3LWUA

Crystal structure of putative succinylglutamate desuccinylase/aspartoacylase (yp_749235.1) from shewanella frigidimarina ncimb 400 at 2.10 a resolution
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
372
structure length
372
Chain Sequence
MTKAIQSSVQVGELATGQALTVPIYSFMGSENSAPSVYIQANVHGAEVQGNAVIYQLMTLLEGYQVLGDITLAPLANPLGINQKSGEFTLGRFDPITGVNWNREYFDHNVDIQNWYAEHQHLTNSELFCAYRSMLVETCQARLTHSFGISTGHRLAVNLQAMAHQADIVLDLHTGPKSCKHLYCPEYDIDAARFFSIPYTLIIPNSFGGAMDEATFCPWWQLTEYATSQGREFSVPVSAFTLELASQERIDLADALEDAKGILAYLSHRGVIAEKVNPASMERFGCYLKDYKKFHAPKAGLIEYCASVGEPLTAGKPLVNILRIDLYGSEQAYQAISLPMDCVPILHFASASVLQGTELYKVMTNVFPLQPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Succinylglutamate desuccinylase/aspartoacylase
publication title Crystal structure of Putative succinylglutamate desuccinylase/aspartoacylase (YP_749235.1) from Shewanella frigidimarina NCIMB 400 at 2.10 A resolution
rcsb
source organism Shewanella frigidimarina
total genus 113
structure length 372
sequence length 372
ec nomenclature
pdb deposition date 2010-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04952 AstE_AspA Succinylglutamate desuccinylase / Aspartoacylase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3lwuA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3lwuA01
2I3CA 1GUGA 2C6PA 2EVBA 2NN6G 1LOKA 2JEBI 1IYUA 3PUWA 3VR4A 4G7ZC 3LMSA 2R6GA 3KZWA 2WZNA 3OPOA 2PVVA 3L7ZC 4OP4A 2JEWA 1BAVA 3B3SA 5JM6A 2PJ8A 2PE3A 3PUXA 3H8GA 4R76A 3CT9A 3IWWA 2RFHA 3FPPA 2V8HA 1YW6A 2AWOA 2XEFA 3A8IE 2JEAI 2Q43A 2B8GA 4Q7AA 2PIZA 3H94A 2AUJD 3D7GA 4UEZA 1ONLA 4DNTB 3CRLC 3SI2A 3EQLC 1BDOA 1TF8A 3SE0A 4NJRA 1IYVA 3V38A 4RCNA 1CI3M 3M85A 2GLFA 3ISZA 3SJEA 8CPAA 1K8OA 3BI0A 1SMYC 1Q1BA 1ZLHA 3NE5B 4PV1C 3DXJC 3BI1A 1OBRA 2VL1A 5HVGA 5LYLA 3B3TA 1GUNA 3PUVA 4TQUS 2O5JC 3VARA 4A37A 2C6CA 4KN4C 1OXTA 3KHZA 4OC4A 1HTPA 5F09A 2ZEGA 3D67A 4NGMA 4PPZA 4DK1A 4NGRA 1FNOA 1YSJA 5D29A 1CTMA 3VR6A 5KNDA 2WYRA 4ZX8A 1V43A 4FAIA 2A6HD 3CDXA 3LNNA 1YNNC 3PFOA 3ISXA 4ZY1A 2BDOA 4FUUA 1QMUA 2IJZA 4H2KA 1FR3A 3KL9A 3RLFA 1ZKOA 3WABA 4JZ0A 4NGSA 1O78A 5DS0A 3FH4A 2PCFB 4NFRA 4LJZC 1Z6HA 3BG3A 1ZG7A 1Q1EA 3IKJA 2V77A 4G1PA 2E74C 3CPXA 2PJ1A 1DD2A 4OC1A 3PV0A 4ZYQA 4JBWA 4OO1G 3D68A 3DGVA 4KKTA 4IFDH 4KSIA 2V4DA 2JE6I 2A6HC 4KMUC 4FBEA 2A68D 3I4LA 2ANPA 3RAMA 2DN8A 4HR7B 2A6ED 1LACA 1VDZA 3S9LA 1YLOA 3AB9A 3MXUA 1CBXA 1Y0RA 2QJ8A 3SDZA 2Q8IB 3BXMA 4XTCS 2EWBA 1TXRA 1TKJA 2ABZA 3D4UA 5BN3A 4P45A 3GQBA 5LRJA 1IY7A 1H9SB 2CW0C 1RTQA 1HQMC 2ZEOA 4G7HC 1PYTB 2PCUA 4UF4A 3IIBA 4OGQC 1PMRA 5BN4A 1Z7TA 3BDOA 1LANA 1OXVA 1HPCA 5K8MA 4MCQA 2A68C 1B9MA 2PIYA 3KQXA 1DTDA 1BPMA 4NGPA 1IW7D 2A6EC 3HGBA 1Q90A 2NN6H 2PJ9A 1TKHA 3JRUA 1ARMA 1CFMA 1ZG8A 3K2KA 1CP7A 2JXMB 5K8PA 4IQZA 1Y0YA 3M4YA 2BOAA 2ZEPA 1Y8PB 1H9RA 1VF7A 1BLLE 1GUTA 4OC3A 3KR5A 5JGFA 2ZELA 1GUSA 1DE4C 1DCZA 4EWTA 3NH8A 1FYCA 1A6XA 2QYVA 4DJLA 3IJ3A 3N6RA 1XBUA 2HB6A 4KKSA 4OC2A 1UWYA 2K33A 1Z5RA 2NYQA 1XMBA 2PJBA 3B35A 2RB7A 2ZEEA 1IW7C 3D31A 1AMPA 1PCAA 3FECA 4P4EA 2PJ6A 2ZOGA 3IFEA 3L2NA 1Z2LA 2AFUA 1EE3P 3FEDA 1Q7LA 3CRKC 3LWUA 4EFDA 3VA7A 4MCPA 2K7VA 1VCIA 2Q51A 1E2WA 4OIDA 5IB9A 4P44A 4ZI6A 1VHOA 2ZENA 3PB4X 2PJ3A 2PJCA 3QJYA 3IC1A 3A8JE 4OMEA 3D7FA 2AFMA 5K8OA 2ZEFA 4WJBA 2KCCA 1KWMA 2AFZA 3PB6X 1Y69U 1YNJC 4X2TA 1TKFA 1OXXK 3K9TA 2D2CC 3D7DA 2EJGC 1GYTA 1H9KA 5JEAG 2K32A 4GZYC 6CPAA 3MRUA 4P4JA 3IEHA 2G9DA 2AFOA 4BA2I 4MHYA 1K8MA 4PXBA 3T53B 3OW7A 2L5TA 4BA1I 3GD7A 1LCPA 4I7ZC 4ONWA 5HXDA 5LYDA 2AFXA 2PJ7A 4UIBA 4G7OC 3B3WA 4P4IA 4OO1H 3VR3A 1AYEA 3PBBA 1F2OA 1F57A 3NFZA 3WDNA 1H9JA 1Q12A 4OC0A 4MMOA 1ELLP 4MHNA 1LAMA 4NGNA 4IHMA 4W9YA 2IQ6A 3V7ZA 4YWYA 2JBKA 1B9NA 2C1CA 1M4LA 3B7IA 2HC9A 4NGTA 2BE5D 1H9SA 5LYFA 3RBUA 3I72A 2NSMA 3H8EA 2PPBC 3QG1A 5LRGA 3HLPA 3A7LA 4R7MA 1E2VA 4R6TA 2A69C 4P4BA 3GB0A 4UEFA 3S9MA 2XEIA 2ZEDA 4OC5A 2BCOA 2AFSA 4NJQA 3OOCA 3KR4A 4B6ZA 2D62A 5K36G 4DK0A 1R3NA 3PBEA 3WC5A 3BHXA 5CPAA 5A35A 2EK8A 3B3CA 5C0XG 7CPAA 3HUVA 3PB9X 4KI0A 2XEGA 2GREA 3MN8A 3PFEA 3VATA 1HEEA 1Y8NB 3S9NA 2BE5C 2DNCA 3I73A 4F9VA 4GM5A 4FWUA 4TNUA 3FJUA 4H13C 5KNBA 1VHEA 2JBJA 4DYOA 2V8DA 2YYZA 2XEJA 3RZAA 3TZUA 3T8WA 4Z65A 1CP6A 4UEEA 3NH4A 1GHJA 1T5EA 2ZEMA 2AUKA 4A39A 5JH9A 1QJOA 2O4HA 4L8JA 3FF3A 4PQAA 1YW4A 4XIGS 2CTCA 3FVLA 5D8NA 4NGQA 2OOTA 1HDUA 2CTBA 4MCRA 3WC7A 4A38A 3ND8A 1NSAA 3FMCA 2ZOFA 3PB8X 4BD9A 1EWHA 2EDGA 2DNEA 3B3VA 2J9AA 3D7HA 2IMOA 4F8ZA 5THWA 2QF7A 5K8NA 4MCSA 1HCZA 1CPSA 4OKOA 2IT1A 1YMEA 2PJ0A 2D5DA 1ZG9A 4LQGA 4DUKA 2KA7A 1OXSC 3IFTA 4MRIA 4PXDA 4ZY2A 2PJ5A 4KN7C 1JQGA 2GLJA 1BPNA 4AXVA 4KHZA 5KNCA 1I6VC 2NN6I 5J1QA 3PUZA 3FX6A 5CBMA 3D4RA 4TWEA 2EK9A 2CF4A 2OR4A 1O7LA 1GHKA 4H44C 3DLJA 3SI0A 3SJXA 2PNRC 1VGYA 4JYWA 2PJ4A 1CX8A 1V8QA 3A7AB 4TKOB 5JEAH 3SJGA 4CPAA 1H9MA 2C6GA 2E75C 2F8HA 4X3RA 1F2PA 2GU2A 3D66A 5LYIA 1VIXA 3PRTA 1ELMP 1XJOA 4RUHA 3GUXA 2EJMA 4UIAA 3KGQA 4P10A 4MHZA 3B2YA 3VR5A 4IK2A 3ND9A 4P6YA 2A69D 4PXEA 5HVHA 3WC6A 4LK1C 3T56B 2BO9A 2FVGA 3PEIA 5ELYA 2PJ2A 3PB7X 2ZT9C 1XRYA 1LAPA 2E76C 4K3NA 4WWVA 2PJAA 4PXCA 3W3AA 2EJFC 3VR2A 2B8FA 4MHPA 1Y8OB 3TC8A 4IAVA 4P4DA 1FT7A 2BA1A 3SI1A 2PRQA 5BN5A 5I4MA 1H8LA 4ZX9A 1GUOA 1VF5C 3VH9A 1ZYRC 3QIAA 3U9SA 4H0LC 3T51B 3IO1A 3WT4A 1QQ9A 1TU2B 5K36H 1CG2A 3NH5A 4R8FA 2QVPA 3P20A 4ZY0A 3SJFA 3PUYA 3KQZA 5C0XH 2AFWA 3H8FA 2ZEHA 3NA6A 3A8KE 3KASA 2PVWA 4MXUA 4IFDG 1DXMA 3FEEA 3KI9A 4O23A 1OXUA 2BA0A 4YU9A 3CPAA 4F9UA 3N5FA 1LABA 3KLRA 1ZLIA 5HVFA 1GJXA 3KHXA 1TF9A 4OIWA 4DNRB 1CPXA 4JK1C 1LFWA 1TKWB 2V8VA 2LMCB 1R43A 2V8GA 2CIJA 4X8IA 3GLJA 1XFOA 1G291 1ARLA 4P4FA 4A94A 2O53A 1E2ZA 1Z8LA 3MFYA 2POKA 2Q4ZA 2F1MA 2O5IC 1Y7EA 2DEAA 1HDQA 2F7VA 1IGBA 4KKUA 4EMEA 3M7NA 3TX8A 3I1UA 3QNVA 5LRKA
