3LWUA

Crystal structure of putative succinylglutamate desuccinylase/aspartoacylase (yp_749235.1) from shewanella frigidimarina ncimb 400 at 2.10 a resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
372
structure length
372
Chain Sequence
MTKAIQSSVQVGELATGQALTVPIYSFMGSENSAPSVYIQANVHGAEVQGNAVIYQLMTLLEGYQVLGDITLAPLANPLGINQKSGEFTLGRFDPITGVNWNREYFDHNVDIQNWYAEHQHLTNSELFCAYRSMLVETCQARLTHSFGISTGHRLAVNLQAMAHQADIVLDLHTGPKSCKHLYCPEYDIDAARFFSIPYTLIIPNSFGGAMDEATFCPWWQLTEYATSQGREFSVPVSAFTLELASQERIDLADALEDAKGILAYLSHRGVIAEKVNPASMERFGCYLKDYKKFHAPKAGLIEYCASVGEPLTAGKPLVNILRIDLYGSEQAYQAISLPMDCVPILHFASASVLQGTELYKVMTNVFPLQPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinylglutamate desuccinylase/aspartoacylase
publication title Crystal structure of Putative succinylglutamate desuccinylase/aspartoacylase (YP_749235.1) from Shewanella frigidimarina NCIMB 400 at 2.10 A resolution
rcsb
source organism Shewanella frigidimarina
molecule tags Hydrolase
total genus 113
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3lwuA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3lwuA01
1VGYA 1JQGA 2PJ7A 2JBJA 4P10A 1PCAA 3L7ZC 3VR3A 4UIBA 3DXJC 2PJ8A 1SMYC 4O23A 5BN5A 5JM6A 3PFOA 1DTDA 2I3CA 4A37A 1CTMA 3MFYA 2F1MA 2PNRC 2AUJD 1GUGA 3WABA 3B3SA 1OXTA 3PUYA 1NSAA 3H8FA 3NA6A 2O5JC 2GU2A 4IHMA 4BA2I 3PB4X 4NGQA 5HVFA 2PJ6A 1T5EA 4OGQC 2NYQA 3PBEA 2K33A 4X8IA 4R6TA 2XEIA 2NN6G 3I1UA 4DK0A 1K8OA 3T51B 2C6CA 1DE4C 2IJZA 3B3VA 3HLPA 1CX8A 1H9RA 1Q1EA 3PUZA 2HB6A 2O4HA 2PVVA 1ONLA 4P4JA 1TKFA 4P4BA 3TX8A 5JGFA 2VL1A 4IFDG 2ZEOA 1A6XA 3FPPA 4A38A 4OIDA 1BDOA 3IIBA 2PE3A 4IK2A 3PUVA 2Q43A 1HDQA 2PCUA 1HQMC 3CPXA 1TXRA 2IMOA 2V8VA 5BN4A 1Y0RA 2EK9A 4G7HC 3MRUA 3ND8A 3OOCA 3FEDA 4ZY0A 5K8PA 4UEEA 4Z65A 3NH8A 2J9AA 5HXDA 4FWUA 2B8FA 4LQGA 5K36G 3W3AA 4UIAA 7CPAA 3A8KE 3BI1A 2A68C 3D7FA 4P6YA 4RUHA 1HDUA 4GZYC 2WYRA 2GLFA 3D4RA 1H9JA 1GUSA 2RFHA 4PQAA 2ZEEA 3A8JE 4DNRB 2EWBA 3B7IA 4FBEA 5CBMA 2PIZA 3SI2A 3V38A 4H0LC 4JBWA 4KMUC 5KNBA 3PB7X 1H9SB 3T53B 2BOAA 2F8HA 3B3TA 5CPAA 2AFMA 4OIWA 3TZUA 2BE5C 4ZY2A 1HEEA 3BHXA 5LYIA 2ZOGA 3IFEA 3VARA 5HVGA 4DYOA 5THWA 2ABZA 1CP6A 4FAIA 5HVHA 1XFOA 3GLJA 1Y0YA 4R7MA 4NGPA 1FYCA 4F9VA 3D7GA 2E76C 1ZLIA 5J1QA 3VR6A 3FECA 2JEAI 4BD9A 1HTPA 3M7NA 1IGBA 2C1CA 3KZWA 3S9MA 4OC2A 4MCRA 2E75C 1TKHA 4JZ0A 3L2NA 1CP7A 2XEFA 2KA7A 1TU2B 5LYLA 1Z7TA 2JE6I 1CPXA 2K7VA 4ZY1A 3QG1A 3CRLC 4MCSA 3KQZA 3SJXA 4P45A 4KKUA 1ARMA 1VF5C 1Q90A 3WDNA 4DNTB 2EK8A 1DXMA 4YU9A 3VR5A 4FUUA 1PMRA 2B8GA 1G291 2NN6H 2AFZA 4P4DA 2Q4ZA 2ZEFA 1BPNA 1H9KA 1ZKOA 1QJOA 4TQUS 5I4MA 5DS0A 3IEHA 3SJEA 5KNCA 3SJGA 3VH9A 2D2CC 4MXUA 3PUXA 2D5DA 4MHYA 4IFDH 1GJXA 3K9TA 3KHZA 5LYDA 4NJRA 2IT1A 3TC8A 1RTQA 2JEWA 1TKWB 5JH9A 4X3RA 3SDZA 3A8IE 3T8WA 3CT9A 3PBBA 4TNUA 3BXMA 1LANA 3WC5A 1I6VC 4UF4A 4MHNA 1TF9A 1YSJA 2YYZA 3GUXA 1YNJC 4AXVA 3WC7A 3ISXA 1GHJA 2A68D 5K36H 2CW0C 3OW7A 3PV0A 2OR4A 4DJLA 2IQ6A 2BCOA 1O7LA 3V7ZA 3I72A 1Y7EA 4P4EA 4WJBA 2O5IC 3LWUA 2ZEDA 1ELLP 3WC6A 4ZX9A 3B35A 3D7DA 1IYUA 3B2YA 1OXSC 1Y69U 4A39A 2DNCA 1BPMA 2ZT9C 2ZOFA 3HGBA 4OKOA 5IB9A 3MN8A 3QNVA 3D67A 3PRTA 1YNNC 2V8HA 3KQXA 5D8NA 2BE5D 3KHXA 1CFMA 4OC0A 4OC5A 4NGTA 2OOTA 1XRYA 1LCPA 2V77A 4H44C 4ZYQA 1E2VA 2AWOA 3M85A 4KI0A 4KKTA 1VHOA 5LYFA 2Q51A 1ZG9A 2BA1A 3KR5A 4G7ZC 2LMCB 3BDOA 3FF3A 4GM5A 4MHZA 4NFRA 4ZI6A 5K8NA 1CI3M 3S9LA 5F09A 2G9DA 2A6EC 2KCCA 4DK1A 4MHPA 3PFEA 2HC9A 1IY7A 1XMBA 4R8FA 3RLFA 1H8LA 2BDOA 1IW7D 2ZEMA 2NSMA 4PPZA 4HR7B 1GUTA 4Q7AA 2QJ8A 2CF4A 3LMSA 1VCIA 1O78A 5K8OA 2AFOA 2ZENA 1CBXA 1Y8OB 2L5TA 1FT7A 1BAVA 3D66A 4WWVA 2K32A 1F57A 1VHEA 1Z5RA 1LAPA 1PYTB 1TF8A 3IWWA 4OC4A 4OP4A 1B9NA 3B3WA 3AB9A 4OO1G 1QQ9A 2CTCA 3IJ3A 3FVLA 3PB8X 5K8MA 2PJ4A 4IQZA 4G1PA 1VIXA 3WT4A 3DGVA 1IW7C 4XTCS 2PJ3A 3D7HA 2AFUA 1YMEA 4OMEA 4TKOB 3CDXA 1ARLA 1GYTA 2FVGA 1ZLHA 1KWMA 1Z2LA 4KHZA 2JXMB 1EE3P 1DCZA 1VDZA 1R43A 1AMPA 1ELMP 4F8ZA 4UEFA 1E2ZA 5C0XG 3H8GA 2EDGA 2V8DA 3D4UA 1HCZA 2PJ0A 1ZYRC 4KN4C 1GUNA 2QVPA 3FJUA 2R6GA 4NGNA 3ISZA 2ZELA 1LAMA 1M4LA 4IAVA 4OC3A 2EVBA 3IKJA 3PB9X 3M4YA 1OXUA 2PJAA 4P4IA 2PVWA 4YWYA 3D31A 1H9MA 3KASA 1OBRA 2JBKA 2PJ5A 1UWYA 3PEIA 2CIJA 4ZX8A 4I7ZC 4DUKA 2QF7A 3IC1A 4P4FA 4X2TA 2ZEHA 1FNOA 1Q7LA 3CPAA 3GB0A 2RB7A 3KR4A 3NH4A 2A69C 3IO1A 4JYWA 4TWEA 1OXXK 4W9YA 1GUOA 3SE0A 2PJ1A 4PXCA 2A6HC 4PV1C 3FX6A 4H2KA 1FR3A 5JEAG 4PXBA 2A6ED 1Y8PB 1F2OA 3U9SA 3A7LA 1GHKA 4MRIA 1ZG8A 2EJFC 4KKSA 2BO9A 1OXVA 2PJ9A 4PXDA 4MCQA 1Z6HA 3QIAA 4L8JA 2ANPA 3H94A 1TKJA 2NN6I 2CTBA 4BA1I 3N5FA 5BN3A 3NFZA 2PJBA 2GREA 3BI0A 2AFSA 2XEJA 1YW4A 2WZNA 4LJZC 4LK1C 2EJMA 3GQBA 3NE5B 1CG2A 3HUVA 4XIGS 1CPSA 2AFXA 3SI0A 4B6ZA 2BA0A 3T56B 1DD2A 1H9SA 3DLJA 1V43A 2EJGC 1LOKA 4K3NA 4EMEA 2POKA 1B9MA 1VF7A 2C6PA 3KLRA 2V8GA 3FH4A 2PJCA 4NGSA 4EWTA 3VR2A 2PIYA 3OPOA 4G7OC 3D68A 4OO1H 2DNEA 4UEZA 2DN8A 3RBUA 2AFWA 5A35A 3CRKC 2QYVA 2Q8IB 3K2KA 3ND9A 3SI1A 1AYEA 3QJYA 2V4DA 3P20A 1QMUA 1F2PA 4PXEA 3A7AB 2D62A 3LNNA 1K8MA 2XEGA 2O53A 4OC1A 3B3CA 8CPAA 4EFDA 1IYVA 1LACA 3FEEA 1Z8LA 3KI9A 5C0XH 1BLLE 3JRUA 2PJ2A 1E2WA 5KNDA 2AUKA 1Y8NB 3IFTA 2PPBC 3H8EA 4NGMA 3I73A 1XBUA 3NH5A 3S9NA 1XJOA 3VR4A 2ZEPA 5LRJA 4CPAA 3EQLC 2DEAA 3VATA 1LABA 3PUWA 4MMOA 1HPCA 4A94A 3GD7A 3PB6X 3SJFA 4NJQA 1EWHA 1V8QA 3FMCA 4NGRA 5LRGA 3MXUA 4P44A 6CPAA 4F9UA 4H13C 4ONWA 4MCPA 4KN7C 4RCNA 4JK1C 1YLOA 2C6GA 2A69D 5D29A 3RAMA 2JEBI 3N6RA 1ZG7A 3KGQA 3KL9A 1YW6A 3VA7A 2A6HD 4KSIA 2E74C 2ZEGA 1Q1BA 1Q12A 1R3NA 4R76A 2GLJA 5ELYA 5JEAH 2PCFB 3RZAA 3BG3A 1LFWA 3I4LA 2PRQA 2F7VA 5LRKA
chains in the Genus database with same CATH superfamily
1ESRA 4X64Q 2DPSA 1VGYA 2KVMA 4H6ZA 1JQGA 1IXRA 2K1BA 3VR3A 3QO2A 1TWFH 1WWZA 1XMTA 1SMYC 4HSVA 3LGJA 4NP5A 5JPMC 4CAWA 2K50A 1G2SA 2I3CA 1JJCB 3E0KA 4DV7L 3IU2A 1CTMA 4JI1Q 2P5ZX 2VZAA 4A3JB 1IL8A 4ID6A 3H3VI 1HNWL 2Z3PA 3VWDA 2F0SA 2VS1A 1CZGA 3C2PA 4JXRA 4QUFA 1MGSA 4OEMB 4FF4A 3PUYA 1NE3A 1Z4RA 4L89A 1V1PB 2GU2A 4IHMA 4BA2I 1RDPD 4UA3A 1VQGA 2XN9C 4Y7NH 4OGQC 1IOFA 2K5VA 4X8IA 4AVBA 4C56C 1IBMQ 2NN6G 3I1UA 4HIKA 1G6ZA 3T51B 2C6CA 2XTIA 1PRTC 3HOXG 3RMHA 4P4JA 4LF8L 1NR2A 3NQIA 4P4BA 3TOBA 4YCUA 1WTRA 2JYOA 4KD4A 1A6XA 3FPPA 1XPUA 4OIDA 2RCNA 1LYLA 1Y1VH 5CBAE 4J3GA 3IIBA 5EGTA 1SRUA 2E2IH 4C7HA 3W6SA 4UAIA 3P7JA 5EPJA 2R92B 2V8VA 3QAHA 3F2DA 4KUBA 2JA6G 3MRUA 4R9WA 2LXKA 2F4VL 4DR7Q 3FEDA 5LMNQ 3K5OA 1JJ2A 4QMGA 2PR1A 2J9AA 4PK2A 3D4DA 2A1AA 1D5ZC 1SNDA 1TWGB 5K36G 1L2FA 3BDLA 2R7FA 4RGTA 4E2AA 5IGEA 4UIAA 2K5TA 5AG6A 1EY5A 1EY4A 3D7FA 4P6YA 1HDUA 2WYRA 1U4RA 2KUMA 2VBQA 1H9JA 5FLXE 1NCVA 1GUSA 1WVLA 1YZ6A 3HOZH 2CWAA 4OHJA 2ZEEA 4C3JH 1QOHA 3TBIB 2PIZA 4K6LA 1CA5A 2XIWA 1R9TB 2RDGA 3S2HB 4XPDC 4GS3A 4KMUC 3TMEA 3M4OH 4A33A 4A3KB 1KDAA 1TVXA 3K7AB 1F9SA 3EO4A 3PB7X 1UEBA 1EYGA 1SNMA 2B2TC 2R93G 2AFMA 4JC0A 1L1OB 3BYTB 1DOKA 2FT0A 3BHXA 4C2MH 4U5YA 3VARA 4BXXG 1IIDA 3R9GA 5THWA 4ULLA 2IY5B 4JI4L 2F52A 4IJHA 4JI0L 2ABZA 4JI6Q 1EOVA 1XFOA 4LNQA 5C5LA 4F88A 3HOWG 4X3KA 3TEHB 1BBUA 3Q24A 2NMTA 1GXDC 1GO3E 4HIDA 3D7GA 5BWAB 5J1QA 2KOLA 1JR0D 4BD9A 1RKNA 3KZWA 2F0LA 4DR1L 4IO9A 5F49A 3L2NA 1TY2A 3E9IA 2XEFA 2Z8LA 1E24A 1TU2B 2AQ1B 2EXDA 4RGOS 5LYLA 1Z7TA 2JE6I 3CMEA 2P6EA 1I5FA 1WFQA 1TWAB 5IP9H 3QG1A 2H5XA 2SOBA 4P45A 2OWOA 3F8TA 1U6MA 5DAUA 4NXYA 1SFOH 4NXNQ 5BR8L 1DXMA 1SXTA 1X32A 2EY5A 2B63H 1MD2D 4A3DG 4FUUA 1PMRA 4DV5Q 2B2VA 3BJ8A 5D65A 3MXNB 4JI8Q 3D2MA 1VQ7A 3RLNA 4DF7A 1Q2DA 5DS0A 1VQ4A 1S7LA 4JCVE 1AUGA 4B13A 5CV9A 4EVYA 3PUXA 3TSSA 4MHYA 2D4PA 2OQ0A 4FXGC 3KHZA 2IT1A 3TC8A 2F0KA 1B4OA 5JH9A 1QNUA 2F0OA 4DR5Q 1RO5A 2ZM6L 1SJHD 5A2QE 1RTOA 4TNUA 4KORA 5IGFA 2BUEA 1STGA 3CHBD 4JI5L 1CSPA 3F0AA 1VKCA 1YNJC 2KQ3A 3QWNA 5C4JB 1CKNA 1UAPA 5DWNA 4FP5D 4AH6A 4AQYQ 3A9LA 2A68D 5D3IB 3EFAA 1QUQA 2EYFA 3I4NH 3OW7A 1KQSA 3R95A 1QSOA 3L2PA 2Z3MA 1X3GA 3RZOB 1O7LA 3K57A 4P4EA 1CHQD 2ZEDA 1EY7A 2M2LA 3QB3A 4RCOA 4K5VA 4Y7NB 4ZX9A 1IYUA 4UPAA 3CCJA 2DNCA 2Q2IA 4QB9A 2HHHL 5KIXA 4DAMA 2ZT9C 2UUBQ 2AKWB 3HGBA 5IYBG 5A27A 2QCPX 5IB9A 1PH2A 3CKIB 3S6HA 1SNQA 3HS0C 3QNVA 2JA5H 3KQXA 2ZPAA 1ICWA 4DV2Q 2OOTA 4H89A 4WRDA 2CQAA 2IHEA 4OLLA 1Y1VB 4DU9A 1KL9A 1A15A 1HZBA 4JG2A 1N34Q 4ZYQA 3FRMA 4EQ5A 4K0KL 4KI0A 3SXNA 1B2TA 5EJWA 1ZG9A 2LXJA 3K9UA 4M8AA 4KVOE 3KLSA 5FO8B 1PTOH 2NTSA 4NFRA 1HJPA 1KD1C 4DK3C 2GFQA 5K8NA 4L5QA 1CI3M 1GKHA 2EYOA 3G6EA 4ME5A 3T1HQ 2SEBD 1S7NA 1MJEA 3S9LA 1S5BD 2ZXRA 1FNVA 4OONA 4DK1A 3PFEA 4IALA 1XMBA 4DV1L 2ZEMA 3DM3A 1BBXC 2NSMA 4Q7AA 1RXTA 2REFA 4L6TB 3SVMA 2C9OA 2BSWA 5NUCA 1I6HH 2EO8A 3QOLA 3HOWB 1TWHH 1X54A 5JPNC 1NJIC 2X7BA 3HOZB 4KS9A 3NWSA 2AFOA 3NTKA 4WFN3 1XF8A 2Z11A 2ZENA 1CBXA 1Y8OB 2VUMH 2KEDA 4K8JA 2L5TA 4Q0FA 4YCVA 3L3OC 2PQEA 3SR1A 1XYIA 2IX1A 2BDNA 3RZDH 3M4OB 3MA2B 4ZLTF 2TMPA 5IWAL 4KOWA 1UE7A 1N8RC 2K32A 2NVXH 3X3MA 2Q2TA 4A30A 1PYTB 1TF8A 1K9MC 4OC4A 1JOQA 2I07B 3IJ3A 2Q04A 4DR6Q 4CJ1B 4IPGA 5DLQE 2HQYA 1LTSD 2A5HA 3PB8X 2VW9A 2PJ4A 3H0GH 1WYDA 4G1PA 3WR7A 3WT4A 3D7HA 2AFUA 2AMCB 3S9WA 3MVVA 4DUYQ 3EC4A 4RN7A 1GYTA 3R3OA 4QVTA 3KFUA 4IZ8A 4A3DB 1EWCA 2UXCL 4LFCQ 2VUMG 1R43A 1DCZA 4P74A 3I56A 1YVKA 4RGNA 4RGMA 1ELMP 2MP1A 4K2LA 4PG3A 3C1FA 5C82A 1E2ZA 1G51A 5C0XG 2V8DA 1HCZA 1YVOA 1RODA 2J7ZA 5F48A 5JOBA 5IE8A 3WOFA 2HV2A 2VZYA 4IFDJ 2Z0ZA 3VYSA 2R6GA 3A55A 3HP3A 1N32Q 1LTTD 2MQHA 4A3LG 4AB7A 5HMNA 3TS0A 4IAVA 4KD3A 3F2UA 1QILA 1CM9A 1HNZQ 1VQNA 2OQKA 3IKJA 2YNDA 2LFNA 1SLJA 5C3XA 4YRHA 1OXUA 2PJAA 2C5CA 2L12A 3GTOH 2B2WC 4ME3A 1LTID 4K14A 1O7YA 3D31A 1G6PA 1H9MA 2QECA 3T13A 1YEZA 4QUCA 1YNND 3CW2C 5C4XG 4F7XA 5IB0A 3KLSX 1G91A 4FXKC 4ZX8A 5L37A 4KOYA 3GYAA 2DGYA 4P4FA 3TZDA 5KRUA 4BS9A 1JQYD 1S5DD 1Q7LA 1SYBA 4K5XA 1SEBD 3GB0A 1SYDA 3U9OA 3NH4A 2Q4VA 3K8AA 1WTHA 1IHZA 1HRJA 1EIFA 2QEJC 5KTDA 1X65A 2CHBD 5EKIA 