3LWUA

Crystal structure of putative succinylglutamate desuccinylase/aspartoacylase (yp_749235.1) from shewanella frigidimarina ncimb 400 at 2.10 a resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
372
structure length
372
Chain Sequence
MTKAIQSSVQVGELATGQALTVPIYSFMGSENSAPSVYIQANVHGAEVQGNAVIYQLMTLLEGYQVLGDITLAPLANPLGINQKSGEFTLGRFDPITGVNWNREYFDHNVDIQNWYAEHQHLTNSELFCAYRSMLVETCQARLTHSFGISTGHRLAVNLQAMAHQADIVLDLHTGPKSCKHLYCPEYDIDAARFFSIPYTLIIPNSFGGAMDEATFCPWWQLTEYATSQGREFSVPVSAFTLELASQERIDLADALEDAKGILAYLSHRGVIAEKVNPASMERFGCYLKDYKKFHAPKAGLIEYCASVGEPLTAGKPLVNILRIDLYGSEQAYQAISLPMDCVPILHFASASVLQGTELYKVMTNVFPLQPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative succinylglutamate desuccinylase/aspartoacylase (YP_749235.1) from Shewanella frigidimarina NCIMB 400 at 2.10 A resolution
rcsb
source organism Shewanella frigidimarina
molecule tags Hydrolase
molecule keywords Succinylglutamate desuccinylase/aspartoacylase
total genus 113
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3lwuA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3lwuA01
2C1CA 2V77A 1ELMP 2FVGA 4DYOA 3NE5B 1LOKA 3BHXA 5F09A 3PB4X 2EK9A 5HVHA 4ZY2A 4MMOA 3GQBA 2JE6I 1LABA 1CP7A 2PPBC 1UWYA 4P4EA 1QJOA 4P4BA 4KKUA 3PUXA 3D7DA 3NA6A 3PBBA 1H9KA 4F9UA 3KZWA 2PNRC 1RTQA 2A69D 3HGBA 3I72A 3VA7A 5K8OA 2EK8A 2O4HA 1LACA 1TKWB 3VR5A 1GUTA 2DN8A 2E75C 2ANPA 2F7VA 1FT7A 4L8JA 1HPCA 2AUKA 1CX8A 4WJBA 3H94A 1H9SB 3PEIA 1FR3A 1OXXK 3PUYA 3W3AA 3OPOA 3QIAA 3A8IE 2LMCB 3B3WA 5JEAG 2BOAA 5K8PA 2EJFC 2PJ0A 1HDQA 3OOCA 4P4IA 3SJFA 1VIXA 1FYCA 2ZT9C 3M85A 3BI0A 1CPXA 2ABZA 2PRQA 4UEFA 1H9MA 5IB9A 4GZYC 2JEAI 2VL1A 3D66A 4TNUA 5KNDA 3ISXA 4IAVA 2QF7A 3MRUA 1B9MA 3GB0A 4FBEA 2K33A 1Z5RA 2C6CA 1GHJA 3D7FA 1E2WA 5BN4A 5LYDA 3VR2A 4PPZA 1YW6A 1ZG8A 4MCSA 4JBWA 2CIJA 3FJUA 1VHEA 1YMEA 1DXMA 4MHNA 4BA1I 1IGBA 3CPXA 3HUVA 1HQMC 3CRKC 1GHKA 2L5TA 2RB7A 4ZY1A 3FECA 2RFHA 2ZEPA 5C0XH 4BA2I 1TKHA 2JEWA 4NGSA 1Q1EA 1B9NA 4JZ0A 4P4DA 2CTCA 1Z6HA 1XRYA 1R43A 3PFOA 1OXVA 3BI1A 4MHZA 4R6TA 4XIGS 1DCZA 1GYTA 3FPPA 3WC5A 4IFDG 1K8OA 1VF7A 4R7MA 4KN7C 3ND8A 3BG3A 2O53A 1IYVA 1Z7TA 4LJZC 2V8HA 2GLFA 4NJRA 1ZG7A 5K36H 3N5FA 1Y69U 3M7NA 1HDUA 2XEFA 2PJBA 3FVLA 2Q4ZA 3H8FA 1DE4C 4OC2A 3OW7A 1EWHA 1Y0RA 3IWWA 4TWEA 3KQXA 3KHZA 1F57A 1XFOA 5HXDA 3IFTA 5ELYA 3WDNA 4BD9A 4NGNA 4FWUA 4OC1A 2OOTA 3PB6X 2IT1A 1LAMA 3B3CA 3BXMA 4H2KA 4X8IA 5JGFA 4R8FA 4OKOA 1OBRA 5KNBA 2PJ6A 3H8EA 3MN8A 5D29A 2AFWA 2HC9A 2PJ7A 5CBMA 3D31A 1V8QA 1ELLP 2PJ1A 2PVWA 4PQAA 3BDOA 2PJ8A 2AFMA 1LCPA 1Q12A 3CT9A 5K8NA 3N6RA 3H8GA 2DEAA 4OC4A 1ONLA 2OR4A 1TF9A 2Q51A 3P20A 3GUXA 2QJ8A 4GM5A 3D67A 3FEDA 1HEEA 3FEEA 3V38A 3B2YA 4MCRA 4PXEA 3DXJC 4JK1C 4IQZA 3RLFA 3WABA 3T8WA 2WYRA 1CTMA 4FUUA 4NGPA 2F1MA 3NFZA 4EMEA 3CDXA 3CPAA 1HTPA 4MCQA 3T53B 3RAMA 3L7ZC 4I7ZC 3KR4A 1H9JA 3M4YA 5BN3A 4OGQC 4A38A 3PB8X 2EJMA 3KR5A 2PIZA 1YNNC 2C6PA 1TF8A 1BDOA 1K8MA 4F9VA 2V8GA 1YSJA 2J9AA 4OIWA 1Y8NB 1IW7C 1H9SA 4OMEA 2BCOA 5LYLA 1E2VA 4O23A 1O78A 3D4RA 4W9YA 4KHZA 2GLJA 4P45A 3D68A 4KMUC 7CPAA 4UIAA 1DD2A 2E76C 1Y7EA 5JH9A 1IY7A 3I1UA 3LMSA 3NH8A 4IHMA 4WWVA 8CPAA 3IIBA 2ZEDA 1IW7D 4Z65A 2PJCA 1F2OA 3T51B 3PUZA 4A39A 3B3SA 2A69C 2ZEFA 1Y8PB 1T5EA 1VF5C 3S9MA 4G7HC 6CPAA 4H13C 2GREA 4A37A 4NGTA 3PB7X 4ZX9A 4KSIA 1Z8LA 3B7IA 5I4MA 2G9DA 2I3CA 3FF3A 3HLPA 3PBEA 2JXMB 2V8VA 4UEZA 3K9TA 2HB6A 3S9LA 2R6GA 3T56B 1QMUA 4NGRA 3SI0A 1CFMA 1G291 5LRKA 3SDZA 4PXDA 4UEEA 1YNJC 2V8DA 2PIYA 4ZYQA 4ONWA 3PFEA 2AFOA 3KLRA 1ZLIA 2PVVA 1GUNA 1IYUA 2ZENA 4EWTA 1CP6A 1EE3P 1VCIA 1LAPA 1YLOA 1F2PA 2AFZA 1PMRA 4KKSA 2B8FA 3VR6A 2Q43A 1ZYRC 2K32A 2D5DA 1BLLE 4TKOB 4H0LC 2A68D 3IO1A 1LANA 4DK1A 4UIBA 2ZOGA 2NN6G 3B3VA 2BE5D 1Y0YA 2DNCA 2XEJA 2ZOFA 1CG2A 2WZNA 3FH4A 2NYQA 5J1QA 1R3NA 3VR4A 2PJ5A 2ZEGA 3DGVA 5CPAA 4NGQA 2IJZA 2E74C 3QJYA 2EVBA 3A7LA 4NGMA 3IKJA 2POKA 2NN6H 5BN5A 3CRLC 1YW4A 4ZX8A 1Q90A 1PYTB 1XJOA 5JM6A 3A8JE 5KNCA 5C0XG 2XEGA 1BPMA 3ISZA 4RUHA 5DS0A 3I73A 4B6ZA 4OO1G 3IFEA 2CTBA 1Q1BA 2PJ4A 1AMPA 2AFUA 1DTDA 3U9SA 3VH9A 1TU2B 1SMYC 1CPSA 2F8HA 3MFYA 1OXTA 3LNNA 1V43A 1A6XA 3QNVA 3V7ZA 2A6ED 2NN6I 5HVFA 3MXUA 3SJXA 4IFDH 1FNOA 5D8NA 2PE3A 4OC5A 1GUSA 1M4LA 1Q7LA 1Y8OB 2KA7A 3NH4A 1PCAA 2D2CC 1VGYA 2K7VA 3VATA 1ZG9A 2GU2A 2A6EC 4P6YA 1AYEA 2V4DA 3PV0A 3B3TA 4P10A 5HVGA 4NFRA 3GD7A 3KASA 4PXBA 1VDZA 1H9RA 4LK1C 4R76A 2C6GA 4YU9A 1GUGA 3PUWA 4FAIA 1ZKOA 2QYVA 2A6HD 2EWBA 3SI1A 3SJEA 4MHPA 3KI9A 1TKJA 3QG1A 1ARMA 3WC6A 4X2TA 1OXUA 3D7HA 4G7ZC 4KI0A 1XBUA 4OO1H 4MHYA 1TXRA 2IMOA 2A6HC 4KN4C 4OIDA 3KQZA 4K3NA 2BE5C 3WC7A 2KCCA 1XMBA 3DLJA 3NH5A 3S9NA 2D62A 3TZUA 3VR3A 5K36G 4UF4A 3K2KA 4A94A 4DNRB 3VARA 5K8MA 1Z2LA 2BA0A 1LFWA 1BAVA 3PRTA 3A7AB 2ZEHA 3KGQA 5LRGA 3FMCA 2O5IC 2NSMA 2XEIA 5LYIA 4DJLA 1E2ZA 2B8GA 4OC0A 4MRIA 5LRJA 3TX8A 3EQLC 2JBKA 2EDGA 4OP4A 4MCPA 4ZY0A 2Q8IB 3FX6A 4DUKA 3AB9A 4IK2A 2CF4A 2O5JC 1JQGA 1BPNA 4PXCA 3KL9A 4P4JA 4CPAA 3ND9A 4JYWA 4XTCS 3SJGA 2QVPA 2BA1A 1VHOA 2AWOA 4PV1C 1OXSC 3GLJA 1I6VC 4NJQA 4P44A 4TQUS 3LWUA 2PCUA 4X3RA 2PJ3A 2PJ9A 2ZEMA 3WT4A 4KKTA 4YWYA 5LYFA 4Q7AA 4DNTB 3L2NA 3TC8A 1HCZA 1GUOA 2DNEA 2ZELA 2CW0C 1ZLHA 4OC3A 3RZAA 1NSAA 4ZI6A 2PJ2A 3IEHA 3SI2A 2ZEEA 3PUVA 1H8LA 4P4FA 2AFXA 2PJAA 2AFSA 1CI3M 1QQ9A 4F8ZA 4RCNA 2PCFB 5JEAH 2ZEOA 4MXUA 4G7OC 5THWA 1O7LA 2A68C 3IJ3A 2BO9A 2EJGC 3D4UA 4H44C 3KHXA 2BDOA 4G1PA 2IQ6A 3SE0A 2JBJA 5A35A 3JRUA 3D7GA 1CBXA 4LQGA 3I4LA 2YYZA 4HR7B 3RBUA 3PB9X 1GJXA 2JEBI 3A8KE 4AXVA 4EFDA 1TKFA 1KWMA 3IC1A 1ARLA 2AUJD 3B35A 4DK0A
chains in the Genus database with same CATH superfamily
2FVGA 3CXPA 2EY5A 1KL9A 3BHXA 2I07B 1O7ZA 3PB4X 3AYHB 2JN4A 1KHIA 4ZY2A 4UHVA 4X3UA 4EQPA 1LABA 4XT3B 3P2FA 1E0BA 2MO1A 4A3BG 4P4EA 1UE7A 4PQXA 4RAUC 1STAA 4YFJA 1HA6A 4KKUA 3D7DA 3H0GB 4CYPA 5AFWA 1RTQA 1BXTA 4OL7A 3GTJH 1X12A 3D3RA 2EK8A 1LACA 1TKWB 1GUTA 2WAQB 1S5DD 3T16A 3FNCA 4YWLA 4L8JA 4CGPA 3KYHC 4A3DB 4DR6L 4C3IG 2RDHA 3A74A 2F0NA 4J3GA 3C2PA 4X5KA 1PRTF 1K83B 2WKCA 1S60A 3K5OA 2LMCB 4ZCKA 5TSSA 1SYFA 2BOAA 4OWXB 2J8RA 1F2LA 4A3EB 2PJ0A 3OOCA 4P4IA 3SJFA 4PZ7A 3HKZG 2B3UA 2GIVA 1K3BC 1CPXA 2R7FA 2ABZA 3GTKH 3NTKA 3PGZA 4HJ9A 1C8CA 2X7BA 1VQBA 3TZDA 4M1UB 1FJGQ 2F0JA 3H3VH 1JQYD 2L9HA 2VBQA 4TNUA 2REEA 3CW2C 2FMCA 4A3LG 2WUUA 1L1OA 3HKZE 5C3XA 3GTOB 2JDDA 5IP9G 3Q24A 2Q2IA 5IGGA 4DR2Q 3QB3A 4APVA 4R4TA 2Z4IA 4LFCL 2Q4YA 3CKIB 5J8CA 1K3RA 4JBWA 3GTPH 2CIJA 3FJUA 4WFN3 2NWGA 1RD9D 4BA1I 3CCEA 1D7QA 1IGBA 3CPXA 3NENA 1GHKA 2ZXPA 3TE4A 1Q8KA 1XMOQ 2FINB 4KK7A 2RFHA 1LRZA 3S6GA 5C0XH 1KDCA 4NGSA 1Q1EA 5G3LD 1EYDA 3ERSX 3JAME 3LGJA 4JZ0A 5JJLA 1Y1VG 4B3MQ 1Z6HA 1XRYA 1SYDA 1AW7A 3FYNA 5DAUA 1S5ED 5IYBG 4DR1L 4NXMQ 4DKAC 5GAEC 4XNHB 4IUNA 2WPWA 2UXCL 2K01A 1HQRD 4CGLA 1K8OA 1UE5A 3BG3A 3T4AC 4MFQA 2R93G 1TQOA 3K0XA 4KUBA 2SOBA 4RKLA 4JD6A 3R93A 3EFAA 4OO1I 1TWFH 1WTRA 1PDQA 5AG5A 5HH1A 1LT3D 1A15A 3DWPA 4GKKL 5C82A 4B10A 5C4HA 3I3CA 1DE4C 3RYOA 1EWHA 4DR4Q 1Y0RA 2VY3A 4MFZA 1QILA 2F4IA 4OC1A 2OOTA 4EX5A 4QVTA 4HKFA 2A5HA 2TMPA 4BXXH 4LMQD 4DU9A 5KNBA 4NB3A 2PJ6A 2K6AA 4LFBQ 3H8EA 3RZDB 3IRBA 3I91A 2ZXOA 4P74A 4LFAL 4L5QA 4YCVA 3K6OA 1VMPA 3D31A 3F0AA 2D9UA 1JJCB 1ICWA 1UNSA 2PVWA 3OWEB 4A3EG 4UCNA 5ELNA 5K8NA 3KDFB 1X3GA 3MAQA 3AMUA 1JB7A 1RCVD 4XQQA 2Q51A 1L2FA 4MN3A 1PH2A 4QUSA 2R92H 1A8VA 1I6HB 4DV1Q 2CH4W 1EY8A 4UCPA 3AQQA 1MSGA 1SEBD 2B5GB 4MCRA 4RHSA 5DWMA 4OEMB 4NCZA 1PTOH 2RDGA 3NXWA 2EBJA 4FUUA 4NGPA 3S9WA 1E1TA 2DJFC 4KOXA 4XQJA 3M4OB 4R87A 1EOTA 4H7BA 5C44B 4EMEA 3BZDB 4X66L 4YY3Q 1EWIA 3T53B 2IPKD 3L7ZC 3BZKA 5BN3A 4LNQA 3UI2A 4A38A 2B2UA 1ESRA 1V1QA 1A2UA 2L12A 1F9SA 4NPSA 5IGBA 2PIZA 1FNVA 4QBJA 2Z8LA 1S3ZA 3HOZG 2GFQA 1N9WA 4ZQ3A 5G1ZA 4F9VA 3BVGA 4DR2L 1KRSA 3SVMA 4OIWA 2VNUD 2BOSA 1IW7C 3S1NH 4OMEA 1TWGH 2BCOA 3PF5A 1IBKL 1E2VA 4JI7Q 2DPTA 2R98A 4O23A 1SQHA 4K14A 4W9YA 2GLJA 1M4GA 3OMCA 4KMUC 2F4VL 3P2HA 2L0CA 5H84A 3ULLA 1PLFA 1TR5A 2HHHL 4NDXA 1WK4A 4BINA 4IHMA 4DAVA 2FMMA 1IW7D 4WJWA 4V0BA 5IGDA 1YNXA 1SMYD 2PJCA 1F2OA 3T51B 2R93B 3B3SA 5HMNA 2V1CC 2PYKA 1VF5C 1U4LA 3PO3G 3S9MA 5KTCA 2CQOA 1VQPA 2Q2UA 2GREA 1KUYA 1NSLA 2FL4A 3S24A 2UU9L 1Q8IA 2XIWA 4NXNL 1KDAA 2NTTA 3M7GA 4YIJA 3K5MA 5LL6S 4KSIA 1U0LA 4QUCA 4UFXA 3MXNA 1Z8LA 4HNXB 4TWEA 1LTGD 3B8GA 1FL0A 4P2CB 4P73A 2G9DA 5IT9L 3PBEA 2V8VA 4PK3A 2E2JH 4ONUA 1M4IA 2BEIA 1VQ9A 3M3YB 3T56B 4IOCA 4NGRA 2NB0A 2QW7A 1AFPA 4ABNA 3G48A 4HJ7A 1VQAA 1T9HA 4B3TQ 2V8DA 1MKHA 3DEPA 1XYIA 4ONWA 1ZYRD 3H3VI 1IB1E 2OU2A 3R9EA 1GUNA 2IY5B 4DR4L 1IYUA 3FRMA 1U9RA 1Y14B 3R2TA 1VCIA 5IOCA 4JI6Q 1YLOA 4LX9A 4A3IG 3QR8A 3N52A 2ZW5A 2FHTA 1SRUA 2VQEL 3VR6A 2K32A 3RUZA 3NP8A 2A68D 4H0LC 5LMNQ 1GHEA 4QF4A 2NN6G 4PMCA 2DF5A 1D5ZC 3BLNA 4K2LA 1FJGL 2VUMG 1B8AA 3JVNA 2IHFA 1QUQB 1VMCA 4JI4L 4HCSA 1AP0A 1Y0YA 4JI0Q 1ILPA 1CG2A 2VXWA 2NYQA 5J1QA 1CUKA 2PDOA 2AQ3B 4AH6A 3DR6A 4BMHA 2PR8A 4RG1A 2ZEGA 5E3FA 1PUAA 2Z3PA 3HOYB 3O13A 4R3KA 5CPAA 1RODA 1TIQA 4KSFA 1M44A 3S15B 2XWBB 3GTLH 1PFNA 1I12A 2GE3A 2E74C 1YX0A 2JA6H 1ILQA 2F0KA 3QJYA 1TWGB 2B39A 4BBSG 1NSNS 2PQAA 1DOMA 3IKJA 3ZJYC 4QIWE 1JMCA 2UXDL 1MJAA 3CCQA 4C2XA 1JJGA 2F0OA 3EVQA 4C1NK 3A8JE 1WTWA 4RUHA 2JEVA 5M3FH 3NPPA 1KNEA 4JI0L 1CM9A 1AMPA 2PJ4A 2AFUA 3OIQA 3G7LA 3U9SA 3VH9A 3NELA 1CPSA 2I5HA 4R3LA 4ZBGA 3MFYA 4CDDC 3W6XA 3FIXA 4E2AA 5DLQE 1XIXA 1S5CD 3LNNA 5AG6A 4H6UA 2K5NA 2NN6I 2G3AA 4A3JG 3H5ZA 3DDDA 2K5HA 1DZ1A 3DWAA 3HOYH 4EVOA 4OC5A 3MWYW 1QWYA 1Y8OB 3C1FA 3J81j 1C4QA 4JI3L 1N71A 3EXNA 5IE8A 3NSWA 1TVXA 5IV0A 1DONA 4I7AA 2YV5A 4R4CA 4DV3Q 3TO6A 4R8IA 1AYEA 3VYTA 4IFDI 1M8AA 1P0HA 1B4OA 1B6BA 2CNSA 4YGOA 4JC0A 3GD7A 4AG9A 4B11A 3D8GA 4ULLA 1H9RA 4R76A 4YU9A 2LY7A 2UUCL 2YTXA 3DEOA 4A76A 1I21A 4Q5VA 2KEEA 1B2TA 1XMTA 2EWBA 3OHXC 3SI1A 4MHPA 1IICA 3CP0A 5M5XB 