chains in the Genus database with same CATH superfamily
1HTLD 4N8X1 1X56A 4FXDA 4GXHA 3E0EA 1ESRA 1U4RA 4K5XA 2K4KA 1LOKA 4JG2A 3K57A 1HZ9A 2CH4A 1EIHA 2RF4A 3NK9A 1XMOQ 3L7ZC 4R1JA 3WOEA 3EIVA 1IBML 2MP1A 4XPDC 5HGTA 4DAVA 4EQPA 2IL4A 3H8GA 1JWUD 3FPPA 1SDFA 1U4LA 1ASYA 1LUZA 2Z0ZA 4AVBA 3UDXA 3S14B 1MJ9A 2CCZA 5LL6S 2PIZA 4A33A 3H94A 5CBEE 2AUJD 1JOOA 5ELCA 1KXLA 3F0AA 2IJ0A 5AGEA 5M3FG 4DNTB 2QIRA 3PO2B 3SE0A 1HFNA 2Z4IA 3V38A 4C3HH 3PZJA 2Q2HA 3M4PA 4WJWA 3HOWB 4HAEA 2RCFA 4O42A 3FBUA 3HKZE 1KDBA 2PW5A 5IGFA 1Q82C 5IP9G 4JI5Q 2OCEA 4MFKA 4NF1A 3SJEA 4HTHA 3ZYYX 3BI0A 1SMYC 4DV4L 1XMQQ 1YX0A 4FD6A 1B87A 3M7GA 2NYZD 1HNZQ 1LTRD 1SN8A 4JCVE 1SNDA 3B3TA 2EE1A 3CD6A 3VARA 4XPLA 4MBUA 2F5IA 4JI3Q 1OXTA 3H09A 3VYTA 2E2JH 3KHZA 1YJNA 1YVKA 1HTPA 1LT4D 4X3TA 2ZM6Q 1IBKL 4BMHA 1AEXA 5C44B 1KD1C 3D67A 4NGMA 2EXDA 1FNOA 1MSHA 4R3KA 5F49A 1CTMA 4HIKA 4ZX8A 4L8AA 4AQYL 3J7YW 2K1BA 4OL7A 5IGDA 3PF5A 3ISXA 3PFOA 4JI6L 2B63G 4FUUA 5DLQE 1FR3A 3LD2A 1S5KA 4A3MH 4NGSA 1HNXQ 1O78A 3EVQA 1F9SA 2PCFB 1NSNS 4JC0A 4NFRA 4A3JG 4LJZC 1SNCA 4KY7A 1ZG7A 2V77A 1XTDA 4X3SA 1I1DA 5FLXc 1PYWD 5FOBB 4A3GG 1IBLQ 1EEFD 3HOXB 4OO1G 2CNTA 1W6JA 2RHSB 3K0YA 3EXNA 5DWNA 4KSIA 4X66Q 2Y0SG 4DK6C 4A3EB 2V4DA 1LRZA 2A6HC 3I4LA 2K5TA 3CC2A 3A74A 4KSAA 2OZGA 4MJ8A 5IODA 3GKRA 2RDFA 3G6EA 3S9LA 4CGNA 1Z9FA 2Z9HA 3UDFA 4J15A 4C68A 1F2YA 5IWAL 1I4XA 4A93G 1OTCA 1SSOA 2WAQG 1CBXA 1Y0RA 2Q8IB 4GS4A 4Q38A 2N88A 2ATRA 1TXRA 2ABZA 1KAAA 4DPGA 4P45A 1A2TA 1I5FA 3GTLB 2EIFA 1YVCA 3RO0A 3BU2A 1JC7A 3C46A 1PHJA 2EYJA 2ZEOA 1H95A 2NVXH 4DR5Q 3BYTB 4CAFA 4OGQC 1TWAH 1VS0A 5DAUA 4HNWB 4NXNL 2XVSA 4PV6A 2Q7SA 1Z7TA 3BDOA 3MHBA 2VW9A 1KIXA 3TCVA 4KVXA 3EROA 4QUSA 4UDUC 2R92H 1JJGA 4MCQA 5EBVA 5E4XA 2A68C 1B9MA 4FF3A 3CCLA 1M4VA 4KUBA 3KK7A 3GTQB 4F6AA 4NMZA 2NB0A 5D3DA 1JR0D 3K2KA 1WTVA 4YHHQ 1X10A 2EYMA 3M4YA 3F8KA 3L2PA 4IZ8A 2OZHA 2ZEPA 4MTKA 1VF7A 5FO8B 1NMTA 1D1IA 2ZELA 1GUSA 4JI2Q 1WWZA 1FNVA 3D3SA 1JB7A 2LS01 3NH8A 3MGDA 3T1YL 2QYVA 4DJLA 1JORA 2OT2A 1XBUA 3IJ3A 5J8FA 4B9WA 3QAYA 4A30A 2HB6A 4LFAL 4KKSA 4LF9L 3I4MB 4OC2A 4U9YA 4L5SA 3C26A 3P7JA 5I9OA 1X3PA 1HZCA 3C3LA 3D31A 2RSNA 4P4EA 3LX0A 4K14A 1PXUA 4CKBA 2EQSA 1Q2CA 3S14H 4LNQA 1FJGL 4R4TA 3BVZA 4UBRA 1Z4RA 3H4QA 4E0AA 2NVTH 2Q51A 3STBD 1ESFA 2XSCA 1PH2A 2JJQA 2DY8A 1S72A 5FJ8G 4KOUA 1VQPA 4GLXA 3PB4X 4QL5A 2PJCA 3A8JE 4LUOA 4CJ1B 3PO2G 4B3SL 1O80A 5ELBA 1KZFA 3NTHA 4U5YA 5E7NA 4WJBA 4RGNA 3RUZA 1VMCA 3JC66 3HOZB 1STBA 3HOWG 3KFUA 1TKFA 3J80i 2SNMA 1WTXA 4DUZL 1PH6A 4JI4L 1GVPA 2EJGC 1YREA 2UUAL 5I2XA 4N9PA 2K32A 3F2BA 3QB3A 4UPAA 3FXTA 2G9DA 3D2MA 2N3SA 1MIUA 4ME5A 1UAPA 1RXTA 1CZGA 3J80L 1K28A 2ZTDA 4MHYA 2K5DA 1HR0L 1ILQA 2L5TA 2VB3X 3F8TA 3GD7A 4B3MQ 3S2HB 1J5EQ 2PJ7A 4G7OC 1HH2P 5LMNL 4MY3A 5IGBA 3M3YB 3B3WA 4II9A 4QUFA 5IGGA 1KTKA 2MJ8A 5C44G 2PC1A 3E6ZX 2AQ1B 3PBBA 1XJVA 1F2OA 1F57A 1EOTA 5JJKA 5C3EB 2A73B 1BNZA 4Y49C 4WJ3M 1IKLA 4W9YA 3IRBA 1PYBA 3V7ZA 1JB3A 1HA5A 4UP8A 4NGTA 1JJ2A 1UUPA 3PO3H 2HC9A 3EBEA 1TS4A 4LF7L 4FXKC 1Y14B 3HOUH 2B5GB 2Z3OA 1L0XB 3OW2A 3QG1A 5LRGA 2F4VL 4UCNA 4A76A 1I3QB 3A7LA 2JA8H 4PNYA 3EY5A 1I4QA 4XQJA 1JE5A 4EVOA 4HJAA 4IUSA 2A69C 3HOXG 3CXPA 1QSNA 4UEFA 1XOVA 4A3DB 1SYEA 4DR1L 2ZW7A 4KTAA 2PI2A 4A3EG 3KR4A 3G3SA 1QOHA 4DK0A 1VQFA 2A5HA 3WC5A 5CPAA 4XT1B 3S9WA 2RQXA 4HPSA 3PB9X 4CGLA 2XEGA 3OTOL 4GKKL 1HEEA 4B5OA 1AE3A 1V1OA 4Q0FA 1RD9D 4F7XA 4H13C 3GV3A 3FNCA 2V8DA 2YYZA 3J81E 1L0YB 4IFDI 2O28A 4YWLA 3RZAA 5J39A 4HIMA 2KBNA 3MXPA 3ULPA 4UEEA 4JOIA 1T5EA 2K28A 1MKHA 1SXTA 1TWFH 4B11A 3SXHA 1QJOA 1EY7A 1YW4A 3U4VA 2J8NA 3TP7A 2HQYA 1PU9A 4K8JA 1EY5A 2PZUA 1HA6A 3I3GA 5D8NA 2L11A 1MSGA 4DU9A 1WCMH 5KYLA 2ZOFA 2AMCB 1EWHA 4QIWE 1FGBD 2F0KA 1HNWL 5JJLA 3PB8X 2DNEA 5G20A 2C35B 5C4XB 2LSSA 2IMOA 1LO5D 3R9GA 5K8NA 4MCSA 3W1BA 3S15B 2I00A 1YEZA 4WJ4A 2D5DA 4A2ZA 2XNAC 5KTAA 4DUKA 3NELA 1C9OA 1ZO0A 2ZW4A 4XT3B 1CHPD 2ICEC 3GTPH 2PJ5A 1TWGH 3HZXA 3NWTA 3FP9A 2F3WA 4HJ7A 1DJRD 1XMTA 3OYYA 5C0XJ 4JD6A 2L9HA 4R4IA 5J1QA 2EY1A 5CBMA 2EXZA 1DONA 1JICA 4TWEA 2FJ2A 3I4MG 3TT2A 5HGQA 4PG3A 3H0GB 4H44C 1SBBB 5DNFA 5C5MA 3JVNA 1RDPD 2RHQB 5CV6A 1N36Q 2UUBQ 3BZCA 2HIVA 2G5DA 2KCMA 1QG7A 1CX8A 1V8QA 4BBSH 4TKOB 3SJGA 2F0OA 1IYKA 2JDCA 4JI8Q 4CJ2C 1XNRQ 2C6GA 4GOPB 2B3UA 2F8HA 4B13A 1N32L 4R4CA 4H6ZA 5EC4A 1VQ7A 1PVOA 1ELMP 2ENBA 4OAEA 2HHHQ 1JOKA 4KY5A 3PIO3 1EYCA 2RA4A 3VA5A 3GUXA 3R9EA 3MA2B 1STNA 2K52A 1B2TA 4UIAA 1ZYRD 2VNUD 3KGQA 3CCRA 4MHZA 4RA8A 1SLJA 4IK2A 3ND9A 2A69D 3HOZG 2BO9A 3T56B 4EQOA 1M4DA 2R7DA 3BJUA 2BH2A 4PK3A 1KLGD 1XPUA 1KNEA 3I55A 1GOZA 3G4SA 2Z6KC 3I7FA 5IYCH 5C3WA 1WTOA 4RN7A 2N49A 1X55A 5JVH3 2FIWA 2PJAA 2QDLA 3S1MH 1QSMA 1Y1WB 3TC8A 1RHPA 1GM5A 2ASBA 4YWKA 2PYKA 4IN3A 