A 3VATA 1VGYA 4X3RA 5CPAA 2ZELA 4MXUA 3IC1A 3LWUA 4ZY0A 3A8KE 4ZX9A 1ZKOA 4Z65A 3D7DA 4EMEA 3K2KA 1ZG8A 1HDQA 3T8WA 2O5JC 1LACA 2WYRA 5J1QA 1BLLE 1VF5C 3VARA 2GREA 4NGPA 2QYVA 4A38A 3B3TA 4FAIA 2DN8A 7CPAA 2JE6I 2BA0A 2PCUA 3S9MA 5I4MA 4P6YA 4H0LC 2PJ7A 4OC0A 1FNOA 1GUTA 1H9SB 4MCSA 1HQMC 3EQLC 3RZAA 2BO9A 2AFZA 2WZNA 5C0XG 4A94A 1GHJA 1O7LA 2V8VA 2PJ6A 2IMOA 5LYLA 2EDGA 3OW7A 2EJMA 3L7ZC 4P4JA 4ZY1A 1GUSA 2A68C 3IIBA 4EWTA 3B7IA 1VF7A 1GUGA 3LNNA 3KHZA 5LYDA 2CW0C 2PVVA 3FECA 1GUNA 2C6GA 1Z5RA 1ZLHA 1DD2A 3KHXA 1CFMA 1G291 3ND9A 4OKOA 2CTBA 3AB9A 2Q4ZA 2AUJD 1TXRA 4OO1H 1IGBA 3KGQA 3H8GA 3KQXA 4G1PA 4FBEA 3D7FA 1NSAA 4OMEA 3SJEA 4FWUA 1O78A 3KLRA 3SDZA 1Y8NB 3I73A 4MHZA 5JM6A 4WJBA 2CF4A 3TZUA 2ZEOA 3RAMA 1FYCA 4PPZA 1YNJC 3GUXA 4XIGS 3KI9A 3PUZA 4A37A 2K32A 1ZG7A 2J9AA 1E2WA 3FPPA 4OC4A 2BCOA 2D62A 3WABA 5JEAH 1PCAA 2BA1A 4DYOA 3M7NA 1Q1EA 4OC3A 4TKOB 4A39A 2RFHA 3ISXA 3H8EA 3TC8A 1TU2B 1E2ZA 2K33A 2C6PA 3GD7A 2GLJA 3PB7X 3PV0A 2ANPA 3HLPA 2QJ8A 5THWA 1ZG9A 3CT9A 2JXMB 4F9VA 1Z8LA 2E76C 4PV1C 1OXUA 4MCRA 3T53B 2PJ1A 3BXMA 3PUVA 4KSIA 3FH4A 4NJRA 3CRLC 2OR4A 1VHEA 2NN6H 2E74C
chains in the Genus database with same CATH superfamily
1BBWA 1Z7TA 1DOLA 1SMYC 4CDEC 3IL8A 5C44B 2XRSD 5E4WC 2C27A 5D14A 2NZ1D 4KOVA 3RO0A 1O7ZA 4OO1G 1DZ1A 2RB7A 5JOBA 4I65A 4BBSB 4JZ0A 4GM5A 4MI4A 2IL8A 1RHPA 1YNNC 1X56A 4IUSA 3DXJC 4JWPA 4IZ8A 1O80A 4YWKA 1F57A 4V190 1XMQL 1RO5A 1F2YA 4LNQA 1VQEA 1TKFA 5IB0A 4IFDJ 2NYQA 1TWGB 1S60A 1WFQA 3GV3A 5LRJA 1A63A 2P0WA 3SJXA 2GVAA 4L5SA 2ZEEA 2SEBD 3PBEA 4NJQA 1VQBA 1B1ZA 2ZJRA 1RTQA 2GIVA 5K8PA 3S1RH 4HPSA 1HNZQ 3UE0A 1TF9A 4H13C 3U9SA 2L15A 2BOSA 3RNZA 3NE7A 4L5RC 5AG4A 3D0FA 1EYAA 2FIWA 1X65A 1Q81C 1YW4A 2CXAA 2G0BA 1HEEA 4B3SL 2UXBQ 4MCPA 1B4OA 1IIDA 3OPOA 2VZYA 3K6OA 1GJXA 5L37A 3H91A 3PUYA 1B53A 3S6GA 2LSSA 4RG1A 5G1ZA 1Y7RA 4OIDA 1PFSA 3DR8A 4R76A 4GKKQ 3WR7A 2B8GA 2NYZD 3HKZB 1PTOH 4IPDA 4CAXA 4JI7L 4LF6L 2B2TA 4KKTA 1D1KA 1SAPA 2P6EA 2FHTA 1QILA 2B63H 4DUYQ 3S14B 2Q4VA 4BMHA 5M3MG 4OGQC 1PYSB 1HFGA 3M3YB 1Z6HA 3HGBA 1MJ9A 5KTCA 2IX1A 3G8WA 4A3GB 2JSOA 1DXMA 2PC1A 5C5MA 3VR2A 1TS3A 4PXBA 2DNCA 3S1QB 1B9NA 4BBSH 2PCFB 4BD9A 3RYOA 1DYQA 3JRUA 3K7UC 4QIWE 4NXMQ 3I4NB 3RLFA 1PVOA 2N8NA 1BPNA 1K3BC 1NY4A 4HEDA 3DR6A 2MJ8A 1EQRA 2KEEA 1YHAA 3TOAA 1BBUA 5BR8L 5JJLA 2IX3A 2QEJC 5M5YH 3K5OA 2WACA 2IHEA 1VMCA 2PR8A 4DV1L 5LMNL 1TS4A 2F0PA 4FD7A 1Q7YC 5EBDA 1KZFA 4DNTB 2F0HA 2EYMA 4ME3A 4NXNL 1QVGA 2CWPA 4NCZA 2JEAI 2A68D 1EWHA 4C56C 1SYEA 1OXXK 3D6WA 4OXPA 3AMUA 3K7AB 3V2TA 1N36Q 5AG7A 5LYFA 2HDMA 1R9TH 4A76A 1ARLA 1Q82C 4HJAA 3D4RA 5DEHA 1TT2A 3GQBA 3L2NA 1A62A 3T16A 5CBAE 2G5DA 5JEAG 1EYGA 3N52A 1I50H 1CG2A 1R57A 4QBJA 2NVQB 4X2TA 1EL0A 5GCNA 1HUNA 3DDDA 5GAHC 4OIKA 3ERQA 4IPHA 4KLWA 1HTPA 4FP5D 4UA3A 3DLLA 1I6VC 4GS3A 4FF1A 5ELCA 2ZOGA 2NBFA 5LRGA 2D4OA 1NTGA 1C48A 4HJ8A 1EUJA 4LFCL 1JJ2A 5IOCA 1UE1A 1RIPA 2D0PA 4KOYA 4W9YA 1U6MA 5FLXE 2E2HB 4PXEA 4X8IA 4X5KA 3I72A 3CHBD 5ELEA 1XBUA 4A3IH 3D7HA 4UF4A 4FXGC 3S6FA 4UEEA 3FJUA 4K6DA 4MHEA 1M90C 4B3MQ 3QNVA 3R9GA 3J80L 4XPDB 2DGYA 4IUQA 3I90A 1QZGA 1BF4A 3UY5A 5K8MA 5M3MH 1PTOC 1I21A 1U4LA 2N49A 5EGTA 3NSWA 3S16B 1H8LA 4A3FG 5G3LD 2EY6A 5C4JH 4B3RL 2XTIA 3KJPA 4WORA 5BN3A 4YCVA 1W6KA 1ENCA 1S5ED 4EGVA 2EIFA 2IQ6A 1QWYA 2PW7A 5BR8Q 5KIXA 4K2KA 3NQIA 3BZKA 4IF5A 4IURA 4JI7Q 4LF6Q 2SNMA 5JPNC 2LXJA 4XT1B 3TP5A 3WWVA 1V1PA 2VZAA 4C2ZA 3KASA 1AEXA 1PU9A 4HR7B 5CV9A 1R9TB 2XEIA 1H9MA 4A3KB 3VYUA 1S5DD 1CK1A 1I3QB 2B4DB 4LF4L 4GKJQ 5E3FA 4J15A 2L0CA 3S2DH 3GTPH 4GOPC 4JBWA 4JBJA 3RD4A 4A31A 4R4IA 1SMYD 1VQPA 4P4FA 2HHHQ 2XN9C 5C3EG 4IHMA 2HCCA 4FF2A 2BDNA 2Z6BA 1ZYRD 1A6XA 3A9LA 1PH5A 1H9SA 4LF7L 3PB8X 1IW7D 2UU9L 3T56B 4C1NI 2PZTA 3H3VI 1IKMA 1VQOA 2K6AA 3ZYYX 2HD3A 1HNWQ 2F7VA 2R93B 1KDAA 2Q8IB 2B2YA 2JLMA 2IT1A 2CNMA 4DR3Q 2UXDQ 4MY3A 1XWEA 3A8IE 3D8PA 3IU2A 5C3EH 1PFMA 4ME5A 1BBXC 1QSTA 2Q7SA 4AVBA 4KY6A 4I7AA 4DK1A 5ISVA 5DLQE 1A2ZA 3B3SA 3LACA 2PNHA 3S24A 1ESRA 1B70B 1TWFH 2KEDA 5FLMG 3I7FA 2P6GA 4F8ZA 4NB3A 1SYCA 4JXRA 5IV0A 2FVGA 3BG3A 1F2OA 4JK1C 4BBRG 4FDBA 3PEIA 2A1AA 2OCEA 1CKNA 3B3WA 3PRTA 4L63B 5IYDH 3H3VH 3FVLA 5I4DA 1S3ZA 3M4YA 5I9OA 3MC0B 2PJ2A 4UCPA 3IWWA 4MRIA 5M3FB 2B39A 4DNCA 3BHXA 4TVAB 3Q24A 1Z2LA 1TWAH 4CKCA 4A3KH 4O2DA 1BXTA 4JC0A 1HPCA 3HOVG 2QIRA 2KHIA 3CXQA 1PV4A 2A6EC 2EYLA 2I5LX 1IYJB 1PRTF 1E2VA 4DV2L 4XPDC 4RKBA 3J81E 1DGSA 2B2WA 5COYA 4DAYB 1SE3A 1HDUA 2P6FA 2ZEHA 4OADA 2L1BA 1A2TA 5EQ0A 2FSRA 4NW2A 4IOCA 1S72A 1W6JA 1GVPA 3M7GA 4I7ZC 5D8NA 2MPMA 5EPLA 4R8FA 2I5MX 3K57A 2Y0SB 4RWSC 2A6HC 2DJGC 4EVOA 3F5BA 1CZGA 4UFXA 5C4XH 1MGSA 3FX6A 4F87A 2BUEA 1C0AA 2HUZA 2K28A 2G9DA 3H94A 1OBRA 5CR3A 2JA9A 1Y0YA 1MJBA 2JA7G 4IFDI 3WC7A 3CCJA 2GU2A 1D1IA 4JI1L 2F5IA 3MHBA 1PXUA 4IQZA 4PQXA 2F03A 1TWFB 3I4NH 2PJAA 5IGEA 1ONLA 4HMJA 2Q04A 2FCKA 1OTCA 1P0HA 3GLJA 5FVJA 2CNSA 1SJED 2JYOA 5CGKA 2V8HA 3I4OA 3OIQA 3OW2A 2F4VQ 2YTXA 2NVTH 4R8NA 3O13A 4C2XA 1Y69U 2JA8B 1IKLA 3PFOA 1AZPA 3I4MB 2KCCA 3P75A 4LF8L 1GUWA 1XE4A 5BWAB 3D4DA 4X66L 1IBLL 5FOBB 3S6KA 1EE3P 1DOKA 3BS1A 4HNWB 4KHZA 3S1MB 2L12A 3C3LA 1IYVA 1R43A 5FLMH 3NTKA 5TSSA 3S1NB 1D7QA 4Y7NB 4X3RA 4GOPB 3HOZB 2ZELA 4FF3A 3A8KE 1JR0D 3AFPA 2X7BA 3S9WA 1MHWC 4Z65A 4A30A 2RDGA 1QOHA 4U9ZA 4EMEA 1YNXA 4K8IA 2KENA 3M4PA 2Z4HA 1WJJA 4CGYB 3VARA 1GOZA 1A3TA 1G6PA 1VKCA 2GREA 2QYVA 2YNCC 4NGPA 4A38A 5FJ8G 4N8FA 4DN4M 3IGRA 3UDXA 4FAIA 7CPAA 3RUZA 5IP7G 3BVMA 5I0CA 4MTKA 4BBRB 2Q2TA 4X6AH 1JOOA 4R9MA 1JICA 4KV6A 2A5HA 3KLSA 4C3IH 4B9XA 1JT8A 5IODA 3M9BA 1YITA 1Y1VB 3A55A 1CM0A 2WV6D 3QOLA 2DPTA 5I6YA 4M8AA 2AQ2B 2E2JH 2AFZA 2WZNA 4A94A 2QECA 4ONUA 1A2UA 1TR5A 5GROA 2BH2A 3CCSA 2KVMA 4RHRA 1YX0A 2EDGA 2KUMA 1UEAB 3OW7A 4KHPQ 2A68C 1C9OA 1PFNA 2F0FA 3HP3A 1WTPA 4EVYA 1LT5D 4Y52H 4A3DB 3RNUA 3PGPA 1EY0A 2CW0C 3F8TA 2PVVA 1FNWA 1PZID 4H02A 3FYNA 1PRTD 1STGA 1YREA 1STYA 2WPXA 5CBEE 5JAVA 2B5GA 3R1KA 3TEHB 3KHXA 4HTHA 4N9TA 1FY7A 2F0EA 3NBIA 1ICWA 3PCOB 3QOJA 5AJ3L 1Y1WG 1SE4A 1NE9A 1XMTA 4Y7NH 1G2SA 1RODA 1KXLA 1IGBA 3E9IA 4K6LA 1SYDA 5IWAL 1TIID 2NZOA 5M9OA 1F9SA 1O78A 3SDZA 3I73A 4JXQA 1PZKD 1D8LA 5FLXc 4HKFA 4UCNA 4WJBA 4LF8Q 1SNOA 4Z9CB 5EJWA 2HIXA 2EYJA 2RBMA 1AP0A 4XIGS 2B4BA 1JC7A 2JN4A 1LTID 4QL5A 1CM9A 5IY0A 3RLOA 1JWSD 1QUQB 5C6AA 2F4VL 1L0YB 4OC4A 3FB3A 2BCOA 2Z9HA 2HCIA 1QB5D 4DYOA 4BY1H 3URYA 1QVCA 3SK4A 3S1QH 2REFA 4TSSA 3E3XA 2F0SA 2RFHA 4UY8C 3OWCA 4A3JH 2XSCA 1IB1E 4P71A 1KC8C 1HNXL 4DK6C 1MSHA 5IP7H 1FJGQ 2Z0SA 1B3AA 5C4XG 5C3XA 2GLJA 3JUWA 3PB7X 3PV0A 1Q2YA 3R9EA 4X65Q 5FJ8H 1I6HB 1O7IA 4DV6L 1LRZA 2AQ1B 2JXMB 1ZG9A 2QJ8A 3CT9A 5THWA 2Z8LA 4CRYB 1S7LA 4KLVA 3W5OA 3NPPA 3NTIA 1BCPF 3JAMc 3FVQA 1CA5A 2JEVA 2OZUA 3T53B 4MCRA 4QC6A 2XIWA 1NR2A 1JWUD 2JK8A 1XOVA 5EAYA 1F77A 4LF7Q 3P1HA 2ZJPA 2E74C 2K75A 2CW0D 1QSRA 2EYPA 1CT1D 3T1YL 3MXNB 4CAVA 1YI2A 1YBYA 1T9HA 5LMNW 3NBHA 4BY7B 3IFDA 1PH9A 4GOPA 1CKOA 1X54A 4TWEA 6CPAA 4F9UA 1VQCA 4RCOA 4QB9A 4TNUA 2R98A 1NE3A 2K4KA 3B2YA 4U673 4HN7A 1EEID 1VQAA 3OIPA 2R93G 1WCMH 1I50B 4R57A 2VUMG 4AQYQ 3WT4A 2GANA 1VS0A 4NXYA 3SR1A 4YHHQ 2FL4A 2IL4A 4CKBA 4DR1L 2UXDL 2CFMA 2PQ8A 3P2FA 4JJXA 3K0XA 4BXXH 5K36G 2G3AA 3N7ZA 4HAEA 3A8JE 1IICA 1YNJD 1AYEA 4ALPA 3AQQA 2EY2A 1N9WA 1SNDA 3PO3H 1W2BA 2K04A 4QJFA 4DF7A 3DWAA 3J81c 3CCRA 3C2PA 5DS0A 1NUCA 1TWCH 2PPBC 2EYFA 3PIPA 4IO9A 1X9NA 3NXWA 2LY7A 4P75A 1A3UA 1Y8PB 1IZ6A 2LMCB 1A8VA 1BO4A 4YRHA 1CPSA 4BS9A 2B3VA 2JP1A 1RXTA 3I4MH 1CSQA 1QSMA 4C3IG 5H1SE 4DR6Q 3I1UA 1YEZA 4OP4A 5AG6A 5D3IB 2VZZA 3KDFB 1SNPA 2O53A 1X12A 3W1BA 3EFXD 4U5YA 3GTLB 2PJ9A 3BVGA 5GAEC 2PJBA 2WFWA 3LODA 4DR2Q 1HQRD 4QMGA 3PUWA 3PMFA 3M4QA 1ZLIA 2RHSB 3V7ZA 4HMIA 4IK2A 4CAEA 4G7HC 2TMPA 2BDOA 1B7YB 2ALYB 2XWBB 4GN3B 3FBUA 2G9HD 4MN3A 3P7JA 3S1NH 1DONA 5HGQA 4R3LA 1SROA 4QY7A 2I46A 3NP8A 5KRUA 5NUCA 2Z6KC 3QIAA 2ZOFA 1YVCA 3IRBA 1KAWA 2AFXA 4ZBGA 1VQLA 3MAQA 1HR0Q 3S14H 3MRUA 2G3TA 5ELOA 2NZHA 4DA2A 1I94Q 4BBRH 4X66Q 2I79A 2FFKB 2HUGA 1MBYA 4R87A 1CTMA 4BINA 1QVFA 2MFIA 3EO4A 2AKWB 2M2LA 1OXSC 2V1CC 2R93H 2EK9A 4NSQA 1K8MA 1I4XA 2EPBA 3IEHA 1S7KA 2A19A 2PSWA 1WD1A 2OWOA 4X62L 1TWHB 4DGZA 1A15A 1H9KA 4R1JA 4AQYL 4QUSA 5A2QL 2ZTCA 1VQJA 1CPXA 1F2PA 2I07B 4L5TA 2WINB 4YY3L 3PB6X 2JEWA 3NA6A 4L89A 5EC4A 4C3HH 2E2JB 5F47A 3GTMB 4LF4Q 5E1FA 4GKJL 1UAPA 2Z3KA 4EQOA 4MHDA 3GTKH 4A93B 4JI4Q 1O7YA 3GV6A 1B50A 3HOYB 4ZYQA 1CX8A 2J8MA 4XYOA 3KFUA 4WRDA 3SK5A 2F1MA 1PMRA 2EY5A 2H1EA 1QMUA 2WAQB 4O1NA 1DCZA 3H0GG 2EJFC 2XEJA 3B3VA 1PYTB 4RGMA 4A4IA 2D4PA 3ERSX 1EIFA 2PMZB 4B3RQ 1BVSA 3LD2A 2LS01 1M4LA 1HZ9A 1YW6A 1BCPD 4KY7A 2LKVA 3E9HA 2VQEQ 4ZX8A 1I12A 2DXQA 4K14A 1ZEQX 4K5XA 4IALA 1IBML 2VXWA 4PMBA 4DAVA 3PF5A 5EBVA 1TIQA 1Y1VG 1IBKQ 5T1GA 4IJHA 4OC2A 4EX5A 2F0DA 2WSAA 3SE0A 1B6BA 3FXTA 3NQTA 4KD4A 1EZ6A 3D66A 5I2YA 2IY5B 2F0IA 5CV8A 1KAAA 2Z3OA 1R3NA 2J0TD 3GTJH 1M44A 2WKCA 4MBUA 3X3NA 1II3A 1J9OA 1VQ9A 2X6GA 2ASBA 3KJOA 3GTQH 3U4ZA 3S2HH 2MO1A 1ZO0A 4G7OC 2A69C 3NE5B 3BJ8A 1JB3A 4B3SQ 1VQKA 2UXBL 1S4ZA 3EFAA 4X65L 2UUBQ 3F1ZA 4G7ZC 4WWVA 4A3JB 1PH8A 3E6ZX 4CYNA 3WOFA 3CCVA 1XNRL 5C44G 4KOTA 4P4IA 3GYAA 1KDCA 1SEBD 4PXDA 2F0WA 1TWGH 4CJ2C 4ZRZA 3CU7A 4B3TL 1I6HH 1V9PA 4CDDC 3V8IA 2B2WC 1R4PB 2EJGC 