4X65Q 1LV9A 3WC6A 5C88A 2JP1A 1OXUA 4RMFA 3E0JA 1D1IA 2F52A 2B4DA 2LFNA 4OO1H 4POGA 3SEBA 4WRDA 1TXRA 3NE8A 5AG7A 4XPKA 3AU7A 3KQZA 4JI8Q 5LL6X 4GLXA 2VUMB 5EJWA 1EEFD 1RJTA 1NMTA 1VHSA 1DGSA 3EN2A 3K2KA 3SHLA 3P75A 1Z2LA 1NR2A 3PRTA 4RWSC 5CV6A 2HUGA 2MJ8A 4MJ8A 1IZ6A 2E8GA 1N36Q 5LYIA 4HJ5A 4DJLA 4BBSB 1OZPA 1X65A 3BJ8A 3TX8A 1XMQQ 2UU9Q 2K14A 1VQNA 2EDGA 2R61A 4MCPA 4ZY0A 2QKIC 4IK2A 2O5JC 2QDBA 4DAYB 1BPNA 4DXGA 4PXCA 2Z3NA 3C3LA 5DEHA 4ZY1A 4JYWA 1S5BD 1M90C 3R3OA 1QSMA 4CYOA 4PV1C 5CV7A 3CCVA 4NJQA 4QQBX 3A56A 2VZZA 4NEXA 5LHY1 2PJ3A 3WT4A 1SYBA 1UUPA 2YNEA 5LYFA 1ZEQX 4Q7AA 1GD7A 4DNTB 3JAML 4YHHL 2EVNA 3L3OC 5IYDG 1GUOA 2ZELA 5FLMG 2CW0C 4MZ9A 1YI2A 3GTOH 4GLAC 2Y0SB 1UFHA 5AG4A 3OW2A 3SI2A 2ZEEA 4P4FA 2AE6A 1W2BA 1CKMA 2PJAA 3S2HH 1C7YA 1O7LA 1VQGA 2QA4A 1AEXA 4K8JA 3KLSA 3GTMB 3KHXA 2BDOA 4A3IH 1LM0A 5LMNW 3JRUA 3GKRA 4LQGA 3DHQA 1YR0A 3PB9X 5ELEA 3SGIA 4BBRG 1D6EC 4OGQC 1I4PA 4JVZA 1KWMA 4M3SA 2AUJD 4GXHA 4WJ4A 2C1CA 2K5VA 3EROA 1JB3A 2V77A 3LWEA 1S5FD 4FO2A 3KFUA 1LOKA 2B4BA 3CHBD 2EY6A 5ELFA 2VB3X 4QC6A 2ID0A 3I4NH 4IUSA 4MMOA 2CWAA 1IOIA 3S17H 1I5FA 2JE6I 3ER0A 3UDFA 1CP7A 1QSTA 3U9OA 4MFPA 1IXRA 4FF1A 5IX3A 1QJOA 1PH8A 4OX9L 4P4BA 3MFGA 5AGEA 1P8LA 3PUXA 3NA6A 2MQHA 3KZWA 2PNRC 4A3FH 1BCPB 4FP5D 1K9MC 2Z3OA 5DM63 2F0VA 2JA6B 2RQXA 1PFMA 4XPDC 1CSQA 1TT2A 4DN4M 2F7VA 4MNOA 4A2ZA 2RSNA 1HPCA 5EGTA 1UEBA 2ENBA 1PXUA 3MEFA 2PZUA 5E1FA 1CX8A 4WJBA 2KEDA 4LFAQ 4CBVA 1FR3A 3PUYA 1XPRA 3GTMH 1EIFA 3A8IE 3PIPA 3G8WA 5E7NA 2XNAC 3S16H 4M6HA 4IJLA 4AYBE 1HDQA 5I9OA 1FYCA 3M85A 5F48A 4QJFA 2MUYA 2OXPA 3ITPA 4KJNA 2K5WA 2FIWA 4DR3Q 1SMXA 1L0XB 3B6YA 3I70A 1WTVA 4LF6L 1DJRD 5IB9A 2JA7G 2VL1A 3TFYA 3J81E 4AYBG 3RMHA 3HKSA 5I2YA 1B9MA 3WOFA 2BH2A 4FBEA 3H91A 3Q8DA 1Z5RA 1NMFA 3JAMc 2MGSA 2DGYA 3GY9A 3D7FA 4LF4Q 3CCSA 1E2WA 5LYDA 3ZYYX 2A19A 2E5LL 4L5RC 1ZG8A 2B2YC 5CC4A 5T1IA 4X62L 2KCWA 1SNOA 1VHEA 4MHNA 2B2VA 2IL4A 3HUVA 4B3SL 2Y0SG 1MJBA 2JDCA 2Q44A 5L37A 3IWGA 2L5TA 2Z6KA 1Y1WH 1HJPA 3VYUA 1TY0A 1BO4A 5HY6A 2RHSB 5FO8B 5KGUA 2ZEPA 2ZXVA 1X10A 3EO4A 4AB7A 1YNND 4BA2I 5JPNC 2MNAA 4DNCA 1AN8A 1O7IA 1STYA 2JA8H 1Q81C 1STBA 1UE6A 1A63A 2CTCA 2VZYA 4P4DA 1XEBA 3BYTB 3H09A 4YWKA 2UUAL 2E2JB 2I79A 5C3EG 2PO4A 1CM0A 4R4OA 4DR5Q 5C4XH 4MFLA 1HZCA 2F0MA 4K2KA 5ISVA 1BVSA 4XIGS 4R6TA 4IFDG 4AIMA 4QUFA 3EC4A 3ND8A 1TS3A 1GOZA 4GN4B 2TSSA 3A9LA 4B3ML 2V8HA 1S7NA 1Z8XA 4ZGYB 2UXBQ 1F9PA 3CAMA 2GLFA 2G9HD 3MA2B 4Y7NB 4KVXA 1B3AA 3GTJB 5K36H 3N5FA 1S7LA 4LFBL 4A3FB 1KUXA 2XEFA 4YRHA 5M3FB 2Q4ZA 1MI2A 2H4OA 3OW7A 4X62Q 2QGQA 1QNUA 3HEJA 4NMZA 4KD3A 4WJ3M 1ASYA 4ZAIA 1F57A 3KQXA 3T90A 3SK6A 5GROA 5DWNA 1S3OA 1IBLL 5ELYA 2IW3A 2JA9A 3S1MB 3HOVG 1XPOA 3SXHA 1EIHA 2VB2X 4FWUA 4NGNA 1HXYD 2LS01 2PI2A 2JA6G 1KTKA 3GV6A 4Y7NH 2B63B 1LAMA 1ET6A 1LTLA 3K5LA 5I4DA 3BXMA 4X8IA 2NVXH 1Y1WG 1J5EQ 5C6AA 2Q2HA 1U6MA 1EQVA 4H6ZA 5D29A 3BDCA 1CHQD 5CBMA 2FSRA 1EYAA 1ELLP 1KRTA 1CA6A 5FOBB 3BDOA 3AEVA 1K8GA 2AFMA 1BBWA 4QL5A 1LCPA 1WJJA 3BJ7A 4HSVA 2F0IA 2F0UA 3QOJA 1LT6D 4B12A 4JI5Q 2DEAA 2R92B 1ONLA 3HOXG 1B50A 4OC4A 4ORFA 5F49A 3P20A 5D3IB 1B53A 1Q2YA 2EZVA 3LODA 3KLWA 1XTDA 4X64Q 3D67A 3FEDA 4KOUA 1Y1VH 4KZTA 3B2YA 1IYKA 3HOWH 3CPWA 4IQZA 3RLFA 3T8WA 3M4QA 3ULPA 1Z8WA 3BU2A 1V0CA 1Y9KA 2F5IA 3D8PA 2DJGC 2B63H 1SNMA 2QEXA 4JI7L 1ENAA 1JICA 4A31A 1U5KA 4GKJQ 4F0YA 2Q04A 3RAMA 4N8FA 3KR4A 1STGA 3M4YA 5HGQA 3J80E 5C4XG 3I9SA 1ZO0A 3KR5A 4CGMA 4OELB 4CRYB 4A3CG 1YNNC 1WD0A 1GUWA 2N8NA 2XSCA 2FIAA 4A3LH 1K8MA 1STNA 2Y0SE 3JAMi 4IUPA 3D2PA 1PZKD 1Z9UA 1Y8NB 2IL8A 1NE3A 2E5LQ 1N32Q 5FVJA 4CAVA 5IY0A 4AVAA 1W3SA 2OCEA 4OWTB 5CBAE 3CXQA 1TS5A 1CSPA 1Y7EA 2R8VA 3CCLA 1KAAA 1X55A 4N8X1 8CPAA 3DMUA 3OTOQ 3IIBA 3D4WA 1G51A 2ZEDA 4CAXA 1YHAA 4X64L 5CBEE 1JT8A 5C3WA 3F2BA 2A69C 2ZEFA 1FNUA 5A2QL 4A3MH 1T5EA 2HUZA 3Q6SA 3G6EA 4C3HB 2FT0A 4A37A 6CPAA 5F2DA 1PTOD 2OTJA 1V1OA 3PB7X 2KHJA 4CDFC 1EU4A 4HAEA 2HQYA 1DOKA 3HOWG 3FF3A 1VS0A 4DR6Q 4H89A 4UEZA 3HRZC 4II9A 5GQOA 1Q86C 3D3SA 4YHHQ 2PRBA 1QMUA 4LF8L 5LRKA 4AQYQ 2OWOA 1TY2A 3W1GA 4R8NA 4UEEA 1SDFA 4KS9A 2PIYA 2RKSA 1SBBB 1Y1WB 3PFEA 1ZLIA 5G20A 4A3JH 1SE4A 5M9OA 1J4JA 2ZENA 4EWTA 2QDLA 4CGYB 1HH2P 1ASZA 4MIUA 3W1BA 1YNJD 2WB1E 1CKOA 3RZOB 1PMRA 4KKSA 1VQ4A 4HEDA 3S14B 1PTOB 1SSOA 1BLLE 2R92G 1BCPC 4HJAA 1A2ZA 3EFXD 4FXGC 5IP7G 5EBDA 4IO9A 1EEID 3T9YA 1LTID 5JOBA 2ZW7A 2WB1G 3M9BA 3F2DA 2KHIA 3CCJA 3W6SA 4FD6A 3K57A 2A74C 2DNCA 4PZ8A 5E96A 2WZNA 1QNKA 2B3VA 4RH6A 3I55A 1YEZA 2NVYB 2XTIA 2MFIA 1YJ9A 1PYSB 2KHSA 2A4NA 2PJ5A 4UP9A 2RHQB 2K28A 1SNCA 4PSXA 1ML0D 3PSIA 4HIKA 3K7UC 1LO5D 1I4RA 4A3KG 2P6GA 2Z6KC 1SJED 4B5OA 3F5BA 3CRLC 4PK2A 1V1PA 1Q90A 3DNSA 1G2TA 5E4WC 4UA3A 1N34L 5KNCA 2OH1A 2EY1A 3ISZA 5D3DA 5EC4A 4BY7H 4P72A 5JJIA 3RLOA 4B6ZA 3PO2B 5K5PA 4KLVA 3KK7A 1Q1BA 2FXQA 1TU2B 1ZXTA 4C2ZA 1BCPF 1JC7A 1RXTA 3DLLA 2F8HA 2VQFQ 4MBUA 3S2DB 2HIXA 5C4ZA 3PO3H 1A6XA 4ILWA 1QSOA 4RS2A 1PFSA 3GTLB 1IYLA 2YNDA 5HVFA 2PW5A 3SJXA 5D8NA 5EKKA 4C3HG 4A75A 1I4QA 4EQNA 4A3GH 2UXBL 4S3SA 1Q7LA 5AJ3Q 2CCZA 2KA7A 1X3EA 1HFNA 2R7HA 2K7VA 3HOWB 3DUZA 3PGPA 3GTKB 3RNZA 3SXOA 3TTHA 3GTGB 2A6EC 1MJCA 1EWCA 2BDNA 2V4DA 3PV0A 1IIDA 3B3TA 2GVAA 3W2DA 1I6HH 3CD6A 1LTRD 4H02A 2UUBQ 2EUIA 4PXBA 1VDZA 1PRTC 2C35B 2X6LA 3BDLA 2E2HH 2E2IB 1I4GA 3C26A 1GUGA 1VQKA 3J81i 2B2WC 5JPHA 3R9GA 1X32A 3NWTA 3UDGA 4FAIA 2HDLA 1N34Q 5EAYA 2A6HD 1Q82C 4IPHA 4GOPC 1C9OA 3EJIA 5ELCA 3QG1A 4X2TA 3D7HA 1MJEA 1SNPA 2VI7A 2OZHA 5CNPA 3TP6A 4KI0A 3CMAA 2DPSA 4JI5L 4DAYA 2E2IH 2IMOA 1L1OB 2ZTDA 2VXKA 3KBXA 2F0LA 1YVCA 2GN5A 2GANA 4K3NA 3WC7A 2B2YA 1XNRQ 3CC4A 3NH5A 4AVCA 4CGOA 2WSAA 2PQ8A 2UUBL 3SK8A 4C3HH 2OB0A 2M2LA 1K73C 3VARA 2PZWA 3CC7A 1IL2A 1BAVA 4UY8C 1K4JA 2KOLA 4BBRH 1XNQQ 1I4XA 2WAQG 3T1HQ 5LRGA 3FMCA 4LW1A 4C3IB 5FJ8G 4POFA 4A3KB 4CDEC 1E2ZA 2B8GA 4O2DA 4MRIA 5LRJA 2D0OA 2HQLA 3VDYA 4OP4A 4U9ZA 2UXDQ 2AMCB 2Q8IB 3HOZH 2Q0YA 2VL6A 3AB9A 4TVAB 4LUZA 2CF4A 1JQGA 4C68A 5D65A 1SR3A 4DV2Q 5CV9A 4IPGA 3K5NA 4DV4L 1KIXA 3S1NB 1GO3E 2F0GA 4DV0Q 2ZPAA 4P4JA 2N55A 5F47A 3TT2A 3SJGA 4GNXA 2BA1A 4C2MH 4BWGB 2AWOA 2F3WA 4A33A 1I6VC 3DM3A 5FLMH 3NBHB 5H1SE 2JJQA 5C0XJ 3I4OA 1QE6A 3LWUA 1YJNA 3EBEA 5T1GA 2PJ9A 2ZEMA 1PZJD 5EPJA 4DFAA 1B1ZA 3KUPA 4AG7A 4BXXG 3E9HA 4P75A 1QZHA 2H5MA 4C2MB 3J80c 2VS1A 1S7KA 3SK4A 1ZLHA 3RZAA 4RFBA 1I4HA 2JK8A 2PJ2A 4KD4A 2D0PA 4ZUIA 2E2HB 2Z0ZA 2AFXA 2AFSA 4KOSA 4F8ZA 1QSRA 2PCFB 4NP5A 1I3QB 2JA7H 1NE9A 4A30A 4MXUA 1QVFA 1TWAB 3F8TA 3NE7A 2A68C 4DR5L 5FJ8H 4GN3B 1YIJA 2PQAB 4KLKA 2EJGC 5FO7B 3D4UA 5M3MG 3OWFA 2JBJA 5M5YH 2EYLA 3S2DH 1HUMA 5KYIA 1CBXA 3I4LA 2WP8J 3ERQA 3RBUA 2ZW6A 4HMIA 4XNHC 2JEBI 3I56A 1WWZA 2AFZA 3L9AX 4A3GB 2PMZE 2PMZB 4DK0A 1HNXL 3B35A 1HNWL 1F77A 1ELMP 1F9RA 3PO2H 4JV5L 4JXRA 1I1DA 3H3VC 5F09A 3MXNB 1CQVA 1KXLA 1F2MA 2JA8G 5HVHA 2CNMA 3IGRA 2Q7BA 2M00A 4BY7G 3GQBA 4ZKBB 1EQQA 2PNHA 3K80C 3VYSA 5KEEA 4F87A 2NVQB 1PH1A 1UWYA 3NK9A 2Z10A 3G4SA 1EL0A 2PQEA 3FEWX 1H9KA 4F9UA 1ET9A 1SLJA 1XOVA 2A69D 3HGBA 2B2WA 3VA7A 2K1BA 3T1YL 4A3KH 5K8OA 3PQIA 1MSHA 5G3LF 4KHVA 2E75C 4FF2A 1PTOC 2DY8A 1FT7A 2B4DB 4QMGA 3D2MA 3HS0C 3H94A 3SXNA 4AVBA 1H9SB 4LUOA 4C7IA 3W3AA 1N36L 1B3QA 3QIAA 2B58A 3B3WA 2CH4A 1M1DA 3EIVA 3KLSX 3KF6A 1C48A 1M4DA 4KJOA 1VIXA 4GS4A 1VQHA 4FNFA 3P1HA 4U68A 4BY1G 1TWCB 2FFKB 4GNXB 1VQ7A 1QVCA 1VQEA 3R9FA 4F8MA 1AE3A 2Q8TA 3NUCA 2HDMA 2P6EA 1O7YA 3TN2A 4UFWA 2JEAI 5KNDA 3J7A5 3ISXA 4JI4Q 2H1EA 4C2YA 3D6WA 1VQDA 2KVMA 5KRUA 3RN2A 1K8AC 1HZAA 1H95A 3CCRA 1D5MC 2C6CA 5G22A 1GHJA 1S4ZA 4L89A 3J81c 5EMIA 1PH7A 2PW7A 5BN4A 5BWAB 3VR2A 4PPZA 5IYDH 2HCIA 4QB4A 1YW6A 3ZZIA 2YU9B 2EIFA 3M3YH 2F0SA 1NJIC 1J8IA 3A54A 1YMEA 3FKIB 4CYNA 3LACA 1HQMC 2KCTA 1ENCA 1MBYA 1Z4EA 1LTTD 3K7AH 2RB7A 4DK3C 4U5YA 4QCLA 1EY9A 3H15A 3FECA 1PV4A 4R4IA 5FLXc 3HOZB 1D2BA 1PTOF 4CHTB 2JEWA 1TKHA 1RHPA 5IGEA 1Y7RA 1TWCH 1KAWA 4O0AA 4X3SA 4A3EH 1SFOB 2JA5B 1A2TA 1R43A 3R2IA 3PFOA 2KUMA 1XWEA 1OXVA 1JE4A 1VKCA 2KBNA 2HD3A 1AE2A 3BI1A 3MGDA 2LXJA 3J7AV 1VQ8A 3C1EA 5IGFA 4KHPL 1DCZA 2O28A 2B3GA 2ICIA 3FPPA 4BBHA 1WTOA 3OIPA 1WI5A 3CMEA 2YTVA 4KN7C 4CS0B 4A3GG 1IBLQ 1B70B 1IYVA 1Z7TA 3KDFA 3PO3B 3G3SA 2NVXB 4NJRA 2RBMA 2CVRA 3I4MH 4JXQA 4KTAA 1PFBA 3GV3A 3S1QB 1CK1A 1II3A 2EXDA 2JA8B 4ZKCB 4CJ2C 2JYOA 1LLRD 3K0YA 3M7NA 4BY7B 4JLYA 1HDUA 2PJBA 3IAYA 3H8FA 1M4VA 3HOUB 3I4NB 3S6KA 2Z3KA 3JUWA 3ULJA 1VQ5A 4HTHA 1XFOA 5HXDA 3H0GG 3IFTA 4AQYL 1IHZA 4OIKA 4HIDA 2IT1A 1K28A 4DUYQ 1PZID 2BUEA 4F7XA 3VYRA 4CKCA 4CKBA 4DR7L 4FD7A 4H2KA 4RGNA 3RO0A 4J15A 1BOBA 4OKOA 1OBRA 2SNSA 4OWWB 3V2TA 2CKZB 1CKNB 5ELOA 4K30A 1WCMG 1VQMA 3KF6B 1T5XD 4DF7A 2AFWA 4L6TB 2PJ7A 1MGSA 2DUDA 3HOVH 2B29A 2GA4B 2PJ1A 4PQAA 3J80i 1A0IA 2F0TA 3D4DA 4A3IB 2ZM6L 2PJ8A 3V8IA 1Q12A 4FYDA 3N6RA 4BY1B 4JI2L 2EE1A 3CXCA 2OR4A 1PRTD 5JJKA 1TF9A 4GKJL 5J1ZA 2K5TA 4DAPA 2QJ8A 2R7ZH 4GM5A 1V9PA 2J8MA 3S2HB 3RLNA 4JI1L 1IL8A 3V38A 3NEMA 2JSOA 3OMGA 2DY7A 4TRDA 4LF9Q 3MXPA 4PXEA 2K50A 1XF8A 1W6JA 4JK1C 3EY5A 4XPDB 3QO2A 1MHWC 1LTAD 1A62A 3CDXA 1HTPA 4MCQA 5C5LA 4L8AA 3HOYG 4PMBA 1H9JA 1L0WA 1IKMA 2WKDA 3PB8X 2EJMA 4Y52H 5DM73 1HNXQ 2XRSD 2ZM6Q 1YHBA 3I90A 1F2ZA 2NMTA 5M5WB 4L5TA 2V8GA 3W5OA 1YSJA 2J9AA 2L55A 2ZTCA 1EU3A 5LYLA 3HOUH 1O78A 1BUVT 1KZFA 4KHZA 5CR3A 4P45A 4JI6L 4K6DA 7CPAA 1DM0B 5I6WA 2R1IA 1DD2A 3CCMA 1PYWD 5JH9A 4FF3A 5LMUQ 1YJWA 4BBSH 5EPLA 2FS5A 4WWVA 3NHHA 4C3IH 3I4MB 1XX8A 4A39A 3PUZA 1EZ8A 4DV2L 3GYAA 1D5XC 4DV0L 4LUAA 4H13C 4JV5Q 4A3BH 4NGTA 2AJ6A 2Z6BA 3TSSA 2F3IA 4ZX9A 4UBRA 2RSOA 4IF5A 4FF4A 2EYFA 5E4XA 2IHEA 2K4KA 4KY6A 3HOUG 2C5CA 3I4NG 3TP7A 1WTXA 2I3CA 1G6ZA 3I3GA 2JXMB 5COYA 2IWHA 2F0WA 3K9TA 4RI1A 4Q38A 2CFMA 3K9UA 1SFOH 3AFPA 3X3MA 2BH8A 3S14H 3W91A 4WORA 4IUTA 1G291 2ATWA 2H5XA 2JLMA 4ZYQA 4A93G 2N88A 1Q3LA 4RN7A 2AFOA 