3EC4A 3J80c 2OH1A 2GN5A 4CGYB 2BA1A 2PO4A 4DA2A 4CYQA 4NCZA 1HQRD 5M5WB 4AVAA 5I4MA 1H8LA 4F0YA 2MHVA 3TZDA 3VH9A 2VQEQ 2CY2A 1IU8A 2I46A 4H0LC 3T51B 3IO1A 4BY7H 3WT4A 4P75A 4CRZB 2Y0MA 1QUQB 5C3EG 3CMAA 2VY3A 4RAUC 3NH5A 1GUWA 2VBQA 3GYAA 1FNWA 2QVPA 5I0CA 3PUYA 2Q0YA 5LMUL 3M9BA 5C0XH 4POFA 3H8FA 3CZXA 4KOTA 4ID6A 4IFDG 2UXDQ 1NJIC 1I94L 3G8WA 3S1NH 3K8AA 1LABA 2K14A 1ZLIA 5HVFA 1N33L 5KEEA 4YCVA 4JBKA 5IX3A 1SNMA 4IOCA 1OZPA 1T9HA 4A3DG 1R43A 1K8AC 3W6SA 5C4JB 2PQAA 2L15A 5KIXA 2K5WA 3T1HQ 2N55A 4KJOA 1LM0A 3Q0AA 1I4RA 3MEHA 1AZQA 2D0OA 3K7AB 4LF5L 4HEDA 1Z8LA 2EYLA 3HRZC 3RMHA 3ICEA 2M00A 1C0AA 2POKA 2GVAA 2IX0A 3S1QH 2O5IC 3ZJ0A 3RZOH 1SYBA 2F7VA 3TO9A 4KKUA 2JA5B 5CV8A 4KHPL 4YGOA 2CNSA 3HOYH 3G6JB 4DV1Q 1VQAA 4H6UA 1GUGA 4I7AA 2WIIB 2EVBA 3PIP3 3PUWA 4C1NK 3I4NH 2F4IA 1S4ZA 1TVXA 2R6GA 3KZWA 2WZNA 4PSWA 1L0WA 3OPOA 2ZJRA 4OP4A 3I4NG 4X6AH 1AZPA 4K2KA 4CDDC 1WI5A 1E7ZA 3HOVH 4B3RQ 2PE3A 4NXYA 5CORA 1SFOH 2YNCA 2E2HH 2KCNA 1X3GA 2B2YA 3AU7A 4F87A 3D2PA 1K3BC 1S7LA 5C4XG 1M4GA 1BOBA 4Q7AA 2KVMA 5F2DA 5E96A 2UXBQ 5IP7G 3S1RB 2ZW5A 3D7GA 1Y1VH 4JV5L 4MHDA 4UEZA 2OTJA 2DF5A 3S2DH 1BCPB 4DN4M 5ELEA 3CRLC 5HH1A 4XQQA 1BQQT 1YVOA 4IJHA 5CGKA 4UFXA 4NJRA 1I6HH 5EMIA 3R2TA 1UWVA 1LT3D 1YNND 4GNXB 1PH9A 2P6FA 1CQFA 1CI3M 4RCNA 4C2YA 3M85A 3O13A 4DUYQ 2GLFA 2JA7H 5F48A 5IYDH 4PZ8A 4A3BB 2R3ZA 1K8OA 4DR6Q 1Q1BA 1WD1A 1EUJA 3NE5B 4UWIA 4PV1C 3H0GG 3CMEA 1VMPA 5HVGA 5IT9L 4LUVA 4TQUS 1GKHA 3PUVA 1TS2A 1CM0A 5IYBG 5M5XB 4CDFC 5IGEA 4KV6A 4BY1B 1B44D 2CHBD 2L0CA 3A55A 4ZLTF 4BXXH 3NE8A 4DR4Q 1E3PA 2HIXA 5F09A 1PTOH 1C7YA 5EJWA 4PPZA 2PMZE 1VQEA 1TY2A 5KNDA 3EFXD 4IOAA 4LX9A 4C2ZA 2F0MA 2XGTA 1TIQA 2MO1A 2CWPA 2NTTA 3A5ZB 4FF4A 2WPWA 3KL9A 1QUQA 1ZKOA 3WABA 4JZ0A 1NSLA 1A63A 3FEWX 3GO5A 2F0SA 2JA6H 2Z6BA 3I3CA 2EYOA 5ELDA 4UP7A 3BLNA 1HRJA 3V05A 2IY5B 2ZTEA 2RVLA 5FVJA 3IKJA 4A3CH 4G1PA 3I4OA 1QVCA 4DR7Q 1LTBD 2RKSA 1Y9WA 4OC1A 4JI0Q 4JBWA 3WWVA 3TO6A 1DZ1A 1M4IA 2R7ZB 2YNDA 3DGVA 4XNHC 3DM3A 2E2IH 1ILPA 3KDFA 4H89A 1Y1WG 2VEZA 2I0QA 3P2FA 3I8ZA 4R8NA 2JE6I 1KABA 1YNXA 4KMUC 3MWYW 3JAME 1Z8XA 2ZM6L 1EL0A 2XWJB 3R9FA 2XWBB 2Z11A 2DN8A 4EGVA 1Z9UA 3PIOA 1GO3E 1D1KA 2BL1A 4JYAQ 2WINB 1SR3A 3WOFA 1PZJD 3DM1A 1X12A 3NUCA 1B1ZA 3KF8A 2B2TA 3AB9A 4HN7A 2QJ8A 4OADA 4XTCS 4FVMA 1TKJA 3I70A 3D4UA 2R61A 1ON0A 1L1OB 1IY7A 3BVMA 1H9SB 3I2ZA 2F0VA 3ERQA 1RTQA 1PYTB 5EBCA 2KECA 2PCUA 4UF4A 3MFGA 1PMRA 1BBXC 1S7FA 3CPFA 2VB2X 1W2BA 4R4QA 4C3JH 4BBRB 4DV3L 4A3IH 4QBJA 3L3OC 2C9OA 2F0HA 2N78A 1OXVA 3PGZA 4UY8C 1JCKB 1RODA 4A3IG 1WTQA 2G0BA 1G91A 1D6EC 4NW2A 3IL8A 1IW7D 3KBXA 4X66L 3HGBA 4QIWB 2LKVA 2YU9H 4HJ5A 4X65Q 3MXGA 1KUVA 5C3XA 1EYAA 2LFNA 3TP8A 5K8PA 1NAPA 5E3FA 1VQ6A 4R57A 2PZTA 4IQZA 5EKLA 1BO0A 1R57A 4HMJA 4R9MA 1LT6D 2XTIA 4L63B 5CBAE 1Q7YC 3GTJB 1GUTA 2JA5H 1N71A 2F03A 4MFPA 4O1NA 4GN3B 1DE4C 1Q2DA 4NEXA 2JA5G 1YK3A 3SR1A 2FMCA 1FYCA 4GNXA 3N6RA 2F0GA 4DR5L 3OWFA 5M3FH 1XXGA 2E5LQ 2EYHA 4X62Q 4CS0B 1UWYA 1P0HA 1XMBA 2SDFA 3QAHA 2RB7A 4K6DA 1YHBA 1PDQA 1G2TA 4A3KB 5ISVA 3FECA 4J6HA 4LFCQ 1WTHA 4M1UB 2RBMA 1STGA 5IGCA 1ET9A 1Q7LA 5ELFA 5IP9H 1XPRA 1XNQQ 4CGOA 4MCPA 1IB1E 1NTGA 1W3SA 2PDOA 1E2WA 4P44A 2FMMA 2MNAA 4PMCA 4YHHL 4ZI6A 2E8GA 2PJ3A 1YHAA 2VXWA 2B2UA 4OMEA 1TIID 3M4OB 1G51A 2D4PA 4QJFA 2F0QA 1XE4A 4JI2L 2VUMB 1TR5A 2AFZA 5IV0A 1A3TA 1Y69U 4LF8Q 4MFLA 1YNJC 4X2TA 1NR4A 3PIPA 1N8RC 4P72A 1SE2A 2R1IA 2YTYA 3S16B 5CC4A 4DV2L 2B63H 2EY5A 3DDDA 1F2MA 4A3BG 5JEAG 3E0KA 1X6OA 4X5KA 4UA3A 4A31A 2BSWA 2HQEA 3MC0B 3MEFA 3SK8A 3I9SA 6CPAA 5JPHA 1SE4A 3PMFA 1B53A 3H5ZA 3D3RA 3STBC 4A3JH 4PXBA 1V1PB 4ONWA 4I7ZC 1QZGA 3D8GA 2AFXA 3U50C 4BY1G 4L89A 5IT9c 2B2VC 1EQRA 4P4IA 4A3GH 4OO1H 3H3VH 4POGA 4B3TQ 1VQJA 2PQEA 4JOIC 4PZ7A 1Q8KA 3NXWA 4IURA 3WDNA 1XEBA 5C88A 4X64Q 4KLKA 4JPBW 4MHNA 4ULLA 1C48A 4C3IB 3HG9A 2IQ6A 5COYA 1TY0A 2REEA 1R9TB 1KRTA 2G9HD 2NVQH 3IWEA 1H9SA 1PZID 3AFQA 4ZAIA 3URYA 1WFQA 2GE3A 5DWMA 2B4BA 3CHBD 2ZXVA 4A93H 2OQ0A 2PPBC 3ER0A 2EY6A 1T5XD 1DOMA 1WOCA 4C1NI 1YJ9A 1EQQA 1VQ8A 2CFMA 1KDAA 4H7BA 5JPNC 3NBIA 3VDYA 3CAMA 1E0BA 1K83H 2F0IA 1CKNB 1JE4A 3H6MA 4B08A 1Q81C 1Z8WA 4J3GA 4R6TA 4XPDB 4UFVA 3S9MA 2R7ZG 2AE6A 2ZEDA 2J8RA 4NJQA 1ENCA 3OOCA 4B3ML 2D62A 1J5EL 3ULJA 4GKJQ 1R3NA 3PBEA 4E8OA 2QEJC 1SE3A 2EK8A 4ZUJA 1S3ZA 2EYPA 3MN8A 4J1MA 1QNUA 3W6XA 1NE9A 2DNCA 1IBMQ 3N52A 4UHVA 3EJIA 4OIJA 3GTMH 1HZBA 1L2FA 4FWUA 3DNSA 4TNUA 4AG9A 5KNBA 2IW3A 4DYOA 4MNOA 1QZHA 1VQMA 4Z65A 1VQOA 2MUYA 4YCUA 2P5ZX 1FL0A 4TRDA 1WJJA 3GTOB 1B6BA 1PFNA 4A39A 3Q6SA 4BBRG 4PMWA 2O4HA 2F0PA 4L8JA 5EKKA 4C2MH 4JBMA 2FXQA 2HDMA 3VWEA 3R8BA 4XIGS 3OIPA 5EPKA 4PZ6A 2CTCA 3FVLA 2KHJA 4NGQA 4N9TA 2CTBA 4MCRA 3WC7A 4A38A 3ND8A 1I12A 1RO5A 4LW1A 1X9NA 1EIGA 5DEHA 3AFPA 2J9AA 3D7HA 3OSOA 1I4GA 1YNJD 5I4DA 4A95A 1HCZA 1CPSA 4DV4Q 1YMEA 3FYNA 1UEAB 4K8IA 1TWHB 2WKDA 3TRZA 1YI2A 2KA7A 5NUCA 3ULLA 3X3MA 1OXSC 2G3AA 3T16A 2Z3MA 2UXCQ 4KN7C 3S24A 4NPSA 5FJ8H 4AXVA 4RI1A 5EAYA 4KHZA 4RFBA 4DV0Q 2NN6I 1SE8A 2FE7A 1QILA 3PO2H 1NCVA 1E22A 2F3IA 2OR4A 2AHOB 4AIMA 4A3KG 1MI2A 2LY7A 3KLSA 4M3SA 3HOWH 3FRPB 2VS1A 4DFAA 1FVIA 4JYWA 1RTOA 2ODFA 2H1EA 1J4JA 1QVGA 2DPSA 2PJ4A 1V1PA 1VHSA 5G3LD 3A7AB 3E5SA 2OEOA 2X69A 3KLSX 1F2LA 5H86A 3UI2A 1F2PA 2GU2A 