3LWUA

Crystal structure of putative succinylglutamate desuccinylase/aspartoacylase (yp_749235.1) from shewanella frigidimarina ncimb 400 at 2.10 a resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
372
structure length
372
Chain Sequence
b'MTKAIQSSVQVGELATGQALTVPIYSFMGSENSAPSVYIQANVHGAEVQGNAVIYQLMTLLEGYQVLGDITLAPLANPLGINQKSGEFTLGRFDPITGVNWNREYFDHNVDIQNWYAEHQHLTNSELFCAYRSMLVETCQARLTHSFGISTGHRLAVNLQAMAHQADIVLDLHTGPKSCKHLYCPEYDIDAARFFSIPYTLIIPNSFGGAMDEATFCPWWQLTEYATSQGREFSVPVSAFTLELASQERIDLADALEDAKGILAYLSHRGVIAEKVNPASMERFGCYLKDYKKFHAPKAGLIEYCASVGEPLTAGKPLVNILRIDLYGSEQAYQAISLPMDCVPILHFASASVLQGTELYKVMTNVFPLQPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinylglutamate desuccinylase/aspartoacylase
molecule tags Hydrolase
source organism Shewanella frigidimarina
publication title Crystal structure of Putative succinylglutamate desuccinylase/aspartoacylase (YP_749235.1) from Shewanella frigidimarina NCIMB 400 at 2.10 A resolution
rcsb
total genus 113
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3lwuA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3lwuA01
1FR3A 2O5JC 2AFUA 2Q51A 3IFEA 4X8IA 1H9SB 2BO9A 1Y8OB 3MN8A 2D5DA 4ZI6A 2L5TA 2LMCB 4EWTA 2O5IC 2JBKA 1DCZA 4HR7B 3VARA 1YSJA 4A38A 1TKWB 4BA2I 3T53B 3IO1A 4IQZA 2BOAA 4GM5A 2PVWA 4MCQA 1H8LA 3U9SA 1IW7D 1TKHA 1TKFA 4H2KA 4A39A 1Y8NB 3B3CA 2PE3A 1K8OA 4OIWA 2A6HD 1VF5C 1TXRA 3NFZA 4CPAA 2K32A 1UWYA 4OC1A 4NJQA 3IKJA 3OOCA 2CIJA 1QMUA 3GLJA 1HQMC 4LK1C 5JM6A 2ZEMA 1CFMA 2BCOA 3D68A 4DJLA 3FMCA 2PCUA 2PIZA 1IYVA 3CRLC 4NGPA 5C0XG 5ELYA 4R6TA 2V8DA 2DEAA 4B6ZA 2YYZA 2POKA 2V8HA 5LRGA 3CRKC 2EJMA 3PB9X 1BAVA 1ZLIA 1BPNA 2C6CA 3WC6A 3P20A 2PIYA 2EJFC 4P45A 1YW4A 4F8ZA 2PJ5A 2ZEOA 1OXXK 3L2NA 5C0XH 1E2WA 1Q12A 1R3NA 1XMBA 2BE5D 3BHXA 4DUKA 4KKUA 1Y8PB 2A68D 1GUOA 1Y69U 2PJ1A 1CG2A 3GB0A 5HVHA 5LYFA 5CPAA 3RAMA 4NGQA 1IGBA 4GZYC 2D2CC 2JEWA 1KWMA 3PUZA 3B3SA 3FF3A 3S9NA 3BI1A 2ZT9C 1CPXA 1YMEA 2PVVA 3BG3A 1ZLHA 4G7ZC 3M4YA 3BDOA 3D7HA 2BE5C 4MXUA 1OXTA 1HEEA 5A35A 1CI3M 2PJ0A 1CPSA 2ZEEA 5HVGA 4LQGA 1ONLA 3NH8A 3QIAA 3BI0A 3WABA 3PEIA 1LCPA 3MFYA 4UIAA 3SE0A 2NN6I 4UEZA 1GUGA 1TF9A 4P4EA 1Q90A 5JEAH 1FNOA 8CPAA 5LYLA 5K8NA 1V43A 4FBEA 1E2VA 1K8MA 3K2KA 2PJAA 4OC3A 4ZX8A 5LRJA 2JBJA 5I4MA 2DN8A 2CW0C 2PJCA 1OXUA 2AUKA 3OPOA 5K36G 1HDUA 1BDOA 4EFDA 4OC2A 4NGRA 3M85A 2FVGA 1A6XA 2ZEHA 4RUHA 1Y0RA 2ZEFA 3V38A 3PB4X 2XEJA 2F1MA 2PJBA 3KR5A 2JEBI 2JEAI 3CPXA 2GREA 2IJZA 4NJRA 4W9YA 4LJZC 5K8PA 1I6VC 3SJEA 3PBBA 2AFOA 3S9MA 1T5EA 2AFXA 4OO1H 1PYTB 1RTQA 3FECA 4FWUA 2PJ8A 4MHYA 3QG1A 2GLJA 1O78A 1VCIA 4L8JA 2IQ6A 4P4IA 4X2TA 2CF4A 2BA1A 4KN4C 7CPAA 3VA7A 3VR4A 1OBRA 4PPZA 3RZAA 3NE5B 4MCPA 2AWOA 2A68C 3A8JE 5KNBA 3WC5A 1CBXA 3FEEA 4RCNA 2Q4ZA 3CDXA 3KASA 4MHPA 3FPPA 2E76C 3D31A 4XIGS 5KNCA 4KHZA 3FH4A 3A7AB 1VDZA 1V8QA 2CTBA 2QYVA 4ZY1A 1TF8A 5BN5A 4I7ZC 3T8WA 4ZYQA 2HC9A 4F9UA 3PUWA 4KSIA 3PB8X 2A69D 3NA6A 3QNVA 4OO1G 3SJGA 4O23A 3I72A 4WWVA 1HTPA 5BN3A 5BN4A 1Q7LA 1YLOA 2KCCA 2QVPA 1ZG9A 3A7LA 1FYCA 5HXDA 2V8VA 3IWWA 4OC4A 3SI2A 2PJ2A 6CPAA 3H8FA 1TU2B 3KLRA 5K36H 2A69C 2QF7A 3VR3A 3K9TA 5LYIA 3I1UA 1AYEA 3KZWA 3WC7A 2PJ6A 5JH9A 1NSAA 4UF4A 2BA0A 4XTCS 2K7VA 3TX8A 2WZNA 1CX8A 3VH9A 2PPBC 2ZOGA 1YNJC 3KHXA 3D4RA 1GHJA 1IW7C 4NGSA 1H9RA 5JEAG 1Z7TA 4IFDG 2NYQA 3FJUA 5D8NA 1DD2A 3B7IA 1HCZA 3S9LA 3VR6A 3MXUA 1VGYA 3VR2A 4JZ0A 2RFHA 1OXSC 1GUNA 3D4UA 4ZY0A 2NN6H 1F2PA 4PQAA 2A6ED 2K33A 4ZY2A 2EK9A 1Z5RA 1Q1BA 1LABA 3VATA 3IJ3A 5HVFA 3MRUA 3PUYA 4UEFA 4DYOA 4TKOB 4OGQC 1ZG7A 1HDQA 1PCAA 3PFOA 2PRQA 2AFZA 1B9MA 1Y7EA 2C6GA 2O4HA 2EWBA 4KKSA 1OXVA 4IHMA 4Q7AA 2BDOA 1ZKOA 3B2YA 3PUVA 3B3TA 2KA7A 4YWYA 3CT9A 3FX6A 3N5FA 4OC5A 3B3WA 3B35A 4MCSA 1E2ZA 4WJBA 1VHEA 3GUXA 5D29A 3NH5A 3D67A 4AXVA 2DNCA 1GYTA 2D62A 3A8IE 2EK8A 3DLJA 2NN6G 3KL9A 1YW6A 1GUSA 1XBUA 3TC8A 1ARLA 2C6PA 1R43A 2PJ3A 3H8GA 3WT4A 1Q1EA 1LAMA 5IB9A 2CTCA 2A6HC 3SI0A 3ISXA 2ZEDA 4OC0A 5J1QA 2EDGA 4MCRA 1XFOA 4P4DA 1CP6A 1VIXA 2R6GA 3W3AA 1SMYC 2PJ7A 4FUUA 3AB9A 2Q43A 3PBEA 3ND8A 4JBWA 1BLLE 1Z8LA 4F9VA 4MRIA 1LANA 5JGFA 5K8OA 2ABZA 2J9AA 3H8EA 3CPAA 3N6RA 2F7VA 4KI0A 1EE3P 1VHOA 2RB7A 3SJFA 4MHNA 2E74C 3WDNA 2B8GA 1LAPA 4K3NA 4PXDA 2A6EC 1AMPA 1PMRA 2ZELA 4MMOA 3RBUA 1O7LA 3KQZA 1GUTA 2IT1A 2GU2A 4IK2A 3SDZA 1ZG8A 3ISZA 2WYRA 4JK1C 2AUJD 1YNNC 5DS0A 3H94A 2VL1A 2ZEPA 4MHZA 2PJ9A 1JQGA 2O53A 4PXBA 1G291 4DNTB 2V77A 4IFDH 3FEDA 3IC1A 4G1PA 3PFEA 2E75C 2DNEA 4R8FA 3A8KE 3GQBA 3SI1A 3ND9A 1DTDA 1IYUA 4P4BA 1DE4C 5LRKA 3RLFA 4EMEA 4KKTA 2EJGC 2EVBA 1F2OA 3T56B 1FT7A 4ZX9A 3KHZA 2AFWA 3BXMA 4PXEA 3LMSA 1QJOA 3IFTA 4NGTA 4UIBA 4OKOA 2IMOA 4PXCA 4P10A 4IAVA 2C1CA 4KMUC 1IY7A 1TKJA 4G7OC 1ARMA 4DNRB 1XJOA 3V7ZA 3OW7A 1HPCA 3KR4A 3EQLC 4OIDA 4P4FA 1QQ9A 3SJXA 3VR5A 4P6YA 2XEFA 1H9SA 4NGNA 4BD9A 2AFSA 4R76A 3DGVA 4JYWA 1BPMA 4Z65A 3LWUA 3KGQA 1ELMP 3TZUA 1F57A 1M4LA 4NGMA 3IEHA 4TWEA 1LACA 1H9KA 2NSMA 3PRTA 4H0LC 2XEIA 4OP4A 5THWA 5F09A 2V8GA 2JXMB 3PB7X 1EWHA 4H44C 2Q8IB 1H9JA 2PNRC 3PUXA 3D7GA 1CP7A 1B9NA 1H9MA 3D66A 4UEEA 2G9DA 2ANPA 3DXJC 4R7MA 3PB6X 2XEGA 3HUVA 3HLPA 1LOKA 4DK0A 4TNUA 3I73A 4G7HC 2PJ4A 5CBMA 3GD7A 4BA1I 3LNNA 5LYDA 3KQXA 4X3RA 2AFMA 3M7NA 1LFWA 1Y0YA 2PCFB 3D7DA 4ONWA 2JE6I 1Z2LA 2OR4A 3FVLA 3PV0A 4YU9A 4P44A 3HGBA 4TQUS 3QJYA 2F8HA 2ZOFA 3D7FA 4A37A 2ZEGA 2HB6A 1Z6HA 3B3VA 4H13C 3NH4A 4OMEA 2OOTA 1CTMA 1ZYRC 1DXMA 2B8FA 4FAIA 1GHKA 4PV1C 3I4LA 3JRUA 4DK1A 3IIBA 4KN7C 4A94A 3T51B 2V4DA 4NFRA 5KNDA 1VF7A 3L7ZC 5K8MA 4P4JA 1ELLP 2GLFA 1XRYA 2I3CA 2QJ8A 3KI9A 1GJXA 2ZENA
chains in the Genus database with same CATH superfamily
3HOZH 2Y0SB 4DR3Q 1FR3A 3M4QA 3IFEA 2GVBA 4MNOA 2UXBQ 2RDGA 5EPJA 2WKDA 4AQYQ 2LMCB 3OYYA 4CKBA 1PUAA 4EWTA 2RDHA 4KY7A 2F4VQ 4L5SA 1DCZA 3VARA 4LMQD 3BDCA 4LFCQ 3T53B 3GKRA 1CKNA 2BOAA 4GM5A 3RUZA 3HZXA 2K01A 1NE9A 4J8QA 3TFYA 1PFBA 1TKFA 4A39A 2K5WA 4BY1H 3B3CA 1K8OA 2JQOA 3VYUA 3GV3A 1V0CA 1TWAB 4DV1Q 1VF5C 1MSHA 3LACA 3ZZIA 3E5SA 4O42A 3ER0A 4ZGYB 1EIFA 1PFNA 3MEFA 4LF6Q 3G71A 4R9MA 4BBSB 4TSSA 1AZPA 2E2DC 1QMUA 1IKMA 2ZEMA 1CFMA 4YHHQ 4ZRZA 2BCOA 4DJLA 5LMNQ 5T1IA 4B5PA 3Q24A 1YEZA 4NGPA 4CGPA 2A19A 4FXKC 1TWFB 4UWIA 3TMEA 2JA5H 5JPMC 2V8DA 4RHRA 4EQ5A 1XIXA 1AH9A 2POKA 4B6ZA 3CRKC 1F2YA 4C2ZA 4JC0A 5IYDG 1MSGA 2XSCA 3P20A 3GTMB 5FO8B 4F8ZA 4XPLA 4C3JB 2PJ5A 2ZEOA 1OXXK 1N8RC 4JJXA 4QIWB 3R93A 3KF8B 1LT5D 1X56A 1R3NA 3S16B 3BYYB 2BE5D 2RSOA 1JOOA 4DUKA 1PHJA 1KAAA 2EPBA 3BJ8A 3OWCA 3HKSA 1RIPA 1NMTA 4JI8Q 5I2XA 3GB0A 4UFXA 5EKLA 1YZ6A 2QEXA 1IGBA 3FDTA 3PUZA 4OIJA 2B58A 3B3SA 4HEDA 5EMIA 4A3KG 2R93H 3BI1A 2WP8J 3H6MA 4DUYL 2ZT9C 2UUBL 1CPXA 3K5MA 1ZLHA 4R87A 3M4YA 1MGSA 2DY8A 5ISRA 2KENA 4C3HH 2VQEL 4WJ3M 5FJ8G 4LNQA 3G6EA 4AYBB 2I07B 1J5EL 3M7GA 5HVGA 4LQGA 5M5YB 2OT2A 3A54A 4A32A 3SGIA 3I3GA 1STHA 1Y1WG 2K5TA 1KRSA 2DJFC 2K4KA 2MO1A 3H4QA 1PRTF 4A3KB 1IXRA 3AFPA 4S3SA 1D6EC 3S14B 3AU7A 5M3FG 3F8KA 2B3UA 4L5RC 4LFAL 3QOJA 4XT3B 1S60A 1JC7A 2B2WA 2R61A 5LYLA 5K8NA 1V43A 1ET9A 1E2VA 3FYNA 1N36Q 5E3FA 2CKZB 4OC3A 1X3QA 1I3QB 4ZX8A 5C3XA 4EVOA 4A3BG 2Z6KC 5COYA 3JAMc 1Z9FA 1JOQA 4NW2A 2DF5A 1RTNA 2G0BA 2AUKA 2K1BA 3S1MB 3VYRA 3U58A 5AJ3Q 1HDUA 1BDOA 1F9SA 1UEAB 1AUGA 2EYOA 3S15B 5C4XH 2Z3MA 2P6EA 1D7QA 4UP8A 4RUHA 2RF4A 1Y0RA 2ZEFA 1F77A 2JEAI 3CPXA 4KZTA 1EQVA 3F1ZA 1U4RA 4BBSG 4QCLA 4A3EB 1X3GA 3OTOL 4U673 1HQRD 1PLFA 3UDIA 5G21A 5C5LA 4OO1H 2WB1E 4KVXA 3GTOH 4JI6L 3FECA 2MP1A 3H0GH 1O78A 3F2CA 4LF4L 3E3XA 5FK9C 4DR6L 4KN4C 4ODGA 2NUCA 1OBRA 4PPZA 1CSPA 3RZAA 1QNUA 1BVSA 4G4KA 3CC4A 2AWOA 2ZXPA 2L1BA 1VQKA 1CBXA 5DWNA 4X66Q 1PH7A 1F9PA 1YR0A 3FPPA 2OF1A 4P2CB 4GNXC 5D65A 2J8RA 4DV3L 1XOVA 1N32Q 1NSNS 3FH4A 4KOVA 1D5XC 3A7AB 1ICWA 1V8QA 1VDZA 1VS0A 2CTBA 2QYVA 4KOYA 2NVTB 4ZY1A 3TN2A 3AFQA 4I7ZC 2Y0SE 3K81C 1A3UA 4P75A 4RGNA 4F9UA 2SOBA 2ASBA 1WCMG 3P1HA 5HURA 2OZGA 1IBML 2BL1A 4IPHA 2BSWA 2A69D 3S6HA 4M8AA 4QC6A 4M1UB 3SJGA 4WWVA 2JDCA 1HTPA 5BN4A 4LFBL 2MGSA 2C5CA 3MTSA 1QSOA 2KCCA 4X5KA 1ZG9A 3GTQH 1ICFB 1FYCA 2VB2X 2E2JH 1VQHA 3SR1A 4OC4A 1TWFH 2K5DA 4C7IA 5IWAL 1RXTA 2PJ2A 5L37A 2OTJA 2OZHA 3H8FA 3KLRA 5ELCA 5FLXL 5ELEA 2QF7A 1SMYD 1I4QA 2EYHA 1VQ7A 1JB3A 3K9TA 1GKHA 4HCSA 4MY3A 3I1UA 3IU2A 5LYIA 3KZWA 4EVYA 1WTWA 5JH9A 4K30A 2BA0A 3FEWX 4XTCS 4YGOA 3TX8A 2DJGC 2D0PA 1CX8A 4BY7H 3G4SA 3CMEA 1N9WA 4KORA 4DR7Q 3OHXC 1EFID 3CC2A 4BBRB 3P2HA 1HCZA 3N52A 4FF1A 1VGYA 1XPUA 1OXSC 2V1CC 3K7UC 3TP5A 1KUXA 2HV2A 3D4UA 1CUKA 2NN6H 2XRQD 3NHHA 1F2PA 4DUZQ 2PDOA 4PQAA 2K33A 1VQ6A 1FGUA 2EE1A 3CCVA 5CBEE 2IHFA 1GD7A 1XWEA 2C27A 5C3WA 4C2YA 1TWHB 4UEFA 2WINB 3SK5A 4DYOA 1GHEA 1HZAA 4UCPA 1GXDC 2JA8H 1A8VA 4A93B 4B3ML 1KXLA 1PCAA 1ZG7A 2PRQA 2DPTA 3PFOA 5FKAC 1WCMB 1Y7EA 2O4HA 2EWBA 4IHMA 2Y0SG 1O80A 1JWUD 2ZW6A 5GQOA 4CDCC 3I9SA 3L9AX 4LF5L 1Q81C 3CT9A 3FX6A 3N5FA 4IUQA 3B3WA 1HRJA 2VQFQ 4PSXA 2A4NA 3GUXA 3DUZA 3PZJA 3RNZA 1QSRA 1FL0A 5A2QE 2DNCA 1LTRD 1HNWQ 1GYTA 4KOXA 2EK8A 5IP7H 1QNKA 3LODA 1M44A 4DAYA 2BUEA 3IWEA 4BXXH 3R3OA 5CV6A 1XBUA 3CU7A 1YJ9A 4WFN3 3TC8A 4XPDC 2WUUA 4C68A 1ARLA 1IICA 3CCUA 3A0JA 4FF2A 3RO0A 3MWYW 5IB9A 1B50A 4DKAC 3DEPA 3NBIA 4QB9A 2P0WA 2UUCL 5DWMA 1PH1A 4QF4A 2PC1A 4OC0A 2BDNA 2B3GA 1I50B 5F2DA 4LF8Q 2DPSA 2G5DA 1VQNA 2FSRA 4HNXB 4FXDA 2PR8A 1B53A 2R92G 3S14H 4MCRA 2I0QA 1VIXA 4LF7Q 5FLXE 3SXOA 1SMYC 2PJ7A 3AB9A 2Q43A 5M9OA 3AQQA 2ZM6L 2OB0A 4AYBE 3FP9A 2ICEC 2F0NA 3IAYA 1LANA 4R57A 5K8OA 1C9OA 1UFHA 2FXQA 5E4WC 2ABZA 1Y1VH 3MFGA 2J9AA 3HOUG 3H8EA 4QJFA 3JVNA 4KOTA 4A3BB 1QUQA 2RB7A 3V8IA 4QUSA 1CHQD 1E0BA 4JV5Q 4R3LA 2VS1A 1NJIC 1Y7RA 1SNMA 3STBD 1GO3E 4BBRH 2B8GA 1I12A 3E0EA 4K3NA 1PXUA 2CQOA 3QOLA 2ZELA 4MMOA 3CHBD 3RBUA 2HUZA 1ML0D 4XDXA 1IL2A 2VY3A 2WYRA 4JK1C 4JLYA 1NTGA 2ID0A 5M3MB 2Q44A 3NEMA 2JSOA 4I7AA 