3KLRA 1SYGA 4DK6C 1QCBD 2PVVA 1WCMB 1CP6A 1EFID 1EE3P 1LAPA 1HZ9A 1N33Q 5JJZA 1F2PA 3TP5A 3J81L 4CAEA 4JBJA 3J7ZC 2B8FA 4NXNQ 3HOXH 2AQ1B 2Q43A 1RTNA 2OT2A 2ZJQA 2NVTB 4TKOB 3IO1A 4UWIA 3TP8A 1I94Q 1LANA 4DK1A 2WV6D 5I2XA 3UY5A 2ZOGA 3KF8B 2XVSA 4B13A 2I5LX 1MIUA 1U4PA 1CZWA 1R9TB 3E0KA 1YZ6A 3BYYB 3B3VA 3PCOB 2BE5D 5IT9c 4L63B 2ES2A 1RL2A 3G71A 3I2ZA 2XEJA 1Q7YC 1BCPD 3ZJ0A 3FH4A 3S16B 4G4KA 3U58A 1Z8TA 5C4JH 2R93H 5HURA 3NQIA 5C44G 2XWJB 3DGVA 2I5MX 4Z9CB 1BR9A 3UE1A 4I65A 1K0RA 2Q4VA 1WVLA 1EYGA 4Y49B 1FGBD 1TXYA 5JEAJ 3RN5A 2SEBD 1K0SA 2IX1A 2JA5H 2EVBA 3A7LA 3H6MA 1VQCA 2VQFL 1TWHB 3V96A 2J4XA 2N49A 1DYQA 4KOTA 4IURA 1SE2A 4NGMA 2PZTA 5D14A 3A5ZB 2POKA 2NN6H 3A0JA 3CQZB 5BN5A 5KYLA 1SJHD 1XJOA 4R9MA 3K8AA 4YY3L 5GAHC 2I46A 1HA5A 5ELDA 1E3PA 3F8KA 5JM6A 5C0XG 2XEGA 4DR1Q 4XXEA 1BPMA 3UDIA 4I49A 3I73A 5JAVA 4OO1G 3IFEA 2CTBA 2Z3LA 4KY5A 3UDXA 3TOBA 5CMDA 3TRZA 4ME3A 1DTDA 2CQAA 3E5SA 1SYEA 1B44D 1I94L 1RTOA 2CHBD 3I4MG 2XN9C 5IT9E 4YCWA 1V43A 3QNVA 1MK4A 2SDFA 3IU1A 2RA4A 3MXUA 3E9IA 1FNOA 4X65L 3CC2A 5FK9C 1GUSA 5EKLA 3KJOA 1M4LA 5FO9B 1KUVA 3NH4A 1B7YB 2YNCA 4LF5Q 2D2CC 3MVVA 4OXPA 1VGYA 2L11A 1YGHA 5GADC 1AZPA 1PH5A 3FP9A 2M9VA 2OTLA 2R7ZG 3MTSA 4DV5L 1EUJA 5G21A 3VATA 3TS0A 1JE5A 4P6YA 3DSBA 4LF7Q 4P10A 5HVGA 2A8VA 2RCNA 5IP7H 5ELBA 1OO9B 4NFRA 2A73B 1R9TH 2Z4HA 2RVLA 1KDBA 1CJWA 1YLEA 3E6ZX 3KASA 4DUYL 3PF4A 4LK1C 3VWDA 1KABA 4JI1Q 3E0EA 4A93B 4HSPA 4PNYA 4XT1B 1L0CA 3JC66 4ALPA 3PUWA 2YU9H 1ZKOA 5C5MA 3FPUB 3SJEA 5CV8A 2NZ1D 3KI9A 4O42A 4GS3A 2CXAA 4DV7Q 5JPMC 2MPMA 3KOJA 2CW0D 1HZBA 4CKEA 1BF4A 2EO8A 3QAHA 3F2CA 4G7ZC 1XBUA 4MHYA 4LWCA 4XQNA 2BE5C 1HR0W 1CQFA 1VQFA 3MXGA 2OQ0A 1CT1D 3S9NA 2D62A 2E2DC 5K36G 4B08A 4N9TA 1SYCA 1X54A 3PMFA 4DNRB 1J9OA 4DV3L 1L1OC 1HNZQ 4OAEA 3CPFA 5LMUL 2EYPA 1E24A 1C0AA 3KGQA 1A3TA 4IUQA 2G3TA 1YITA 2R7DA 2NZHA 2NVYH 1Q2CA 4DAMA 2PR1A 4CAFA 4OC0A 2HIVA 3EQLC 4KORA 4HIMA 5KIXA 5IYCH 2JBKA 1QOHA 4OONA 1FY7A 1IKLA 1YBYA 3FX6A 4DUKA 4KY7A 1G2SA 1LTBD 1ICFB 3HG9A 1WTPA 5JVG3 3KL9A 2J7ZA 1BOSA 3ND9A 4XTCS 2F4VQ 1VHOA 1VQIA 5EBVA 2X6GA 1OXSC 5EPKA 4P44A 1E7ZA 2K5QA 4TQUS 2OF1A 1WYDA 2NYZD 1IOFA 3PIO3 1G8ZD 3FKIH 4K5VA 3AFQA 4JI2Q 1QZGA 1S5KA 4X3RA 1JWMD 4C1NI 4IUUA 5H86A 3GTPB 1PHJA 2FXFA 4A3JB 1Z47A 1QUQA 5C44H 4FXDA 2AWNA 1JOKA 4XDXA 4DV4Q 1LTSD 4IPDA 1XJVA 2PSWA 2I00A 3L2NA 3CCUA 3WWVA 4RGMA 5M5YB 3TC8A 2IX0A 4DUZL 3PIOA 2BL1A 3S1RH 4UDUC 1HNZL 2OZGA 5NUCA 2R7ZB 4TSSA 3PUVA 1IBMQ 4A93H 1H8LA 3IU2A 2KECA 4RCNA 3KBGA 5CV4A 3MZ5A 5JEAH 3R96A 2Z0SA 1EQRA 4RA8A 2EYMA 4NXML 2MO0A 1XTCD 5J3BA 5KTDA 1HFGA 2KCNA 3BVZA 3SE0A 4LQ6A 5A35A 2YTYA 3Q0AA 1G91A 2WACA 2ZJPA 1WOCA 2YYZA 4LF7L 4HR7B 4RKBA 4MTKA 2FE7A 2REFA 4PMWA 1GJXA 4AXVA 4EFDA 1TKFA 4MY0A 5I9PA 3F2UA 4E6IA 3IC1A 4K5WA 1STEA 2VQEQ 2DXQA 1P16A 2B5GA 4DYOA 3NE5B 2F0FA 4IZ8A 1Y9WA 3ICEA 4GN5A 2IJ0A 4HMJA 4KV6A 1JOQA 2EK9A 4DNIA 4MY3A 1UAPA 2EPBA 2KQ3A 3MC0B 5M3FG 4Q36A 2PPBC 1ON0A 4F0XA 1N8RC 1XE4A 3D6CA 3K58A 3FB3A 5IYCG 3S1QH 3D0FA 3PBBA 3C46A 3I72A 1BO0A 4KSAA 2QECA 2B63G 4MTNA 2K03A 2O4HA 2KCMA 1BBXC 3VR5A 1TWHH 2DN8A 1PH3A 3J7AF 2ANPA 2ODFA 1PVOA 2AUKA 5EKIA 4ODGA 3PEIA 1OXXK 2HCCA 1SN8A 3OPOA 1CZGA 3TMEA 4R57A 3M4PA 3L0OA 5FLXE 1YVOA 5A27A 5JEAG 4B3SQ 3H4QA 4KLWA 5K8PA 2EJFC 4R4QA 3QWNA 2C9OA 2A1AA 2ZJRA 4HCEA 2J0TD 5IWAQ 2ZT9C 4MHDA 3BI0A 4JPBW 3HOXB 4R1JA 2PRQA 4IJHA 1P4NA 3TREA 4UEFA 1H9MA 4GZYC 2VQYA 4J8QA 1N33L 3D66A 2P0WA 1D1KA 1X3FA 4JG2A 2D4PA 2QF7A 4ZLTF 3MRUA 4IAVA 5F46A 3GB0A 2K33A 3UE0A 2FJ2A 5J39A 2Q8RE 3RZOH 2RDFA 3TO9A 4KOWA 5C0XI 1E1OA 2ICEC 2K75A 3FDTA 5A28A 4N9PA 3BS1A 4OX9Q 5JVH3 1VQOA 4MCSA 1SNQA 3CU7A 1WD1A 2B2VC 4JI3Q 1DXMA 4B9XA 3CRKC 2L4NA 5IP9H 3FHWA 3F1ZA 4DV5Q 4HJ8A 1WTQA 1X9NA 4XPLA 1EIGA 1A3VA 3TS2A 2C27A 4F88A 1LT5D 4HIOA 1B9NA 3R1KA 4F6AA 4UF4A 4CJ1B 2ATRA 4LUVA 2L1BA 1YK3A 5GCNA 5IB0A 1D8LA 1F2YA 2MP1A 2HHHQ 4MHZA 3ONAB 5IODA 3GIUA 1JWQA 3T13A 1GYTA 3WC5A 2AKWB 4JCVE 2CNTA 4BBRB 1VF7A 4R7MA 4A3DH 4LF6Q 2HQEA 5J22A 3FXTA 1GVPA 4JYAQ 2O53A 3RNUA 4LJZC 1FNWA 2AQ2B 2MHVA 4UP8A 4JBKA 2F03A 5JQ4A 5AJ3L 1ZG7A 3H0GH 2B2TC 1RKNA 4JI8L 1Y69U 5M5WH 1XMQL 2PI2E 1XNQL 3GTQB 4ZUJA 3FVLA 4OIJA 3DR8A 4E0AA 3IFDA 1Q46A 4OC2A 1W6KA 3IWWA 4CRZB 1ESFA 3KHZA 1JWUD 1JJ2A 4HNYB 4CGNA 4IUVA 3WDNA 3S17B 4BD9A 4J1MA 4K0KQ 3PB6X 3FVQA 3B3CA 5JGFA 4DV1L 4R8FA 4GKKQ 1YREA 3MN8A 2L15A 2XGTA 3M4OH 2HC9A 1N32L 1AUGA 4NW2A 1V8QA 4A4IA 4FVMA 2KENA 1X3QA 2N78A 3WR7A 1RF2D 1EYCA 2WFWA 3CT9A 3VWEA 4EGVA 4UFVA 3H8GA 1PYBA 1SXTA 1BNZA 3K81C 5FLXL 4DR7Q 2GVBA 3GUXA 1UWVA 1SROA 3BJUA 5BR8L 1IU8A 1QG7A 2P6FA 2XRQD 1QB5D 2EYOA 1I3QH 2JA7B 4PSWA 4AYBB 1HTLD 3OSOA 1XNRL 1HEEA 2RCFA 3FEEA 4CYQA 3DXJC 4K0KL 4PG3A 2NVTH 3NWSA 3WABA 3K7AB 1ENFA 2KJXA 4DGZA 1CTMA 5IWAL 2WYRA 1XPUA 2F1MA 3S1RB 2OQKA 4J6HA 3NFZA 3SR1A 1IBKQ 4QB9A 4A32A 3S1MH 3CPAA 5J8FA 2K52A 4I7ZC 1TS2A 4DUZQ 2J8NA 2K05A 1EY7A 4UWJA 4OADA 1YVKA 2C6PA 4YWMA 2F3VA 2HT1A 1TF8A 2BSWA 2F0PA 3RD4A 1IBML 1BDOA 4X3KA 3STBD 3G6JB 4JOIA 5FKAC 1JOOA 4ME5A 3V05A 1SNDA 1H9SA 2AHOB 2G5DA 3D4RA 5C3EB 1EIYB 3S15H 1U4MA 2F0QA 3D68A 3GP7A 3NBHA 4MHEA 3VA5A 3PIP3 2VW9A 4UIAA 2E76C 4A95A 1IY7A 3I1UA 1VQ6A 3LMSA 2VZAA 4FXKC 3NH8A 4KUAA 1JR0D 4KHPQ 4Z65A 2YGWA 3N7ZA 3L2PA 1PH4A 2WIIB 5IIFA 1Y8PB 1MJ9A 1VQLA 4G7HC 3S6HA 1STHA 4IPCA 1X3PA 4HN7A 4RHRA 2NBFA 3KF8A 1AZQA 3U50C 4A3FG 3B7IA 2QIRA 5I4MA 3OYYA 2K5DA 1U4RA 3HLPA 1NNXA 2EY2A 4OHJA 2HB6A 3S9LA 3CF5A 3FBUA 4PV6A 2R6GA 5HGTA 4B3RQ 3SI0A 1CFMA 3HOVB 4DR3L 3SDZA 1PH6A 2O4XA 4PXDA 1YNJC 1FD7D 4K8IA 2UUCQ 4UPAA 4M6GA 2WINB 1CHPD 4A3CH 1PU9A 2ZTEA 4ZK9B 1NY4A 3QB8A 1RDPD 1OTCA 4M8AA 1KNAA 3HFZB 3R8BA 4JBMA 2F0DA 5CGKA 2ZXRA 1IYJB 2NUCA 1EFWA 1I50B 5M3MH 4JOIC 2EYHA 2OZUA 2B2TA 1HR0L 1HNWQ 1ZYRC 2F0HA 1QVGA 2D5DA 1EOVA 1JORA 4FD4A 3STBC 3J7YW 4MFKA 4UIBA 4LFCQ 3URYA 4G57A 2EOTA 1SAPA 1J6QA 2JQOA 4RCOA 4BS9A 3T1HL 1BQQT 2ALYB 3MEHA 4EVYA 4IFDJ 1GXDC 4LF8Q 2ZOFA 4M6IA 1LT4D 3TQYA 1R3NA 2ARHA 1DOLA 4YCUA 2QCPX 3VR4A 2SNMA 1Z9FA 2QILA 1KC8C 2RF4A 3BZCA 4A3MB 4MI4A 1YQEA 5EBCA 4DXFA 5ISRA 4NGQA 4CJ0B 5C4XB 3GO5A 1JCKB 3GDEA 1B87A 1S7FA 2IJZA 1BKBA 1EZ6A 3I7FA 1YHQA 5I6YA 4HPSA 4B14A 3TOAA 4QGUA 4KOVA 1EQTA 4C3JG 4JJXA 1HR0Q 1L0YB 3NQTA 1SE8A 4DV6Q 3NTIA 1S72A 1YW4A 3TCVA 4ZX8A 2NVQH 5A2QE 1PYTB 1AH9A 4B5PA 2CY2A 1RO5A 3CZXA 4Y49C 4K6LA 5DS0A 2NTSA 3TDQA 1KD1C 3U4ZA 4OLLA 2Z1CA 2RC4A 1HHVA 2EXZA 2EYJA 3RR5A 1SMYC 1NAPA 1Z4RA 3EA6A 1OXTA 1HRJA 2EQSA 4B5PB 3V7ZA 2A6ED 1EY4A 4XYOA 4IFDH 3TO7A 2LXKA 2PE3A 3U4VA 4U673 3Q23A 1BBUA 2WPXA 1E22A 1XXGA 3DM1A 4NSQA 1LYLA 1PCAA 4O1NA 3JTKA 4IOAA 5C4JB 2YNCC 4CDCC 3OTOL 1A3UA 1ZG9A 2Z9HA 3NBIA 1TWAH 2GU2A 4JWPA 2F0EA 5IYBH 1X56A 4DV7L 4UAIA 2Y0MA 2VUMH 2Z11A 5BR8Q 4NF1A 4ZRZA 2C6GA 4V190 3WOEA 4B3TL 3NTHA 1I50H 3TBIB 5M3MB 3RZDH 1R4QB 1X6OA 1J5EL 4DA2A 1Q2DA 2Z3MA 5IGCA 3OWCA 2QEJC 2QYVA 3MHBA 5EQ0A 1NCVA 1R4PB 1VQJA 5CORA 3R95A 2N3SA 1NUCA 1FVIA 1TKJA 3S6FA 1ARMA 1WCMH 3PP9A 1FGUA 2LKVA 2Q2TA 4FD5A 4ID6A 1MD2D 4B9WA 4Q0FA 3IWEA 1GKHA 4KVME 2P5ZX 3HZXA 4C56C 2A6HC 1TS4A 4KN4C 3A5UA 4OIDA 4UP7A 4X6AH 1PRTB 2CWPA 4NXYA 2VEZA 3A55A 2I0QA 2KCCA 1XMBA 2WB1B 3DLJA 1WFQA 2PC1A 4JYAL 2ZW4A 3GTQH 1TWFB 4A3BB 5KTAA 4C3JH 3TZUA 3LX0A 4JW0A 3VR3A 3GTGH 2Q7SA 3KKWA 3CXSA 4U9YA 1NBWA 4R9WA 1JWSD 3FRPB 3KJPA 4A94A 4CAWA 5K8MA 1RIPA 2BA0A 4DPGA 3HP3A 1EY0A 1LFWA 4KVOE 4A3MG 3A7AB 1KLGD 4XYQA 2ZEHA 3TEHB 1EY6A 4NKLA 3P7JA 4A3DG 3K59A 2O5IC 2WAQE 1O80A 2NSMA 1KQSA 2XEIA 4C3JB 5I0CA 4LAAA 5C3EH 4MFJA 1S40A 2HV2A 4P71A 2G0BA 4IN3A 4L5SA 5CYUA 4M85A 3SK5A 3HKZB 2R3ZA 2QMLA 1NTGA 1TIID 4CPAA 1GM5A 4RGOS 3PO2G 4PZ6A 1NMGA 2QVPA 2O2LD 3IL8A 1CA5A 4GNXC 3GLJA 4B3RL 3CQZH 1F9QA 4QIWB 1M1KC 5DNFA 1XMOL 4DV6L 2PCUA 4LF4L 1UEAB 1HUNA 4KKTA 4YWYA 4E8OA 2D4OA 1LUZA 4GLVB 1QSNA 2OEOA 5M5XH 1PH9A 3PZJA 4X66Q 1HCZA 2DNEA 2B2UC 2NZOA 4FDBA 4X3TA 2IX3A 4OC3A 3FKIG 4HNWB 1KLUD 1PA6A 4QY7A 4IALA 4EQ5A 4LF5L 1NSAA 4ZI6A 4EQOA 4GOPA 2K04A 4UCMA 2UXCQ 3IEHA 3SHPA 3E3XA 1G6PA 1CI3M 5CV5A 1QQ9A 2ZEOA 1Y1VB 3BVMA 4RGTA 4C7HA 2X69A 2UUAQ 1CKNA 4LF9L 4G7OC 4K5XA 5THWA 2JA5G 3J80L 4KOYA 3X3NA 3IJ3A 3I8ZA 2BO9A 1SE3A 4H44C 1K83H 1EY5A 2LSSA 4GOPB 3T1YQ 2ASBA 2IQ6A 4G1PA 4BY1H 4ZYSA 5LMNL 1V1PB 3D7GA 3QOLA 5GAGC 2FCKA 3LD2A 3Q22A 1NR4A 1R57A 3QAYA 1WTHA 3DWQA 3A8KE 1UE1A 1ARLA
chains in the Genus database with same CATH topology