3D66A 5LYIA 3M4OH 1S5FD 5JAVA 3PRTA 2EPBA 1A62A 3CQZB 3MZ5A 3GTGB 1C8CA 4AYBB 2MO0A 1WTPA 3GY9A 2WV6D 5FLMG 5C5LA 4O0AA 2VUMG 5KRUA 4P10A 5C44H 1VQDA 3VR5A 1IXRA 2WUUA 2FVGA 5FLXE 2Z1CA 4KOYA 2RCNA 4ZQ3A 2XIWA 3TOAA 4YCWA 1AN8A 5I6WA 2CXAA 3B8GA 2RDGA 1RL2A 4JI7L 1MJAA 3NSWA 5LHY1 3IU2A 4MFJA 4UCMA 1I50B 5L37A 5GADC 1PRTD 5IOCA 4PXCA 1HJPA 2UUBL 4Q5VA 5T1GA 2K03A 1AH9A 4EVYA 4WFN3 1VKCA 1G6PA 3SXOA 3NP8A 4AG7A 1RTNA 2PW7A 5CV5A 5AJ3Q 2PRQA 4RKLA 1XX8A 3TP5A 3SXNA 4V190 1XNRL 4QB9A 3I91A 3HOXH 1PV4A 4K2LA 1ZYRC 3QIAA 4OEMB 3U9SA 2FCKA 3JUWA 3GP7A 2EUIA 1DGSA 2HHHL 1X3EA 4HJ9A 4KLVA 1B8AA 4A3EH 1M44A 4HJ8A 1CG2A 4R8FA 1LTLA 4C3IG 1PRTF 4KLWA 2C5CA 1AFPA 4ZY0A 2Y0SE 4O2DA 2BDNA 4IPDA 4MIUA 1PH1A 2AFWA 3NA6A 4IF5A 1SROA 2D9UA 3A8KE 3V2TA 3K7UC 2B2YC 1LTGD 1FGUA 3FEEA 2VQFL 4O23A 3RZDB 4ZGYB 2BA0A 4F9UA 4P73A 4OX9L 2H5MA 4HKFA 4DXFA 3S6HA 1KL9A 1PFSA 1CZWA 2A1AA 5M3MB 3GTLH 1PTOC 1UE6A 3BZKA 4MTNA 1TF9A 1IKMA 4OIWA 1EY9A 1YHQA 4JK1C 3NEMA 4K0KQ 1LFWA 1ML0D 3K59A 1TS5A 1SNQA 1J9OA 4G4KA 1PFBA 2GVBA 3VYRA 3PSIA 4MY0A 1RF2D 4KORA 3K58A 1SNPA 1E2ZA 4NXML 2O53A 3U58A 5C82A 3EFAA 2IX1A 1SNOA 3E0JA 3GTQH 4L5TA 2F1MA 2R8VA 2DEAA 3T4AC 1IGBA 4RGMA 5BR8Q 4DR2Q 2KHIA 5M9OA 1NR2A 2IWHA 3QNVA 2I3CA 1D5XC 1B7YB 4U68A 2C6PA 2EO8A 2NN6G 2JEBI 3VR4A 3LMSA 3CKIB 2QKIC 1E1TA 3DHQA 2PVVA 3OWEB 3S17B 2UUCL 1LLRD 2JEWA 4QGUA 5FO9B 3RNUA 4JI1Q 4FD4A 1M90C 3B3SA 1F9PA 2KUMA 3FKIB 2NZOA 3CT9A 1IL2A 4IFDJ 3CCJA 3I4MH 2FS5A 3HKZB 1PZKD 2AWOA 2Q43A 3T1HL 2B8GA 4GLAC 2R93B 1BKBA 2ARHA 5A27A 4JW0A 1X32A 2F0DA 5A28A 4DK3C 4Y49B 1ONLA 1TWCB 5GAGC 1S5ED 3IWGA 3SI2A 3W91A 5G22A 1BDOA 1HR0Q 3QOJA 4Y7NB 4BINA 2K01A 1M1KC 5LMNQ 2DXQA 4DV1L 3ISZA 2VXKA 3NBHB 3D6CA 4ABNA 3OMGA 3SHPA 1ZLHA 1QNKA 1JT8A 1XF8A 3DXJC 3R96A 1CK1A 5IIFA 3HOZH 3S6GA 1GUNA 2O5JC 4A3FB 2UU9Q 4MZ9A 3RYOA 2MFIA 2VZAA 3D4DA 1PH5A 2NBFA 4B3RL 3DEPA 4LF4L 3A56A 3CP0A 4OC4A 5D3IB 1QCBD 3NQIA 4OONA 2ZEGA 2VL6A 2B5GA 5C4ZA 4DK1A 4NGRA 2F0LA 1EQTA 1CA5A 1KUYA 2F4VQ 1YSJA 1G6ZA 5D29A 2UXBL 4FD7A 4L5RC 4FAIA 2AQ3B 4RG1A 1EY4A 4TSSA 4QQBX 3LNNA 3K9UA 1YNNC 4GS3A 1HR0W 1JOQA 2Z0SA 4AYBG 4A75A 3S2HH 3RLFA 4APVA 5M5YB 1ENFA 4CYPA 4CGMA 4RHRA 3M3YH 1S5CD 5LMNW 1PTOD 4XYOA 5DS0A 4RGOS 1EOVA 5GAHC 1Z6HA 3BG3A 2OWOA 1Q1EA 3TDQA 3T90A 5C3EH 3AYHB 5JJZA 2CNMA 1QB5D 4DR3Q 4LFBL 2M2LA 4L6TB 1DD2A 3PV0A 4GKKQ 4AB7A 4FD5A 1EZ6A 3R3OA 1YR0A 3D68A 5JJIA 1ASZA 4KKTA 4IFDH 3GTKB 2WB1E 4IUTA 2C27A 2PSWA 4FBEA 1I3QH 4DR4L 2ANPA 1NUCA 4CAVA 2FFKB 1PTOF 3MAQA 4CYOA 4FXGC 1D2BA 3RAMA 4HR7B 1QE6A 2A6ED 3BJ7A 1EYGA 1VDZA 4NDXA 4AH6A 1B3QA 4IPCA 4P71A 4ZKBB 2NVYB 4QUCA 4A3DH 2BH8A 1QSRA 3SDZA 2P6GA 2R7HA 1UNSA 3ITPA 3CCMA 4P74A 3PQIA 2LXJA 2PR8A 1HQMC 2JK8A 2F0UA 1Z47A 3K80C 1W6KA 1IHZA 2KEEA 3IIBA 1TQOA 2B2WA 1U4PA 5BN4A 2Z10A 4LF6L 4DR7L 4XYQA 2I5LX 5M3MG 4JI0L 1D8LA 3NTIA 4DV6L 1HPCA 5K8MA 3H3VC 1BBWA 2A19A 1YGHA 3CC7A 1DTDA 1F9RA 1J6QA 3DWQA 2EY2A 4GN4B 1BPMA 4CGPA 1FY7A 3HP3A 1Q90A 2DJGC 2K50A 1TKHA 1ARMA 1ZG8A 1KC8C 1Q46A 4OWWB 4DAYB 3V96A 3UDIA 2KOLA 3R1KA 2K5NA 2DGYA 4JYAL 2F52A 2AKWB 2BOAA 1CHQD 1F9QA 1H9RA 2O4XA 5HMNA 1YIJA 3U9OA 3KR5A 4OC3A 1BR9A 3NENA 3AQQA 1DCZA 1M8AA 1K0RA 1UE5A 3G7LA 4WRDA 2PI2E 5C4XH 2IX3A 4A32A 4EWTA 3DEOA 2QW7A 1VQCA 5IP7H 4XDXA 3D8PA 4JJXA 1HHVA 2FL4A 3S15H 4LWCA 2FIAA 2I79A 1IYJB 3S6KA 5C6AA 2K33A 2HT1A 4DAMA 4GOPA 1N32Q 2NYQA 3B35A 3DR6A 2OXPA 2ZEEA 1IW7C 1AMPA 3SEBA 4IPHA 4CAXA 1JWSD 2PJ6A 3L2NA 4CKCA 1Z2LA 1S5DD 3TSSA 3FKIG 2F0JA 3CRKC 2P0WA 3LWUA 3TBIB 4X65L 3HKZG 4C3HB 3CW2C 3H0GH 4KUAA 1I21A 4OIDA 1BUVT 5IB9A 2R93G 1U6MA 1K73C 1VHOA 4CAEA 3CCUA 3KF6B 2ZENA 5IYBH 3QJYA 3J81j 3CCQA 2EZVA 1HZAA 4DXGA 1XMOL 3D7FA 5GQOA 1LT5D 1STYA 1G8ZD 1KWMA 2Q44A 3SHLA 3PB6X 1CKMA 4KK7A 3BVGA 1II3A 1BCPD 1IYLA 3DR8A 1MD2D 2OB0A 1YQEA 3N7ZA 4MI4A 4IUUA 2E2JB 3D7DA 1A2UA 2E5LL 4X62L 3EA6A 1SYFA 1HUNA 4YFJA 4DV7Q 1LTAD 3D4WA 4GZYC 2OU2A 1D7QA 3MRUA 4P4JA 3IEHA 4RCOA 2VZZA 1OO9B 3J80E 2OTLA 2L1BA 2HDLA 4BA2I 1LYLA 1K8MA 3U4ZA 4A3FG 3OW7A 4BA1I 1XTCD 1LCPA 5HXDA 1XNQL 3J7ZC 3HKSA 2J8MA 4A3MB 4JI5L 1I94Q 1E24A 2D4OA 1KNAA 4UP9A 3VR3A 1K0SA 5FK9C 4C7HA 1A0IA 1XMQL 3I56A 1Y1WH 1N33Q 1HNZL 4ME3A 1Q12A 4OC0A 4MMOA 1ELLP 4NGNA 4IHMA 5AG5A 4R4OA 5I9PA 2B4DB 2DY7A 4JI3L 5M5WH 4YWYA 4LF8L 1B9NA 4E2AA 5LYFA 3B7IA 2BE5D 2PNHA 4FO2A 3I72A 1X54A 4Z9CB 2ATWA 1O7IA 2NSMA 3H8EA 5IB0A 4QB4A 1JWQA 1HUMA 3OIQA 3HLPA 3KBGA 4QCLA 1WTRA 5F46A 3E9HA 2NTSA 4OHJA 4KOXA 1ICWA 4R7MA 4A3LG 4KD4A 1Q2YA 3OMCA 3GB0A 3W2DA 3NTKA 2XEIA 4OC5A 2BCOA 1EWCA 1A2ZA 4CJ0B 1HNXL 1N34Q 3UY5A 5K36G 5T1IA 1EYDA 4CHTB 5JEAJ 2B3VA 4CKEA 2NZ1D 7CPAA 1N9WA 2DPTA 3J81i 4KI0A 1CA6A 3HUVA 4B3TL 2NVXB 3PFEA 4FDBA 1TWAB 1IBLL 1MJCA 5J3BA 3S9NA 4X64L 3I73A 4F9VA 5C4JH 1U0LA 3V8IA 1VHEA 2JBJA 3CCSA 2R92B 3J81L 2FT0A 2RSOA 3CCVA 3K7AH 2ALYB 1V9PA 1PH7A 1IIDA 5I6YA 3KJPA 1CP6A 3IU1A 3NH4A 2ZEMA 5JPMC 2I5HA 2Z6KA 5A2QL 3F2CA 1SMXA 1D5ZC 4PQAA 1TXYA 2Q8RE 4IALA 1PA6A 3F2UA 4FF1A 2L12A 2SEBD 4JXQA 3FMCA 4BBHA 4BD9A 5J22A 1EY8A 2EDGA 2D0PA 1GD7A 4M6GA 3NHHA 2Q04A 4HSVA 4FF2A 4GKJL 3B3VA 4B5PB 3Q23A 3FRMA 1EQVA 5CMDA 4OKOA 2IT1A 2PJ0A 4UCPA 1C4QA 3KF6A 4JXRA 3CCEA 4HIOA 1XPOA 2A4NA 1SJED 5AG7A 4EQNA 3QWNA 1SJHD 1O7ZA 3SVMA 2KENA 1IZ6A 