5GADC 4JI6Q 4NGQA 4IOAA 3S6HA 2D2CC 5LHY1 4DUYL 2IWHA 2E2DC 1EEFD 3ICEA 1QQ9A 5EBCA 4DXGA 1LFWA 4J3GA 4AVAA 2DNEA 4HIMA 4NGNA 1VDZA 2N88A 3RZOB 1JJCB 4L6TB 4A3LG 3QG1A 2J7ZA 4ZCKA 1FVIA 3BZDB 4J1MA 2YTYA 4NKLA 4BA2I 3D68A 1Z9FA 1IU8A 1GD7A 3I56A 2IW3A 3DMUA 3L3OC 1WOCA 3WOEA 1LTLA 3N5FA 1NMFA 2SNSA 4BWGB 1HRJA 4V0BA 2J8NA 3K81C 2JQOA 4MFPA 4RGNA 3L0OA 4UWIA 2ID0A 3VA7A 4PXCA 2DPSA 2OOTA 2B3GA 3RZDH 1BCPB 2OZGA 1Q7LA 4XXEA 2PJ4A 1E1OA 3GTJB 3KR5A 2YYZA 3SXOA 3I4MG 5IYBG 1XRYA 4DR5Q 1IY7A 4UEZA 4ODGA 4DV7L 1VQNA 3RLNA 2B2VC 3TFYA 2P5ZX 5F09A 1KLUD 4II9A 1L1OA 1OZPA 4O0AA 1UWYA 3T9YA 3E0JA 1SRUA 1NR4A 4JI2L 4LUAA 4DNRB 2NN6I 1DOMA 1ET6A 2WKDA 5DM73 4HIKA 1LAMA 2Q0YA 4DV4Q 2A69D 3KR4A 2L5TA 3I8ZA 4XQJA 4UBRA 4YY3Q 4GNXB 1X55A 1X3QA 1Q8IA 3CF5A 1XMOL 1M4GA 4ILWA 3IKJA 5CV5A 4BY7G 1IHZA 3FMCA 3H5ZA 2B2VA 3NEMA 4KD3A 4DXFA 4LF5L 4L8JA 1TKHA 2RVLA 4ZKBB 5C88A 1VMPA 3TO9A 1TWAB 3ULPA 1F2ZA 1ZYRC 2I00A 4CBVA 3W2DA 1EFWA 3KLWA 4R6TA 2R3ZA 4A33A 4F0YA 4DAPA 5IGDA 3K7AH 1YLEA 1BUVT 1SJHD 4BXXG 5K36H 3D31A 1RJTA 1KDBA 2QW7A 4QUCA 3D7GA 3J7AF 4B3TQ 2ZEFA 4A3BH 2JA6H 2CCZA 5ELYA 1KLGD 1K83B 3FEWX 5JVG3 3PO2H 3K59A 4JI8L 1Q2DA 2AJ6A 4RMFA 3FEEA 4UDUC 2QA4A 4A3KG 4JPBW 4F88A 1EU3A 1Z47A 1E24A 2YGWA 1K73C 3TT2A 3CDXA 3NWSA 3I4LA 2OH1A 2EXZA 4A3LH 2NWGA 1EQVA 2ZPAA 2C35B 3SXNA 2PZUA 5H86A 2D5DA 3FRPB 4MMOA 1JE5A 3PGZA 1ON0A 3D2MA 1YVKA 5CV7A 1B2TA 1ILPA 4JOIA 1H9RA 4CAWA 4ZY2A 5IT9c 2ZT9C 5KYLA 3VA5A 2V4DA 1YJNA 3R96A 4IPGA 3ISZA 4K0KQ 3A74A 3KDFA 2R7ZH 2ZTEA 1SQHA 1B44D 3IFEA 3R2IA 3SHLA 3CXSA 1Z4EA 3VATA 3W6XA 1MIUA 1W3SA 3TMEA 4E6IA 2OU2A 3JVNA 5CPAA 3PIP3 1S5CD 1KNAA 3LWUA 3IC1A 3S16H 4HIDA 2ZXPA 4A3MH 2EYOA 4KORA 3D7DA 2F52A 5A28A 2JJQA 4UAIA 1ML0D 1KUYA 4GLVB 1IXRA 3HOXB 5J1QA 3LX0A 5C0XJ 1BCPC 1V1OA 4UP7A 1UE6A 1CHQD 3DM3A 1XPOA 1L0CA 3CMEA 1K28A 1I94L 2E2IB 2KCWA 1K3RA 4PZ6A 4JI5L 1UUPA 3S9MA 4P6YA 4X3UA 2QILA 3MXGA 2OXPA 2EBJA 4OC0A 4A3BB 1FNOA 2NVYH 2F0OA 3K58A 1Z9UA 4FXDA 2ZJQA 2OQ0A 4WJ4A 4RKLA 1WCMB 3NTHA 2FJ2A 4KUAA 4KHVA 1BO0A 4GNXC 4B10A 2V8VA 2EUIA 1SYBA 1F9QA 2K5VA 1Z8WA 3QAYA 3MA2B 1JQYD 2OF1A 1XXGA 2EJMA 4K30A 4CGNA 3M3YH 1GUGA 2JA6G 3NK9A 4J8QA 2JA5G 4C7HA 4ZQ3A 2ZXRA 3S2HB 3FECA 1Z5RA 4DR5L 1SFOH 1ZLHA 4DV0Q 4B11A 4A93G 3DM1A 1CFMA 3ND9A 4UCMA 2I5HA 3F2DA 1PFBA 2OT2A 3U4VA 4MTNA 2EO8A 1SNQA 2CTBA 5IP9G 1WTRA 2Q4ZA 1U5KA 2PI2A 2AUJD 5IIFA 4LAAA 4ULLA 1TXRA 4OO1H 2R92H 4BY1G 2RF4A 3R8BA 5FLXL 2XRQD 5JJZA 1EOVA 3EJIA 3U50C 3Q23A 3H8GA 1LO5D 4MHZA 5JM6A 4JV5L 1EY6A 1NBWA 3BVZA 4Q0FA 2SDFA 1FGBD 4EQPA 1TXYA 4DUZL 1XNQL 4FF4A 3TO7A 3F2UA 3GUXA 4DKAC 3FRMA 1SYGA 4UWJA 2K14A 1HZAA 3KI9A 2DY7A 3T1HQ 2J4XA 3QR8A 3OWEB 4DAYA 3EY5A 1JCKB 3TZDA 4DR4L 2J9AA 1E2WA 4M6HA 5DWNA 3HOXG 4JOIC 2DUDA 1KIXA 3BJUA 2BA1A 1T5XD 2FMMA 3JAME 3M7NA 3CC4A 4CGLA 4WJ3M 4TKOB 1IL8A 4DV2Q 3ISXA 4K5VA 3TO6A 2NVQH 1Q46A 1EQTA 2A73B 1FGUA 1RTOA 1E2ZA 1MJCA 1PTOD 2CH4W 1HNXQ 1EWIA 2C6PA 4C7IA 3GD7A 2PZWA 2RCNA 2H4OA 2GVBA 4IUTA 3CXCA 1VQ4A 2Q2UA 1HHVA 1CSPA 5ISRA 1HA5A 2DY8A 2ANPA 4F9VA 2WB1E 4M1UB 1VQ7A 4ZUJA 2E76C 4FYDA 1G2TA 1OXUA 4FVMA 3SEBA 4Q5VA 3QO2A 4RS2A 1SXTA 3PUVA 4JI6L 3A0JA 2OR4A 3R9FA 2R7DA 2NN6H 3I55A 2RSNA 1EOTA 5HGTA 4DPGA 1LOKA 3GTGB 4EQNA 1CI3M 1BR9A 1EZ8A 1C4QA 4JI1Q 1TY2A 5KNBA 5DNFA 2QDLA 1VHSA 3EA6A 2ICIA 1SSOA 4H2KA 4BBSG 3G7LA 5IGCA 4YGOA 4S3SA 5IGGA 1BPMA 1P4NA 1WTOA 1C7YA 4CKEA 3H8FA 1ASZA 2JA7B 2I3CA 5K8NA 2A8VA 2YU9B 1XEBA 3VWEA 5LL6X 2EK8A 4IAVA 4KI0A 3C1EA 1V1PB 1JWQA 5HXDA 1ASYA 2R7ZG 1BQQT 3HEJA 5CORA 1J4JA 4KUBA 1CA6A 4PK2A 4YCUA 1KUXA 3HKZG 2B4DA 3FIXA 2RCFA 4M6IA 1HFNA 3QB3A 2K03A 1X3EA 5KTDA 2XNAC 5IYBH 1GKHA 1B9MA 1HH2P 3Q0AA 2UXCL 1SNMA 1I5FA 2JDCA 3PFEA 3E0EA 1B87A 3R95A 2PYKA 1LANA 1K8AC 1AMPA 1RL2A 4RHSA 4P4BA 1CBXA 2UUCQ 1D6EC 1DE4C 2VBQA 4ZYSA 1SMXA 5C0XH 4P45A 3VYTA 2FE7A 3SHPA 3CKIB 3CPFA 4LFAQ 2RSOA 3CCEA 4GS4A 1G91A 2K5DA 4KMUC 2ZEMA 3HKSA 3PO3B 1B3QA 1S5FD 3SJFA 4DAMA 5K5PA 4KKSA 2JBJA 1KUVA 3CCMA 1YSJA 4LF5Q 2ICEC 1LCPA 4A3DG 5C3EB 1KL9A 1OXVA 3D4UA 3K9UA 3E0KA 3Q22A 5IYCG 1N34Q 1STBA 4XNHC 4NMZA 4ZAIA 2QF7A 3ULLA 4XPKA 1EWCA 1YLOA 4A3MB 1RKNA 4GZYC 4IUUA 4F0XA 2HHHL 3AYHB 4AG7A 3EBEA 4AVCA 2CNTA 5K8OA 3KF6A 1KTKA 1EIYB 4JI8Q 3GIUA 5HMNA 4WJWA 4DUKA 4UP8A 1QNKA 2E5LL 3PIO3 4LUVA 3IU1A 3BYYB 3BZCA 5KNCA 4TQUS 2A6HD 2OTLA 2F0VA 3MXNA 3NH8A 3F8KA 2NVXH 4YU9A 5LMUL 1GHEA 2E2IH 2LFNA 2X6LA 4AYBE 2Z3NA 2O2LD 3D3SA 3MWYW 4GNXA 1IOFA 3HLPA 2OQKA 4JBKA 3ONAB 4MFQA 1TKJA 2BOAA 2B2UA 3VYSA 1Y0RA 3I3GA 2K5WA 2F3IA 1SBBB 2GFQA 5HVFA 4CGOA 4M6GA 1ESFA 1PYBA 2AWOA 1HJPA 3FDTA 4A3JG 2YNEA 4H6UA 4X3KA 2MGSA 2VW9A 2F3WA 1FD7D 4XQQA 1Y1WB 4G4KA 2B2UC 4Q7AA 3T1YQ 4YWLA 1FNVA 2ATWA 3UDFA 4A75A 1Q2CA 2F0QA 4DV1Q 4F6AA 4LK1C 3NHHA 1ENFA 4LQGA 2L55A 1TWHH 3IFTA 1TY0A 1CJWA 3AU7A 4NXNQ 2KCTA 2HQEA 4CGPA 1CQFA 2ES2A 4OLLA 2PIYA 4BA1I 5LL6S 4PG3A 2WAQE 5IB9A 1GUOA 2Q8RE 5JPMC 4JI0Q 3BI1A 1SFOB 1N33Q 2VI7A 4IJLA 2QEXA 4UEFA 4K2LA 1S5BD 4C3HB 2ZM6L 1I4RA 2NTSA 2QMLA 1IYLA 3PSIA 3UE1A 5C0XI 2B58A 4UFWA 2O4HA 4PK3A 1A0IA 1HUMA 1TKWB 1L1OC 3MTSA 3BDOA 3OWFA 2KBNA 3A54A 5ELBA 3S9LA 1KABA 2JA8H 2IJ0A 3UI2A 4CPAA 3K5LA 1NMGA 1WWZA 3G6JB 1XPRA 1X32A 3KUPA 2AHOB 4OELB 4UP9A 2FXFA 5IYDG 1I1DA 1KRSA 4O23A 2AUKA 3VR5A 2E5LQ 3G3SA 3QWNA 1H9JA 2MHVA 1EY4A 1QG7A 1EYDA 1N71A 2JA6B 3PZJA 2B8FA 4GLXA 1YK3A 2R61A 5D65A 4HJ5A 3HG9A 3H6MA 4X3SA 4NFRA 2UUBL 1AE2A 4C1NK 1Y1WH 4KSFA 3GTOH 4KJNA 3M4OH 3G4SA 3NE8A 1X3PA 1HR0W 1QSOA 4YFJA 5AJ3Q 2MO0A 4ZKCB 1RTNA 5HY6A 3UDIA 3LWEA 4HNXB 4JYAL 1Q90A 2BE5D 4RGTA 2YTVA 4KKUA 4UPAA 4A3BG 1M1KC 3IJ3A 2V77A 2PJCA 1Q3LA 4Q36A 1TS2A 3PO2G 3CPAA 3PP9A 4C3IB 2QVPA 4R9WA 4YWYA 2PW5A 2SOBA 2M00A 3MXUA 4MHPA 3JTKA 5G22A 1XTDA 5FKAC 1SE8A 2KQ3A 5M5WB 3DUZA 3RMHA 8CPAA 4OIJA 2XEGA 1E22A 1LV9A 1XNQQ 4KOUA 2IPKD 3H4QA 1PRTC 4CAFA 5KYIA 4KTAA 3CC2A 1N32Q 2GLFA 4C68A 2AMCB 2RHQB 4DV4L 5IX3A 2WB1G 2ZW5A 1F9RA 3KF8B 3D3RA 3CC7A 3DWQA 3NWTA 4JYWA 4JI0L 2XGTA 1SLJA 2GE3A 3V96A 5BN4A 1QCBD 1PHJA 1AFPA 1VQ8A 2KCNA 3K0YA 2VXKA 2KA7A 4Y49C 2Z11A 2L9HA 4N9PA 3KK7A 5DAUA 4DV0L 3J7ZC 4XTCS 1IYUA 5IGFA 1UE7A 1T5EA 1LTRD 1XTCD 4KVOE 3H0GB 3CPXA 4G57A 1IBKL 4ORFA 4N8X1 2XWJB 2K50A 1V43A 2AFSA 2ZEGA 2C5CA 1BOBA 2CHBD 5EPJA 2ZENA 1YVOA 4KN4C 2XVSA 3HFZB 4J6HA 1TVXA 2WIIB 1UE5A 2VUMH 4KVXA 1LTBD 1PH7A 1OO9B 3OYYA 4KY5A 5IT9E 2PO4A 3U9OA 3TS2A 4R7MA 5KNDA 3BI0A 1LT6D 4EQ5A 3WC6A 3S9NA 3T1HL 2D0OA 2BE5C 2Y0SG 1XJOA 2VQYA 5H84A 4OWTB 3HOYG 1CP7A 4BBHA 5CNPA 4B13A 1NMTA 4DFAA 3MFYA 1K8OA 2F8HA 2VEZA 1M4IA 4L8AA 5CBMA 4OHJA 3B35A 3PBBA 5A35A 4X3TA 2Q4YA 1B8AA 2MNAA 3DEOA 1VHOA 4JYAQ 2CIJA 3F2BA 2K05A 2VQEL 2CH4A 3RN5A 3I9SA 4TRDA 2Q8TA 1Y7EA 3GTMH 5C4JB 3NELA 1STNA 2HQLA 4KJOA 4A93H 4BY1B 3LMSA 3E5SA 1V8QA 3HOUB 4IFDG 5IE8A 4OC1A 3HOYH 3AFQA 4A3IB 4ZI6A 3SXHA 3VR4A 2CTCA 2F0MA 4IUNA 3T51B 4KLKA 1J5EL 2ZW4A 1QZHA 2PJ0A 4FD4A 4P10A 2JEBI 4JVZA 4FXKC 2PRBA 1XIXA 3HUVA 3J81i 1WTQA 2VS1A 4HJ9A 4DR1Q 4KHPL 1AE3A 4MJ8A 2PJ5A 3ZJ0A 3FEDA 3F2CA 3MEHA 3MN8A 4AYBG 4DV5L 4H44C 2FMCA 1QUQA 1X3FA 2FINB 2FXQA 4NPSA 1SN8A 3NENA 4LWCA 3TN2A 1XFOA 4P4EA 1X6OA 5J8FA 3SK6A 1YR0A 2Z4IA 1G8ZD 3GO5A 4MXUA 4C3JH 1BKBA 2GA4B 4CJ0B 2H5MA 1ZKOA 4DR7L 5I9PA 1ZG8A 1HDQA 3PF4A 3T8WA 5C4ZA 1AZQA 1LACA 2WYRA 4O42A 1BLLE 4QQBX 1VF5C 4YIJA 1N33L 4Y49B 1M1DA 2NTTA 3B3TA 5A27A 3MXPA 5DM63 3KYHC 2DN8A 2EOTA 2JE6I 2BA0A 3FHWA 2FT0A 1AN8A 4LQ6A 1WTXA 4A3EG 5I4MA 3J80E 1FNUA 2ZXOA 4H0LC 1EIHA 1GUTA 1H9SB 2CQOA 1U4MA 3A56A 3T4AC 4OONA 4MCSA 1X3GA 2EE1A 3EQLC 2N3SA 4X64Q 4DV3Q 1JORA 1LM0A 3ER0A 1N32L 3CQZH 5IP9H 5C0XG 1GHJA 4OL7A 3ZJYC 2FIAA 2PJ6A 1UWVA 2HIVA 5A2QE 5LYLA 4P4JA 1TWCB 4JI2Q 3T90A 1VF7A 3CCLA 2WAQG 1LTAD 3GDEA 3KHZA 3LGJA 5LYDA 2UU9Q 5GAGC 4CYQA 4PSXA 2C6GA 2B63G 4PZ8A 1G291 1VQDA 3CCUA 4Q38A 4K5WA 4OKOA 4B5PB 2AWNA 4XPLA 3FKIH 3H09A 3AB9A 1I4HA 5HURA 1EU4A 1HXYD 3HOZG 5M3FH 3KGQA 2F0NA 1LTTD 1BNZA 4LF9L 1XPUA 1NAPA 3I3CA 4G1PA 4DV5Q 4FBEA 1U9RA 4JI3Q 1NSAA 4ZUIA 4OMEA 3KLRA 2YNDA 4R4TA 5ELDA 2Q7BA 4K0KL 2CF4A 1LT3D 3TZUA 2ZEOA 3RAMA 1ET9A 4PPZA 5HH1A 1Y9WA 3KKWA 1G51A 1RD9D 2D9UA 1ZG7A 4DR4Q 1XMQQ 5AG5A 5GQOA 4HJ7A 1VQ6A 2D62A 3WABA 1E1TA 1EIGA 1PCAA 3ITPA 3S17H 2JA5H 3RN2A 1JMCA 1PYWD 2F3VA 5M5WH 4OC3A 1EY9A 4PZ7A 3V05A 4AIMA 2K5TA 4A39A 2E2HH 3H8EA 5E4XA 3W1GA 1X10A 4FO2A 1MK4A 2K33A 3TTHA 4CJ1B 1P8LA 2L11A 3J7A5 1YQEA 2R92G 1Z8LA 4KOWA 1Y9KA 5J3BA 4AG9A 2ENBA 2PJ1A 3BXMA 4KSIA 3FH4A 3CRLC 1R4QB 1VHEA 4FD6A 3GTKB 1MJEA 1K8GA 5JJIA 1BAVA 4OWXB 2HT1A 2JBKA 4ONWA 3G6EA 3NH4A 1C8CA 3H0GH 2PE3A 3PO2B 4R4CA 1YZ6A 4UIAA 1AW7A 2NSMA 4UFVA 2R7HA 5M5XH 4ID6A 4RFBA 2Y0MA 4MHNA 1CUKA 1VQFA 2DF5A 3KF8A 5C5LA 1PH1A 2ARHA 4LUOA 1Q1BA 4X64L 2EWBA 4MCQA 3GTPB 4DK0A 2VNUD 4UIBA 4C2MH 3D8GA 4NP5A 3HOWG 5J8CA 1IW7C 1VQMA 4P44A 1WVLA 4NGMA 3HOZH 2KHJA 1K9MC 4F7XA 3MZ5A 4MFLA 1L0XB 3P2HA 1Y1VH 1ELLP 1WD0A 3RBUA 1D5MC 2POKA 3HRZC 5CMDA 2JA5B 4MFJA 1ARMA 2F0UA 3HZXA 3C26A 1LAPA 4CGMA 1ILQA 2H5XA 4IUPA 3TP7A 1N8RC 2UUAL 4K3NA 1PRTB 1NSNS 3EVQA 3NFZA 3HKZE 1NSLA 2JA7H 1STHA 4CHTB 1Z8XA 4PQAA 2Q2HA 5ELNA 4B3ML 3SJGA 1MI2A 3SVMA 3K5MA 3FF3A 4HNYB 4A3CG 3KLSX 1LUZA 1CKMA 4OX9Q 4DNIA 4A3DH 1LT4D 2NUCA 5FK9C 1HTLD 2QKIC 2YV5A 3GTQB 3GY9A 4XT3B 5IYCH 4PV6A 