2FVGA 2EY5A 3BHXA 2I07B 1O7ZA 3PB4X 4ZY2A 4X3UA 4EQPA 1LABA 4XT3B 1E0BA 4P4EA 4PQXA 4RAUC 1STAA 1HA6A 4KKUA 3D7DA 3H0GB 5AFWA 1RTQA 1BXTA 4OL7A 3D3RA 2EK8A 1LACA 1TKWB 1GUTA 2WAQB 1S5DD 3T16A 4L8JA 4A3DB 4C3IG 2RDHA 2F0NA 3C2PA 1PRTF 1K83B 2WKCA 3K5OA 2LMCB 5TSSA 1SYFA 2BOAA 2PJ0A 1F2LA 4A3EB 3OOCA 4P4IA 3SJFA 1CPXA 2ABZA 3NTKA 1C8CA 3TZDA 4M1UB 2F0JA 1JQYD 2L9HA 4TNUA 2FMCA 5C3XA 3GTOB 3Q24A 5IGGA 3QB3A 2Z4IA 3CKIB 4JBWA 2CIJA 3FJUA 4WFN3 2NWGA 1RD9D 4BA1I 1IGBA 3CPXA 1GHKA 2ZXPA 2FINB 4KK7A 2RFHA 5C0XH 1KDCA 4NGSA 1Q1EA 5G3LD 1EYDA 3JAME 4JZ0A 1Z6HA 1XRYA 1SYDA 1AW7A 5DAUA 1S5ED 4IUNA 2K01A 1HQRD 1K8OA 3BG3A 3T4AC 1TQOA 2SOBA 4RKLA 3R93A 4OO1I 1WTRA 1PDQA 1LT3D 1A15A 3DWPA 5C4HA 3I3CA 1DE4C 1EWHA 1Y0RA 1QILA 2F4IA 4OC1A 2OOTA 2A5HA 2TMPA 4LMQD 4DU9A 5KNBA 2PJ6A 2K6AA 3H8EA 3RZDB 3I91A 2ZXOA 3K6OA 1VMPA 3D31A 2D9UA 1ICWA 1UNSA 2PVWA 3OWEB 5K8NA 3MAQA 3AMUA 1RCVD 4XQQA 2Q51A 4MN3A 1I6HB 1EY8A 1MSGA 1SEBD 4MCRA 4RHSA 1PTOH 2RDGA 3NXWA 4FUUA 4NGPA 3S9WA 4XQJA 3M4OB 1EOTA 4H7BA 5C44B 4EMEA 3BZDB 3T53B 2IPKD 3L7ZC 5BN3A 4A38A 3UI2A 2B2UA 1ESRA 1A2UA 2L12A 1F9SA 2PIZA 5IGBA 1FNVA 2Z8LA 4ZQ3A 4F9VA 3BVGA 3SVMA 4OIWA 2VNUD 2BOSA 1IW7C 4OMEA 2BCOA 1E2VA 4O23A 4K14A 4W9YA 2GLJA 3OMCA 4KMUC 2L0CA 1PLFA 1TR5A 4NDXA 4IHMA 4DAVA 2FMMA 1IW7D 4WJWA 4V0BA 5IGDA 2PJCA 1SMYD 1F2OA 3T51B 2R93B 3B3SA 2PYKA 1VF5C 1U4LA 3S9MA 2GREA 1Q8IA 2XIWA 1KDAA 2NTTA 3M7GA 4YIJA 3K5MA 5LL6S 4KSIA 4QUCA 3MXNA 1Z8LA 1LTGD 4P2CB 5IT9L 2G9DA 3PBEA 2V8VA 3M3YB 3T56B 4NGRA 2NB0A 1AFPA 4ABNA 2V8DA 3DEPA 1XYIA 4ONWA 1ZYRD 1GUNA 1IYUA 1U9RA 5IOCA 3R2TA 1VCIA 1YLOA 3N52A 2FHTA 3VR6A 2K32A 3RUZA 3NP8A 2A68D 4H0LC 4QF4A 2NN6G 4PMCA 1D5ZC 4K2LA 1VMCA 4HCSA 1AP0A 1Y0YA 1ILPA 1CG2A 2VXWA 2NYQA 5J1QA 2AQ3B 2ZEGA 5E3FA 3HOYB 3O13A 5CPAA 1RODA 3S15B 2XWBB 1PFNA 2E74C 1ILQA 2F0KA 3QJYA 1TWGB 2B39A 1NSNS 1DOMA 3IKJA 2F0OA 3EVQA 4C1NK 3A8JE 1WTWA 4RUHA 3NPPA 1KNEA 2PJ4A 1CM9A 1AMPA 2AFUA 3OIQA 3G7LA 3U9SA 3VH9A 1CPSA 3MFYA 1S5CD 3LNNA 2NN6I 1DZ1A 4OC5A 3DWAA 4EVOA 3MWYW 1QWYA 1Y8OB 3C1FA 1C4QA 3NSWA 1TVXA 1DONA 4R8IA 1AYEA 3VYTA 4IFDI 1M8AA 1B4OA 3GD7A 3D8GA 4ULLA 1H9RA 4R76A 4YU9A 2LY7A 3DEOA 4Q5VA 2KEEA 1B2TA 2EWBA 3OHXC 3SI1A 4MHPA 5M5XB 1LV9A 3WC6A 2JP1A 1OXUA 3E0JA 1D1IA 2LFNA 4OO1H 3SEBA 4WRDA 1TXRA 3AU7A 3KQZA 5LL6X 2VUMB 5EJWA 1EEFD 1RJTA 3K2KA 3SHLA 3P75A 1Z2LA 1NR2A 3PRTA 4RWSC 5CV6A 2HUGA 2MJ8A 5LYIA 4DJLA 4BBSB 3TX8A 2EDGA 2R61A 4MCPA 4ZY0A 2QKIC 4IK2A 2O5JC 2QDBA 1BPNA 4PXCA 4DXGA 3C3LA 5DEHA 4JYWA 1S5BD 3R3OA 4PV1C 5CV7A 4NJQA 3A56A 5LHY1 2PJ3A 3WT4A 1UUPA 1SYBA 5LYFA 1ZEQX 4Q7AA 4DNTB 3JAML 3L3OC 1GUOA 2ZELA 2CW0C 2Y0SB 3SI2A 2ZEEA 4P4FA 2PJAA 1O7LA 1AEXA 4K8JA 3KLSA 3GTMB 3KHXA 2BDOA 3JRUA 4LQGA 3DHQA 3PB9X 5ELEA 1D6EC 4OGQC 1I4PA 1KWMA 2AUJD 2C1CA 3EROA 1JB3A 2V77A 3LWEA 1S5FD 4FO2A 1LOKA 3CHBD 2EY6A 5ELFA 2VB3X 2ID0A 4MMOA 2JE6I 1CP7A 3U9OA 4FF1A 1QJOA 4P4BA 3MFGA 3PUXA 3NA6A 3KZWA 2PNRC 1BCPB 4FP5D 5DM63 2F0VA 2JA6B 2RQXA 1PFMA 1TT2A 4DN4M 2F7VA 2RSNA 1HPCA 5EGTA 1CX8A 2ENBA 1PXUA 5E1FA 2PZUA 4WJBA 2KEDA 4CBVA 1FR3A 3PUYA 3A8IE 2XNAC 1HDQA 5I9OA 1FYCA 3M85A 2MUYA 2OXPA 3ITPA 4KJNA 2K5WA 5IB9A 1WTVA 1L0XB 3I70A 1DJRD 2VL1A 3J81E 3RMHA 5I2YA 1B9MA 3WOFA 4FBEA 3H91A 1Z5RA 2MGSA 3D7FA 1E2WA 5LYDA 3ZYYX 1ZG8A 2B2YC 5CC4A 5T1IA 1SNOA 1VHEA 4MHNA 2B2VA 3HUVA 2L5TA 4ZY1A 3VYUA 1TY0A 5KGUA 2ZEPA 5FO8B 1YNND 4BA2I 5JPNC 1AN8A 1STYA 1STBA 4P4DA 2CTCA 3BYTB 3H09A 2E2JB 2PO4A 4K2KA 2F0MA 4R6TA 4XIGS 4IFDG 4QUFA 3ND8A 1TS3A 1GOZA 2TSSA 2V8HA 1F9PA 2GLFA 2G9HD 3MA2B 4Y7NB 1B3AA 3GTJB 5K36H 3N5FA 4A3FB 2XEFA 5M3FB 2Q4ZA 1MI2A 2H4OA 3OW7A 4TWEA 1QNUA 3HEJA 4NMZA 4KD3A 3KQXA 4ZAIA 1F57A 3SK6A 5ELYA 2IW3A 4NGNA 3S1MB 1EIHA 4FWUA 3SXHA 2VB2X 1HXYD 2LS01 2B63B 1KTKA 3GV6A 1LAMA 1ET6A 3BXMA 3K5LA 5I4DA 4X8IA 5C6AA 1EQVA 5D29A 3BDCA 1CHQD 5CBMA 1EYAA 1ELLP 1CA6A 5FOBB 3BDOA 2AFMA 1LCPA 4HSVA 2F0IA 2F0UA 3QOJA 1LT6D 2DEAA 2R92B 1ONLA 1B50A 4OC4A 3P20A 5D3IB 1B53A 2EZVA 3D67A 3FEDA 3B2YA 4IQZA 3RLFA 3T8WA 1SNMA 1ENAA 1JICA 3RAMA 3KR4A 1STGA 3M4YA 3J80E 3KR5A 1YNNC 1WD0A 1GUWA 2XSCA 1K8MA 1STNA 4IUPA 1PZKD 1Y8NB 2IL8A 5CBAE 1TS5A 1Y7EA 1KAAA 8CPAA 3DMUA 3IIBA 3D4WA 2ZEDA 5CBEE 5C3WA 2A69C 2ZEFA 1FNUA 5A2QL 1T5EA 3Q6SA 6CPAA 4C3HB 4A37A 5F2DA 1PTOD 1V1OA 3PB7X 1EU4A 4HAEA 1DOKA 3FF3A 4UEZA 3HRZC 1QMUA 5LRKA 1TY2A 4UEEA 4R8NA 1SDFA 2PIYA 2RKSA 1SBBB 1Y1WB 3PFEA 1ZLIA 1SE4A 5M9OA 2ZENA 4EWTA 4CGYB 4MIUA 1YNJD 3RZOB 1PMRA 4KKSA 4HEDA 3S14B 1PTOB 1SSOA 1BLLE 1BCPC 3EFXD 4FXGC 5EBDA 1EEID 1LTID 5JOBA 3K57A 2A74C 2DNCA 2WZNA 1QNKA 4RH6A 2NVYB 2KHSA 2PJ5A 2K28A 1SNCA 1ML0D 1LO5D 1I4RA 1SJED 3CRLC 1V1PA 1Q90A 1G2TA 5E4WC 5KNCA 2EY1A 3ISZA 5D3DA 4B6ZA 3PO2B 5K5PA 3KK7A 1Q1BA 1TU2B 1ZXTA 1BCPF 1JC7A 2F8HA 3S2DB 5C4ZA 1A6XA 4ILWA 3GTLB 5HVFA 2PW5A 3SJXA 5D8NA 5EKKA 4C3HG 1I4QA 4EQNA 4S3SA 1Q7LA 2KA7A 1HFNA 2K7VA 3HOWB 3DUZA 3GTKB 3GTGB 2A6EC 1EWCA 2BDNA 2V4DA 3PV0A 3B3TA 3W2DA 1LTRD 4PXBA 1VDZA 1PRTC 2X6LA 3BDLA 2E2IB 1I4GA 1GUGA 2B2WC 1X32A 3NWTA 4FAIA 2HDLA 2A6HD 3EJIA 5ELCA 3QG1A 4X2TA 3D7HA 1SNPA 3TP6A 4KI0A 4DAYA 2IMOA 3KBXA 2F0LA 4K3NA 3WC7A 2B2YA 3NH5A 3SK8A 2M2LA 3VARA 2PZWA 1BAVA 2KOLA 1I4XA 5LRGA 3FMCA 4C3IB 4A3KB 1E2ZA 2B8GA 4MRIA 5LRJA 4OP4A 2Q8IB 3AB9A 2CF4A 1JQGA 5D65A 5CV9A 3S1NB 3K5NA 2F0GA 4P4JA 2N55A 3SJGA 2BA1A 4BWGB 2AWOA 2F3WA 1I6VC 5C0XJ 1QE6A 3LWUA 5T1GA 2PJ9A 2ZEMA 1PZJD 5EPJA 4DFAA 1B1ZA 3KUPA 4C2MB 3SK4A 1ZLHA 3RZAA 4RFBA 1I4HA 2PJ2A 4KD4A 4ZUIA 2E2HB 2AFXA 2AFSA 4F8ZA 2PCFB 4NP5A 1I3QB 4MXUA 1TWAB 2A68C 2EJGC 5FO7B 3D4UA 3OWFA 2JBJA 2EYLA 1HUMA 5KYIA 1CBXA 3I4LA 2WP8J 3ERQA 3RBUA 4HMIA 2JEBI 2AFZA 3L9AX 4A3GB 2PMZB 4DK0A 3B35A 1F77A 1ELMP 1F9RA 3H3VC 5F09A 1CQVA 1F2MA 5HVHA 2M00A 3GQBA 4ZKBB 5KEEA 3VYSA 4F87A 2NVQB 1UWYA 3NK9A 1EL0A 2PQEA 3FEWX 1H9KA 4F9UA 1ET9A 2A69D 3HGBA 2B2WA 3VA7A 2K1BA 5K8OA 1MSHA 5G3LF 4KHVA 2E75C 4FF2A 1PTOC 2DY8A 1FT7A 4QMGA 3HS0C 3H94A 1H9SB 3W3AA 3QIAA 3B3WA 3KLSX 1C48A 4KJOA 1VIXA 4FNFA 3P1HA 4U68A 1TWCB 2FFKB 4F8MA 2Q8TA 3NUCA 2HDMA 1O7YA 3TN2A 2JEAI 5KNDA 3ISXA 2H1EA 3D6WA 5KRUA 2KVMA 1D5MC 2C6CA 1GHJA 1S4ZA 2PW7A 5BN4A 3VR2A 4PPZA 2HCIA 4QB4A 1YW6A 2YU9B 2F0SA 1J8IA 3A54A 1YMEA 3FKIB 1HQMC 1ENCA 1MBYA 1LTTD 2RB7A 4QCLA 1EY9A 3FECA 3HOZB 1D2BA 1PTOF 4CHTB 2JEWA 1TKHA 1RHPA 5IGEA 4X3SA 2JA5B 1R43A 1SFOB 1A2TA 3R2IA 3PFOA 2KUMA 1XWEA 1OXVA 1JE4A 3BI1A 3J7AV 3C1EA 5IGFA 1DCZA 3FPPA 2ICIA 1WTOA 3OIPA 4KN7C 1IYVA 1Z7TA 3PO3B 2NVXB 4NJRA 2RBMA 2CVRA 4KTAA 1PFBA 3GV3A 3S1QB 1CK1A 1II3A 2JA8B 4ZKCB 4CJ2C 2JYOA 1LLRD 3K0YA 3M7NA 4BY7B 1HDUA 2PJBA 3IAYA 3H8FA 1M4VA 3HOUB 3I4NB 4HTHA 1XFOA 5HXDA 3IFTA 1IHZA 4OIKA 2IT1A 1PZID 4F7XA 3VYRA 4CKCA 4CKBA 4H2KA 4RGNA 4OKOA 1OBRA 2SNSA 3V2TA 1T5XD 4DF7A 2AFWA 4L6TB 2PJ7A 1MGSA 2PJ1A 2GA4B 4PQAA 2F0TA 4A3IB 3D4DA 2PJ8A 1Q12A 4FYDA 3N6RA 4BY1B 2EE1A 2OR4A 1PRTD 1TF9A 5J1ZA 2QJ8A 4DAPA 4GM5A 3S2HB 1IL8A 3V38A 2JSOA 3OMGA 2DY7A 4TRDA 3MXPA 4PXEA 1W6JA 4JK1C 3QO2A 1LTAD 3CDXA 1HTPA 4MCQA 5C5LA 4PMBA 1H9JA 1IKMA 2WKDA 3PB8X 2EJMA 5DM73 2XRSD 3I90A 1F2ZA 5M5WB 2V8GA 1YSJA 2J9AA 2L55A 1EU3A 5LYLA 1O78A 1BUVT 4KHZA 5CR3A 4P45A 4K6DA 7CPAA 1DM0B 5I6WA 1DD2A 1PYWD 5JH9A 4FF3A 5EPLA 4WWVA 3NHHA 3I4MB 1XX8A 4A39A 3PUZA 1EZ8A 1D5XC 4H13C 4NGTA 3TSSA 4ZX9A 2RSOA 4FF4A 2EYFA 5E4XA 4KY6A 2C5CA 3TP7A 1WTXA 2I3CA 1G6ZA 2JXMB 5COYA 2IWHA 2F0WA 3K9TA 3X3MA 4WORA 4IUTA 1G291 4ZYQA 2N88A 1Q3LA 2AFOA 3KLRA 1SYGA 2PVVA 1QCBD 1WCMB 1CP6A 1EFID 1EE3P 1LAPA 5JJZA 1F2PA 3TP5A 3J81L 2B8FA 2Q43A 2AQ1B 1RTNA 2OT2A 2NVTB 4TKOB 3IO1A 3TP8A 1LANA 4DK1A 2WV6D 5I2XA 2ZOGA 2XVSA 1U4PA 1CZWA 1R9TB 3BYYB 3B3VA 2BE5D 4L63B 2XEJA 1BCPD 3FH4A 3S16B 4G4KA 5HURA 3NQIA 2XWJB 3DGVA 4Z9CB 1BR9A 4I65A 1WVLA 1FGBD 5JEAJ 2SEBD 2IX1A 2EVBA 3A7LA 3H6MA 1TWHB 3V96A 2J4XA 1DYQA 4NGMA 4IURA 1SE2A 2PZTA 5D14A 2POKA 2NN6H 3CQZB 5BN5A 5KYLA 1SJHD 1XJOA 2I46A 1HA5A 5ELDA 5JM6A 5C0XG 2XEGA 1BPMA 4XXEA 3I73A 5JAVA 4OO1G 3IFEA 2CTBA 4KY5A 5CMDA 1DTDA 2CQAA 3E5SA 1SYEA 1B44D 1RTOA 2CHBD 2XN9C 5IT9E 1V43A 3QNVA 2SDFA 2RA4A 3MXUA 1FNOA 5FK9C 1GUSA 5EKLA 1M4LA 5FO9B 3NH4A 2D2CC 3MVVA 1VGYA 2L11A 1AZPA 2M9VA 3VATA 3MTSA 4P6YA 4P10A 5HVGA 5ELBA 1OO9B 4NFRA 2A73B 2Z4HA 2RVLA 1KDBA 3KASA 3E6ZX 4LK1C 1KABA 4A93B 4HSPA 4PNYA 4XT1B 3PUWA 1ZKOA 5C5MA 3FPUB 3SJEA 5CV8A 2NZ1D 3KI9A 4O42A 5JPMC 2MPMA 1BF4A 2CW0D 4CKEA 4G7ZC 1XBUA 4MHYA 4XQNA 2BE5C 1CQFA 3MXGA 1CT1D 3S9NA 2D62A 2E2DC 5K36G 4B08A 4N9TA 1SYCA 3PMFA 4DNRB 1J9OA 2EYPA 3KGQA 1A3TA 4IUQA 4OC0A 3EQLC 2JBKA 5KIXA 1QOHA 1IKLA 3FX6A 4DUKA 4KY7A 1G2SA 1LTBD 3HG9A 1WTPA 5JVG3 3KL9A 2J7ZA 1BOSA 3ND9A 4XTCS 1VHOA 2X6GA 1OXSC 5EPKA 4P44A 2K5QA 4TQUS 2OF1A 2NYZD 3PIO3 1G8ZD 4X3RA 4K5VA 1JWMD 4C1NI 4IUUA 3GTPB 4A3JB 1Z47A 4FXDA 2AWNA 1JOKA 4XDXA 1LTSD 3L2NA 4RGMA 5M5YB 3TC8A 2IX0A 4UDUC 5NUCA 2R7ZB 4TSSA 3PUVA 1H8LA 2KECA 4RCNA 3KBGA 5CV4A 3MZ5A 5JEAH 4RA8A 2EYMA 1XTCD 1HFGA 2KCNA 3BVZA 3SE0A 5A35A 3Q0AA 1G91A 2WACA 2YYZA 4HR7B 4RKBA 4PMWA 1GJXA 4AXVA 4EFDA 1TKFA 5I9PA 3F2UA 4E6IA 3IC1A 4K5WA 1STEA 4DYOA 3NE5B 2F0FA 4IZ8A 2IJ0A 4HMJA 4KV6A 1JOQA 2EK9A 1UAPA 2EPBA 2KQ3A 3MC0B 2PPBC 3D6CA 3K58A 3PBBA 3C46A 3I72A 1BO0A 2K03A 2O4HA 1BBXC 3VR5A 2DN8A 3J7AF 2ANPA 2AUKA 5EKIA 4ODGA 3PEIA 1OXXK 2HCCA 3OPOA 1CZGA 3TMEA 5FLXE 5JEAG 5K8PA 2EJFC 3QWNA 2C9OA 4HCEA 2J0TD 2ZT9C 3BI0A 3HOXB 2PRQA 4UEFA 1H9MA 4GZYC 4J8QA 3D66A 1D1KA 4IAVA 2QF7A 4ZLTF 3MRUA 3GB0A 2K33A 2FJ2A 5J39A 2Q8RE 2RDFA 5C0XI 2ICEC 3FDTA 4N9PA 3BS1A 5JVH3 4MCSA 1SNQA 3CU7A 1WD1A 2B2VC 1DXMA 4B9XA 3CRKC 2L4NA 1WTQA 1EIGA 1A3VA 4F88A 1LT5D 1B9NA 4CJ1B 2L1BA 1F2YA 2MP1A 4MHZA 3ONAB 5IODA 3T13A 1GYTA 3WC5A 4BBRB 1VF7A 4R7MA 2HQEA 5J22A 2O53A 4LJZC 1FNWA 2AQ2B 2MHVA 2F03A 1ZG7A 2B2TC 1RKNA 1Y69U 3GTQB 4ZUJA 3FVLA 4OIJA 3IFDA 4OC2A 1W6KA 3IWWA 1ESFA 3KHZA 1JWUD 4IUVA 3WDNA 3S17B 4BD9A 4J1MA 3PB6X 3FVQA 3B3CA 5JGFA 4R8FA 3MN8A 2HC9A 4NW2A 1V8QA 4FVMA 1X3QA 1RF2D 1EYCA 3CT9A 4EGVA 3H8GA 1SXTA 1BNZA 5FLXL 3GUXA 1QG7A 2XRQD 1QB5D 2EYOA 2JA7B 4AYBB 1HTLD 3OSOA 1HEEA 3FEEA 3DXJC 3NWSA 3WABA 3K7AB 1ENFA 2KJXA 4DGZA 1CTMA 2WYRA 2F1MA 3S1RB 4J6HA 3NFZA 3SR1A 3CPAA 4I7ZC 1TS2A 2K05A 1EY7A 2C6PA 2F3VA 1TF8A 2F0PA 3RD4A 1BDOA 4X3KA 3G6JB 5FKAC 1JOOA 4ME5A 3V05A 1SNDA 1H9SA 3D4RA 5C3EB 1U4MA 2F0QA 3D68A 3GP7A 3NBHA 4MHEA 3VA5A 3PIP3 4UIAA 2E76C 1IY7A 3I1UA 3LMSA 4FXKC 3NH8A 1JR0D 4Z65A 2WIIB 5IIFA 1Y8PB 4G7HC 1STHA 1X3PA 4HN7A 4RHRA 2NBFA 3KF8A 1AZQA 3B7IA 5I4MA 2K5DA 1U4RA 3HLPA 2EY2A 4OHJA 2HB6A 3S9LA 2R6GA 5HGTA 3SI0A 1CFMA 3HOVB 3SDZA 2O4XA 4PXDA 1YNJC 1FD7D 4K8IA 2WINB 1CHPD 4ZK9B 1RDPD 3R8BA 4M8AA 1KNAA 2F0DA 5CGKA 2ZXRA 2NUCA 1I50B 2EYHA 2B2TA 1ZYRC 2F0HA 2D5DA 1JORA 3J7YW 4UIBA 3URYA 2EOTA 1SAPA 4G57A 4RCOA 4BS9A 1BQQT 3MEHA 4IFDJ 1GXDC 2ZOFA 1LT4D 1R3NA 1DOLA 2QCPX 3VR4A 2SNMA 2QILA 4A3MB 5EBCA 4DXFA 5ISRA 4NGQA 4CJ0B 5C4XB 3GO5A 1JCKB 2IJZA 1EZ6A 5I6YA 1EQTA 4C3JG 1L0YB 3NQTA 3NTIA 1YW4A 4ZX8A 5A2QE 1PYTB 4K6LA 5DS0A 2NTSA 3TDQA 2Z1CA 1HHVA 2EXZA 2EYJA 1SMYC 1NAPA 3EA6A 1OXTA 1HRJA 3V7ZA 2A6ED 1EY4A 4XYOA 4IFDH 2PE3A 3Q23A 4U673 1XXGA 3DM1A 1PCAA 4O1NA 5C4JB 1A3UA 1ZG9A 3NBIA 2GU2A 2F0EA 4UAIA 4ZRZA 2C6GA 4V190 3WOEA 3NTHA 3TBIB 5M3MB 1R4QB 4DA2A 5IGCA 