4MRIA 4ZY2A 2EBJA 1JQGA 2GLJA 2F0EA 1BPNA 3S1RH 2F0NA 3A0JA 5EQ0A 1AE2A 4B9XA 5JVG3 3TO7A 1EIFA 1BOSA 3D4RA 4PSXA 2EK9A 2NVTB 1O7LA 4YY3Q 1S40A 4F0XA 2JN4A 4XNHB 2B3GA 1VGYA 1K3RA 1LV9A 1TT2A 3KJOA 5D65A 1VQ9A 1VQKA 1VQLA 4A3BH 5JEAH 4ORFA 1CQVA 4C56C 2CH4W 4QMGA 4C3HG 1B70B 4X3RA 4MHEA 1ZXTA 1VIXA 2N8NA 4KHVA 2K05A 1XJOA 5ISRA 5M5XH 3RN5A 2J4XA 5KTDA 2QCPX 4BY1H 1WVLA 2K5HA 1PUAA 2JDDA 2JA9A 3NWSA 3E9IA 2H4OA 1IL8A 2UXCL 3K5OA 2QDBA 2IPKD 3RD4A 2B4DA 2R98A 3WC6A 4KVOE 3K5MA 3GIUA 4DV0L 4QY7A 2Z3KA 2JLMA 3KLWA 3HS0C 4BS9A 2PJ2A 2ZXRA 4ILWA 1F2ZA 2ZT9C 1XRYA 2Z4HA 2E76C 4K3NA 4PQXA 1MJBA 3W3AA 4DV5Q 2WP8J 2EJFC 2KQ3A 4MHPA 1CJWA 1Y8OB 1L1OA 2WB1B 1UE1A 1MBYA 5H1SE 4IAVA 1AW7A 5E1FA 1J8IA 1S7KA 4P4DA 5EGTA 2HCIA 4A3MG 3PO3B 1GUOA 4R3LA 4ZX9A 3M4QA 1VF5C 3HOUB 2GA4B 4B12A 2R7ZH 2BEIA 4DV3Q 3K81C 3RR5A 3GDEA 1VQGA 2EVNA 4NSQA 1QQ9A 3RN2A 2JA8B 1QVFA 3NE7A 3P20A 1Y7RA 2I07B 3SJFA 2A74C 3FIXA 3CU7A 4TVAB 3K5LA 1MJEA 1XWEA 5ELNA 5G21A 3KASA 4V0BA 4F88A 2JQOA 2ZJQA 2PVWA 4NKLA 4MXUA 1PRTC 1KHIA 1UFHA 1EZ8A 4P2CB 2V1CC 4UWJA 3KLRA 4ZBGA 1GJXA 3DWAA 3GV6A 4DNRB 1EIYB 1L0CA 2VQYA 1TKWB 1SYCA 2V8GA 2YTXA 4X8IA 4F8MA 1VQHA 2Q8TA 2QA4A 3WR7A 3W5OA 1CUKA 5AJ3L 4BBRH 1ARLA 2F0WA 3K5NA 5K5PA 2REFA 2EOTA 4A94A 4B5PA 2R7FA 1BBUA 3TOBA 2Z3PA 4JWPA 2ES2A 1WD0A 1TWFB 3QB8A 4K5VA 1SQHA 1IICA 3M7NA 3J7AF 3F5BA 3TX8A 2R92G 1ENAA 1I4PA 3PGPA 5LRKA 1WTWA 4HNYB 3UE0A 4ZRZA 3C1EA 1WCMB 3DUZA 3SGIA 1IYUA 2WKCA 3J81c 3GTJH 4G7ZC 1UEBA 2QECA 2K6AA 1Y9KA 1ET6A 4RGTA 4LQ6A 1BAVA 5AG4A 2B58A 2FSRA 5TSSA 3TE4A 1SMYD 3DMUA 4K0KL 5JM6A 2PJ8A 3VWDA 3PUXA 4OELB 4R76A 3IWWA 2RFHA 2V8HA 1BVSA 1VQNA 1IBKQ 4Y52H 1P16A 2NMTA 5CYUA 1YW6A 3GTPB 3FPUB 3A8IE 2XEFA 2JEAI 3KUPA 1TWGB 3F1ZA 4DNCA 4DV2Q 5FKAC 4A3KH 1X65A 4AQYQ 2J0TD 4S3SA 3T13A 4JI6Q 4JVZA 4XQNA 3FVQA 4CRYB 2F0TA 3EQLC 4GLVB 4X3UA 1PH8A 1TF8A 4RHSA 1IYVA 1P8LA 3D0FA 1YBYA 5BR8L 4DR2L 4HSPA 1F77A 2KJXA 4IJLA 4KOSA 2QILA 4KD3A 1X3QA 2PMZB 4IUPA 4QF4A 4K6LA 2WFWA 4YIJA 4BBSB 1M1DA 8CPAA 3OHXC 4ZCKA 2K75A 2WACA 5FLMH 3R2IA 3TQYA 3Q22A 3BI1A 2VUMH 1OBRA 2VL1A 4CDCC 2ZXOA 1Q86C 3JTKA 1O7YA 2B29A 2HCCA 5IT9E 4U9ZA 4UFWA 5LYLA 5FO7B 4J8QA 4JI1L 4A37A 1D5MC 2C6CA 4KN4C 4DAPA 3S16H 3J7AV 4C7IA 3Q8DA 1WK4A 2OF1A 4M6IA 1PRTB 3J7A5 5G3LF 3VR6A 2WYRA 1V43A 2B2WC 5CNPA 2A6HD 2H5XA 5IWAQ 3CDXA 1XYIA 4ZY1A 2BDOA 3CXQA 1N36L 1QMUA 2IJZA 4H2KA 1CKNA 4MN3A 2FHTA 1EY6A 1SEBD 3RLOA 1IOIA 1STHA 4RWSC 1EFWA 1PH3A 3S1MB 3FH4A 1S5BD 1LTID 3MXNB 4JI8L 3ZJYC 2CQAA 1G2SA 4KJNA 2E74C 4NXNQ 3CPXA 2YNEA 4OXPA 3JAMi 2L55A 2PJ1A 1K9MC 2ICIA 4C3IH 4ZYQA 2KCTA 4QC6A 1R9TH 1R4PB 1PFMA 1DOKA 2UU9L 4BY7B 3DWPA 3OWCA 2WB1G 4LAAA 5JQ4A 4ALPA 3JAML 2YNCC 5HY6A 1BF4A 4CYNA 2A68D 1PH4A 3NPPA 3PO3G 1LACA 2NZHA 2CQOA 3HOUG 1YLOA 4GOPC 2RDHA 4Q36A 5H84A 4QVTA 4XXEA 3MXUA 2WAQE 3TP6A 3S1NB 3K6OA 3BXMA 1KRSA 2EWBA 2P6EA 5BN3A 1S60A 3GQBA 3RNZA 2JA8G 4JLYA 5LRJA 1YJWA 2I5MX 1BXTA 2CW0C 1JJCB 2PZWA 3T1YQ 3FB3A 4G7HC 2M9VA 3A5UA 4OWXB 4LFAQ 5IE8A 3LGJA 4LF9Q 2Q7BA 3TREA 2VQEL 4DR3L 3SK6A 3UDGA 1LANA 4M85A 5I2YA 3FHWA 3C2PA 5CR3A 1QWYA 3IGRA 5KYIA 2PIYA 3KQXA 4ZUIA 3S1QB 1SYGA 3EN2A 5G1ZA 4NGPA 2A6EC 1FJGQ 2B2VA 2NN6H 3RZOB 3CPWA 2PJ9A 3A54A 4DKAC 3JRUA 3GTOH 1CFMA 1CP7A 3PP9A 2UXDL 2JXMB 5KGUA 5C0XI 2WSAA 2FXFA 3DLLA 4EX5A 1VQBA 1Y0YA 4KVME 3HOYB 1DOLA 5A2QE 2O2LD 1Y8PB 4B3SQ 2FINB 1BLLE 5CV4A 3I4NB 5KTCA 5JGFA 2K04A 1ICFB 1CKOA 5EBDA 5BWAB 2RC4A 2PQAB 4KOVA 1MK4A 1A6XA 3HOVB 1LTTD 4DUZQ 4JI4Q 5CV9A 3P75A 3S6FA 1SFOB 1WCMG 3SK5A 1TWHH 4ZKCB 3CF5A 2UUAQ 2E2HB 4E6IA 1Z5RA 2PJBA 2Z3LA 2DUDA 2TMPA 3KOJA 3D6WA 1DYQA 1PCAA 1A15A 4I49A 1EU3A 1Y1VB 3IFEA 4PMBA 2ZOGA 1TS3A 3QR8A 3S2DB 2AFUA 5C4HA 1EE3P 4X3KA 3FEDA 1U9RA 3AEVA 3UE1A 4EFDA 3VA7A 4KS9A 2K7VA 1VCIA 4NP5A 4LUZA 1I6HB 4FP5D 4AVCA 3T9YA 3A9LA 2LXKA 4IPGA 3BYYB 4JI7Q 1AUGA 1V1QA 1GHEA 4DNIA 2CKZB 1VQ4A 3IC1A 2JA7B 3ERSX 2B2TC 4UAIA 2PR1A 2AFMA 2VZYA 4N8FA 1HFGA 3G71A 3L9AX 2ZEFA 5K8OA 2KCCA 3TN2A 1OXXK 1PLFA 4LF7Q 4HMIA 3K9TA 3B6YA 2D2CC 3CQZH 3BDCA 3GTGH 3MXNA 2ZJPA 3KYHC 4BBSG 1GYTA 3VYUA 1H9KA 4IO9A 3PF4A 2Q2TA 1PTOB 1Z4EA 4DGZA 2HD3A 1CM9A 2K5VA 3R95A 2AFOA 3MTSA 1UE7A 2JYOA 2AQ2B 3T53B 4DR1Q 3E3XA 4R9WA 5LYDA 3TS0A 3CC4A 1NBWA 1RCVD 4UIBA 1S3OA 5F47A 4NB3A 2JA6B 4DUYL 1I50H 2XRSD 5E4WC 2VQFQ 3BZDB 1EEID 2CW0D 1CT1D 5EPJA 1AYEA 2JP1A 4OX9Q 1Q8IA 4IUNA 4DR6L 1KUXA 3OTOQ 3NFZA 1H9JA 3HEJA 3CXCA 3KKWA 3I90A 1BCPC 1EFID 2XN9C 1STEA 3IFDA 5D14A 4A4IA 1LAMA 5IYCG 2MQHA 4DF7A 2QMLA 3TTHA 2JBKA 2C1CA 1NMGA 1M4LA 2E2IB 4GNXC 3RBUA 1CSQA 1JMCA 1YZ6A 2VI7A 1NY4A 4K5WA 3P1HA 2B39A 4NXMQ 4RMFA 4DV7L 3H91A 1KDCA 2ID0A 1E2VA 4U673 4P4BA 1SAPA 2MPMA 1STAA 5J8CA 4BY7G 1EY0A 2AFSA 1IOFA 1HNWQ 4B6ZA 1FD7D 3RZDH 5DM63 3BJ8A 1V0CA 3BHXA 3NQTA 5M3MH 5A35A 3B3CA 5C0XG 1FNUA 2IHFA 2CWAA 3QO2A 2YGWA 1BO4A 4KZTA 3JAMc 2GREA 2ZPAA 3VATA 2B2UC 4ONUA 1Y8NB 5IY0A 2UUCQ 2BE5C 2ZTCA 4GM5A 2HUGA 3KDFB 5GROA 4C3JB 4A3IB 3FJUA 1VQIA 4YWMA 1Q3LA 2JSOA 5DM73 4CBVA 2XEJA 3TZUA 2QGQA 3T8WA 2YU9B 3TMEA 1K4JA 1GHJA 4B10A 2X7BA 2AUKA 5JH9A 4M6HA 1YITA 1MGSA 3KF8B 1X3FA 4H02A 2Q4VA 3FF3A 4OIKA 4RKBA 5CV7A 1S7NA 2SNSA 1Z8TA 2OOTA 1HDUA 1MHWC 4CAWA 1NSAA 2J7ZA 1N34L 1B4OA 4EQ5A 1A8VA 3DSBA 2JEVA 4F8ZA 3PCOB 3IAYA 4LUAA 