1JMCA 1IKMA 3CC4A 5FKAC 3K5NA 1HA5A 1NTGA 2R8VA 5CV5A 2A6ED 2RQXA 1CZWA 1JE5A 1Y8PB 3A7LA 4MRIA 1LT3D 1ENCA 4LMQD 3ER0A 3HKZG 4KKSA 1OXVA 2PJ9A 4B5PB 4BY7H 4CGNA 3V96A 3Q22A 4PQXA 3GTKH 3TRZA 1QZGA 2EVNA 4A4IA 2CTBA 1BOSA 4E8OA 2NVTH 1P8LA 1BR9A 2Z4HA 1EIYB 2GREA 1LT6D 3NBHB 4C7IA 2HQLA 1D5MC 2ODFA 2F0DA 4BBRG 3GDEA 4A3FH 1EUJA 3OTOQ 3VYUA 5FJ8H 2WZNA 3AEVA 1X12A 2CH4A 2EPBA 4YHHL 3D6CA 1SJED 3RO0A 1A62A 1XE4A 2VXKA 3S15H 2I5LX 5IGCA 2POKA 1YHBA 1WTVA 5CNPA 1VQJA 2OT2A 3VR2A 2Z3OA 2PIYA 3DR8A 1PH9A 2WV6D 2DN8A 2A4NA 4GNXA 2Q8IB 1NUCA 3K2KA 5AG5A 2WKDA 4JYAL 1AYEA 4KUAA 3QJYA 2EYMA 1FD7D 1QMUA 3C26A 1B87A 5G3LF 4CJ0B 2P6GA 4A3FG 1YBYA 3JC66 4R3KA 1A8VA 2XEGA 5DEHA 3S24A 2PQAA 4OC1A 3GTQH 1XMQL 2F3WA 1ASYA 4EFDA 1YQEA 1LACA 4KHPQ 3KI9A 1EU4A 1UUPA 4MTNA 1EY0A 1E2WA 4MHDA 2AQ3B 1U0LA 5FO7B 4DV3L 1I6HB 1QG7A 2B39A 4RKLA 3IFTA 3FB3A 3ULLA 3H8EA 2WP8J 4DV4Q 4NGMA 2J0TD 3I73A 5EKLA 1EQQA 3E0JA 1XJOA 4A3GH 3PZJA 3SGIA 2EYJA 2VUMB 1V1OA 1PYBA 4R87A 2E2DC 1MBYA 3VATA 4GLAC 1LABA 5IP7H 1ON0A 4R4QA 1S5KA 3ULJA 2EQSA 2GA4B 3P1HA 3K5LA 2OZUA 3W2DA 4OWTB 1SBBB 3ERQA 4CHTB 2NVXB 2FXFA 5CV6A 4RHSA 4KLVA 5I9PA 4KOXA 3TOAA 3I7FA 3P2HA 1NAPA 4F9UA 1F77A 1F2MA 1PRTB 1E22A 4CAXA 5KTCA 3DNSA 1N36L 1B50A 5COYA 4A3EG 1VQ9A 4L5SA 3EROA 4WORA 4XYOA 4ZAIA 1IU8A 1PZID 1QCBD 1QSNA 2M9VA 2B4DB 2Q2HA 2A6HD 1STYA 2JJQA 2UU9Q 1Z4EA 5JEAJ 1OO9B 2PR8A 5C4XB 4A3JH 4DUZL 3G4SA 4JPBW 1PH3A 1WTOA 1X55A 5JEAH 2GLJA 4GXHA 5IYCG 2FHTA 2JA8H 3I4MH 1CK1A 1MK4A 4A3IG 3R2TA 2QIRA 5FLXL 4WJ4A 1PCAA 1PYWD 3L7ZC 1BXTA 4IUSA 5EKKA 1NNXA 2KCTA 2PJ8A 2OTLA 5BN5A 5JM6A 3RN5A 1UE6A 3KF8A 3SHLA 4PZ6A 2F1MA 2PNRC 1FL0A 1GUGA 3F2CA 1XNRQ 3S2DB 3B3SA 1OXTA 4F8MA 1SYCA 1UE5A 1PUAA 3EBEA 5GAGC 3H8FA 3MGDA 3HKZB 4LF7Q 3PB4X 5HVFA 3M4PA 3HKZE 4XPDB 4A3CG 2NYQA 3PBEA 2K05A 2K33A 4G57A 4DR3L 2JA8G 1ASZA 5CR3A 3I4MG 4F0YA 4X66L 1A2ZA 2IJZA 1VQMA 2NB0A 3HLPA 1YJ9A 2O4HA 3TX8A 3FKIH 2HCIA 1I21A 1VMCA 4UFWA 2ZEOA 1S72A 1BUVT 4KOUA 4A38A 5J8CA 1ML0D 4JD6A 4KVXA 3UDIA 4FF3A 2E5LQ 2F0EA 3K81C 1CKMA 2DUDA 4UDUC 2N49A 2Q4YA 1CHPD 5AJ3L 1J4JA 3CPXA 4EQPA 5E4XA 2NYZD 5BN4A 4DR4Q 1HZAA 2MGSA 1Y0RA 1MHWC 5M3MG 3FNCA 1F9PA 1U4MA 5K8PA 1XWEA 3CXSA 3VA5A 1G8ZD 2ZJQA 4A3KH 2JA7G 2UXDL 4A3FB 1FY7A 3W3AA 4ILWA 7CPAA 1HFGA 2A68C 3NWTA 4PZ7A 3S6FA 3D4RA 1SR3A 1K73C 4HTHA 1PH7A 3L9AX 2K01A 3S15B 3A8JE 2Z1CA 1KZFA 3B7IA 4NSQA 4RH6A 3V38A 1YIJA 3GTJH 2ENBA 2I79A 2HIVA 4RHRA 5I2YA 5JJIA 1M4VA 1SMXA 1MJ9A 2F8HA 5CPAA 2WSAA 2Q7BA 4JV5Q 1XTDA 5A2QL 2DXQA 4ZY2A 5C44G 1LT4D 4IF5A 2DF5A 2OU2A 2ZOGA 2VI7A 5HVHA 2VQFQ 3PO2G 3GLJA 3URYA 1TWAH 1A63A 4EGVA 4KHVA 1S7FA 4JJXA 4KTAA 1ZLIA 3VR6A 1GHEA 1S3ZA 1GD7A 3OWEB 3VDYA 4B3SQ 3M7NA 1GVPA 4A3EB 2E75C 3K58A 4JZ0A 2Z10A 2UXBL 3H3VH 1XPRA 5H84A 2KA7A 4A3GB 2B29A 3CP0A 1XNQQ 5E1FA 4POGA 1CPXA 4MNOA 4MFQA 2K7VA 3CCQA 2YNCA 2R98A 1HNXL 3CRLC 2N8NA 3KQZA 2D9UA 4LF5L 3LWEA 2RVLA 2ATWA 4IUTA 4FNFA 4QY7A 3SK4A 2KCWA 1K8GA 2JA9A 4UWIA 4DKAC 1WOCA 4A3IB 3WDNA 1M44A 1L0CA 2EK8A 4B3RL 4YU9A 4QL5A 3VR5A 3CCMA 4UP9A 2E2HB 2TSSA 2NN6H 4P4DA 2ZEFA 1ZKOA 1Y1WG 2QDLA 5I4MA 3HOXH 2XWJB 4CGPA 2AE6A 3SJGA 3VH9A 1IBLL 2XWBB 3CAMA 5C4JH 4Y52H 5C88A 4FF1A 1GJXA 4B14A 4A76A 2B4BA 2VQEL 2B5GA 4NJRA 1DGSA 1RTQA 3S17H 4AG7A 4X3RA 2R7DA 3D3RA 2C27A 1PRTF 3DEOA 4KV6A 3RZOH 2JA8B 3I4MB 1JWQA 1PZJD 4LAAA 3BXMA 5FLMG 1I6VC 1W3SA 2JP1A 2JA6H 4JVZA 1NBWA 1EFWA 3DEPA 3M3YH 4LUAA 4CYQA 1J5EQ 2Y0SG 5K36H 2EXZA 3PV0A 3NBIA 4B3TQ 2JSOA 2OR4A 2IQ6A 5ISRA 4RG1A 1EY9A 3S1RH 2BCOA 2RSOA 2IX3A 3CF5A 1PH4A 2R7ZG 2OH1A 4JBJA 3V7ZA 4AG9A 3NE7A 2O5IC 3LWUA 4N8X1 4F0XA 4NPSA 2RSNA 2G9HD 1N33Q 3PO3G 3WC6A 3CZXA 4X64L 3D7DA 2RKSA 4M6IA 1BPMA 2QW7A 1LTAD 3W5OA 1YGHA 3BJ7A 3OIPA 1EQVA 1IYJB 4ZUIA 2ZOFA 5I2XA 4ONUA 2R61A 4UFVA 4KY7A 4XT3B 2RDHA 3MN8A 3WWVA 1YNNC 3FKIB 5T1GA 4JI1L 2V8HA 1EZ6A 1GOZA 2R93H 1CFMA 2JK8A 1MKHA 4DAVA 4NGTA 4OC5A 1I4QA 1LCPA 1EIGA 4DXFA 5C3EH 2Q0YA 4BXXH 3M85A 4CDFC 2VEZA 5LYFA 2Q51A 1BBWA 2GN5A 3K59A 2I46A 1W6KA 3C3LA 4A2ZA 2VY3A 3KR5A 4XQQA 3HOWH 2LMCB 3BDOA 3FF3A 1C8CA 5J3BA 4GM5A 4MHZA 1PFSA 1IBML 1HXYD 3I91A 2L55A 2IJ0A 4YGOA 2ZXOA 2ICIA 1K4JA 3SXHA 1ILQA 2G9DA 3D3SA 2A6EC 2KCCA 4MHPA 4CDCC 2HC9A 1JWUD 5C44B 4BINA 3SK6A 2MNAA 1MSGA 1H8LA 1YVCA 4JBKA 4GOPC 1IW7D 4PV6A 4PPZA 3PO2B 3PMFA 2MJ8A 5C3EG 3DWPA 2G3TA 3TE4A 1S5ED 4FO2A 4JI7L 1M1KC 4NDXA 3MAQA 2F0QA 3GTJB 2DY8A 1PYSB 4DR7L 4GS4A 1FT7A 5LMNL 4WJ3M 3HOYG 4A3DH 1SDFA 2PZUA 2L9HA 4K5WA 5IT9E 3S1NB 2OTJA 4DAYA 3IWWA 5BR8Q 4OP4A 2GE3A 5LHY1 4IPHA 2ZXPA 2D0OA 4ZUJA 5K8MA 4JI2L 4IQZA 1W2BA 1M90C 4OMEA 2A8VA 3J7AV 4KY6A 4TKOB 3R8BA 2KHIA 5C4HA 1ZLHA 3NE8A 1Z2LA 2JXMB 4OELB 4HJ5A 2JDCA 2ZXVA 4GKKQ 1Y1WB 1TR5A 2ZM6Q 1DJRD 2ES2A 4TVAB 2DJFC 1STHA 4FD5A 3D4UA 3E6ZX 2PJ0A 3CQZB 4GN5A 5IY0A 3BLNA 1XEBA 5ELFA 1KUXA 2LY7A 5CMDA 1I4HA 4V0BA 2QVPA 3FJUA 4MFLA 1KRTA 2LS01 4JI6L 2AJ6A 5HY6A 5E4WC 4KK7A 1IB1E 3ISZA 3OWFA 4ALPA 2CY2A 5F47A 1V1PA 4LFBQ 4FD6A 1FGBD 1HUMA 1F9RA 2KCMA 4P4IA 4YWYA 3QAYA 2K5QA 3I70A 4A3MG 1SNOA 3KASA 1OBRA 2CWPA 5IYBH 2PJ5A 1FNWA 2Y0SB 3HOXB 4CJ2C 1UWYA 5EQ0A 3U50C 2CIJA 2V1CC 4MFZA 2F0VA 4DUKA 2QF7A 2Y0SE 2X69A 3IC1A 5G1ZA 3EN2A 2YNEA 1FNOA 2R7ZB 1Q2YA 3JAML 5JJZA 4S3SA 2HD3A 3S17B 1XOVA 3LD2A 2MO0A 4QBJA 4R3LA 4B10A 4NXNL 3KF6B 4TWEA 1OXXK 3DDDA 1Q2CA 4C3IG 3K6OA 4R9MA 4PXCA 2A6HC 3R93A 2YV5A 4H2KA 1EOTA 4CDEC 3E9HA 4JI8L 2JA6B 3GTPB 1PU9A 2VNUD 2X6GA 2HCCA 1D6EC 3J81L 4PXBA 1HUNA 3OMCA 4Q36A 1B44D 3U9SA 3WOEA 3RNZA 3V2TA 3M3YB 2ZW7A 3VYTA 1M1DA 4PXDA 4XQJA 3RR5A 3GTLH 5JVG3 1TKJA 2CVRA 3T1YQ 4UCPA 3S1RB 4BA1I 1RL2A 1VQOA 3N5FA 4CGOA 1KRSA 4A3BG 4KLWA 2PJBA 2BH8A 4LF4Q 2BOSA 1LRZA 2AFSA 2OCEA 5GAHC 2RDFA 3FIXA 2KCNA 4LK1C 1R57A 1WK4A 5EPLA 4BY1G 2XRSD 1HR0L 1CG2A 3ZJYC 1CPSA 4B6ZA 1JB7A 2BA0A 1DD2A 5EPKA 1LOKA 1YNXA 4AQYL 3TO7A 4C3HG 4NGSA 2K6AA 2RHSB 2R93B 4EWTA 3A54A 1L1OA 3QOJA 5IWAQ 4CRYB 1VQ8A 5C3EB 1IKLA 4HMIA 3H15A 4LF9Q 5A35A 3CRKC 1EL0A 4ORFA 3TCVA 4CYPA 2B2VC 2G5DA 3SI1A 3ND9A 3OYYA 1P16A 1NMTA 3P20A 5ELEA 1I12A 4MZ9A 1F2PA 3TP7A 5C4ZA 1STAA 3N7ZA 2D62A 1SN8A 3LNNA 4F87A 2O53A 3B3CA 3NPPA 2K4KA 3R1KA 1BCPD 1UE1A 1KAAA 2JLMA 8CPAA 5C6AA 2RBMA 2UXCQ 1Z8LA 4P71A 4C1NK 1G2TA 5C0XH 2J8RA 5FVJA 3JRUA 1ZYRD 3KYHC 2PJ2A 4U68A 3SHPA 1CUKA 2XSCA 2IL4A 2CFMA 3JAMc 5AG4A 2AUKA 1Y8NB 2ICEC 3GV6A 1E1TA 1XBUA 5M9OA 1PTOD 1QSTA 3NH5A 3AYHB 3S9NA 2EOTA 4A3LH 2HQEA 1EQRA 2P0WA 4DR2L 1WJJA 1B7YB 2DEAA 2F0GA 1Q8IA 3T1HL 4FF2A 3GD7A 3J81c 2IW3A 1PFNA 3HOUG 1EWHA 1YREA 3MXNA 3FMCA 4X65L 1VQIA 5C4XH 4NGRA 1LLRD 5LRGA 3MXUA 4P44A 3VWEA 1AE3A 3AMUA 2Z0SA 4PMCA 4JK1C 1I4PA 4J8QA 4V190 4FXDA 2C6GA 2A69D 3RAMA 2JEBI 1NSLA 4JI3Q 1A2TA 3K7UC 1UFHA 3TS2A 3VA7A 4KJNA 4A3MB 4KSIA 4HCEA 2ZEGA 3MWYW 3PIO3 3AQQA 4LWCA 1D2BA 2WAQG 5M5WH 4DAPA 1LT5D 1C7YA 1S60A 5KYLA 2PI2E 4R76A 3S2DH 2PCFB 4CGMA 2FS5A 4OWWB 3NEMA 1I4RA 2F7VA 4DR6L 3SXOA 1JOOA 1LV9A 4P10A 1TT2A 3CPFA 5LL6X 4QUSA 1KDCA 1X9NA 5KEEA 4B12A 1AZPA 1SE8A 3S16B 2FIWA 1KXLA 3KF6A 4O23A 4N8FA 4YWKA 1DTDA 2FMCA 3KDFB 4A37A 3MFYA 4LFCL 3TQYA 1D7QA 2HUZA 4BBRH 2BEIA 5ELNA 4OX9Q 1MJCA 1STBA 3JVNA 4QC6A 1VQLA 3SK8A 2O5JC 2CNSA 1KUYA 4LFAQ 1YLEA 4NGQA 2EYPA 2PJ6A 2Q7SA 2CCZA 3FDTA 4YCWA 3W1GA 2PQ8A 5J8FA 4P73A 1EQTA 2MFIA 1B1ZA 2XEIA 4R6TA 4DA2A 4A3BB 1N32L 1Z9UA 4AVAA 1NMFA 3B3VA 1D8LA 2IX0A 2RCFA 1WD0A 1CX8A 1HNZL 1H9RA 1Q1EA 3O13A 1HZCA 2F0MA 2PDOA 4IUPA 2KENA 1CSQA 4IFDG 3J80L 4BY1B 2B2UA 3PGZA 1B8AA 2X6LA 4JYAQ 3PUVA 4IFDI 2Q43A 4L8AA 3X3NA 1PXUA 3Q8DA 4X6AH 4LX9A 2PCUA 5H1SE 3J7YW 1UWVA 2F0TA 1A3UA 1HQMC 4EVOA 2IMOA 1A3VA 1JICA 2QEXA 1X3PA 3CC7A 3GTLB 3J7AF 1DM0B 1ENFA 1KHIA 4ZY0A 1VQBA 1IOIA 4PSWA 4Z65A 3NH8A 3R9FA 1TS4A 4FWUA 4O42A 4RI1A 1STEA 4DV3Q 1WCMH 4X3SA 5E96A 4B9XA 2FE7A 1Y14B 2Y0MA 3PCOB 4KY5A 3CCSA 2NZHA 4XXEA 4GZYC 2GLFA 1JCKB 2ARHA 3J81j 2KHSA 4K8IA 4YY3L 1JWSD 4IURA 5KGUA 4DNRB 1TWCB 2YGWA 1K8AC 3HOVG 1AE2A 3CXCA 2EY2A 3J7ZC 2QMLA 3SI2A 1U5KA 4JBWA 1JC7A 3A0JA 2IHFA 1NY4A 4FD4A 2F4IA 5I6WA 3LACA 3CMAA 1H9SB 3T53B 4ABNA 4NW2A 1PFMA 3UE1A 2ALYB 3F8KA 4A3EH 4OIWA 4CAVA 3TZUA 4M1UB 1WCMG 3IFEA 5HVGA 4DYOA 2QGQA 5TSSA 2B2YA 1O7ZA 4U9YA 1PFBA 4NMZA 3JAMi 1Y0YA 4DV6Q 1FYCA 5F2DA 2JDDA 4NGPA 5EMIA 3DWQA 1U4LA 5HGQA 4F9VA 2PMZB 2RF4A 4FYDA 1YR0A 5IYCH 2AWNA 4II9A 3FECA 1QNKA 2L15A 2PMZE 3UDXA 4DXGA 2JEAI 1HTPA 2Z6KA 4A3IH 1IGBA 2C1CA 3S9MA 3D8PA 1SSOA 1HR0W 4HIMA 1PH1A 4RMFA 1AP0A 3K5MA 2F0HA 3STBD 2E2HH 2FSRA 4CDDC 4K2KA 1YK3A 2LKVA 2PW7A 2PI2A 1RF2D 1Z8XA 3HFZB 4CRZB 2O28A 4ZY1A 1SAPA 4NF1A 1Q7YC 4MCSA 1F2LA 4L5RC 3SJXA 4EX5A 1PH6A 4KHPL 1ARMA 3S6GA 1Q90A 3GTMB 2F5IA 3BU2A 1PH8A 4A3CH 2K14A 4PMWA 3H4QA 4DV4L 1AZQA 5D14A 2B8GA 3HKSA 3EA6A 1BPNA 1NE9A 1KABA 3HZXA 1H9KA 5DM73 1QJOA 4TQUS 1SYEA 4WJWA 5M3FH 1XMOL 2J4XA 5EBDA 4MY3A 2HT1A 2A19A 2D2CC 2R3ZA 4MXUA 4QIWB 2D5DA 1AN8A 3BVMA 5ELBA 3K9TA 4QIWE 3BZDB 5M5WB 2SNMA 4MBUA 4A95A 1TKWB 2ZW5A 4GNXC 3EY5A 4PZ8A 3SDZA 3R96A 4X62L 3A8IE 1JORA 4ODGA 1STNA 3R9EA 4B5PA 2BH2A 1LANA 3WC5A 4BBSG 3GIUA 4MHNA 4UF4A 1TF9A 5M3MH 1YSJA 2YYZA 3CXQA 3PSIA 1M8AA 4GOPB 1Q82C 1IBKQ 4JBMA 4ZRZA 3G48A 3IAYA 1YX0A 1PDQA 3ISXA 3WC7A 4B11A 1GHJA 1MIUA 1HZ9A 3NBHA 4N9PA 3UI2A 2ZJPA 3ZYYX 3M9BA 4XQNA 4DNIA 5M3FG 4PNYA 3AFQA 2JA7H 4BBRB 2UU9L 2GIVA 1N9WA 4L63B 2NTTA 1B6BA 1ET6A 5IT9L 1EY8A 3I72A 4B9WA 2FL4A 1HQRD 3JTKA 4I7AA 4GKJQ 1ELLP 2CXAA 1Z8WA 2F0FA 4JOIA 3B2YA 5CV7A 3B35A 1QVCA 4M3SA 2LSSA 1RCVD 5C3WA 3FXTA 1TXYA 4QF4A 3D67A 3PRTA 1VQDA 3CC2A 2BE5D 3UE0A 4HNXB 1HH2P 1WTXA 4OC0A 5GAEC 2H5MA 2UUAQ 3KBXA 2NVQB 2J8MA 1XNRL 1EEFD 1XRYA 3LODA 5C44H 3I4OA 4H44C 5FK9C 1E3PA 4UP8A 2EY1A 1E2VA 3BJUA 2P6FA 3PIP3 1PVOA 4CYOA 4KKTA 4LF7L 3A56A 2EYLA 3CD6A 3PO2H 3HOVB 5CYUA 1RTNA 3RD4A 3BS1A 1HHVA 4NXMQ 3VYRA 4ZI6A 1I94Q 2E8GA 4IUQA 5ELCA 