4P72A 4NF1A 3N6RA 1BDOA 1YJWA 2Y0SE 4APVA 1JJGA 1KHIA 3NH5A 2KJXA 1M8AA 1GYTA 1V1QA 2ZEPA 5FO8B 4U9YA 3RZOH 1HNWL 1SNCA 1I4QA 4B9WA 2Z0ZA 4DR6L 3VR3A 5LMUQ 3R93A 2PJ8A 4B5OA 2NVYB 3IO1A 3H3VC 2O28A 2PR1A 3KBXA 4OIWA 2WUUA 2B3UA 1VIXA 2A6ED 4POGA 1XNRQ 2VL6A 2OB0A 5JEAJ 1K0RA 2QCPX 4JG2A 4P2CB 5E96A 1JWMD 1I4PA 1KRTA 1MJAA 1E7ZA 4LJZC 1MD2D 2EVBA 2K5QA 1Q86C 1WTVA 1VCIA 4HCEA 4CDCC 1HNZL 4F8MA 1QSNA 3S15B 2R8VA 3Q8DA 5IT9L 1RDPD 3J7AV 4IUVA 4FUUA 5JQ4A 2AQ3B 1NNXA 2F0GA 4GLAC 4EFDA 4GN5A 1M4VA 3CPWA 2AFUA 5I2XA 4M85A 2AFMA 3NBHB 2HB6A 1U0LA 2RDHA 1YGHA 2HC9A 1HCZA 2PNRC 1AH9A 3CQZB 1P16A 2HV2A 1DTDA 3CZXA 5C4XB 2CWAA 4GKKL 5KTAA 5HVHA 2Q44A 3SI0A 3PQIA 4HSPA 4OEMB 4U68A 3WC5A 3VR6A 1FT7A 4A3FH 1BOSA 2NMTA 4KSAA 3TCVA 4HIOA 1PUAA 4JD6A 4JLYA 2A4NA 4ZLTF 4AYBB 3M85A 2Q51A 5C4HA 4DR2L 2CKZB 2REEA 3W91A 2C6CA 2UUAQ 1D5XC 3EC4A 3L2PA 5F2DA 3DHQA 3J7YW 1TF8A 4BY7H 2V8DA 2HDLA 2K52A 4LW1A 1E0BA 4P4DA 3OTOL 1K4JA 2JDDA 2PMZE 5HVGA 4LFAL 1HZBA 1JQGA 1I4GA 1YMEA 2O5IC 3S1RB 1HA6A 2YNCA 3FKIB 5JGFA 1JE4A 3OOCA 3TREA 4MFZA 1WK4A 1LYLA 1GHKA 2EXDA 2WB1B 2AFWA 4QB4A 1Z4RA 2VL1A 4A2ZA 4KOXA 3I4NG 3SI2A 4NGRA 3B6YA 1CP6A 3TE4A 4LX9A 4R8IA 2VY3A 4RAUC 1XMBA 1N36L 4FD5A 1QJOA 3S2DB 5LMNQ 4C2YA 3T13A 3TRZA 2RDFA 2B5GB 4KZTA 1FR3A 4PMCA 2R7ZB 5FO9B 5BN5A 4KOSA 3CXPA 3JAMi 3J80i 3PB9X 3BDCA 3OMCA 2C9OA 4DU9A 1WI5A 3G71A 2N55A 4UHVA 3HOWH 4JI3L 3EXNA 1XJVA 4JI4L 2F0LA 2UUCL 1L2FA 1EYCA 1GO3E 2R6GA 3VYRA 2EY1A 2RKSA 1Q8KA 4DV6Q 2ABZA 5LRKA 2MP1A 5IGBA 2PIZA 5AFWA 1RF2D 3K8AA 1GM5A 3FKIG 2BH8A 3FNCA 2OTJA 4OX9L 1PZJD 1UFHA 1LTGD 3ULJA 1L0WA 5F46A 4A3EB 3DWPA 2MQHA 1E3PA 1Y14B 3TS0A 3VH9A 2F0KA 4K8JA 3K9TA 3I2ZA 5J39A 1CQVA 3OHXC 1QE6A 1YHBA 4H7BA 1SDFA 4AXVA 3C46A 2E75C 3W6SA 2F0JA 3KL9A 4QCLA 1XYIA 1YIJA 4OWWB 5M5XB 2K1BA 4ABNA 5D29A 2PI2E 4KK7A 3PB4X 4RUHA 3K5NA 3HOXH 3UDGA 2I0QA 1KWMA 2Q43A 3G48A 2LXKA 3GTOB 3M4OB 3V38A 3IWGA 2O4XA 3B3CA 3EN2A 4JW0A 3QJYA 2Z3PA 3GTLH 4C3JB 1PH2A 3PIOA 2VB2X 1D2BA 3SI1A 3PUXA 3JAML 3HOUG 1LABA 4NXML 1ENAA 4LF9Q 1NCVA 1LTSD 4WFN3 4OO1I 3SGIA 3GB0A 3BLNA 5JJKA 3AEVA 4A3GG 3KZWA 4OAEA 1TQOA 3OTOQ 2ZW6A 4MY0A 1CHPD 1STEA 2EVNA 2BL1A 1XF8A 2IHFA 2B29A 4HSVA 2AFOA 5CV4A 2XEFA 3STBC 3J81j 4JBMA 3A5UA 3BDLA 1IYKA 1ELMP 5EKLA 4YCWA 3KOJA 4RN7A 1AUGA 2NN6G 2Q2IA 2R92B 3PO3G 2PQAA 2K7VA 4YHHL 4LMQD 3HOWB 3A7AB 5E7NA 4DR7Q 3BYTB 3KQZA 5ELFA 3D67A 3A5ZB 5EKIA 4NEXA 3X3MA 5C3WA 4I49A 5JH9A 4ZGYB 3CP0A 5FO7B 1Z8TA 1Q12A 1V0CA 2X69A 2PVWA 5C44H 2ZXVA 2ZTDA 3CRKC 4PNYA 3TP6A 5KEEA 3DGVA 4H6ZA 3VWDA 4A3EH 5G3LF 4A3MG 2V8GA 4H89A 3ZZIA 4KN7C 1EFID 1NJIC 5M3MB 2RC4A 5JPHA 2IJZA 1S3OA 4HCSA 4LFBQ 5CC4A 2NVXB 3B8GA 3CW2C 5C82A 4POFA 5I6WA 1MSGA 4X62Q 2EZVA 2FS5A 2TSSA 3TDQA 5J22A 3U58A 1S7NA 3CCQA 4QGUA 4JCVE 1KQSA 3D2PA 4NGSA 2EQSA 1EQQA 2MUYA 1VQIA 3I70A 5CYUA 4IFDH 1YNND 3DLJA 4XNHB 2PRQA 3EIVA 5DWMA 1EY7A 4XDXA 5KGUA 3CAMA 4A3IG 2Z6KA 2R1IA 2VUMB 4FNFA 2CVRA 4JV5Q 4RGOS 3RR5A 3W3AA 5IWAQ 4OC5A 3P20A 1I3QH 2ZEDA 3MFGA 1WTHA 3C1FA 2EYHA 2UXCQ 1OXTA 4IPCA 2PQAB 3WDNA 2C1CA 1N34L 3NUCA 4RCNA 4A3CH 3A7LA 5AGEA 4C3JG 2BEIA 1PTOB 1DM0B 4MFKA 2M9VA 2DEAA 4B6ZA 4GN4B 4E8OA 4B14A 3DNSA 4E2AA 3TQYA 4A95A 5F49A 2B63B 3ND8A 1CZWA 4MHYA 4NGTA 2PJ3A 2Z3LA 1XX8A 1FL0A 2J8RA 3JC66 1U4PA 1YJ9A 4A3GH 4A3FB 4DJLA 1XMOQ 1PH6A 1HR0L 4R3KA 2WPWA 3HOUH 5LYIA 2QDBA 1IBMQ 3TX8A 2YU9H 1Y8OB 3QAHA 2K01A 1VGYA 3KF6B 4GXHA 2F0TA 4MNOA 4R4QA 2Z3MA 1KD1C 3MEFA 1FJGL 2K5HA 1IL2A 4ZY0A 4C3HG 4ZX9A 1WCMG 3GTGH 2ZW7A 4L5QA 4KVME 2L4NA 3MGDA 1J8IA 4RA8A 2AE6A 3K2KA 1WTWA 4AB7A 3MVVA 4CRZB 1RCVD 1ZXTA 2O5JC 4AH6A 5D3DA 1TS5A 3HOVH 3TSSA 4PSWA 4LFCQ 4RH6A 3L9AX 5CV6A 4DK3C 4LUZA 4P74A 4B08A 2KHSA 1H95A 3DEPA 2PCUA 1EY5A 1JOKA 2PQEA 5M5YB 2PJ7A 1WYDA 3FP9A 3OMGA 4QF4A 3BJ7A 1PLFA 3VDYA 2ATRA 3QB8A 2A74C 1L1OB 1HQMC 4IN3A 3OSOA 4DV3L 3RZAA 4A32A 3TBIB 3RZDB 2BO9A 4RI1A 3GP7A 3GKRA 1STAA 4KS9A 1O7LA 4C2MB 3CMAA 1IBLQ 3KBGA 2IMOA 3TOBA 2QGQA 5JVH3 3EROA 3L7ZC 4ZY1A 1GUSA 2VQFL 2ODFA 3IIBA 4EWTA 1SYFA 3B7IA 1K0SA 2E8GA 1J6QA 3LNNA 3I91A 4B5PA 3DSBA 4DUZQ 1GUNA 4LFBL 2F4IA 1DD2A 4PMWA 4CYOA 1A3VA 1KNEA 2BSWA 1SE2A 2Z1CA 2PDOA 1CKNB 2GN5A 3F0AA 3R2TA 4B12A 4R4OA 3KQXA 2RQXA 3IWEA 3D7FA 1JOQA 4QVTA 2OZHA 3SJEA 4FWUA 2B2YC 1Y8NB 1F2LA 1JB7A 1S7FA 1U4RA 2OEOA 1DJRD 4JI5Q 4QUFA 1ICFB 4CYPA 4DV7Q 4DR3L 1FYCA 1VQ5A 3HOVB 1YNJC 2KECA 1PH3A 2HQYA 5EMIA 4CS0B 1MKHA 4XYQA 2JA8G 3HS0C 2IX0A 1IOIA 2NVTB 3IAYA 3K80C 3PUZA 4MZ9A 1VQGA 3D4WA 2K32A 3FPUB 2Z10A 4A37A 2WP8J 1LLRD 1UEBA 3FPPA 2NB0A 2KCMA 1PH4A 4ZK9B 1QNUA 2VB3X 5JEAH 2KOLA 1F9PA 1Q1EA 2B2TC 5EPKA 2CQAA 3BU2A 1PA6A 1EY8A 1UNSA 1HZCA 1S5KA 3SK8A 1SR3A 3STBD 3S1MH 2R7FA 5J1ZA 1VQHA 3Q6SA 3J81L 1YHQA 1TU2B 3H15A 5F48A 3TC8A 2CY2A 3D6CA 1M4DA 1G6ZA 2ZM6Q 1S40A 2DJFC 3S15H 5G21A 4E0AA 4QIWB 2RA4A 3TP8A 1GXDC 5M3FG 1K83H 4P73A 4CDFC 3J80c 3R3OA 5G20A 1PDQA 4PV1C 4MIUA 5EKKA 3S17B 4XQNA 1PTOF 2K5NA 1F2MA 5T1IA 1J5EQ 2VQFQ 3CD6A 2N78A 4M3SA 1D5ZC 4NDXA 4NJRA 4YWMA
chains in the Genus database with same CATH topology
1Z7TA 1DOLA 1SMYC 3IL8A 5C44B 2XRSD 5E4WC 5D14A 2NZ1D 1O7ZA 4OO1G 1DZ1A 2RB7A 5JOBA 4I65A 4BBSB 4JZ0A 4GM5A 2IL8A 1RHPA 1YNNC 3DXJC 4IZ8A 1O80A 1F57A 4V190 1F2YA 1TKFA 4IFDJ 2NYQA 1TWGB 3GV3A 5LRJA 3SJXA 2ZEEA 2SEBD 3PBEA 4NJQA 1B1ZA 1RTQA 5K8PA 1TF9A 4H13C 3U9SA 2BOSA 1EYAA 1YW4A 1HEEA 4MCPA 1B4OA 3OPOA 3K6OA 1GJXA 3H91A 3PUYA 1B53A 4OIDA 4R76A 2B8GA 2NYZD 3HKZB 1PTOH 2B2TA 4KKTA 1D1KA 1SAPA 2FHTA 1QILA 3S14B 4OGQC 1HFGA 3M3YB 1Z6HA 3HGBA 2IX1A 4A3GB 2JSOA 1DXMA 5C5MA 3VR2A 1TS3A 4PXBA 2DNCA 3S1QB 1B9NA 2PCFB 4BD9A 1DYQA 3JRUA 3I4NB 3RLFA 1BPNA 4HEDA 2MJ8A 2KEEA 2IX3A 2QEJC 3K5OA 2WACA 1VMCA 1TS4A 2F0PA 5EBDA 4DNTB 2F0HA 2EYMA 2JEAI 2A68D 1EWHA 4C56C 1SYEA 1OXXK 3D6WA 3AMUA 3K7AB 3V2TA 5LYFA 2HDMA 1ARLA 3D4RA 5DEHA 1TT2A 3GQBA 3L2NA 3T16A 5CBAE 5JEAG 3N52A 1CG2A 2NVQB 4X2TA 1EL0A 1HUNA 4OIKA 3ERQA 1HTPA 4FP5D 1I6VC 4FF1A 5LRGA 5ELCA 2ZOGA 2NBFA 1C48A 5IOCA 4W9YA 5FLXE 2E2HB 4PXEA 4X8IA 3I72A 3CHBD 5ELEA 1XBUA 3D7HA 4UF4A 4FXGC 4UEEA 3FJUA 4K6DA 4MHEA 3QNVA 3J80L 4IUQA 3I90A 1BF4A 5K8MA 1PTOC 1U4LA 5EGTA 3S16B 3NSWA 1H8LA 5G3LD 2EY6A 4WORA 5BN3A 1W6KA 1ENCA 1S5ED 4EGVA 2IQ6A 1QWYA 2PW7A 5KIXA 4K2KA 3NQIA 4IURA 2SNMA 5JPNC 4XT1B 3TP5A 1V1PA 3KASA 1AEXA 4HR7B 5CV9A 1R9TB 2XEIA 1H9MA 4A3KB 3VYUA 1S5DD 1CK1A 1I3QB 5E3FA 2L0CA 4JBWA 3RD4A 1SMYD 4P4FA 2XN9C 4IHMA 2HCCA 4FF2A 2BDNA 1ZYRD 1A6XA 1H9SA 3PB8X 1IW7D 3T56B 4C1NI 2PZTA 1IKMA 2K6AA 3ZYYX 2F7VA 2R93B 1KDAA 2Q8IB 2B2YA 2IT1A 1XWEA 3A8IE 1PFMA 4ME5A 1BBXC 4KY6A 4DK1A 3B3SA 1ESRA 4F8ZA 2KEDA 1SYCA 2FVGA 3BG3A 1F2OA 4JK1C 3PEIA 3B3WA 3PRTA 4L63B 3FVLA 5I4DA 3M4YA 5I9OA 3MC0B 2PJ2A 3IWWA 4MRIA 5M3FB 2B39A 3BHXA 3Q24A 1Z2LA 4CKCA 1BXTA 1HPCA 2A6EC 2EYLA 1PRTF 1E2VA 4RKBA 3J81E 2B2WA 5COYA 1SE3A 1HDUA 2ZEHA 2L1BA 1A2TA 5EQ0A 4NW2A 1W6JA 3M7GA 5D8NA 4I7ZC 2MPMA 5EPLA 4R8FA 3K57A 2Y0SB 4RWSC 2A6HC 4EVOA 1CZGA 1MGSA 3FX6A 4F87A 2K28A 2G9DA 3H94A 1OBRA 5CR3A 1Y0YA 4IFDI 3WC7A 2GU2A 1D1IA 3MHBA 1PXUA 4IQZA 4PQXA 2F03A 1TWFB 2PJAA 5IGEA 1ONLA 4HMJA 3GLJA 1SJED 2JYOA 5CGKA 2V8HA 3OIQA 4R8NA 3O13A 1Y69U 2JA8B 1IKLA 3PFOA 1AZPA 3I4MB 2KCCA 3P75A 1GUWA 3D4DA 5FOBB 1EE3P 1DOKA 3BS1A 4KHZA 3S1MB 2L12A 3C3LA 1IYVA 1R43A 3NTKA 5TSSA 3S1NB 4Y7NB 4X3RA 3HOZB 2ZELA 4FF3A 3A8KE 1JR0D 3S9WA 4Z65A 2RDGA 1QOHA 4EMEA 4K8IA 2Z4HA 4CGYB 3VARA 1GOZA 1A3TA 2GREA 2QYVA 4NGPA 4A38A 4DN4M 4FAIA 7CPAA 3RUZA 3BVMA 4BBRB 1JOOA 1JICA 4KV6A 2A5HA 3KLSA 4B9XA 5IODA 1Y1VB 3A55A 2WV6D 3QOLA 5I6YA 4M8AA 2AQ2B 2AFZA 2WZNA 4A94A 1A2UA 1TR5A 2KVMA 4RHRA 2EDGA 2KUMA 1UEAB 3OW7A 2A68C 1PFNA 2F0FA 3HP3A 1WTPA 1LT5D 4A3DB 1EY0A 2CW0C 2PVVA 1FNWA 1PZID 1PRTD 1STGA 1STYA 5CBEE 5JAVA 3KHXA 4HTHA 4N9TA 2F0EA 3NBIA 1ICWA 3QOJA 1SE4A 1G2SA 1RODA 1IGBA 4K6LA 1SYDA 1TIID 5M9OA 1F9SA 1O78A 3SDZA 3I73A 1PZKD 4WJBA 1SNOA 4Z9CB 5EJWA 2EYJA 2RBMA 1AP0A 4XIGS 1JC7A 1LTID 1CM9A 1JWSD 5C6AA 1L0YB 4OC4A 2BCOA 2HCIA 1QB5D 4DYOA 3URYA 3SK4A 4TSSA 2F0SA 2RFHA 2XSCA 1MSHA 1B3AA 5C3XA 2GLJA 3PB7X 3PV0A 1I6HB 2QJ8A 3HLPA 5THWA 1ZG9A 2AQ1B 2JXMB 3CT9A 2Z8LA 1CA5A 3NPPA 3NTIA 1BCPF 4MCRA 3FVQA 3T53B 2XIWA 1NR2A 1JWUD 1F77A 3P1HA 2E74C 2CW0D 2EYPA 1CT1D 3NBHA 4BY7B 3IFDA 4TWEA 6CPAA 4F9UA 4RCOA 4TNUA 3B2YA 4U673 4HN7A 1EEID 3OIPA 1I50B 3WT4A 3SR1A 4CKBA 5K36G 4HAEA 3A8JE 1YNJD 1AYEA 2EY2A 1SNDA 2K04A 4DF7A 3DWAA 3C2PA 5DS0A 1NUCA 2PPBC 2EYFA 3NXWA 2LY7A 1A3UA 1Y8PB 2LMCB 1CPSA 4BS9A 2JP1A 4C3IG 4OP4A 3I1UA 5D3IB 1SNPA 2O53A 3EFXD 3GTLB 2PJ9A 3BVGA 2PJBA 1HQRD 4QMGA 3PUWA 3PMFA 1ZLIA 3V7ZA 4HMIA 4IK2A 4G7HC 2TMPA 2BDOA 2XWBB 2G9HD 4MN3A 3P7JA 1DONA 2I46A 3NP8A 5KRUA 5NUCA 3QIAA 2ZOFA 2AFXA 3MAQA 3MRUA 4DA2A 2FFKB 2HUGA 1MBYA 1CTMA 2M2LA 1OXSC 2EK9A 1K8MA 1I4XA 2EPBA 3IEHA 1WD1A 1TWHB 4DGZA 1A15A 1H9KA 5A2QL 1CPXA 1F2PA 2I07B 2WINB 3PB6X 2JEWA 3NA6A 2E2JB 3GTMB 5E1FA 1UAPA 4EQOA 4A93B 1O7YA 3GV6A 1B50A 3HOYB 4ZYQA 1CX8A 4XYOA 4WRDA 3SK5A 2F1MA 1PMRA 2EY5A 2H1EA 1QMUA 2WAQB 4O1NA 1DCZA 3B3VA 2EJFC 2XEJA 1PYTB 4RGMA 2PMZB 2LS01 1M4LA 1YW6A 1BCPD 4KY7A 2LKVA 4ZX8A 4K14A 1ZEQX 4K5XA 4IALA 2VXWA 4PMBA 4DAVA 5T1GA 4OC2A 2F0DA 3SE0A 3NQTA 4KD4A 1EZ6A 3D66A 5I2YA 2F0IA 5CV8A 1KAAA 1R3NA 2J0TD 2WKCA 3X3NA 