1KAWA 1RKNA 2QF7A 5THWA 3S17H 1E1OA 3NBHA 2GIVA 3BDLA 5GAEC 3SK4A 5LL6X 1NNXA 3HOYG 4KY6A 5M3FB 2A8VA 4HCSA 3FKIH 3LODA 1ZG9A 4LQGA 1DM0B 4L5QA 3F2DA 1EWIA 3IFTA 4RS2A 3TEHB 4BWGB 4PXDA 4ZK9B 4LF4Q 2R93H 1L1OC 4IUVA 2L4NA 2G3TA 2ZXPA 1B3AA 4HNXB 2X6GA 3HOVG 3R93A 5KNCA 1R4QB 3W1GA 1I6VC 1GXDC 4HIDA 3ZZIA 3PUZA 3FX6A 2IL8A 2KHSA 1K8GA 1TWCH 3C1FA 2CF4A 2XRQD 2CVRA 1GHKA 3TS2A 4Y7NH 3H15A 4PK2A 3DLJA 3SI0A 3SJXA 2E2DC 2X6LA 2PNRC 1Y1VG 1U5KA 2SOBA 1RIPA 4CPAA 1H9MA 2DJFC 4M8AA 5AG6A 5HURA 1VQ5A 2OZUA 2E75C 3Q24A 3L0OA 1NE3A 1B50A 4LFBQ 4A3FH 1QSTA 4RUHA 2JA7G 2B63B 2PQ8A 5GCNA 4LFCL 5IYDG 4R8IA 4B14A 2BUEA 2EJMA 3CXSA 4FNFA 3TFYA 1RJTA 2K5QA 2PRBA 3P2HA 5LMUQ 4MFQA 3B2YA 4P6YA 3AMUA 5J1ZA 4PXEA 3VYSA 3K0XA 4LK1C 5FLXL 4A3JB 1I4HA 5HVHA 3PEIA 5ELYA 1XIXA 3EO4A 4BXXG 2Z8LA 1BCPF 4MFZA 4YRHA 2HQLA 2Q4YA 3PB7X 4KSFA 5M5YH 4A3GB 1LAPA 2WPXA 4YY3L 1EU4A 2NUCA 4WWVA 4AYBE 3MVVA 1KQSA 3VR2A 2B8FA 2QEXA 3X3NA 4WORA 1QSOA 2TSSA 2Y0SB 1A3UA 2Z3NA 1U4MA 1A3VA 1KLUD 3SI1A 1FT7A 4IUQA 4LMQD 5ELOA 5BN5A 2ZW6A 1JWMD 2JA6G 2NVQB 1WYDA 4OWTB 4LF5Q 4A3LH 3LWEA 4A93B 1SYDA 2NWGA 4G57A 4LF6Q 4A3CG 2WAQB 5EKIA 3ONAB 1NMFA 3GTKH 4DV6Q 1TU2B 5K36H 2Q2IA 4I65A 4R87A 2AWNA 2GANA 1K83B 4KHPQ 3LACA 3KQZA 1HXYD 2EYFA 2GFQA 2ZEHA 2MGSA 5AFWA 4CDEC 1LTSD 4ZYSA 1ZEQX 1DXMA 3KI9A 3FDTA 2NVYH 4GN5A 3HFZB 1OXUA 4YU9A 3CPAA 2IHEA 4DAYA 3N5FA 2YV5A 1P4NA 2KCWA 4OO1I 3H3VI 3KHXA 1JQYD 5JOBA 1CPXA 4XPKA 4DV5L 1YLEA 4C2XA 2YTVA 2V8VA 2LMCB 4FYDA 4OLLA 2CIJA 1CSPA 3RLNA 4JBJA 3GLJA 3GTMB 1XFOA 1G291 2KEDA 4KOWA 2HUZA 2F3VA 2Q2UA 4P4FA 4JV5Q 3MFYA 4RH6A 2OQKA 2Q4ZA 4ODGA 1PYSB 1Y7EA 5EPLA 1HDQA 2BOSA 4C3JG 3BS1A 4C2MB 4HCEA 4EMEA 3G48A 1SRUA 2F0FA 2HV2A 3I1UA 2AJ6A 1AP0A 3QOLA 4K30A
chains in the Genus database with same CATH topology
1HTLD 4FXDA 1ESRA 1U4RA 4K5XA 1LOKA 3K57A 1EIHA 3NK9A 3L7ZC 3WOEA 2MP1A 5HGTA 4DAVA 4EQPA 3H8GA 1JWUD 3FPPA 1SDFA 1U4LA 3S14B 5LL6S 2PIZA 3H94A 5CBEE 2AUJD 1JOOA 5ELCA 2IJ0A 4DNTB 3PO2B 3SE0A 1HFNA 2Z4IA 3V38A 3HOWB 4WJWA 4HAEA 4O42A 1KDBA 2PW5A 5IGFA 3SJEA 4HTHA 3ZYYX 3BI0A 1SMYC 3M7GA 2NYZD 1LTRD 1SNDA 3B3TA 2EE1A 3VARA 1OXTA 3H09A 3VYTA 3KHZA 1HTPA 1LT4D 4X3TA 1AEXA 5C44B 3D67A 4NGMA 1FNOA 1MSHA 1CTMA 4ZX8A 3J7YW 2K1BA 4OL7A 5IGDA 3PFOA 3ISXA 4FUUA 1FR3A 4NGSA 1O78A 3EVQA 1F9SA 2PCFB 1NSNS 4NFRA 4LJZC 1SNCA 4KY7A 1ZG7A 2V77A 4X3SA 1PYWD 5FOBB 1EEFD 3HOXB 4OO1G 1W6JA 3K0YA 4KSIA 4A3EB 2V4DA 2A6HC 3I4LA 5IODA 2RDFA 3S9LA 1F2YA 1I4XA 1CBXA 1SSOA 1Y0RA 2Q8IB 2N88A 1TXRA 2ABZA 1KAAA 4P45A 1A2TA 3GTLB 1JC7A 3C46A 2ZEOA 2EYJA 3BYTB 4OGQC 5DAUA 2XVSA 1Z7TA 3BDOA 3MHBA 3EROA 4UDUC 4MCQA 5E4XA 2A68C 1B9MA 4FF3A 1M4VA 3KK7A 3GTQB 4NMZA 2NB0A 5D3DA 1JR0D 3K2KA 1WTVA 2EYMA 3M4YA 4IZ8A 2ZEPA 1VF7A 5FO8B 1D1IA 2ZELA 1GUSA 1FNVA 2LS01 3NH8A 2QYVA 4DJLA 1JORA 2OT2A 1XBUA 3IJ3A 4B9WA 2HB6A 4KKSA 3I4MB 4OC2A 3P7JA 5I9OA 1X3PA 3C3LA 3D31A 2RSNA 4P4EA 4CKBA 3LX0A 1PXUA 4K14A 3BVZA 2Q51A 1ESFA 2XSCA 2DY8A 3PB4X 2PJCA 3A8JE 4CJ1B 1O80A 5ELBA 3NTHA 4WJBA 4RGNA 3RUZA 1VMCA 3HOZB 1STBA 1TKFA 2SNMA 1WTXA 2EJGC 5I2XA 4N9PA 2K32A 3QB3A 2G9DA 4ME5A 1UAPA 1CZGA 3J80L 4MHYA 2K5DA 1ILQA 2L5TA 2VB3X 3GD7A 3S2HB 2PJ7A 4G7OC 5IGBA 3M3YB 3B3WA 4QUFA 5IGGA 1KTKA 2MJ8A 3E6ZX 2AQ1B 3PBBA 1F2OA 1F57A 1EOTA 5C3EB 2A73B 1BNZA 1IKLA 4W9YA 3V7ZA 1JB3A 1HA5A 4NGTA 2HC9A 1UUPA 1TS4A 4FXKC 1L0XB 3QG1A 5LRGA 1I3QB 3A7LA 4PNYA 1I4QA 4XQJA 4EVOA 2A69C 4UEFA 4A3DB 1SYEA 4KTAA 3KR4A 1QOHA 4DK0A 2A5HA 3WC5A 5CPAA 4XT1B 3S9WA 2RQXA 3PB9X 2XEGA 1HEEA 1V1OA 4Q0FA 1RD9D 4F7XA 4H13C 3GV3A 2V8DA 2YYZA 3J81E 1L0YB 4IFDI 3RZAA 5J39A 3MXPA 4UEEA 1T5EA 2K28A 1SXTA 3SXHA 1QJOA 1EY7A 1YW4A 3TP7A 4K8JA 1EY5A 2PZUA 1HA6A 5D8NA 2L11A 1MSGA 4DU9A 5KYLA 2ZOFA 3PB8X 1EWHA 1FGBD 2F0KA 2DNEA 5C4XB 2IMOA 1LO5D 5K8NA 4MCSA 3S15B 2D5DA 2XNAC 4DUKA 4XT3B 1CHPD 2ICEC 2PJ5A 3HZXA 3NWTA 2F3WA 1DJRD 5C0XJ 2L9HA 5J1QA 2EY1A 5CBMA 2EXZA 1DONA 1JICA 4TWEA 2FJ2A 3H0GB 4H44C 1SBBB 5DNFA 5C5MA 1RDPD 5CV6A 1QG7A 1CX8A 1V8QA 4TKOB 3SJGA 2F0OA 4CJ2C 2C6GA 2F8HA 1ELMP 2ENBA 1JOKA 4KY5A 3PIO3 1EYCA 2RA4A 3VA5A 3GUXA 3MA2B 1STNA 1B2TA 4UIAA 1ZYRD 2VNUD 3KGQA 4MHZA 4RA8A 4IK2A 3ND9A 2A69D 2BO9A 3T56B 4EQOA 1KLGD 1KNEA 1GOZA 5C3WA 1WTOA 5JVH3 2PJAA 1Y1WB 3TC8A 1RHPA 2PYKA 4IN3A 4CGYB 2BA1A 2PO4A 4DA2A 1HQRD 5M5WB 5I4MA 1H8LA 2MHVA 3TZDA 3VH9A 2I46A 4H0LC 3T51B 3IO1A 3WT4A 4RAUC 3NH5A 1GUWA 1FNWA 2QVPA 3PUYA 5C0XH 3H8FA 4ID6A 4IFDG 1LABA 1ZLIA 5HVFA 5KEEA 1SNMA 1R43A 5C4JB 5KIXA 2K5WA 2N55A 4KJOA 3Q0AA 1I4RA 3MEHA 1AZQA 3K7AB 4HEDA 1Z8LA 2EYLA 3HRZC 3RMHA 2M00A 2POKA 2IX0A 2O5IC 1SYBA 2F7VA 4KKUA 2JA5B 5CV8A 3G6JB 1GUGA 2WIIB 2EVBA 3PIP3 3PUWA 4C1NK 2F4IA 1S4ZA 1TVXA 2R6GA 3KZWA 2WZNA 3OPOA 4OP4A 1AZPA 4K2KA 2PE3A 5CORA 2KCNA 3AU7A 2B2YA 4F87A 4Q7AA 2KVMA 5F2DA 3S1RB 3D7GA 4UEZA 1BCPB 4DN4M 5ELEA 3CRLC 4XQQA 1BQQT 5CGKA 4NJRA 3R2TA 1LT3D 1YNND 1CQFA 1CI3M 4RCNA 3M85A 3O13A 2GLFA 4A3BB 2R3ZA 1K8OA 1Q1BA 1WD1A 3NE5B 4PV1C 1VMPA 5HVGA 5IT9L 4TQUS 3PUVA 1TS2A 5M5XB 5IGEA 4KV6A 4BY1B 1B44D 2CHBD 2L0CA 3A55A 4ZLTF 5F09A 1PTOH 5EJWA 4PPZA 1TY2A 5KNDA 3EFXD 2F0MA 2NTTA 4FF4A 3KL9A 1ZKOA 3WABA 4JZ0A 3FEWX 3GO5A 2F0SA 3I3CA 2EYOA 5ELDA 1HRJA 3V05A 2RVLA 3IKJA 4G1PA 1LTBD 2RKSA 4OC1A 4JBWA 1DZ1A 2R7ZB 3DGVA 