3NXWA 2VL6A 2N55A 5FLXc 2JN4A 5F09A 4KOTA 4O2DA 5K5PA 2R92G 2H4OA 1IY7A 1WCMB 4R8FA 1YI2A 5LMUQ 2G0BA 4HR7B 2EZVA 3S1NH 2Z9HA 2FCKA 2E5LL 2QJ8A 2ZTDA 3IRBA 1BVSA 3LMSA 2WKCA 1VCIA 4GN4B 1EYCA 2E2JB 2F0NA 4DR4L 3F5BA 4AVCA 4U9ZA 5GQOA 4APVA 2SNSA 3D66A 4WWVA 1Q3LA 2K04A 2O4XA 4DV0Q 1F57A 2UUCQ 1LAPA 4AYBG 4B3RQ 1Y1WH 1FJGQ 4OO1G 1QQ9A 2CTCA 3RLOA 1PHJA 3Q6SA 2B4DA 1SNCA 2N78A 4R4IA 3CQZH 4UCNA 4A93G 5GADC 2PC1A 4OO1I 3BDCA 3NSWA 4YIJA 1DOLA 2Z6BA 4XTCS 2PJ3A 1IBLQ 1P0HA 1ET9A 1KDBA 3CDXA 2FVGA 2YTXA 1KWMA 4DV7Q 3BVGA 5IOCA 3C1EA 4KHZA 1HNWQ 2VQEQ 1Q8KA 1EE3P 4UCMA 5FLMH 4F8ZA 1H95A 4XYQA 2IPKD 1YJNA 4UEFA 3H8GA 1BCPC 1VQFA 2EDGA 4TRDA 1OZPA 1J9OA 5AG7A 3KBGA 2CW0D 4K6DA 4Q38A 1ZYRC 2KBNA 1GUNA 1PZKD 4P72A 3CCEA 1D5XC 3EIVA 4X3UA 5M5YB 4NGNA 2ZELA 4Y49C 2K28A 1LO5D 1M4LA 3K80C 2R7ZH 4OC3A 1PTOC 4XDXA 1EYDA 2Z3NA 3HRZC 4LF8Q 3SK5A 4BBSB 5AFWA 3PO3H 4IPDA 3TDQA 1EIHA 4B3SL 2PVWA 5I9OA 1S5CD 1AW7A 2ID0A 1F2YA 3ONAB 3CCVA 1KTKA 2B2TA 1CQVA 2F0WA 4IUUA 5CBEE 3F2BA 2REEA 4NEXA 5M3FB 3KLWA 3PEIA 1XNQL 1ICFB 3GTPH 2EIFA 1QVFA 1VMPA 3HG9A 4ZGYB 1KAWA 3B8GA 3TP8A 3PQIA 4X2TA 3DSBA 4HPSA 1L0XB 4CKEA 2F4VQ 1PH5A 2RB7A 4LF6L 2AHOB 3S14B 2A69C 3L0OA 4OAEA 3EJIA 4JLYA 4JYWA 1CQFA 1I4XA 1T9HA 5IYDG 4B3ML 1B53A 3GTGB 2Q8RE 3SE0A 3S1QB 2PZTA 1S7KA 4H7BA 5M3MB 4CAFA 1O80A 4HNWB 1A3TA 2NWGA 2CQOA 3PIOA 1XJVA 5I4DA 4RWSC 1F2OA 5J22A 2OF1A 1L0WA 1GHKA 4OIJA 1ZG8A 2BO9A 3A5ZB 2FXQA 2JA7B 4KSFA 4MCQA 3QIAA 2ANPA 1K0RA 3H94A 2NN6I 2NZOA 2IWHA 3NFZA 1CKNB 1I4GA 5IGBA 4K30A 4I65A 1QUQB 4E6IA 2CNMA 2FMMA 2XEJA 3I2ZA 2I0QA 3GO5A 1BO4A 4ZYSA 1Z47A 2EJMA 3GQBA 3NE5B 3OIQA 4HAEA 3I55A 4JI0Q 4JI4Q 4JI7Q 5G3LD 2YNCC 3HUVA 4XIGS 4IOAA 3DM1A 3OSOA 3HOYH 3SI0A 4KLKA 3DLJA 3ZJ0A 4K3NA 1V43A 2EJGC 1Z8TA 4KSAA 4EMEA 1J5EL 1VF7A 3A74A 3KLRA 2C6PA 1C48A 2PJCA 4B3TL 2FJ2A 2VB2X 3OPOA 4G7OC 4RFBA 2EBJA 3MHBA 2DNEA 1S5FD 4C2ZA 5DM63 3RBUA 2AFWA 2QYVA 4DR1Q 4LW1A 4C1NI 1N33L 2H1EA 2NVYB 4PMBA 5FO9B 3MFGA 4JI2Q 3CPWA 1Y1VG 3A7AB 1K8MA 1JOKA 4AYBB 4X5KA 3FRPB 5ISVA 4HJ9A 1KNAA 4AYBE 1MI2A 1XIXA 4H02A 1BLLE 4J1MA 1F2ZA 3TO9A 3KKWA 4KZTA 3U58A 2XGTA 4A93B 2ASBA 2OB0A 5KNDA 3LX0A 4P75A 1CKOA 2PPBC 3E0EA 1S4ZA 4EQNA 4JXQA 1UNSA 1WTPA 2D0PA 5LRJA 4CPAA 2L11A 3EQLC 1K83B 4MMOA 1HPCA 1FNUA 1EYAA 4XT1B 3PB6X 3SJFA 5EBCA 3HOZG 2DPTA 4NJQA 3I90A 4C3JG 4A3MH 5FOBB 1XPOA 2YU9H 3M4QA 4FD7A 4RA8A 1RIPA 1KC8C 3K0XA 6CPAA 3FEWX 4H13C 4ONWA 4MCPA 4KN7C 4RCNA 3KJPA 4JI5Q 2PO4A 5CV4A 2OXPA 1YLOA 2OEOA 3I8ZA 1GUWA 3N6RA 5C5MA 4UFXA 5CORA 5IX3A 2RHQB 1I50B 3S16H 3EVQA 1VQCA 1Q81C 2XNAC 4C3IH 3IGRA 1Q1BA 3U4VA 3D8GA 3NTHA 1R3NA 1SQHA 2MHVA 5ELYA 3W6XA 3RZAA 3BG3A 1LFWA 5F46A 3I4LA 2PRQA 1XTCD 1EY6A 3KJOA 5H86A 3DUZA 3TTHA 2Q2UA 4ZKBB 2PJ7A 4M6GA 2JBJA 1I3QB 2HHHQ 3H6MA 4ZKCB 3DXJC 4UIBA 3Q0AA 4XNHC 4FVMA 2Q44A 4QQBX 3G71A 3PFOA 2K5NA 2WACA 4A3BH 3DHQA 3RN2A 4DK6C 3STBC 3I9SA 5IP9G 3MEFA 3PO3B 4GKKL 1QWYA 2AUJD 3WABA 3GY9A 2K5HA 4UP7A 1NSAA 2ZW6A 2MUYA 4K0KQ 4BY1H 2HIXA 3NA6A 4DV5L 3MEHA 1KUVA 1QSRA 1T5EA 3IFDA 3MXPA 2B63G 1TWFB 3QR8A 1SE4A 4X3TA 4C3HH 1HR0Q 2DJGC 4DK0A 1K8OA 1VQ5A 1J6QA 3MXGA 2F0IA 1DE4C 3TP5A 4A31A 3MZ5A 4LFBL 3PUZA 4HMJA 2HB6A 2PVVA 1ONLA 1JB3A 1TKFA 5JGFA 1SE3A 4DPGA 1VQEA 2M00A 4EQOA 4DV1Q 2GVBA 2VL1A 4MTKA 4DR5L 3G8WA 3B6YA 4CBVA 1XX8A 2F0UA 3D2PA 4HJ8A 1BDOA 2PE3A 4IK2A 3M7GA 3FBUA 4OL7A 4KVME 1KIXA 1HDQA 1PLFA 5I6YA 3OW2A 1UEAB 1HFNA 4QCLA 3EFXD 1C0AA 1TXRA 4Q5VA 1C9OA 2QDBA 1TIID 4OWXB 2EK9A 2CH4W 4G7HC 1TWCH 1YJWA 2OZHA 3ND8A 3OOCA 2GANA 5JVH3 4UEEA 4BMHA 5HXDA 2B8FA 2K5WA 4LQGA 5EC4A 1VQHA 4HNYB 4L5TA 3I4NG 2E2IB 2WPWA 2B2WA 3A8KE 1WTWA 3BI1A 1N71A 1A0IA 2PW5A 4RUHA 1Q46A 1QE6A 2FINB 1QVGA 3SEBA 3HOYB 1LTRD 2RFHA 4DR2Q 1RD9D 4PQAA 1E7ZA 1QB5D 3HOUH 2UUBL 3RNUA 1TS5A 2EWBA 1LTLA 5C0XJ 4FBEA 3CU7A 4OXPA 5CBMA 2ZJRA 1ZXTA 1R4QB 4H0LC 3T1YL 4ZCKA 1EWIA 1SNPA 4DV2L 1YHAA 3IL8A 2L1BA 2WB1G 5KNBA 4X65Q 2JA5G 4PK3A 4LF4L 2BOAA 3B3TA 2B3VA 4IUNA 1R4PB 4M6HA 1SYFA 1N34L 2D4OA 1U4PA 4A32A 2BE5C 4RKBA 1HEEA 1TIQA 5LYIA 1II3A 2RA4A 1D1IA 5ELOA 4HJ7A 1HA6A 3D4WA 1CM0A 4C3JB 1K0SA 5J39A 1CP6A 4FAIA 4GNXB 2B3UA 4R7MA 3CCUA 1K3BC 3NTIA 3PIPA 1BF4A 3NENA 1E1OA 1S3OA 1CT1D 3OHXC 5LRKA 2SDFA 2E76C 3CCRA 4HJAA 1AFPA 2O2LD 2PQAB 3BZKA 3HEJA 4LF9L 1XXGA 1SMYD 1WTQA 3GTMH 1LM0A 3BVZA 1TKHA 2R7HA 4IUVA 4MCRA 4OC2A 4CS0B 4C2MB 1CP7A 2I00A 4DN4M 4ZQ3A 2JEVA 4OADA 5G21A 1SROA 4H6UA 3TN2A 2I5MX 3MTSA 1HTLD 4JW0A 4Z9CB 5EBVA 4KKUA 1J8IA 5IIFA 2YU9B 1VF5C 3DLLA 3BYYB 3UDGA 4O1NA 4DNTB 1PA6A 4DFAA 2HUGA 5JJLA 3DR6A 3V8IA 2KEEA 1PRTD 1VQAA 1X3EA 2K03A 1G291 2AFZA 4RAUC 2Q4ZA 2R1IA 1IZ6A 5E7NA 5C0XI 1YHQA 4HSPA 5LMNW 1WD1A 3IEHA 3SJEA 5KNCA 4DUYL 3H0GG 5CGKA 4IFDH 1L1OC 2Z4IA 4C3IB 5IODA 1OTCA 1V0CA 4YWLA 5LYDA 5IGGA 1SFOB 3A5UA 1RHPA 2JEWA 1TS2A 1X3QA 3PP9A 4F6AA 2B63B 3T16A 2OZGA 3FVQA 4R57A 3I3CA 2F0JA 3T8WA 4JWPA 3CT9A 3PBBA 3N52A 4HEDA 4P2CB 1D1KA 4TSSA 3NELA 1JE4A 3W1BA 1VHSA 1AH9A 4YHHQ 3GUXA 3JUWA 2FFKB 4AXVA 1FVIA 3ITPA 4JI3L 1ILPA 5HGTA 2CW0C 1F9QA 2WPXA 4DJLA 1NR4A 3J7A5 4U673 3PF4A 2ZTCA 1LTBD 4LUOA 2NVQH 5GROA 3KF8B 1Y7EA 4WJBA 2QILA 4LUVA 4GLVB 2KHJA 5JAVA 1OXSC 4C3HB 3HOVH 1Y69U 4A39A 2KJXA 2NUCA 2PNHA 1TY0A 4YY3Q 3ULPA 2HDMA 2DY7A 3CXPA 3H3VC 1KNEA 4OKOA 1XMQQ 3DWAA 2PZWA 3TFYA 3G3SA 2PYKA 3I4NB 5D8NA 4QJFA 4XPLA 3KHXA 4NKLA 3PF5A 4OX9L 2A73B 2V77A 1KLGD 1MJAA 1KLUD 4G4KA 4MJ8A 2AWOA 1BO0A 1A2UA 1VHOA 5DWMA 4LFAL 4I49A 4J6HA 5JPHA 2BA1A 4AIMA 4G7ZC 1BNZA 3S1MH 2WB1B 2IL8A 1BOBA 2JA5B 3TT2A 5D3DA 4POFA 2E2JH 1BCPB 2WB1E 2F3IA 3D6WA 2JQOA 2XVSA 3E3XA 1M4DA 1CJWA 2RC4A 4BY7G 1M4GA 3RLFA 2BDOA 1GUTA 4Y49B 1TS3A 1ZEQX 3ERSX 5LL6S 3OTOL 1FGUA 1PTOB 1VS0A 2YTVA 1Z9FA 2CF4A 3NQTA 4R4TA 2MO1A 3HOUB 1N36Q 1O78A 1B3AA 5K8OA 2VB3X 5FJ8G 1NSNS 3JAME 5ELDA 1Y9KA 2B58A 3FYNA 4C2XA 5DNFA 3AFPA 3I3GA 4MIUA 3ICEA 5JJKA 5CC4A 1BAVA 3H5ZA 4DUZQ 1VHEA 2PRBA 1Z5RA 1DZ1A 3V05A 4DGZA 3FPUB 5A28A 3IWEA 1B9NA 3G6JB 2L4NA 2HDLA 3AB9A 3B3WA 2KECA 1X56A 1TWHB 2F0PA 4R4CA 4R1JA 1C4QA 2EUIA 2CNTA 3J81i 3J81E 3FVLA 3FP9A 4ZBGA 1K28A 4MFKA 3J80c 3TO6A 4C2YA 1XMOQ 1VIXA 1NMGA 1QZHA 3DGVA 1P4NA 1IW7C 2F3VA 2WAQB 2Q8TA 3U4ZA 1I1DA 1YMEA 3RZDB 1IYKA 4CGYB 4R8IA 4HIOA 5M5XH 1MSHA 2WAQE 1ARLA 5M5YH 3W91A 3C46A 4N9TA 2B3GA 5G22A 1ENAA 1VDZA 3P75A 1AMPA 2B2UC 4HN7A 4BBSH 1YNJD 2Z3LA 4X62Q 1MJBA 2ZTEA 5JQ4A 4FDBA 2BL1A 4E0AA 1JWMD 3H0GB 3T90A 3GP7A 3KDFA 4A75A 4KN4C 4OIKA 2QA4A 2J8NA 3Q23A 4DR3Q 4PSXA 4X66Q 4DV6L 4A3GG 3T9YA 1LAMA 4HKFA 2EVBA 3ZZIA 5IGDA 5IP7G 5E3FA 3PB9X 4C68A 2K5DA 3S14H 4CYNA 3M4YA 3MC0B 3GTGH 2JBKA 1WI5A 4IJLA 3S1QH 2FIAA 4QB4A 4I7ZC 5AJ3Q 2MPMA 3T4AC 4YWMA 4IPCA 5G20A 1RJTA 1EEID 4KJOA 1PV4A 2ZEHA 4KOVA 3CPAA 3QB8A 2VXWA 1X10A 4DNCA 3H09A 1S40A 3KR4A 1X6OA 4CKCA 4ZK9B 3IO1A 4UBRA 3GTOB 5KYIA 2N88A 3K0YA 3NK9A 1Q86C 2VZZA 2UXDQ 1GUOA 4NCZA 4W9YA 5GCNA 4QGUA 2PJ1A 4A3JG 4PV1C 2B5GB 2NBFA 3FX6A 1FR3A 1BQQT 2WUUA 5HH1A 5JEAG 2Z3KA 3H91A 3D0FA 2B2YC 4CKBA 5KTAA 3NP8A 5HURA 1IL2A 2EJFC 1Y7RA 3S6KA 1EZ8A 2R92H 1Z6HA 4L8JA 1LTGD 3IU1A 3PGPA 4MN3A 5EAYA 1T5XD 1TQOA 5BN3A 3RYOA 2WFWA 1O7IA 2Z6KC 3KOJA 2EY6A 4M85A 3BI0A 5AGEA 1TWGH 4UWJA 3NUCA 1SE2A 2ATRA 3UY5A 4YFJA 4HCSA 1YW4A 1CA6A 4LJZC 2K52A 2NVYH 3KUPA 1ESFA 1JJGA 1EU3A 1SYGA 1IBKL 4BY7B 2AFXA 3T56B 1H9SA 3GTKB 1B9MA 2V8GA 3FH4A 2NVTB 1DOMA 3DMUA 3D68A 1VQPA 4OO1H 1R9TH 3S2HH 3FHWA 2F03A 1K3RA 2EYHA 1LUZA 4KOSA 1M4IA 4UEZA 4GN3B 4BWGB 3K7AH 4CAEA 4A93H 3FKIG 4GKJL 2PSWA 2C35B 5I0CA 2UXBQ 2WIIB 2QKIC 2V4DA 4MFJA 4PXEA 3S1MB 1V9PA 1X3FA 4GLXA 1IYLA 4XPKA 4RS2A 2I5HA 1HNXQ 1K83H 4J15A 4LF5Q 2GVAA 1IYVA 3FEEA 5IV0A 1B3QA 3G7LA 1Y9WA 1VQKA 1E0BA 2L0CA 2UUAL 4R8NA 1ZO0A 4UHVA 4XNHB 1YITA 1B70B 3F1ZA 4CGLA 2YTYA 1AEXA 4A3KG 4R4OA 4IOCA 3OWCA 4IN3A 5IT9c 3VR4A 3E5SA 2ZEPA 3GKRA 4NXML 4B08A 1DYQA 2A74C 1BCPF 4MHEA 3RUZA 1I94L 3GTQB 3CCLA 3PUWA 3AU7A 3TREA 4MI4A 4A94A 1I50H 3NHHA 1V8QA 2N3SA 4BBHA 1QSMA 4LUZA 3J80i 3J80E 5J1ZA 5T1IA 5LMUL 1GM5A 4B5OA 4JV5L 1U9RA 1PTOF 1V1QA 2XRQD 2NZ1D 4JOIC 4O0AA 2G3AA 1VQ6A 4MFPA 3BZCA 3EXNA 5D29A 4DAYB 2CKZB 2VQFL 5M5XB 4UY8C 1DONA 1JT8A 1I3QH 1ZG7A 2ZW4A 2WINB 3KGQA 3KL9A 1YW6A 1BKBA 3R2IA 3TP6A 2E74C 5IYDH 4LF6Q 2AQ2B 5CV8A 3KK7A 3GV3A 4NB3A 1EFID 3IWGA 1Q12A 3OMGA 4DV0L 3P2FA 2UUCL 2VQYA 2EE1A 4B3MQ 4LQ6A 1W6JA 1IICA 1L0YB 4GOPA 2K75A 1FJGL 3UDFA 4MY0A
chains in the Genus database with same CATH topology