1II3A 1J9OA 2X6GA 4G7OC 2A69C 3NE5B 1JB3A 1S4ZA 4G7ZC 4WWVA 4A3JB 3E6ZX 3WOFA 4P4IA 1KDCA 1SEBD 4PXDA 2F0WA 4CJ2C 4ZRZA 3CU7A 2B2WC 1R4PB 2EJGC 4NGQA 2D2CC 5LHY1 2IWHA 2E2DC 1EEFD 1QQ9A 5EBCA 4DXGA 1LFWA 2DNEA 4NGNA 1VDZA 2N88A 3RZOB 4L6TB 3QG1A 2J7ZA 3BZDB 4J1MA 4NKLA 4BA2I 3D68A 2IW3A 3DMUA 3L3OC 3WOEA 3N5FA 2SNSA 4BWGB 1HRJA 4V0BA 4RGNA 2ID0A 3VA7A 4PXCA 2OOTA 1BCPB 1Q7LA 4XXEA 2PJ4A 3GTJB 3KR5A 2YYZA 1XRYA 1IY7A 4UEZA 4ODGA 2B2VC 5F09A 1KLUD 1UWYA 3E0JA 1NR4A 4DNRB 2NN6I 1DOMA 1ET6A 2WKDA 5DM73 1LAMA 2A69D 3KR4A 2L5TA 3I8ZA 4XQJA 1X3QA 1Q8IA 4ILWA 3IKJA 5CV5A 1IHZA 3FMCA 2B2VA 4DXFA 4KD3A 4L8JA 1TKHA 2RVLA 4ZKBB 1VMPA 1TWAB 1F2ZA 1ZYRC 4CBVA 3W2DA 4R6TA 2R3ZA 4DAPA 5IGDA 1BUVT 1SJHD 5K36H 3D31A 1RJTA 1KDBA 4QUCA 3D7GA 3J7AF 2ZEFA 5ELYA 1KLGD 1K83B 3FEWX 5JVG3 3K59A 3FEEA 4UDUC 4F88A 1EU3A 1Z47A 3CDXA 3NWSA 3I4LA 2EXZA 2NWGA 1EQVA 2PZUA 2D5DA 3FRPB 4MMOA 5CV7A 1B2TA 1ILPA 1H9RA 4ZY2A 2ZT9C 5KYLA 3VA5A 2V4DA 3ISZA 1B44D 3IFEA 3R2IA 3SHLA 3VATA 3TMEA 4E6IA 5CPAA 3PIP3 1S5CD 1KNAA 3LWUA 3IC1A 2ZXPA 2EYOA 3D7DA 4UAIA 1ML0D 3HOXB 5J1QA 3LX0A 5C0XJ 1BCPC 1V1OA 1CHQD 2E2IB 1UUPA 3S9MA 4P6YA 4X3UA 2QILA 3MXGA 2OXPA 4OC0A 4A3BB 1FNOA 2F0OA 3K58A 4FXDA 4RKLA 1WCMB 3NTHA 2FJ2A 4KHVA 1BO0A 2V8VA 1SYBA 1F9QA 3MA2B 1JQYD 2OF1A 1XXGA 2EJMA 1GUGA 3NK9A 4J8QA 4ZQ3A 2ZXRA 3S2HB 3FECA 1Z5RA 1ZLHA 3DM1A 1CFMA 3ND9A 1PFBA 2OT2A 1SNQA 2CTBA 1WTRA 2Q4ZA 2AUJD 5IIFA 4LAAA 4ULLA 1TXRA 4OO1H 3R8BA 5FLXL 2XRQD 5JJZA 3H8GA 3EJIA 3Q23A 1LO5D 4MHZA 5JM6A 1EY6A 3BVZA 4Q0FA 2SDFA 1FGBD 4EQPA 4FF4A 3F2UA 3GUXA 1SYGA 3KI9A 2DY7A 2J4XA 3OWEB 4DAYA 1JCKB 3TZDA 2J9AA 1E2WA 2BA1A 1T5XD 2FMMA 3JAME 3M7NA 4TKOB 1IL8A 3ISXA 4K5VA 1EQTA 2A73B 1RTOA 1E2ZA 1PTOD 2C6PA 3GD7A 2PZWA 2H4OA 4IUTA 1HHVA 5ISRA 1HA5A 2DY8A 2ANPA 4F9VA 4M1UB 4ZUJA 2E76C 4FYDA 1G2TA 1OXUA 4FVMA 3SEBA 4Q5VA 3QO2A 1SXTA 3PUVA 2OR4A 2NN6H 2RSNA 1EOTA 5HGTA 1LOKA 3GTGB 4EQNA 1CI3M 1BR9A 1EZ8A 1C4QA 1TY2A 5KNBA 5DNFA 3EA6A 2ICIA 1SSOA 4H2KA 3G7LA 5IGCA 4S3SA 5IGGA 1BPMA 1WTOA 4CKEA 3H8FA 2JA7B 2I3CA 5K8NA 2YU9B 5LL6X 2EK8A 4IAVA 4KI0A 3C1EA 1V1PB 5HXDA 1BQQT 3HEJA 5CORA 1CA6A 1HFNA 3QB3A 2K03A 2XNAC 3Q0AA 1B9MA 3PFEA 1SNMA 2PYKA 1LANA 1AMPA 4RHSA 4P4BA 1CBXA 1D6EC 1DE4C 4ZYSA 5C0XH 4P45A 3VYTA 3CKIB 2RSOA 1G91A 2K5DA 4KMUC 2ZEMA 3PO3B 1S5FD 5K5PA 4KKSA 2JBJA 1YSJA 2ICEC 1LCPA 5C3EB 1OXVA 3D4UA 3Q22A 1STBA 4NMZA 4ZAIA 2QF7A 1EWCA 1YLOA 4A3MB 1RKNA 4GZYC 4IUUA 5K8OA 1KTKA 4WJWA 4DUKA 1QNKA 3PIO3 3BYYB 5KNCA 4TQUS 2A6HD 3NH8A 2F0VA 3MXNA 4YU9A 2LFNA 2X6LA 2O2LD 3MWYW 3ONAB 1TKJA 2BOAA 2B2UA 3VYSA 1Y0RA 2K5WA 1SBBB 5HVFA 1ESFA 2AWOA 3FDTA 4X3KA 2MGSA 2F3WA 1FD7D 4XQQA 1Y1WB 4G4KA 2B2UC 4Q7AA 1FNVA 2F0QA 4LK1C 3NHHA 1ENFA 4LQGA 2L55A 3IFTA 1TY0A 3AU7A 2HQEA 1CQFA 2PIYA 4BA1I 5LL6S 5IB9A 1GUOA 2Q8RE 5JPMC 3BI1A 1SFOB 4UEFA 4K2LA 1S5BD 4C3HB 1I4RA 2NTSA 5C0XI 2O4HA 1HUMA 1TKWB 3MTSA 3BDOA 3OWFA 3A54A 5ELBA 3S9LA 1KABA 2IJ0A 3UI2A 4CPAA 3K5LA 3G6JB 1X32A 3KUPA 4O23A 2AUKA 3VR5A 3QWNA 1H9JA 2MHVA 1EY4A 1QG7A 1EYDA 2JA6B 2B8FA 5D65A 2R61A 4NFRA 3HG9A 3H6MA 4X3SA 4C1NK 4KJNA 1X3PA 4ZKCB 1RTNA 3LWEA 1Q90A 2BE5D 4RGTA 4KKUA 3IJ3A 2V77A 2PJCA 1Q3LA 1TS2A 3CPAA 4C3IB 2QVPA 4R9WA 4YWYA 2PW5A 2SOBA 2M00A 3MXUA 4MHPA 5FKAC 2KQ3A 5M5WB 3DUZA 3RMHA 8CPAA 4OIJA 2XEGA 1LV9A 2IPKD 1PRTC 5KYIA 4KTAA 2GLFA 1F9RA 3D3RA 3DWQA 3NWTA 4JYWA 3V96A 5BN4A 1QCBD 1AFPA 2KCNA 3K0YA 2KA7A 2L9HA 4N9PA 3KK7A 5DAUA 4XTCS 1IYUA 5IGFA 1T5EA 1LTRD 1XTCD 3H0GB 3CPXA 4G57A 2XWJB 1V43A 2AFSA 2ZEGA 2C5CA 2CHBD 5EPJA 2ZENA 4KN4C 2XVSA 4J6HA 1TVXA 2WIIB 1LTBD 1OO9B 4KY5A 5IT9E 2PO4A 3U9OA 4R7MA 5KNDA 3BI0A 1LT6D 3WC6A 3S9NA 2BE5C 1XJOA 1CP7A 4DFAA 3MFYA 1K8OA 2F8HA 5CBMA 4OHJA 3B35A 3PBBA 5A35A 4X3TA 3DEOA 1VHOA 2CIJA 2K05A 4TRDA 2Q8TA 1Y7EA 5C4JB 1STNA 4KJOA 3LMSA 4BY1B 3E5SA 1V8QA 3HOUB 4IFDG 4OC1A 4A3IB 4ZI6A 3SXHA 3VR4A 2CTCA 2F0MA 4IUNA 3T51B 2PJ0A 4P10A 2JEBI 4FXKC 3HUVA 1WTQA 2PJ5A 3FEDA 3MEHA 3MN8A 4H44C 2FMCA 3SJFA 2FINB 4P4EA 3TN2A 1XFOA 3SK6A 2Z4IA 1G8ZD 3GO5A 4MXUA 2GA4B 4CJ0B 1ZKOA 5I9PA 1ZG8A 1HDQA 3T8WA 5C4ZA 1AZQA 1LACA 2WYRA 4O42A 1BLLE 1VF5C 4YIJA 2NTTA 3B3TA 3MXPA 5DM63 2DN8A 2EOTA 2JE6I 2BA0A 1AN8A 1WTXA 5I4MA 3J80E 1FNUA 2ZXOA 4H0LC 1EIHA 1GUTA 1H9SB 1U4MA 3A56A 3T4AC 4MCSA 2EE1A 3EQLC 1JORA 5C0XG 1GHJA 4OL7A 2PJ6A 5A2QE 5LYLA 4P4JA 1TWCB 1VF7A 1LTAD 3KHZA 5LYDA 2C6GA 1G291 4K5WA 4OKOA 2AWNA 3H09A 3AB9A 1I4HA 5HURA 1EU4A 1HXYD 3KGQA 2F0NA 1LTTD 1BNZA 1NAPA 3I3CA 4G1PA 4FBEA 1U9RA 1NSAA 4ZUIA 4OMEA 3KLRA 5ELDA 2CF4A 1LT3D 3TZUA 2ZEOA 3RAMA 1ET9A 4PPZA 1RD9D 2D9UA 1ZG7A 2D62A 3WABA 1EIGA 1PCAA 3ITPA 1PYWD 2F3VA 4OC3A 1EY9A 3V05A 4A39A 3H8EA 5E4XA 4FO2A 2K33A 4CJ1B 2L11A 1Z8LA 2ENBA 2PJ1A 3BXMA 4KSIA 3FH4A 3CRLC 1R4QB 1VHEA 3GTKB 1BAVA 2JBKA 4ONWA 3NH4A 1C8CA 2PE3A 3PO2B 4UIAA 1AW7A 2NSMA 4ID6A 4RFBA 4MHNA 3KF8A 5C5LA 1Q1BA 2EWBA 4MCQA 3GTPB 4DK0A 2VNUD 4UIBA 3D8GA 4NP5A 1IW7C 4P44A 1WVLA 4NGMA 4F7XA 3MZ5A 1L0XB 1ELLP 1WD0A 3RBUA 1D5MC 2POKA 3HRZC 5CMDA 2JA5B 1ARMA 2F0UA 3HZXA 1LAPA 1ILQA 4IUPA 3TP7A 4K3NA 1PRTB 1NSNS 3EVQA 3NFZA 1STHA 4CHTB 4PQAA 3SJGA 1MI2A 3SVMA 3K5MA 3FF3A 3KLSX 1LT4D 2NUCA 5FK9C 1HTLD 2QKIC 3GTQB 4XT3B 3N6RA 1BDOA 3NH5A 2KJXA 1M8AA 1GYTA 2ZEPA 5FO8B 1SNCA 1I4QA 4B9WA 3VR3A 3R93A 2PJ8A 2NVYB 3IO1A 3H3VC 3KBXA 4OIWA 1VIXA 2A6ED 5JEAJ 2QCPX 4P2CB 1JWMD 1I4PA 4LJZC 1MD2D 2EVBA 2K5QA 1WTVA 1VCIA 4HCEA 4F8MA 3S15B 5IT9L 1RDPD 3J7AV 4IUVA 4FUUA 2AQ3B 2F0GA 4EFDA 1M4VA 2AFUA 5I2XA 2AFMA 2HB6A 2RDHA 2HC9A 1HCZA 2PNRC 3CQZB 1DTDA 5C4XB 5HVHA 3SI0A 4HSPA 4U68A 3WC5A 3VR6A 1FT7A 1BOSA 4ZLTF 4AYBB 3M85A 2Q51A 5C4HA 2C6CA 1D5XC 5F2DA 3DHQA 3J7YW 1TF8A 2V8DA 2HDLA 1E0BA 4P4DA 5HVGA 1JQGA 1I4GA 1YMEA 2O5IC 3S1RB 1HA6A 3FKIB 5JGFA 1JE4A 3OOCA 1GHKA 2WB1B 2AFWA 4QB4A 2VL1A 3SI2A 4NGRA 1CP6A 4R8IA 4RAUC 1XMBA 1QJOA 3S2DB 3T13A 2RDFA 1FR3A 4PMCA 2R7ZB 5FO9B 5BN5A 3PB9X 3BDCA 3OMCA 2C9OA 4DU9A 2N55A 2F0LA 3VYRA 1EYCA 2ABZA 2R6GA 5LRKA 2EY1A 2RKSA 2MP1A 5IGBA 2PIZA 5AFWA 1RF2D 1PZJD 1LTGD 4A3EB 3DWPA 3VH9A 2F0KA 4K8JA 3K9TA 5J39A 1CQVA 3OHXC 1QE6A 4H7BA 1SDFA 4AXVA 3C46A 2E75C 2F0JA 3KL9A 4QCLA 1XYIA 5M5XB 2K1BA 4ABNA 5D29A 3PB4X 4KK7A 4RUHA 3K5NA 1KWMA 2Q43A 3GTOB 3M4OB 3V38A 2O4XA 3B3CA 3QJYA 4C3JB 2VB2X 1D2BA 3SI1A 3PUXA 3JAML 1LABA 1ENAA 3GB0A 1NCVA 1LTSD 4WFN3 4OO1I 3KZWA 1TQOA 1CHPD 1STEA 4HSVA 2AFOA 5CV4A 2XEFA 1ELMP 3BDLA 5EKLA 2NN6G 2R92B 2K7VA 3HOWB 4LMQD 3A7AB 3BYTB 3KQZA 5ELFA 3D67A 5EKIA 3X3MA 5C3WA 5JH9A 5FO7B 1Q12A 2X69A 2PVWA 3CRKC 3DGVA 4PNYA 3TP6A 5KEEA 5G3LF 2V8GA 4KN7C 1EFID 5M3MB 2IJZA 4HCSA 5CC4A 2NVXB 5I6WA 2EZVA 1MSGA 2TSSA 3TDQA 5J22A 4NGSA 2MUYA 3I70A 5CYUA 3DLJA 4IFDH 1YNND 2PRQA 1EY7A 4XDXA 5KGUA 2VUMB 4FNFA 2CVRA 4RGOS 3W3AA 4OC5A 3P20A 2ZEDA 3MFGA 3C1FA 2EYHA 1OXTA 3WDNA 2C1CA 3NUCA 4RCNA 3A7LA 4C3JG 1PTOB 1DM0B 2M9VA 2DEAA 4B6ZA 2B63B 3ND8A 1CZWA 4MHYA 4NGTA 2PJ3A 1XX8A 1U4PA 4A3FB 4DJLA 5LYIA 2QDBA 3TX8A 1Y8OB 2K01A 1VGYA 2F0TA 4ZY0A 4C3HG 4ZX9A 2L4NA 1J8IA 4RA8A 3K2KA 1WTWA 3MVVA 1RCVD 1ZXTA 2O5JC 5D3DA 1TS5A 3TSSA 4RH6A 3L9AX 5CV6A 4B08A 2KHSA 3DEPA 2PCUA 1EY5A 1JOKA 2PQEA 5M5YB 2PJ7A 3OMGA 4QF4A 1PLFA 2A74C 1HQMC 4IN3A 3OSOA 3RZAA 3TBIB 3RZDB 2BO9A 3GP7A 1STAA 1O7LA 4C2MB 3KBGA 2IMOA 5JVH3 3EROA 3L7ZC 4ZY1A 1GUSA 3IIBA 4EWTA 1SYFA 3B7IA 3LNNA 3I91A 1GUNA 2F4IA 1DD2A 4PMWA 1A3VA 1KNEA 1SE2A 2Z1CA 3R2TA 3KQXA 2RQXA 3D7FA 1JOQA 3SJEA 4FWUA 2B2YC 1Y8NB 1F2LA 1U4RA 2OEOA 1DJRD 4QUFA 3HOVB 1FYCA 1YNJC 2KECA 4XYQA 3HS0C 2IX0A 2NVTB 3IAYA 3PUZA 3D4WA 2K32A 3FPUB 4A37A 2WP8J 1LLRD 3FPPA 2NB0A 4ZK9B 1QNUA 2VB3X 5JEAH 2KOLA 1F9PA 1Q1EA 2B2TC 5EPKA 2CQAA 1EY8A 1UNSA 3SK8A 5J1ZA 3Q6SA 3J81L 3TC8A 1TU2B 3D6CA 1G6ZA 4QIWB 2RA4A 3TP8A 1GXDC 3R3OA 1PDQA 4PV1C 4MIUA 5EKKA 3S17B 4XQNA 1PTOF 1F2MA 5T1IA 1D5ZC 4NDXA 4NJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z7T A;  1BAV A;  1SMY C;  1LOK A;  2JBK A;  4ONW A;  3NH4 A;  1CI3 M;  2PE3 A;  4UIA A;  2NSM A;  5KNB A;  4TWE A;  4OO1 G;  6CPA A;  2RB7 A;  4H2K A;  4MHN A;  4F9U A;  4TNU A;  1BPM A;  3B2Y A;  4JZ0 A;  4GM5 A;  1YNN C;  1Q1B A;  3DXJ C;  3H8F A;  3WT4 A;  1F57 A;  2EWB A;  4MCQ A;  4DK0 A;  2I3C A;  5K8N A;  4UIB A;  2EK8 A;  4IAV A;  4KI0 A;  1IW7 C;  1TKF A;  2NYQ A;  4P44 A;  4NGM A;  5HXD A;  5LRJ A;  3SJX A;  2ZEE A;  5K36 G;  3A8J E;  3PBE A;  1AYE A;  1ELL P;  4NJQ A;  3RBU A;  2POK A;  1RTQ A;  1ARM A;  5K8P A;  1LAP A;  4K3N A;  1TF9 A;  4H13 C;  3U9S A;  1B9M A;  3NFZ A;  3PFE A;  5DS0 A;  2PPB C;  1LAN A;  4PQA A;  3SJG A;  1AMP A;  3FF3 A;  1YW4 A;  4P4B A;  1CBX A;  1HEE A;  1DE4 C;  1Y8P B;  4MCP A;  5C0X H;  4P45 A;  2LMC B;  3OPO A;  1GJX A;  3PUY A;  1CPS A;  3N6R A;  1BDO A;  4OID A;  4KMU C;  1GYT A;  2ZEM A;  3NH5 A;  2ZEP A;  4R76 A;  2B8G A;  3I1U A;  4OP4 A;  4KKS A;  2JBJ A;  1YSJ A;  2O53 A;  4KKT A;  3VR3 A;  1LCP A;  2PJ9 A;  2PJ8 A;  1OXV A;  2PJB A;  3D4U A;  4OGQ C;  1Z6H A;  3HGB A;  3PUW A;  3IO1 A;  1ZLI A;  3V7Z A;  2QF7 A;  4OIW A;  1VIX A;  1DXM A;  4IK2 A;  2A6E D;  4G7H C;  3VR2 A;  1YLO A;  4GZY C;  4PXB A;  2BDO A;  2DNC A;  1B9N A;  2PCF B;  4BD9 A;  3JRU A;  3RLF A;  4LJZ C;  1BPN A;  2EVB A;  5K8O A;  1VCI A;  3QIA A;  2ZOF A;  4DUK A;  2AFX