1ILPA 3I8ZA 4R8NA 2JE6I 1KABA 4KMUC 3JAME 3MWYW 1EL0A 2XWJB 2XWBB 2DN8A 4EGVA 1D1KA 2WINB 3WOFA 1PZJD 3DM1A 3NUCA 1B1ZA 2B2TA 3AB9A 3KF8A 4HN7A 2QJ8A 4XTCS 4FVMA 1TKJA 3I70A 3D4UA 2R61A 1IY7A 3BVMA 1H9SB 2F0VA 3ERQA 1RTQA 1PYTB 5EBCA 2KECA 2PCUA 4UF4A 3MFGA 1PMRA 1BBXC 2VB2X 4BBRB 3L3OC 2C9OA 2F0HA 1OXVA 1JCKB 1RODA 1WTQA 1G91A 1D6EC 4NW2A 3IL8A 1IW7D 3KBXA 3HGBA 4QIWB 2LKVA 3MXGA 5C3XA 1EYAA 2LFNA 3TP8A 5K8PA 1NAPA 5E3FA 2PZTA 4IQZA 5EKLA 1BO0A 4HMJA 1LT6D 5CBAE 4L63B 3GTJB 1GUTA 2F03A 4O1NA 1DE4C 3SR1A 2FMCA 1FYCA 3N6RA 2F0GA 3OWFA 1XXGA 2EYHA 1UWYA 1XMBA 2SDFA 2RB7A 4K6DA 1G2TA 1PDQA 4A3KB 3FECA 4J6HA 4M1UB 2RBMA 1STGA 5IGCA 1ET9A 1Q7LA 5ELFA 4MCPA 1E2WA 4P44A 2FMMA 4PMCA 4ZI6A 2PJ3A 2VXWA 2B2UA 4OMEA 1TIID 3M4OB 2F0QA 2VUMB 1TR5A 2AFZA 1A3TA 1Y69U 1YNJC 4X2TA 1NR4A 1SE2A 3S16B 5CC4A 2EY5A 1F2MA 5JEAG 2HQEA 3MC0B 3SK8A 6CPAA 1SE4A 3PMFA 1B53A 3D3RA 4PXBA 1V1PB 4ONWA 4I7ZC 3D8GA 2AFXA 2B2VC 4P4IA 4OO1H 2PQEA 3NXWA 4IURA 3WDNA 4MHNA 4ULLA 1C48A 4C3IB 3HG9A 2IQ6A 5COYA 1TY0A 1R9TB 2G9HD 1H9SA 1PZID 4ZAIA 3URYA 3CHBD 2PPBC 2EY6A 1T5XD 1DOMA 4C1NI 1KDAA 5JPNC 4H7BA 3NBIA 1E0BA 2F0IA 4B08A 1JE4A 3H6MA 4R6TA 3S9MA 2ZEDA 4NJQA 1ENCA 3OOCA 2D62A 1R3NA 3PBEA 2QEJC 1SE3A 2EK8A 4ZUJA 2EYPA 3MN8A 4J1MA 1QNUA 2DNCA 3N52A 3EJIA 4OIJA 4FWUA 4TNUA 5KNBA 2IW3A 4DYOA 4Z65A 2MUYA 4TRDA 3GTOB 4A39A 1PFNA 3Q6SA 4PMWA 2O4HA 2F0PA 4L8JA 5EKKA 2HDMA 3R8BA 4XIGS 3OIPA 5EPKA 2CTCA 3FVLA 4NGQA 4N9TA 2CTBA 4MCRA 3WC7A 4A38A 3ND8A 1EIGA 5DEHA 2J9AA 3D7HA 3OSOA 1I4GA 1YNJD 5I4DA 1HCZA 1CPSA 1YMEA 1UEAB 4K8IA 1TWHB 2WKDA 2KA7A 5NUCA 3X3MA 1OXSC 3T16A 4KN7C 4AXVA 4KHZA 4RFBA 2NN6I 1QILA 1NCVA 2OR4A 1MI2A 2LY7A 3KLSA 3FRPB 4DFAA 4JYWA 1RTOA 2H1EA 2PJ4A 1V1PA 5G3LD 3A7AB 3E5SA 2OEOA 2X69A 3KLSX 1F2LA 3UI2A 1F2PA 2GU2A 3D66A 5LYIA 1S5FD 5JAVA 3PRTA 2EPBA 3CQZB 3MZ5A 3GTGB 1C8CA 4AYBB 1WTPA 2WV6D 5C5LA 5KRUA 4P10A 3VR5A 2FVGA 5FLXE 2Z1CA 4ZQ3A 2XIWA 1AN8A 5I6WA 2RDGA 3NSWA 5LHY1 1I50B 1PRTD 5IOCA 4PXCA 4Q5VA 5T1GA 2K03A 4WFN3 3NP8A 1RTNA 2PW7A 5CV5A 2PRQA 4RKLA 1XX8A 3TP5A 4V190 3I91A 4K2LA 1ZYRC 3QIAA 3U9SA 3GP7A 1CG2A 4R8FA 4C3IG 1PRTF 2C5CA 1AFPA 4ZY0A 2BDNA 4MIUA 2AFWA 3NA6A 2D9UA 3A8KE 3V2TA 2B2YC 1LTGD 3FEEA 4O23A 3RZDB 2BA0A 4F9UA 4DXFA 1CZWA 5M3MB 1PTOC 1TF9A 4OIWA 1IKMA 1EY9A 4JK1C 1LFWA 1ML0D 3K59A 1TS5A 1SNQA 1J9OA 4G4KA 1PFBA 3VYRA 1RF2D 3K58A 1SNPA 1E2ZA 2O53A 2IX1A 1SNOA 3E0JA 2F1MA 2DEAA 3T4AC 1IGBA 4RGMA 5M9OA 1NR2A 2IWHA 3QNVA 2I3CA 1D5XC 4U68A 2C6PA 2NN6G 2JEBI 3VR4A 3LMSA 3CKIB 2QKIC 3DHQA 2PVVA 3OWEB 3S17B 2JEWA 1LLRD 5FO9B 3B3SA 1F9PA 2KUMA 3FKIB 3CT9A 4IFDJ 3HKZB 1PZKD 2AWOA 2Q43A 2B8GA 2R93B 1X32A 2F0DA 1ONLA 1TWCB 1S5ED 3SI2A 1BDOA 3QOJA 4Y7NB 2K01A 3ISZA 3D6CA 4ABNA 3OMGA 1ZLHA 1QNKA 3DXJC 1CK1A 5IIFA 1GUNA 2O5JC 4A3FB 3D4DA 2NBFA 3DEPA 3A56A 4OC4A 5D3IB 1QCBD 3NQIA 2ZEGA 5C4ZA 4DK1A 4NGRA 2F0LA 1EQTA 1CA5A 1YSJA 5D29A 1G6ZA 4FAIA 2AQ3B 4TSSA 1EY4A 3LNNA 1YNNC 1JOQA 3RLFA 5M5YB 1ENFA 4RHRA 1S5CD 1PTOD 4XYOA 5DS0A 4RGOS 1Z6HA 3BG3A 1Q1EA 3TDQA 5JJZA 1QB5D 2M2LA 4L6TB 1DD2A 3PV0A 1EZ6A 3R3OA 3D68A 4KKTA 4IFDH 3GTKB 4IUTA 4FBEA 2ANPA 1NUCA 2FFKB 1PTOF 3MAQA 4FXGC 1D2BA 3RAMA 4HR7B 1QE6A 2A6ED 1VDZA 4NDXA 4ZKBB 4QUCA 2NVYB 3SDZA 1UNSA 3ITPA 1HQMC 2F0UA 1Z47A 1W6KA 1IHZA 2KEEA 3IIBA 1TQOA 2B2WA 1U4PA 5BN4A 4XYQA 3NTIA 1HPCA 5K8MA 3H3VC 1DTDA 1F9RA 3DWQA 2EY2A 1BPMA 3HP3A 1Q90A 1TKHA 1ARMA 1ZG8A 3V96A 2KOLA 2BOAA 1CHQD 1F9QA 1H9RA 2O4XA 4OC3A 3U9OA 3KR5A 1BR9A 1DCZA 1M8AA 3G7LA 4WRDA 2IX3A 4EWTA 3DEOA 4XDXA 1HHVA 5C6AA 2K33A 2NYQA 3B35A 2OXPA 2ZEEA 1IW7C 1AMPA 3SEBA 1JWSD 2PJ6A 3L2NA 4CKCA 1Z2LA 1S5DD 3TSSA 2F0JA 3CRKC 3LWUA 3TBIB 4C3HB 5IB9A 4OIDA 1BUVT 1VHOA 2ZENA 3QJYA 2EZVA 4DXGA 3D7FA 1LT5D 1STYA 1G8ZD 1KWMA 3SHLA 3PB6X 4KK7A 3BVGA 1II3A 1BCPD 1MD2D 4IUUA 2E2JB 3D7DA 1A2UA 3EA6A 1SYFA 1HUNA 1LTAD 3D4WA 4GZYC 3MRUA 4P4JA 3IEHA 4RCOA 1OO9B 3J80E 4BA2I 2L1BA 2HDLA 1K8MA 3OW7A 4BA1I 1XTCD 1LCPA 5HXDA 4A3MB 1KNAA 3VR3A 5FK9C 1Q12A 4OC0A 4MMOA 1ELLP 4NGNA 4IHMA 5I9PA 2DY7A 4YWYA 1B9NA 5LYFA 3B7IA 2BE5D 4FO2A 3I72A 4Z9CB 2NSMA 3H8EA 4QB4A 1HUMA 3OIQA 3HLPA 3KBGA 4QCLA 1WTRA 2NTSA 4OHJA 1ICWA 4R7MA 4KD4A 3OMCA 3GB0A 3W2DA 3NTKA 2XEIA 4OC5A 2BCOA 1EWCA 4CJ0B 5K36G 5T1IA 1EYDA 4CHTB 5JEAJ 4CKEA 2NZ1D 7CPAA 3HUVA 4KI0A 1CA6A 2NVXB 3PFEA 1TWAB 3S9NA 3I73A 4F9VA 1VHEA 2JBJA 2R92B 3J81L 2RSOA 5I6YA 1CP6A 3NH4A 2ZEMA 5JPMC 5A2QL 1D5ZC 4PQAA 2Q8RE 4IALA 3F2UA 4FF1A 2L12A 2SEBD 3FMCA 4BD9A 5J22A 1EY8A 2EDGA 3NHHA 4HSVA 4FF2A 3B3VA 3Q23A 1EQVA 5CMDA 4OKOA 2IT1A 2PJ0A 1C4QA 1SJED 4EQNA 3QWNA 1SJHD 1O7ZA 3SVMA 4MRIA 4ZY2A 1JQGA 2GLJA 2F0EA 1BPNA 2F0NA 5EQ0A 4B9XA 5JVG3 1BOSA 3D4RA 2EK9A 2NVTB 1O7LA 1VGYA 1LV9A 1TT2A 5D65A 5JEAH 1CQVA 4C56C 4QMGA 4C3HG 4X3RA 4MHEA 1ZXTA 1VIXA 4KHVA 2K05A 1XJOA 5ISRA 2J4XA 2QCPX 1WVLA 3NWSA 2H4OA 1IL8A 3K5OA 2QDBA 2IPKD 3RD4A 3WC6A 3K5MA 3HS0C 4BS9A 2PJ2A 2ZXRA 4ILWA 1F2ZA 2ZT9C 1XRYA 2Z4HA 2E76C 4K3NA 4PQXA 3W3AA 2WP8J 2EJFC 2KQ3A 4MHPA 1Y8OB 2WB1B 1MBYA 4IAVA 1AW7A 5E1FA 1J8IA 4P4DA 5EGTA 2HCIA 3PO3B 1GUOA 4ZX9A 1VF5C 3HOUB 2GA4B 1QQ9A 2JA8B 3P20A 2I07B 3SJFA 2A74C 3CU7A 3K5LA 1XWEA 3KASA 4V0BA 4F88A 2PVWA 4MXUA 4NKLA 1PRTC 1EZ8A 4P2CB 3KLRA 1GJXA 3DWAA 3GV6A 4DNRB 1TKWB 1SYCA 2V8GA 4X8IA 