2QEJC 2QYVA 3MHBA 5EQ0A 1NCVA 1R4PB 5CORA 1NUCA 1TKJA 1ARMA 2LKVA 4ID6A 1MD2D 4B9WA 4Q0FA 3HZXA 4C56C 2A6HC 1TS4A 4KN4C 4OIDA 1PRTB 3A55A 2KCCA 1XMBA 2WB1B 3DLJA 1TWFB 4A3BB 3TZUA 3LX0A 3VR3A 4UF4A 4R9WA 1JWSD 3FRPB 4A94A 5K8MA 2BA0A 1LFWA 3HP3A 1EY0A 3A7AB 1KLGD 4XYQA 2ZEHA 1EY6A 4NKLA 3P7JA 3K59A 2O5IC 1O80A 2NSMA 2XEIA 4C3JB 4LAAA 4IN3A 5CYUA 3SK5A 3HKZB 2R3ZA 1TIID 4CPAA 4RGOS 2QVPA 2O2LD 3IL8A 1CA5A 3GLJA 1F9QA 4QIWB 5DNFA 2PCUA 1UEAB 1HUNA 4KKTA 4YWYA 2OEOA 1HCZA 2DNEA 2B2UC 2IX3A 4X3TA 4OC3A 1KLUD 4IALA 1NSAA 4ZI6A 4EQOA 2K04A 3IEHA 1CI3M 5CV5A 1QQ9A 2ZEOA 1Y1VB 3BVMA 4RGTA 2X69A 4G7OC 4K5XA 5THWA 3J80L 3X3NA 3IJ3A 3I8ZA 2BO9A 1SE3A 4H44C 1EY5A 4G1PA 2IQ6A 4ZYSA 1V1PB 3D7GA 3QOLA 3Q22A 1NR4A 3DWQA 3A8KE 1ARLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C1C A;  2V77 A;  1ELM P;  2FVG A;  4DYO A;  3NE5 B;  1LOK A;  3BHX A;  5F09 A;  3PB4 X;  2EK9 A;  5HVH A;  4ZY2 A;  4MMO A;  3GQB A;  2JE6 I;  1LAB A;  1CP7 A;  2PPB C;  1UWY A;  4P4E A;  1QJO A;  4P4B A;  4KKU A;  3PUX A;  3D7D A;  3NA6 A;  3PBB A;  1H9K A;  4F9U A;  3KZW A;  2PNR C;  1RTQ A;  2A69 D;  3HGB A;  3I72 A;  3VA7 A;  5K8O A;  2EK8 A;  2O4H A;  1LAC A;  1TKW B;  3VR5 A;  1GUT A;  2DN8 A;  2E75 C;  2ANP A;  2F7V A;  1FT7 A;  4L8J A;  1HPC A;  2AUK A;  1CX8 A;  4WJB A;  3H94 A;  1H9S B;  3PEI A;  1FR3 A;  1OXX K;  3PUY A;  3W3A A;  3OPO A;  3QIA A;  3A8I E;  2LMC B;  3B3W A;  5JEA G;  2BOA A;  5K8P A;  2EJF C;  2PJ0 A;  1HDQ A;  3OOC A;  4P4I A;  3SJF A;  1VIX A;  1FYC A;  2ZT9 C;  3M85 A;  3BI0 A;  1CPX A;  2ABZ A;  2PRQ A;  4UEF A;  1H9M A;  5IB9 A;  4GZY C;  2JEA I;  2VL1 A;  3D66 A;  4TNU A;  5KND A;  3ISX A;  4IAV A;  2QF7 A;  3MRU A;  1B9M A;  3GB0 A;  4FBE A;  2K33 A;  1Z5R A;  2C6C A;  1GHJ A;  3D7F A;  1E2W A;  5BN4 A;  5LYD A;  3VR2 A;  4PPZ A;  1YW6 A;  1ZG8 A;  4MCS A;  4JBW A;  2CIJ A;  3FJU A;  1VHE A;  1YME A;  1DXM A;  4MHN A;  4BA1 I;  1IGB A;  3CPX A;  3HUV A;  1HQM C;  3CRK C;  1GHK A;  2L5T A;  2RB7 A;  4ZY1 A;  3FEC A;  2RFH A;  2ZEP A;  5C0X H;  4BA2 I;  1TKH A;  2JEW A;  4NGS A;  1Q1E A;  1B9N A;  4JZ0 A;  4P4D A;  2CTC A;  1Z6H A;  1XRY A;  1R43 A;  3PFO A;  1OXV A;  3BI1 A;  4MHZ A;  4R6T A;  4XIG S;  1DCZ A;  1GYT A;  3FPP A;  3WC5 A;  4IFD G;  1K8O A;  1VF7 A;  4R7M A;  4KN7 C;  3ND8 A;  3BG3 A;  2O53 A;  1IYV A;  1Z7T A;  4LJZ C;  2V8H A;  2GLF A;  4NJR A;  1ZG7 A;  5K36 H;  3N5F A;  1Y69 U;  3M7N A;  1HDU A;  2XEF A;  2PJB A;  3FVL A;  2Q4Z A;  3H8F A;  1DE4 C;  4OC2 A;  3OW7 A;  1EWH A;  1Y0R A;  3IWW A;  4TWE A;  3KQX A;  3KHZ A;  1F57 A;  1XFO A;  5HXD A;  3IFT A;  5ELY A;  3WDN A;  4BD9 A;  4NGN A;  4FWU A;  4OC1 A;  2OOT A;  3PB6 X;  2IT1 A;  1LAM A;  3B3C A;  3BXM A;  4H2K A;  4X8I A;  5JGF A;  4R8F A;  4OKO A;  1OBR A;  5KNB A;  2PJ6 A;  3H8E A;  3MN8 A;  5D29 A;  2AFW A;  2HC9 A;  2PJ7 A;  5CBM A;  3D31 A;  1V8Q A;  1ELL P;  2PJ1 A;  2PVW A;  4PQA A;  3BDO A;  2PJ8 A;  2AFM A;  1LCP A;  1Q12 A;  3CT9 A;  5K8N A;  3N6R A;  3H8G A;  2DEA A;  4OC4 A;  1ONL A;  2OR4 A;  1TF9 A;  2Q51 A;  3P20 A;  3GUX A;  2QJ8 A;  4GM5 A;  3D67 A;  3FED A;  1HEE A;  3FEE A;  3V38 A;  3B2Y A;  4MCR A;  4PXE A;  3DXJ C;  4JK1 C;  4IQZ A;  3RLF A;  3WAB A;  3T8W A;  2WYR A;  1CTM A;  4FUU A;  4NGP A;  2F1M A;  3NFZ A;  4EME A;  3CDX A;  3CPA A;  1HTP A;  4MCQ A;  3T53 B;  3RAM A;  3L7Z C;  4I7Z C;  3KR4 A;  1H9J A;  3M4Y A;  5BN3 A;  4OGQ C;  4A38 A;  3PB8 X;  2EJM A;  3KR5 A;  2PIZ A;  1YNN C;  2C6P A;  1TF8 A;  1BDO A;  1K8M A;  4F9V A;  2V8G A;  1YSJ A;  2J9A A;  4OIW A;  1Y8N B;  1IW7 C;  1H9S A;  4OME A;  2BCO A;  5LYL A;  1E2V A;  4O23 A;  1O78 A;  3D4R A;  4W9Y A;  4KHZ A;  2GLJ A;  4P45 A;  3D68 A;  4KMU C;  7CPA A;  4UIA A;  1DD2 A;  2E76 C;  1Y7E A;  5JH9 A;  1IY7 A;  3I1U A;  3LMS A;  3NH8 A;  4IHM A;  4WWV A;  8CPA A;  3IIB A;  2ZED A;  1IW7 D;  4Z65 A;  2PJC A;  1F2O A;  3T51 B;  3PUZ A;  4A39 A;  3B3S A;  2A69 C;  2ZEF A;  1Y8P B;  1T5E A;  1VF5 C;  3S9M A;  4G7H C;  6CPA A;  4H13 C;  2GRE A;  4A37 A;  4NGT A;  3PB7 X;  4ZX9 A;  4KSI A;  1Z8L A;  3B7I A;  5I4M A;  2G9D A;  2I3C A;  3FF3 A;  3HLP A;  3PBE A;  2JXM B;  2V8V A;  4UEZ A;  3K9T A;  2HB6 A;  3S9L A;  2R6G A;  3T56 B;  1QMU A;  4NGR A;  3SI0 A;  1CFM A;  1G29 1;  5LRK A;  3SDZ A;  4PXD A;  4UEE A;  1YNJ C;  2V8D A;  2PIY A;  4ZYQ A;  4ONW A;  3PFE A;  2AFO A;  3KLR A;  1ZLI A;  2PVV A;  1GUN A;  1IYU A;  2ZEN A;  4EWT A;  1CP6 A;  1EE3 P;  1VCI A;  1LAP A;  1YLO A;  1F2P A;  2AFZ A;  1PMR A;  4KKS A;  2B8F A;  3VR6 A;  2Q43 A;  1ZYR C;  2K32 A;  2D5D A;  1BLL E;  4TKO B;  4H0L C;  2A68 D;  3IO1 A;  1LAN A;  4DK1 A;  4UIB A;  2ZOG A;  2NN6 G;  3B3V A;  2BE5 D;  1Y0Y A;  2DNC A;  2XEJ A;  2ZOF A;  1CG2 A;  2WZN A;  3FH4 A;  2NYQ A;  5J1Q A;  1R3N A;  3VR4 A;  2PJ5 A;  2ZEG A;  3DGV A;  5CPA A;  4NGQ A;  2IJZ A;  2E74 C;  3QJY A;  2EVB A;  3A7L A;  4NGM A;  3IKJ A;  2POK A;  2NN6 H;  5BN5 A;  3CRL C;  1YW4 A;  4ZX8 A;  1Q90 A;  1PYT B;  1XJO A;  5JM6 A;  3A8J E;  5KNC A;  5C0X G;  2XEG A;  1BPM A;  3ISZ A;  4RUH A;  5DS0 A;  3I73 A;  4B6Z A;  4OO1 G;  3IFE A;  2CTB A;  1Q1B A;  2PJ4 A;  1AMP A;  2AFU A;  1DTD A;  3U9S A;  3VH9 A;  1TU2 B;  1SMY C;  1CPS A;  2F8H A;  3MFY A;  1OXT A;  3LNN A;  1V43 A;  1A6X A;  3QNV A;  3V7Z A;  2A6E D;  2NN6 I;  5HVF A;  3MXU A;  3SJX A;  4IFD H;  1FNO A;  5D8N A;  2PE3 A;  4OC5 A;  1GUS A;  1M4L A;  1Q7L A;  1Y8O B;  2KA7 A;  3NH4 A;  1PCA A;  2D2C C;  1VGY A;  2K7V A;  3VAT A;  1ZG9 A;  2GU2 A;  2A6E C;  4P6Y A;  1AYE A;  2V4D A;  3PV0 A;  3B3T A;  4P10 A;  5HVG A;  4NFR A;  3GD7 A;  3KAS A;  4PXB A;  1VDZ A;  1H9R A;  4LK1 C;  4R76 A;  2C6G A;  4YU9 A;  1GUG A;  3PUW A;  4FAI A;  1ZKO A;  2QYV A;  2A6H D;  2EWB A;  3SI1 A;  3SJE A;  4MHP A;  3KI9 A;  1TKJ A;  3QG1 A;  1ARM A;  3WC6 A;  4X2T A;  1OXU A;  3D7H A;  4G7Z C;  4KI0 A;  1XBU A;  4OO1 H;  4MHY A;  1TXR A;  2IMO A;  2A6H C;  4KN4 C;  4OID A;  3KQZ A;  4K3N A;  2BE5 C;  3WC7 A;  2KCC A;  1XMB A;  3DLJ A;  3NH5 A;  3S9N A;  2D62 A;  3TZU A;  3VR3 A;  5K36 G;  4UF4 A;  3K2K A;  4A94 A;  4DNR B;  3VAR A;  5K8M A;  1Z2L A;  2BA0 A;  1LFW A;  1BAV A;  3PRT A;  3A7A B;  2ZEH A;  3KGQ A;  5LRG A;  3FMC A;  2O5I C;  2NSM A;  2XEI A;  5LYI A;  4DJL A;  1E2Z A;  2B8G A;  4OC0 A;  4MRI A;  5LRJ A;  3TX8 A;  3EQL C;  2JBK A;  2EDG A;  4OP4 A;  4MCP A;  4ZY0 A;  2Q8I B;  3FX6 A;  4DUK A;  3AB9 A;  4IK2 A;  2CF4 A;  2O5J C;  1JQG A;  1BPN A;  4PXC A;  3KL9 A;  4P4J A;  4CPA A;  3ND9 A;  4JYW A;  4XTC S;  3SJG A;  2QVP A;  2BA1 A;  1VHO A;  2AWO A;  4PV1 C;  1OXS C;  3GLJ A;  1I6V C;  4NJQ A;  4P44 A;  4TQU S;  3LWU A;  2PCU A;  4X3R A;  2PJ3 A;  2PJ9 A;  2ZEM A;  3WT4 A;  4KKT A;  4YWY A;  5LYF A;  4Q7A A;  4DNT B;  3L2N A;  3TC8 A;  1HCZ A;  1GUO A;  2DNE A;  2ZEL A;  2CW0 C;  1ZLH A;  4OC3 A;  3RZA A;  1NSA A;  4ZI6 A;  2PJ2 A;  3IEH A;  3SI2 A;  2ZEE A;  3PUV A;  1H8L A;  4P4F A;  2AFX A;  2PJA A;  2AFS A;  1CI3 M;  1QQ9 A;  4F8Z A;  4RCN A;  2PCF B;  5JEA H;  2ZEO A;  4MXU A;  4G7O C;  5THW A;  1O7L A;  2A68 C;  3IJ3 A;  2BO9 A;  2EJG C;  3D4U A;  4H44 C;  3KHX A;  2BDO A;  4G1P A;  2IQ6 A;  3SE0 A;  2JBJ A;  5A35 A;  3JRU A;  3D7G A;  1CBX A;  4LQG A;  3I4L A;  2YYZ A;  4HR7 B;  3RBU A;  3PB9 X;  1GJX A;  2JEB I;  3A8K E;  4AXV A;  4EFD A;  1TKF A;  1KWM A;  3IC1 A;  1ARL A;  2AUJ D;  3B35 A;  4DK0 A; 
#chains in the Genus database with same CATH topology
 2FVG A;  3CXP A;  2EY5 A;  1KL9 A;  3BHX A;  2I07 B;  1O7Z A;  3PB4 X;  3AYH B;  2JN4 A;  1KHI A;  4ZY2 A;  4UHV A;  4X3U A;  4EQP A;  1LAB A;  4XT3 B;  3P2F A;  1E0B A;  2MO1 A;  4A3B G;  4P4E A;  1UE7 A;  4PQX A;  4RAU C;  1STA A;  4YFJ A;  1HA6 A;  4KKU A;  3D7D A;  3H0G B;  4CYP A;  5AFW A;  1RTQ A;  1BXT A;  4OL7 A;  3GTJ H;  1X12 A;  3D3R A;  2EK8 A;  1LAC A;  1TKW B;  1GUT A;  2WAQ B;  1S5D D;  3T16 A;  3FNC A;  4YWL A;  4L8J A;  4CGP A;  3KYH C;  4A3D B;  4DR6 L;  4C3I G;  2RDH A;  3A74 A;  2F0N A;  4J3G A;  3C2P A;  4X5K A;  1PRT F;  1K83 B;  2WKC A;  1S60 A;  3K5O A;  2LMC B;  4ZCK A;  5TSS A;  1SYF A;  2BOA A;  4OWX B;  2J8R A;  1F2L A;  4A3E B;  2PJ0 A;  3OOC A;  4P4I A;  3SJF A;  4PZ7 A;  3HKZ G;  2B3U A;  2GIV A;  1K3B C;  1CPX A;  2R7F A;  2ABZ A;  3GTK H;  3NTK A;  3PGZ A;  4HJ9 A;  1C8C A;  2X7B A;  1VQB A;  3TZD A;  4M1U B;  1FJG Q;  2F0J A;  3H3V H;  1JQY D;  2L9H A;  2VBQ A;  4TNU A;  2REE A;  3CW2 C;  2FMC A;  4A3L G;  2WUU A;  1L1O A;  3HKZ E;  5C3X A;  3GTO B;  2JDD A;  5IP9 G;  3Q24 A;  2Q2I A;  5IGG A;  4DR2 Q;  3QB3 A;  4APV A;  4R4T A;  2Z4I A;  4LFC L;  2Q4Y A;  3CKI B;  5J8C A;  1K3R A;  4JBW A;  3GTP H;  2CIJ A;  3FJU A;  4WFN 3;  2NWG A;  1RD9 D;  4BA1 I;  3CCE A;  1D7Q A;  1IGB A;  3CPX A;  3NEN A;  1GHK A;  2ZXP A;  3TE4 A;  1Q8K A;  1XMO Q;  2FIN B;  4KK7 A;  2RFH A;  1LRZ A;  3S6G A;  5C0X H;  1KDC A;  4NGS A;  1Q1E A;  5G3L D;  1EYD A;  3ERS X;  3JAM E;  3LGJ A;  4JZ0 A;  5JJL A;  1Y1V G;  4B3M Q;  1Z6H A;  1XRY A;  1SYD A;  1AW7 A;  3FYN A;  5DAU A;  1S5E D;  5IYB G;  4DR1 L;  4NXM Q;  4DKA C;  5GAE C;  4XNH B;  4IUN A;  2WPW A;  2UXC L;  2K01 A;  1HQR D;  4CGL A;  1K8O A;  1UE5 A;  3BG3 A;  3T4A C;  4MFQ A;  2R93 G;  1TQO A;  3K0X A;  4KUB A;  2SOB A;  4RKL A;  4JD6 A;  3R93 A;  3EFA A;  4OO1 I;  1TWF H;  1WTR A;  1PDQ A;  5AG5 A;  5HH1 A;  1LT3 D;  1A15 A;  3DWP A;  4GKK L;  5C82 A;  4B10 A;  5C4H A;  3I3C A;  1DE4 C;  3RYO A;  1EWH A;  4DR4 Q;  1Y0R A;  2VY3 A;  4MFZ A;  1QIL A;  2F4I A;  4OC1 A;  2OOT A;  4EX5 A;  4QVT A;  4HKF A;  2A5H A;  2TMP A;  4BXX H;  4LMQ D;  4DU9 A;  5KNB A;  4NB3 A;  2PJ6 A;  2K6A A;  4LFB Q;  3H8E A;  3RZD B;  3IRB A;  