A;  3MRU A;  4FUU A;  5KNC A;  4TQU S;  2A6H D;  3NH8 A;  4EFD A;  2AFU A;  1CTM A;  4YU9 A;  2AFM A;  1OXS C;  2HB6 A;  2EK9 A;  1K8M A;  2HC9 A;  3IEH A;  1HCZ A;  2PNR C;  4DNT B;  2JEA I;  2A68 D;  1EWH A;  1DTD A;  1H9K A;  1OXX K;  1TKJ A;  2BOA A;  5HVH A;  1Y0R A;  1CPX A;  3SI0 A;  5LYF A;  5HVF A;  1F2P A;  3WC5 A;  2AWO A;  3VR6 A;  1FT7 A;  1ARL A;  3PB6 X;  2JEW A;  3NA6 A;  3D4R A;  4Q7A A;  3GQB A;  3L2N A;  3M85 A;  5JEA G;  2Q51 A;  1CG2 A;  4X2T A;  4ZYQ A;  1CX8 A;  4LK1 C;  2C6C A;  4LQG A;  3IFT A;  1HTP A;  2F1M A;  1PMR A;  1TF8 A;  1QMU A;  2V8D A;  1I6V C;  1DCZ A;  3B3V A;  2EJF C;  2PIY A;  4BA1 I;  1PYT B;  2XEJ A;  2ZOG A;  5LRG A;  5IB9 A;  4P4D A;  1GUO A;  3BI1 A;  4W9Y A;  5HVG A;  4UEF A;  1JQG A;  1YME A;  4PXE A;  2O5I C;  4X8I A;  3I72 A;  1XBU A;  3D7H A;  4UF4 A;  1M4L A;  5JGF A;  4UEE A;  3OOC A;  3FJU A;  1YW6 A;  2O4H A;  1GHK A;  1TKW B;  3QNV A;  2AFW A;  4ZX8 A;  3BDO A;  2VL1 A;  3SI2 A;  5K8M A;  4NGR A;  1CP6 A;  3S9L A;  4CPA A;  1XMB A;  1H8L A;  1QJO A;  4OC2 A;  3SE0 A;  3D66 A;  5BN3 A;  1FR3 A;  2IQ6 A;  1R3N A;  4O23 A;  2AUK A;  3VR5 A;  5BN5 A;  1H9J A;  3PB9 X;  3KAS A;  2B8F A;  4G7O C;  4HR7 B;  2A69 C;  3NE5 B;  4NFR A;  2XEI A;  2ABZ A;  5LRK A;  1H9M A;  2R6G A;  4G7Z C;  2PIZ A;  4WWV A;  4JBW A;  4P4I A;  4PXD A;  4P4F A;  1Q90 A;  2BE5 D;  4IHM A;  4KKU A;  3IJ3 A;  1A6X A;  2V77 A;  2PJC A;  3VH9 A;  2EJG C;  1H9S A;  4NGQ A;  3PB8 X;  3K9T A;  1IW7 D;  3CPA A;  2D2C C;  3T56 B;  2QVP A;  4AXV A;  2E75 C;  4YWY A;  3KL9 A;  1QQ9 A;  3MXU A;  4MHP A;  4RUH A;  5D29 A;  3PB4 X;  1LFW A;  2F7V A;  2DNE A;  1KWM A;  2Q43 A;  2Q8I B;  4NGN A;  8CPA A;  1VDZ A;  2XEG A;  3V38 A;  2IT1 A;  3QG1 A;  3B3C A;  3QJY A;  4BA2 I;  3D68 A;  3A8I E;  2GLF A;  4DK1 A;  3N5F A;  3SI1 A;  3PUX A;  1LAB A;  3B3S A;  3GB0 A;  4F8Z A;  3KZW A;  4JYW A;  2FVG A;  3BG3 A;  5BN4 A;  3VA7 A;  1F2O A;  4PXC A;  4JK1 C;  2OOT A;  3PEI A;  3B3W A;  1Q7L A;  3PRT A;  2KA7 A;  2AFO A;  2PJ4 A;  3FVL A;  2XEF A;  3KR5 A;  2YYZ A;  3M4Y A;  1XRY A;  1ELM P;  1IY7 A;  2PJ2 A;  4UEZ A;  4XTC S;  1IYU A;  3IWW A;  2NN6 G;  4MRI A;  1T5E A;  2K7V A;  3BHX A;  5F09 A;  3A7A B;  3CPX A;  1Z2L A;  1UWY A;  3KQZ A;  3D67 A;  1HPC A;  4DNR B;  1V43 A;  2AFS A;  2ZEG A;  2NN6 I;  2A6E C;  5JH9 A;  1Q12 A;  1E2V A;  2ZEN A;  1LAM A;  4KN4 C;  2A69 D;  2PVW A;  2L5T A;  3KR4 A;  3CRK C;  3DGV A;  1HDU A;  2ZEH A;  2V8G A;  4KN7 C;  3IKJ A;  4R7M A;  3FMC A;  5KND A;  5D8N A;  4I7Z C;  2IJZ A;  3BI0 A;  3WC6 A;  3S9N A;  4L8J A;  1TKH A;  2BE5 C;  1XJO A;  4R8F A;  1CP7 A;  1ZYR C;  4NGS A;  2A6H C;  3MFY A;  4R6T A;  1K8O A;  2F8H A;  5CBM A;  3DLJ A;  4IFD H;  3FX6 A;  2PRQ A;  3B35 A;  5K36 H;  3PBB A;  3D31 A;  5A35 A;  2G9D A;  3H94 A;  1OBR A;  1Y0Y A;  3D7G A;  1VHO A;  2CIJ A;  2ZEF A;  3WC7 A;  5ELY A;  1Y7E A;  2GU2 A;  3W3A A;  4IQZ A;  4OC5 A;  3P20 A;  3FEE A;  2ZED A;  2PJA A;  3LMS A;  1ONL A;  1OXT A;  1V8Q A;  4IFD G;  3WDN A;  2C1C A;  3GLJ A;  4OC1 A;  4ZI6 A;  4RCN A;  3VR4 A;  2CTC A;  3CDX A;  3A7L A;  3I4L A;  2V8H A;  3T51 B;  2D5D A;  2PJ0 A;  4MMO A;  2DEA A;  4P10 A;  4B6Z A;  2JEB I;  1Y69 U;  1H9R A;  3ND8 A;  3HUV A;  4MHY A;  3PFO A;  4NGT A;  2PJ3 A;  4ZY2 A;  2KCC A;  2ZT9 C;  2V4D A;  2PJ5 A;  4DJL A;  3FED A;  1EE3 P;  3ISZ A;  3MN8 A;  4KHZ A;  4H44 C;  5LYI A;  3SJF A;  3IFE A;  3TX8 A;  1Y8O B;  1IYV A;  1XFO A;  4P4E A;  1R43 A;  3VAT A;  1VGY A;  4X3R A;  5CPA A;  2ZEL A;  4MXU A;  3IC1 A;  3LWU A;  4ZY0 A;  3A8K E;  4ZX9 A;  1ZKO A;  4Z65 A;  3D7D A;  4EME A;  3K2K A;  1ZG8 A;  1HDQ A;  3T8W A;  2O5J C;  1LAC A;  2WYR A;  5J1Q A;  1BLL E;  1VF5 C;  3VAR A;  2GRE A;  4NGP A;  2QYV A;  4A38 A;  3B3T A;  4FAI A;  2DN8 A;  7CPA A;  2JE6 I;  2BA0 A;  2PCU A;  3S9M A;  5I4M A;  4P6Y A;  4H0L C;  2PJ7 A;  4OC0 A;  1FNO A;  1GUT A;  1H9S B;  4MCS A;  1HQM C;  3EQL C;  3RZA A;  2BO9 A;  2AFZ A;  2WZN A;  5C0X G;  4A94 A;  1GHJ A;  1O7L A;  2V8V A;  2PJ6 A;  2IMO A;  5LYL A;  2EDG A;  3OW7 A;  2EJM A;  3L7Z C;  4P4J A;  4ZY1 A;  1GUS A;  2A68 C;  3IIB A;  4EWT A;  3B7I A;  1VF7 A;  1GUG A;  3LNN A;  3KHZ A;  5LYD A;  2CW0 C;  2PVV A;  3FEC A;  1GUN A;  2C6G A;  1Z5R A;  1ZLH A;  1DD2 A;  3KHX A;  1CFM A;  1G29 1;  3ND9 A;  4OKO A;  2CTB A;  3AB9 A;  2Q4Z A;  2AUJ D;  1TXR A;  4OO1 H;  1IGB A;  3KGQ A;  3H8G A;  3KQX A;  4G1P A;  4FBE A;  3D7F A;  1NSA A;  4OME A;  3SJE A;  4FWU A;  1O78 A;  3KLR A;  3SDZ A;  1Y8N B;  3I73 A;  4MHZ A;  5JM6 A;  4WJB A;  2CF4 A;  3TZU A;  2ZEO A;  3RAM A;  1FYC A;  4PPZ A;  1YNJ C;  3GUX A;  4XIG S;  3KI9 A;  3PUZ A;  4A37 A;  2K32 A;  1ZG7 A;  2J9A A;  1E2W A;  3FPP A;  4OC4 A;  2BCO A;  2D62 A;  3WAB A;  5JEA H;  1PCA A;  2BA1 A;  4DYO A;  3M7N A;  1Q1E A;  4OC3 A;  4TKO B;  4A39 A;  2RFH A;  3ISX A;  3H8E A;  3TC8 A;  1TU2 B;  1E2Z A;  2K33 A;  2C6P A;  3GD7 A;  2GLJ A;  3PB7 X;  3PV0 A;  2ANP A;  3HLP A;  2QJ8 A;  5THW A;  1ZG9 A;  3CT9 A;  2JXM B;  4F9V A;  1Z8L A;  2E76 C;  4PV1 C;  1OXU A;  4MCR A;  3T53 B;  2PJ1 A;  3BXM A;  3PUV A;  4KSI A;  3FH4 A;  4NJR A;  3CRL C;  2OR4 A;  1VHE A;  2NN6 H;  2E74 C; 
#chains in the Genus database with same CATH topology
 1BBW A;  1Z7T A;  1DOL A;  1SMY C;  4CDE C;  3IL8 A;  5C44 B;  2XRS D;  5E4W C;  2C27 A;  5D14 A;  2NZ1 D;  4KOV A;  3RO0 A;  1O7Z A;  4OO1 G;  1DZ1 A;  2RB7 A;  5JOB A;  4I65 A;  4BBS B;  4JZ0 A;  4GM5 A;  4MI4 A;  2IL8 A;  1RHP A;  1YNN C;  1X56 A;  4IUS A;  3DXJ C;  4JWP A;  4IZ8 A;  1O80 A;  4YWK A;  1F57 A;  4V19 0;  1XMQ L;  1RO5 A;  1F2Y A;  4LNQ A;  1VQE A;  1TKF A;  5IB0 A;  4IFD J;  2NYQ A;  1TWG B;  1S60 A;  1WFQ A;  3GV3 A;  5LRJ A;  1A63 A;  2P0W A;  3SJX A;  2GVA A;  4L5S A;  2ZEE A;  2SEB D;  3PBE A;  4NJQ A;  1VQB A;  1B1Z A;  2ZJR A;  1RTQ A;  2GIV A;  5K8P A;  3S1R H;  4HPS A;  1HNZ Q;  3UE0 A;  1TF9 A;  4H13 C;  3U9S A;  2L15 A;  2BOS A;  3RNZ A;  3NE7 A;  4L5R C;  5AG4 A;  3D0F A;  1EYA A;  2FIW A;  1X65 A;  1Q81 C;  1YW4 A;  2CXA A;  2G0B A;  1HEE A;  4B3S L;  2UXB Q;  4MCP A;  1B4O A;  1IID A;  3OPO A;  2VZY A;  3K6O A;  1GJX A;  5L37 A;  3H91 A;  3PUY A;  1B53 A;  3S6G A;  2LSS A;  4RG1 A;  5G1Z A;  1Y7R A;  4OID A;  1PFS A;  3DR8 A;  4R76 A;  4GKK Q;  3WR7 A;  2B8G A;  2NYZ D;  3HKZ B;  1PTO H;  4IPD A;  4CAX A;  4JI7 L;  4LF6 L;  2B2T A;  4KKT A;  1D1K A;  1SAP A;  2P6E A;  2FHT A;  1QIL A;  2B63 H;  4DUY Q;  3S14 B;  2Q4V A;  4BMH A;  5M3M G;  4OGQ C;  1PYS B;  1HFG A;  3M3Y B;  1Z6H A;  3HGB A;  1MJ9 A;  5KTC A;  2IX1 A;  3G8W A;  4A3G B;  2JSO A;  1DXM A;  2PC1 A;  5C5M A;  3VR2 A;  1TS3 A;  4PXB A;  2DNC A;  3S1Q B;  1B9N A;  4BBS H;  2PCF B;  4BD9 A;  3RYO A;  1DYQ A;  3JRU A;  3K7U C;  4QIW E;  4NXM Q;  3I4N B;  3RLF A;  1PVO A;  2N8N A;  1BPN A;  1K3B C;  1NY4 A;  4HED A;  3DR6 A;  2MJ8 A;  1EQR A;  2KEE A;  1YHA A;  3TOA A;  1BBU A;  5BR8 L;  5JJL A;  2IX3 A;  2QEJ C;  5M5Y H;  3K5O A;  2WAC A;  2IHE A;  1VMC A;  2PR8 A;  4DV1 L;  5LMN L;  1TS4 A;  2F0P A;  4FD7 A;  1Q7Y C;  5EBD A;  1KZF A;  4DNT B;  2F0H A;  2EYM A;  4ME3 A;  4NXN L;  1QVG A;  2CWP A;  4NCZ A;  2JEA I;  2A68 D;  1EWH A;  4C56 C;  1SYE A;  1OXX K;  3D6W A;  4OXP A;  3AMU A;  3K7A B;  3V2T A;  1N36 Q;  5AG7 A;  5LYF A;  2HDM A;  1R9T H;  4A76 A;  1ARL A;  1Q82 C;  4HJA A;  3D4R A;  5DEH A;  1TT2 A;  3GQB A;  3L2N A;  1A62 A;  3T16 A;  5CBA E;  2G5D A;  5JEA G;  1EYG A;  3N52 A;  1I50 H;  1CG2 A;  1R57 A;  4QBJ A;  2NVQ B;  4X2T A;  1EL0 A;  5GCN A;  1HUN A;  3DDD A;  5GAH C;  4OIK A;  3ERQ A;  4IPH A;  4KLW A;  1HTP A;  4FP5 D;  4UA3 A;  3DLL A;  1I6V C;  4GS3 A;  4FF1 A;  5ELC A;  2ZOG A;  2NBF A;  5LRG A;  2D4O A;  1NTG A;  1C48 A;  4HJ8 A;  1EUJ A;  4LFC L;  1JJ2 A;  5IOC A;  1UE1 A;  1RIP A;  2D0P A;  4KOY A;  4W9Y A;  1U6M A;  5FLX E;  2E2H B;  4PXE A;  4X8I A;  4X5K A;  3I72 A;  3CHB D;  5ELE A;  1XBU A;  4A3I H;  3D7H A;  4UF4 A;  4FXG C;  3S6F A;  4UEE A;  3FJU A;  4K6D A;  4MHE A;  1M90 C;  4B3M Q;  3QNV A;  3R9G A;  3J80 L;  4XPD B;  2DGY A;  4IUQ A;  3I90 A;  1QZG A;  1BF4 A;  3UY5 A;  5K8M A;  5M3M H;  1PTO C;  1I21 A;  1U4L A;  2N49 A;  5EGT A;  3NSW A;  3S16 B;  1H8L A;  4A3F G;  5G3L D;  2EY6 A;  5C4J H;  4B3R L;  2XTI A;  3KJP A;  4WOR A;  5BN3 A;  4YCV A;  1W6K A;  1ENC A;  1S5E D;  4EGV A;  2EIF A;  2IQ6 A;  1QWY A;  2PW7 A;  5BR8 Q;  5KIX A;  4K2K A;  3NQI A;  3BZK A;  4IF5 A;  4IUR A;  4JI7 Q;  4LF6 Q;  2SNM A;  5JPN C;  2LXJ A;  4XT1 B;  3TP5 A;  3WWV A;  1V1P A;  2VZA A;  4C2Z A;  3KAS A;  1AEX A;  1PU9 A;  4HR7 B;  5CV9 A;  1R9T B;  2XEI A;  1H9M A;  4A3K B;  3VYU A;  1S5D D;  1CK1 A;  1I3Q B;  2B4D B;  4LF4 L;  4GKJ Q;  5E3F A;  4J15 A;  2L0C A;  3S2D H;  3GTP H;  4GOP C;  4JBW A;  4JBJ A;  3RD4 A;  4A31 A;  4R4I A;  1SMY D;  1VQP A;  4P4F A;  2HHH Q;  2XN9 C;  5C3E G;  4IHM A;  2HCC A;  4FF2 A;  2BDN A;  2Z6B A;  1ZYR D;  1A6X A;  3A9L A;  1PH5 A;  1H9S A;  4LF7 L;  3PB8 X;  1IW7 D;  2UU9 L;  3T56 B;  4C1N I;  2PZT A;  3H3V I;  1IKM A;  1VQO A;  2K6A A;  3ZYY X;  2HD3 A;  1HNW Q;  2F7V A;  2R93 B;  