3KLSX 1EFWA 2VBQA 2MQHA 4X65Q 2JA6H 1I6HH 1TWCH 1YIJA 3MGDA 3QR8A 4ME3A 4B9WA 1IB1E 3KYHC 2R93B 3A5UA 4FYDA 1YJWA 2P6FA 5FVJA 3PCOB 4DU9A 4GS4A 2QW7A 2Q2UA 3E6ZX 4A93G 2A5HA 2E2IB 3BVZA 4DV3Q 4N9TA 4KK7A 2VQEQ 4JI0Q 1QSTA 1IYUA 3PIOA 3PMFA 3HOXB 1DE4C 4IJLA 3RLFA 4P4BA 4EMEA 5LRKA 1NMGA 1R4QB 4B08A 1M4DA 5F47A 1IYJB 2EJGC 4ZCKA 3D2PA 1QSNA 4M3SA 4A3JB 1F2OA 2OTLA 3KHZA 4EQOA 2GN5A 3SK4A 3SVMA 3S1RB 1AFPA 2AFWA 4PXEA 4ZUJA 1LTTD 4NGTA 1LYLA 2I5LX 3OWFA 4UIBA 3EC4A 5J22A 3T1YL 2UUAQ 2N55A 4QIWE 5HGTA 1TIID 3PO2H 3CKIB 1XJOA 5EPLA 1HNXQ 5F46A 3OW7A 1HPCA 1S5FD 3KR4A 1Z8WA 4DF7A 2L0CA 5CMDA 3VR5A 5IV0A 5FLMH 4JYAL 4NGNA 2Z10A 1R9TB 4CJ1B 3H3VC 4L5TA 4WJWA 4HMIA 1BCPB 2EO8A 1F57A 3HRZC 4HSVA 1LACA 5F09A 2ALYB 2NSMA 4OP4A 5LHY1 5CV8A 1VQ8A 1K4JA 1H95A 1STBA 4OLLA 4NXMQ 5C82A 3KDFB 1SYCA 4WORA 4ZYSA 4GLAC 2VNUD 1RCVD 4X3UA 1EYCA 2Q8IB 4DV6Q 4XT1B 4DAYB 1RDPD 4FD7A 4YWMA 2XVSA 1XNQL 3D66A 5IGFA 1LTGD 3MXNB 2G9DA 4NXNL 4MFQA 4GOPC 3KOJA 5G20A 1PRTB 4H7BA 4YFJA 3R8BA 3OW2A 3HUVA 4TNUA 2ZJRA 4YY3Q 1MKHA 3SK6A 5M5XH 2PW5A 4BA1I 5DM63 2B4DA 3J7ZC 2NZ1D 1VMPA 4LFCL 5I4DA 4QBJA 4DV5Q 1EY0A 4IFDJ 4QY7A 1Y0YA 2PCFB 1C0AA 1IL8A 3GO5A 1NAPA 1IBLQ 2AJ6A 4ONWA 1SDFA 2OR4A 4KSFA 2EYFA 3PV0A 1SBBB 3I4MG 3H15A 2J8NA 2F8HA 2ZOFA 5IP9H 4DR3L 4EGVA 3A55A 3NTIA 4KSAA 4MHEA 2OCEA 3NH4A 2ZW5A 2QDLA 4FAIA 3S1RH 4CKCA 4PV1C 2M2LA 3OMCA 4DR5Q 1M90C 3DWQA 2BH8A 2VQYA 4NKLA 4A94A 5KNDA 4X64Q 4JG2A 3WOEA 2B5GA 5M5YH 3K59A 2VQFL 4CGYB 3KI9A 3GTGH 2PZTA 2Q51A 1PH3A 3D8PA 3C2PA 4CGOA 1F2ZA 1Y8OB 1IOIA 5HGQA 5CC4A 4A3DH 5LL6X 4C1NI 5DAUA 3MHBA 3Q23A 4BINA 5TSSA 1SNOA 4K8IA 2N88A 3TSSA 1VQGA 4O0AA 1LTLA 3EVQA 3QB8A 4JI1L 4K0KL 3TEHB 3EFAA 4J15A 4HPSA 2PVWA 2NVXB 1KUVA 1W6KA 2MUYA 1U4PA 3GTPB 1AEXA 5LMNL 1B7YB 1TKHA 5LMUQ 2PE3A 4IURA 4OELB 1Y1VG 2A6HD 2RHSB 1B70B 2WFWA 1TXRA 2Z3OA 1MI2A 1D5ZC 1SYBA 2K32A 2HCCA 2IL8A 2VZAA 3W1GA 3I4NB 1UWYA 3EJIA 4NJQA 2KEDA 1ZEQX 1X54A 3OOCA 2B2WC 1II3A 5C3EG 1SE3A 2CIJA 5C4JB 1J8IA 4RG1A 2E5LQ 2OQ0A 4GS3A 3D68A 1B44D 3JC66 1K9MC 2PCUA 1IYVA 2F0IA 4KTAA 4QGUA 5C0XJ 2Q2HA 4R6TA 4K5VA 4AYBG 4F0XA 4JI4Q 4K8JA 4IPGA 4FD6A 3UI2A 1S7NA 2PIYA 4O1NA 5JPNC 3CXQA 1YW4A 4FF3A 2Z3LA 1A3TA 3ERSX 2FINB 1UUPA 2NYZD 2B63G 2R7DA 1XYIA 5C0XH 1L1OB 3CMAA 1YGHA 1TY0A 4BY1B 2PSWA 3R2TA 4HCEA 3BHXA 5KRUA 2LFNA 5IGGA 4L89A 1CM9A 1Y8PB 2QILA 4CAFA 5AG4A 5IP9G 2RDFA 4YCUA 1SE4A 4CRYB 5CPAA 4DXFA 3RAMA 5ISVA 4FNFA 2D2CC 1KWMA 1QVCA 3FF3A 1Z47A 1YVOA 3SK8A 4RFBA 2RCFA 4LF5Q 3J7AV 3Q0AA 1ZXTA 3BDOA 3D7HA 1LV9A 1P4NA 1OXTA 1TWGH 1ESRA 1HEEA 2AE6A 4MFLA 4PZ7A 2F0JA 1X65A 3SXHA 3TO7A 4B9XA 3IU1A 1UNSA 4GNXA 3EO4A 4RGMA 4PK3A 1O7IA 3FBUA 5M5WB 2I00A 3QIAA 2F0UA 2A73B 4GOPB 3WABA 2KJXA 3DEOA 4XYQA 3VA5A 4TVAB 5C5MA 2XIWA 4FD4A 1LLRD 1PDQA 1G6ZA 2QEJC 3HEJA 3MA2B 1EU4A 2QECA 5KIXA 3SE0A 3QAHA 2WAQG 3W5OA 4DAMA 1LT3D 1TF9A 4P4EA 3TS0A 4LUAA 1UE6A 2F0FA 1SYEA 1Q8KA 5FO9B 1EQQA 1Q90A 2PRBA 3BZCA 1S5CD 2K04A 1KABA 5AG6A 4JOIC 1STEA 4EQPA 2F0SA 1VQ4A 1SYFA 2KHIA 2F3IA 4ZKCB 3HS0C 5FLMG 2D0OA 4CGLA 4R4CA 2RKSA 2DN8A 3QB3A 3ITPA 3RMHA 1EOTA 3PP9A 4JPBW 3OPOA 2JA5B 1SJHD 1K73C 3PO2G 2UU9Q 2UUBQ 2XNAC 4A3LH 3TTHA 2QMLA 4OC2A 3TBIB 1VQ5A 3M85A 1RL2A 2F0DA 2MPMA 2FVGA 1I4GA 1VQDA 3VWDA 2L9HA 4N8FA 3V38A 1HXYD 2Q8RE 3NSWA 2F1MA 3M3YH 2XEJA 3PB4X 2IX3A 2KCWA 2L4NA 1S5BD 3SXNA 3E9IA 4LJZC 2JEVA 2ODFA 3GIUA 2KUMA 3TT2A 2AFOA 1DONA 2MJ8A 4A3GH 3S9MA 2F52A 2AFXA 3KJOA 4FWUA 3BYTB 1EY8A 2PJ8A 5I9PA 1NCVA 4DGZA 2REFA 4CYPA 2BA1A 2I79A 5I2YA 3H3VH 2R7HA 1EYGA 3KBGA 2IW3A 3NE5B 1S3OA 3S17H 1Q7YC 1MD2D 4A3IH 4B11A 1B6BA 2PYKA 4DK3C 4RCNA 2Q4ZA 3CDXA 3KASA 2E76C 3DM1A 2F03A 4KHZA 1RHPA 4ZBGA 2B2VA 2KCNA 1L0WA 1M4VA 1Q8IA 1HTLD 1TF8A 1U4LA 5BN5A 4RMFA 2HC9A 3O13A 4KY5A 4B5PB 2B29A 1NSLA 1PRTD 1MIUA 5D14A 2YNDA 4A2ZA 4IALA 3KFUA 4OO1G 1FVIA 4AQYL 3HOWH 2VXKA 1S3ZA 1Y14B 5JVG3 4LF4Q 4BBSH 1YLOA 1QG7A 1STGA 1QUQB 1X10A 2KHJA 2MFIA 3A7LA 2FE7A 3IL8A 4C2MB 5A2QL 4A33A 2V8VA 3IWWA 3SI2A 4GLVB 1BCPD 3K58A 1EY5A 2Q04A 3FRMA 1SNCA 3C26A 2KQ3A 1WI5A 3R9GA 4NF1A 1JB7A 3S6KA 1WTOA 4WRDA 2R92H 3J81c 3CXSA 3WC7A 2KBNA 4A3BH 4QVTA 1E22A 1L0CA 4UF4A 2QGQA 1PYSB 1SNDA 2WZNA 4KHPQ 1Q82C 2PPBC 4Y7NB 2QJ8A 1YNJC 5IGBA 4XQNA 4OX9L 3CQZH 4NXML 4UA3A 3Q6SA 1WTXA 1Z7TA 2F3VA 1IZ6A 3M4OH 2NYQA 4OXPA 4F88A 3FJUA 4JXQA 1U5KA 3UDFA 2F0PA 3I3CA 1L0XB 5EBVA 1EEFD 1W2BA 1F9RA 4YWKA 2N8NA 1YI2A 4DR4L 4RKBA 2VXWA 2RFHA 2YTYA 4YHHL 2CWPA 1C4QA 4G57A 3J80c 2A6ED 5DNFA 3K6OA 3BVMA 3KDFA 4PZ6A 1PH8A 4ME5A 3TS2A 1YLEA 1Z5RA 1Q1BA 1LABA 3PO3H 2OXPA 3MRUA 2Y0MA 3FNCA 4BMHA 1I4RA 4U68A 4RAUC 3QWNA 4OGQC 3GTLH 1HDQA 5BR8Q 5FJ8H 1M4GA 1HNZQ 2AFZA 2H1EA 1YK3A 4M6GA 4JI5Q 2C6GA 2PI2E 5IGEA 4KKSA 1OXVA 1PZJD 4IO9A 3J7AF 1JORA 1S7FA 4MFJA 2BDOA 2R93G 2LXKA 4CRZB 1OO9B 3JAME 5IYBH 3I4OA 1YJNA 4OC5A 3MXPA 3B35A 1EUJA 2PQAB 1M8AA 1CJWA 2WPXA 3CZXA 1B1ZA 2VUMH 4J6HA 3D67A 5BR8L 1UE5A 4U9YA 3TO6A 1WD0A 2H5MA 3CXPA 4UP9A 3DLJA 2XTIA 2NN6G 1EOVA 2E2JB 1B87A 2GFQA 4X62Q 1JJGA 3C1FA 4RA8A 2EUIA 2NTTA 3I55A 3EA6A 2NVXH 1R43A 2PJ3A 3K0XA 3H8GA 1M4IA 2CH4W 1E24A 1JWSD 2A6HC 4V0BA 2P6GA 1HNWL 5LMUL 3BDLA 1MJCA 1A0IA 1XFOA 4P4DA 2CWAA 1CP6A 1STAA 2R6GA 3N7ZA 4OWWB 4MBUA 4F9VA 4JBWA 1HZBA 1Z8LA 4L5QA 4KUAA 4MRIA 5JGFA 4R1JA 1A2ZA 2N3SA 5IOCA 3J7A5 1Z8TA 3GYAA 3E0JA 3GTJB 1VQAA 1LTID 3U4ZA 3N6RA 1KHIA 2F7VA 1U4MA 1VHOA 1AP0A 3U4VA 2JA6B 2KEEA 3K57A 1C8CA 2E74C 4UPAA 4JBMA 1NBWA 1EY9A 4N9PA 2A6EC 1AMPA 5CGKA 1IU8A 1XTDA 3I91A 1EQTA 1N34L 4H89A 4IK2A 1IBLL 1ZG8A 3BZDB 4XXEA 2FCKA 4FVMA 5DS0A 2WB1G 1A63A 2IHEA 3FKIB 5AG7A 1KNAA 4FF4A 2ZEPA 3T1YQ 2UUAL 3HOZG 4JD6A 4MHZA 3NE8A 2O53A 1G291 2R1IA 3D3RA 3MC0B 2AHOB 4KY6A 3VYTA 4CKEA 2DNEA 1WTQA 3GTPH 2ZW7A 4AVAA 3TO9A 2NTSA 4K14A 4HIOA 2YNCC 5AGEA 4JI7L 2B39A 3A8KE 2FMMA 4UHVA 3CAMA 3GQBA 3F5BA 1HH2P 3H0GG 1Y9KA 3T9YA 2Z6BA 5DM73 2EVBA 1BO4A 2CFMA 4ABNA 4I49A 2EQSA 3VDYA 4B3TQ 3IFTA 4JI1Q 2R3ZA 4DXGA 3ZYYX 4OKOA 2IMOA 4LF6L 1PTOB 5C4XG 4PXCA 3FRPB 2C1CA 1IY7A 5H1SE 4K5XA 4G7OC 5G22A 2WKCA 2LSSA 2NWGA 4A4IA 3ULPA 3WOFA 2VI7A 4RH6A 4QMGA 3G3SA 4X62L 1QQ9A 2EZVA 5IT9E 4A3MG 2RA4A 3EN2A 4MI4A 2H5XA 4R76A 4Z65A 4IFDI 4B5OA 4C7HA 1TS3A 2G3TA 3TZUA 3RYOA 2BH2A 3PO3B 3W1BA 1DM0B 2PI2A 5LL6S 3IEHA 4JWPA 4NGMA 4H0LC 5THWA 3EIVA 4A3GB 1A2TA 2JXMB 2R98A 5CNPA 4H44C 1XMOQ 1H9JA 5KTCA 4DN4M 1CP7A 4UEEA 5JPHA 1Y1WH 1MJAA 3DXJC 4R7MA 4KS9A 1EY4A 3OTOQ 1FJGQ 3HLPA 4LF8L 3NQIA 5KYLA 1YX0A 2PQAA 4J1MA 3J81j 1C48A 4A3GG 1EIYB 3M9BA 4C3HG 3KQXA 5JAVA 5NUCA 1EIGA 4C2XA 5BWAB 5ELNA 3K5OA 1U9RA 4CAXA 2RBMA 3MZ5A 1K0RA 4A3KH 2NVQB 1UE7A 2JK8A 1KTKA 1Z9UA 4ZY0A 1NY4A 1D2BA 3W2DA 1Z2LA 3FVLA 4YU9A 3GDEA 3HOXH 4JYAQ 4KOUA 4GN5A 3HGBA 1PH6A 3UDXA 2CNMA 5CV7A 4B3MQ 1QVFA 3B3VA 2OOTA 1CTMA 1ZYRC 1DXMA 2B8FA 2VW9A 1L0YB 3I4LA 2ZXOA 4MHDA 4AB7A 1J9OA 1GM5A 1K3BC 2X69A 4B3SL 4KN7C 3T51B 2WACA 3CCEA 1CQFA 1VF7A 5KTDA 4GKJL 1ELLP 2UXDL 1STNA 3H91A 4HJ7A 3OWEB 4UCMA 1VQMA 4HTHA 2JA8B 2ZENA 2O5JC 1VQOA 2AFUA 1NR4A 4IPCA 2BO9A 3J80i 4R8NA 3MN8A 1FJGL 4DV4L 2D5DA 4J3GA 4DV1L 1CT1D 2HQLA 4ZI6A 2UU9L 4OEMB 3F2DA 2KCMA 3HOVB 2VUMG 2HT1A 1R9TH 2O5IC 2K05A 4HR7B 1YSJA 4CJ0B 3I56A 4LF9Q 1TKWB 4BA2I 1S5DD 3EBEA 1TT2A 3S9WA 1VQJA 3BU2A 4MCQA 4QL5A 5IYBG 3CP0A 1KL9A 3CF5A 1H8LA 4LUOA 5EBCA 4B3RQ 2GA4B 2IJ0A 3U9SA 1IW7D 1B4OA 1DOLA 1Y8NB 2PQEA 4DR2Q 4OIWA 3M4PA 3R9EA 3FVQA 3HKZG 2RCNA 3NFZA 4POGA 3B6YA 4H6UA 2C9OA 4CYQA 4MFPA 1RJTA 3F8TA 2ZXRA 1RKNA 4OC1A 1LT4D 4I65A 2K14A 3IKJA 3E0KA 4P72A 1WWZA 1HFGA 1SLJA 2NVTH 3PO3G 1K83B 5E4XA 3GLJA 1HQMC 1G8ZD 1TVXA 4CDEC 1BBXC 1I4HA 1X9NA 3UY5A 5C0XG 5ELYA 3OSOA 5G1ZA 2Q7BA 2B63H 2A1AA 4RKLA 2DEAA 4LW1A 2PQ8A 5LRGA 1PZKD 2EJMA 3FHWA 1BAVA 3CPWA 2C6CA 3WC6A 2EJFC 4P45A 4AIMA 1EYDA 4LX9A 3NELA 2H4OA 4DV0L 3FIXA 4OADA 4IPDA 2Z11A 3L2NA 1E2WA 1NUCA 1Q12A 1SNQA 1XMBA 2IX1A 5JJKA 3PIO3 3S24A 4JBKA 3G7LA 1PV4A 4KKUA 4LWCA 3J81i 5E7NA 3BS1A 3ICEA 1VQCA 2A68D 3FKIH 3PSIA 5C3EH 3RZDB 2KHSA 1Y69U 2F0QA 2PJ1A 5LYFA 2XWJB 4Q36A 4NGQA 2K50A 2AMCB 4PMWA 4C56C 4GZYC 2JEWA 1FNVA 3JTKA 3S2DH 1S5ED 3S9NA 3HOYG 4DR1Q 4BY7B 1VQEA 3A9LA 4RI1A 3MAQA 2PVVA 2M00A 1A3VA 2BE5C 2EYPA 4RWSC 4F8MA 1Z8XA 2FIAA 5A35A 2CHBD 2HCIA 1CI3M 2VZYA 4GXHA 2Q2TA 1CPSA 3HOWG 2CXAA 2ZEEA 4DV5L 1S7LA 2Q0YA 5T1GA 4RCOA 1I1DA 5JVH3 3NH8A 3A56A 2K5QA 1W3SA 2UUCQ 4WJ4A 3IFDA 4PQXA 1IBKL 4B3SQ 4Y52H 1PA6A 1WJJA 2A74C 4C2MH 5GAEC 4A3DG 1S5KA 3I70A 3CXCA 1G6PA 1DOMA 3PEIA 2TSSA 4BS9A 5IT9c 1LCPA 1J6QA 1TS4A 2N78A 1JE5A 1PFSA 4MZ9A 3MFYA 3K9UA 4UIAA 4QUFA 2AQ2B 4DR4Q 1LTSD 4HN7A 1YREA 3F0AA 3D6WA 4A3IG 1HR0W 3DWAA 3IWGA 5JEAH 1FNOA 1K8MA 3K2KA 2RC4A 4R4QA 1FNWA 4L6TB 1SRUA 3ERQA 5EKIA 5LRJA 5A28A 1YNXA 2JBJA 5I4MA 2PJCA 3UE1A 2JA9A 4F0YA 1OXUA 1YVCA 3M4OB 4K2LA 2DGYA 2Z4HA 2YGWA 1D1KA 2QIRA 4PNYA 2K03A 1YITA 4DR2L 1BNZA 1IBMQ 1HZ9A 2GIVA 1A6XA 2WIIB 2Z3KA 3G6JB 3KR5A 3OIQA 5EQ0A 4CGNA 2L15A 2GREA 4CYOA 1HUMA 2ES2A 4NJRA 4W9YA 5K8PA 1I6VC 5E1FA 1DYQA 4C3IG 3PBBA 4X66L 2HIVA 3TREA 1T5EA 4A3LG 3VYSA 5IY0A 1JJCB 3FB3A 2XGTA 1ZO0A 3MVVA 1Q2CA 1VMCA 1VCIA 2MO0A 2Q7SA 4X2TA 3GTLB 1F2MA 1BR9A 1D8LA 1ET6A 4NXYA 1I5FA 3P75A 4JI0L 4OIKA 4A76A 5I6YA 1L1OA 3TRZA 4MCPA 4KOWA 2Q2IA 2A68C 4OL7A 5GCNA 3A8JE 4HIDA 4OWXB 3HOUB 1TWAH 4OHJA 3WC5A 2KVMA 5AJ3L 3T90A 4AVCA 4YCWA 3D31A 3DR8A 1Q86C 1M1KC 5KNCA 5C6AA 2DY7A 3ZJYC 1K3RA 2FHTA 3CCSA 2FL4A 4ILWA 3RNUA 2FT0A 3D6CA 1YHAA 4ZYQA 4APVA 2E2HH 3T1HQ 4Q38A 2O4XA 5IWAQ 3PUWA 4KSIA 1JCKB 3CCLA 2FS5A 4B10A 5G3LD 1LM0A 4A3IB 1PTOF 1KUYA 1PH2A 3QNVA 3H5ZA 5H84A 4POFA 3I72A 3K5NA 1L2FA 5BN3A 3NBHB 5IYCH 1Q7LA 4B14A 1NR2A 1MK4A 2IX0A 3PIP3 5C4JH 5I9OA 3GTMH 1N32L 3NWTA 5F49A 5C88A 1I3QH 4OAEA 2DXQA 5AFWA 1BXTA 2EY6A 1QZGA 2RVLA 1V1OA 3RZOB 4KV6A 2HQYA 5EBDA 6CPAA 3TOBA 1TU2B 5K36H 3MXGA 3VR3A 4JXRA 1QVGA 