1ESRA 1VGYA 2KVMA 1JQGA 2K1BA 3VR3A 3QO2A 1SMYC 4HSVA 4NP5A 5JPMC 1G2SA 2I3CA 1CTMA 4A3JB 1IL8A 4ID6A 2F0SA 1CZGA 3C2PA 4QUFA 1MGSA 4FF4A 3PUYA 1V1PB 2GU2A 4IHMA 4BA2I 1RDPD 2XN9C 4OGQC 4X8IA 4C56C 2NN6G 3I1UA 1G6ZA 3T51B 2C6CA 1PRTC 3RMHA 4P4JA 1NR2A 3NQIA 4P4BA 1WTRA 2JYOA 4KD4A 1A6XA 3FPPA 4OIDA 5CBAE 3IIBA 5EGTA 4UAIA 3P7JA 5EPJA 2R92B 2V8VA 3MRUA 4R9WA 3FEDA 3K5OA 4QMGA 2J9AA 3D4DA 1D5ZC 1SNDA 1TWGB 5K36G 3BDLA 4RGTA 5IGEA 4UIAA 1EY5A 1EY4A 3D7FA 4P6YA 1HDUA 2WYRA 1U4RA 2KUMA 1H9JA 5FLXE 1NCVA 1GUSA 1WVLA 4OHJA 2ZEEA 1QOHA 3TBIB 2PIZA 4K6LA 1CA5A 2XIWA 1R9TB 2RDGA 3S2HB 4KMUC 3TMEA 4A3KB 1KDAA 1TVXA 3K7AB 1F9SA 3PB7X 1SNMA 2B2TC 2AFMA 3BYTB 1DOKA 3BHXA 3VARA 5THWA 4ULLA 2ABZA 1XFOA 5C5LA 4F88A 4X3KA 3Q24A 1GXDC 3D7GA 5J1QA 2KOLA 1JR0D 4BD9A 1RKNA 3KZWA 2F0LA 3L2NA 1TY2A 2XEFA 2Z8LA 1TU2B 2AQ1B 4RGOS 5LYLA 1Z7TA 2JE6I 1TWAB 3QG1A 2SOBA 4P45A 5DAUA 1DXMA 1SXTA 1X32A 2EY5A 4FUUA 1MD2D 1PMRA 2B2VA 5D65A 4DF7A 5DS0A 5CV9A 3PUXA 3TSSA 4MHYA 4FXGC 3KHZA 2IT1A 3TC8A 2F0KA 1B4OA 5JH9A 1QNUA 2F0OA 1SJHD 5A2QE 1RTOA 4TNUA 5IGFA 1STGA 3CHBD 1YNJC 2KQ3A 3QWNA 5C4JB 1UAPA 4FP5D 2A68D 5D3IB 2EYFA 3OW7A 3RZOB 1O7LA 3K57A 4P4EA 1CHQD 2ZEDA 1EY7A 2M2LA 3QB3A 4RCOA 4K5VA 4Y7NB 4ZX9A 1IYUA 2DNCA 5KIXA 2ZT9C 3HGBA 2QCPX 5IB9A 3CKIB 1SNQA 3HS0C 3QNVA 3KQXA 1ICWA 2OOTA 4WRDA 2CQAA 1Y1VB 4DU9A 1A15A 4ZYQA 4KI0A 1B2TA 5EJWA 1ZG9A 4M8AA 3KLSA 5FO8B 1PTOH 2NTSA 4NFRA 5K8NA 1CI3M 2EYOA 4ME5A 2SEBD 3S9LA 1S5BD 2ZXRA 1FNVA 4DK1A 3PFEA 4IALA 1XMBA 2ZEMA 2NSMA 1BBXC 4Q7AA 4L6TB 3SVMA 2C9OA 5NUCA 3QOLA 3HOWB 5JPNC 3HOZB 3NWSA 2AFOA 3NTKA 4WFN3 2ZENA 1CBXA 1Y8OB 2KEDA 4K8JA 2L5TA 4Q0FA 3SR1A 3L3OC 2PQEA 1XYIA 2IX1A 2BDNA 3M4OB 3MA2B 4ZLTF 2TMPA 2K32A 3X3MA 1PYTB 1TF8A 4OC4A 1JOQA 2I07B 3IJ3A 4CJ1B 1LTSD 2A5HA 3PB8X 2PJ4A 4G1PA 3WT4A 3D7HA 2AFUA 3S9WA 3MVVA 1GYTA 3R3OA 4IZ8A 4A3DB 1EWCA 1R43A 1DCZA 4RGNA 4RGMA 1ELMP 2MP1A 4K2LA 3C1FA 1E2ZA 5C0XG 2V8DA 1HCZA 1RODA 2J7ZA 5JOBA 3WOFA 4IFDJ 3VYSA 2R6GA 3A55A 3HP3A 1LTTD 4IAVA 4KD3A 3F2UA 1QILA 1CM9A 3IKJA 2LFNA 5C3XA 1OXUA 2PJAA 2C5CA 2L12A 2B2WC 1LTID 4K14A 1O7YA 3D31A 1H9MA 3T13A 4QUCA 1YNND 4F7XA 3KLSX 1G91A 4FXKC 4ZX8A 4P4FA 3TZDA 5KRUA 4BS9A 1JQYD 1S5DD 1Q7LA 1SYBA 4K5XA 1SEBD 3GB0A 1SYDA 3U9OA 3NH4A 1IHZA 1HRJA 2QEJC 2CHBD 5EKIA 1IKMA 5FKAC 3K5NA 1HA5A 5CV5A 2A6ED 2RQXA 1CZWA 1Y8PB 3A7LA 4MRIA 1LT3D 1ENCA 4LMQD 4KKSA 1OXVA 2PJ9A 3V96A 3Q22A 4PQXA 2CTBA 1BOSA 1BR9A 2Z4HA 2GREA 1LT6D 1D5MC 2F0DA 3VYUA 2WZNA 2EPBA 3D6CA 1SJED 5IGCA 2POKA 1WTVA 2OT2A 3VR2A 2PIYA 2WV6D 2DN8A 2Q8IB 1NUCA 3K2KA 2WKDA 1AYEA 3QJYA 2EYMA 1FD7D 1QMUA 5G3LF 4CJ0B 2XEGA 5DEHA 4OC1A 2F3WA 4EFDA 1LACA 3KI9A 1EU4A 1UUPA 1EY0A 1E2WA 2AQ3B 5FO7B 1I6HB 1QG7A 2B39A 4RKLA 3IFTA 3H8EA 2WP8J 4NGMA 2J0TD 3I73A 5EKLA 3E0JA 1XJOA 2EYJA 2VUMB 1V1OA 2E2DC 1MBYA 3VATA 1LABA 3P1HA 2GA4B 3K5LA 3W2DA 1SBBB 3ERQA 4CHTB 2NVXB 5CV6A 4RHSA 5I9PA 1NAPA 4F9UA 1F77A 1F2MA 1PRTB 1B50A 5COYA 3EROA 4WORA 4XYOA 4ZAIA 1PZID 1QCBD 2M9VA 2A6HD 1STYA 5JEAJ 1OO9B 5C4XB 1WTOA 2GLJA 5JEAH 2FHTA 1CK1A 3R2TA 5FLXL 1PCAA 1PYWD 3L7ZC 1BXTA 5EKKA 2PJ8A 5BN5A 5JM6A 3KF8A 3SHLA 2F1MA 2PNRC 1GUGA 3S2DB 3B3SA 1OXTA 4F8MA 1SYCA 3H8FA 3HKZB 3PB4X 5HVFA 2NYQA 3PBEA 2K05A 2K33A 4G57A 5CR3A 2IJZA 2NB0A 3HLPA 2O4HA 3TX8A 2HCIA 1VMCA 2ZEOA 1BUVT 4A38A 1ML0D 4FF3A 2F0EA 4UDUC 1CHPD 3CPXA 4EQPA 5E4XA 2NYZD 5BN4A 1Y0RA 2MGSA 1F9PA 1U4MA 5K8PA 1XWEA 3VA5A 1G8ZD 4A3FB 3W3AA 4ILWA 7CPAA 1HFGA 2A68C 3NWTA 3D4RA 4HTHA 3L9AX 2K01A 3S15B 3A8JE 2Z1CA 3B7IA 4RH6A 3V38A 2ENBA 4RHRA 5I2YA 1M4VA 2F8HA 5CPAA 5A2QL 4ZY2A 1LT4D 2ZOGA 5HVHA 3GLJA 3URYA 4EGVA 4KHVA 4KTAA 1ZLIA 3VR6A 3OWEB 3M7NA 4A3EB 2E75C 3K58A 4JZ0A 2KA7A 4A3GB 5E1FA 1CPXA 2K7VA 3CRLC 3KQZA 2D9UA 3LWEA 2RVLA 4IUTA 4FNFA 3SK4A 4A3IB 3WDNA 2EK8A 4YU9A 3VR5A 2E2HB 2TSSA 2NN6H 4P4DA 2ZEFA 1ZKOA 5I4MA 2XWJB 3SJGA 3VH9A 2XWBB 4FF1A 1GJXA 4NJRA 1RTQA 4X3RA 3D3RA 1PRTF 3DEOA 4KV6A 2JA8B 3I4MB 1PZJD 4LAAA 3BXMA 1I6VC 2JP1A 3DEPA 5K36H 2EXZA 3PV0A 3NBIA 2JSOA 2OR4A 2IQ6A 5ISRA 1EY9A 2BCOA 2RSOA 2IX3A 3V7ZA 2O5IC 3LWUA 2RSNA 2G9HD 3WC6A 3D7DA 2RKSA 1BPMA 1LTAD 3OIPA 1EQVA 4ZUIA 2ZOFA 5I2XA 2R61A 4KY7A 4XT3B 2RDHA 3MN8A 1YNNC 3FKIB 5T1GA 2V8HA 1EZ6A 1GOZA 1CFMA 4OC5A 4DAVA 4NGTA 1I4QA 1LCPA 1EIGA 4DXFA 3M85A 5LYFA 2Q51A 3K59A 2I46A 1W6KA 3C3LA 3KR5A 4XQQA 2LMCB 3BDOA 3FF3A 1C8CA 4GM5A 4MHZA 1HXYD 3I91A 2L55A 2IJ0A 2ZXOA 2ICIA 3SXHA 1ILQA 2G9DA 2A6EC 2KCCA 4MHPA 2HC9A 1JWUD 5C44B 3SK6A 1MSGA 1H8LA 1IW7D 4PPZA 3PO2B 3PMFA 2MJ8A 3DWPA 1S5ED 4FO2A 4NDXA 3MAQA 2F0QA 3GTJB 2DY8A 1FT7A 1SDFA 2PZUA 2L9HA 4K5WA 5IT9E 3S1NB 4DAYA 3IWWA 4OP4A 5LHY1 2ZXPA 4ZUJA 5K8MA 4IQZA 4OMEA 3J7AV 4KY6A 4TKOB 3R8BA 5C4HA 1ZLHA 1Z2LA 2JXMB 1Y1WB 1TR5A 1DJRD 1STHA 3D4UA 3E6ZX 2PJ0A 3CQZB 5ELFA 2QVPA 2LY7A 5CMDA 1I4HA 4V0BA 3FJUA 2LS01 5E4WC 4KK7A 3ISZA 3OWFA 1V1PA 1FGBD 1HUMA 1F9RA 4P4IA 4YWYA 2K5QA 3I70A 1SNOA 3KASA 1OBRA 2PJ5A 1FNWA 2Y0SB 3HOXB 4CJ2C 1UWYA 5EQ0A 2CIJA 4DUKA 2F0VA 2QF7A 2X69A 3IC1A 1FNOA 2R7ZB 3JAML 5JJZA 4S3SA 3S17B 4TWEA 1OXXK 4C3IG 3K6OA 4PXCA 2A6HC 3R93A 4H2KA 1EOTA 3GTPB 2JA6B 4PXBA 2VNUD 2X6GA 2HCCA 1D6EC 3J81L 1HUNA 3OMCA 3U9SA 1B44D 3WOEA 3V2TA 3M3YB 3VYTA 4PXDA 4XQJA 5JVG3 1TKJA 2CVRA 3S1RB 4BA1I 3N5FA 2PJBA 2BOSA 2AFSA 2RDFA 2KCNA 4LK1C 5EPLA 2XRSD 1CG2A 1CPSA 4B6ZA 2BA0A 1DD2A 5EPKA 1LOKA 4C3HG 4NGSA 2K6AA 2R93B 4EWTA 3A54A 3QOJA 5C3EB 1IKLA 4HMIA 5A35A 3CRKC 1EL0A 2B2VC 3SI1A 3ND9A 3P20A 5ELEA 1F2PA 3TP7A 5C4ZA 1STAA 2D62A 3LNNA 4F87A 2O53A 3B3CA 3NPPA 1BCPD 1KAAA 8CPAA 5C6AA 2RBMA 1Z8LA 1G2TA 4C1NK 5C0XH 3JRUA 1ZYRD 2PJ2A 4U68A 2XSCA 2AUKA 1Y8NB 2ICEC 3GV6A 1XBUA 5M9OA 1PTOD 3NH5A 3S9NA 2EOTA 2HQEA 2DEAA 2F0GA 1Q8IA 4FF2A 3GD7A 2IW3A 1PFNA 1EWHA 3MXNA 3FMCA 4NGRA 1LLRD 5LRGA 3MXUA 4P44A 3AMUA 4PMCA 4JK1C 1I4PA 4J8QA 4V190 4FXDA 2C6GA 2A69D 3RAMA 2JEBI 1A2TA 3VA7A 4KJNA 4A3MB 4KSIA 4HCEA 2ZEGA 3MWYW 3PIO3 1D2BA 4DAPA 1LT5D 5KYLA 4R76A 2PCFB 1I4RA 2F7VA 1JOOA 1LV9A 4P10A 1TT2A 5LL6X 1KDCA 5KEEA 1AZPA 3S16B 4O23A 1DTDA 2FMCA 4A37A 3MFYA 1STBA 3SK8A 2O5JC 4NGQA 2EYPA 2PJ6A 3FDTA 1EQTA 4R6TA 1B1ZA 2XEIA 4DA2A 4A3BB 3B3VA 2IX0A 1CX8A 1WD0A 1H9RA 1Q1EA 3O13A 2F0MA 4IUPA 4IFDG 3J80L 4BY1B 2B2UA 2X6LA 3PUVA 4IFDI 2Q43A 3X3NA 1PXUA 2PCUA 3J7YW 2F0TA 1A3UA 1HQMC 4EVOA 2IMOA 1A3VA 1JICA 3GTLB 1X3PA 3J7AF 1DM0B 1ENFA 4ZY0A 4Z65A 3NH8A 1TS4A 4FWUA 4O42A 1STEA 4X3SA 4B9XA 4KY5A 4XXEA 4GZYC 2GLFA 1JCKB 2KHSA 4K8IA 1JWSD 4IURA 5KGUA 4DNRB 1TWCB 3SI2A 2EY2A 4JBWA 1JC7A 2F4IA 5I6WA 1H9SB 3T53B 4ABNA 4NW2A 1PFMA 4OIWA 3TZUA 4M1UB 3IFEA 5HVGA 4DYOA 5TSSA 2B2YA 1O7ZA 1PFBA 4NMZA 1Y0YA 4NGPA 1FYCA 5F2DA 3DWQA 1U4LA 4F9VA 2PMZB 4FYDA 2AWNA 3FECA 1QNKA 4DXGA 2JEAI 1HTPA 1IGBA 2C1CA 3S9MA 1SSOA 1AP0A 3K5MA 2F0HA 4K2KA 2LKVA 2PW7A 1RF2D 4ZY1A 1SAPA 4MCSA 1F2LA 3SJXA 1ARMA 1Q90A 3GTMB 4PMWA 1AZQA 5D14A 2B8GA 3EA6A 1BPNA 1KABA 3HZXA 1H9KA 5DM73 1QJOA 4TQUS 1SYEA 4WJWA 2J4XA 5EBDA 2D2CC 2R3ZA 4MXUA 4QIWB 2D5DA 1AN8A 3BVMA 5ELBA 3K9TA 3BZDB 5M5WB 2SNMA 1TKWB 3SDZA 3A8IE 1JORA 4ODGA 1STNA 1LANA 3WC5A 4UF4A 4MHNA 1TF9A 1YSJA 2YYZA 1M8AA 4ZRZA 3WC7A 3IAYA 3ISXA 1PDQA 1GHJA 3NBHA 3UI2A 4N9PA 3ZYYX 4XQNA 4PNYA 4BBRB 4L63B 2NTTA 1ET6A 5IT9L 1EY8A 3I72A 4B9WA 1HQRD 1ELLP 2F0FA 3B35A 3B2YA 5CV7A 1RCVD 5C3WA 4QF4A 3D67A 3PRTA 2BE5D 1WTXA 4OC0A 3KBXA 2NVQB 1XRYA 1EEFD 4H44C 5FK9C 2EY1A 1E2VA 3PIP3 4KKTA 3A56A 2EYLA 3HOVB 5CYUA 1RTNA 3RD4A 3BS1A 1HHVA 3VYRA 4ZI6A 4IUQA 5ELCA 3NXWA 2N55A 5F09A 5K5PA 1IY7A 2H4OA 1WCMB 4R8FA 4HR7B 2EZVA 2QJ8A 3LMSA 2WKCA 1VCIA 1EYCA 2E2JB 2F0NA 2SNSA 3D66A 4WWVA 1Q3LA 2K04A 2O4XA 1F57A 1LAPA 4OO1G 1QQ9A 2CTCA 3Q6SA 1SNCA 4OO1I 3BDCA 3NSWA 4YIJA 1DOLA 4XTCS 2PJ3A 3CDXA 1ET9A 1KDBA 2FVGA 1KWMA 3BVGA 5IOCA 3C1EA 4KHZA 1EE3P 4F8ZA 4XYQA 2IPKD 4UEFA 3H8GA 1BCPC 2EDGA 4TRDA 1J9OA 3KBGA 2CW0D 4K6DA 1ZYRC 1GUNA 1PZKD 1D5XC 4X3UA 5M5YB 4NGNA 2ZELA 2K28A 1LO5D 1M4LA 4OC3A 1PTOC 4XDXA 1EYDA 3HRZC 3SK5A 4BBSB 5AFWA 3TDQA 1EIHA 2PVWA 5I9OA 1S5CD 1AW7A 2ID0A 1F2YA 3ONAB 1KTKA 2B2TA 1CQVA 2F0WA 4IUUA 5CBEE 5M3FB 3PEIA 1VMPA 3HG9A 3TP8A 4X2TA 1L0XB 4CKEA 2RB7A 3S14B 2A69C 3EJIA 4JYWA 1CQFA 1I4XA 1B53A 3GTGB 2Q8RE 3SE0A 3S1QB 2PZTA 4H7BA 5M3MB 1O80A 1A3TA 2NWGA 5I4DA 4RWSC 1F2OA 5J22A 2OF1A 1GHKA 4OIJA 1ZG8A 2BO9A 2JA7B 4MCQA 3QIAA 2ANPA 3H94A 2NN6I 2IWHA 3NFZA 1I4GA 5IGBA 4I65A 2XEJA 4E6IA 2FMMA 3GO5A 4ZYSA 1Z47A 2EJMA 3GQBA 3NE5B 3OIQA 4HAEA 5G3LD 3HUVA 4XIGS 3SI0A 3DM1A 3OSOA 3DLJA 4K3NA 1V43A 2EJGC 4EMEA 1VF7A 2C6PA 3KLRA 1C48A 2PJCA 2FJ2A 2VB2X 3OPOA 4G7OC 4RFBA 3MHBA 2DNEA 1S5FD 5DM63 3RBUA 2AFWA 2QYVA 4C1NI 2H1EA 2NVYB 4PMBA 5FO9B 3MFGA 3A7AB 1K8MA 1JOKA 4AYBB 3FRPB 1KNAA 1MI2A 1BLLE 4J1MA 1F2ZA 4A93B 5KNDA 3LX0A 2PPBC 1S4ZA 4EQNA 1UNSA 1WTPA 5LRJA 4CPAA 2L11A 3EQLC 1K83B 4MMOA 1HPCA 1FNUA 1EYAA 4XT1B 3PB6X 3SJFA 5EBCA 4NJQA 3I90A 4C3JG 5FOBB 4RA8A 6CPAA 3FEWX 4H13C 4ONWA 4MCPA 4KN7C 4RCNA 2PO4A 5CV4A 2OXPA 1YLOA 2OEOA 3I8ZA 1GUWA 3N6RA 5C5MA 5CORA 1I50B 3EVQA 2XNAC 1Q1BA 3D8GA 3NTHA 1R3NA 2MHVA 5ELYA 3RZAA 3BG3A 1LFWA 3I4LA 2PRQA 1XTCD 1EY6A 3DUZA 4ZKBB 2PJ7A 2JBJA 1I3QB 3H6MA 4ZKCB 3DXJC 4UIBA 3Q0AA 4FVMA 3PFOA 2WACA 3DHQA 3PO3B 1QWYA 2AUJD 3WABA 1NSAA 2MUYA 3NA6A 3MEHA 1T5EA 3IFDA 3MXPA 1TWFB 1SE4A 4X3TA 4DK0A 1K8OA 3MXGA 2F0IA 1DE4C 3TP5A 3MZ5A 3PUZA 4HMJA 2HB6A 2PVVA 1ONLA 1JB3A 1TKFA 5JGFA 1SE3A 2VL1A 2M00A 4EQOA 4CBVA 1XX8A 2F0UA 1BDOA 2PE3A 4IK2A 3M7GA 4OL7A 1HDQA 1PLFA 5I6YA 1UEAB 1HFNA 4QCLA 3EFXD 1TXRA 4Q5VA 2QDBA 1TIID 2EK9A 4G7HC 3ND8A 3OOCA 5JVH3 4UEEA 5HXDA 2B8FA 2K5WA 4LQGA 2E2IB 2B2WA 3A8KE 1WTWA 3BI1A 2PW5A 4RUHA 1QE6A 2FINB 3SEBA 3HOYB 1LTRD 2RFHA 4PQAA 1RD9D 1QB5D 1TS5A 2EWBA 5C0XJ 4FBEA 3CU7A 5CBMA 1ZXTA 1R4QB 4H0LC 1SNPA 3IL8A 2L1BA 5KNBA 2BOAA 3B3TA 4IUNA 1R4PB 1SYFA 1U4PA 2BE5C 4RKBA 1HEEA 5LYIA 1II3A 2RA4A 1D1IA 1HA6A 3D4WA 4C3JB 5J39A 1CP6A 4FAIA 4R7MA 3NTIA 1BF4A 1CT1D 3OHXC 2SDFA 2E76C 1AFPA 2O2LD 3HEJA 1XXGA 1SMYD 1WTQA 4MCRA 4OC2A 3BVZA 1TKHA 4IUVA 4C2MB 1CP7A 4DN4M 4ZQ3A 3TN2A 3MTSA 1HTLD 4Z9CB 4KKUA 1J8IA 5IIFA 2YU9B 1VF5C 3BYYB 4O1NA 4DNTB 4DFAA 2HUGA 2KEEA 1PRTD 2K03A 1G291 2AFZA 4RAUC 2Q4ZA 5C0XI 4HSPA 1WD1A 3IEHA 3SJEA 5KNCA 5CGKA 4IFDH 2Z4IA 4C3IB 5IODA 5LYDA 5IGGA 1SFOB 1RHPA 2JEWA 1TS2A 1X3QA 2B63B 3T16A 3FVQA 3I3CA 2F0JA 3T8WA 3CT9A 3PBBA 3N52A 4HEDA 4P2CB 1D1KA 4TSSA 1JE4A 3GUXA 2FFKB 4AXVA 3ITPA 1ILPA 5HGTA 2CW0C 1F9QA 4DJLA 1NR4A 4U673 1LTBD 1Y7EA 4WJBA 2QILA 5JAVA 1OXSC 4C3HB 1Y69U 4A39A 2KJXA 2NUCA 1TY0A 2HDMA 2DY7A 3H3VC 1KNEA 4OKOA 3DWAA 2PZWA 2PYKA 3I4NB 5D8NA 3KHXA 4NKLA 2A73B 2V77A 1KLGD 1KLUD 4G4KA 2AWOA 1BO0A 1A2UA 1VHOA 4J6HA 2BA1A 4G7ZC 1BNZA 2WB1B 2IL8A 2JA5B 5D3DA 1BCPB 3D6WA 2XVSA 3RLFA 2BDOA 1GUTA 1TS3A 1ZEQX 5LL6S 1PTOB 2CF4A 3NQTA 3HOUB 1O78A 1B3AA 5K8OA 2VB3X 1NSNS 3JAME 5ELDA 5DNFA 4MIUA 5CC4A 1BAVA 1VHEA 1Z5RA 1DZ1A 3V05A 4DGZA 3FPUB 1B9NA 3G6JB 2L4NA 2HDLA 3AB9A 3B3WA 2KECA 2F0PA 1TWHB 1C4QA 3J81E 3FVLA 1VIXA 3DGVA 1IW7C 2F3VA 2WAQB 2Q8TA 1YMEA 3RZDB 4CGYB 4R8IA 1ARLA 1MSHA 3C46A 4N9TA 1ENAA 1VDZA 3P75A 1AMPA 2B2UC 4HN7A 1YNJD 1JWMD 3H0GB 3GP7A 4KN4C 4OIKA 3Q23A 1LAMA 2EVBA 5IGDA 3PB9X 5E3FA 2K5DA 3M4YA 3MC0B 2JBKA 4QB4A 4I7ZC 2MPMA 3T4AC 