1KDA A;  2Q8I B;  2B2Y A;  2JLM A;  2IT1 A;  2CNM A;  4DR3 Q;  2UXD Q;  4MY3 A;  1XWE A;  3A8I E;  3D8P A;  3IU2 A;  5C3E H;  1PFM A;  4ME5 A;  1BBX C;  1QST A;  2Q7S A;  4AVB A;  4KY6 A;  4I7A A;  4DK1 A;  5ISV A;  5DLQ E;  1A2Z A;  3B3S A;  3LAC A;  2PNH A;  3S24 A;  1ESR A;  1B70 B;  1TWF H;  2KED A;  5FLM G;  3I7F A;  2P6G A;  4F8Z A;  4NB3 A;  1SYC A;  4JXR A;  5IV0 A;  2FVG A;  3BG3 A;  1F2O A;  4JK1 C;  4BBR G;  4FDB A;  3PEI A;  2A1A A;  2OCE A;  1CKN A;  3B3W A;  3PRT A;  4L63 B;  5IYD H;  3H3V H;  3FVL A;  5I4D A;  1S3Z A;  3M4Y A;  5I9O A;  3MC0 B;  2PJ2 A;  4UCP A;  3IWW A;  4MRI A;  5M3F B;  2B39 A;  4DNC A;  3BHX A;  4TVA B;  3Q24 A;  1Z2L A;  1TWA H;  4CKC A;  4A3K H;  4O2D A;  1BXT A;  4JC0 A;  1HPC A;  3HOV G;  2QIR A;  2KHI A;  3CXQ A;  1PV4 A;  2A6E C;  2EYL A;  2I5L X;  1IYJ B;  1PRT F;  1E2V A;  4DV2 L;  4XPD C;  4RKB A;  3J81 E;  1DGS A;  2B2W A;  5COY A;  4DAY B;  1SE3 A;  1HDU A;  2P6F A;  2ZEH A;  4OAD A;  2L1B A;  1A2T A;  5EQ0 A;  2FSR A;  4NW2 A;  4IOC A;  1S72 A;  1W6J A;  1GVP A;  3M7G A;  4I7Z C;  5D8N A;  2MPM A;  5EPL A;  4R8F A;  2I5M X;  3K57 A;  2Y0S B;  4RWS C;  2A6H C;  2DJG C;  4EVO A;  3F5B A;  1CZG A;  4UFX A;  5C4X H;  1MGS A;  3FX6 A;  4F87 A;  2BUE A;  1C0A A;  2HUZ A;  2K28 A;  2G9D A;  3H94 A;  1OBR A;  5CR3 A;  2JA9 A;  1Y0Y A;  1MJB A;  2JA7 G;  4IFD I;  3WC7 A;  3CCJ A;  2GU2 A;  1D1I A;  4JI1 L;  2F5I A;  3MHB A;  1PXU A;  4IQZ A;  4PQX A;  2F03 A;  1TWF B;  3I4N H;  2PJA A;  5IGE A;  1ONL A;  4HMJ A;  2Q04 A;  2FCK A;  1OTC A;  1P0H A;  3GLJ A;  5FVJ A;  2CNS A;  1SJE D;  2JYO A;  5CGK A;  2V8H A;  3I4O A;  3OIQ A;  3OW2 A;  2F4V Q;  2YTX A;  2NVT H;  4R8N A;  3O13 A;  4C2X A;  1Y69 U;  2JA8 B;  1IKL A;  3PFO A;  1AZP A;  3I4M B;  2KCC A;  3P75 A;  4LF8 L;  1GUW A;  1XE4 A;  5BWA B;  3D4D A;  4X66 L;  1IBL L;  5FOB B;  3S6K A;  1EE3 P;  1DOK A;  3BS1 A;  4HNW B;  4KHZ A;  3S1M B;  2L12 A;  3C3L A;  1IYV A;  1R43 A;  5FLM H;  3NTK A;  5TSS A;  3S1N B;  1D7Q A;  4Y7N B;  4X3R A;  4GOP B;  3HOZ B;  2ZEL A;  4FF3 A;  3A8K E;  1JR0 D;  3AFP A;  2X7B A;  3S9W A;  1MHW C;  4Z65 A;  4A30 A;  2RDG A;  1QOH A;  4U9Z A;  4EME A;  1YNX A;  4K8I A;  2KEN A;  3M4P A;  2Z4H A;  1WJJ A;  4CGY B;  3VAR A;  1GOZ A;  1A3T A;  1G6P A;  1VKC A;  2GRE A;  2QYV A;  2YNC C;  4NGP A;  4A38 A;  5FJ8 G;  4N8F A;  4DN4 M;  3IGR A;  3UDX A;  4FAI A;  7CPA A;  3RUZ A;  5IP7 G;  3BVM A;  5I0C A;  4MTK A;  4BBR B;  2Q2T A;  4X6A H;  1JOO A;  4R9M A;  1JIC A;  4KV6 A;  2A5H A;  3KLS A;  4C3I H;  4B9X A;  1JT8 A;  5IOD A;  3M9B A;  1YIT A;  1Y1V B;  3A55 A;  1CM0 A;  2WV6 D;  3QOL A;  2DPT A;  5I6Y A;  4M8A A;  2AQ2 B;  2E2J H;  2AFZ A;  2WZN A;  4A94 A;  2QEC A;  4ONU A;  1A2U A;  1TR5 A;  5GRO A;  2BH2 A;  3CCS A;  2KVM A;  4RHR A;  1YX0 A;  2EDG A;  2KUM A;  1UEA B;  3OW7 A;  4KHP Q;  2A68 C;  1C9O A;  1PFN A;  2F0F A;  3HP3 A;  1WTP A;  4EVY A;  1LT5 D;  4Y52 H;  4A3D B;  3RNU A;  3PGP A;  1EY0 A;  2CW0 C;  3F8T A;  2PVV A;  1FNW A;  1PZI D;  4H02 A;  3FYN A;  1PRT D;  1STG A;  1YRE A;  1STY A;  2WPX A;  5CBE E;  5JAV A;  2B5G A;  3R1K A;  3TEH B;  3KHX A;  4HTH A;  4N9T A;  1FY7 A;  2F0E A;  3NBI A;  1ICW A;  3PCO B;  3QOJ A;  5AJ3 L;  1Y1W G;  1SE4 A;  1NE9 A;  1XMT A;  4Y7N H;  1G2S A;  1ROD A;  1KXL A;  1IGB A;  3E9I A;  4K6L A;  1SYD A;  5IWA L;  1TII D;  2NZO A;  5M9O A;  1F9S A;  1O78 A;  3SDZ A;  3I73 A;  4JXQ A;  1PZK D;  1D8L A;  5FLX c;  4HKF A;  4UCN A;  4WJB A;  4LF8 Q;  1SNO A;  4Z9C B;  5EJW A;  2HIX A;  2EYJ A;  2RBM A;  1AP0 A;  4XIG S;  2B4B A;  1JC7 A;  2JN4 A;  1LTI D;  4QL5 A;  1CM9 A;  5IY0 A;  3RLO A;  1JWS D;  1QUQ B;  5C6A A;  2F4V L;  1L0Y B;  4OC4 A;  3FB3 A;  2BCO A;  2Z9H A;  2HCI A;  1QB5 D;  4DYO A;  4BY1 H;  3URY A;  1QVC A;  3SK4 A;  3S1Q H;  2REF A;  4TSS A;  3E3X A;  2F0S A;  2RFH A;  4UY8 C;  3OWC A;  4A3J H;  2XSC A;  1IB1 E;  4P71 A;  1KC8 C;  1HNX L;  4DK6 C;  1MSH A;  5IP7 H;  1FJG Q;  2Z0S A;  1B3A A;  5C4X G;  5C3X A;  2GLJ A;  3JUW A;  3PB7 X;  3PV0 A;  1Q2Y A;  3R9E A;  4X65 Q;  5FJ8 H;  1I6H B;  1O7I A;  4DV6 L;  1LRZ A;  2AQ1 B;  2JXM B;  1ZG9 A;  2QJ8 A;  3CT9 A;  5THW A;  2Z8L A;  4CRY B;  1S7L A;  4KLV A;  3W5O A;  3NPP A;  3NTI A;  1BCP F;  3JAM c;  3FVQ A;  1CA5 A;  2JEV A;  2OZU A;  3T53 B;  4MCR A;  4QC6 A;  2XIW A;  1NR2 A;  1JWU D;  2JK8 A;  1XOV A;  5EAY A;  1F77 A;  4LF7 Q;  3P1H A;  2ZJP A;  2E74 C;  2K75 A;  2CW0 D;  1QSR A;  2EYP A;  1CT1 D;  3T1Y L;  3MXN B;  4CAV A;  1YI2 A;  1YBY A;  1T9H A;  5LMN W;  3NBH A;  4BY7 B;  3IFD A;  1PH9 A;  4GOP A;  1CKO A;  1X54 A;  4TWE A;  6CPA A;  4F9U A;  1VQC A;  4RCO A;  4QB9 A;  4TNU A;  2R98 A;  1NE3 A;  2K4K A;  3B2Y A;  4U67 3;  4HN7 A;  1EEI D;  1VQA A;  3OIP A;  2R93 G;  1WCM H;  1I50 B;  4R57 A;  2VUM G;  4AQY Q;  3WT4 A;  2GAN A;  1VS0 A;  4NXY A;  3SR1 A;  4YHH Q;  2FL4 A;  2IL4 A;  4CKB A;  4DR1 L;  2UXD L;  2CFM A;  2PQ8 A;  3P2F A;  4JJX A;  3K0X A;  4BXX H;  5K36 G;  2G3A A;  3N7Z A;  4HAE A;  3A8J E;  1IIC A;  1YNJ D;  1AYE A;  4ALP A;  3AQQ A;  2EY2 A;  1N9W A;  1SND A;  3PO3 H;  1W2B A;  2K04 A;  4QJF A;  4DF7 A;  3DWA A;  3J81 c;  3CCR A;  3C2P A;  5DS0 A;  1NUC A;  1TWC H;  2PPB C;  2EYF A;  3PIP A;  4IO9 A;  1X9N A;  3NXW A;  2LY7 A;  4P75 A;  1A3U A;  1Y8P B;  1IZ6 A;  2LMC B;  1A8V A;  1BO4 A;  4YRH A;  1CPS A;  4BS9 A;  2B3V A;  2JP1 A;  1RXT A;  3I4M H;  1CSQ A;  1QSM A;  4C3I G;  5H1S E;  4DR6 Q;  3I1U A;  1YEZ A;  4OP4 A;  5AG6 A;  5D3I B;  2VZZ A;  3KDF B;  1SNP A;  2O53 A;  1X12 A;  3W1B A;  3EFX D;  4U5Y A;  3GTL B;  2PJ9 A;  3BVG A;  5GAE C;  2PJB A;  2WFW A;  3LOD A;  4DR2 Q;  1HQR D;  4QMG A;  3PUW A;  3PMF A;  3M4Q A;  1ZLI A;  2RHS B;  3V7Z A;  4HMI A;  4IK2 A;  4CAE A;  4G7H C;  2TMP A;  2BDO A;  1B7Y B;  2ALY B;  2XWB B;  4GN3 B;  3FBU A;  2G9H D;  4MN3 A;  3P7J A;  3S1N H;  1DON A;  5HGQ A;  4R3L A;  1SRO A;  4QY7 A;  2I46 A;  3NP8 A;  5KRU A;  5NUC A;  2Z6K C;  3QIA A;  2ZOF A;  1YVC A;  3IRB A;  1KAW A;  2AFX A;  4ZBG A;  1VQL A;  3MAQ A;  1HR0 Q;  3S14 H;  3MRU A;  2G3T A;  5ELO A;  2NZH A;  4DA2 A;  1I94 Q;  4BBR H;  4X66 Q;  2I79 A;  2FFK B;  2HUG A;  1MBY A;  4R87 A;  1CTM A;  4BIN A;  1QVF A;  2MFI A;  3EO4 A;  2AKW B;  2M2L A;  1OXS C;  2V1C C;  2R93 H;  2EK9 A;  4NSQ A;  1K8M A;  1I4X A;  2EPB A;  3IEH A;  1S7K A;  2A19 A;  2PSW A;  1WD1 A;  2OWO A;  4X62 L;  1TWH B;  4DGZ A;  1A15 A;  1H9K A;  4R1J A;  4AQY L;  4QUS A;  5A2Q L;  2ZTC A;  1VQJ A;  1CPX A;  1F2P A;  2I07 B;  4L5T A;  2WIN B;  4YY3 L;  3PB6 X;  2JEW A;  3NA6 A;  4L89 A;  5EC4 A;  4C3H H;  2E2J B;  5F47 A;  3GTM B;  4LF4 Q;  5E1F A;  4GKJ L;  1UAP A;  2Z3K A;  4EQO A;  4MHD A;  3GTK H;  4A93 B;  4JI4 Q;  1O7Y A;  3GV6 A;  1B50 A;  3HOY B;  4ZYQ A;  1CX8 A;  2J8M A;  4XYO A;  3KFU A;  4WRD A;  3SK5 A;  2F1M A;  1PMR A;  2EY5 A;  2H1E A;  1QMU A;  2WAQ B;  4O1N A;  1DCZ A;  3H0G G;  2EJF C;  2XEJ A;  3B3V A;  1PYT B;  4RGM A;  4A4I A;  2D4P A;  3ERS X;  1EIF A;  2PMZ B;  4B3R Q;  1BVS A;  3LD2 A;  2LS0 1;  1M4L A;  1HZ9 A;  1YW6 A;  1BCP D;  4KY7 A;  2LKV A;  3E9H A;  2VQE Q;  4ZX8 A;  1I12 A;  2DXQ A;  4K14 A;  1ZEQ X;  4K5X A;  4IAL A;  1IBM L;  2VXW A;  4PMB A;  4DAV A;  3PF5 A;  5EBV A;  1TIQ A;  1Y1V G;  1IBK Q;  5T1G A;  4IJH A;  4OC2 A;  4EX5 A;  2F0D A;  2WSA A;  3SE0 A;  1B6B A;  3FXT A;  3NQT A;  4KD4 A;  1EZ6 A;  3D66 A;  5I2Y A;  2IY5 B;  2F0I A;  5CV8 A;  1KAA A;  2Z3O A;  1R3N A;  2J0T D;  3GTJ H;  1M44 A;  2WKC A;  4MBU A;  3X3N A;  1II3 A;  1J9O A;  1VQ9 A;  2X6G A;  2ASB A;  3KJO A;  3GTQ H;  3U4Z A;  3S2H H;  2MO1 A;  1ZO0 A;  4G7O C;  2A69 C;  3NE5 B;  3BJ8 A;  1JB3 A;  4B3S Q;  1VQK A;  2UXB L;  1S4Z A;  3EFA A;  4X65 L;  2UUB Q;  3F1Z A;  4G7Z C;  4WWV A;  4A3J B;  1PH8 A;  3E6Z X;  4CYN A;  3WOF A;  3CCV A;  1XNR L;  5C44 G;  4KOT A;  4P4I A;  3GYA A;  1KDC A;  1SEB D;  4PXD A;  2F0W A;  1TWG H;  4CJ2 C;  4ZRZ A;  3CU7 A;  4B3T L;  1I6H H;  1V9P A;  4CDD C;  3V8I A;  2B2W C;  1R4P B;  2EJG C;  5GAD C;  4JI6 Q;  4NGQ A;  4IOA A;  3S6H A;  2D2C C;  5LHY 1;  4DUY L;  2IWH A;  2E2D C;  1EEF D;  3ICE A;  1QQ9 A;  5EBC A;  4DXG A;  1LFW A;  4J3G A;  4AVA A;  2DNE A;  4HIM A;  4NGN A;  1VDZ A;  2N88 A;  3RZO B;  1JJC B;  4L6T B;  4A3L G;  3QG1 A;  2J7Z A;  4ZCK A;  1FVI A;  3BZD B;  4J1M A;  2YTY A;  4NKL A;  4BA2 I;  3D68 A;  1Z9F A;  1IU8 A;  1GD7 A;  3I56 A;  2IW3 A;  3DMU A;  3L3O C;  1WOC A;  3WOE A;  1LTL A;  3N5F A;  1NMF A;  2SNS A;  4BWG B;  1HRJ A;  4V0B A;  2J8N A;  3K81 C;  2JQO A;  4MFP A;  4RGN A;  3L0O A;  4UWI A;  2ID0 A;  3VA7 A;  4PXC A;  2DPS A;  2OOT A;  2B3G A;  3RZD H;  1BCP B;  2OZG A;  1Q7L A;  4XXE A;  2PJ4 A;  1E1O A;  3GTJ B;  3KR5 A;  2YYZ A;  3SXO A;  3I4M G;  5IYB G;  1XRY A;  4DR5 Q;  1IY7 A;  4UEZ A;  4ODG A;  4DV7 L;  1VQN A;  3RLN A;  2B2V C;  3TFY A;  2P5Z X;  5F09 A;  1KLU D;  4II9 A;  1L1O A;  1OZP A;  4O0A A;  1UWY A;  3T9Y A;  3E0J A;  1SRU A;  1NR4 A;  4JI2 L;  4LUA A;  4DNR B;  2NN6 I;  1DOM A;  1ET6 A;  2WKD A;  5DM7 3;  4HIK A;  1LAM A;  2Q0Y A;  4DV4 Q;  2A69 D;  3KR4 A;  2L5T A;  3I8Z