5I6WA 1XF8A 2ZTEA 1G2SA 1NE3A 1HA6A 3CW2C 2LKVA 1UE1A 3DSBA 1XMOL 2PJ6A 4C3IB 4DUZL 1HUNA 4B3RL 1VQPA 4P74A 2K7VA 1HR0L 2F0TA 4R9WA 2B2TA 3VH9A 1QOHA 1VQ9A 3TE4A 2ZOGA 4A3EH 2EXZA 5FO7B 1STYA 3CCMA 2NVQH 4CS0B 2D9UA 1CHPD 4R4IA 3QAYA 3WR7A 2VZZA 4JI2L 3J80L 4CYNA 2ZTCA 1BOSA 3S9LA 3VR6A 3MXUA 4YIJA 4JI5L 3VR2A 4JZ0A 2ATWA 3SEBA 1X55A 2ZJPA 3PGPA 1TXYA 1PH9A 4OO1I 2EK9A 2OH1A 4YWLA 3VATA 3NTKA 5JJIA 4CDFC 3IJ3A 5HVFA 1T9HA 3PUYA 1EU3A 4K6DA 2UXDQ 1VKCA 5CV5A 2K5VA 2YU9B 1KAWA 4BBRG 1KRTA 1XX8A 4DV2Q 4Q7AA 4A3CH 4PSWA 2EYMA 3HOUH 1PYWD 3B2YA 4HMJA 1GOZA 1QB5D 2AQ1B 1Q2YA 5C3EB 3RZDH 2B4DB 2WPWA 2Q4VA 1SAPA 5KEEA 4KUBA 3PQIA 3S15H 2D62A 1YBYA 5EPKA 3A8IE 3MXNA 1XEBA 4X64L 1MHWC 2EOTA 4ZKBB 3R95A 2Z0ZA 1RODA 2Z6KA 1YW6A 4P73A 1Y9WA 1GUSA 1IBKQ 1PH4A 1NNXA 1YQEA 2K5NA 3EFXD 4MTKA 1E1TA 1P8LA 5C44H 1Q1EA 1LAMA 1G2TA 3I4NH 1KLUD 2CTCA 5M5WH 4IN3A 2R7ZB 2EY1A 2CH4A 5IP7G 5GAGC 3P2FA 4AH6A 1F9QA 1TS5A 1YHBA 2EDGA 1BCPC 3GP7A 1MJBA 1B3QA 4IUUA 1UEBA 3W3AA 4XYOA 4FUUA 1EEID 1XMTA 4M6IA 3I4MH 1ENCA 1VQLA 3PBEA 1WFQA 3ND8A 5DLQE 4P71A 3TP7A 4XNHC 4JI3L 3HOVG 3K80C 2EBJA 4H02A 2R7ZG 4NCZA 5AG5A 1RF2D 3I90A 1JICA 3DHQA 1O7YA 3CPAA 4NDXA 4KI0A 1EE3P 3SJFA 5ELDA 4RN7A 4UFVA 4MHNA 3KF6A 3RR5A 3WDNA 5E96A 2JA8G 4OWTB 2F0OA 3P7JA 4X3SA 1PMRA 4DAVA 2JA7G 1I4PA 1O7LA 1KIXA 2JN4A 2NMTA 2IT1A 2WAQB 3RLOA 2CNSA 3SDZA 1OTCA 4AVBA 4N8X1 4OX9Q 1J4JA 3CCQA 4UAIA 4DK6C 1KQSA 2ENBA 1YNNC 4B3TL 4RGTA 1EZ6A 5D3DA 1QZHA 4B13A 2CCZA 5A27A 1IYKA 2VL1A 4C3HB 2PJ9A 3EXNA 1XNRL 1WVLA 1JQGA 4PXBA 1SNPA 2V77A 4FO2A 3FEDA 1SMXA 1DOKA 3HOWB 3IC1A 4G1PA 4IOAA 3PFEA 1GVPA 2ZJQA 4LUVA 4HJ9A 3CC7A 5EGTA 1VQIA 1IKLA 2L12A 2VUMB 1Q2DA 4E8OA 3FXTA 3SI1A 1MJEA 4CAEA 3BJUA 2J4XA 3X3NA 3IRBA 4KKTA 4DR1L 3G8WA 1EWIA 4JI6Q 1KD1C 5GAHC 1VQBA 2X6GA 3LMSA 4U5YA 1PYBA 3KF6B 4HNYB 1PTOC 5CBAE 4K6LA 4UWJA 3J81E 1N34Q 2RHQB 3OIPA 2VEZA 4P10A 2SEBD 4FDBA 2E5LL 1ENAA 5G3LF 1TKJA 1QILA 4CJ2C 5LMNW 4DAPA 3KKWA 5J1ZA 4YY3L 4IUNA 4Q0FA 4XNHB 4AG9A 4KHVA 1YVKA 3MEHA 1WCMH 4X3TA 2KECA 1VQFA 4A93H 1H9SA 1ILPA 3J7YW 2RSNA 3DGVA 1BBUA 3LWUA 1ELMP 3M3YB 4QQBX 4A3JH 1HJPA 2EYJA 4A95A 4TWEA 1N36L 3E9HA 1H9KA 1SE8A 1L1OC 2GANA 2YNCA 2ARHA 3F2UA 2JA6G 1KDCA 3S6GA 1D1IA 4UY8C 3PB7X 2PNRC 3PUXA 1U0LA 3AYHB 1B9NA 1DJRD 2I5MX 4XPDB 4Y49B 1CZGA 3L3OC 2I5HA 2ANPA 2R7FA 2QA4A 3PIPA 1A15A 3NUCA 1D5MC 1K8AC 4JI3Q 5K5PA 2XEGA 5ELBA 1CM0A 2B63B 2NBFA 1LOKA 4NB3A 4DK0A 1BUVT 2R8VA 1XJVA 2NZHA 1IHZA 5CBMA 5JOBA 5LYDA 1B8AA 4X3RA 2AFMA 1BBWA 2I46A 3M7NA 2WB1B 3PF4A 1LFWA 4FXGC 2YV5A 2EYLA 1ASYA 4DR5L 2K52A 3W91A 1U6MA 3ONAB 1HNXL 1QSMA 4F7XA 3LWEA 4DFAA 3Q22A 1XTCD 4P44A 1E1OA 3D7FA 3QJYA 1KLGD 4U9ZA 4A37A 2YU9H 2ZEGA 1AZQA 2JYOA 1X32A 3WWVA 4OMEA 3D2MA 4GLXA 5GADC 4NPSA 5J3BA 1SROA 1WD1A 3S16H 4K5WA 2ZXVA 1Y1VB 2ICIA 3JRUA 3RN2A 1N33L 3GTJH 5I0CA 1S72A 1PTOD 3R2IA 3HG9A 2V4DA 4NFRA 3RLNA 5HH1A 5K8MA 4HJ8A 3I4MB 2GLFA 4P4JA 1XRYA 3PGZA 2JA7B 2I3CA 3CCJA 4OONA 2B2YA 1GJXA 3K5LA 4HJ5A 3F2BA 5M3FH 4BXXG 2R92B 1AW7A 4R8IA 4X8IA 1JJ2A 3GTKB 1H9SB 1IYLA 4HAEA 1Q46A 1SXTA 2L5TA 4DV0Q 2WV6D 1TY2A 2E8GA 1SQHA 2WSAA 3R1KA 2JBKA 1HA5A 1I6HB 4A38A 1ESFA 1PFMA 3C46A 2OQKA 2OU2A 4A30A 5CV4A 2JA7H 4IQZA 3IO1A 2XN9C 1I94Q 3K7AH 4UBRA 5M3MH 1I21A 4E2AA 4HNWB 3I8ZA 1SYDA 1SFOB 4H2KA 2IWHA 3DDDA 2VL6A 1ASZA 1WTRA 2R7ZH 4CPAA 1S4ZA 5M3MG 3S17B 1SE2A 1Z4RA 2GVAA 4MFZA 4LUZA 1XXGA 4A3FB 4R4OA 4RGOS 5IE8A 1HZCA 1TIQA 1QWYA 2HDLA 2JDDA 2O28A 4LK1C 5JM6A 1B3AA 1UWVA 5EAYA 4KVME 3FMCA 1SFOH 2PIZA 3CRLC 4DR7L 2ZW4A 4A3MB 2IY5B 2F4VL 3S1MH 5IT9L 2YYZA 3KF8A 5KGUA 2B5GB 2V8HA 3PB9X 1N71A 5C44G 1ZLIA 1TWHH 1BPNA 4CDDC 2HHHQ 4ZAIA 4DV4Q 1X3EA 2F0LA 3D8GA 1HNZL 2K5HA 4R4TA 5ELOA 2F0MA 4GNXB 3U50C 2AWNA 4BY7G 1R57A 1V1PA 2Z0SA 4ZUIA 1JMCA 1PZID 5IIFA 1X3FA 3H3VI 1E7ZA 2NZOA 1GUOA 1RO5A 2YNEA 2EY2A 1CG2A 1KDAA 1OZPA 2BEIA 3ZJ0A 5HVHA 1C7YA 3QO2A 1QCBD 2J0TD 3H0GB 2HD3A 1M1DA 2G3AA 4DNCA 1JE4A 1ZYRD 1AE3A 4A3CG 1YMEA 1WYDA 3BG3A 4KD4A 3X3MA 4G7ZC 4CAVA 2E2HB 4JBJA 4LQ6A 4GKKL 1EYAA 4MXUA 4II9A 4XQQA 4DV7Q 2PJ0A 1IIDA 5H86A 2F5IA 3DNSA 4KLKA 3S2HH 1ONLA 2PZUA 4A75A 1XPRA 4ULLA 4LAAA 4MIUA 4MY0A 1QE6A 4EX5A 1XMQQ 2IL4A 2Z3NA 2F0WA 3BI0A 4MTNA 3JUWA 1NMFA 4IOCA 2GE3A 2FIWA 2QCPX 2F0EA 4DNIA 4UDUC 3TZDA 4JV5L 1MJ9A 2B2TC 2NN6I 2HQEA 2B4BA 1GUGA 2A8VA 4UEZA 1J5EQ 3HKZB 2Z8LA 8CPAA 4A3JG 3FPUB 2J8MA 2YTXA 4FBEA 3TP6A 1BO0A 2Z3PA 1JOKA 3T4AC 2YTVA 4PG3A 2PJAA 5D3IB 2LXJA 4HKFA 4L63B 5GROA 1ENFA 1EY7A 1BKBA 4RS2A 3V2TA 4A3FH 2CW0C 2UXBL 3H09A 1AE2A 1FGBD 1E3PA 5EJWA 1G91A 3G48A 5K36G 2JLMA 3ULLA 4BWGB 4EFDA 3NENA 4IZ8A 4NGRA 4ORFA 1JR0D 1CKMA 1WOCA 2ZEHA 3C1EA 1K0SA 5C4ZA 1WTHA 2PJBA 3C3LA 1DZ1A 2JEBI 1XNQQ 2IJZA 4YRHA 2SDFA 4V190 2X6LA 4NXNQ 2NB0A 4E0AA 1UAPA 3CQZB 3SJEA 5IYCG 1PYTB 4F6AA 5IGDA 2N49A 1RTQA 4A3DB 3QG1A 2GLJA 4MHYA 3RN5A 4L8JA 2IQ6A 4P4IA 3GTKH 3I7FA 4JVZA 2CF4A 3KLWA 1LUZA 5CV9A 7CPAA 1BQQT 5EKKA 3VA7A 3D0FA 3VR4A 1TWGB 4MN3A 3J81L 3EY5A 2FMCA 2OEOA 3LX0A 1LTAD 5KNBA 1BCPF 3FEEA 2B2VC 2VB3X 4MHPA 1PU9A 4UCNA 1XE4A 1BOBA 1SYGA 4O2DA 2ATRA 4XIGS 4M6HA 3BZKA 3K7AB 1KC8C 2WAQE 5IGCA 4JI4L 3HOYB 2HHHL 4DA2A 3T8WA 2QKIC 1SN8A 2B2YC 4HIKA 1DGSA 2XRSD 2ZM6Q 5JJLA 5KTAA 4Y7NH 2EXDA 2PNHA 3PB8X 1WTPA 3NA6A 2B2UA 3K8AA 3HP3A 4GN3B 1TWCB 3S1NH 4PK2A 2EIFA 4O23A 3PO2B 4DUYQ 2Z9HA 2PMZE 4PZ8A 1CK1A 4C3IH 1K83H 5M3FB 5ELFA 2QVPA 1JT8A 4BBHA 4DR6Q 1HR0Q 4AG7A 4NMZA 2LY7A 5HXDA 3KBXA 1PH5A 1JQYD 3HOVH 2NVYB 5CR3A 3RD4A 3NBHA 3W6XA 2Z1CA 2A69C 1A2UA 5HY6A 4K0KQ 1LT6D 1AYEA 1FY7A 4DV6L 1A62A 1I94L 3GTGB 3K0YA 2OWOA 1CA6A 4GN4B 1NSAA 3CD6A 1TS2A 1V1QA 3S2DB 3NE7A 3R9FA 1XMQL 2CW0D 4F87A 3KHXA 2NVYH 3D4RA 4QB4A 4XPKA 1GHJA 3GV6A 1IW7C 2FFKB 1H9RA 3I4NG 5JEAG 4RHSA 1X12A 3T16A 4IFDG 4UFWA 2REEA 5D8NA 4LFBQ 5IYDH 1EIHA 2PZWA 1DD2A 4PV6A 2CVRA 1WTVA 3S1QH 3B7IA 3T1HL 4QUCA 4K2KA 2JA5G 3KLSA 4KD3A 3URYA 3GY9A 4MJ8A 5FOBB 1GUNA 2CY2A 4ZY2A 1ILQA 4JCVE 4JOIA 3TCVA 4KHPL 4C3JG 4TRDA 1YNJD 3LD2A 4NSQA 2AQ3B 4H6ZA 3AMUA 1YNND 4TKOB 4IJHA 5HMNA 2M9VA 4IUSA 4MFKA 1B9MA 1HFNA 3L0OA 4HSPA 4BY1G 4ALPA 2P5ZX 1EY6A 2CQAA 2K75A 3DMUA 1ZKOA 3PUVA 3B3TA 4CAWA 2KA7A 4YWYA 4DPGA 1Y1WB 4IF5A 3D3SA 3HOZB 4MCSA 4Z9CB 1E2ZA 4LF9L 4WJBA 3EROA 2LS01 3FKIG 1S40A 1VHEA 5D29A 2F0VA 3NH5A 4AXVA 5C4XB 1HHVA 2SNMA 1X3PA 2ZTDA 1JWMD 1GUWA 1EL0A 3KL9A 3S1NB 1TQOA 1FD7D 3KJPA 4A31A 2EVNA 5IX3A 3OMGA 4JI8L 4ZLTF 1P0HA 2C6PA 1G51A 5EC4A 5F48A 3WT4A 4M85A 3GTOB 3A74A 1KNEA 4X3KA 5JJZA 4A3EG 2F0KA 3TP8A 4CGMA 3SI0A 3ISXA 2ZEDA 4DV2L 2IPKD 5J8CA 4GKKQ 5J1QA 4DV7L 3TOAA 1PTOH 1KDBA 3ULJA 1BLLE 3NWSA 1V9PA 3BLNA 3SHLA 4EQNA 2X7BA 1YHQA 1RTOA 3PF5A 5FLXc 4IUPA 3T13A 1S7KA 2O2LD 5CYUA 1LAPA 3B8GA 4UP7A 4PXDA 4FD5A 1JWQA 3A5ZB 3S1QB 3NK9A 1TR5A 3LGJA 5J39A 3KQZA 1GUTA 3NTHA 2GU2A 5C0XI 2Q4YA 1I50H 1N33Q 4C3JH 5IB0A 1KZFA 1O7ZA 2MHVA 3KUPA 1B2TA 3ISZA 2AUJD 2SNSA 2G9HD 3H94A 1R4PB 3BJ7A 2RQXA 4JI2Q 3AEVA 3HFZB 4LF7L 2K6AA 5C4HA 4ZK9B 1SSOA 5JEAJ 4E6IA 4DNTB 3V05A 2PR1A 4IFDH 5JQ4A 3NXWA 3DR6A 2E75C 2F3WA 4PMBA 2PMZB 2F4IA 3I2ZA 4L8AA 1F2LA 4NP5A 3D4DA 4YCVA 4R8FA 3JAML 2BOSA 4KLWA 4ZQ3A 3ND9A 3L2PA 1DTDA 3JAMi 3D4WA 1MBYA 4R3KA 3BVGA 3HOXG 4HIMA 1XNRQ 1CA5A 4X65L 4KVOE 1AN8A 4KLVA 1WK4A 1W6JA 2L11A 4JW0A 3T56B 1SEBD 4GOPA 1PVOA 1FT7A 4ZX9A 4Q5VA 3BXMA 4CBVA 1QJOA 2D4OA 2AKWB 4C1NK 3DLLA 4HJAA 4JI7Q 3IGRA 3TDQA 2PO4A 4B12A 4LFAQ 2ZPAA 3SHPA 1CKNB 2PW7A 4IAVA 4KMUC 2TMPA 1P16A 1Z4EA 1CQVA 1PRTC 1RD9D 3V96A 4DNRB 1ARMA 1CSQA 3V7ZA 4KJOA 3VWEA 4OIDA 1LO5D 3EQLC 1LRZA 4P4FA 3CCRA 4Y49C 1I4XA 4KJNA 2HDMA 3SJXA 3UDGA 4NEXA 2Q8TA 4P6YA 2OZUA 2D4PA 2XEFA 4BD9A 2AFSA 2F0HA 2DUDA 1BPMA 4JYWA 2L55A 2K28A 5DEHA 3KGQA 4ONUA 3W6SA 1EQRA 5CORA 2QDBA 1M4LA 1IOFA 1K8GA 3PRTA 4IUTA 2XEIA 3CPFA 2V8GA 1V1PB 1ON0A 2FJ2A 1SJED 3Q8DA 3DM3A 1SR3A 3NPPA 1EWHA 4ID6A 2HUGA 2CNTA 3D7GA 1FNUA 1H9MA 3UE0A 3NQTA 1LTBD 1Q3LA 4A3MH 3STBC 2C35B 3J80E 4XQJA 3PB6X 5J8FA 2FXFA 2J7ZA 3S2HB 3I73A 3TQYA 4G7HC 2PJ4A 4GKJQ 3GD7A 1VHSA 1EZ8A 3LNNA 2UXCQ 2B2UC 2EY5A 3HKZE 1XPOA 2B3VA 5C44B 2F0GA 1CZWA 4FP5D 3HOYH 2MNAA 4IUVA 2KOLA 3D7DA 2JE6I 1EWCA 4KOSA 1K28A 5IODA 3KK7A 4PMCA 2JP1A 4CHTB 2HIXA 1BF4A 4TQUS 4X6AH 2JJQA 2KCTA 4A3FG 2HB6A 3S6FA 1Z6HA 2E2IH 2UXCL 5M5XB 4H13C 1GHKA 4DK1A 3U9OA 5KYIA 1X6OA 3RZOH 3IIBA 2XWBB 1T5XD 2Z4IA 3L7ZC 3R96A 3DWPA 1CKOA 3NP8A 3GTQB 4NGSA
chains in the Genus database with same CATH topology