1RJTA 1EEID 4KJOA 2ZEHA 3CPAA 2VXWA 3H09A 3KR4A 4CKCA 4ZK9B 3IO1A 3GTOB 5KYIA 2N88A 3K0YA 3NK9A 4W9YA 1GUOA 2PJ1A 4PV1C 2NBFA 3FX6A 1FR3A 1BQQT 5JEAG 3H91A 2B2YC 4CKBA 5HURA 3NP8A 2EJFC 1EZ8A 1Z6HA 4L8JA 1LTGD 4MN3A 1T5XD 1TQOA 5BN3A 2EY6A 3BI0A 3NUCA 1SE2A 4HCSA 1YW4A 1CA6A 4LJZC 3KUPA 1ESFA 1EU3A 1SYGA 4BY7B 2AFXA 3T56B 1H9SA 3GTKB 1B9MA 2V8GA 3FH4A 2NVTB 1DOMA 3DMUA 3D68A 4OO1H 2F03A 4UEZA 2EYHA 4BWGB 2WIIB 2QKIC 2V4DA 4PXEA 3S1MB 1IYVA 3FEEA 3G7LA 1E0BA 2L0CA 4R8NA 1AEXA 4IN3A 3VR4A 3E5SA 2ZEPA 4B08A 1DYQA 2A74C 1BCPF 4MHEA 3RUZA 3GTQB 3PUWA 3AU7A 4A94A 3NHHA 1V8QA 3J80E 5J1ZA 5T1IA 1U9RA 1PTOF 2XRQD 2NZ1D 5D29A 1DONA 5M5XB 1ZG7A 3KGQA 3KL9A 2WINB 1YW6A 3R2IA 3TP6A 2E74C 2AQ2B 5CV8A 3KK7A 3GV3A 1EFID 1Q12A 3OMGA 2EE1A 1W6JA 1L0YB 5LRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VGY A;  1JQG A;  2PJ7 A;  2JBJ A;  4P10 A;  1PCA A;  3L7Z C;  3VR3 A;  4UIB A;  3DXJ C;  2PJ8 A;  1SMY C;  4O23 A;  5BN5 A;  5JM6 A;  3PFO A;  1DTD A;  2I3C A;  4A37 A;  1CTM A;  3MFY A;  2F1M A;  2PNR C;  2AUJ D;  1GUG A;  3WAB A;  3B3S A;  1OXT A;  3PUY A;  1NSA A;  3H8F A;  3NA6 A;  2O5J C;  2GU2 A;  4IHM A;  4BA2 I;  3PB4 X;  4NGQ A;  5HVF A;  2PJ6 A;  1T5E A;  4OGQ C;  2NYQ A;  3PBE A;  2K33 A;  4X8I A;  4R6T A;  2XEI A;  2NN6 G;  3I1U A;  4DK0 A;  1K8O A;  3T51 B;  2C6C A;  1DE4 C;  2IJZ A;  3B3V A;  3HLP A;  1CX8 A;  1H9R A;  1Q1E A;  3PUZ A;  2HB6 A;  2O4H A;  2PVV A;  1ONL A;  4P4J A;  1TKF A;  4P4B A;  3TX8 A;  5JGF A;  2VL1 A;  4IFD G;  2ZEO A;  1A6X A;  3FPP A;  4A38 A;  4OID A;  1BDO A;  3IIB A;  2PE3 A;  4IK2 A;  3PUV A;  2Q43 A;  1HDQ A;  2PCU A;  1HQM C;  3CPX A;  1TXR A;  2IMO A;  2V8V A;  5BN4 A;  1Y0R A;  2EK9 A;  4G7H C;  3MRU A;  3ND8 A;  3OOC A;  3FED A;  4ZY0 A;  5K8P A;  4UEE A;  4Z65 A;  3NH8 A;  2J9A A;  5HXD A;  4FWU A;  2B8F A;  4LQG A;  5K36 G;  3W3A A;  4UIA A;  7CPA A;  3A8K E;  3BI1 A;  2A68 C;  3D7F A;  4P6Y A;  4RUH A;  1HDU A;  4GZY C;  2WYR A;  2GLF A;  3D4R A;  1H9J A;  1GUS A;  2RFH A;  4PQA A;  2ZEE A;  3A8J E;  4DNR B;  2EWB A;  3B7I A;  4FBE A;  5CBM A;  2PIZ A;  3SI2 A;  3V38 A;  4H0L C;  4JBW A;  4KMU C;  5KNB A;  3PB7 X;  1H9S B;  3T53 B;  2BOA A;  2F8H A;  3B3T A;  5CPA A;  2AFM A;  4OIW A;  3TZU A;  2BE5 C;  4ZY2 A;  1HEE A;  3BHX A;  5LYI A;  2ZOG A;  3IFE A;  3VAR A;  5HVG A;  4DYO A;  5THW A;  2ABZ A;  1CP6 A;  4FAI A;  5HVH A;  1XFO A;  3GLJ A;  1Y0Y A;  4R7M A;  4NGP A;  1FYC A;  4F9V A;  3D7G A;  2E76 C;  1ZLI A;  5J1Q A;  3VR6 A;  3FEC A;  2JEA I;  4BD9 A;  1HTP A;  3M7N A;  1IGB A;  2C1C A;  3KZW A;  3S9M A;  4OC2 A;  4MCR A;  2E75 C;  1TKH A;  4JZ0 A;  3L2N A;  1CP7 A;  2XEF A;  2KA7 A;  1TU2 B;  5LYL A;  1Z7T A;  2JE6 I;  1CPX A;  2K7V A;  4ZY1 A;  3QG1 A;  3CRL C;  4MCS A;  3KQZ A;  3SJX A;  4P45 A;  4KKU A;  1ARM A;  1VF5 C;  1Q90 A;  3WDN A;  4DNT B;  2EK8 A;  1DXM A;  4YU9 A;  3VR5 A;  4FUU A;  1PMR A;  2B8G A;  1G29 1;  2NN6 H;  2AFZ A;  4P4D A;  2Q4Z A;  2ZEF A;  1BPN A;  1H9K A;  1ZKO A;  1QJO A;  4TQU S;  5I4M A;  5DS0 A;  3IEH A;  3SJE A;  5KNC A;  3SJG A;  3VH9 A;  2D2C C;  4MXU A;  3PUX A;  2D5D A;  4MHY A;  4IFD H;  1GJX A;  3K9T A;  3KHZ A;  5LYD A;  4NJR A;  2IT1 A;  3TC8 A;  1RTQ A;  2JEW A;  1TKW B;  5JH9 A;  4X3R A;  3SDZ A;  3A8I E;  3T8W A;  3CT9 A;  3PBB A;  4TNU A;  3BXM A;  1LAN A;  3WC5 A;  1I6V C;  4UF4 A;  4MHN A;  1TF9 A;  1YSJ A;  2YYZ A;  3GUX A;  1YNJ C;  4AXV A;  3WC7 A;  3ISX A;  1GHJ A;  2A68 D;  5K36 H;  2CW0 C;  3OW7 A;  3PV0 A;  2OR4 A;  4DJL A;  2IQ6 A;  2BCO A;  1O7L A;  3V7Z A;  3I72 A;  1Y7E A;  4P4E A;  4WJB A;  2O5I C;  3LWU A;  2ZED A;  1ELL P;  3WC6 A;  4ZX9 A;  3B35 A;  3D7D A;  1IYU A;  3B2Y A;  1OXS C;  1Y69 U;  4A39 A;  2DNC A;  1BPM A;  2ZT9 C;  2ZOF A;  3HGB A;  4OKO A;  5IB9 A;  3MN8 A;  3QNV A;  3D67 A;  3PRT A;  1YNN C;  2V8H A;  3KQX A;  5D8N A;  2BE5 D;  3KHX A;  1CFM A;  4OC0 A;  4OC5 A;  4NGT A;  2OOT A;  1XRY A;  1LCP A;  2V77 A;  4H44 C;  4ZYQ A;  1E2V A;  2AWO A;  3M85 A;  4KI0 A;  4KKT A;  1VHO A;  5LYF A;  2Q51 A;  1ZG9 A;  2BA1 A;  3KR5 A;  4G7Z C;  2LMC B;  3BDO A;  3FF3 A;  4GM5 A;  4MHZ A;  4NFR A;  4ZI6 A;  5K8N A;  1CI3 M;  3S9L A;  5F09 A;  2G9D A;  2A6E C;  2KCC A;  4DK1 A;  4MHP A;  3PFE A;  2HC9 A;  1IY7 A;  1XMB A;  4R8F A;  3RLF A;  1H8L A;  2BDO A;  1IW7 D;  2ZEM A;  2NSM A;  4PPZ A;  4HR7 B;  1GUT A;  4Q7A A;  2QJ8 A;  2CF4 A;  3LMS A;  1VCI A;  1O78 A;  5K8O A;  2AFO A;  2ZEN A;  1CBX A;  1Y8O B;  2L5T A;  1FT7 A;  1BAV A;  3D66 A;  4WWV A;  2K32 A;  1F57 A;  1VHE A;  1Z5R A;  1LAP A;  1PYT B;  1TF8 A;  3IWW A;  4OC4 A;  4OP4 A;  1B9N A;  3B3W A;  3AB9 A;  4OO1 G;  1QQ9 A;  2CTC A;  3IJ3 A;  3FVL A;  3PB8 X;  5K8M A;  2PJ4 A;  4IQZ A;  4G1P A;  1VIX A;  3WT4 A;  3DGV A;  1IW7 C;  4XTC S;  2PJ3 A;  3D7H A;  2AFU A;  1YME A;  4OME A;  4TKO B;  3CDX A;  1ARL A;  1GYT A;  2FVG A;  1ZLH A;  1KWM A;  1Z2L A;  4KHZ A;  2JXM B;  1EE3 P;  1DCZ A;  1VDZ A;  1R43 A;  1AMP A;  1ELM P;  4F8Z A;  4UEF A;  1E2Z A;  5C0X G;  3H8G A;  2EDG A;  2V8D A;  3D4U A;  1HCZ A;  2PJ0 A;  1ZYR C;  4KN4 C;  1GUN A;  2QVP A;  3FJU A;  2R6G A;  4NGN A;  3ISZ A;  2ZEL A;  1LAM A;  1M4L A;  4IAV A;  4OC3 A;  2EVB A;  3IKJ A;  3PB9 X;  3M4Y A;  1OXU A;  2PJA A;  4P4I A;  2PVW A;  4YWY A;  3D31 A;  1H9M A;  3KAS A;  1OBR A;  2JBK A;  2PJ5 A;  1UWY A;  3PEI A;  2CIJ A;  4ZX8 A;  4I7Z C;  4DUK A;  2QF7 A;  3IC1 A;  4P4F A;  4X2T A;  2ZEH A;  1FNO A;  1Q7L A;  3CPA A;  3GB0 A;  2RB7 A;  3KR4 A;  3NH4 A;  2A69 C;  3IO1 A;  4JYW A;  4TWE A;  1OXX K;  4W9Y A;  1GUO A;  3SE0 A;  2PJ1 A;  4PXC A;  2A6H C;  4PV1 C;  3FX6 A;  4H2K A;  1FR3 A;  5JEA G;  4PXB A;  2A6E D;  1Y8P B;  1F2O A;  3U9S A;  3A7L A;  1GHK A;  4MRI A;  1ZG8 A;  2EJF C;  4KKS A;  2BO9 A;  1OXV A;  2PJ9 A;  4PXD A;  4MCQ A;  1Z6H A;  3QIA A;  4L8J A;  2ANP A;  3H94 A;  1TKJ A;  2NN6 I;  2CTB A;  4BA1 I;  3N5F A;  5BN3 A;  3NFZ A;  2PJB A;  2GRE A;  3BI0 A;  2AFS A;  2XEJ A;  1YW4 A;  2WZN A;  4LJZ C;  4LK1 C;  2EJM A;  3GQB A;  3NE5 B;  1CG2 A;  3HUV A;  4XIG S;  1CPS A;  2AFX A;  3SI0 A;  4B6Z A;  2BA0 A;  3T56 B;  1DD2 A;  1H9S A;  3DLJ A;  1V43 A;  2EJG C;  1LOK A;  4K3N A;  4EME A;  2POK A;  1B9M A;  1VF7 A;  2C6P A;  3KLR A;  2V8G A;  3FH4 A;  2PJC A;  4NGS A;  4EWT A;  3VR2 A;  2PIY A;  3OPO A;  4G7O C;  3D68 A;  4OO1 H;  2DNE A;  4UEZ A;  2DN8 A;  3RBU A;  2AFW A;  5A35 A;  3CRK C;  2QYV A;  2Q8I B;  3K2K A;  3ND9 A;  3SI1 A;  1AYE A;  3QJY A;  2V4D A;  3P20 A;  1QMU A;  1F2P A;  4PXE A;  3A7A B;  2D62 A;  3LNN A;  1K8M A;  2XEG A;  2O53 A;  4OC1 A;  3B3C A;  8CPA A;  4EFD A;  1IYV A;  1LAC A;  3FEE A;  1Z8L A;  3KI9 A;  5C0X H;  1BLL E;  3JRU A;  2PJ2 A;  1E2W A;  5KND A;  2AUK A;  1Y8N B;  3IFT A;  2PPB C;  3H8E A;  4NGM A;  3I73 A;  1XBU A;  3NH5 A;  3S9N A;  1XJO A;  3VR4 A;  2ZEP A;  5LRJ A;  4CPA A;  3EQL C;  2DEA A;  3VAT A;  1LAB A;  3PUW A;  4MMO A;  1HPC A;  4A94 A;  3GD7 A;  3PB6 X;  3SJF A;  4NJQ A;  1EWH A;  1V8Q A;  3FMC A;  4NGR A;  5LRG A;  3MXU A;  4P44 A;  6CPA A;  4F9U A;  4H13 C;  4ONW A;  4MCP A;  4KN7 C;  4RCN A;  4JK1 C;  1YLO A;  2C6G A;  2A69 D;  5D29 A;  3RAM A;  2JEB I;  3N6R A;  1ZG7 A;  3KGQ A;  3KL9 A;  1YW6 A;  3VA7 A;  2A6H D;  4KSI A;  2E74 C;  2ZEG A;  1Q1B A;  1Q12 A;  1R3N A;  4R76 A;  2GLJ A;  5ELY A;  5JEA H;  2PCF B;  3RZA A;  3BG3 A;  1LFW A;  3I4L A;  2PRQ A;  2F7V A;  5LRK A; 
#chains in the Genus database with same CATH topology
 1ESR A;  4X64 Q;  2DPS A;  1VGY A;  2KVM A;  4H6Z A;  1JQG A;  1IXR A;  2K1B A;  3VR3 A;  3QO2 A;  1TWF H;  1WWZ A;  1XMT A;  1SMY C;  4HSV A;  3LGJ A;  4NP5 A;  5JPM C;  4CAW A;  2K50 A;  1G2S A;  2I3C A;  1JJC B;  3E0K A;  4DV7 L;  3IU2 A;  1CTM A;  4JI1 Q;  2P5Z X;  2VZA A;  4A3J B;  1IL8 A;  4ID6 A;  3H3V I;  1HNW L;  2Z3P A;  3VWD A;  2F0S A;  2VS1 A;  1CZG A;  3C2P A;  4JXR A;  4QUF A;  1MGS A;  4OEM B;  4FF4 A;  3PUY A;  1NE3 A;  1Z4R A;  4L89 A;  1V1P B;  2GU2 A;  4IHM A;  4BA2 I;  1RDP D;  4UA3 A;  1VQG A;  2XN9 C;  4Y7N H;  4OGQ C;  1IOF A;  2K5V A;  4X8I A;  4AVB A;  4C56 C;  1IBM Q;  2NN6 G;  3I1U A;  4HIK A;  1G6Z A;  3T51 B;  2C6C A;  2XTI A;  1PRT C;  3HOX G;  3RMH A;  4P4J A;  4LF8 L;  1NR2 A;  3NQI A;  4P4B A;  3TOB A;  4YCU A;  1WTR A;  2JYO A;  4KD4 A;  1A6X A;  3FPP A;  1XPU A;  4OID A;  2RCN A;  1LYL A;  1Y1V H;  5CBA E;  4J3G A;  3IIB A;  5EGT A;  1SRU A;  2E2I H;  4C7H A;  3W6S A;  4UAI A;  3P7J A;  5EPJ A;  2R92 B;  2V8V A;  3QAH A;  3F2D A;  4KUB A;  2JA6 G;  3MRU A;  4R9W A;  2LXK A;  2F4V L;  4DR7 Q;  3FED A;  5LMN Q;  3K5O A;  1JJ2 A;  4QMG A;  2PR1 A;  2J9A A;  4PK2 A;  3D4D A;  2A1A A;  1D5Z C;  1SND A;  1TWG B;  5K36 G;  1L2F A;  3BDL A;  2R7F A;  4RGT A;  4E2A A;  5IGE A;  4UIA A;  2K5T A;  5AG6 A;  1EY5 A;  1EY4 A;  3D7F A;  4P6Y A;  1HDU A;  2WYR A;  1U4R A;  2KUM A;  2VBQ A;  1H9J A;  5FLX E;  1NCV A;  1GUS A;  1WVL A;  1YZ6 A;  3HOZ H;  2CWA A;  4OHJ A;  2ZEE A;  4C3J H;  1QOH A;  3TBI B;  2PIZ A;  4K6L A;  1CA5 A;  2XIW A;  1R9T B;  2RDG A;  3S2H B;  4XPD C;  4GS3 A;  4KMU C;  3TME A;  3M4O H;  4A33 A;  4A3K B;  1KDA A;  1TVX A;  3K7A B;  1F9S A;  3EO4 A;  3PB7 X;  1UEB A;  1EYG A;  1SNM A;  2B2T C;  2R93 G;  2AFM A;  4JC0 A;  1L1O B;  3BYT B;  1DOK A;  2FT0 A;  3BHX A;  4C2M H;  4U5Y A;  3VAR A;  4BXX G;  1IID A;  3R9G A;  5THW A;  4ULL A;  2IY5 B;  4JI4 L;  2F52 A;  4IJH A;  4JI0 L;  2ABZ A;  4JI6 Q;  1EOV A;  1XFO A;  4LNQ A;  5C5L A;  4F88 A;  3HOW G;  4X3K A;  3TEH B;  1BBU A;  3Q24 A;  2NMT A;  1GXD C;  1GO3 E;  4HID A;  3D7G A;  5BWA B;  5J1Q A;  2KOL A;  1JR0 D;  4BD9 A;  1RKN A;  3KZW A;  2F0L A;  4DR1 L;  4IO9 A;  