3I91 A;  2ZXO A;  4P74 A;  4LFA L;  4L5Q A;  4YCV A;  3K6O A;  1VMP A;  3D31 A;  3F0A A;  2D9U A;  1JJC B;  1ICW A;  1UNS A;  2PVW A;  3OWE B;  4A3E G;  4UCN A;  5ELN A;  5K8N A;  3KDF B;  1X3G A;  3MAQ A;  3AMU A;  1JB7 A;  1RCV D;  4XQQ A;  2Q51 A;  1L2F A;  4MN3 A;  1PH2 A;  4QUS A;  2R92 H;  1A8V A;  1I6H B;  4DV1 Q;  2CH4 W;  1EY8 A;  4UCP A;  3AQQ A;  1MSG A;  1SEB D;  2B5G B;  4MCR A;  4RHS A;  5DWM A;  4OEM B;  4NCZ A;  1PTO H;  2RDG A;  3NXW A;  2EBJ A;  4FUU A;  4NGP A;  3S9W A;  1E1T A;  2DJF C;  4KOX A;  4XQJ A;  3M4O B;  4R87 A;  1EOT A;  4H7B A;  5C44 B;  4EME A;  3BZD B;  4X66 L;  4YY3 Q;  1EWI A;  3T53 B;  2IPK D;  3L7Z C;  3BZK A;  5BN3 A;  4LNQ A;  3UI2 A;  4A38 A;  2B2U A;  1ESR A;  1V1Q A;  1A2U A;  2L12 A;  1F9S A;  4NPS A;  5IGB A;  2PIZ A;  1FNV A;  4QBJ A;  2Z8L A;  1S3Z A;  3HOZ G;  2GFQ A;  1N9W A;  4ZQ3 A;  5G1Z A;  4F9V A;  3BVG A;  4DR2 L;  1KRS A;  3SVM A;  4OIW A;  2VNU D;  2BOS A;  1IW7 C;  3S1N H;  4OME A;  1TWG H;  2BCO A;  3PF5 A;  1IBK L;  1E2V A;  4JI7 Q;  2DPT A;  2R98 A;  4O23 A;  1SQH A;  4K14 A;  4W9Y A;  2GLJ A;  1M4G A;  3OMC A;  4KMU C;  2F4V L;  3P2H A;  2L0C A;  5H84 A;  3ULL A;  1PLF A;  1TR5 A;  2HHH L;  4NDX A;  1WK4 A;  4BIN A;  4IHM A;  4DAV A;  2FMM A;  1IW7 D;  4WJW A;  4V0B A;  5IGD A;  1YNX A;  1SMY D;  2PJC A;  1F2O A;  3T51 B;  2R93 B;  3B3S A;  5HMN A;  2V1C C;  2PYK A;  1VF5 C;  1U4L A;  3PO3 G;  3S9M A;  5KTC A;  2CQO A;  1VQP A;  2Q2U A;  2GRE A;  1KUY A;  1NSL A;  2FL4 A;  3S24 A;  2UU9 L;  1Q8I A;  2XIW A;  4NXN L;  1KDA A;  2NTT A;  3M7G A;  4YIJ A;  3K5M A;  5LL6 S;  4KSI A;  1U0L A;  4QUC A;  4UFX A;  3MXN A;  1Z8L A;  4HNX B;  4TWE A;  1LTG D;  3B8G A;  1FL0 A;  4P2C B;  4P73 A;  2G9D A;  5IT9 L;  3PBE A;  2V8V A;  4PK3 A;  2E2J H;  4ONU A;  1M4I A;  2BEI A;  1VQ9 A;  3M3Y B;  3T56 B;  4IOC A;  4NGR A;  2NB0 A;  2QW7 A;  1AFP A;  4ABN A;  3G48 A;  4HJ7 A;  1VQA A;  1T9H A;  4B3T Q;  2V8D A;  1MKH A;  3DEP A;  1XYI A;  4ONW A;  1ZYR D;  3H3V I;  1IB1 E;  2OU2 A;  3R9E A;  1GUN A;  2IY5 B;  4DR4 L;  1IYU A;  3FRM A;  1U9R A;  1Y14 B;  3R2T A;  1VCI A;  5IOC A;  4JI6 Q;  1YLO A;  4LX9 A;  4A3I G;  3QR8 A;  3N52 A;  2ZW5 A;  2FHT A;  1SRU A;  2VQE L;  3VR6 A;  2K32 A;  3RUZ A;  3NP8 A;  2A68 D;  4H0L C;  5LMN Q;  1GHE A;  4QF4 A;  2NN6 G;  4PMC A;  2DF5 A;  1D5Z C;  3BLN A;  4K2L A;  1FJG L;  2VUM G;  1B8A A;  3JVN A;  2IHF A;  1QUQ B;  1VMC A;  4JI4 L;  4HCS A;  1AP0 A;  1Y0Y A;  4JI0 Q;  1ILP A;  1CG2 A;  2VXW A;  2NYQ A;  5J1Q A;  1CUK A;  2PDO A;  2AQ3 B;  4AH6 A;  3DR6 A;  4BMH A;  2PR8 A;  4RG1 A;  2ZEG A;  5E3F A;  1PUA A;  2Z3P A;  3HOY B;  3O13 A;  4R3K A;  5CPA A;  1ROD A;  1TIQ A;  4KSF A;  1M44 A;  3S15 B;  2XWB B;  3GTL H;  1PFN A;  1I12 A;  2GE3 A;  2E74 C;  1YX0 A;  2JA6 H;  1ILQ A;  2F0K A;  3QJY A;  1TWG B;  2B39 A;  4BBS G;  1NSN S;  2PQA A;  1DOM A;  3IKJ A;  3ZJY C;  4QIW E;  1JMC A;  2UXD L;  1MJA A;  3CCQ A;  4C2X A;  1JJG A;  2F0O A;  3EVQ A;  4C1N K;  3A8J E;  1WTW A;  4RUH A;  2JEV A;  5M3F H;  3NPP A;  1KNE A;  4JI0 L;  1CM9 A;  1AMP A;  2PJ4 A;  2AFU A;  3OIQ A;  3G7L A;  3U9S A;  3VH9 A;  3NEL A;  1CPS A;  2I5H A;  4R3L A;  4ZBG A;  3MFY A;  4CDD C;  3W6X A;  3FIX A;  4E2A A;  5DLQ E;  1XIX A;  1S5C D;  3LNN A;  5AG6 A;  4H6U A;  2K5N A;  2NN6 I;  2G3A A;  4A3J G;  3H5Z A;  3DDD A;  2K5H A;  1DZ1 A;  3DWA A;  3HOY H;  4EVO A;  4OC5 A;  3MWY W;  1QWY A;  1Y8O B;  3C1F A;  3J81 j;  1C4Q A;  4JI3 L;  1N71 A;  3EXN A;  5IE8 A;  3NSW A;  1TVX A;  5IV0 A;  1DON A;  4I7A A;  2YV5 A;  4R4C A;  4DV3 Q;  3TO6 A;  4R8I A;  1AYE A;  3VYT A;  4IFD I;  1M8A A;  1P0H A;  1B4O A;  1B6B A;  2CNS A;  4YGO A;  4JC0 A;  3GD7 A;  4AG9 A;  4B11 A;  3D8G A;  4ULL A;  1H9R A;  4R76 A;  4YU9 A;  2LY7 A;  2UUC L;  2YTX A;  3DEO A;  4A76 A;  1I21 A;  4Q5V A;  2KEE A;  1B2T A;  1XMT A;  2EWB A;  3OHX C;  3SI1 A;  4MHP A;  1IIC A;  3CP0 A;  5M5X B;  4X65 Q;  1LV9 A;  3WC6 A;  5C88 A;  2JP1 A;  1OXU A;  4RMF A;  3E0J A;  1D1I A;  2F52 A;  2B4D A;  2LFN A;  4OO1 H;  4POG A;  3SEB A;  4WRD A;  1TXR A;  3NE8 A;  5AG7 A;  4XPK A;  3AU7 A;  3KQZ A;  4JI8 Q;  5LL6 X;  4GLX A;  2VUM B;  5EJW A;  1EEF D;  1RJT A;  1NMT A;  1VHS A;  1DGS A;  3EN2 A;  3K2K A;  3SHL A;  3P75 A;  1Z2L A;  1NR2 A;  3PRT A;  4RWS C;  5CV6 A;  2HUG A;  2MJ8 A;  4MJ8 A;  1IZ6 A;  2E8G A;  1N36 Q;  5LYI A;  4HJ5 A;  4DJL A;  4BBS B;  1OZP A;  1X65 A;  3BJ8 A;  3TX8 A;  1XMQ Q;  2UU9 Q;  2K14 A;  1VQN A;  2EDG A;  2R61 A;  4MCP A;  4ZY0 A;  2QKI C;  4IK2 A;  2O5J C;  2QDB A;  4DAY B;  1BPN A;  4DXG A;  4PXC A;  2Z3N A;  3C3L A;  5DEH A;  4ZY1 A;  4JYW A;  1S5B D;  1M90 C;  3R3O A;  1QSM A;  4CYO A;  4PV1 C;  5CV7 A;  3CCV A;  4NJQ A;  4QQB X;  3A56 A;  2VZZ A;  4NEX A;  5LHY 1;  2PJ3 A;  3WT4 A;  1SYB A;  1UUP A;  2YNE A;  5LYF A;  1ZEQ X;  4Q7A A;  1GD7 A;  4DNT B;  3JAM L;  4YHH L;  2EVN A;  3L3O C;  5IYD G;  1GUO A;  2ZEL A;  5FLM G;  2CW0 C;  4MZ9 A;  1YI2 A;  3GTO H;  4GLA C;  2Y0S B;  1UFH A;  5AG4 A;  3OW2 A;  3SI2 A;  2ZEE A;  4P4F A;  2AE6 A;  1W2B A;  1CKM A;  2PJA A;  3S2H H;  1C7Y A;  1O7L A;  1VQG A;  2QA4 A;  1AEX A;  4K8J A;  3KLS A;  3GTM B;  3KHX A;  2BDO A;  4A3I H;  1LM0 A;  5LMN W;  3JRU A;  3GKR A;  4LQG A;  3DHQ A;  1YR0 A;  3PB9 X;  5ELE A;  3SGI A;  4BBR G;  1D6E C;  4OGQ C;  1I4P A;  4JVZ A;  1KWM A;  4M3S A;  2AUJ D;  4GXH A;  4WJ4 A;  2C1C A;  2K5V A;  3ERO A;  1JB3 A;  2V77 A;  3LWE A;  1S5F D;  4FO2 A;  3KFU A;  1LOK A;  2B4B A;  3CHB D;  2EY6 A;  5ELF A;  2VB3 X;  4QC6 A;  2ID0 A;  3I4N H;  4IUS A;  4MMO A;  2CWA A;  1IOI A;  3S17 H;  1I5F A;  2JE6 I;  3ER0 A;  3UDF A;  1CP7 A;  1QST A;  3U9O A;  4MFP A;  1IXR A;  4FF1 A;  5IX3 A;  1QJO A;  1PH8 A;  4OX9 L;  4P4B A;  3MFG A;  5AGE A;  1P8L A;  3PUX A;  3NA6 A;  2MQH A;  3KZW A;  2PNR C;  4A3F H;  1BCP B;  4FP5 D;  1K9M C;  2Z3O A;  5DM6 3;  2F0V A;  2JA6 B;  2RQX A;  1PFM A;  4XPD C;  1CSQ A;  1TT2 A;  4DN4 M;  2F7V A;  4MNO A;  4A2Z A;  2RSN A;  1HPC A;  5EGT A;  1UEB A;  2ENB A;  1PXU A;  3MEF A;  2PZU A;  5E1F A;  1CX8 A;  4WJB A;  2KED A;  4LFA Q;  4CBV A;  1FR3 A;  3PUY A;  1XPR A;  3GTM H;  1EIF A;  3A8I E;  3PIP A;  3G8W A;  5E7N A;  2XNA C;  3S16 H;  4M6H A;  4IJL A;  4AYB E;  1HDQ A;  5I9O A;  1FYC A;  3M85 A;  5F48 A;  4QJF A;  2MUY A;  2OXP A;  3ITP A;  4KJN A;  2K5W A;  2FIW A;  4DR3 Q;  1SMX A;  1L0X B;  3B6Y A;  3I70 A;  1WTV A;  4LF6 L;  1DJR D;  5IB9 A;  2JA7 G;  2VL1 A;  3TFY A;  3J81 E;  4AYB G;  3RMH A;  3HKS A;  5I2Y A;  1B9M A;  3WOF A;  2BH2 A;  4FBE A;  3H91 A;  3Q8D A;  1Z5R A;  1NMF A;  3JAM c;  2MGS A;  2DGY A;  3GY9 A;  3D7F A;  4LF4 Q;  3CCS A;  1E2W A;  5LYD A;  3ZYY X;  2A19 A;  2E5L L;  4L5R C;  1ZG8 A;  2B2Y C;  5CC4 A;  5T1I A;  4X62 L;  2KCW A;  1SNO A;  1VHE A;  4MHN A;  2B2V A;  2IL4 A;  3HUV A;  4B3S L;  2Y0S G;  1MJB A;  2JDC A;  2Q44 A;  5L37 A;  3IWG A;  2L5T A;  2Z6K A;  1Y1W H;  1HJP A;  3VYU A;  1TY0 A;  1BO4 A;  5HY6 A;  2RHS B;  5FO8 B;  5KGU A;  2ZEP A;  2ZXV A;  1X10 A;  3EO4 A;  4AB7 A;  1YNN D;  4BA2 I;  5JPN C;  2MNA A;  4DNC A;  1AN8 A;  1O7I A;  1STY A;  2JA8 H;  1Q81 C;  1STB A;  1UE6 A;  1A63 A;  2CTC A;  2VZY A;  4P4D A;  1XEB A;  3BYT B;  3H09 A;  4YWK A;  2UUA L;  2E2J B;  2I79 A;  5C3E G;  2PO4 A;  1CM0 A;  4R4O A;  4DR5 Q;  5C4X H;  4MFL A;  1HZC A;  2F0M A;  4K2K A;  5ISV A;  1BVS A;  4XIG S;  4R6T A;  4IFD G;  4AIM A;  4QUF A;  3EC4 A;  3ND8 A;  1TS3 A;  1GOZ A;  4GN4 B;  2TSS A;  3A9L A;  4B3M L;  2V8H A;  1S7N A;  1Z8X A;  4ZGY B;  2UXB Q;  1F9P A;  3CAM A;  2GLF A;  2G9H D;  3MA2 B;  4Y7N B;  4KVX A;  1B3A A;  3GTJ B;  5K36 H;  3N5F A;  1S7L A;  4LFB L;  4A3F B;  1KUX A;  2XEF A;  4YRH A;  5M3F B;  2Q4Z A;  1MI2 A;  2H4O A;  3OW7 A;  4X62 Q;  2QGQ A;  1QNU A;  3HEJ A;  4NMZ A;  4KD3 A;  4WJ3 M;  1ASY A;  4ZAI A;  1F57 A;  3KQX A;  3T90 A;  3SK6 A;  5GRO A;  5DWN A;  1S3O A;  1IBL L;  5ELY A;  2IW3 A;  2JA9 A;  3S1M B;  3HOV G;  1XPO A;  3SXH A;  1EIH A;  2VB2 X;  4FWU A;  4NGN A;  1HXY D;  2LS0 1;  2PI2 A;  2JA6 G;  1KTK A;  3GV6 A;  4Y7N H;  2B63 B;  1LAM A;  1ET6 A;  1LTL A;  3K5L A;  5I4D A;  3BXM A;  4X8I A;  2NVX H;  1Y1W G;  1J5E Q;  5C6A A;  2Q2H A;  1U6M A;  1EQV A;  4H6Z A;  5D29 A;  3BDC A;  1CHQ D;  5CBM A;  2FSR A;  1EYA A;  1ELL P;  1KRT A;  1CA6 A;  5FOB B;  3BDO A;  3AEV A;  1K8G A;  2AFM A;  1BBW A;  4QL5 A;  1LCP A;  1WJJ A;  3BJ7 A;  4HSV A;  2F0I A;  2F0U A;  3QOJ A;  1LT6 D;  4B12 A;  4JI5 Q;  2DEA A;  2R92 B;  1ONL A;  3HOX G;  1B50 A;  4OC4 A;  4ORF A;  5F49 A;  3P20 A;  5D3I B;  1B53 A;  1Q2Y A;  2EZV A;  3LOD A;  3KLW A;  1XTD A;  4X64 Q;  3D67 A;  3FED A;  4KOU A;  1Y1V H;  4KZT A;  3B2Y A;  1IYK A;  3HOW H;  3CPW A;  4IQZ A;  3RLF A;  3T8W A;  3M4Q A;  3ULP A;  1Z8W A;  3BU2 A;  1V0C A;  1Y9K A;  2F5I A;  3D8P A;  2DJG C;  2B63 H;  1SNM A;  2QEX A;  4JI7 L;  1ENA A;  1JIC A;  4A31 A;  1U5K A;  4GKJ Q;  4F0Y A;  2Q04 A;  3RAM A;  4N8F A;  3KR4 A;  1STG A;  3M4Y A;  5HGQ A;  3J80 E;  5C4X G;  3I9S A;  1ZO0 A;  3KR5 A;  4CGM A;  4OEL B;  4CRY B;  4A3C G;  1YNN C;  1WD0 A;  1GUW A;  2N8N A;  2XSC A;  2FIA A;  4A3L H;  1K8M A;  1STN A;  2Y0S E;  3JAM i;  4IUP A;  3D2P A;  1PZK D;  1Z9U A;  1Y8N B;  2IL8 A;  1NE3 A;  2E5L Q;  1N32 Q;  5FVJ A;  4CAV A;  5IY0 A;  4AVA A;  1W3S A;  2OCE A;  4OWT B;  5CBA E;  3CXQ A;  1TS5 A;  1CSP A;  1Y7E A;  2R8V A;  3CCL A;  1KAA A;  1X55 A;  4N8X 1;  8CPA A;  3DMU A;  3OTO Q;  3IIB A;  3D4W A;  1G51 A;  2ZED A;  4CAX A;  1YHA A;  4X64 L;  5CBE E;  1JT8 A;  5C3W A;  3F2B A;  2A69 C;  2ZEF A;  1FNU A;  5A2Q L;  4A3M H;  1T5E A;  2HUZ A;  3Q6S A;  3G6E A;  4C3H