A;  4XQJ A;  4UBR A;  4YY3 Q;  4GNX B;  1X55 A;  1X3Q A;  1Q8I A;  3CF5 A;  1XMO L;  1M4G A;  4ILW A;  3IKJ A;  5CV5 A;  4BY7 G;  1IHZ A;  3FMC A;  3H5Z A;  2B2V A;  3NEM A;  4KD3 A;  4DXF A;  4LF5 L;  4L8J A;  1TKH A;  2RVL A;  4ZKB B;  5C88 A;  1VMP A;  3TO9 A;  1TWA B;  3ULP A;  1F2Z A;  1ZYR C;  2I00 A;  4CBV A;  3W2D A;  1EFW A;  3KLW A;  4R6T A;  2R3Z A;  4A33 A;  4F0Y A;  4DAP A;  5IGD A;  3K7A H;  1YLE A;  1BUV T;  1SJH D;  4BXX G;  5K36 H;  3D31 A;  1RJT A;  1KDB A;  2QW7 A;  4QUC A;  3D7G A;  3J7A F;  4B3T Q;  2ZEF A;  4A3B H;  2JA6 H;  2CCZ A;  5ELY A;  1KLG D;  1K83 B;  3FEW X;  5JVG 3;  3PO2 H;  3K59 A;  4JI8 L;  1Q2D A;  2AJ6 A;  4RMF A;  3FEE A;  4UDU C;  2QA4 A;  4A3K G;  4JPB W;  4F88 A;  1EU3 A;  1Z47 A;  1E24 A;  2YGW A;  1K73 C;  3TT2 A;  3CDX A;  3NWS A;  3I4L A;  2OH1 A;  2EXZ A;  4A3L H;  2NWG A;  1EQV A;  2ZPA A;  2C35 B;  3SXN A;  2PZU A;  5H86 A;  2D5D A;  3FRP B;  4MMO A;  1JE5 A;  3PGZ A;  1ON0 A;  3D2M A;  1YVK A;  5CV7 A;  1B2T A;  1ILP A;  4JOI A;  1H9R A;  4CAW A;  4ZY2 A;  5IT9 c;  2ZT9 C;  5KYL A;  3VA5 A;  2V4D A;  1YJN A;  3R96 A;  4IPG A;  3ISZ A;  4K0K Q;  3A74 A;  3KDF A;  2R7Z H;  2ZTE A;  1SQH A;  1B44 D;  3IFE A;  3R2I A;  3SHL A;  3CXS A;  1Z4E A;  3VAT A;  3W6X A;  1MIU A;  1W3S A;  3TME A;  4E6I A;  2OU2 A;  3JVN A;  5CPA A;  3PIP 3;  1S5C D;  1KNA A;  3LWU A;  3IC1 A;  3S16 H;  4HID A;  2ZXP A;  4A3M H;  2EYO A;  4KOR A;  3D7D A;  2F52 A;  5A28 A;  2JJQ A;  4UAI A;  1ML0 D;  1KUY A;  4GLV B;  1IXR A;  3HOX B;  5J1Q A;  3LX0 A;  5C0X J;  1BCP C;  1V1O A;  4UP7 A;  1UE6 A;  1CHQ D;  3DM3 A;  1XPO A;  1L0C A;  3CME A;  1K28 A;  1I94 L;  2E2I B;  2KCW A;  1K3R A;  4PZ6 A;  4JI5 L;  1UUP A;  3S9M A;  4P6Y A;  4X3U A;  2QIL A;  3MXG A;  2OXP A;  2EBJ A;  4OC0 A;  4A3B B;  1FNO A;  2NVY H;  2F0O A;  3K58 A;  1Z9U A;  4FXD A;  2ZJQ A;  2OQ0 A;  4WJ4 A;  4RKL A;  1WCM B;  3NTH A;  2FJ2 A;  4KUA A;  4KHV A;  1BO0 A;  4GNX C;  4B10 A;  2V8V A;  2EUI A;  1SYB A;  1F9Q A;  2K5V A;  1Z8W A;  3QAY A;  3MA2 B;  1JQY D;  2OF1 A;  1XXG A;  2EJM A;  4K30 A;  4CGN A;  3M3Y H;  1GUG A;  2JA6 G;  3NK9 A;  4J8Q A;  2JA5 G;  4C7H A;  4ZQ3 A;  2ZXR A;  3S2H B;  3FEC A;  1Z5R A;  4DR5 L;  1SFO H;  1ZLH A;  4DV0 Q;  4B11 A;  4A93 G;  3DM1 A;  1CFM A;  3ND9 A;  4UCM A;  2I5H A;  3F2D A;  1PFB A;  2OT2 A;  3U4V A;  4MTN A;  2EO8 A;  1SNQ A;  2CTB A;  5IP9 G;  1WTR A;  2Q4Z A;  1U5K A;  2PI2 A;  2AUJ D;  5IIF A;  4LAA A;  4ULL A;  1TXR A;  4OO1 H;  2R92 H;  4BY1 G;  2RF4 A;  3R8B A;  5FLX L;  2XRQ D;  5JJZ A;  1EOV A;  3EJI A;  3U50 C;  3Q23 A;  3H8G A;  1LO5 D;  4MHZ A;  5JM6 A;  4JV5 L;  1EY6 A;  1NBW A;  3BVZ A;  4Q0F A;  2SDF A;  1FGB D;  4EQP A;  1TXY A;  4DUZ L;  1XNQ L;  4FF4 A;  3TO7 A;  3F2U A;  3GUX A;  4DKA C;  3FRM A;  1SYG A;  4UWJ A;  2K14 A;  1HZA A;  3KI9 A;  2DY7 A;  3T1H Q;  2J4X A;  3QR8 A;  3OWE B;  4DAY A;  3EY5 A;  1JCK B;  3TZD A;  4DR4 L;  2J9A A;  1E2W A;  4M6H A;  5DWN A;  3HOX G;  4JOI C;  2DUD A;  1KIX A;  3BJU A;  2BA1 A;  1T5X D;  2FMM A;  3JAM E;  3M7N A;  3CC4 A;  4CGL A;  4WJ3 M;  4TKO B;  1IL8 A;  4DV2 Q;  3ISX A;  4K5V A;  3TO6 A;  2NVQ H;  1Q46 A;  1EQT A;  2A73 B;  1FGU A;  1RTO A;  1E2Z A;  1MJC A;  1PTO D;  2CH4 W;  1HNX Q;  1EWI A;  2C6P A;  4C7I A;  3GD7 A;  2PZW A;  2RCN A;  2H4O A;  2GVB A;  4IUT A;  3CXC A;  1VQ4 A;  2Q2U A;  1HHV A;  1CSP A;  5ISR A;  1HA5 A;  2DY8 A;  2ANP A;  4F9V A;  2WB1 E;  4M1U B;  1VQ7 A;  4ZUJ A;  2E76 C;  4FYD A;  1G2T A;  1OXU A;  4FVM A;  3SEB A;  4Q5V A;  3QO2 A;  4RS2 A;  1SXT A;  3PUV A;  4JI6 L;  3A0J A;  2OR4 A;  3R9F A;  2R7D A;  2NN6 H;  3I55 A;  2RSN A;  1EOT A;  5HGT A;  4DPG A;  1LOK A;  3GTG B;  4EQN A;  1CI3 M;  1BR9 A;  1EZ8 A;  1C4Q A;  4JI1 Q;  1TY2 A;  5KNB A;  5DNF A;  2QDL A;  1VHS A;  3EA6 A;  2ICI A;  1SSO A;  4H2K A;  4BBS G;  3G7L A;  5IGC A;  4YGO A;  4S3S A;  5IGG A;  1BPM A;  1P4N A;  1WTO A;  1C7Y A;  4CKE A;  3H8F A;  1ASZ A;  2JA7 B;  2I3C A;  5K8N A;  2A8V A;  2YU9 B;  1XEB A;  3VWE A;  5LL6 X;  2EK8 A;  4IAV A;  4KI0 A;  3C1E A;  1V1P B;  1JWQ A;  5HXD A;  1ASY A;  2R7Z G;  1BQQ T;  3HEJ A;  5COR A;  1J4J A;  4KUB A;  1CA6 A;  4PK2 A;  4YCU A;  1KUX A;  3HKZ G;  2B4D A;  3FIX A;  2RCF A;  4M6I A;  1HFN A;  3QB3 A;  2K03 A;  1X3E A;  5KTD A;  2XNA C;  5IYB H;  1GKH A;  1B9M A;  1HH2 P;  3Q0A A;  2UXC L;  1SNM A;  1I5F A;  2JDC A;  3PFE A;  3E0E A;  1B87 A;  3R95 A;  2PYK A;  1LAN A;  1K8A C;  1AMP A;  1RL2 A;  4RHS A;  4P4B A;  1CBX A;  2UUC Q;  1D6E C;  1DE4 C;  2VBQ A;  4ZYS A;  1SMX A;  5C0X H;  4P45 A;  3VYT A;  2FE7 A;  3SHP A;  3CKI B;  3CPF A;  4LFA Q;  2RSO A;  3CCE A;  4GS4 A;  1G91 A;  2K5D A;  4KMU C;  2ZEM A;  3HKS A;  3PO3 B;  1B3Q A;  1S5F D;  3SJF A;  4DAM A;  5K5P A;  4KKS A;  2JBJ A;  1KUV A;  3CCM A;  1YSJ A;  4LF5 Q;  2ICE C;  1LCP A;  4A3D G;  5C3E B;  1KL9 A;  1OXV A;  3D4U A;  3K9U A;  3E0K A;  3Q22 A;  5IYC G;  1N34 Q;  1STB A;  4XNH C;  4NMZ A;  4ZAI A;  2QF7 A;  3ULL A;  4XPK A;  1EWC A;  1YLO A;  4A3M B;  1RKN A;  4GZY C;  4IUU A;  4F0X A;  2HHH L;  3AYH B;  4AG7 A;  3EBE A;  4AVC A;  2CNT A;  5K8O A;  3KF6 A;  1KTK A;  1EIY B;  4JI8 Q;  3GIU A;  5HMN A;  4WJW A;  4DUK A;  4UP8 A;  1QNK A;  2E5L L;  3PIO 3;  4LUV A;  3IU1 A;  3BYY B;  3BZC A;  5KNC A;  4TQU S;  2A6H D;  2OTL A;  2F0V A;  3MXN A;  3NH8 A;  3F8K A;  2NVX H;  4YU9 A;  5LMU L;  1GHE A;  2E2I H;  2LFN A;  2X6L A;  4AYB E;  2Z3N A;  2O2L D;  3D3S A;  3MWY W;  4GNX A;  1IOF A;  3HLP A;  2OQK A;  4JBK A;  3ONA B;  4MFQ A;  1TKJ A;  2BOA A;  2B2U A;  3VYS A;  1Y0R A;  3I3G A;  2K5W A;  2F3I A;  1SBB B;  2GFQ A;  5HVF A;  4CGO A;  4M6G A;  1ESF A;  1PYB A;  2AWO A;  1HJP A;  3FDT A;  4A3J G;  2YNE A;  4H6U A;  4X3K A;  2MGS A;  2VW9 A;  2F3W A;  1FD7 D;  4XQQ A;  1Y1W B;  4G4K A;  2B2U C;  4Q7A A;  3T1Y Q;  4YWL A;  1FNV A;  2ATW A;  3UDF A;  4A75 A;  1Q2C A;  2F0Q A;  4DV1 Q;  4F6A A;  4LK1 C;  3NHH A;  1ENF A;  4LQG A;  2L55 A;  1TWH H;  3IFT A;  1TY0 A;  1CJW A;  3AU7 A;  4NXN Q;  2KCT A;  2HQE A;  4CGP A;  1CQF A;  2ES2 A;  4OLL A;  2PIY A;  4BA1 I;  5LL6 S;  4PG3 A;  2WAQ E;  5IB9 A;  1GUO A;  2Q8R E;  5JPM C;  4JI0 Q;  3BI1 A;  1SFO B;  1N33 Q;  2VI7 A;  4IJL A;  2QEX A;  4UEF A;  4K2L A;  1S5B D;  4C3H B;  2ZM6 L;  1I4R A;  2NTS A;  2QML A;  1IYL A;  3PSI A;  3UE1 A;  5C0X I;  2B58 A;  4UFW A;  2O4H A;  4PK3 A;  1A0I A;  1HUM A;  1TKW B;  1L1O C;  3MTS A;  3BDO A;  3OWF A;  2KBN A;  3A54 A;  5ELB A;  3S9L A;  1KAB A;  2JA8 H;  2IJ0 A;  3UI2 A;  4CPA A;  3K5L A;  1NMG A;  1WWZ A;  3G6J B;  1XPR A;  1X32 A;  3KUP A;  2AHO B;  4OEL B;  4UP9 A;  2FXF A;  5IYD G;  1I1D A;  1KRS A;  4O23 A;  2AUK A;  3VR5 A;  2E5L Q;  3G3S A;  3QWN A;  1H9J A;  2MHV A;  1EY4 A;  1QG7 A;  1EYD A;  1N71 A;  2JA6 B;  3PZJ A;  2B8F A;  4GLX A;  1YK3 A;  2R61 A;  5D65 A;  4HJ5 A;  3HG9 A;  3H6M A;  4X3S A;  4NFR A;  2UUB L;  1AE2 A;  4C1N K;  1Y1W H;  4KSF A;  3GTO H;  4KJN A;  3M4O H;  3G4S A;  3NE8 A;  1X3P A;  1HR0 W;  1QSO A;  4YFJ A;  5AJ3 Q;  2MO0 A;  4ZKC B;  1RTN A;  5HY6 A;  3UDI A;  3LWE A;  4HNX B;  4JYA L;  1Q90 A;  2BE5 D;  4RGT A;  2YTV A;  4KKU A;  4UPA A;  4A3B G;  1M1K C;  3IJ3 A;  2V77 A;  2PJC A;  1Q3L A;  4Q36 A;  1TS2 A;  3PO2 G;  3CPA A;  3PP9 A;  4C3I B;  2QVP A;  4R9W A;  4YWY A;  2PW5 A;  2SOB A;  2M00 A;  3MXU A;  4MHP A;  3JTK A;  5G22 A;  1XTD A;  5FKA C;  1SE8 A;  2KQ3 A;  5M5W B;  3DUZ A;  3RMH A;  8CPA A;  4OIJ A;  2XEG A;  1E22 A;  1LV9 A;  1XNQ Q;  4KOU A;  2IPK D;  3H4Q A;  1PRT C;  4CAF A;  5KYI A;  4KTA A;  3CC2 A;  1N32 Q;  2GLF A;  4C68 A;  2AMC B;  2RHQ B;  4DV4 L;  5IX3 A;  2WB1 G;  2ZW5 A;  1F9R A;  3KF8 B;  3D3R A;  3CC7 A;  3DWQ A;  3NWT A;  4JYW A;  4JI0 L;  2XGT A;  1SLJ A;  2GE3 A;  3V96 A;  5BN4 A;  1QCB D;  1PHJ A;  1AFP A;  1VQ8 A;  2KCN A;  3K0Y A;  2VXK A;  2KA7 A;  4Y49 C;  2Z11 A;  2L9H A;  4N9P A;  3KK7 A;  5DAU A;  4DV0 L;  3J7Z C;  4XTC S;  1IYU A;  5IGF A;  1UE7 A;  1T5E A;  1LTR D;  1XTC D;  4KVO E;  3H0G B;  3CPX A;  4G57 A;  1IBK L;  4ORF A;  4N8X 1;  2XWJ B;  2K50 A;  1V43 A;  2AFS A;  2ZEG A;  2C5C A;  1BOB A;  2CHB D;  5EPJ A;  2ZEN A;  1YVO A;  4KN4 C;  2XVS A;  3HFZ B;  4J6H A;  1TVX A;  2WII B;  1UE5 A;  2VUM H;  4KVX A;  1LTB D;  1PH7 A;  1OO9 B;  3OYY A;  4KY5 A;  5IT9 E;  2PO4 A;  3U9O A;  3TS2 A;  4R7M A;  5KND A;  3BI0 A;  1LT6 D;  4EQ5 A;  3WC6 A;  3S9N A;  3T1H L;  2D0O A;  2BE5 C;  2Y0S G;  1XJO A;  2VQY A;  5H84 A;  4OWT B;  3HOY G;  1CP7 A;  4BBH A;  5CNP A;  4B13 A;  1NMT A;  4DFA A;  3MFY A;  1K8O A;  2F8H A;  2VEZ A;  1M4I A;  4L8A A;  5CBM A;  4OHJ A;  3B35 A;  3PBB A;  5A35 A;  4X3T A;  2Q4Y A;  1B8A A;  2MNA A;  3DEO A;  1VHO A;  4JYA Q;  2CIJ A;  3F2B A;  2K05 A;  2VQE L;  2CH4 A;  3RN5 A;  3I9S A;  4TRD A;  2Q8T A;  1Y7E A;  3GTM H;  5C4J B;  3NEL A;  1STN A;  2HQL A;  4KJO A;  4A93 H;  4BY1 B;  3LMS A;  3E5S A;  1V8Q A;  3HOU B;  4IFD G;  5IE8 A;  4OC1 A;  3HOY H;  3AFQ A;  4A3I B;  4ZI6 A;  3SXH A;  3VR4 A;  2CTC A;  2F0M A;  4IUN A;  3T51 B;  4KLK A;  1J5E L;  2ZW4 A;  1QZH A;  2PJ0 A;  4FD4 A;  4P10 A;  