5F49 A;  3L2N A;  1TY2 A;  3E9I A;  2XEF A;  2Z8L A;  1E24 A;  1TU2 B;  2AQ1 B;  2EXD A;  4RGO S;  5LYL A;  1Z7T A;  2JE6 I;  3CME A;  2P6E A;  1I5F A;  1WFQ A;  1TWA B;  5IP9 H;  3QG1 A;  2H5X A;  2SOB A;  4P45 A;  2OWO A;  3F8T A;  1U6M A;  5DAU A;  4NXY A;  1SFO H;  4NXN Q;  5BR8 L;  1DXM A;  1SXT A;  1X32 A;  2EY5 A;  2B63 H;  1MD2 D;  4A3D G;  4FUU A;  1PMR A;  4DV5 Q;  2B2V A;  3BJ8 A;  5D65 A;  3MXN B;  4JI8 Q;  3D2M A;  1VQ7 A;  3RLN A;  4DF7 A;  1Q2D A;  5DS0 A;  1VQ4 A;  1S7L A;  4JCV E;  1AUG A;  4B13 A;  5CV9 A;  4EVY A;  3PUX A;  3TSS A;  4MHY A;  2D4P A;  2OQ0 A;  4FXG C;  3KHZ A;  2IT1 A;  3TC8 A;  2F0K A;  1B4O A;  5JH9 A;  1QNU A;  2F0O A;  4DR5 Q;  1RO5 A;  2ZM6 L;  1SJH D;  5A2Q E;  1RTO A;  4TNU A;  4KOR A;  5IGF A;  2BUE A;  1STG A;  3CHB D;  4JI5 L;  1CSP A;  3F0A A;  1VKC A;  1YNJ C;  2KQ3 A;  3QWN A;  5C4J B;  1CKN A;  1UAP A;  5DWN A;  4FP5 D;  4AH6 A;  4AQY Q;  3A9L A;  2A68 D;  5D3I B;  3EFA A;  1QUQ A;  2EYF A;  3I4N H;  3OW7 A;  1KQS A;  3R95 A;  1QSO A;  3L2P A;  2Z3M A;  1X3G A;  3RZO B;  1O7L A;  3K57 A;  4P4E A;  1CHQ D;  2ZED A;  1EY7 A;  2M2L A;  3QB3 A;  4RCO A;  4K5V A;  4Y7N B;  4ZX9 A;  1IYU A;  4UPA A;  3CCJ A;  2DNC A;  2Q2I A;  4QB9 A;  2HHH L;  5KIX A;  4DAM A;  2ZT9 C;  2UUB Q;  2AKW B;  3HGB A;  5IYB G;  5A27 A;  2QCP X;  5IB9 A;  1PH2 A;  3CKI B;  3S6H A;  1SNQ A;  3HS0 C;  3QNV A;  2JA5 H;  3KQX A;  2ZPA A;  1ICW A;  4DV2 Q;  2OOT A;  4H89 A;  4WRD A;  2CQA A;  2IHE A;  4OLL A;  1Y1V B;  4DU9 A;  1KL9 A;  1A15 A;  1HZB A;  4JG2 A;  1N34 Q;  4ZYQ A;  3FRM A;  4EQ5 A;  4K0K L;  4KI0 A;  3SXN A;  1B2T A;  5EJW A;  1ZG9 A;  2LXJ A;  3K9U A;  4M8A A;  4KVO E;  3KLS A;  5FO8 B;  1PTO H;  2NTS A;  4NFR A;  1HJP A;  1KD1 C;  4DK3 C;  2GFQ A;  5K8N A;  4L5Q A;  1CI3 M;  1GKH A;  2EYO A;  3G6E A;  4ME5 A;  3T1H Q;  2SEB D;  1S7N A;  1MJE A;  3S9L A;  1S5B D;  2ZXR A;  1FNV A;  4OON A;  4DK1 A;  3PFE A;  4IAL A;  1XMB A;  4DV1 L;  2ZEM A;  3DM3 A;  1BBX C;  2NSM A;  4Q7A A;  1RXT A;  2REF A;  4L6T B;  3SVM A;  2C9O A;  2BSW A;  5NUC A;  1I6H H;  2EO8 A;  3QOL A;  3HOW B;  1TWH H;  1X54 A;  5JPN C;  1NJI C;  2X7B A;  3HOZ B;  4KS9 A;  3NWS A;  2AFO A;  3NTK A;  4WFN 3;  1XF8 A;  2Z11 A;  2ZEN A;  1CBX A;  1Y8O B;  2VUM H;  2KED A;  4K8J A;  2L5T A;  4Q0F A;  4YCV A;  3L3O C;  2PQE A;  3SR1 A;  1XYI A;  2IX1 A;  2BDN A;  3RZD H;  3M4O B;  3MA2 B;  4ZLT F;  2TMP A;  5IWA L;  4KOW A;  1UE7 A;  1N8R C;  2K32 A;  2NVX H;  3X3M A;  2Q2T A;  4A30 A;  1PYT B;  1TF8 A;  1K9M C;  4OC4 A;  1JOQ A;  2I07 B;  3IJ3 A;  2Q04 A;  4DR6 Q;  4CJ1 B;  4IPG A;  5DLQ E;  2HQY A;  1LTS D;  2A5H A;  3PB8 X;  2VW9 A;  2PJ4 A;  3H0G H;  1WYD A;  4G1P A;  3WR7 A;  3WT4 A;  3D7H A;  2AFU A;  2AMC B;  3S9W A;  3MVV A;  4DUY Q;  3EC4 A;  4RN7 A;  1GYT A;  3R3O A;  4QVT A;  3KFU A;  4IZ8 A;  4A3D B;  1EWC A;  2UXC L;  4LFC Q;  2VUM G;  1R43 A;  1DCZ A;  4P74 A;  3I56 A;  1YVK A;  4RGN A;  4RGM A;  1ELM P;  2MP1 A;  4K2L A;  4PG3 A;  3C1F A;  5C82 A;  1E2Z A;  1G51 A;  5C0X G;  2V8D A;  1HCZ A;  1YVO A;  1ROD A;  2J7Z A;  5F48 A;  5JOB A;  5IE8 A;  3WOF A;  2HV2 A;  2VZY A;  4IFD J;  2Z0Z A;  3VYS A;  2R6G A;  3A55 A;  3HP3 A;  1N32 Q;  1LTT D;  2MQH A;  4A3L G;  4AB7 A;  5HMN A;  3TS0 A;  4IAV A;  4KD3 A;  3F2U A;  1QIL A;  1CM9 A;  1HNZ Q;  1VQN A;  2OQK A;  3IKJ A;  2YND A;  2LFN A;  1SLJ A;  5C3X A;  4YRH A;  1OXU A;  2PJA A;  2C5C A;  2L12 A;  3GTO H;  2B2W C;  4ME3 A;  1LTI D;  4K14 A;  1O7Y A;  3D31 A;  1G6P A;  1H9M A;  2QEC A;  3T13 A;  1YEZ A;  4QUC A;  1YNN D;  3CW2 C;  5C4X G;  4F7X A;  5IB0 A;  3KLS X;  1G91 A;  4FXK C;  4ZX8 A;  5L37 A;  4KOY A;  3GYA A;  2DGY A;  4P4F A;  3TZD A;  5KRU A;  4BS9 A;  1JQY D;  1S5D D;  1Q7L A;  1SYB A;  4K5X A;  1SEB D;  3GB0 A;  1SYD A;  3U9O A;  3NH4 A;  2Q4V A;  3K8A A;  1WTH A;  1IHZ A;  1HRJ A;  1EIF A;  2QEJ C;  5KTD A;  1X65 A;  2CHB D;  5EKI A;  1JMC A;  1IKM A;  3CC4 A;  5FKA C;  3K5N A;  1HA5 A;  1NTG A;  2R8V A;  5CV5 A;  2A6E D;  2RQX A;  1CZW A;  1JE5 A;  1Y8P B;  3A7L A;  4MRI A;  1LT3 D;  1ENC A;  4LMQ D;  3ER0 A;  3HKZ G;  4KKS A;  1OXV A;  2PJ9 A;  4B5P B;  4BY7 H;  4CGN A;  3V96 A;  3Q22 A;  4PQX A;  3GTK H;  3TRZ A;  1QZG A;  2EVN A;  4A4I A;  2CTB A;  1BOS A;  4E8O A;  2NVT H;  1P8L A;  1BR9 A;  2Z4H A;  1EIY B;  2GRE A;  1LT6 D;  3NBH B;  4C7I A;  2HQL A;  1D5M C;  2ODF A;  2F0D A;  4BBR G;  3GDE A;  4A3F H;  1EUJ A;  3OTO Q;  3VYU A;  5FJ8 H;  2WZN A;  3AEV A;  1X12 A;  2CH4 A;  2EPB A;  4YHH L;  3D6C A;  1SJE D;  3RO0 A;  1A62 A;  1XE4 A;  2VXK A;  3S15 H;  2I5L X;  5IGC A;  2POK A;  1YHB A;  1WTV A;  5CNP A;  1VQJ A;  2OT2 A;  3VR2 A;  2Z3O A;  2PIY A;  3DR8 A;  1PH9 A;  2WV6 D;  2DN8 A;  2A4N A;  4GNX A;  2Q8I B;  1NUC A;  3K2K A;  5AG5 A;  2WKD A;  4JYA L;  1AYE A;  4KUA A;  3QJY A;  2EYM A;  1FD7 D;  1QMU A;  3C26 A;  1B87 A;  5G3L F;  4CJ0 B;  2P6G A;  4A3F G;  1YBY A;  3JC6 6;  4R3K A;  1A8V A;  2XEG A;  5DEH A;  3S24 A;  2PQA A;  4OC1 A;  3GTQ H;  1XMQ L;  2F3W A;  1ASY A;  4EFD A;  1YQE A;  1LAC A;  4KHP Q;  3KI9 A;  1EU4 A;  1UUP A;  4MTN A;  1EY0 A;  1E2W A;  4MHD A;  2AQ3 B;  1U0L A;  5FO7 B;  4DV3 L;  1I6H B;  1QG7 A;  2B39 A;  4RKL A;  3IFT A;  3FB3 A;  3ULL A;  3H8E A;  2WP8 J;  4DV4 Q;  4NGM A;  2J0T D;  3I73 A;  5EKL A;  1EQQ A;  3E0J A;  1XJO A;  4A3G H;  3PZJ A;  3SGI A;  2EYJ A;  2VUM B;  1V1O A;  1PYB A;  4R87 A;  2E2D C;  1MBY A;  3VAT A;  4GLA C;  1LAB A;  5IP7 H;  1ON0 A;  4R4Q A;  1S5K A;  3ULJ A;  2EQS A;  2GA4 B;  3P1H A;  3K5L A;  2OZU A;  3W2D A;  4OWT B;  1SBB B;  3ERQ A;  4CHT B;  2NVX B;  2FXF A;  5CV6 A;  4RHS A;  4KLV A;  5I9P A;  4KOX A;  3TOA A;  3I7F A;  3P2H A;  1NAP A;  4F9U A;  1F77 A;  1F2M A;  1PRT B;  1E22 A;  4CAX A;  5KTC A;  3DNS A;  1N36 L;  1B50 A;  5COY A;  4A3E G;  1VQ9 A;  4L5S A;  3ERO A;  4WOR A;  4XYO A;  4ZAI A;  1IU8 A;  1PZI D;  1QCB D;  1QSN A;  2M9V A;  2B4D B;  2Q2H A;  2A6H D;  1STY A;  2JJQ A;  2UU9 Q;  1Z4E A;  5JEA J;  1OO9 B;  2PR8 A;  5C4X B;  4A3J H;  4DUZ L;  3G4S A;  4JPB W;  1PH3 A;  1WTO A;  1X55 A;  5JEA H;  2GLJ A;  4GXH A;  5IYC G;  2FHT A;  2JA8 H;  3I4M H;  1CK1 A;  1MK4 A;  4A3I G;  3R2T A;  2QIR A;  5FLX L;  4WJ4 A;  1PCA A;  1PYW D;  3L7Z C;  1BXT A;  4IUS A;  5EKK A;  1NNX A;  2KCT A;  2PJ8 A;  2OTL A;  5BN5 A;  5JM6 A;  3RN5 A;  1UE6 A;  3KF8 A;  3SHL A;  4PZ6 A;  2F1M A;  2PNR C;  1FL0 A;  1GUG A;  3F2C A;  1XNR Q;  3S2D B;  3B3S A;  1OXT A;  4F8M A;  1SYC A;  1UE5 A;  1PUA A;  3EBE A;  5GAG C;  3H8F A;  3MGD A;  3HKZ B;  4LF7 Q;  3PB4 X;  5HVF A;  3M4P A;  3HKZ E;  4XPD B;  4A3C G;  2NYQ A;  3PBE A;  2K05 A;  2K33 A;  4G57 A;  4DR3 L;  2JA8 G;  1ASZ A;  5CR3 A;  3I4M G;  4F0Y A;  4X66 L;  1A2Z A;  2IJZ A;  1VQM A;  2NB0 A;  3HLP A;  1YJ9 A;  2O4H A;  3TX8 A;  3FKI H;  2HCI A;  1I21 A;  1VMC A;  4UFW A;  2ZEO A;  1S72 A;  1BUV T;  4KOU A;  4A38 A;  5J8C A;  1ML0 D;  4JD6 A;  4KVX A;  3UDI A;  4FF3 A;  2E5L Q;  2F0E A;  3K81 C;  1CKM A;  2DUD A;  4UDU C;  2N49 A;  2Q4Y A;  1CHP D;  5AJ3 L;  1J4J A;  3CPX A;  4EQP A;  5E4X A;  2NYZ D;  5BN4 A;  4DR4 Q;  1HZA A;  2MGS A;  1Y0R A;  1MHW C;  5M3M G;  3FNC A;  1F9P A;  1U4M A;  5K8P A;  1XWE A;  3CXS A;  3VA5 A;  1G8Z D;  2ZJQ A;  4A3K H;  2JA7 G;  2UXD L;  4A3F B;  1FY7 A;  3W3A A;  4ILW A;  7CPA A;  1HFG A;  2A68 C;  3NWT A;  4PZ7 A;  3S6F A;  3D4R A;  1SR3 A;  1K73 C;  4HTH A;  1PH7 A;  3L9A X;  2K01 A;  3S15 B;  3A8J E;  2Z1C A;  1KZF A;  3B7I A;  4NSQ A;  4RH6 A;  3V38 A;  1YIJ A;  3GTJ H;  2ENB A;  2I79 A;  2HIV A;  4RHR A;  5I2Y A;  5JJI A;  1M4V A;  1SMX A;  1MJ9 A;  2F8H A;  5CPA A;  2WSA A;  2Q7B A;  4JV5 Q;  1XTD A;  5A2Q L;  2DXQ A;  4ZY2 A;  5C44 G;  1LT4 D;  4IF5 A;  2DF5 A;  2OU2 A;  2ZOG A;  2VI7 A;  5HVH A;  2VQF Q;  3PO2 G;  3GLJ A;  3URY A;  1TWA H;  1A63 A;  4EGV A;  4KHV A;  1S7F A;  4JJX A;  4KTA A;  1ZLI A;  3VR6 A;  1GHE A;  1S3Z A;  1GD7 A;  3OWE B;  3VDY A;  4B3S Q;  3M7N A;  1GVP A;  4A3E B;  2E75 C;  3K58 A;  4JZ0 A;  2Z10 A;  2UXB L;  3H3V H;  1XPR A;  5H84 A;  2KA7 A;  4A3G B;  2B29 A;  3CP0 A;  1XNQ Q;  5E1F A;  4POG A;  1CPX A;  4MNO A;  4MFQ A;  2K7V A;  3CCQ A;  2YNC A;  2R98 A;  1HNX L;  3CRL C;  2N8N A;  3KQZ A;  2D9U A;  4LF5 L;  3LWE A;  2RVL A;  2ATW A;  4IUT A;  4FNF A;  4QY7 A;  3SK4 A;  2KCW A;  1K8G A;  2JA9 A;  4UWI A;  4DKA C;  1WOC A;  4A3I B;  3WDN A;  1M44 A;  1L0C A;  2EK8 A;  4B3R L;  4YU9 A;  4QL5 A;  3VR5 A;  3CCM A;  4UP9 A;  2E2H B;  2TSS A;  2NN6 H;  4P4D A;  2ZEF A;  1ZKO A;  1Y1W G;  2QDL A;  5I4M A;  3HOX H;  2XWJ B;  4CGP A;  2AE6 A;  3SJG A;  3VH9 A;  1IBL L;  2XWB B;  3CAM A;  5C4J H;  4Y52 H;  5C88 A;  4FF1 A;  1GJX A;  4B14 A;  4A76 A;  2B4B A;  2VQE L;  2B5G A;  4NJR A;  1DGS A;  1RTQ A;  3S17 H;  4AG7 A;  4X3R A;  2R7D A;  3D3R A;  2C27 A;  1PRT F;  3DEO A;  4KV6 A;  3RZO H;  2JA8 B;  3I4M B;  1JWQ A;  1PZJ D;  4LAA A;  3BXM A;  5FLM G;  1I6V C;  1W3S A;  2JP1 A;  2JA6 H;  4JVZ A;  1NBW A;  1EFW A;  3DEP A;  3M3Y H;  4LUA A;  4CYQ A;  1J5E Q;  2Y0S G;  5K36 H;  2EXZ A;  3PV0 A;  3NBI A;  4B3T Q;  2JSO A;  2OR4 A;  2IQ6 A;  5ISR A;  4RG1 A;  1EY9 A;  3S1R H;  2BCO A;  2RSO A;  2IX3 A;  3CF5 A;  1PH4 A;  2R7Z G;  2OH1 A;  4JBJ A;  3V7Z A;  4AG9 A;  3NE7 A;  2O5I C;  3LWU A;  4N8X 1;  4F0X A;  4NPS A;  2RSN A;  2G9H D;  1N33 Q;  3PO3 G;  3WC6 A;  3CZX A;  4X64 L;  3D7D A;  2RKS A;  4M6I A;  1BPM A;  2QW7 A;  1LTA D;  3W5O A;  1YGH A;  3BJ7 A;  3OIP A;  1EQV A;  1IYJ B;  4ZUI A;  2ZOF A;  5I2X A;  4ONU A;  2R61 A;  4UFV A;  4KY7 A;  4XT3 B;  2RDH A;  3MN8 A;  3WWV A;  1YNN C;  3FKI B;  5T1G A;  4JI1 L;  2V8H A;  1EZ6 A;  1GOZ A;  2R93 H;  1CFM A;  2JK8 A;  1MKH A;  4DAV A;  4NGT A;  4OC5 A;  1I4Q A;  1LCP A;  1EIG A;  4DXF A;  5C3E H;  2Q0Y A;  4BXX H;  3M85 A;  4CDF C;  2VEZ A;  5LYF A;  2Q51 A;  1BBW A;  2GN5 A;  3K59 A;  2I46 A;  1W6K A;  3C3L A;  4A2Z A;  2VY3 A;  3KR5 A;  4XQQ A;  3HOW H;  2LMC B;  3BDO A;  3FF3 A;  1C8C A;  5J3B A;  4GM5 A;  4MHZ A;  1PFS A;  1IBM L;  1HXY D;  3I91 A;  2L55 A;  2IJ0 A;  4YGO A;  2ZXO A;  2ICI A;  1K4J A;  3SXH A;  1ILQ A;  2G9D A;  3D3S A;  2A6E C;  2KCC A;  4MHP A;  4CDC C;  2HC9 A;  1JWU D;  5C44 B;  4BIN A;  3SK6 A;  2MNA A;  1MSG A;  1H8L A;  1YVC A;  4JBK A;  4GOP C;  1IW7 D;  4PV6 A;  4PPZ A;  3PO2 B;  3PMF A;  2MJ8 A;  5C3E G;  3DWP A;  2G3T A;  3TE4 A;  1S5E D;  4FO2 A;  4JI7 L;  1M1K C;  4NDX A;  3MAQ A;  2F0Q A;  3GTJ B;  2DY8 A;  1PYS B;  4DR7 L;  4GS4 A;  1FT7 A;  5LMN L;  4WJ3 M;  3HOY G;  4A3D H;  1SDF A;  2PZU A;  2L9H A;  4K5W A;  5IT9 E;  3S1N B;  2OTJ A;  4DAY A;  3IWW A;  5BR8 Q;  4OP4 A;  2GE3 A;  5LHY 1;  4IPH A;  2ZXP A;  2D0O A;  4ZUJ A;  5K8M A;  4JI2 L;  4IQZ A;  1W2B A;  1M90 C;  4OME A;  2A8V A;  3J7A V;  4KY6 A;  4TKO B;  3R8B A;  2KHI A;  5C4H A;  1ZLH A;  3NE8 A;  1Z2L A;  2JXM B;  4OEL B;  4HJ5 A;  2JDC A;  2ZXV A;  4GKK Q;  1Y1W B;  1TR5 A;  2ZM6 Q;  1DJR D;  2ES2 A;  4TVA B;  2DJF C;  1STH A;  4FD5 A;  3D4U A;  3E6Z X;  2PJ0 A;  3CQZ B;  4GN5 A;  5IY0 A;  3BLN A;  1XEB A;  5ELF A;  1KUX A;  2LY7 A;  5CMD A;  1I4H A;  4V0B A;  2QVP A;  3FJU A;  4MFL A;  1KRT A;  2LS0 1;  4JI6 L;  2AJ6 A;  5HY6 A;  5E4W C;  4KK7 A;  1IB1 E;  3ISZ A;  3OWF A;  4ALP A;  2CY2 A;  5F47 A;  1V1P A;  4LFB Q;  4FD6 A;  1FGB D;  1HUM A;  1F9R A;  2KCM A;  4P4I A;  4YWY A;  3QAY A;  2K5Q A;  3I70 A;  4A3M G;  1SNO A;  3KAS A;  1OBR A;  2CWP A;  5IYB H;  2PJ5 A;  1FNW A;  2Y0S B;  3HOX B;  4CJ2 C;  1UWY A;  5EQ0 A;  3U50 C;  2CIJ A;  2V1C C;  4MFZ A;  2F0V A;  4DUK A;  2QF7 A;  2Y0S E;  2X69 A;  3IC1 A;  5G1Z A;  3EN2 A;  2YNE A;  1FNO A;  2R7Z B;  1Q2Y A;  3JAM L;  5JJZ A;  4S3S A;  2HD3 A;  3S17 B;  1XOV A;  3LD2 A;  2MO0 A;  4QBJ A;  4R3L A;  4B10 A;  4NXN L;  3KF6 B;  4TWE A;  1OXX K;  3DDD A;  1Q2C A;  4C3I G;  3K6O A;  4R9M A;  4PXC A;  2A6H C;  3R93 A;  2YV5 A;  4H2K A;  1EOT A;  4CDE C;  3E9H A;  4JI8 L;  2JA6 B;  3GTP B;  1PU9 A;  2VNU D;  2X6G A;  2HCC A;  1D6E C;  3J81 L;  4PXB A;  1HUN A;  3OMC A;  4Q36 A;  1B44 D;  3U9S A;  3WOE A;  3RNZ A;  3V2T A;  3M3Y B;  2ZW7 A;  3VYT A;  1M1D A;  4PXD A;  4XQJ A;  3RR5 A;  3GTL H;  5JVG 3;  1TKJ A;  2CVR A;  3T1Y Q;  4UCP A;  3S1R B;  4BA1 I;  1RL2 A;  1VQO A;  3N5F A;  4CGO A;  1KRS A;  4A3B G;  4KLW A;  2PJB A;  2BH8 A;  4LF4 Q;  2BOS A;  1LRZ A;  2AFS A;  2OCE A;  5GAH C;  2RDF A;  3FIX A;  2KCN A;  4LK1 C;  1R57 A;  1WK4 A;  5EPL A;  4BY1 G;  2XRS D;  1HR0 L;  1CG2 A;  3ZJY C;  1CPS A;  4B6Z A;  1JB7 A;  2BA0 A;  1DD2 A;  5EPK A;  1LOK A;  1YNX A;  4AQY L;  3TO7 A;  4C3H G;  4NGS A;  2K6A A;  2RHS B;  2R93 B;  4EWT A;  3A54 A;  1L1O A;  3QOJ A;  5IWA Q;  4CRY B;  1VQ8 A;  5C3E B;  1IKL A;  4HMI A;  3H15 A;  4LF9 Q;  5A35 A;  3CRK C;  1EL0 A;  4ORF A;  3TCV A;  4CYP A;  2B2V C;  2G5D A;  3SI1 A;  3ND9 A;  3OYY A;  1P16 A;  1NMT A;  3P20 A;  5ELE A;  1I12 A;  4MZ9 A;  1F2P A;  3TP7 A;  5C4Z A;  1STA A;  3N7Z A;  2D62 A;  1SN8 A;  3LNN A;  4F87 A;  2O53 A;  3B3C A;  3NPP A;  2K4K A;  3R1K A;  1BCP D;  1UE1 A;  1KAA A;  2JLM A;  8CPA A;  5C6A A;  2RBM A;  2UXC Q;  1Z8L A;  4P71 A;  4C1N K;  1G2T A;  5C0X H;  2J8R A;  5FVJ A;  3JRU A;  1ZYR D;  3KYH C;  2PJ2 A;  4U68 A;  3SHP A;  1CUK A;  2XSC A;  2IL4 A;  2CFM A;  3JAM c;  5AG4 A;  2AUK A;  1Y8N B;  2ICE C;  3GV6 A;  1E1T A;  1XBU A;  5M9O A;  1PTO D;  1QST A;  3NH5 A;  3AYH B;  3S9N A;  2EOT A;  4A3L H;  2HQE A;  1EQR A;  2P0W A;  4DR2 L;  1WJJ A;  1B7Y B;  2DEA A;  2F0G A;  1Q8I A;  3T1H L;  4FF2 A;  3GD7 A;  3J81 c;  2IW3 A;  1PFN A;  3HOU G;  1EWH A;  1YRE A;  3MXN A;  3FMC A;  4X65 L;  1VQI A;  5C4X H;  4NGR A;  1LLR D;  5LRG A;  3MXU A;  4P44 A;  3VWE A;  1AE3 A;  3AMU A;  2Z0S A;  4PMC A;  4JK1 C;  1I4P A;  4J8Q A;  4V19 0;  4FXD A;  2C6G A;  2A69 D;  3RAM A;  2JEB I;  1NSL A;  4JI3 Q;  1A2T A;  3K7U C;  1UFH A;  3TS2 A;  3VA7 A;  4KJN A;  4A3M B;  4KSI A;  4HCE A;  2ZEG A;  3MWY W;  3PIO 3;  3AQQ A;  4LWC A;  1D2B A;  2WAQ G;  5M5W H;  4DAP A;  1LT5 D;  1C7Y A;  1S60 A;  5KYL A;  2PI2 E;  4R76 A;  3S2D H;  2PCF B;  4CGM A;  2FS5 A;  4OWW B;  3NEM A;  1I4R A;  2F7V A;  4DR6 L;  3SXO A;  1JOO A;  1LV9 A;  4P10 A;  1TT2 A;  3CPF A;  5LL6 X;  4QUS A;  1KDC A;  1X9N A;  5KEE A;  4B12 A;  1AZP A;  1SE8 A;  3S16 B;  2FIW A;  1KXL A;  3KF6 A;  4O23 A;  4N8F A;  4YWK A;  1DTD A;  2FMC A;  3KDF B;  4A37 A;  3MFY A;  4LFC L;  3TQY A;  1D7Q A;  2HUZ A;  4BBR H;  2BEI A;  5ELN A;  4OX9 Q;  1MJC A;  1STB A;  3JVN A;  4QC6 A;  1VQL A;  3SK8 A;  2O5J C;  2CNS A;  1KUY A;  4LFA Q;  1YLE A;  4NGQ A;  2EYP A;  2PJ6 A;  2Q7S A;  2CCZ A;  3FDT A;  4YCW A;  3W1G A;  2PQ8 A;  5J8F A;  4P73 A;  1EQT A;  2MFI A;  1B1Z A;  2XEI A;  4R6T A;  4DA2 A;  4A3B B;  1N32 L;  1Z9U A;  4AVA A;  1NMF A;  3B3V A;  1D8L A;  2IX0 A;  2RCF A;  1WD0 A;  1CX8 A;  1HNZ L;  1H9R A;  1Q1E A;  3O13 A;  1HZC A;  2F0M A;  2PDO A;  4IUP A;  2KEN A;  1CSQ A;  4IFD G;  3J80 L;  4BY1 B;  2B2U A;  3PGZ A;  1B8A A;  2X6L A;  4JYA Q;  3PUV A;  4IFD I;  2Q43 A;  4L8A A;  3X3N A;  1PXU A;  3Q8D A;  4X6A H;  4LX9 A;  2PCU A;  5H1S E;  3J7Y W;  1UWV A;  2F0T A;  1A3U A;  1HQM C;  4EVO A;  2IMO A;  1A3V A;  1JIC A;  2QEX A;  1X3P A;  3CC7 A;  3GTL B;  3J7A F;  1DM0 B;  1ENF A;  1KHI A;  4ZY0 A;  1VQB A;  1IOI A;  4PSW A;  4Z65 A;  3NH8 A;  3R9F A;  1TS4 A;  4FWU A;  4O42 A;  4RI1 A;  1STE A;  4DV3 Q;  1WCM H;  4X3S A;  5E96 A;  4B9X A;  2FE7 A;  1Y14 B;  2Y0M A;  3PCO B;  4KY5 A;  3CCS A;  2NZH A;  4XXE A;  4GZY C;  2GLF A;  1JCK B;  2ARH A;  3J81 j;  2KHS A;  4K8I A;  4YY3 L;  1JWS D;  4IUR A;  5KGU A;  4DNR B;  1TWC B;  2YGW A;  1K8A C;  3HOV G;  1AE2 A;  3CXC A;  2EY2 A;  3J7Z C;  2QML A;  3SI2 A;  1U5K A;  4JBW A;  1JC7 A;  3A0J A;  2IHF A;  1NY4 A;  4FD4 A;  2F4I A;  5I6W A;  3LAC A;  3CMA A;  1H9S B;  3T53 B;  4ABN A;  4NW2 A;  1PFM A;  3UE1 A;  2ALY B;  3F8K A;  4A3E H;  4OIW A;  4CAV A;  3TZU A;  4M1U B;  1WCM G;  3IFE A;  5HVG A;  4DYO A;  2QGQ A;  5TSS A;  2B2Y A;  1O7Z A;  4U9Y A;  1PFB A;  4NMZ A;  3JAM i;  1Y0Y A;  4DV6 Q;  1FYC A;  5F2D A;  2JDD A;  4NGP A;  5EMI A;  3DWQ A;  1U4L A;  5HGQ A;  4F9V A;  2PMZ B;  2RF4 A;  4FYD A;  1YR0 A;  5IYC H;  2AWN A;  4II9 A;  3FEC A;  1QNK A;  2L15 A;  2PMZ E;  3UDX A;  4DXG A;  2JEA I;  1HTP A;  2Z6K A;  4A3I H;  1IGB A;  2C1C A;  3S9M A;  3D8P A;  1SSO A;  1HR0 W;  4HIM A;  1PH1 A;  4RMF A;  1AP0 A;  3K5M A;  2F0H A;  3STB D;  2E2H H;  2FSR A;  4CDD C;  4K2K A;  1YK3 A;  2LKV A;  2PW7 A;  2PI2 A;  1RF2 D;  1Z8X A;  3HFZ B;  4CRZ B;  2O28 A;  4ZY1 A;  1SAP A;  4NF1 A;  1Q7Y C;  4MCS A;  1F2L A;  4L5R C;  3SJX A;  4EX5 A;  1PH6 A;  4KHP L;  1ARM A;  3S6G A;  1Q90 A;  3GTM B;  2F5I A;  3BU2 A;  1PH8 A;  4A3C H;  2K14 A;  4PMW A;  3H4Q A;  4DV4 L;  1AZQ A;  5D14 A;  2B8G A;  3HKS A;  3EA6 A;  1BPN A;  1NE9 A;  1KAB A;  3HZX A;  1H9K A;  5DM7 3;  1QJO A;  4TQU S;  1SYE A;  4WJW A;  5M3F H;  1XMO L;  2J4X A;  5EBD A;  4MY3 A;  2HT1 A;  2A19 A;  2D2C C;  2R3Z A;  4MXU A;  4QIW B;  2D5D A;  1AN8 A;  3BVM A;  5ELB A;  3K9T A;  4QIW E;  3BZD B;  5M5W B;  2SNM A;  4MBU A;  4A95 A;  1TKW B;  2ZW5 A;  4GNX C;  3EY5 A;  4PZ8 A;  3SDZ A;  3R96 A;  4X62 L;  3A8I E;  1JOR A;  4ODG A;  1STN A;  3R9E A;  4B5P A;  2BH2 A;  1LAN A;  3WC5 A;  4BBS G;  3GIU A;  4MHN A;  4UF4 A;  1TF9 A;  5M3M H;  1YSJ A;  2YYZ A;  3CXQ A;  3PSI A;  1M8A A;  4GOP B;  1Q82 C;  1IBK Q;  4JBM A;  4ZRZ A;  3G48 A;  3IAY A;  1YX0 A;  1PDQ A;  3ISX A;  3WC7 A;  4B11 A;  1GHJ A;  1MIU A;  1HZ9 A;  3NBH A;  4N9P A;  3UI2 A;  2ZJP A;  3ZYY X;  3M9B A;  4XQN A;  4DNI A;  5M3F G;  4PNY A;  3AFQ A;  2JA7 H;  4BBR B;  2UU9 L;  2GIV A;  1N9W A;  4L63 B;  2NTT A;  1B6B A;  1ET6 A;  5IT9 L;  1EY8 A;  3I72 A;  4B9W A;  2FL4 A;  1HQR D;  3JTK A;  4I7A A;  4GKJ Q;  1ELL P;  2CXA A;  1Z8W A;  2F0F A;  4JOI A;  3B2Y A;  5CV7 A;  3B35 A;  1QVC A;  4M3S A;  2LSS A;  1RCV D;  5C3W A;  3FXT A;  1TXY A;  4QF4 A;  3D67 A;  3PRT A;  1VQD A;  3CC2 A;  2BE5 D;  3UE0 A;  4HNX B;  1HH2 P;  1WTX A;  4OC0 A;  5GAE C;  2H5M A;  2UUA Q;  3KBX A;  2NVQ B;  2J8M A;  1XNR L;  1EEF D;  1XRY A;  3LOD A;  5C44 H;  3I4O A;  4H44 C;  5FK9 C;  1E3P A;  4UP8 A;  2EY1 A;  1E2V A;  3BJU A;  2P6F A;  3PIP 3;  1PVO A;  4CYO A;  4KKT A;  4LF7 L;  3A56 A;  2EYL A;  3CD6 A;  3PO2 H;  3HOV B;  5CYU A;  1RTN A;  3RD4 A;  3BS1 A;  1HHV A;  4NXM Q;  3VYR A;  4ZI6 A;  1I94 Q;  2E8G A;  4IUQ A;  5ELC A;  3NXW A;  2VL6 A;  2N55 A;  5FLX c;  2JN4 A;  5F09 A;  4KOT A;  4O2D A;  5K5P A;  2R92 G;  2H4O A;  1IY7 A;  1WCM B;  4R8F A;  1YI2 A;  5LMU Q;  2G0B A;  4HR7 B;  2EZV A;  3S1N H;  2Z9H A;  2FCK A;  2E5L L;  2QJ8 A;  2ZTD A;  3IRB A;  1BVS A;  3LMS A;  2WKC A;  1VCI A;  4GN4 B;  1EYC A;  2E2J B;  2F0N A;  4DR4 L;  3F5B A;  4AVC A;  4U9Z A;  5GQO A;  4APV A;  2SNS A;  3D66 A;  4WWV A;  1Q3L A;  2K04 A;  2O4X A;  4DV0 Q;  1F57 A;  2UUC Q;  1LAP A;  4AYB G;  4B3R Q;  1Y1W H;  1FJG Q;  4OO1 G;  1QQ9 A;  2CTC A;  3RLO A;  1PHJ A;  3Q6S A;  2B4D A;  1SNC A;  2N78 A;  4R4I A;  3CQZ H;  4UCN A;  4A93 G;  5GAD C;  2PC1 A;  4OO1 I;  3BDC A;  3NSW A;  4YIJ A;  1DOL A;  2Z6B A;  4XTC S;  2PJ3 A;  1IBL Q;  1P0H A;  1ET9 A;  1KDB A;  3CDX A;  2FVG A;  2YTX A;  1KWM A;  4DV7 Q;  3BVG A;  5IOC A;  3C1E A;  4KHZ A;  1HNW Q;  2VQE Q;  1Q8K A;  1EE3 P;  4UCM A;  5FLM H;  