2Y0SB 1FR3A 3IFEA 2RDGA 5EPJA 2WKDA 2LMCB 4CKBA 4EWTA 2RDHA 4KY7A 1DCZA 3VARA 4LMQD 3BDCA 3T53B 2BOAA 4GM5A 3RUZA 3HZXA 2K01A 4J8QA 1PFBA 1TKFA 4A39A 2K5WA 3B3CA 1K8OA 3VYUA 3GV3A 1TWAB 1VF5C 1MSHA 3E5SA 4O42A 1PFNA 4BBSB 4TSSA 1AZPA 2E2DC 1QMUA 1IKMA 2ZEMA 1CFMA 4ZRZA 2BCOA 4DJLA 5T1IA 3Q24A 4NGPA 4FXKC 1TWFB 3TMEA 2V8DA 5JPMC 4RHRA 4B6ZA 2POKA 3CRKC 1F2YA 1MSGA 2XSCA 3P20A 3GTMB 5FO8B 4F8ZA 4C3JB 2PJ5A 2ZEOA 1OXXK 4QIWB 3R93A 1LT5D 1R3NA 3S16B 3BYYB 2BE5D 2RSOA 1JOOA 4DUKA 1KAAA 2EPBA 5I2XA 3GB0A 5EKLA 1IGBA 3FDTA 3PUZA 4OIJA 3B3SA 4HEDA 3BI1A 2WP8J 3H6MA 2ZT9C 1CPXA 3K5MA 1ZLHA 3M4YA 1MGSA 2DY8A 5ISRA 4AYBB 2I07B 3M7GA 5HVGA 4LQGA 5M5YB 2OT2A 3A54A 1STHA 1PRTF 4A3KB 4S3SA 1D6EC 3S14B 3AU7A 3QOJA 4XT3B 1JC7A 2B2WA 2R61A 5LYLA 5K8NA 1V43A 1ET9A 1E2VA 5E3FA 4OC3A 1X3QA 1I3QB 4ZX8A 5C3XA 4EVOA 5COYA 1JOQA 4NW2A 1RTNA 2AUKA 2K1BA 3S1MB 3VYRA 1HDUA 1BDOA 1F9SA 1UEAB 2EYOA 3S15B 4RUHA 1Y0RA 2ZEFA 1F77A 2JEAI 3CPXA 1EQVA 1U4RA 4QCLA 4A3EB 4U673 1HQRD 1PLFA 5C5LA 4OO1H 3FECA 2MP1A 1O78A 5FK9C 4KN4C 4ODGA 2NUCA 1OBRA 4PPZA 3RZAA 1QNUA 4G4KA 2AWOA 2ZXPA 2L1BA 1CBXA 1F9PA 3FPPA 2OF1A 4P2CB 5D65A 1NSNS 3FH4A 1D5XC 3A7AB 1ICWA 1V8QA 1VDZA 2CTBA 2QYVA 4ZY1A 2NVTB 3TN2A 4I7ZC 1A3UA 4RGNA 4F9UA 2SOBA 3P1HA 5HURA 2A69D 4M8AA 4M1UB 3SJGA 4WWVA 1HTPA 5BN4A 2MGSA 2C5CA 3MTSA 2KCCA 1ZG9A 1FYCA 2VB2X 3SR1A 4OC4A 2K5DA 2PJ2A 3H8FA 3KLRA 5ELCA 5FLXL 5ELEA 2QF7A 1SMYD 1I4QA 2EYHA 1JB3A 3K9TA 4HCSA 5LYIA 3I1UA 3KZWA 1WTWA 5JH9A 2BA0A 3FEWX 4XTCS 3TX8A 1CX8A 3OHXC 1EFID 4BBRB 1HCZA 3N52A 4FF1A 1VGYA 1OXSC 3TP5A 3D4UA 4ZY0A 2NN6H 2XRQD 3NHHA 1F2PA 4PQAA 2K33A 2EE1A 5CBEE 1XWEA 5C3WA 1TWHB 4UEFA 2WINB 3SK5A 4DYOA 1GXDC 1ZG7A 1PCAA 4A93B 3PFOA 2PRQA 5FKAC 1WCMB 1Y7EA 2O4HA 2EWBA 4IHMA 1O80A 1JWUD 3L9AX 3CT9A 3FX6A 3N5FA 4IUQA 3B3WA 1HRJA 3GUXA 3DUZA 5A2QE 2DNCA 1LTRD 1GYTA 2EK8A 1QNKA 4DAYA 3R3OA 5CV6A 1XBUA 3CU7A 4WFN3 3TC8A 1ARLA 4FF2A 5IB9A 3MWYW 1B50A 3DEPA 3NBIA 4QF4A 4OC0A 2BDNA 1I50B 5F2DA 4FXDA 1B53A 4MCRA 1VIXA 5FLXE 1SMYC 2PJ7A 3AB9A 2Q43A 5M9OA 2ICEC 2F0NA 3IAYA 1LANA 5K8OA 5E4WC 2ABZA 3MFGA 2J9AA 3H8EA 4A3BB 2RB7A 1CHQD 1E0BA 1SNMA 2B8GA 4K3NA 1PXUA 3QOLA 2ZELA 4MMOA 3CHBD 3RBUA 1ML0D 4XDXA 2WYRA 4JK1C 2ID0A 5M3MB 2JSOA 3KLSX 4B9WA 2R93B 4FYDA 4DU9A 3E6ZX 2A5HA 2E2IB 3BVZA 4N9TA 4KK7A 1IYUA 3PMFA 3HOXB 1DE4C 4P4BA 3RLFA 5LRKA 4EMEA 4B08A 1R4QB 2EJGC 4A3JB 1F2OA 3KHZA 4EQOA 3S1RB 3SK4A 3SVMA 1AFPA 2AFWA 4PXEA 4ZUJA 1LTTD 4NGTA 3OWFA 4UIBA 5J22A 2N55A 5HGTA 1TIID 3CKIB 1XJOA 5EPLA 3OW7A 1HPCA 1S5FD 3KR4A 4DF7A 2L0CA 5CMDA 3VR5A 4NGNA 1R9TB 4CJ1B 3H3VC 4WJWA 4HMIA 1BCPB 1F57A 3HRZC 4HSVA 1LACA 5F09A 2NSMA 4OP4A 5LHY1 5CV8A 1STBA 1SYCA 4WORA 4ZYSA 2VNUD 4X3UA 1RCVD 1EYCA 2Q8IB 4XT1B 1RDPD 3D66A 2XVSA 5IGFA 1LTGD 2G9DA 1PRTB 4H7BA 3R8BA 3HUVA 4TNUA 3SK6A 5DM63 2PW5A 4BA1I 2NZ1D 1VMPA 5I4DA 1EY0A 4IFDJ 1Y0YA 2PCFB 1IL8A 3GO5A 1NAPA 4ONWA 1SDFA 2OR4A 2EYFA 3PV0A 1SBBB 2F8HA 2ZOFA 4EGVA 3A55A 3NTIA 4MHEA 3NH4A 4FAIA 4CKCA 4PV1C 2M2LA 3OMCA 3DWQA 4A94A 4NKLA 5KNDA 3WOEA 3K59A 4CGYB 3KI9A 2PZTA 2Q51A 3C2PA 1F2ZA 1Y8OB 5CC4A 5LL6X 4C1NI 5DAUA 3MHBA 3Q23A 5TSSA 1SNOA 4K8IA 2N88A 3TSSA 3EVQA 2PVWA 2NVXB 1W6KA 2MUYA 1U4PA 3GTPB 1AEXA 1TKHA 2PE3A 4IURA 2A6HD 1TXRA 1MI2A 1D5ZC 1SYBA 2K32A 2HCCA 2IL8A 3I4NB 1UWYA 3EJIA 4NJQA 2KEDA 1ZEQX 3OOCA 2B2WC 1II3A 2CIJA 1SE3A 5C4JB 1J8IA 3D68A 1B44D 2PCUA 1IYVA 2F0IA 4KTAA 5C0XJ 4R6TA 4K5VA 4K8JA 3UI2A 2PIYA 4O1NA 5JPNC 1YW4A 4FF3A 1A3TA 2FINB 1UUPA 2NYZD 1XYIA 5C0XH 1TY0A 4BY1B 3R2TA 4HCEA 3BHXA 5KRUA 2LFNA 5IGGA 1CM9A 1Y8PB 2QILA 2RDFA 1SE4A 5CPAA 4DXFA 3RAMA 4FNFA 2D2CC 1KWMA 3FF3A 1Z47A 3SK8A 4RFBA 3J7AV 3Q0AA 1ZXTA 3BDOA 3D7HA 1LV9A 1OXTA 1HEEA 1ESRA 2F0JA 3SXHA 4B9XA 1UNSA 4RGMA 5M5WB 3QIAA 2F0UA 2A73B 3WABA 2KJXA 3DEOA 4XYQA 3VA5A 5C5MA 2XIWA 1LLRD 1PDQA 1G6ZA 2QEJC 3HEJA 3MA2B 1EU4A 5KIXA 3SE0A 1TF9A 1LT3D 4P4EA 2F0FA 1SYEA 5FO9B 1Q90A 1S5CD 2K04A 1KABA 1STEA 4EQPA 2F0SA 1SYFA 4ZKCB 3HS0C 2RKSA 2DN8A 3QB3A 3ITPA 3RMHA 1EOTA 3OPOA 2JA5B 1SJHD 2XNAC 4OC2A 3TBIB 3M85A 2F0DA 2MPMA 2FVGA 1I4GA 2L9HA 3V38A 1HXYD 2Q8RE 3NSWA 2F1MA 2XEJA 3PB4X 2IX3A 2L4NA 1S5BD 4LJZC 2KUMA 2AFOA 1DONA 2MJ8A 3S9MA 2AFXA 4FWUA 3BYTB 1EY8A 2PJ8A 5I9PA 1NCVA 4DGZA 2BA1A 5I2YA 3KBGA 2IW3A 3NE5B 1MD2D 2PYKA 4RCNA 2Q4ZA 3CDXA 3KASA 2E76C 3DM1A 2F03A 4KHZA 1RHPA 2B2VA 2KCNA 1M4VA 1Q8IA 1HTLD 1TF8A 1U4LA 5BN5A 2HC9A 3O13A 4KY5A 1PRTD 5D14A 4IALA 4OO1G 5JVG3 1YLOA 1QG7A 1STGA 3A7LA 3IL8A 4C2MB 5A2QL 2V8VA 3IWWA 3SI2A 1BCPD 3K58A 1EY5A 1SNCA 2KQ3A 1WTOA 4WRDA 3WC7A 4UF4A 1SNDA 2WZNA 2PPBC 4Y7NB 2QJ8A 1YNJC 5IGBA 4XQNA 3Q6SA 1WTXA 1Z7TA 2F3VA 2NYQA 4F88A 3FJUA 2F0PA 3I3CA 1L0XB 1EEFD 1F9RA 4RKBA 2VXWA 2RFHA 1C4QA 4G57A 2A6ED 5DNFA 3K6OA 3BVMA 4ME5A 1Z5RA 1Q1BA 1LABA 2OXPA 3MRUA 1I4RA 4U68A 4RAUC 3QWNA 4OGQC 1HDQA 2AFZA 2H1EA 2C6GA 5IGEA 4KKSA 1OXVA 1PZJD 3J7AF 1JORA 2BDOA 1OO9B 3JAME 4OC5A 3MXPA 3B35A 1M8AA 1B1ZA 3D67A 4J6HA 1WD0A 3DLJA 2NN6G 2E2JB 3C1FA 4RA8A 2NTTA 3EA6A 1R43A 2PJ3A 3H8GA 1JWSD 2A6HC 4V0BA 3BDLA 1XFOA 4P4DA 1CP6A 1STAA 2R6GA 4F9VA 4JBWA 1Z8LA 4MRIA 5JGFA 5IOCA 3E0JA 3GTJB 1LTID 3N6RA 2F7VA 1U4MA 1VHOA 1AP0A 2JA6B 2KEEA 3K57A 1C8CA 2E74C 1EY9A 4N9PA 2A6EC 1AMPA 5CGKA 3I91A 1EQTA 4IK2A 1ZG8A 3BZDB 4XXEA 4FVMA 5DS0A 3FKIB 1KNAA 4FF4A 2ZEPA 4MHZA 2O53A 1G291 3D3RA 3MC0B 4KY6A 3VYTA 4CKEA 2DNEA 1WTQA 2NTSA 4K14A 2B39A 3A8KE 2FMMA 3GQBA 5DM73 2EVBA 4ABNA 3IFTA 2R3ZA 4DXGA 3ZYYX 4OKOA 2IMOA 1PTOB 4PXCA 3FRPB 2C1CA 1IY7A 4K5XA 4G7OC 2WKCA 2NWGA 3WOFA 4RH6A 4QMGA 1QQ9A 2EZVA 5IT9E 2RA4A 4R76A 4Z65A 4IFDI 1TS3A 3TZUA 3PO3B 4NGMA 1DM0B 3IEHA 5LL6S 4H0LC 5THWA 4A3GB 1A2TA 2JXMB 4H44C 1H9JA 4DN4M 1CP7A 4UEEA 3DXJC 4R7MA 1EY4A 3HLPA 3NQIA 5KYLA 4J1MA 1C48A 4C3HG 3KQXA 5JAVA 5NUCA 1EIGA 3K5OA 1U9RA 2RBMA 3MZ5A 2NVQB 1KTKA 1D2BA 3W2DA 1Z2LA 3FVLA 4YU9A 3HGBA 5CV7A 3B3VA 2OOTA 1CTMA 1ZYRC 1DXMA 2B8FA 1L0YB 3I4LA 2ZXOA 1J9OA 2X69A 4KN7C 3T51B 2WACA 1CQFA 1VF7A 1ELLP 1STNA 3H91A 3OWEB 4HTHA 2JA8B 2ZENA 2O5JC 2AFUA 1NR4A 2BO9A 4R8NA 3MN8A 2D5DA 1CT1D 4ZI6A 3HOVB 2O5IC 2K05A 4HR7B 1YSJA 4CJ0B 1TKWB 4BA2I 1S5DD 1TT2A 3S9WA 4MCQA 1H8LA 5EBCA 2GA4B 2IJ0A 3U9SA 1IW7D 1B4OA 1DOLA 1Y8NB 2PQEA 4OIWA 3FVQA 3NFZA 2C9OA 1RJTA 2ZXRA 1RKNA 4OC1A 1LT4D 4I65A 3IKJA 1HFGA 1K83B 5E4XA 3GLJA 1HQMC 1G8ZD 1TVXA 1BBXC 1I4HA 5C0XG 5ELYA 3OSOA 4RKLA 2DEAA 5LRGA 1PZKD 2EJMA 1BAVA 3WC6A 2C6CA 2EJFC 4P45A 1EYDA 2H4OA 3L2NA 1SNQA 1E2WA 1NUCA 1Q12A 1XMBA 2IX1A 3PIO3 3G7LA 4KKUA 3BS1A 2A68D 3RZDB 2KHSA 1Y69U 2F0QA 2PJ1A 5LYFA 2XWJB 4NGQA 4GZYC 4PMWA 4C56C 2JEWA 1FNVA 1S5ED 3S9NA 4BY7B 3MAQA 2PVVA 2M00A 1A3VA 2BE5C 2EYPA 4RWSC 4F8MA 5A35A 2CHBD 2HCIA 1CI3M 1CPSA 2ZEEA 5T1GA 4RCOA 5JVH3 3NH8A 3A56A 2K5QA 3IFDA 4PQXA 2A74C 3I70A 1DOMA 3PEIA 2TSSA 4BS9A 1LCPA 1TS4A 3MFYA 4UIAA 4QUFA 2AQ2B 1LTSD 4HN7A 3D6WA 3DWAA 5JEAH 1FNOA 1K8MA 3K2KA 1FNWA 4L6TB 3ERQA 5EKIA 5LRJA 2JBJA 5I4MA 2PJCA 1OXUA 3M4OB 4K2LA 2Z4HA 1D1KA 4PNYA 2K03A 1BNZA 1A6XA 2WIIB 3G6JB 3KR5A 3OIQA 5EQ0A 2GREA 1HUMA 4NJRA 4W9YA 5K8PA 1I6VC 5E1FA 1DYQA 4C3IG 3PBBA 1T5EA 3VYSA 3MVVA 1VMCA 1VCIA 4X2TA 3GTLB 1F2MA 1BR9A 1ET6A 3P75A 4OIKA 5I6YA 4MCPA 2A68C 4OL7A 3A8JE 3HOUB 4OHJA 3WC5A 2KVMA 3D31A 5KNCA 5C6AA 2DY7A 2FHTA 4ILWA 3D6CA 4ZYQA 2O4XA 3PUWA 4KSIA 1JCKB 5G3LD 4A3IB 1PTOF 3QNVA 3K5NA 3I72A 5BN3A 1Q7LA 1NR2A 2IX0A 3PIP3 5I9OA 3NWTA 5AFWA 1BXTA 2EY6A 2RVLA 1V1OA 3RZOB 4KV6A 5EBDA 6CPAA 1TU2B 5K36H 3MXGA 3VR3A 5I6WA 1G2SA 1HA6A 2LKVA 2PJ6A 4C3IB 1HUNA 2K7VA 2F0TA 4R9WA 2B2TA 3VH9A 1QOHA 2ZOGA 2EXZA 5FO7B 1STYA 2D9UA 1CHPD 3J80L 1BOSA 3S9LA 3VR6A 3MXUA 4YIJA 3VR2A 4JZ0A 3SEBA 4OO1I 2EK9A 3VATA 3NTKA 3IJ3A 5HVFA 3PUYA 1EU3A 4K6DA 5CV5A 2YU9B 1XX8A 4Q7AA 2EYMA 1PYWD 3B2YA 4HMJA 1GOZA 1QB5D 2AQ1B 5C3EB 1SAPA 5KEEA 2D62A 5EPKA 3A8IE 3MXNA 2EOTA 4ZKBB 1RODA 1YW6A 1GUSA 3EFXD 1Q1EA 1LAMA 1G2TA 1KLUD 2CTCA 4IN3A 2R7ZB 2EY1A 1F9QA 1TS5A 2EDGA 3GP7A 1BCPC 4IUUA 3W3AA 4XYOA 4FUUA 1EEID 1ENCA 3PBEA 3ND8A 3TP7A 1RF2D 3I90A 1JICA 3DHQA 1O7YA 3CPAA 4NDXA 4KI0A 1EE3P 3SJFA 5ELDA 4MHNA 3WDNA 2F0OA 3P7JA 4X3SA 1PMRA 4DAVA 1I4PA 1O7LA 2IT1A 2WAQB 3SDZA 4UAIA 2ENBA 1YNNC 4RGTA 1EZ6A 5D3DA 2VL1A 4C3HB 2PJ9A 1JQGA 1WVLA 4PXBA 1SNPA 2V77A 4FO2A 3FEDA 1DOKA 3HOWB 3IC1A 4G1PA 3PFEA 5EGTA 2L12A 1IKLA 2VUMB 3SI1A 2J4XA 3X3NA 4KKTA 2X6GA 3LMSA 1PTOC 5CBAE 4K6LA 3J81E 3OIPA 4P10A 2SEBD 1ENAA 5G3LF 1TKJA 1QILA 4CJ2C 4DAPA 5J1ZA 4IUNA 4Q0FA 4KHVA 3MEHA 4X3TA 2KECA 1H9SA 1ILPA 3J7YW 2RSNA 3DGVA 3LWUA 1ELMP 3M3YB 2EYJA 4TWEA 1H9KA 3F2UA 1KDCA 1D1IA 3PB7X 2PNRC 3PUXA 1B9NA 1DJRD 1CZGA 3L3OC 2ANPA 1A15A 3NUCA 1D5MC 2XEGA 5K5PA 5ELBA 2B63B 2NBFA 1LOKA 4DK0A 1BUVT 1IHZA 5CBMA 5JOBA 5LYDA 4X3RA 2AFMA 2I46A 3M7NA 2WB1B 1LFWA 4FXGC 2EYLA 3ONAB 4F7XA 3LWEA 4DFAA 3Q22A 1XTCD 4P44A 3D7FA 3QJYA 1KLGD 4A37A 2ZEGA 1AZQA 2JYOA 1X32A 4OMEA 1WD1A 4K5WA 1Y1VB 2ICIA 3JRUA 1PTOD 3R2IA 3HG9A 2V4DA 4NFRA 5K8MA 4P4JA 3I4MB 2GLFA 1XRYA 2JA7B 2I3CA 2B2YA 1GJXA 3K5LA 2R92B 1AW7A 4R8IA 4X8IA 3GTKB 1H9SB 4HAEA 1SXTA 2L5TA 2WV6D 1TY2A 2JBKA 1HA5A 1I6HB 4A38A 1ESFA 1PFMA 3C46A 5CV4A 3IO1A 4IQZA 2XN9C 3I8ZA 1SYDA 1SFOB 4H2KA 2IWHA 1WTRA 4CPAA 1S4ZA 3S17B 1SE2A 1XXGA 4A3FB 4RGOS 1QWYA 2HDLA 4LK1C 5JM6A 1B3AA 3FMCA 2PIZA 3CRLC 4A3MB 5IT9L 2YYZA 3KF8A 5KGUA 2V8HA 3PB9X 1ZLIA 1BPNA 4ZAIA 3D8GA 2F0LA 2F0MA 2AWNA 1V1PA 4ZUIA 1PZID 5IIFA 1GUOA 2EY2A 1CG2A 1KDAA 5HVHA 3QO2A 1QCBD 2J0TD 3H0GB 1JE4A 1ZYRD 1YMEA 3BG3A 4KD4A 3X3MA 4G7ZC 2E2HB 1EYAA 4MXUA 4XQQA 2PJ0A 1ONLA 2PZUA 4ULLA 4LAAA 4MIUA 1QE6A 2F0WA 3BI0A 2QCPX 2F0EA 4UDUC 3TZDA 2B2TC 2NN6I 2HQEA 4UEZA 1GUGA 3HKZB 2Z8LA 8CPAA 3FPUB 4FBEA 3TP6A 1BO0A 1JOKA 3T4AC 2PJAA 5D3IB 4L63B 1ENFA 1EY7A 3V2TA 2CW0C 3H09A 1FGBD 1G91A 5EJWA 5K36G 4BWGB 4EFDA 4IZ8A 4NGRA 1JR0D 2ZEHA 3C1EA 5C4ZA 2PJBA 3C3LA 1DZ1A 2JEBI 2IJZA 2SDFA 4V190 2X6LA 2NB0A 1UAPA 3CQZB 3SJEA 1PYTB 5IGDA 1RTQA 4A3DB 3QG1A 2GLJA 4MHYA 4L8JA 2IQ6A 4P4IA 2CF4A 5CV9A 7CPAA 1BQQT 5EKKA 3VA7A 3VR4A 1TWGB 4MN3A 3J81L 2FMCA 2OEOA 3LX0A 1LTAD 5KNBA 1BCPF 3FEEA 2B2VC 2VB3X 4MHPA 1SYGA 4XIGS 3K7AB 5IGCA 3HOYB 4DA2A 3T8WA 2QKIC 2B2YC 2XRSD 3PB8X 1WTPA 3NA6A 2B2UA 3HP3A 1TWCB 4O23A 3PO2B 1CK1A 5M3FB 5ELFA 2QVPA 4NMZA 2LY7A 5HXDA 3KBXA 1JQYD 2NVYB 5CR3A 3RD4A 3NBHA 2Z1CA 2A69C 1A2UA 1LT6D 1AYEA 3GTGB 3K0YA 1CA6A 1NSAA 1TS2A 3S2DB 2CW0D 4F87A 3KHXA 4QB4A 3D4RA 1GHJA 3GV6A 1IW7C 2FFKB 1H9RA 5JEAG 4RHSA 3T16A 4IFDG 5D8NA 1EIHA 2PZWA 1DD2A 2CVRA 1WTVA 3B7IA 4QUCA 4K2KA 3KLSA 4KD3A 3URYA 5FOBB 1GUNA 4ZY2A 1ILQA 4C3JG 4TRDA 1YNJD 2AQ3B 3AMUA 1YNND 4TKOB 2M9VA 1B9MA 1HFNA 4HSPA 1EY6A 2CQAA 3DMUA 1ZKOA 3PUVA 3B3TA 2KA7A 4YWYA 1Y1WB 3HOZB 4MCSA 4Z9CB 1E2ZA 4WJBA 3EROA 2LS01 1VHEA 5D29A 2F0VA 3NH5A 4AXVA 5C4XB 1HHVA 2SNMA 1X3PA 1JWMD 1GUWA 1EL0A 3KL9A 3S1NB 1TQOA 1FD7D 3OMGA 4ZLTF 2C6PA 3WT4A 3GTOB 4X3KA 1KNEA 5JJZA 2F0KA 3TP8A 3SI0A 3ISXA 2ZEDA 2IPKD 5J1QA 1PTOH 1KDBA 1BLLE 3NWSA 3SHLA 4EQNA 1RTOA 4IUPA 3T13A 2O2LD 5CYUA 1LAPA 4PXDA 3S1QB 3NK9A 1TR5A 5J39A 3KQZA 1GUTA 3NTHA 2GU2A 5C0XI 1O7ZA 2MHVA 3KUPA 1B2TA 3ISZA 2AUJD 2SNSA 2G9HD 3H94A 1R4PB 2RQXA 2K6AA 5C4HA 4ZK9B 1SSOA 5JEAJ 4E6IA 4DNTB 3V05A 4IFDH 3NXWA 2E75C 2F3WA 4PMBA 