B;  2FT0 A;  4A37 A;  6CPA A;  5F2D A;  1PTO D;  2OTJ A;  1V1O A;  3PB7 X;  2KHJ A;  4CDF C;  1EU4 A;  4HAE A;  2HQY A;  1DOK A;  3HOW G;  3FF3 A;  1VS0 A;  4DR6 Q;  4H89 A;  4UEZ A;  3HRZ C;  4II9 A;  5GQO A;  1Q86 C;  3D3S A;  4YHH Q;  2PRB A;  1QMU A;  4LF8 L;  5LRK A;  4AQY Q;  2OWO A;  1TY2 A;  3W1G A;  4R8N A;  4UEE A;  1SDF A;  4KS9 A;  2PIY A;  2RKS A;  1SBB B;  1Y1W B;  3PFE A;  1ZLI A;  5G20 A;  4A3J H;  1SE4 A;  5M9O A;  1J4J A;  2ZEN A;  4EWT A;  2QDL A;  4CGY B;  1HH2 P;  1ASZ A;  4MIU A;  3W1B A;  1YNJ D;  2WB1 E;  1CKO A;  3RZO B;  1PMR A;  4KKS A;  1VQ4 A;  4HED A;  3S14 B;  1PTO B;  1SSO A;  1BLL E;  2R92 G;  1BCP C;  4HJA A;  1A2Z A;  3EFX D;  4FXG C;  5IP7 G;  5EBD A;  4IO9 A;  1EEI D;  3T9Y A;  1LTI D;  5JOB A;  2ZW7 A;  2WB1 G;  3M9B A;  3F2D A;  2KHI A;  3CCJ A;  3W6S A;  4FD6 A;  3K57 A;  2A74 C;  2DNC A;  4PZ8 A;  5E96 A;  2WZN A;  1QNK A;  2B3V A;  4RH6 A;  3I55 A;  1YEZ A;  2NVY B;  2XTI A;  2MFI A;  1YJ9 A;  1PYS B;  2KHS A;  2A4N A;  2PJ5 A;  4UP9 A;  2RHQ B;  2K28 A;  1SNC A;  4PSX A;  1ML0 D;  3PSI A;  4HIK A;  3K7U C;  1LO5 D;  1I4R A;  4A3K G;  2P6G A;  2Z6K C;  1SJE D;  4B5O A;  3F5B A;  3CRL C;  4PK2 A;  1V1P A;  1Q90 A;  3DNS A;  1G2T A;  5E4W C;  4UA3 A;  1N34 L;  5KNC A;  2OH1 A;  2EY1 A;  3ISZ A;  5D3D A;  5EC4 A;  4BY7 H;  4P72 A;  5JJI A;  3RLO A;  4B6Z A;  3PO2 B;  5K5P A;  4KLV A;  3KK7 A;  1Q1B A;  2FXQ A;  1TU2 B;  1ZXT A;  4C2Z A;  1BCP F;  1JC7 A;  1RXT A;  3DLL A;  2F8H A;  2VQF Q;  4MBU A;  3S2D B;  2HIX A;  5C4Z A;  3PO3 H;  1A6X A;  4ILW A;  1QSO A;  4RS2 A;  1PFS A;  3GTL B;  1IYL A;  2YND A;  5HVF A;  2PW5 A;  3SJX A;  5D8N A;  5EKK A;  4C3H G;  4A75 A;  1I4Q A;  4EQN A;  4A3G H;  2UXB L;  4S3S A;  1Q7L A;  5AJ3 Q;  2CCZ A;  2KA7 A;  1X3E A;  1HFN A;  2R7H A;  2K7V A;  3HOW B;  3DUZ A;  3PGP A;  3GTK B;  3RNZ A;  3SXO A;  3TTH A;  3GTG B;  2A6E C;  1MJC A;  1EWC A;  2BDN A;  2V4D A;  3PV0 A;  1IID A;  3B3T A;  2GVA A;  3W2D A;  1I6H H;  3CD6 A;  1LTR D;  4H02 A;  2UUB Q;  2EUI A;  4PXB A;  1VDZ A;  1PRT C;  2C35 B;  2X6L A;  3BDL A;  2E2H H;  2E2I B;  1I4G A;  3C26 A;  1GUG A;  1VQK A;  3J81 i;  2B2W C;  5JPH A;  3R9G A;  1X32 A;  3NWT A;  3UDG A;  4FAI A;  2HDL A;  1N34 Q;  5EAY A;  2A6H D;  1Q82 C;  4IPH A;  4GOP C;  1C9O A;  3EJI A;  5ELC A;  3QG1 A;  4X2T A;  3D7H A;  1MJE A;  1SNP A;  2VI7 A;  2OZH A;  5CNP A;  3TP6 A;  4KI0 A;  3CMA A;  2DPS A;  4JI5 L;  4DAY A;  2E2I H;  2IMO A;  1L1O B;  2ZTD A;  2VXK A;  3KBX A;  2F0L A;  1YVC A;  2GN5 A;  2GAN A;  4K3N A;  3WC7 A;  2B2Y A;  1XNR Q;  3CC4 A;  3NH5 A;  4AVC A;  4CGO A;  2WSA A;  2PQ8 A;  2UUB L;  3SK8 A;  4C3H H;  2OB0 A;  2M2L A;  1K73 C;  3VAR A;  2PZW A;  3CC7 A;  1IL2 A;  1BAV A;  4UY8 C;  1K4J A;  2KOL A;  4BBR H;  1XNQ Q;  1I4X A;  2WAQ G;  3T1H Q;  5LRG A;  3FMC A;  4LW1 A;  4C3I B;  5FJ8 G;  4POF A;  4A3K B;  4CDE C;  1E2Z A;  2B8G A;  4O2D A;  4MRI A;  5LRJ A;  2D0O A;  2HQL A;  3VDY A;  4OP4 A;  4U9Z A;  2UXD Q;  2AMC B;  2Q8I B;  3HOZ H;  2Q0Y A;  2VL6 A;  3AB9 A;  4TVA B;  4LUZ A;  2CF4 A;  1JQG A;  4C68 A;  5D65 A;  1SR3 A;  4DV2 Q;  5CV9 A;  4IPG A;  3K5N A;  4DV4 L;  1KIX A;  3S1N B;  1GO3 E;  2F0G A;  4DV0 Q;  2ZPA A;  4P4J A;  2N55 A;  5F47 A;  3TT2 A;  3SJG A;  4GNX A;  2BA1 A;  4C2M H;  4BWG B;  2AWO A;  2F3W A;  4A33 A;  1I6V C;  3DM3 A;  5FLM H;  3NBH B;  5H1S E;  2JJQ A;  5C0X J;  3I4O A;  1QE6 A;  3LWU A;  1YJN A;  3EBE A;  5T1G A;  2PJ9 A;  2ZEM A;  1PZJ D;  5EPJ A;  4DFA A;  1B1Z A;  3KUP A;  4AG7 A;  4BXX G;  3E9H A;  4P75 A;  1QZH A;  2H5M A;  4C2M B;  3J80 c;  2VS1 A;  1S7K A;  3SK4 A;  1ZLH A;  3RZA A;  4RFB A;  1I4H A;  2JK8 A;  2PJ2 A;  4KD4 A;  2D0P A;  4ZUI A;  2E2H B;  2Z0Z A;  2AFX A;  2AFS A;  4KOS A;  4F8Z A;  1QSR A;  2PCF B;  4NP5 A;  1I3Q B;  2JA7 H;  1NE9 A;  4A30 A;  4MXU A;  1QVF A;  1TWA B;  3F8T A;  3NE7 A;  2A68 C;  4DR5 L;  5FJ8 H;  4GN3 B;  1YIJ A;  2PQA B;  4KLK A;  2EJG C;  5FO7 B;  3D4U A;  5M3M G;  3OWF A;  2JBJ A;  5M5Y H;  2EYL A;  3S2D H;  1HUM A;  5KYI A;  1CBX A;  3I4L A;  2WP8 J;  3ERQ A;  3RBU A;  2ZW6 A;  4HMI A;  4XNH C;  2JEB I;  3I56 A;  1WWZ A;  2AFZ A;  3L9A X;  4A3G B;  2PMZ E;  2PMZ B;  4DK0 A;  1HNX L;  3B35 A;  1HNW L;  1F77 A;  1ELM P;  1F9R A;  3PO2 H;  4JV5 L;  4JXR A;  1I1D A;  3H3V C;  5F09 A;  3MXN B;  1CQV A;  1KXL A;  1F2M A;  2JA8 G;  5HVH A;  2CNM A;  3IGR A;  2Q7B A;  2M00 A;  4BY7 G;  3GQB A;  4ZKB B;  1EQQ A;  2PNH A;  3K80 C;  3VYS A;  5KEE A;  4F87 A;  2NVQ B;  1PH1 A;  1UWY A;  3NK9 A;  2Z10 A;  3G4S A;  1EL0 A;  2PQE A;  3FEW X;  1H9K A;  4F9U A;  1ET9 A;  1SLJ A;  1XOV A;  2A69 D;  3HGB A;  2B2W A;  3VA7 A;  2K1B A;  3T1Y L;  4A3K H;  5K8O A;  3PQI A;  1MSH A;  5G3L F;  4KHV A;  2E75 C;  4FF2 A;  1PTO C;  2DY8 A;  1FT7 A;  2B4D B;  4QMG A;  3D2M A;  3HS0 C;  3H94 A;  3SXN A;  4AVB A;  1H9S B;  4LUO A;  4C7I A;  3W3A A;  1N36 L;  1B3Q A;  3QIA A;  2B58 A;  3B3W A;  2CH4 A;  1M1D A;  3EIV A;  3KLS X;  3KF6 A;  1C48 A;  1M4D A;  4KJO A;  1VIX A;  4GS4 A;  1VQH A;  4FNF A;  3P1H A;  4U68 A;  4BY1 G;  1TWC B;  2FFK B;  4GNX B;  1VQ7 A;  1QVC A;  1VQE A;  3R9F A;  4F8M A;  1AE3 A;  2Q8T A;  3NUC A;  2HDM A;  2P6E A;  1O7Y A;  3TN2 A;  4UFW A;  2JEA I;  5KND A;  3J7A 5;  3ISX A;  4JI4 Q;  2H1E A;  4C2Y A;  3D6W A;  1VQD A;  2KVM A;  5KRU A;  3RN2 A;  1K8A C;  1HZA A;  1H95 A;  3CCR A;  1D5M C;  2C6C A;  5G22 A;  1GHJ A;  1S4Z A;  4L89 A;  3J81 c;  5EMI A;  1PH7 A;  2PW7 A;  5BN4 A;  5BWA B;  3VR2 A;  4PPZ A;  5IYD H;  2HCI A;  4QB4 A;  1YW6 A;  3ZZI A;  2YU9 B;  2EIF A;  3M3Y H;  2F0S A;  1NJI C;  1J8I A;  3A54 A;  1YME A;  3FKI B;  4CYN A;  3LAC A;  1HQM C;  2KCT A;  1ENC A;  1MBY A;  1Z4E A;  1LTT D;  3K7A H;  2RB7 A;  4DK3 C;  4U5Y A;  4QCL A;  1EY9 A;  3H15 A;  3FEC A;  1PV4 A;  4R4I A;  5FLX c;  3HOZ B;  1D2B A;  1PTO F;  4CHT B;  2JEW A;  1TKH A;  1RHP A;  5IGE A;  1Y7R A;  1TWC H;  1KAW A;  4O0A A;  4X3S A;  4A3E H;  1SFO B;  2JA5 B;  1A2T A;  1R43 A;  3R2I A;  3PFO A;  2KUM A;  1XWE A;  1OXV A;  1JE4 A;  1VKC A;  2KBN A;  2HD3 A;  1AE2 A;  3BI1 A;  3MGD A;  2LXJ A;  3J7A V;  1VQ8 A;  3C1E A;  5IGF A;  4KHP L;  1DCZ A;  2O28 A;  2B3G A;  2ICI A;  3FPP A;  4BBH A;  1WTO A;  3OIP A;  1WI5 A;  3CME A;  2YTV A;  4KN7 C;  4CS0 B;  4A3G G;  1IBL Q;  1B70 B;  1IYV A;  1Z7T A;  3KDF A;  3PO3 B;  3G3S A;  2NVX B;  4NJR A;  2RBM A;  2CVR A;  3I4M H;  4JXQ A;  4KTA A;  1PFB A;  3GV3 A;  3S1Q B;  1CK1 A;  1II3 A;  2EXD A;  2JA8 B;  4ZKC B;  4CJ2 C;  2JYO A;  1LLR D;  3K0Y A;  3M7N A;  4BY7 B;  4JLY A;  1HDU A;  2PJB A;  3IAY A;  3H8F A;  1M4V A;  3HOU B;  3I4N B;  3S6K A;  2Z3K A;  3JUW A;  3ULJ A;  1VQ5 A;  4HTH A;  1XFO A;  5HXD A;  3H0G G;  3IFT A;  4AQY L;  1IHZ A;  4OIK A;  4HID A;  2IT1 A;  1K28 A;  4DUY Q;  1PZI D;  2BUE A;  4F7X A;  3VYR A;  4CKC A;  4CKB A;  4DR7 L;  4FD7 A;  4H2K A;  4RGN A;  3RO0 A;  4J15 A;  1BOB A;  4OKO A;  1OBR A;  2SNS A;  4OWW B;  3V2T A;  2CKZ B;  1CKN B;  5ELO A;  4K30 A;  1WCM G;  1VQM A;  3KF6 B;  1T5X D;  4DF7 A;  2AFW A;  4L6T B;  2PJ7 A;  1MGS A;  2DUD A;  3HOV H;  2B29 A;  2GA4 B;  2PJ1 A;  4PQA A;  3J80 i;  1A0I A;  2F0T A;  3D4D A;  4A3I B;  2ZM6 L;  2PJ8 A;  3V8I A;  1Q12 A;  4FYD A;  3N6R A;  4BY1 B;  4JI2 L;  2EE1 A;  3CXC A;  2OR4 A;  1PRT D;  5JJK A;  1TF9 A;  4GKJ L;  5J1Z A;  2K5T A;  4DAP A;  2QJ8 A;  2R7Z H;  4GM5 A;  1V9P A;  2J8M A;  3S2H B;  3RLN A;  4JI1 L;  1IL8 A;  3V38 A;  3NEM A;  2JSO A;  3OMG A;  2DY7 A;  4TRD A;  4LF9 Q;  3MXP A;  4PXE A;  2K50 A;  1XF8 A;  1W6J A;  4JK1 C;  3EY5 A;  4XPD B;  3QO2 A;  1MHW C;  1LTA D;  1A62 A;  3CDX A;  1HTP A;  4MCQ A;  5C5L A;  4L8A A;  3HOY G;  4PMB A;  1H9J A;  1L0W A;  1IKM A;  2WKD A;  3PB8 X;  2EJM A;  4Y52 H;  5DM7 3;  1HNX Q;  2XRS D;  2ZM6 Q;  1YHB A;  3I90 A;  1F2Z A;  2NMT A;  5M5W B;  4L5T A;  2V8G A;  3W5O A;  1YSJ A;  2J9A A;  2L55 A;  2ZTC A;  1EU3 A;  5LYL A;  3HOU H;  1O78 A;  1BUV T;  1KZF A;  4KHZ A;  5CR3 A;  4P45 A;  4JI6 L;  4K6D A;  7CPA A;  1DM0 B;  5I6W A;  2R1I A;  1DD2 A;  3CCM A;  1PYW D;  5JH9 A;  4FF3 A;  5LMU Q;  1YJW A;  4BBS H;  5EPL A;  2FS5 A;  4WWV A;  3NHH A;  4C3I H;  3I4M B;  1XX8 A;  4A39 A;  3PUZ A;  1EZ8 A;  4DV2 L;  3GYA A;  1D5X C;  4DV0 L;  4LUA A;  4H13 C;  4JV5 Q;  4A3B H;  4NGT A;  2AJ6 A;  2Z6B A;  3TSS A;  2F3I A;  4ZX9 A;  4UBR A;  2RSO A;  4IF5 A;  4FF4 A;  2EYF A;  5E4X A;  2IHE A;  2K4K A;  4KY6 A;  3HOU G;  2C5C A;  3I4N G;  3TP7 A;  1WTX A;  2I3C A;  1G6Z A;  3I3G A;  2JXM B;  5COY A;  2IWH A;  2F0W A;  3K9T A;  4RI1 A;  4Q38 A;  2CFM A;  3K9U A;  1SFO H;  3AFP A;  3X3M A;  2BH8 A;  3S14 H;  3W91 A;  4WOR A;  4IUT A;  1G29 1;  2ATW A;  2H5X A;  2JLM A;  4ZYQ A;  4A93 G;  2N88 A;  1Q3L A;  4RN7 A;  2AFO A;  3KLR A;  1SYG A;  4DK6 C;  1QCB D;  2PVV A;  1WCM B;  1CP6 A;  1EFI D;  1EE3 P;  1LAP A;  1HZ9 A;  1N33 Q;  5JJZ A;  1F2P A;  3TP5 A;  3J81 L;  4CAE A;  4JBJ A;  3J7Z C;  2B8F A;  4NXN Q;  3HOX H;  2AQ1 B;  2Q43 A;  1RTN A;  2OT2 A;  2ZJQ A;  2NVT B;  4TKO B;  3IO1 A;  4UWI A;  3TP8 A;  1I94 Q;  1LAN A;  4DK1 A;  2WV6 D;  5I2X A;  3UY5 A;  2ZOG A;  3KF8 B;  2XVS A;  4B13 A;  2I5L X;  1MIU A;  1U4P A;  1CZW A;  1R9T B;  3E0K A;  1YZ6 A;  3BYY B;  3B3V A;  3PCO B;  2BE5 D;  5IT9 c;  4L63 B;  2ES2 A;  1RL2 A;  3G71 A;  3I2Z A;  2XEJ A;  1Q7Y C;  1BCP D;  3ZJ0 A;  3FH4 A;  3S16 B;  4G4K A;  3U58 A;  1Z8T A;  5C4J H;  2R93 H;  5HUR A;  3NQI A;  5C44 G;  2XWJ B;  3DGV A;  2I5M X;  4Z9C B;  1BR9 A;  3UE1 A;  4I65 A;  1K0R A;  2Q4V A;  1WVL A;  1EYG A;  4Y49 B;  1FGB D;  1TXY A;  5JEA J;  3RN5 A;  2SEB D;  1K0S A;  2IX1 A;  2JA5 H;  2EVB A;  3A7L A;  3H6M A;  1VQC A;  2VQF L;  1TWH B;  3V96 A;  2J4X A;  2N49 A;  1DYQ A;  4KOT A;  4IUR A;  1SE2 A;  4NGM A;  2PZT A;  5D14 A;  3A5Z B;  2POK A;  2NN6 H;  3A0J A;  3CQZ B;  5BN5 A;  5KYL A;  1SJH D;  1XJO A;  4R9M A;  3K8A A;  4YY3 L;  5GAH C;  2I46 A;  1HA5 A;  5ELD A;  1E3P A;  3F8K A;  5JM6 A;  5C0X G;  2XEG A;  4DR1 Q;  4XXE A;  1BPM A;  3UDI A;  4I49 A;  3I73 A;  5JAV A;  4OO1 G;  3IFE A;  2CTB A;  2Z3L A;  4KY5 A;  3UDX A;  3TOB A;  5CMD A;  3TRZ A;  4ME3 A;  1DTD A;  2CQA A;  3E5S A;  1SYE A;  1B44 D;  1I94 L;  1RTO A;  2CHB D;  3I4M G;  2XN9 C;  5IT9 E;  4YCW A;  1V43 A;  3QNV A;  1MK4 A;  2SDF A;  3IU1 A;  2RA4 A;  3MXU A;  3E9I A;  1FNO A;  4X65 L;  3CC2 A;  5FK9 C;  1GUS A;  5EKL A;  3KJO A;  1M4L A;  5FO9 B;  1KUV A;  3NH4 A;  1B7Y B;  2YNC A;  4LF5 Q;  2D2C C;  3MVV A;  4OXP A;  1VGY A;  2L11 A;  1YGH A;  5GAD C;  1AZP A;  1PH5 A;  3FP9 A;  2M9V A;  2OTL A;  2R7Z G;  3MTS A;  4DV5 L;  1EUJ A;  5G21 A;  3VAT A;  3TS0 A;  1JE5 A;  4P6Y A;  3DSB A;  4LF7 Q;  4P10 A;  5HVG A;  2A8V A;  2RCN A;  5IP7 H;  5ELB A;  1OO9 B;  4NFR A;  2A73 B;  1R9T H;  2Z4H A;  2RVL A;  1KDB A;  1CJW A;  1YLE A;  3E6Z X;  3KAS A;  4DUY L;  3PF4 A;  4LK1 C;  3VWD A;  1KAB A;  4JI1 Q;  3E0E A;  4A93 B;  4HSP A;  4PNY A;  4XT1 B;  1L0C A;  3JC6 6;  4ALP A;  3PUW A;  2YU9 H;  1ZKO A;  5C5M A;  3FPU B;  3SJE A;  5CV8 A;  2NZ1 D;  3KI9 A;  4O42 A;  4GS3 A;  2CXA A;  4DV7 Q;  5JPM C;  2MPM A;  3KOJ A;  2CW0 D;  1HZB A;  4CKE A;  1BF4 A;  2EO8 A;  3QAH A;  3F2C A;  4G7Z C;  1XBU A;  4MHY A;  4LWC A;  4XQN A;  2BE5 C;  1HR0 W;  1CQF A;  1VQF A;  3MXG A;  2OQ0 A;  1CT1 D;  3S9N A;  2D62 A;  2E2D C;  5K36 G;  4B08 A;  4N9T A;  1SYC A;  1X54 A;  3PMF A;  4DNR B;  1J9O A;  4DV3 L;  1L1O C;  1HNZ Q;  4OAE A;  3CPF A;  5LMU L;  2EYP A;  1E24 A;  1C0A A;  3KGQ A;  1A3T A;  4IUQ A;  2G3T A;  1YIT A;  2R7D A;  2NZH A;  2NVY H;  1Q2C A;  4DAM A;  2PR1 A;  4CAF A;  4OC0 A;  2HIV A;  3EQL C;  4KOR A;  4HIM A;  5KIX A;  5IYC H;  2JBK A;  1QOH A;  4OON A;  1FY7 A;  1IKL A;  1YBY A;  3FX6 A;  4DUK A;  4KY7 A;  1G2S A;  1LTB D;  1ICF B;  3HG9 A;  1WTP A;  5JVG 3;  3KL9 A;  2J7Z A;  1BOS A;  3ND9 A;  4XTC S;  2F4V Q;  1VHO A;  1VQI A;  5EBV A;  2X6G A;  1OXS C;  5EPK A;  4P44 A;  1E7Z A;  2K5Q A;  4TQU S;  2OF1 A;  1WYD A;  2NYZ D;  1IOF A;  3PIO 3;  1G8Z D;  3FKI H;  4K5V A;  3AFQ A;  4JI2 Q;  1QZG A;  1S5K A;  4X3R A;  1JWM D;  4C1N I;  4IUU A;  5H86 A;  3GTP B;  1PHJ A;  2FXF A;  4A3J B;  1Z47 A;  1QUQ A;  5C44 H;  4FXD A;  2AWN A;  1JOK A;  4XDX A;  4DV4 Q;  1LTS D;  4IPD A;  1XJV A;  2PSW A;  2I00 A;  3L2N A;  3CCU A;  3WWV A;  4RGM A;  5M5Y B;  3TC8 A;  2IX0 A;  4DUZ L;  3PIO A;  2BL1 A;  3S1R H;  4UDU C;  1HNZ L;  2OZG A;  5NUC A;  2R7Z B;  4TSS A;  3PUV A;  1IBM Q;  4A93 H;  1H8L A;  3IU2 A;  2KEC A;  4RCN A;  3KBG A;  5CV4 A;  3MZ5 A;  5JEA H;  3R96 A;  2Z0S A;  1EQR A;  4RA8 A;  2EYM A;  4NXM L;  2MO0 A;  1XTC D;  5J3B A;  5KTD A;  1HFG A;  2KCN A;  3BVZ A;  3SE0 A;  4LQ6 A;  5A35 A;  2YTY A;  3Q0A A;  1G91 A;  2WAC A;  2ZJP A;  1WOC A;  2YYZ A;  4LF7 L;  4HR7 B;  4RKB A;  4MTK A;  2FE7 A;  2REF A;  4PMW A;  1GJX A;  4AXV A;  4EFD A;  1TKF A;  4MY0 A;  5I9P A;  3F2U A;  4E6I A;  3IC1 A;  4K5W A;  1STE A;  2VQE Q;  2DXQ A;  1P16 A;  2B5G A;  4DYO A;  3NE5 B;  2F0F A;  4IZ8 A;  1Y9W A;  3ICE A;  4GN5 A;  2IJ0 A;  4HMJ A;  4KV6 A;  1JOQ A;  2EK9 A;  4DNI A;  4MY3 A;  1UAP A;  2EPB A;  2KQ3 A;  3MC0 B;  5M3F G;  4Q36 A;  2PPB C;  1ON0 A;  4F0X A;  1N8R C;  1XE4 A;  3D6C A;  3K58 A;  3FB3 A;  5IYC G;  3S1Q H;  3D0F A;  3PBB A;  3C46 A;  3I72 A;  1BO0 A;  4KSA A;  2QEC A;  2B63 G;  4MTN A;  2K03 A;  2O4H A;  2KCM A;  1BBX C;  3VR5 A;  1TWH H;  2DN8 A;  1PH3 A;  3J7A F;  2ANP A;  2ODF A;  1PVO A;  2AUK A;  5EKI A;  4ODG A;  3PEI A;  1OXX K;  2HCC A;  1SN8 A;  3OPO A;  1CZG A;  3TME A;  4R57 A;  3M4P A;  3L0O A;  5FLX E;  1YVO A;  5A27 A;  5JEA G;  4B3S Q;  3H4Q A;  4KLW A;  5K8P A;  2EJF C;  4R4Q A;  3QWN A;  2C9O A;  2A1A A;  2ZJR A;  4HCE A;  2J0T D;  5IWA Q;  2ZT9 C;  4MHD A;  3BI0 A;  4JPB W;  3HOX B;  4R1J A;  2PRQ A;  4IJH A;  1P4N A;  3TRE A;  4UEF A;  1H9M A;  4GZY C;  2VQY A;  4J8Q A;  1N33 L;  3D66 A;  2P0W A;  1D1K A;  1X3F A;  4JG2 A;  2D4P A;  2QF7 A;  4ZLT F;  3MRU A;  4IAV A;  5F46 A;  3GB0 A;  2K33 A;  3UE0 A;  2FJ2 A;  5J39 A;  2Q8R E;  3RZO H;  2RDF A;  3TO9 A;  4KOW A;  5C0X I;  1E1O A;  2ICE C;  2K75 A;  3FDT A;  5A28 A;  4N9P A;  3BS1 A;  4OX9 Q;  5JVH 3;  1VQO A;  4MCS A;  1SNQ A;  3CU7 A;  1WD1 A;  2B2V C;  4JI3 Q;  1DXM A;  4B9X A;  3CRK C;  2L4N A;  5IP9 H;  3FHW A;  3F1Z A;  4DV5 Q;  4HJ8 A;  1WTQ A;  1X9N A;  4XPL A;  1EIG A;  1A3V A;  3TS2 A;  2C27 A;  4F88 A;  1LT5 D;  4HIO A;  1B9N A;  3R1K A;  4F6A A;  4UF4 A;  4CJ1 B;  2ATR A;  4LUV A;  2L1B A;  1YK3 A;  5GCN A;  5IB0 A;  1D8L A;  1F2Y A;  2MP1 A;  2HHH Q;  4MHZ A;  3ONA B;  5IOD A;  3GIU A;  1JWQ A;  3T13 A;  1GYT A;  3WC5 A;  2AKW B;  4JCV E;  2CNT A;  4BBR B;  1VF7 A;  4R7M A;  4A3D H;  4LF6 Q;  2HQE A;  5J22 A;  3FXT A;  1GVP A;  4JYA Q;  2O53 A;  3RNU A;  4LJZ C;  1FNW A;  2AQ2 B;  2MHV A;  4UP8 A;  4JBK A;  2F03 A;  5JQ4 A;  5AJ3 L;  1ZG7 A;  3H0G H;  2B2T C;  1RKN A;  4JI8 L;  1Y69 U;  5M5W H;  1XMQ L;  2PI2 E;  1XNQ L;  3GTQ B;  4ZUJ A;  3FVL A;  4OIJ A;  3DR8 A;  4E0A A;  3IFD A;  1Q46 A;  4OC2 A;  1W6K A;  3IWW A;  4CRZ B;  1ESF A;  3KHZ A;  1JWU D;  1JJ2 A;  4HNY B;  4CGN A;  4IUV A;  3WDN A;  3S17 B;  4BD9 A;  4J1M A;  4K0K Q;  3PB6 X;  3FVQ A;  3B3C A;  5JGF A;  4DV1 L;  4R8F A;  4GKK Q;  1YRE A;  3MN8 A;  2L15 A;  2XGT A;  3M4O H;  2HC9 A;  1N32 L;  1AUG A;  4NW2 A;  1V8Q A;  4A4I A;  4FVM A;  2KEN A;  1X3Q A;  2N78 A;  3WR7 A;  1RF2 D;  1EYC A;  2WFW A;  3CT9 A;  3VWE A;  4EGV A;  4UFV A;  3H8G A;  1PYB A;  1SXT A;  1BNZ A;  3K81 C;  5FLX L;  4DR7 Q;  2GVB A;  3GUX A;  1UWV A;  1SRO A;  3BJU A;  5BR8 L;  1IU8 A;  1QG7 A;  2P6F A;  2XRQ D;  1QB5 D;  2EYO A;  1I3Q H;  2JA7 B;  4PSW A;  4AYB B;  1HTL D;  3OSO A;  1XNR L;  1HEE A;  2RCF A;  3FEE A;  4CYQ A;  3DXJ C;  4K0K L;  4PG3 A;  2NVT H;  3NWS A;  3WAB A;  3K7A B;  1ENF A;  2KJX A;  4DGZ A;  1CTM A;  5IWA L;  2WYR A;  1XPU A;  2F1M A;  3S1R B;  2OQK A;  4J6H A;  3NFZ A;  3SR1 A;  1IBK Q;  4QB9 A;  4A32 A;  3S1M H;  3CPA A;  5J8F A;  2K52 A;  4I7Z C;  1TS2 A;  4DUZ Q;  2J8N A;  2K05 A;  1EY7 A;  4UWJ A;  4OAD A;  1YVK A;  2C6P A;  4YWM A;  2F3V A;  2HT1 A;  1TF8 A;  2BSW A;  2F0P A;  3RD4 A;  1IBM L;  1BDO A;  4X3K A;  3STB D;  3G6J B;  4JOI A;  5FKA C;  1JOO A;  4ME5 A;  3V05 A;  1SND A;  1H9S A;  2AHO B;  2G5D A;  3D4R A;  5C3E B;  1EIY B;  3S15 H;  1U4M A;  2F0Q A;  3D68 A;  3GP7 A;  3NBH A;  4MHE A;  3VA5 A;  3PIP 3;  2VW9 A;  4UIA A;  2E76 C;  4A95 A;  1IY7 A;  3I1U A;  1VQ6 A;  3LMS A;  2VZA A;  4FXK C;  3NH8 A;  4KUA A;  1JR0 D;  4KHP Q;  4Z65 A;  2YGW A;  3N7Z A;  3L2P A;  1PH4 A;  2WII B;  5IIF A;  1Y8P B;  1MJ9 A;  1VQL A;  4G7H C;  3S6H A;  1STH A;  4IPC A;  1X3P A;  4HN7 A;  4RHR A;  2NBF A;  3KF8 A;  1AZQ A;  3U50 C;  4A3F G;  3B7I A;  2QIR A;  5I4M A;  3OYY A;  2K5D A;  1U4R A;  3HLP A;  1NNX A;  2EY2 A;  4OHJ A;  2HB6 A;  3S9L A;  3CF5 A;  3FBU A;  4PV6 A;  2R6G A;  5HGT A;  4B3R Q;  3SI0 A;  1CFM A;  3HOV B;  4DR3 L;  3SDZ A;  1PH6 A;  2O4X A;  4PXD A;  1YNJ C;  1FD7 D;  4K8I A;  2UUC Q;  4UPA A;  4M6G A;  2WIN B;  1CHP D;  4A3C H;  1PU9 A;  2ZTE A;  4ZK9 B;  1NY4 A;  3QB8 A;  1RDP D;  1OTC A;  4M8A A;  1KNA A;  3HFZ B;  3R8B A;  4JBM A;  2F0D A;  5CGK A;  2ZXR A;  1IYJ B;  2NUC A;  1EFW A;  1I50 B;  5M3M H;  4JOI C;  2EYH A;  2OZU A;  2B2T A;  1HR0 L;  1HNW Q;  1ZYR C;  2F0H A;  1QVG A;  2D5D A;  1EOV A;  1JOR A;  4FD4 A;  3STB C;  3J7Y W;  4MFK A;  4UIB A;  4LFC Q;  3URY A;  4G57 A;  2EOT A;  1SAP A;  1J6Q A;  2JQO A;  4RCO A;  4BS9 A;  3T1H L;  1BQQ T;  2ALY B;  3MEH A;  4EVY A;  4IFD J;  1GXD C;  4LF8 Q;  2ZOF A;  4M6I A;  1LT4 D;  3TQY A;  1R3N A;  2ARH A;  1DOL A;  4YCU A;  2QCP X;  3VR4 A;  2SNM A;  1Z9F A;  2QIL A;  1KC8 C;  2RF4 A;  3BZC A;  4A3M B;  4MI4 A;  1YQE A;  5EBC A;  4DXF A;  5ISR A;  4NGQ A;  4CJ0 B;  5C4X B;  3GO5 A;  1JCK B;  3GDE A;  1B87 A;  1S7F A;  2IJZ A;  1BKB A;  1EZ6 A;  3I7F A;  1YHQ A;  5I6Y A;  4HPS A;  4B14 A;  3TOA A;  4QGU A;  4KOV A;  1EQT A;  4C3J G;  4JJX A;  1HR0 Q;  1L0Y B;  3NQT A;  1SE8 A;  4DV6 Q;  3NTI A;  1S72 A;  1YW4 A;  3TCV A;  4ZX8 A;  2NVQ H;  5A2Q E;  1PYT B;  1AH9 A;  4B5P A;  2CY2 A;  1RO5 A;  3CZX A;  4Y49 C;  4K6L A;  5DS0 A;  2NTS A;  3TDQ A;  1KD1 C;  3U4Z A;  4OLL A;  2Z1C A;  2RC4 A;  1HHV A;  2EXZ A;  2EYJ A;  3RR5 A;  1SMY C;  1NAP A;  1Z4R A;  3EA6 A;  1OXT A;  1HRJ A;  2EQS A;  4B5P B;  3V7Z A;  2A6E D;  1EY4 A;  4XYO A;  4IFD H;  3TO7 A;  2LXK A;  2PE3 A;  3U4V A;  4U67 3;  3Q23 A;  1BBU A;  2WPX A;  1E22 A;  1XXG A;  3DM1 A;  4NSQ A;  1LYL A;  1PCA A;  4O1N A;  3JTK A;  4IOA A;  5C4J B;  2YNC C;  4CDC C;  3OTO L;  1A3U A;  1ZG9 A;  2Z9H A;  3NBI A;  1TWA H;  2GU2 A;  4JWP A;  2F0E A;  5IYB H;  1X56 A;  4DV7 L;  4UAI A;  2Y0M A;  2VUM H;  2Z11 A;  5BR8 Q;  4NF1 A;  4ZRZ A;  2C6G A;  4V19 0;  3WOE A;  4B3T L;  3NTH A;  1I50 H;  3TBI B;  5M3M B;  3RZD H;  1R4Q B;  1X6O A;  1J5E L;  4DA2 A;  1Q2D A;  2Z3M A;  5IGC A;  3OWC A;  2QEJ C;  2QYV A;  3MHB A;  5EQ0 A;  1NCV A;  1R4P B;  1VQJ A;  5COR A;  3R95 A;  2N3S A;  1NUC A;  1FVI A;  1TKJ A;  3S6F A;  1ARM A;  1WCM H;  3PP9 A;  1FGU A;  2LKV A;  2Q2T A;  4FD5 A;  4ID6 A;  1MD2 D;  4B9W A;  4Q0F A;  3IWE A;  1GKH A;  4KVM E;  2P5Z X;  3HZX A;  4C56 C;  2A6H C;  1TS4 A;  4KN4 C;  3A5U A;  4OID A;  4UP7 A;  4X6A H;  1PRT B;  2CWP A;  4NXY A;  2VEZ