4F8Z A;  1H95 A;  4XYQ A;  2IPK D;  1YJN A;  4UEF A;  3H8G A;  1BCP C;  1VQF A;  2EDG A;  4TRD A;  1OZP A;  1J9O A;  5AG7 A;  3KBG A;  2CW0 D;  4K6D A;  4Q38 A;  1ZYR C;  2KBN A;  1GUN A;  1PZK D;  4P72 A;  3CCE A;  1D5X C;  3EIV A;  4X3U A;  5M5Y B;  4NGN A;  2ZEL A;  4Y49 C;  2K28 A;  1LO5 D;  1M4L A;  3K80 C;  2R7Z H;  4OC3 A;  1PTO C;  4XDX A;  1EYD A;  2Z3N A;  3HRZ C;  4LF8 Q;  3SK5 A;  4BBS B;  5AFW A;  3PO3 H;  4IPD A;  3TDQ A;  1EIH A;  4B3S L;  2PVW A;  5I9O A;  1S5C D;  1AW7 A;  2ID0 A;  1F2Y A;  3ONA B;  3CCV A;  1KTK A;  2B2T A;  1CQV A;  2F0W A;  4IUU A;  5CBE E;  3F2B A;  2REE A;  4NEX A;  5M3F B;  3KLW A;  3PEI A;  1XNQ L;  1ICF B;  3GTP H;  2EIF A;  1QVF A;  1VMP A;  3HG9 A;  4ZGY B;  1KAW A;  3B8G A;  3TP8 A;  3PQI A;  4X2T A;  3DSB A;  4HPS A;  1L0X B;  4CKE A;  2F4V Q;  1PH5 A;  2RB7 A;  4LF6 L;  2AHO B;  3S14 B;  2A69 C;  3L0O A;  4OAE A;  3EJI A;  4JLY A;  4JYW A;  1CQF A;  1I4X A;  1T9H A;  5IYD G;  4B3M L;  1B53 A;  3GTG B;  2Q8R E;  3SE0 A;  3S1Q B;  2PZT A;  1S7K A;  4H7B A;  5M3M B;  4CAF A;  1O80 A;  4HNW B;  1A3T A;  2NWG A;  2CQO A;  3PIO A;  1XJV A;  5I4D A;  4RWS C;  1F2O A;  5J22 A;  2OF1 A;  1L0W A;  1GHK A;  4OIJ A;  1ZG8 A;  2BO9 A;  3A5Z B;  2FXQ A;  2JA7 B;  4KSF A;  4MCQ A;  3QIA A;  2ANP A;  1K0R A;  3H94 A;  2NN6 I;  2NZO A;  2IWH A;  3NFZ A;  1CKN B;  1I4G A;  5IGB A;  4K30 A;  4I65 A;  1QUQ B;  4E6I A;  2CNM A;  2FMM A;  2XEJ A;  3I2Z A;  2I0Q A;  3GO5 A;  1BO4 A;  4ZYS A;  1Z47 A;  2EJM A;  3GQB A;  3NE5 B;  3OIQ A;  4HAE A;  3I55 A;  4JI0 Q;  4JI4 Q;  4JI7 Q;  5G3L D;  2YNC C;  3HUV A;  4XIG S;  4IOA A;  3DM1 A;  3OSO A;  3HOY H;  3SI0 A;  4KLK A;  3DLJ A;  3ZJ0 A;  4K3N A;  1V43 A;  2EJG C;  1Z8T A;  4KSA A;  4EME A;  1J5E L;  1VF7 A;  3A74 A;  3KLR A;  2C6P A;  1C48 A;  2PJC A;  4B3T L;  2FJ2 A;  2VB2 X;  3OPO A;  4G7O C;  4RFB A;  2EBJ A;  3MHB A;  2DNE A;  1S5F D;  4C2Z A;  5DM6 3;  3RBU A;  2AFW A;  2QYV A;  4DR1 Q;  4LW1 A;  4C1N I;  1N33 L;  2H1E A;  2NVY B;  4PMB A;  5FO9 B;  3MFG A;  4JI2 Q;  3CPW A;  1Y1V G;  3A7A B;  1K8M A;  1JOK A;  4AYB B;  4X5K A;  3FRP B;  5ISV A;  4HJ9 A;  1KNA A;  4AYB E;  1MI2 A;  1XIX A;  4H02 A;  1BLL E;  4J1M A;  1F2Z A;  3TO9 A;  3KKW A;  4KZT A;  3U58 A;  2XGT A;  4A93 B;  2ASB A;  2OB0 A;  5KND A;  3LX0 A;  4P75 A;  1CKO A;  2PPB C;  3E0E A;  1S4Z A;  4EQN A;  4JXQ A;  1UNS A;  1WTP A;  2D0P A;  5LRJ A;  4CPA A;  2L11 A;  3EQL C;  1K83 B;  4MMO A;  1HPC A;  1FNU A;  1EYA A;  4XT1 B;  3PB6 X;  3SJF A;  5EBC A;  3HOZ G;  2DPT A;  4NJQ A;  3I90 A;  4C3J G;  4A3M H;  5FOB B;  1XPO A;  2YU9 H;  3M4Q A;  4FD7 A;  4RA8 A;  1RIP A;  1KC8 C;  3K0X A;  6CPA A;  3FEW X;  4H13 C;  4ONW A;  4MCP A;  4KN7 C;  4RCN A;  3KJP A;  4JI5 Q;  2PO4 A;  5CV4 A;  2OXP A;  1YLO A;  2OEO A;  3I8Z A;  1GUW A;  3N6R A;  5C5M A;  4UFX A;  5COR A;  5IX3 A;  2RHQ B;  1I50 B;  3S16 H;  3EVQ A;  1VQC A;  1Q81 C;  2XNA C;  4C3I H;  3IGR A;  1Q1B A;  3U4V A;  3D8G A;  3NTH A;  1R3N A;  1SQH A;  2MHV A;  5ELY A;  3W6X A;  3RZA A;  3BG3 A;  1LFW A;  5F46 A;  3I4L A;  2PRQ A;  1XTC D;  1EY6 A;  3KJO A;  5H86 A;  3DUZ A;  3TTH A;  2Q2U A;  4ZKB B;  2PJ7 A;  4M6G A;  2JBJ A;  1I3Q B;  2HHH Q;  3H6M A;  4ZKC B;  3DXJ C;  4UIB A;  3Q0A A;  4XNH C;  4FVM A;  2Q44 A;  4QQB X;  3G71 A;  3PFO A;  2K5N A;  2WAC A;  4A3B H;  3DHQ A;  3RN2 A;  4DK6 C;  3STB C;  3I9S A;  5IP9 G;  3MEF A;  3PO3 B;  4GKK L;  1QWY A;  2AUJ D;  3WAB A;  3GY9 A;  2K5H A;  4UP7 A;  1NSA A;  2ZW6 A;  2MUY A;  4K0K Q;  4BY1 H;  2HIX A;  3NA6 A;  4DV5 L;  3MEH A;  1KUV A;  1QSR A;  1T5E A;  3IFD A;  3MXP A;  2B63 G;  1TWF B;  3QR8 A;  1SE4 A;  4X3T A;  4C3H H;  1HR0 Q;  2DJG C;  4DK0 A;  1K8O A;  1VQ5 A;  1J6Q A;  3MXG A;  2F0I A;  1DE4 C;  3TP5 A;  4A31 A;  3MZ5 A;  4LFB L;  3PUZ A;  4HMJ A;  2HB6 A;  2PVV A;  1ONL A;  1JB3 A;  1TKF A;  5JGF A;  1SE3 A;  4DPG A;  1VQE A;  2M00 A;  4EQO A;  4DV1 Q;  2GVB A;  2VL1 A;  4MTK A;  4DR5 L;  3G8W A;  3B6Y A;  4CBV A;  1XX8 A;  2F0U A;  3D2P A;  4HJ8 A;  1BDO A;  2PE3 A;  4IK2 A;  3M7G A;  3FBU A;  4OL7 A;  4KVM E;  1KIX A;  1HDQ A;  1PLF A;  5I6Y A;  3OW2 A;  1UEA B;  1HFN A;  4QCL A;  3EFX D;  1C0A A;  1TXR A;  4Q5V A;  1C9O A;  2QDB A;  1TII D;  4OWX B;  2EK9 A;  2CH4 W;  4G7H C;  1TWC H;  1YJW A;  2OZH A;  3ND8 A;  3OOC A;  2GAN A;  5JVH 3;  4UEE A;  4BMH A;  5HXD A;  2B8F A;  2K5W A;  4LQG A;  5EC4 A;  1VQH A;  4HNY B;  4L5T A;  3I4N G;  2E2I B;  2WPW A;  2B2W A;  3A8K E;  1WTW A;  3BI1 A;  1N71 A;  1A0I A;  2PW5 A;  4RUH A;  1Q46 A;  1QE6 A;  2FIN B;  1QVG A;  3SEB A;  3HOY B;  1LTR D;  2RFH A;  4DR2 Q;  1RD9 D;  4PQA A;  1E7Z A;  1QB5 D;  3HOU H;  2UUB L;  3RNU A;  1TS5 A;  2EWB A;  1LTL A;  5C0X J;  4FBE A;  3CU7 A;  4OXP A;  5CBM A;  2ZJR A;  1ZXT A;  1R4Q B;  4H0L C;  3T1Y L;  4ZCK A;  1EWI A;  1SNP A;  4DV2 L;  1YHA A;  3IL8 A;  2L1B A;  2WB1 G;  5KNB A;  4X65 Q;  2JA5 G;  4PK3 A;  4LF4 L;  2BOA A;  3B3T A;  2B3V A;  4IUN A;  1R4P B;  4M6H A;  1SYF A;  1N34 L;  2D4O A;  1U4P A;  4A32 A;  2BE5 C;  4RKB A;  1HEE A;  1TIQ A;  5LYI A;  1II3 A;  2RA4 A;  1D1I A;  5ELO A;  4HJ7 A;  1HA6 A;  3D4W A;  1CM0 A;  4C3J B;  1K0S A;  5J39 A;  1CP6 A;  4FAI A;  4GNX B;  2B3U A;  4R7M A;  3CCU A;  1K3B C;  3NTI A;  3PIP A;  1BF4 A;  3NEN A;  1E1O A;  1S3O A;  1CT1 D;  3OHX C;  5LRK A;  2SDF A;  2E76 C;  3CCR A;  4HJA A;  1AFP A;  2O2L D;  2PQA B;  3BZK A;  3HEJ A;  4LF9 L;  1XXG A;  1SMY D;  1WTQ A;  3GTM H;  1LM0 A;  3BVZ A;  1TKH A;  2R7H A;  4IUV A;  4MCR A;  4OC2 A;  4CS0 B;  4C2M B;  1CP7 A;  2I00 A;  4DN4 M;  4ZQ3 A;  2JEV A;  4OAD A;  5G21 A;  1SRO A;  4H6U A;  3TN2 A;  2I5M X;  3MTS A;  1HTL D;  4JW0 A;  4Z9C B;  5EBV A;  4KKU A;  1J8I A;  5IIF A;  2YU9 B;  1VF5 C;  3DLL A;  3BYY B;  3UDG A;  4O1N A;  4DNT B;  1PA6 A;  4DFA A;  2HUG A;  5JJL A;  3DR6 A;  3V8I A;  2KEE A;  1PRT D;  1VQA A;  1X3E A;  2K03 A;  1G29 1;  2AFZ A;  4RAU C;  2Q4Z A;  2R1I A;  1IZ6 A;  5E7N A;  5C0X I;  1YHQ A;  4HSP A;  5LMN W;  1WD1 A;  3IEH A;  3SJE A;  5KNC A;  4DUY L;  3H0G G;  5CGK A;  4IFD H;  1L1O C;  2Z4I A;  4C3I B;  5IOD A;  1OTC A;  1V0C A;  4YWL A;  5LYD A;  5IGG A;  1SFO B;  3A5U A;  1RHP A;  2JEW A;  1TS2 A;  1X3Q A;  3PP9 A;  4F6A A;  2B63 B;  3T16 A;  2OZG A;  3FVQ A;  4R57 A;  3I3C A;  2F0J A;  3T8W A;  4JWP A;  3CT9 A;  3PBB A;  3N52 A;  4HED A;  4P2C B;  1D1K A;  4TSS A;  3NEL A;  1JE4 A;  3W1B A;  1VHS A;  1AH9 A;  4YHH Q;  3GUX A;  3JUW A;  2FFK B;  4AXV A;  1FVI A;  3ITP A;  4JI3 L;  1ILP A;  5HGT A;  2CW0 C;  1F9Q A;  2WPX A;  4DJL A;  1NR4 A;  3J7A 5;  4U67 3;  3PF4 A;  2ZTC A;  1LTB D;  4LUO A;  2NVQ H;  5GRO A;  3KF8 B;  1Y7E A;  4WJB A;  2QIL A;  4LUV A;  4GLV B;  2KHJ A;  5JAV A;  1OXS C;  4C3H B;  3HOV H;  1Y69 U;  4A39 A;  2KJX A;  2NUC A;  2PNH A;  1TY0 A;  4YY3 Q;  3ULP A;  2HDM A;  2DY7 A;  3CXP A;  3H3V C;  1KNE A;  4OKO A;  1XMQ Q;  3DWA A;  2PZW A;  3TFY A;  3G3S A;  2PYK A;  3I4N B;  5D8N A;  4QJF A;  4XPL A;  3KHX A;  4NKL A;  3PF5 A;  4OX9 L;  2A73 B;  2V77 A;  1KLG D;  1MJA A;  1KLU D;  4G4K A;  4MJ8 A;  2AWO A;  1BO0 A;  1A2U A;  1VHO A;  5DWM A;  4LFA L;  4I49 A;  4J6H A;  5JPH A;  2BA1 A;  4AIM A;  4G7Z C;  1BNZ A;  3S1M H;  2WB1 B;  2IL8 A;  1BOB A;  2JA5 B;  3TT2 A;  5D3D A;  4POF A;  2E2J H;  1BCP B;  2WB1 E;  2F3I A;  3D6W A;  2JQO A;  2XVS A;  3E3X A;  1M4D A;  1CJW A;  2RC4 A;  4BY7 G;  1M4G A;  3RLF A;  2BDO A;  1GUT A;  4Y49 B;  1TS3 A;  1ZEQ X;  3ERS X;  5LL6 S;  3OTO L;  1FGU A;  1PTO B;  1VS0 A;  2YTV A;  1Z9F A;  2CF4 A;  3NQT A;  4R4T A;  2MO1 A;  3HOU B;  1N36 Q;  1O78 A;  1B3A A;  5K8O A;  2VB3 X;  5FJ8 G;  1NSN S;  3JAM E;  5ELD A;  1Y9K A;  2B58 A;  3FYN A;  4C2X A;  5DNF A;  3AFP A;  3I3G A;  4MIU A;  3ICE A;  5JJK A;  5CC4 A;  1BAV A;  3H5Z A;  4DUZ Q;  1VHE A;  2PRB A;  1Z5R A;  1DZ1 A;  3V05 A;  4DGZ A;  3FPU B;  5A28 A;  3IWE A;  1B9N A;  3G6J B;  2L4N A;  2HDL A;  3AB9 A;  3B3W A;  2KEC A;  1X56 A;  1TWH B;  2F0P A;  4R4C A;  4R1J A;  1C4Q A;  2EUI A;  2CNT A;  3J81 i;  3J81 E;  3FVL A;  3FP9 A;  4ZBG A;  1K28 A;  4MFK A;  3J80 c;  3TO6 A;  4C2Y A;  1XMO Q;  1VIX A;  1NMG A;  1QZH A;  3DGV A;  1P4N A;  1IW7 C;  2F3V A;  2WAQ B;  2Q8T A;  3U4Z A;  1I1D A;  1YME A;  3RZD B;  1IYK A;  4CGY B;  4R8I A;  4HIO A;  5M5X H;  1MSH A;  2WAQ E;  1ARL A;  5M5Y H;  3W91 A;  3C46 A;  4N9T A;  2B3G A;  5G22 A;  1ENA A;  1VDZ A;  3P75 A;  1AMP A;  2B2U C;  4HN7 A;  4BBS H;  1YNJ D;  2Z3L A;  4X62 Q;  1MJB A;  2ZTE A;  5JQ4 A;  4FDB A;  2BL1 A;  4E0A A;  1JWM D;  3H0G B;  3T90 A;  3GP7 A;  3KDF A;  4A75 A;  4KN4 C;  4OIK A;  2QA4 A;  2J8N A;  3Q23 A;  4DR3 Q;  4PSX A;  4X66 Q;  4DV6 L;  4A3G G;  3T9Y A;  1LAM A;  4HKF A;  2EVB A;  3ZZI A;  5IGD A;  5IP7 G;  5E3F A;  3PB9 X;  4C68 A;  2K5D A;  3S14 H;  4CYN A;  3M4Y A;  3MC0 B;  3GTG H;  2JBK A;  1WI5 A;  4IJL A;  3S1Q H;  2FIA A;  4QB4 A;  4I7Z C;  5AJ3 Q;  2MPM A;  3T4A C;  4YWM A;  4IPC A;  5G20 A;  1RJT A;  1EEI D;  4KJO A;  1PV4 A;  2ZEH A;  4KOV A;  3CPA A;  3QB8 A;  2VXW A;  1X10 A;  4DNC A;  3H09 A;  1S40 A;  3KR4 A;  1X6O A;  4CKC A;  4ZK9 B;  3IO1 A;  4UBR A;  3GTO B;  5KYI A;  2N88 A;  3K0Y A;  3NK9 A;  1Q86 C;  2VZZ A;  2UXD Q;  1GUO A;  4NCZ A;  4W9Y A;  5GCN A;  4QGU A;  2PJ1 A;  4A3J G;  4PV1 C;  2B5G B;  2NBF A;  3FX6 A;  1FR3 A;  1BQQ T;  2WUU A;  5HH1 A;  5JEA G;  2Z3K A;  3H91 A;  3D0F A;  2B2Y C;  4CKB A;  5KTA A;  3NP8 A;  5HUR A;  1IL2 A;  2EJF C;  1Y7R A;  3S6K A;  1EZ8 A;  2R92 H;  1Z6H A;  4L8J A;  1LTG D;  3IU1 A;  3PGP A;  4MN3 A;  5EAY A;  1T5X D;  1TQO A;  5BN3 A;  3RYO A;  2WFW A;  1O7I A;  2Z6K C;  3KOJ A;  2EY6 A;  4M