2PMZB 2F4IA 1F2LA 4NP5A 3D4DA 4R8FA 3JAML 2BOSA 4ZQ3A 3ND9A 1DTDA 3D4WA 1MBYA 3BVGA 1CA5A 1AN8A 1W6JA 2L11A 3T56B 1SEBD 1FT7A 4ZX9A 4Q5VA 3BXMA 4CBVA 1QJOA 4C1NK 3TDQA 2PO4A 2PW7A 4IAVA 4KMUC 2TMPA 1CQVA 1PRTC 1RD9D 3V96A 4DNRB 1ARMA 3V7ZA 4KJOA 4OIDA 1LO5D 3EQLC 4P4FA 1I4XA 4KJNA 2HDMA 3SJXA 2Q8TA 4P6YA 2XEFA 4BD9A 2AFSA 2F0HA 4JYWA 1BPMA 2L55A 2K28A 5DEHA 3KGQA 5CORA 2QDBA 1M4LA 3PRTA 4IUTA 2XEIA 2V8GA 1V1PB 2FJ2A 1SJED 3NPPA 1EWHA 2HUGA 4ID6A 3D7GA 1FNUA 1H9MA 1LTBD 3NQTA 1Q3LA 3J80E 4XQJA 3PB6X 2J7ZA 3S2HB 3I73A 4G7HC 2PJ4A 3GD7A 1EZ8A 3LNNA 2B2UC 2EY5A 5C44B 2F0GA 1CZWA 4FP5D 4IUVA 2KOLA 3D7DA 2JE6I 1EWCA 5IODA 3KK7A 4PMCA 2JP1A 4CHTB 1BF4A 4TQUS 2HB6A 1Z6HA 5M5XB 4H13C 1GHKA 4DK1A 3U9OA 5KYIA 3IIBA 2XWBB 1T5XD 2Z4IA 3L7ZC 3DWPA 3NP8A 3GTQB 4NGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FR3 A;  2O5J C;  2AFU A;  2Q51 A;  3IFE A;  4X8I A;  1H9S B;  2BO9 A;  1Y8O B;  3MN8 A;  2D5D A;  4ZI6 A;  2L5T A;  2LMC B;  4EWT A;  2O5I C;  2JBK A;  1DCZ A;  4HR7 B;  3VAR A;  1YSJ A;  4A38 A;  1TKW B;  4BA2 I;  3T53 B;  3IO1 A;  4IQZ A;  2BOA A;  4GM5 A;  2PVW A;  4MCQ A;  1H8L A;  3U9S A;  1IW7 D;  1TKH A;  1TKF A;  4H2K A;  4A39 A;  1Y8N B;  3B3C A;  2PE3 A;  1K8O A;  4OIW A;  2A6H D;  1VF5 C;  1TXR A;  3NFZ A;  4CPA A;  2K32 A;  1UWY A;  4OC1 A;  4NJQ A;  3IKJ A;  3OOC A;  2CIJ A;  1QMU A;  3GLJ A;  1HQM C;  4LK1 C;  5JM6 A;  2ZEM A;  1CFM A;  2BCO A;  3D68 A;  4DJL A;  3FMC A;  2PCU A;  2PIZ A;  1IYV A;  3CRL C;  4NGP A;  5C0X G;  5ELY A;  4R6T A;  2V8D A;  2DEA A;  4B6Z A;  2YYZ A;  2POK A;  2V8H A;  5LRG A;  3CRK C;  2EJM A;  3PB9 X;  1BAV A;  1ZLI A;  1BPN A;  2C6C A;  3WC6 A;  3P20 A;  2PIY A;  2EJF C;  4P45 A;  1YW4 A;  4F8Z A;  2PJ5 A;  2ZEO A;  1OXX K;  3L2N A;  5C0X H;  1E2W A;  1Q12 A;  1R3N A;  1XMB A;  2BE5 D;  3BHX A;  4DUK A;  4KKU A;  1Y8P B;  2A68 D;  1GUO A;  1Y69 U;  2PJ1 A;  1CG2 A;  3GB0 A;  5HVH A;  5LYF A;  5CPA A;  3RAM A;  4NGQ A;  1IGB A;  4GZY C;  2D2C C;  2JEW A;  1KWM A;  3PUZ A;  3B3S A;  3FF3 A;  3S9N A;  3BI1 A;  2ZT9 C;  1CPX A;  1YME A;  2PVV A;  3BG3 A;  1ZLH A;  4G7Z C;  3M4Y A;  3BDO A;  3D7H A;  2BE5 C;  4MXU A;  1OXT A;  1HEE A;  5A35 A;  1CI3 M;  2PJ0 A;  1CPS A;  2ZEE A;  5HVG A;  4LQG A;  1ONL A;  3NH8 A;  3QIA A;  3BI0 A;  3WAB A;  3PEI A;  1LCP A;  3MFY A;  4UIA A;  3SE0 A;  2NN6 I;  4UEZ A;  1GUG A;  1TF9 A;  4P4E A;  1Q90 A;  5JEA H;  1FNO A;  8CPA A;  5LYL A;  5K8N A;  1V43 A;  4FBE A;  1E2V A;  1K8M A;  3K2K A;  2PJA A;  4OC3 A;  4ZX8 A;  5LRJ A;  2JBJ A;  5I4M A;  2DN8 A;  2CW0 C;  2PJC A;  1OXU A;  2AUK A;  3OPO A;  5K36 G;  1HDU A;  1BDO A;  4EFD A;  4OC2 A;  4NGR A;  3M85 A;  2FVG A;  1A6X A;  2ZEH A;  4RUH A;  1Y0R A;  2ZEF A;  3V38 A;  3PB4 X;  2XEJ A;  2F1M A;  2PJB A;  3KR5 A;  2JEB I;  2JEA I;  3CPX A;  2GRE A;  2IJZ A;  4NJR A;  4W9Y A;  4LJZ C;  5K8P A;  1I6V C;  3SJE A;  3PBB A;  2AFO A;  3S9M A;  1T5E A;  2AFX A;  4OO1 H;  1PYT B;  1RTQ A;  3FEC A;  4FWU A;  2PJ8 A;  4MHY A;  3QG1 A;  2GLJ A;  1O78 A;  1VCI A;  4L8J A;  2IQ6 A;  4P4I A;  4X2T A;  2CF4 A;  2BA1 A;  4KN4 C;  7CPA A;  3VA7 A;  3VR4 A;  1OBR A;  4PPZ A;  3RZA A;  3NE5 B;  4MCP A;  2AWO A;  2A68 C;  3A8J E;  5KNB A;  3WC5 A;  1CBX A;  3FEE A;  4RCN A;  2Q4Z A;  3CDX A;  3KAS A;  4MHP A;  3FPP A;  2E76 C;  3D31 A;  4XIG S;  5KNC A;  4KHZ A;  3FH4 A;  3A7A B;  1VDZ A;  1V8Q A;  2CTB A;  2QYV A;  4ZY1 A;  1TF8 A;  5BN5 A;  4I7Z C;  3T8W A;  4ZYQ A;  2HC9 A;  4F9U A;  3PUW A;  4KSI A;  3PB8 X;  2A69 D;  3NA6 A;  3QNV A;  4OO1 G;  3SJG A;  4O23 A;  3I72 A;  4WWV A;  1HTP A;  5BN3 A;  5BN4 A;  1Q7L A;  1YLO A;  2KCC A;  2QVP A;  1ZG9 A;  3A7L A;  1FYC A;  5HXD A;  2V8V A;  3IWW A;  4OC4 A;  3SI2 A;  2PJ2 A;  6CPA A;  3H8F A;  1TU2 B;  3KLR A;  5K36 H;  2A69 C;  2QF7 A;  3VR3 A;  3K9T A;  5LYI A;  3I1U A;  1AYE A;  3KZW A;  3WC7 A;  2PJ6 A;  5JH9 A;  1NSA A;  4UF4 A;  2BA0 A;  4XTC S;  2K7V A;  3TX8 A;  2WZN A;  1CX8 A;  3VH9 A;  2PPB C;  2ZOG A;  1YNJ C;  3KHX A;  3D4R A;  1GHJ A;  1IW7 C;  4NGS A;  1H9R A;  5JEA G;  1Z7T A;  4IFD G;  2NYQ A;  3FJU A;  5D8N A;  1DD2 A;  3B7I A;  1HCZ A;  3S9L A;  3VR6 A;  3MXU A;  1VGY A;  3VR2 A;  4JZ0 A;  2RFH A;  1OXS C;  1GUN A;  3D4U A;  4ZY0 A;  2NN6 H;  1F2P A;  4PQA A;  2A6E D;  2K33 A;  4ZY2 A;  2EK9 A;  1Z5R A;  1Q1B A;  1LAB A;  3VAT A;  3IJ3 A;  5HVF A;  3MRU A;  3PUY A;  4UEF A;  4DYO A;  4TKO B;  4OGQ C;  1ZG7 A;  1HDQ A;  1PCA A;  3PFO A;  2PRQ A;  2AFZ A;  1B9M A;  1Y7E A;  2C6G A;  2O4H A;  2EWB A;  4KKS A;  1OXV A;  4IHM A;  4Q7A A;  2BDO A;  1ZKO A;  3B2Y A;  3PUV A;  3B3T A;  2KA7 A;  4YWY A;  3CT9 A;  3FX6 A;  3N5F A;  4OC5 A;  3B3W A;  3B35 A;  4MCS A;  1E2Z A;  4WJB A;  1VHE A;  3GUX A;  5D29 A;  3NH5 A;  3D67 A;  4AXV A;  2DNC A;  1GYT A;  2D62 A;  3A8I E;  2EK8 A;  3DLJ A;  2NN6 G;  3KL9 A;  1YW6 A;  1GUS A;  1XBU A;  3TC8 A;  1ARL A;  2C6P A;  1R43 A;  2PJ3 A;  3H8G A;  3WT4 A;  1Q1E A;  1LAM A;  5IB9 A;  2CTC A;  2A6H C;  3SI0 A;  3ISX A;  2ZED A;  4OC0 A;  5J1Q A;  2EDG A;  4MCR A;  1XFO A;  4P4D A;  1CP6 A;  1VIX A;  2R6G A;  3W3A A;  1SMY C;  2PJ7 A;  4FUU A;  3AB9 A;  2Q43 A;  3PBE A;  3ND8 A;  4JBW A;  1BLL E;  1Z8L A;  4F9V A;  4MRI A;  1LAN A;  5JGF A;  5K8O A;  2ABZ A;  2J9A A;  3H8E A;  3CPA A;  3N6R A;  2F7V A;  4KI0 A;  1EE3 P;  1VHO A;  2RB7 A;  3SJF A;  4MHN A;  2E74 C;  3WDN A;  2B8G A;  1LAP A;  4K3N A;  4PXD A;  2A6E C;  1AMP A;  1PMR A;  2ZEL A;  4MMO A;  3RBU A;  1O7L A;  3KQZ A;  1GUT A;  2IT1 A;  2GU2 A;  4IK2 A;  3SDZ A;  1ZG8 A;  3ISZ A;  2WYR A;  4JK1 C;  2AUJ D;  1YNN C;  5DS0 A;  3H94 A;  2VL1 A;  2ZEP A;  4MHZ A;  2PJ9 A;  1JQG A;  2O53 A;  4PXB A;  1G29 1;  4DNT B;  2V77 A;  4IFD H;  3FED A;  3IC1 A;  4G1P A;  3PFE A;  2E75 C;  2DNE A;  4R8F A;  3A8K E;  3GQB A;  3SI1 A;  3ND9 A;  1DTD A;  1IYU A;  4P4B A;  1DE4 C;  5LRK A;  3RLF A;  4EME A;  4KKT A;  2EJG C;  2EVB A;  1F2O A;  3T56 B;  1FT7 A;  4ZX9 A;  3KHZ A;  2AFW A;  3BXM A;  4PXE A;  3LMS A;  1QJO A;  3IFT A;  4NGT A;  4UIB A;  4OKO A;  2IMO A;  4PXC A;  4P10 A;  4IAV A;  2C1C A;  4KMU C;  1IY7 A;  1TKJ A;  4G7O C;  1ARM A;  4DNR B;  1XJO A;  3V7Z A;  3OW7 A;  1HPC A;  3KR4 A;  3EQL C;  4OID A;  4P4F A;  1QQ9 A;  3SJX A;  3VR5 A;  4P6Y A;  2XEF A;  1H9S A;  4NGN A;  4BD9 A;  2AFS A;  4R76 A;  3DGV A;  4JYW A;  1BPM A;  4Z65 A;  3LWU A;  3KGQ A;  1ELM P;  3TZU A;  1F57 A;  1M4L A;  4NGM A;  3IEH A;  4TWE A;  1LAC A;  1H9K A;  2NSM A;  3PRT A;  4H0L C;  2XEI A;  4OP4 A;  5THW A;  5F09 A;  2V8G A;  2JXM B;  3PB7 X;  1EWH A;  4H44 C;  2Q8I B;  1H9J A;  2PNR C;  3PUX A;  3D7G A;  1CP7 A;  1B9N A;  1H9M A;  3D66 A;  4UEE A;  2G9D A;  2ANP A;  3DXJ C;  4R7M A;  3PB6 X;  2XEG A;  3HUV A;  3HLP A;  1LOK A;  4DK0 A;  4TNU A;  3I73 A;  4G7H C;  2PJ4 A;  5CBM A;  3GD7 A;  4BA1 I;  3LNN A;  5LYD A;  3KQX A;  4X3R A;  2AFM A;  3M7N A;  1LFW A;  1Y0Y A;  2PCF B;  3D7D A;  4ONW A;  2JE6 I;  1Z2L A;  2OR4 A;  3FVL A;  3PV0 A;  4YU9 A;  4P44 A;  3HGB A;  4TQU S;  3QJY A;  2F8H A;  2ZOF A;  3D7F A;  4A37 A;  2ZEG A;  2HB6 A;  1Z6H A;  3B3V A;  4H13 C;  3NH4 A;  4OME A;  2OOT A;  1CTM A;  1ZYR C;  1DXM A;  2B8F A;  4FAI A;  1GHK A;  4PV1 C;  3I4L A;  3JRU A;  4DK1 A;  3IIB A;  4KN7 C;  4A94 A;  3T51 B;  2V4D A;  4NFR A;  5KND A;  1VF7 A;  3L7Z C;  5K8M A;  4P4J A;  1ELL P;  2GLF A;  1XRY A;  2I3C A;  2QJ8 A;  3KI9 A;  1GJX A;  2ZEN A; 
#chains in the Genus database with same CATH topology
 3HOZ H;  2Y0S B;  4DR3 Q;  1FR3 A;  3M4Q A;  3IFE A;  2GVB A;  4MNO A;  2UXB Q;  2RDG A;  5EPJ A;  2WKD A;  4AQY Q;  2LMC B;  3OYY A;  4CKB A;  1PUA A;  4EWT A;  2RDH A;  4KY7 A;  2F4V Q;  4L5S A;  1DCZ A;  3VAR A;  4LMQ D;  3BDC A;  4LFC Q;  3T53 B;  3GKR A;  1CKN A;  2BOA A;  4GM5 A;  3RUZ A;  3HZX A;  2K01 A;  1NE9 A;  4J8Q A;  3TFY A;  1PFB A;  1TKF A;  4A39 A;  2K5W A;  4BY1 H;  3B3C A;  1K8O A;  2JQO A;  3VYU A;  3GV3 A;  1V0C A;  1TWA B;  4DV1 Q;  1VF5 C;  1MSH A;  3LAC A;  3ZZI A;  3E5S A;  4O42 A;  3ER0 A;  4ZGY B;  1EIF A;  1PFN A;  3MEF A;  4LF6 Q;  3G71 A;  4R9M A;  4BBS B;  4TSS A;  1AZP A;  2E2D C;  1QMU A;  1IKM A;  2ZEM A;  1CFM A;  4YHH Q;  4ZRZ A;  2BCO A;  4DJL A;  5LMN Q;  5T1I A;  4B5P A;  3Q24 A;  1YEZ A;  4NGP A;  4CGP A;  2A19 A;  4FXK C;  1TWF B;  4UWI A;  3TME A;  2JA5 H;  5JPM C;  2V8D A;  4RHR A;  4EQ5 A;  1XIX A;  1AH9 A;  2POK A;  4B6Z A;  3CRK C;  1F2Y A;  4C2Z A;  4JC0 A;  5IYD G;  1MSG A;  2XSC A;  3P20 A;  3GTM B;  5FO8 B;  4F8Z A;  4XPL A;  4C3J B;  2PJ5 A;  2ZEO A;  1OXX K;  1N8R C;  4JJX A;  4QIW B;  3R93 A;  3KF8 B;  1LT5 D;  1X56 A;  1R3N A;  3S16 B;  3BYY B;  2BE5 D;  2RSO A;  1JOO A;  4DUK A;  1PHJ A;  1KAA A;  2EPB A;  3BJ8 A;  3OWC A;  3HKS A;  1RIP A;  1NMT A;  4JI8 Q;  5I2X A;  3GB0 A;  4UFX A;  5EKL A;  1YZ6 A;  2QEX A;  1IGB A;  3FDT A;  3PUZ A;  4OIJ A;  2B58 A;  3B3S A;  4HED A;  5EMI A;  4A3K G;  2R93 H;  3BI1 A;  2WP8 J;  3H6M A;  4DUY L;  2ZT9 C;  2UUB L;  1CPX A;  3K5M A;  1ZLH A;  4R87 A;  3M4Y A;  1MGS A;  2DY8 A;  5ISR A;  2KEN A;  4C3H H;  2VQE L;  4WJ3 M;  5FJ8 G;  4LNQ A;  3G6E A;  4AYB B;  2I07 B;  1J5E L;  3M7G A;  5HVG A;  4LQG A;  5M5Y B;  2OT2 A;  3A54 A;  4A32 A;  3SGI A;  3I3G A;  1STH A;  1Y1W G;  2K5T A;  1KRS A;  2DJF C;  2K4K A;  2MO1 A;  3H4Q A;  1PRT F;  4A3K B;  1IXR A;  3AFP A;  4S3S A;  1D6E C;  3S14 B;  3AU7 A;  5M3F G;  3F8K A;  2B3U A;  4L5R C;  4LFA L;  3QOJ A;  4XT3 B;  1S60 A;  1JC7 A;  2B2W A;  2R61 A;  5LYL A;  5K8N A;  1V43 A;  1ET9 A;  1E2V A;  3FYN A;  1N36 Q;  5E3F A;  2CKZ B;  4OC3 A;  1X3Q A;  1I3Q B;  4ZX8 A;  5C3X A;  4EVO A;  4A3B G;  2Z6K C;  5COY A;  3JAM c;  