2JEB I;  4JVZ A;  4FXK C;  2PRB A;  1XIX A;  3HUV A;  3J81 i;  1WTQ A;  2VS1 A;  4HJ9 A;  4DR1 Q;  4KHP L;  1AE3 A;  4MJ8 A;  2PJ5 A;  3ZJ0 A;  3FED A;  3F2C A;  3MEH A;  3MN8 A;  4AYB G;  4DV5 L;  4H44 C;  2FMC A;  1QUQ A;  1X3F A;  2FIN B;  2FXQ A;  4NPS A;  1SN8 A;  3NEN A;  4LWC A;  3TN2 A;  1XFO A;  4P4E A;  1X6O A;  5J8F A;  3SK6 A;  1YR0 A;  2Z4I A;  1G8Z D;  3GO5 A;  4MXU A;  4C3J H;  1BKB A;  2GA4 B;  4CJ0 B;  2H5M A;  1ZKO A;  4DR7 L;  5I9P A;  1ZG8 A;  1HDQ A;  3PF4 A;  3T8W A;  5C4Z A;  1AZQ A;  1LAC A;  2WYR A;  4O42 A;  1BLL E;  4QQB X;  1VF5 C;  4YIJ A;  1N33 L;  4Y49 B;  1M1D A;  2NTT A;  3B3T A;  5A27 A;  3MXP A;  5DM6 3;  3KYH C;  2DN8 A;  2EOT A;  2JE6 I;  2BA0 A;  3FHW A;  2FT0 A;  1AN8 A;  4LQ6 A;  1WTX A;  4A3E G;  5I4M A;  3J80 E;  1FNU A;  2ZXO A;  4H0L C;  1EIH A;  1GUT A;  1H9S B;  2CQO A;  1U4M A;  3A56 A;  3T4A C;  4OON A;  4MCS A;  1X3G A;  2EE1 A;  3EQL C;  2N3S A;  4X64 Q;  4DV3 Q;  1JOR A;  1LM0 A;  3ER0 A;  1N32 L;  3CQZ H;  5IP9 H;  5C0X G;  1GHJ A;  4OL7 A;  3ZJY C;  2FIA A;  2PJ6 A;  1UWV A;  2HIV A;  5A2Q E;  5LYL A;  4P4J A;  1TWC B;  4JI2 Q;  3T90 A;  1VF7 A;  3CCL A;  2WAQ G;  1LTA D;  3GDE A;  3KHZ A;  3LGJ A;  5LYD A;  2UU9 Q;  5GAG C;  4CYQ A;  4PSX A;  2C6G A;  2B63 G;  4PZ8 A;  1G29 1;  1VQD A;  3CCU A;  4Q38 A;  4K5W A;  4OKO A;  4B5P B;  2AWN A;  4XPL A;  3FKI H;  3H09 A;  3AB9 A;  1I4H A;  5HUR A;  1EU4 A;  1HXY D;  3HOZ G;  5M3F H;  3KGQ A;  2F0N A;  1LTT D;  1BNZ A;  4LF9 L;  1XPU A;  1NAP A;  3I3C A;  4G1P A;  4DV5 Q;  4FBE A;  1U9R A;  4JI3 Q;  1NSA A;  4ZUI A;  4OME A;  3KLR A;  2YND A;  4R4T A;  5ELD A;  2Q7B A;  4K0K L;  2CF4 A;  1LT3 D;  3TZU A;  2ZEO A;  3RAM A;  1ET9 A;  4PPZ A;  5HH1 A;  1Y9W A;  3KKW A;  1G51 A;  1RD9 D;  2D9U A;  1ZG7 A;  4DR4 Q;  1XMQ Q;  5AG5 A;  5GQO A;  4HJ7 A;  1VQ6 A;  2D62 A;  3WAB A;  1E1T A;  1EIG A;  1PCA A;  3ITP A;  3S17 H;  2JA5 H;  3RN2 A;  1JMC A;  1PYW D;  2F3V A;  5M5W H;  4OC3 A;  1EY9 A;  4PZ7 A;  3V05 A;  4AIM A;  2K5T A;  4A39 A;  2E2H H;  3H8E A;  5E4X A;  3W1G A;  1X10 A;  4FO2 A;  1MK4 A;  2K33 A;  3TTH A;  4CJ1 B;  1P8L A;  2L11 A;  3J7A 5;  1YQE A;  2R92 G;  1Z8L A;  4KOW A;  1Y9K A;  5J3B A;  4AG9 A;  2ENB A;  2PJ1 A;  3BXM A;  4KSI A;  3FH4 A;  3CRL C;  1R4Q B;  1VHE A;  4FD6 A;  3GTK B;  1MJE A;  1K8G A;  5JJI A;  1BAV A;  4OWX B;  2HT1 A;  2JBK A;  4ONW A;  3G6E A;  3NH4 A;  1C8C A;  3H0G H;  2PE3 A;  3PO2 B;  4R4C A;  1YZ6 A;  4UIA A;  1AW7 A;  2NSM A;  4UFV A;  2R7H A;  5M5X H;  4ID6 A;  4RFB A;  2Y0M A;  4MHN A;  1CUK A;  1VQF A;  2DF5 A;  3KF8 A;  5C5L A;  1PH1 A;  2ARH A;  4LUO A;  1Q1B A;  4X64 L;  2EWB A;  4MCQ A;  3GTP B;  4DK0 A;  2VNU D;  4UIB A;  4C2M H;  3D8G A;  4NP5 A;  3HOW G;  5J8C A;  1IW7 C;  1VQM A;  4P44 A;  1WVL A;  4NGM A;  3HOZ H;  2KHJ A;  1K9M C;  4F7X A;  3MZ5 A;  4MFL A;  1L0X B;  3P2H A;  1Y1V H;  1ELL P;  1WD0 A;  3RBU A;  1D5M C;  2POK A;  3HRZ C;  5CMD A;  2JA5 B;  4MFJ A;  1ARM A;  2F0U A;  3HZX A;  3C26 A;  1LAP A;  4CGM A;  1ILQ A;  2H5X A;  4IUP A;  3TP7 A;  1N8R C;  2UUA L;  4K3N A;  1PRT B;  1NSN S;  3EVQ A;  3NFZ A;  3HKZ E;  1NSL A;  2JA7 H;  1STH A;  4CHT B;  1Z8X A;  4PQA A;  2Q2H A;  5ELN A;  4B3M L;  3SJG A;  1MI2 A;  3SVM A;  3K5M A;  3FF3 A;  4HNY B;  4A3C G;  3KLS X;  1LUZ A;  1CKM A;  4OX9 Q;  4DNI A;  4A3D H;  1LT4 D;  2NUC A;  5FK9 C;  1HTL D;  2QKI C;  2YV5 A;  3GTQ B;  3GY9 A;  4XT3 B;  5IYC H;  4PV6 A;  4P72 A;  4NF1 A;  3N6R A;  1BDO A;  1YJW A;  2Y0S E;  4APV A;  1JJG A;  1KHI A;  3NH5 A;  2KJX A;  1M8A A;  1GYT A;  1V1Q A;  2ZEP A;  5FO8 B;  4U9Y A;  3RZO H;  1HNW L;  1SNC A;  1I4Q A;  4B9W A;  2Z0Z A;  4DR6 L;  3VR3 A;  5LMU Q;  3R93 A;  2PJ8 A;  4B5O A;  2NVY B;  3IO1 A;  3H3V C;  2O28 A;  2PR1 A;  3KBX A;  4OIW A;  2WUU A;  2B3U A;  1VIX A;  2A6E D;  4POG A;  1XNR Q;  2VL6 A;  2OB0 A;  5JEA J;  1K0R A;  2QCP X;  4JG2 A;  4P2C B;  5E96 A;  1JWM D;  1I4P A;  1KRT A;  1MJA A;  1E7Z A;  4LJZ C;  1MD2 D;  2EVB A;  2K5Q A;  1Q86 C;  1WTV A;  1VCI A;  4HCE A;  4CDC C;  1HNZ L;  4F8M A;  1QSN A;  3S15 B;  2R8V A;  3Q8D A;  5IT9 L;  1RDP D;  3J7A V;  4IUV A;  4FUU A;  5JQ4 A;  2AQ3 B;  1NNX A;  2F0G A;  4GLA C;  4EFD A;  4GN5 A;  1M4V A;  3CPW A;  2AFU A;  5I2X A;  4M85 A;  2AFM A;  3NBH B;  2HB6 A;  1U0L A;  2RDH A;  1YGH A;  2HC9 A;  1HCZ A;  2PNR C;  1AH9 A;  3CQZ B;  1P16 A;  2HV2 A;  1DTD A;  3CZX A;  5C4X B;  2CWA A;  4GKK L;  5KTA A;  5HVH A;  2Q44 A;  3SI0 A;  3PQI A;  4HSP A;  4OEM B;  4U68 A;  3WC5 A;  3VR6 A;  1FT7 A;  4A3F H;  1BOS A;  2NMT A;  4KSA A;  3TCV A;  4HIO A;  1PUA A;  4JD6 A;  4JLY A;  2A4N A;  4ZLT F;  4AYB B;  3M85 A;  2Q51 A;  5C4H A;  4DR2 L;  2CKZ B;  2REE A;  3W91 A;  2C6C A;  2UUA Q;  1D5X C;  3EC4 A;  3L2P A;  5F2D A;  3DHQ A;  3J7Y W;  1TF8 A;  4BY7 H;  2V8D A;  2HDL A;  2K52 A;  4LW1 A;  1E0B A;  4P4D A;  3OTO L;  1K4J A;  2JDD A;  2PMZ E;  5HVG A;  4LFA L;  1HZB A;  1JQG A;  1I4G A;  1YME A;  2O5I C;  3S1R B;  1HA6 A;  2YNC A;  3FKI B;  5JGF A;  1JE4 A;  3OOC A;  3TRE A;  4MFZ A;  1WK4 A;  1LYL A;  1GHK A;  2EXD A;  2WB1 B;  2AFW A;  4QB4 A;  1Z4R A;  2VL1 A;  4A2Z A;  4KOX A;  3I4N G;  3SI2 A;  4NGR A;  3B6Y A;  1CP6 A;  3TE4 A;  4LX9 A;  4R8I A;  2VY3 A;  4RAU C;  1XMB A;  1N36 L;  4FD5 A;  1QJO A;  3S2D B;  5LMN Q;  4C2Y A;  3T13 A;  3TRZ A;  2RDF A;  2B5G B;  4KZT A;  1FR3 A;  4PMC A;  2R7Z B;  5FO9 B;  5BN5 A;  4KOS A;  3CXP A;  3JAM i;  3J80 i;  3PB9 X;  3BDC A;  3OMC A;  2C9O A;  4DU9 A;  1WI5 A;  3G71 A;  2N55 A;  4UHV A;  3HOW H;  4JI3 L;  3EXN A;  1XJV A;  4JI4 L;  2F0L A;  2UUC L;  1L2F A;  1EYC A;  1GO3 E;  2R6G A;  3VYR A;  2EY1 A;  2RKS A;  1Q8K A;  4DV6 Q;  2ABZ A;  5LRK A;  2MP1 A;  5IGB A;  2PIZ A;  5AFW A;  1RF2 D;  3K8A A;  1GM5 A;  3FKI G;  2BH8 A;  3FNC A;  2OTJ A;  4OX9 L;  1PZJ D;  1UFH A;  1LTG D;  3ULJ A;  1L0W A;  5F46 A;  4A3E B;  3DWP A;  2MQH A;  1E3P A;  1Y14 B;  3TS0 A;  3VH9 A;  2F0K A;  4K8J A;  3K9T A;  3I2Z A;  5J39 A;  1CQV A;  3OHX C;  1QE6 A;  1YHB A;  4H7B A;  1SDF A;  4AXV A;  3C46 A;  2E75 C;  3W6S A;  2F0J A;  3KL9 A;  4QCL A;  1XYI A;  1YIJ A;  4OWW B;  5M5X B;  2K1B A;  4ABN A;  5D29 A;  2PI2 E;  4KK7 A;  3PB4 X;  4RUH A;  3K5N A;  3HOX H;  3UDG A;  2I0Q A;  1KWM A;  2Q43 A;  3G48 A;  2LXK A;  3GTO B;  3M4O B;  3V38 A;  3IWG A;  2O4X A;  3B3C A;  3EN2 A;  4JW0 A;  3QJY A;  2Z3P A;  3GTL H;  4C3J B;  1PH2 A;  3PIO A;  2VB2 X;  1D2B A;  3SI1 A;  3PUX A;  3JAM L;  3HOU G;  1LAB A;  4NXM L;  1ENA A;  4LF9 Q;  1NCV A;  1LTS D;  4WFN 3;  4OO1 I;  3SGI A;  3GB0 A;  3BLN A;  5JJK A;  3AEV A;  4A3G G;  3KZW A;  4OAE A;  1TQO A;  3OTO Q;  2ZW6 A;  4MY0 A;  1CHP D;  1STE A;  2EVN A;  2BL1 A;  1XF8 A;  2IHF A;  2B29 A;  4HSV A;  2AFO A;  5CV4 A;  2XEF A;  3STB C;  3J81 j;  4JBM A;  3A5U A;  3BDL A;  1IYK A;  1ELM P;  5EKL A;  4YCW A;  3KOJ A;  4RN7 A;  1AUG A;  2NN6 G;  2Q2I A;  2R92 B;  3PO3 G;  2PQA A;  2K7V A;  4YHH L;  4LMQ D;  3HOW B;  3A7A B;  5E7N A;  4DR7 Q;  3BYT B;  3KQZ A;  5ELF A;  3D67 A;  3A5Z B;  5EKI A;  4NEX A;  3X3M A;  5C3W A;  4I49 A;  5JH9 A;  4ZGY B;  3CP0 A;  5FO7 B;  1Z8T A;  1Q12 A;  1V0C A;  2X69 A;  2PVW A;  5C44 H;  2ZXV A;  2ZTD A;  3CRK C;  4PNY A;  3TP6 A;  5KEE A;  3DGV A;  4H6Z A;  3VWD A;  4A3E H;  5G3L F;  4A3M G;  2V8G A;  4H89 A;  3ZZI A;  4KN7 C;  1EFI D;  1NJI C;  5M3M B;  2RC4 A;  5JPH A;  2IJZ A;  1S3O A;  4HCS A;  4LFB Q;  5CC4 A;  2NVX B;  3B8G A;  3CW2 C;  5C82 A;  4POF A;  5I6W A;  1MSG A;  4X62 Q;  2EZV A;  2FS5 A;  2TSS A;  3TDQ A;  5J22 A;  3U58 A;  1S7N A;  3CCQ A;  4QGU A;  4JCV E;  1KQS A;  3D2P A;  4NGS A;  2EQS A;  1EQQ A;  2MUY A;  1VQI A;  3I70 A;  5CYU A;  4IFD H;  1YNN D;  3DLJ A;  4XNH B;  2PRQ A;  3EIV A;  5DWM A;  1EY7 A;  4XDX A;  5KGU A;  3CAM A;  4A3I G;  2Z6K A;  2R1I A;  2VUM B;  4FNF A;  2CVR A;  4JV5 Q;  4RGO S;  3RR5 A;  3W3A A;  5IWA Q;  4OC5 A;  3P20 A;  1I3Q H;  2ZED A;  3MFG A;  1WTH A;  3C1F A;  2EYH A;  2UXC Q;  1OXT A;  4IPC A;  2PQA B;  3WDN A;  2C1C A;  1N34 L;  3NUC A;  4RCN A;  4A3C H;  3A7L A;  5AGE A;  4C3J G;  2BEI A;  1PTO B;  1DM0 B;  4MFK A;  2M9V A;  2DEA A;  4B6Z A;  4GN4 B;  4E8O A;  4B14 A;  3DNS A;  4E2A A;  3TQY A;  4A95 A;  5F49 A;  2B63 B;  3ND8 A;  1CZW A;  4MHY A;  4NGT A;  2PJ3 A;  2Z3L A;  1XX8 A;  1FL0 A;  2J8R A;  3JC6 6;  1U4P A;  1YJ9 A;  4A3G H;  4A3F B;  4DJL A;  1XMO Q;  1PH6 A;  1HR0 L;  4R3K A;  2WPW A;  3HOU H;  5LYI A;  2QDB A;  1IBM Q;  3TX8 A;  2YU9 H;  1Y8O B;  3QAH A;  2K01 A;  1VGY A;  3KF6 B;  4GXH A;  2F0T A;  4MNO A;  4R4Q A;  2Z3M A;  1KD1 C;  3MEF A;  1FJG L;  2K5H A;  1IL2 A;  4ZY0 A;  4C3H G;  4ZX9 A;  1WCM G;  3GTG H;  2ZW7 A;  4L5Q A;  4KVM E;  2L4N A;  3MGD A;  1J8I A;  4RA8 A;  2AE6 A;  3K2K A;  1WTW A;  4AB7 A;  3MVV A;  4CRZ B;  1RCV D;  1ZXT A;  2O5J C;  4AH6 A;  5D3D A;  1TS5 A;  3HOV H;  3TSS A;  4PSW A;  4LFC Q;  4RH6 A;  3L9A X;  5CV6 A;  4DK3 C;  4LUZ A;  4P74 A;  4B08 A;  2KHS A;  1H95 A;  3DEP A;  2PCU A;  1EY5 A;  1JOK A;  2PQE A;  5M5Y B;  2PJ7 A;  1WYD A;  3FP9 A;  3OMG A;  4QF4 A;  3BJ7 A;  1PLF A;  3VDY A;  2ATR