1Z9F A;  1JOQ A;  4NW2 A;  2DF5 A;  1RTN A;  2G0B A;  2AUK A;  2K1B A;  3S1M B;  3VYR A;  3U58 A;  5AJ3 Q;  1HDU A;  1BDO A;  1F9S A;  1UEA B;  1AUG A;  2EYO A;  3S15 B;  5C4X H;  2Z3M A;  2P6E A;  1D7Q A;  4UP8 A;  4RUH A;  2RF4 A;  1Y0R A;  2ZEF A;  1F77 A;  2JEA I;  3CPX A;  4KZT A;  1EQV A;  3F1Z A;  1U4R A;  4BBS G;  4QCL A;  4A3E B;  1X3G A;  3OTO L;  4U67 3;  1HQR D;  1PLF A;  3UDI A;  5G21 A;  5C5L A;  4OO1 H;  2WB1 E;  4KVX A;  3GTO H;  4JI6 L;  3FEC A;  2MP1 A;  3H0G H;  1O78 A;  3F2C A;  4LF4 L;  3E3X A;  5FK9 C;  4DR6 L;  4KN4 C;  4ODG A;  2NUC A;  1OBR A;  4PPZ A;  1CSP A;  3RZA A;  1QNU A;  1BVS A;  4G4K A;  3CC4 A;  2AWO A;  2ZXP A;  2L1B A;  1VQK A;  1CBX A;  5DWN A;  4X66 Q;  1PH7 A;  1F9P A;  1YR0 A;  3FPP A;  2OF1 A;  4P2C B;  4GNX C;  5D65 A;  2J8R A;  4DV3 L;  1XOV A;  1N32 Q;  1NSN S;  3FH4 A;  4KOV A;  1D5X C;  3A7A B;  1ICW A;  1V8Q A;  1VDZ A;  1VS0 A;  2CTB A;  2QYV A;  4KOY A;  2NVT B;  4ZY1 A;  3TN2 A;  3AFQ A;  4I7Z C;  2Y0S E;  3K81 C;  1A3U A;  4P75 A;  4RGN A;  4F9U A;  2SOB A;  2ASB A;  1WCM G;  3P1H A;  5HUR A;  2OZG A;  1IBM L;  2BL1 A;  4IPH A;  2BSW A;  2A69 D;  3S6H A;  4M8A A;  4QC6 A;  4M1U B;  3SJG A;  4WWV A;  2JDC A;  1HTP A;  5BN4 A;  4LFB L;  2MGS A;  2C5C A;  3MTS A;  1QSO A;  2KCC A;  4X5K A;  1ZG9 A;  3GTQ H;  1ICF B;  1FYC A;  2VB2 X;  2E2J H;  1VQH A;  3SR1 A;  4OC4 A;  1TWF H;  2K5D A;  4C7I A;  5IWA L;  1RXT A;  2PJ2 A;  5L37 A;  2OTJ A;  2OZH A;  3H8F A;  3KLR A;  5ELC A;  5FLX L;  5ELE A;  2QF7 A;  1SMY D;  1I4Q A;  2EYH A;  1VQ7 A;  1JB3 A;  3K9T A;  1GKH A;  4HCS A;  4MY3 A;  3I1U A;  3IU2 A;  5LYI A;  3KZW A;  4EVY A;  1WTW A;  5JH9 A;  4K30 A;  2BA0 A;  3FEW X;  4XTC S;  4YGO A;  3TX8 A;  2DJG C;  2D0P A;  1CX8 A;  4BY7 H;  3G4S A;  3CME A;  1N9W A;  4KOR A;  4DR7 Q;  3OHX C;  1EFI D;  3CC2 A;  4BBR B;  3P2H A;  1HCZ A;  3N52 A;  4FF1 A;  1VGY A;  1XPU A;  1OXS C;  2V1C C;  3K7U C;  3TP5 A;  1KUX A;  2HV2 A;  3D4U A;  1CUK A;  2NN6 H;  2XRQ D;  3NHH A;  1F2P A;  4DUZ Q;  2PDO A;  4PQA A;  2K33 A;  1VQ6 A;  1FGU A;  2EE1 A;  3CCV A;  5CBE E;  2IHF A;  1GD7 A;  1XWE A;  2C27 A;  5C3W A;  4C2Y A;  1TWH B;  4UEF A;  2WIN B;  3SK5 A;  4DYO A;  1GHE A;  1HZA A;  4UCP A;  1GXD C;  2JA8 H;  1A8V A;  4A93 B;  4B3M L;  1KXL A;  1PCA A;  1ZG7 A;  2PRQ A;  2DPT A;  3PFO A;  5FKA C;  1WCM B;  1Y7E A;  2O4H A;  2EWB A;  4IHM A;  2Y0S G;  1O80 A;  1JWU D;  2ZW6 A;  5GQO A;  4CDC C;  3I9S A;  3L9A X;  4LF5 L;  1Q81 C;  3CT9 A;  3FX6 A;  3N5F A;  4IUQ A;  3B3W A;  1HRJ A;  2VQF Q;  4PSX A;  2A4N A;  3GUX A;  3DUZ A;  3PZJ A;  3RNZ A;  1QSR A;  1FL0 A;  5A2Q E;  2DNC A;  1LTR D;  1HNW Q;  1GYT A;  4KOX A;  2EK8 A;  5IP7 H;  1QNK A;  3LOD A;  1M44 A;  4DAY A;  2BUE A;  3IWE A;  4BXX H;  3R3O A;  5CV6 A;  1XBU A;  3CU7 A;  1YJ9 A;  4WFN 3;  3TC8 A;  4XPD C;  2WUU A;  4C68 A;  1ARL A;  1IIC A;  3CCU A;  3A0J A;  4FF2 A;  3RO0 A;  3MWY W;  5IB9 A;  1B50 A;  4DKA C;  3DEP A;  3NBI A;  4QB9 A;  2P0W A;  2UUC L;  5DWM A;  1PH1 A;  4QF4 A;  2PC1 A;  4OC0 A;  2BDN A;  2B3G A;  1I50 B;  5F2D A;  4LF8 Q;  2DPS A;  2G5D A;  1VQN A;  2FSR A;  4HNX B;  4FXD A;  2PR8 A;  1B53 A;  2R92 G;  3S14 H;  4MCR A;  2I0Q A;  1VIX A;  4LF7 Q;  5FLX E;  3SXO A;  1SMY C;  2PJ7 A;  3AB9 A;  2Q43 A;  5M9O A;  3AQQ A;  2ZM6 L;  2OB0 A;  4AYB E;  3FP9 A;  2ICE C;  2F0N A;  3IAY A;  1LAN A;  4R57 A;  5K8O A;  1C9O A;  1UFH A;  2FXQ A;  5E4W C;  2ABZ A;  1Y1V H;  3MFG A;  2J9A A;  3HOU G;  3H8E A;  4QJF A;  3JVN A;  4KOT A;  4A3B B;  1QUQ A;  2RB7 A;  3V8I A;  4QUS A;  1CHQ D;  1E0B A;  4JV5 Q;  4R3L A;  2VS1 A;  1NJI C;  1Y7R A;  1SNM A;  3STB D;  1GO3 E;  4BBR H;  2B8G A;  1I12 A;  3E0E A;  4K3N A;  1PXU A;  2CQO A;  3QOL A;  2ZEL A;  4MMO A;  3CHB D;  3RBU A;  2HUZ A;  1ML0 D;  4XDX A;  1IL2 A;  2VY3 A;  2WYR A;  4JK1 C;  4JLY A;  1NTG A;  2ID0 A;  5M3M B;  2Q44 A;  3NEM A;  2JSO A;  4I7A A;  3KLS X;  1EFW A;  2VBQ A;  2MQH A;  4X65 Q;  2JA6 H;  1I6H H;  1TWC H;  1YIJ A;  3MGD A;  3QR8 A;  4ME3 A;  4B9W A;  1IB1 E;  3KYH C;  2R93 B;  3A5U A;  4FYD A;  1YJW A;  2P6F A;  5FVJ A;  3PCO B;  4DU9 A;  4GS4 A;  2QW7 A;  2Q2U A;  3E6Z X;  4A93 G;  2A5H A;  2E2I B;  3BVZ A;  4DV3 Q;  4N9T A;  4KK7 A;  2VQE Q;  4JI0 Q;  1QST A;  1IYU A;  3PIO A;  3PMF A;  3HOX B;  1DE4 C;  4IJL A;  3RLF A;  4P4B A;  4EME A;  5LRK A;  1NMG A;  1R4Q B;  4B08 A;  1M4D A;  5F47 A;  1IYJ B;  2EJG C;  4ZCK A;  3D2P A;  1QSN A;  4M3S A;  4A3J B;  1F2O A;  2OTL A;  3KHZ A;  4EQO A;  2GN5 A;  3SK4 A;  3SVM A;  3S1R B;  1AFP A;  2AFW A;  4PXE A;  4ZUJ A;  1LTT D;  4NGT A;  1LYL A;  2I5L X;  3OWF A;  4UIB A;  3EC4 A;  5J22 A;  3T1Y L;  2UUA Q;  2N55 A;  4QIW E;  5HGT A;  1TII D;  3PO2 H;  3CKI B;  1XJO A;  5EPL A;  1HNX Q;  5F46 A;  3OW7 A;  1HPC A;  1S5F D;  3KR4 A;  1Z8W A;  4DF7 A;  2L0C A;  5CMD A;  3VR5 A;  5IV0 A;  5FLM H;  4JYA L;  4NGN A;  2Z10 A;  1R9T B;  4CJ1 B;  3H3V C;  4L5T A;  4WJW A;  4HMI A;  1BCP B;  2EO8 A;  1F57 A;  3HRZ C;  4HSV A;  1LAC A;  5F09 A;  2ALY B;  2NSM A;  4OP4 A;  5LHY 1;  5CV8 A;  1VQ8 A;  1K4J A;  1H95 A;  1STB A;  4OLL A;  4NXM Q;  5C82 A;  3KDF B;  1SYC A;  4WOR A;  4ZYS A;  4GLA C;  2VNU D;  1RCV D;  4X3U A;  1EYC A;  2Q8I B;  4DV6 Q;  4XT1 B;  4DAY B;  1RDP D;  4FD7 A;  4YWM A;  2XVS A;  1XNQ L;  3D66 A;  5IGF A;  1LTG D;  3MXN B;  2G9D A;  4NXN L;  4MFQ A;  4GOP C;  3KOJ A;  5G20 A;  1PRT B;  4H7B A;  4YFJ A;  3R8B A;  3OW2 A;  3HUV A;  4TNU A;  2ZJR A;  4YY3 Q;  1MKH A;  3SK6 A;  5M5X H;  2PW5 A;  4BA1 I;  5DM6 3;  2B4D A;  3J7Z C;  2NZ1 D;  1VMP A;  4LFC L;  5I4D A;  4QBJ A;  4DV5 Q;  1EY0 A;  4IFD J;  4QY7 A;  1Y0Y A;  2PCF B;  1C0A A;  1IL8 A;  3GO5 A;  1NAP A;  1IBL Q;  2AJ6 A;  4ONW A;  1SDF A;  2OR4 A;  4KSF A;  2EYF A;  3PV0 A;  1SBB B;  3I4M G;  3H15 A;  2J8N A;  2F8H A;  2ZOF A;  5IP9 H;  4DR3 L;  4EGV A;  3A55 A;  3NTI A;  4KSA A;  4MHE A;  2OCE A;  3NH4 A;  2ZW5 A;  2QDL A;  4FAI A;  3S1R H;  4CKC A;  4PV1 C;  2M2L A;  3OMC A;  4DR5 Q;  1M90 C;  3DWQ A;  2BH8 A;  2VQY A;  4NKL A;  4A94 A;  5KND A;  4X64 Q;  4JG2 A;  3WOE A;  2B5G A;  5M5Y H;  3K59 A;  2VQF L;  4CGY B;  3KI9 A;  3GTG H;  2PZT A;  2Q51 A;  1PH3 A;  3D8P A;  3C2P A;  4CGO A;  1F2Z A;  1Y8O B;  1IOI A;  5HGQ A;  5CC4 A;  4A3D H;  5LL6 X;  4C1N I;  5DAU A;  3MHB A;  3Q23 A;  4BIN A;  5TSS A;  1SNO A;  4K8I A;  2N88 A;  3TSS A;  1VQG A;  4O0A A;  1LTL A;  3EVQ A;  3QB8 A;  4JI1 L;  4K0K L;  3TEH B;  3EFA A;  4J15 A;  4HPS A;  2PVW A;  2NVX B;  1KUV A;  1W6K A;  2MUY A;  1U4P A;  3GTP B;  1AEX A;  5LMN L;  1B7Y B;  1TKH A;  5LMU Q;  2PE3 A;  4IUR A;  4OEL B;  1Y1V G;  2A6H D;  2RHS B;  1B70 B;  2WFW A;  1TXR A;  2Z3O A;  1MI2 A;  1D5Z C;  1SYB A;  2K32 A;  2HCC A;  2IL8 A;  2VZA A;  3W1G A;  3I4N B;  1UWY A;  3EJI A;  4NJQ A;  2KED A;  1ZEQ X;  1X54 A;  3OOC A;  2B2W C;  1II3 A;  5C3E G;  1SE3 A;  2CIJ A;  5C4J B;  1J8I A;  4RG1 A;  2E5L Q;  2OQ0 A;  4GS3 A;  3D68 A;  1B44 D;  3JC6 6;  1K9M C;  2PCU A;  1IYV A;  2F0I A;  4KTA A;  4QGU A;  5C0X J;  2Q2H A;  4R6T A;  4K5V A;  4AYB G;  4F0X A;  4JI4 Q;  4K8J A;  4IPG A;  4FD6 A;  3UI2 A;  1S7N A;  2PIY A;  4O1N A;  5JPN C;  3CXQ A;  1YW4 A;  4FF3 A;  2Z3L A;  1A3T A;  3ERS X;  2FIN B;  1UUP A;  2NYZ D;  2B63 G;  2R7D A;  1XYI A;  5C0X H;  1L1O B;  3CMA A;  1YGH A;  1TY0 A;  4BY1 B;  2PSW A;  3R2T A;  4HCE A;  3BHX A;  5KRU A;  2LFN A;  5IGG A;  4L89 A;  1CM9 A;  1Y8P B;  2QIL A;  4CAF A;  5AG4 A;  5IP9 G;  2RDF A;  4YCU A;  1SE4 A;  4CRY B;  5CPA A;  4DXF A;  3RAM A;  5ISV A;  4FNF A;  2D2C C;  1KWM A;  1QVC A;  3FF3 A;  1Z47 A;  1YVO A;  3SK8 A;  4RFB A;  2RCF A;  4LF5 Q;  3J7A V;  3Q0A A;  1ZXT A;  3BDO A;  3D7H A;  1LV9 A;  1P4N A;  1OXT A;  1TWG H;  1ESR A;  1HEE A;  2AE6 A;  4MFL A;  4PZ7 A;  2F0J A;  1X65 A;  3SXH A;  3TO7 A;  4B9X A;  3IU1 A;  1UNS A;  4GNX A;  3EO4 A;  4RGM A;  4PK3 A;  1O7I A;  3FBU A;  5M5W B;  2I00 A;  3QIA A;  2F0U A;  2A73 B;  4GOP B;  3WAB A;  2KJX A;  3DEO A;  4XYQ A;  3VA5 A;  4TVA B;  5C5M A;  2XIW A;  4FD4 A;  1LLR D;  1PDQ A;  1G6Z A;  2QEJ C;  3HEJ A;  3MA2 B;  1EU4 A;  2QEC A;  5KIX A;  3SE0 A;  3QAH A;  2WAQ G;  3W5O A;  4DAM A;  1LT3 D;  1TF9 A;  4P4E A;  3TS0 A;  4LUA A;  1UE6 A;  2F0F A;  1SYE A;  1Q8K A;  5FO9 B;  1EQQ A;  1Q90 A;  2PRB A;  3BZC A;  1S5C D;  2K04 A;  1KAB A;  5AG6 A;  4JOI C;  1STE A;  4EQP A;  2F0S A;  1VQ4 A;  1SYF A;  2KHI A;  2F3I A;  4ZKC B;  3HS0 C;  5FLM G;  2D0O A;  4CGL A;  4R4C A;  2RKS A;  2DN8 A;  3QB3 A;  3ITP A;  3RMH A;  1EOT A;  3PP9 A;  4JPB W;  3OPO A;  2JA5 B;  1SJH D;  1K73 C;  3PO2 G;  2UU9 Q;  2UUB Q;  2XNA C;  4A3L H;  3TTH A;  2QML A;  4OC2 A;  3TBI B;  1VQ5 A;  3M85 A;  1RL2 A;  2F0D A;  2MPM A;  2FVG A;  1I4G A;  1VQD A;  3VWD A;  2L9H A;  4N8F A;  3V38 A;  1HXY D;  2Q8R E;  3NSW A;  2F1M A;  3M3Y H;  2XEJ A;  3PB4 X;  2IX3 A;  2KCW A;  2L4N A;  1S5B D;  3SXN A;  3E9I A;  4LJZ C;  2JEV A;  2ODF A;  3GIU A;  2KUM A;  3TT2 A;  2AFO A;  1DON A;  2MJ8 A;  4A3G H;  3S9M A;  2F52 A;  2AFX A;  3KJO A;  4FWU A;  3BYT B;  1EY8 A;  2PJ8 A;  5I9P A;  1NCV A;  4DGZ A;  2REF A;  4CYP A;  2BA1 A;  2I79 A;  5I2Y A;  3H3V H;  2R7H A;  1EYG A;  3KBG A;  2IW3 A;  3NE5 B;  1S3O A;  3S17 H;  1Q7Y C;  1MD2 D;  4A3I H;  4B11 A;  1B6B A;  2PYK A;  4DK3 C;  4RCN A;  2Q4Z A;  3CDX A;  3KAS A;  2E76 C;  3DM1 A;  2F03 A;  4KHZ A;  1RHP A;  4ZBG A;  2B2V A;  2KCN A;  1L0W A;  1M4V A;  1Q8I A;  1HTL D;  1TF8 A;  1U4L A;  5BN5 A;  4RMF A;  2HC9 A;  3O13 A;  4KY5 A;  4B5P B;  2B29 A;  1NSL A;  1PRT D;  1MIU A;  5D14 A;  2YND A;  4A2Z A;  4IAL A;  3KFU A;  4OO1 G;  1FVI A;  4AQY L;  3HOW H;  2VXK A;  1S3Z A;  1Y14 B;  5JVG 3;  4LF4 Q;  4BBS H;  1YLO A;  1QG7 A;  1STG A;  1QUQ B;  1X10 A;  2KHJ A;  2MFI A;  3A7L A;  2FE7 A;  3IL8 A;  4C2M B;  5A2Q L;  4A33 A;  2V8V A;  3IWW A;  3SI2 A;  4GLV B;  1BCP D;  3K58 A;  1EY5 A;  2Q04 A;  3FRM A;  1SNC A;  3C26 A;  2KQ3 A;  1WI5 A;  3R9G A;  4NF1 A;  1JB7 A;  3S6K A;  1WTO A;  4WRD A;  2R92 H;  3J81 c;  3CXS A;  3WC7 A;  2KBN A;  4A3B H;  4QVT A;  1E22 A;  1L0C A;  4UF4 A;  2QGQ A;  1PYS B;  1SND A;  2WZN A;  4KHP Q;  1Q82 C;  2PPB C;  4Y7N B;  2QJ8 A;  1YNJ C;  5IGB A;  4XQN A;  4OX9 L;  3CQZ H;  4NXM L;  4UA3 A;  3Q6S A;  1WTX A;  1Z7T A;  2F3V A;  1IZ6 A;  3M4O H;  2NYQ A;  4OXP A;  4F88 A;  3FJU A;  4JXQ A;  1U5K A;  3UDF A;  2F0P A;  3I3C A;  1L0X B;  5EBV A;  1EEF D;  1W2B A;  1F9R A;  4YWK A;  2N8N A;  1YI2 A;  4DR4 L;  4RKB A;  2VXW A;  2RFH A;  2YTY A;  4YHH L;  2CWP A;  1C4Q A;  4G57 A;  3J80 c;  2A6E D;  5DNF A;  3K6O A;  3BVM A;  3KDF A;  4PZ6 A;  1PH8 A;  4ME5 A;  3TS2 A;  1YLE A;  1Z5R A;  1Q1B A;  1LAB A;  3PO3 H;  2OXP A;  3MRU A;  2Y0M A;  3FNC A;  4BMH A;  1I4R A;  4U68 A;  4RAU C;  3QWN A;  4OGQ C;  3GTL H;  1HDQ A;  5BR8 Q;  5FJ8 H;  1M4G A;  1HNZ Q;  2AFZ A;  2H1E A;  1YK3 A;  4M6G A;  4JI5 Q;  2C6G A;  2PI2 E;  5IGE A;  4KKS A;  1OXV A;  1PZJ D;  4IO9 A;  3J7A F;  1JOR A;  1S7F A;  4MFJ A;  2BDO A;  2R93 G;  2LXK A;  4CRZ B;  1OO9 B;  3JAM E;  5IYB H;  3I4O A;  1YJN A;  4OC5 A;  3MXP A;  3B35 A;  1EUJ A;  2PQA B;  1M8A A;  1CJW A;  2WPX A;  3CZX A;  1B1Z A;  2VUM H;  4J6H A;  3D67 A;  5BR8 L;  1UE5 A;  4U9Y A;  3TO6 A;  1WD0 A;  2H5M A;  3CXP A;  4UP9 A;  3DLJ A;  2XTI A;  2NN6 G;  1EOV A;  2E2J B;  1B87 A;  2GFQ A;  4X62 Q;  1JJG A;  3C1F A;  4RA8 A;  2EUI A;  2NTT A;  3I55 A;  3EA6 A;  2NVX H;  1R43 A;  2PJ3 A;  3K0X A;  3H8G A;  1M4I A;  2CH4 W;  1E24 A;  1JWS D;  2A6H C;  4V0B A;  2P6G A;  1HNW L;  5LMU L;  3BDL A;  1MJC A;  1A0I A;  1XFO A;  4P4D A;  2CWA A;  1CP6 A;  1STA A;  2R6G A;  3N7Z A;  4OWW B;  4MBU A;  4F9V A;  4JBW A;  1HZB A;  1Z8L A;  4L5Q A;  4KUA A;  4MRI A;  5JGF A;  4R1J A;  1A2Z A;  2N3S A;  5IOC A;  3J7A 5;  1Z8T A;  3GYA A;  3E0J A;  3GTJ B;  1VQA A;  1LTI D;  3U4Z A;  3N6R A;  1KHI A;  2F7V A;  1U4M A;  1VHO A;  1AP0 A;  3U4V A;  2JA6 B;  2KEE A;  3K57 A;  1C8C A;  2E74 C;  4UPA A;  4JBM A;  1NBW A;  1EY9 A;  4N9P A;  2A6E C;  1AMP A;  5CGK A;  1IU8 A;  1XTD A;  3I91 A;  1EQT A;  1N34 L;  4H89 A;  4IK2 A;  1IBL L;  1ZG8 A;  3BZD B;  4XXE A;  2FCK A;  4FVM A;  5DS0 A;  2WB1 G;  1A63 A;  2IHE A;  3FKI B;  5AG7 A;  1KNA A;  4FF4 A;  2ZEP A;  3T1Y Q;  2UUA L;  3HOZ G;  4JD6 A;  4MHZ A;  3NE8 A;  2O53 A;  1G29 1;  2R1I A;  3D3R A;  3MC0 B;  2AHO B;  4KY6 A;  3VYT A;  4CKE A;  2DNE A;  1WTQ A;  3GTP H;  2ZW7 A;  4AVA A;  3TO9 A;  2NTS A;  4K14 A;  4HIO A;  2YNC C;  5AGE A;  4JI7 L;  2B39 A;  3A8K E;  2FMM A;  4UHV A;  3CAM A;  3GQB A;  3F5B A;  1HH2 P;  3H0G G;  1Y9K A;  3T9Y A;  2Z6B A;  5DM7 3;  2EVB A;  1BO4 A;  2CFM A;  4ABN A;  4I49 A;  2EQS A;  3VDY A;  4B3T Q;  3IFT A;  4JI1 Q;  2R3Z A;  4DXG A;  3ZYY X;  4OKO A;  2IMO A;  4LF6 L;  1PTO B;  5C4X G;  4PXC A;  3FRP B;  2C1C A;  1IY7 A;  5H1S E;  4K5X A;  4G7O C;  5G22 A;  2WKC A;  2LSS A;  2NWG A;  4A4I A;  3ULP A;  3WOF A;  2VI7 A;  4RH6 A;  4QMG A;  3G3S A;  4X62 L;  1QQ9 A;  2EZV A;  5IT9 E;  4A3M G;  2RA4 A;  3EN2 A;  4MI4 A;  2H5X A;  4R76 A;  4Z65 A;  4IFD I;  4B5O A;  4C7H A;  1TS3 A;  2G3T A;  3TZU A;  3RYO A;  2BH2 A;  3PO3 B;  3W1B A;  1DM0 B;  2PI2 A;  5LL6 S;  3IEH A;  4JWP A;  4NGM A;  4H0L C;  5THW A;  3EIV A;  4A3G B;  1A2T A;  2JXM B;  2R98 A;  5CNP A;  4H44 C;  1XMO Q;  1H9J A;  5KTC A;  4DN4 M;  1CP7 A;  4UEE A;  5JPH A;  1Y1W H;  1MJA A;  3DXJ C;  4R7M A;  4KS9 A;  1EY4 A;  3OTO Q;  1FJG Q;  3HLP A;  4LF8 L;  3NQI A;  5KYL A;  1YX0 A;  2PQA A;  4J1M A;  3J81 j;  1C48 A;  4A3G G;  1EIY B;  3M9B A;  4C3H G;  3KQX A;  5JAV A;  5NUC A;  1EIG A;  4C2X A;  5BWA B;  5ELN A;  3K5O A;  1U9R A;  4CAX A;  2RBM A;  3MZ5 A;  1K0R A;  4A3K H;  2NVQ B;  1UE7 A;  2JK8 A;  1KTK A;  1Z9U A;  4ZY0 A;  1NY4 A;  1D2B A;  3W2D A;  1Z2L A;  3FVL A;  4YU9 A;  3GDE A;  3HOX H;  4JYA Q;  4KOU A;  4GN5 A;  3HGB A;  1PH6 A;  3UDX A;  2CNM A;  5CV7 A;  4B3M Q;  1QVF A;  3B3V A;  2OOT A;  1CTM A;  1ZYR C;  1DXM A;  2B8F A;  2VW9 A;  1L0Y B;  3I4L A;  2ZXO A;  4MHD A;  4AB7 A;  1J9O A;  1GM5 A;  1K3B C;  2X69 A;  4B3S L;  4KN7 C;  3T51 B;  2WAC A;  3CCE A;  1CQF A;  1VF7 A;  5KTD A;  4GKJ L;  1ELL P;  2UXD L;  1STN A;  3H91 A;  4HJ7 A;  3OWE B;  4UCM A;  1VQM A;  4HTH A;  2JA8 B;  2ZEN A;  2O5J C;  1VQO A;  2AFU A;  1NR4 A;  4IPC A;  2BO9 A;  3J80 i;  4R8N A;  3MN8 A;  1FJG L;  4DV4 L;  2D5D A;  4J3G A;  4DV1 L;  1CT1 D;  2HQL A;  4ZI6 A;  2UU9 L;  4OEM B;  3F2D A;  2KCM A;  3HOV B;  2VUM G;  2HT1 A;  1R9T H;  2O5I C;  2K05 A;  4HR7 B;  1YSJ A;  4CJ0 B;  3I56 A;  4LF9 Q;  1TKW B;  4BA2 I;  1S5D D;  3EBE A;  1TT2 A;  3S9W A;  1VQJ A;  3BU2 A;  4MCQ A;  4QL5 A;  5IYB G;  3CP0 A;  1KL9 A;  3CF5 A;  1H8L A;  4LUO A;  5EBC A;  4B3R Q;  2GA4 B;  2IJ0 A;  3U9S A;  1IW7 D;  1B4O A;  1DOL A;  1Y8N B;  2PQE A;  4DR2 Q;  4OIW A;  3M4P A;  3R9E A;  3FVQ A;  3HKZ G;  2RCN A;  3NFZ A;  4POG A;  3B6Y A;  4H6U A;  2C9O A;  4CYQ A;  4MFP A;  1RJT A;  3F8T A;  2ZXR A;  1RKN A;  4OC1 A;  1LT4 D;  4I65 A;  2K14 A;  3IKJ A;  3E0K A;  4P72 A;  1WWZ A;  1HFG A;  1SLJ A;  2NVT H;  3PO3 G;  1K83 B;  5E4X A;  3GLJ A;  1HQM C;  1G8Z D;  1TVX A;  4CDE C;  1BBX C;  1I4H A;  1X9N A;  3UY5 A;  5C0X G;  5ELY A;  3OSO A;  5G1Z A;  2Q7B A;  2B63 H;  2A1A A;  4RKL A;  2DEA A;  4LW1 A;  2PQ8 A;  5LRG A;  1PZK D;  2EJM A;  3FHW A;  1BAV A;  3CPW A;  2C6C A;  3WC6 A;  2EJF C;  4P45 A;  4AIM A;  1EYD A;  4LX9 A;  3NEL A;  2H4O A;  4DV0 L;  3FIX A;  4OAD A;  4IPD A;  2Z11 A;  3L2N A;  1E2W A;  1NUC A;  1Q12 A;  1SNQ A;  1XMB A;  2IX1 A;  5JJK A;  3PIO 3;  3S24 A;  4JBK A;  3G7L A;  1PV4 A;  4KKU A;  4LWC A;  3J81 i;  5E7N A;  3BS1 A;  3ICE A;  1VQC A;  2A68 D;  3FKI H;  3PSI A;  5C3E H;  3RZD B;  2KHS A;  1Y69 U;  2F0Q A;  2PJ1 A;  5LYF A;  2XWJ B;  4Q36 A;  4NGQ A;  2K50 A;  2AMC B;  4PMW A;  4C56 C;  4GZY C;  2JEW A;  1FNV A;  3JTK A;  3S2D H;  1S5E D;  3S9N A;  3HOY G;  4DR1 Q;  4BY7 B;  1VQE A;  3A9L A;  4RI1 A;  3MAQ A;  2PVV A;  2M00 A;  1A3V A;  2BE5 C;  2EYP A;  4RWS C;  4F8M A;  1Z8X A;  2FIA A;  5A35 A;  2CHB D;  2HCI A;  1CI3 M;  2VZY A;  4GXH A;  2Q2T A;  1CPS A;  3HOW G;  2CXA A;  2ZEE A;  4DV5 L;  1S7L A;  2Q0Y A;  5T1G A;  4RCO A;  1I1D A;  5JVH 3;  3NH8 A;  3A56 A;  2K5Q A;  1W3S A;  2UUC Q;  4WJ4 A;  3IFD A;  4PQX A;  1IBK L;  4B3S Q;  4Y52 H;  1PA6 A;  1WJJ A;  2A74 C;  4C2M H;  5GAE C;  4A3D G;  1S5K A;  3I70 A;  3CXC A;  1G6P A;  1DOM A;  3PEI A;  2TSS A;  4BS9 A;  5IT9 c;  1LCP A;  1J6Q A;  1TS4 A;  2N78 A;  1JE5 A;  1PFS A;  4MZ9 A;  3MFY A;  3K9U A;  4UIA A;  4QUF A;  2AQ2 B;  4DR4 Q;  1LTS D;  4HN7 A;  1YRE A;  3F0A A;  3D6W A;  4A3I G;  1HR0 W;  3DWA A;  3IWG A;  5JEA H;  1FNO A;  1K8M A;  3K2K A;  2RC4 A;  4R4Q A;  1FNW A;  4L6T B;  1SRU A;  3ERQ A;  5EKI A;  5LRJ A;  5A28 A;  1YNX A;  2JBJ A;  5I4M A;  2PJC A;  3UE1 A;  2JA9 A;  4F0Y A;  1OXU A;  1YVC A;  3M4O B;  4K2L A;  2DGY A;  2Z4H A;  2YGW A;  1D1K A;  2QIR A;  4PNY A;  2K03 A;  1YIT A;  4DR2 L;  1BNZ A;  1IBM Q;  1HZ9 A;  2GIV A;  1A6X A;  2WII B;  2Z3K A;  3G6J B;  3KR5 A;  3OIQ A;  5EQ0 A;  4CGN A;  2L15 A;  2GRE A;  4CYO A;  1HUM A;  2ES2 A;  4NJR A;  4W9Y A;  5K8P A;  1I6V C;  5E1F A;  1DYQ A;  4C3I G;  3PBB A;  4X66 L;  2HIV A;  3TRE A;  1T5E A;  4A3L G;  3VYS A;  5IY0 A;  1JJC B;  3FB3 A;  2XGT A;  1ZO0 A;  3MVV A;  1Q2C A;  1VMC A;  1VCI A;  2MO0 A;  2Q7S A;  4X2T A;  3GTL B;  1F2M A;  1BR9 A;  1D8L A;  1ET6 A;  4NXY A;  1I5F A;  3P75 A;  4JI0 L;  4OIK A;  4A76 A;  5I6Y A;  1L1O A;  3TRZ A;  4MCP A;  4KOW A;  2Q2I A;  2A68 C;  4OL7 A;  5GCN A;  3A8J E;  4HID A;  4OWX B;  3HOU B;  1TWA H;  4OHJ A;  3WC5 A;  2KVM A;  5AJ3 L;  3T90 A;  4AVC A;  4YCW A;  3D31 A;  3DR8 A;  1Q86 C;  1M1K C;  5KNC A;  5C6A A;  2DY7 A;  3ZJY C;  1K3R A;  2FHT A;  3CCS A;  2FL4 A;  4ILW A;  3RNU A;  2FT0 A;  3D6C A;  1YHA A;  4ZYQ A;  4APV A;  2E2H H;  3T1H Q;  4Q38 A;  2O4X A;  5IWA Q;  3PUW A;  4KSI A;  1JCK B;  3CCL A;  2FS5 A;  4B10 A;  5G3L D;  1LM0 A;  4A3I B;  1PTO F;  1KUY A;  1PH2 A;  3QNV A;  3H5Z A;  5H84 A;  4POF A;  3I72 A;  3K5N A;  1L2F A;  5BN3 A;  3NBH B;  5IYC H;  1Q7L A;  4B14 A;  1NR2 A;  1MK4 A;  2IX0 A;  3PIP 3;  5C4J H;  5I9O A;  3GTM H;  1N32 L;  3NWT A;  5F49 A;  5C88 A;  1I3Q H;  4OAE A;  2DXQ A;  5AFW A;  1BXT A;  2EY6 A;  1QZG A;  2RVL A;  1V1O A;  3RZO B;  4KV6 A;  2HQY A;  5EBD A;  6CPA A;  3TOB A;  1TU2 B;  5K36 H;  3MXG A;  3VR3 A;  4JXR A;  1QVG A;  5I6W A;  1XF8 A;  2ZTE A;  1G2S A;  1NE3 A;  1HA6 A;  3CW2 C;  2LKV A;  1UE1 A;  3DSB A;  1XMO L;  2PJ6 A;  4C3I B;  4DUZ L;  1HUN A;  4B3R L;  1VQP A;  4P74 A;  2K7V A;  1HR0 L;  2F0T A;  4R9W A;  2B2T A;  3VH9 A;  1QOH A;  1VQ9 A;  3TE4 A;  2ZOG A;  4A3E H;  2EXZ A;  5FO7 B;  1STY A;  3CCM A;  2NVQ H;  4CS0 B;  2D9U A;  1CHP D;  4R4I A;  3QAY A;  3WR7 A;  2VZZ A;  4JI2 L;  3J80 L;  4CYN A;  2ZTC A;  1BOS A;  3S9L A;  3VR6 A;  3MXU A;  4YIJ A;  4JI5 L;  3VR2 A;  4JZ0 A;  2ATW A;  3SEB A;  1X55 A;  2ZJP A;  3PGP A;  1TXY A;  1PH9 A;  4OO1 I;  2EK9 A;  2OH1 A;  4YWL A;  3VAT A;  3NTK A;  5JJI A;  4CDF C;  3IJ3 A;  5HVF A;  1T9H A;  3PUY A;  1EU3 A;  4K6D A;  2UXD Q;  1VKC A;  5CV5 A;  2K5V A;  2YU9 B;  1KAW A;  4BBR G;  1KRT A;  1XX8 A;  4DV2 Q;  4Q7A A;  4A3C H;  4PSW A;  2EYM A;  3HOU H;  1PYW D;  3B2Y A;  4HMJ A;  1GOZ A;  1QB5 D;  2AQ1 B;  1Q2Y A;  5C3E B;  3RZD H;  2B4D B;  2WPW A;  2Q4V A;  1SAP A;  5KEE A;  4KUB A;  3PQI A;  3S15 H;  2D62 A;  1YBY A;  5EPK A;  3A8I E;  3MXN A;  1XEB A;  4X64 L;  1MHW C;  2EOT A;  4ZKB B;  3R95 A;  2Z0Z A;  1ROD A;  2Z6K A;  1YW6 A;  4P73 A;  1Y9W A;  1GUS A;  1IBK Q;  1PH4 A;  1NNX A;  1YQE A;  2K5N A;  3EFX D;  4MTK A;  1E1T A;  1P8L A;  5C44 H;  1Q1E A;  1LAM A;  1G2T A;  3I4N H;  1KLU D;  2CTC A;  5M5W H;  4IN3 A;  2R7Z B;  2EY1 A;  2CH4 A;  5IP7 G;  5GAG C;  3P2F A;  4AH6 A;  1F9Q A;  1TS5 A;  1YHB A;  2EDG A;  1BCP C;  3GP7 A;  1MJB A;  1B3Q A;  4IUU A;  1UEB A;  3W3A A;  4XYO A;  4FUU A;  1EEI D;  1XMT A;  4M6I A;  3I4M H;  1ENC A;  1VQL A;  3PBE A;  1WFQ A;  3ND8 A;  5DLQ E;  4P71 A;  3TP7 A;  4XNH C;  4JI3 L;  3HOV G;  3K80 C;  2EBJ A;  4H02 A;  2R7Z G;  4NCZ A;  5AG5 A;  1RF2 D;  3I90 A;  1JIC A;  3DHQ A;  1O7Y A;  3CPA A;  4NDX A;  4KI0 A;  1EE3 P;  3SJF A;  5ELD A;  4RN7 A;  4UFV A;  4MHN A;  3KF6 A;  3RR5 A;  3WDN A;  5E96 A;  2JA8 G;  4OWT B;  2F0O A;  3P7J A;  4X3S A;  1PMR A;  4DAV A;  2JA7 G;  1I4P A;  1O7L A;  1KIX A;  2JN4 A;  2NMT A;  2IT1 A;  2WAQ B;  3RLO A;  2CNS A;  3SDZ A;  1OTC A;  4AVB A;  4N8X 1;  4OX9 Q;  1J4J A;  3CCQ A;  4UAI A;  4DK6 C;  1KQS A;  2ENB A;  1YNN C;  4B3T L;  4RGT A;  1EZ6 A;  5D3D A;  1QZH A;  4B13 A;  2CCZ A;  5A27 A;  1IYK A;  2VL1 A;  4C3H B;  2PJ9 A;  3EXN A;  1XNR L;  1WVL A;  1JQG A;  4PXB A;  1SNP A;  2V77 A;  4FO2 A;  3FED A;  1SMX A;  1DOK A;  3HOW B;  3IC1 A;  4G1P A;  4IOA A;  3PFE A;  1GVP A;  2ZJQ A;  4LUV A;  4HJ9 A;  3CC7 A;  5EGT A;  1VQI A;  1IKL A;  2L12 A;  2VUM B;  1Q2D A;  4E8O A;  3FXT A;  3SI1 A;  1MJE A;  4CAE A;  3BJU A;  2J4X A;  3X3N A;  3IRB A;  4KKT A;  4DR1 L;  3G8W A;  1EWI A;  4JI6 Q;  1KD1 C;  5GAH C;  1VQB A;  2X6G A;  3LMS A;  4U5Y A;  1PYB A;  3KF6 B;  4HNY B;  1PTO C;  5CBA E;  4K6L A;  4UWJ A;  3J81 E;  1N34 Q;  2RHQ B;  3OIP A;  2VEZ A;  4P10 A;  2SEB D;  4FDB A;  2E5L L;  1ENA A;  5G3L F;  1TKJ A;  1QIL A;  4CJ2 C;  5LMN W;  4DAP A;  3KKW A;  5J1Z A;  4YY3 L;  4IUN A;  4Q0F A;  4XNH B;  4AG9 A;  4KHV A;  1YVK A;  3MEH A;  1WCM H;  4X3T A;  2KEC A;  1VQF A;  4A93 H;  1H9S A;  1ILP A;  3J7Y W;  2RSN A;  3DGV A;  1BBU A;  3LWU A;  1ELM P;  3M3Y B;  4QQB X;  4A3J H;  1HJP A;  2EYJ A;  4A95 A;  4TWE A;  1N36 L;  3E9H A;  1H9K A;  1SE8 A;  1L1O C;  2GAN A;  2YNC A;  2ARH A;  3F2U A;  2JA6 G;  1KDC A;  3S6G A;  1D1I A;  4UY8 C;  3PB7 X;  2PNR C;  3PUX A;  1U0L A;  3AYH B;  1B9N A;  1DJR D;  2I5M X;  4XPD B;  4Y49 B;  1CZG A;  3L3O C;  2I5H A;  2ANP A;  2R7F A;  2QA4 A;  3PIP A;  1A15 A;  3NUC A;  1D5M C;  1K8A C;  4JI3 Q;  5K5P A;  2XEG A;  5ELB A;  1CM0 A;  2B63 B;  2NBF A;  1LOK A;  4NB3 A;  4DK0 A;  1BUV T;  2R8V A;  1XJV A;  2NZH A;  1IHZ A;  5CBM A;  5JOB A;  5LYD A;  1B8A A;  4X3R A;  2AFM A;  1BBW A;  2I46 A;  3M7N A;  2WB1 B;  3PF4 A;  1LFW A;  4FXG C;  2YV5 A;  2EYL A;  1ASY A;  4DR5 L;  2K52 A;  3W91 A;  1U6M A;  3ONA B;  1HNX L;  1QSM A;  4F7X A;  3LWE A;  4DFA A;  3Q22 A;  1XTC D;  4P44 A;  1E1O A;  3D7F A;  3QJY A;  1KLG D;  4U9Z A;  4A37 A;  2YU9 H;  2ZEG A;  1AZQ A;  2JYO A;  1X32 A;  3WWV A;  4OME A;  3D2M A;  4GLX A;  5GAD C;  4NPS A;  5J3B A;  1SRO A;  1WD1 A;  3S16 H;  4K5W A;  2ZXV A;  1Y1V B;  2ICI A;  3JRU A;  3RN2 A;  1N33 L;  3GTJ H;  5I0C A;  1S72 A;  1PTO D;  3R2I A;  3HG9 A;  2V4D A;  4NFR A;  3RLN A;  5HH1 A;  5K8M A;  4HJ8 A;  3I4M B;  2GLF A;  4P4J A;  1XRY A;  3PGZ A;  2JA7 B;  2I3C A;  3CCJ A;  4OON A;  2B2Y A;  1GJX A;  3K5L A;  4HJ5 A;  3F2B A;  5M3F H;  4BXX G;  2R92 B;  1AW7 A;  4R8I A;  4X8I A;  1JJ2 A;  3GTK B;  1H9S B;  1IYL A;  4HAE A;  1Q46 A;  1SXT A;  2L5T A;  4DV0 Q;  2WV6 D;  1TY2 A;  2E8G A;  1SQH A;  2WSA A;  3R1K A;  2JBK A;  1HA5 A;  1I6H B;  4A38 A;  1ESF A;  1PFM A;  3C46 A;  2OQK A;  2OU2 A;  4A30 A;  5CV4 A;  2JA7 H;  4IQZ A;  3IO1 A;  2XN9 C;  1I94 Q;  3K7A H;  4UBR A;  5M3M H;  1I21 A;  4E2A A;  4HNW B;  3I8Z A;  1SYD A;  1SFO B;  4H2K A;  2IWH A;  3DDD A;  2VL6 A;  1ASZ A;  1WTR A;  2R7Z H;  4CPA A;  1S4Z A;  5M3M G;  3S17 B;  1SE2 A;  1Z4R A;  2GVA A;  4MFZ A;  4LUZ A;  1XXG A;  4A3F B;  4R4O A;  4RGO S;  5IE8 A;  1HZC A;  1TIQ A;  1QWY A;  2HDL A;  2JDD A;  2O28 A;  4LK1 C;  5JM6 A;  1B3A A;  1UWV A;  5EAY A;  4KVM E;  3FMC A;  1SFO H;  2PIZ A;  3CRL C;  4DR7 L;  2ZW4 A;  4A3M B;  2IY5 B;  2F4V L;  3S1M H;  5IT9 L;  2YYZ A;  3KF8 A;  5KGU A;  2B5G B;  2V8H A;  3PB9 X;  1N71 A;  5C44 G;  1ZLI A;  1TWH H;  1BPN A;  4CDD C;  2HHH Q;  4ZAI A;  4DV4 Q;  1X3E A;  2F0L A;  3D8G A;  1HNZ L;  2K5H A;  4R4T A;  5ELO A;  2F0M A;  4GNX B;  3U50 C;  2AWN A;  4BY7 G;  1R57 A;  1V1P A;  2Z0S A;  4ZUI A;  1JMC A;  1PZI D;  5IIF A;  1X3F A;  3H3V I;  1E7Z A;  2NZO A;  1GUO A;  1RO5 A;  2YNE A;  2EY2 A;  1CG2 A;  1KDA A;  1OZP A;  2BEI A;  3ZJ0 A;  5HVH A;  1C7Y A;  3QO2 A;  1QCB D;  2J0T D;  3H0G B;  2HD3 A;  1M1D A;  2G3A A;  4DNC A;  1JE4 A;  1ZYR D;  1AE3 A;  4A3C G;  1YME A;  1WYD A;  3BG3 A;  4KD4 A;  3X3M A;  4G7Z C;  4CAV A;  2E2H B;  4JBJ A;  4LQ6 A;  4GKK L;  1EYA A;  4MXU A;  4II9 A;  4XQQ A;  4DV7 Q;  2PJ0 A;  1IID A;  5H86 A;  2F5I A;  3DNS A;  4KLK A;  3S2H H;  1ONL A;  2PZU A;  4A75 A;  1XPR A;  4ULL A;  4LAA A;  4MIU A;  4MY0 A;  1QE6 A;  4EX5 A;  1XMQ Q;  2IL4 A;  2Z3N A;  2F0W A;  3BI0 A;  4MTN A;  3JUW A;  1NMF A;  4IOC A;  2GE3 A;  2FIW A;  2QCP X;  2F0E A;  4DNI A;  4UDU C;  3TZD A;  4JV5 L;  1MJ9 A;  2B2T C;  2NN6 I;  2HQE A;  2B4B A;  1GUG A;  2A8V A;  4UEZ A;  1J5E Q;  3HKZ B;  2Z8L A;  8CPA A;  4A3J G;  3FPU B;  2J8M A;  2YTX A;  4FBE A;  3TP6 A;  1BO0 A;  2Z3P A;  1JOK A;  3T4A C;  2YTV A;  4PG3 A;  2PJA A;  5D3I B;  2LXJ A;  4HKF A;  4L63 B;  5GRO A;  1ENF A;  1EY7 A;  1BKB A;  4RS2 A;  3V2T A;  4A3F H;  2CW0 C;  2UXB L;  3H09 A;  1AE2 A;  1FGB D;  1E3P A;  5EJW A;  1G91 A;  3G48 A;  5K36 G;  2JLM A;  3ULL A;  4BWG B;  4EFD A;  3NEN A;  4IZ8 A;  4NGR A;  4ORF A;  1JR0 D;  1CKM A;  1WOC A;  2ZEH A;  3C1E A;  1K0S A;  5C4Z A;  1WTH A;  2PJB A;  3C3L A;  1DZ1 A;  2JEB I;  1XNQ Q;  2IJZ A;  4YRH A;  2SDF A;  4V19 0;  2X6L A;  4NXN Q;  2NB0 A;  4E0A A;  1UAP A;  3CQZ B;  3SJE A;  5IYC G;  1PYT B;  4F6A A;  5IGD A;  2N49 A;  1RTQ A;  4A3D B;  3QG1 A;  2GLJ A;  4MHY A;  3RN5 A;  4L8J A;  2IQ6 A;  4P4I A;  3GTK H;  3I7F A;  4JVZ A;  2CF4 A;  3KLW A;  1LUZ A;  5CV9 A;  7CPA A;  1BQQ T;  5EKK A;  3VA7 A;  3D0F A;  3VR4 A;  1TWG B;  4MN3 A;  3J81 L;  3EY5 A;  2FMC A;  2OEO A;  3LX0 A;  1LTA D;  5KNB A;  1BCP F;  3FEE A;  2B2V C;  2VB3 X;  4MHP A;  1PU9 A;  4UCN A;  1XE4 A;  1BOB A;  1SYG A;  4O2D A;  2ATR A;  4XIG S;  4M6H A;  3BZK A;  3K7A B;  1KC8 C;  2WAQ E;  5IGC A;  4JI4 L;  3HOY B;  2HHH L;  4DA2 A;  3T8W A;  2QKI C;  1SN8 A;  2B2Y C;  4HIK A;  1DGS A;  2XRS D;  2ZM6 Q;  5JJL A;  5KTA A;  4Y7N H;  2EXD A;  2PNH A;  3PB8 X;  1WTP A;  3NA6 A;  2B2U A;  3K8A A;  3HP3 A;  4GN3 B;  1TWC B;  3S1N H;  4PK2 A;  2EIF A;  4O23 A;  3PO2 B;  4DUY Q;  2Z9H A;  2PMZ E;  4PZ8 A;  1CK1 A;  4C3I H;  1K83 H;  5M3F B;  5ELF A;  2QVP A;  1JT8 A;  4BBH A;  4DR6 Q;  1HR0 Q;  4AG7 A;  4NMZ A;  2LY7 A;  5HXD A;  3KBX A;  1PH5 A;  1JQY D;  3HOV H;  2NVY B;  5CR3 A;  3RD4 A;  3NBH A;  3W6X A;  2Z1C A;  2A69 C;  1A2U A;  5HY6 A;  4K0K Q;  1LT6 D;  1AYE A;  1FY7 A;  4DV6 L;  1A62 A;  1I94 L;  3GTG B;  3K0Y A;  2OWO A;  1CA6 A;  4GN4 B;  1NSA A;  3CD6 A;  1TS2 A;  1V1Q A;  3S2D B;  3NE7 A;  3R9F A;  1XMQ L;  2CW0 D;  4F87 A;  3KHX A;  2NVY H;  3D4R A;  4QB4 A;  4XPK A;  1GHJ A;  3GV6 A;  1IW7 C;  2FFK B;  1H9R A;  3I4N G;  5JEA G;  4RHS A;  1X12 A;  3T16 A;  4IFD G;  4UFW A;  2REE A;  5D8N A;  4LFB Q;  5IYD H;  1EIH A;  2PZW A;  1DD2 A;  4PV6 A;  2CVR A;  1WTV A;  3S1Q H;  3B7I A;  3T1H L;  4QUC A;  4K2K A;  2JA5 G;  3KLS A;  4KD3 A;  3URY A;  3GY9 A;  4MJ8 A;  5FOB B;  1GUN A;  2CY2 A;  4ZY2 A;  1ILQ A;  4JCV E;  4JOI A;  3TCV A;  4KHP L;  4C3J G;  4TRD A;  1YNJ D;  3LD2 A;  4NSQ A;  2AQ3 B;  4H6Z A;  3AMU A;  1YNN D;  4TKO B;  4IJH A;  5HMN A;  2M9V A;  4IUS A;  4MFK A;  1B9M A;  1HFN A;  3L0O A;  4HSP A;  4BY1 G;  4ALP A;  2P5Z X;  1EY6 A;  2CQA A;  2K75 A;  3DMU A;  1ZKO A;  3PUV A;  3B3T A;  4CAW A;  2KA7 A;  4YWY A;  4DPG A;  1Y1W B;  4IF5 A;  3D3S A;  3HOZ B;  4MCS A;  4Z9C B;  1E2Z A;  4LF9 L;  4WJB A;  3ERO A;  2LS0 1;  3FKI G;  1S40 A;  1VHE A;  5D29 A;  2F0V A;  3NH5 A;  4AXV A;  5C4X B;  1HHV A;  2SNM A;  1X3P A;  2ZTD A;  1JWM D;  1GUW A;  1EL0 A;  3KL9 A;  3S1N B;  1TQO A;  1FD7 D;  3KJP A;  4A31 A;  2EVN A;  5IX3 A;  3OMG A;  4JI8 L;  4ZLT F;  1P0H A;  2C6P A;  1G51 A;  5EC4 A;  5F48 A;  3WT4 A;  4M85 A;  3GTO B;  3A74 A;  1KNE A;  4X3K A;  5JJZ A;  4A3E G;  2F0K A;  3TP8 A;  4CGM A;  3SI0 A;  3ISX A;  2ZED A;  4DV2 L;  2IPK D;  5J8C A;  4GKK Q;  5J1Q A;  4DV7 L;  3TOA A;  1PTO H;  1KDB A;  3ULJ A;  1BLL E;  3NWS A;  1V9P A;  3BLN A;  3SHL A;  4EQN A;  2X7B A;  1YHQ A;  1RTO A;  3PF5 A;  5FLX c;  4IUP A;  3T13 A;  1S7K A;  2O2L D;  5CYU A;  1LAP A;  3B8G A;  4UP7 A;  4PXD A;  4FD5 A;  1JWQ A;  3A5Z B;  3S1Q B;  3NK9 A;  1TR5 A;  3LGJ A;  5J39 A;  3KQZ A;  1GUT A;  3NTH A;  2GU2 A;  5C0X I;  2Q4Y A;  1I50 H;  1N33 Q;  4C3J H;  5IB0 A;  1KZF A;  1O7Z A;  2MHV A;  3KUP A;  1B2T A;  3ISZ A;  2AUJ D;  2SNS A;  2G9H D;  3H94 A;  1R4P B;  3BJ7 A;  2RQX A;  4JI2 Q;  3AEV A;  3HFZ B;  4LF7 L;  2K6A A;  5C4H A;  4ZK9 B;  1SSO A;  5JEA J;  4E6I A;  4DNT B;  3V05 A;  2PR1 A;  4IFD H;  5JQ4 A;  3NXW A;  3DR6 A;  2E75 C;  2F3W A;  4PMB A;  2PMZ B;  2F4I A;  3I2Z A;  4L8A A;  1F2L A;  4NP5 A;  3D4D A;  4YCV A;  4R8F A;  3JAM L;  2BOS A;  4KLW A;  4ZQ3 A;  3ND9 A;