4F8MA 2Q8TA 1ARLA 2F0WA 3K5NA 5K5PA 2EOTA 4A94A 1WD0A 1TWFB 4K5VA 3M7NA 3J7AF 3TX8A 1ENAA 1I4PA 5LRKA 1WTWA 4ZRZA 3C1EA 1WCMB 3DUZA 1IYUA 2WKCA 4G7ZC 2K6AA 1ET6A 4RGTA 1BAVA 5TSSA 1SMYD 3DMUA 5JM6A 2PJ8A 3PUXA 4R76A 3IWWA 2RFHA 2V8HA 5CYUA 1YW6A 3GTPB 3FPUB 3A8IE 2XEFA 2JEAI 3KUPA 1TWGB 5FKAC 2J0TD 4S3SA 3T13A 4XQNA 3FVQA 2F0TA 3EQLC 4X3UA 1TF8A 4RHSA 1IYVA 4HSPA 1F77A 2KJXA 2QILA 4KD3A 1X3QA 2PMZB 4IUPA 4QF4A 4K6LA 4YIJA 4BBSB 8CPAA 3OHXC 3Q22A 2WACA 3R2IA 3BI1A 1OBRA 2VL1A 2ZXOA 1O7YA 2HCCA 5LYLA 5IT9E 5FO7B 4J8QA 4A37A 1D5MC 2C6CA 4KN4C 4DAPA 3J7AV 2OF1A 1PRTB 5G3LF 3VR6A 2WYRA 1V43A 2B2WC 2A6HD 3CDXA 1XYIA 4ZY1A 2BDOA 1QMUA 2IJZA 4H2KA 4MN3A 2FHTA 1EY6A 1SEBD 1STHA 4RWSC 3S1MB 3FH4A 1S5BD 1LTID 2CQAA 1G2SA 4KJNA 2E74C 3CPXA 2PJ1A 2L55A 2ICIA 4ZYQA 1R4PB 1PFMA 1DOKA 4BY7B 3DWPA 4LAAA 3JAML 1BF4A 2A68D 3NPPA 1LACA 1YLOA 2RDHA 4XXEA 3MXUA 3TP6A 3S1NB 3K6OA 3BXMA 2EWBA 5BN3A 3GQBA 5LRJA 1BXTA 2CW0C 2PZWA 4G7HC 2M9VA 3SK6A 1LANA 5I2YA 3C2PA 5CR3A 1QWYA 5KYIA 2PIYA 3KQXA 4ZUIA 3S1QB 1SYGA 4NGPA 2A6EC 2B2VA 2NN6H 3RZOB 2PJ9A 3A54A 3JRUA 1CFMA 1CP7A 2JXMB 5KGUA 5C0XI 1Y0YA 3HOYB 1DOLA 5A2QE 2O2LD 1Y8PB 2FINB 1BLLE 5CV4A 3I4NB 5JGFA 2K04A 5EBDA 1A6XA 3HOVB 1LTTD 5CV9A 3P75A 1SFOB 3SK5A 4ZKCB 2E2HB 1Z5RA 4E6IA 2PJBA 2TMPA 3D6WA 1DYQA 1PCAA 1A15A 1EU3A 1Y1VB 3IFEA 4PMBA 2ZOGA 1TS3A 3S2DB 2AFUA 5C4HA 1EE3P 4X3KA 3FEDA 1U9RA 4EFDA 3VA7A 2K7VA 1VCIA 4NP5A 1I6HB 4FP5D 3BYYB 3IC1A 2JA7B 2B2TC 4UAIA 2AFMA 1HFGA 3L9AX 2ZEFA 5K8OA 2KCCA 3TN2A 1OXXK 1PLFA 4HMIA 3K9TA 2D2CC 3BDCA 3MXNA 1GYTA 3VYUA 1H9KA 1PTOB 4DGZA 1CM9A 2AFOA 2JYOA 3MTSA 2AQ2B 3T53B 4R9WA 5LYDA 1RCVD 4UIBA 2JA6B 2XRSD 5E4WC 3BZDB 1EEID 2CW0D 1CT1D 5EPJA 1AYEA 2JP1A 1Q8IA 4IUNA 3NFZA 1H9JA 3HEJA 3I90A 1BCPC 1EFID 2XN9C 1STEA 3IFDA 5D14A 1LAMA 4DF7A 2JBKA 2C1CA 1M4LA 2E2IB 3RBUA 4K5WA 3P1HA 2B39A 3H91A 1KDCA 2ID0A 1E2VA 4U673 4P4BA 1SAPA 2MPMA 1STAA 1EY0A 2AFSA 4B6ZA 1FD7D 5DM63 3BHXA 3NQTA 5A35A 3B3CA 5C0XG 1FNUA 3QO2A 2GREA 3VATA 2B2UC 1Y8NB 2BE5C 4GM5A 2HUGA 4C3JB 4A3IB 3FJUA 1Q3LA 2JSOA 5DM73 4CBVA 2XEJA 3TZUA 3T8WA 2YU9B 3TMEA 1GHJA 2AUKA 5JH9A 1MGSA 3FF3A 4OIKA 4RKBA 5CV7A 2SNSA 2OOTA 1HDUA 1NSAA 2J7ZA 1B4OA 4F8ZA 3IAYA 5THWA 1RKNA 2QF7A 3NBHA 3BDLA 3SK4A 5LL6X 4KY6A 5M3FB 4HCSA 1ZG9A 4LQGA 1DM0B 3IFTA 4BWGB 4PXDA 4ZK9B 4IUVA 2L4NA 2ZXPA 1B3AA 2X6GA 3R93A 5KNCA 1R4QB 1I6VC 1GXDC 3PUZA 3FX6A 2IL8A 2KHSA 3C1FA 2CF4A 2XRQD 2CVRA 1GHKA 3DLJA 3SI0A 3SJXA 2E2DC 2X6LA 2PNRC 2SOBA 4CPAA 1H9MA 4M8AA 5HURA 2E75C 3Q24A 1B50A 4RUHA 2B63B 4R8IA 2EJMA 4FNFA 1RJTA 2K5QA 3B2YA 4P6YA 3AMUA 5J1ZA 4PXEA 3VYSA 5HVHA 4LK1C 5FLXL 4A3JB 1I4HA 3PEIA 5ELYA 2Z8LA 1BCPF 3PB7X 4A3GB 1LAPA 1EU4A 2NUCA 4WWVA 3MVVA 3VR2A 2B8FA 3X3NA 4WORA 2TSSA 2Y0SB 1A3UA 1U4MA 1A3VA 1KLUD 3SI1A 1FT7A 4IUQA 4LMQD 5BN5A 1JWMD 2NVQB 3LWEA 4A93B 1SYDA 2NWGA 4G57A 2WAQB 5EKIA 3ONAB 1TU2B 5K36H 4I65A 2AWNA 1K83B 3KQZA 1HXYD 2EYFA 2ZEHA 2MGSA 5AFWA 1LTSD 4ZYSA 1ZEQX 1DXMA 3KI9A 3FDTA 1OXUA 4YU9A 3CPAA 4DAYA 3N5FA 4OO1I 3KHXA 1JQYD 5JOBA 1CPXA 2V8VA 2LMCB 4FYDA 2CIJA 3GLJA 3GTMB 1XFOA 1G291 2KEDA 2F3VA 4P4FA 3MFYA 4RH6A 2Q4ZA 4ODGA 1Y7EA 5EPLA 1HDQA 2BOSA 4C3JG 3BS1A 4C2MB 4HCEA 4EMEA 2F0FA 3I1UA 1AP0A 3QOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I3C A;  1GUG A;  2C6P A;  2EVB A;  2NN6 G;  1LOK A;  2JEB I;  1IYU A;  3PUW A;  3VR4 A;  4G7Z C;  3LMS A;  2R6G A;  3KZW A;  2WZN A;  3OPO A;  2PVV A;  3L7Z C;  4OP4 A;  2JEW A;  1BAV A;  3B3S A;  5JM6 A;  2PJ8 A;  2PE3 A;  3PUX A;  3H8G A;  4R76 A;  3CT9 A;  3IWW A;  2RFH A;  3FPP A;  2V8H A;  1YW6 A;  2AWO A;  2XEF A;  3A8I E;  2JEA I;  2Q43 A;  2B8G A;  4Q7A A;  2PIZ A;  3H94 A;  2AUJ D;  3D7G A;  4UEZ A;  1ONL A;  4DNT B;  3CRL C;  3SI2 A;  3EQL C;  1BDO A;  1TF8 A;  3SE0 A;  4NJR A;  1IYV A;  3V38 A;  4RCN A;  1CI3 M;  3M85 A;  2GLF A;  3ISZ A;  3SJE A;  8CPA A;  1K8O A;  3BI0 A;  1SMY C;  1Q1B A;  1ZLH A;  3NE5 B;  4PV1 C;  3DXJ C;  3BI1 A;  1OBR A;  2VL1 A;  5HVG A;  5LYL A;  3B3T A;  1GUN A;  3PUV A;  4TQU S;  2O5J C;  3VAR A;  4A37 A;  2C6C A;  4KN4 C;  1OXT A;  3KHZ A;  4OC4 A;  1HTP A;  5F09 A;  2ZEG A;  3D67 A;  4NGM A;  4PPZ A;  4DK1 A;  4NGR A;  1FNO A;  1YSJ A;  5D29 A;  1CTM A;  3VR6 A;  5KND A;  2WYR A;  4ZX8 A;  1V43 A;  4FAI A;  2A6H D;  3CDX A;  3LNN A;  1YNN C;  3PFO A;  3ISX A;  4ZY1 A;  2BDO A;  4FUU A;  1QMU A;  2IJZ A;  4H2K A;  1FR3 A;  3KL9 A;  3RLF A;  1ZKO A;  3WAB A;  4JZ0 A;  4NGS A;  1O78 A;  5DS0 A;  3FH4 A;  2PCF B;  4NFR A;  4LJZ C;  1Z6H A;  3BG3 A;  1ZG7 A;  1Q1E A;  3IKJ A;  2V77 A;  4G1P A;  2E74 C;  3CPX A;  2PJ1 A;  1DD2 A;  4OC1 A;  3PV0 A;  4ZYQ A;  4JBW A;  4OO1 G;  3D68 A;  3DGV A;  4KKT A;  4IFD H;  4KSI A;  2V4D A;  2JE6 I;  2A6H C;  4KMU C;  4FBE A;  2A68 D;  3I4L A;  2ANP A;  3RAM A;  2DN8 A;  4HR7 B;  2A6E D;  1LAC A;  1VDZ A;  3S9L A;  1YLO A;  3AB9 A;  3MXU A;  1CBX A;  1Y0R A;  2QJ8 A;  3SDZ A;  2Q8I B;  3BXM A;  4XTC S;  2EWB A;  1TXR A;  1TKJ A;  2ABZ A;  3D4U A;  5BN3 A;  4P45 A;  3GQB A;  5LRJ A;  1IY7 A;  1H9S B;  2CW0 C;  1RTQ A;  1HQM C;  2ZEO A;  4G7H C;  1PYT B;  2PCU A;  4UF4 A;  3IIB A;  4OGQ C;  1PMR A;  5BN4 A;  1Z7T A;  3BDO A;  1LAN A;  1OXV A;  1HPC A;  5K8M A;  4MCQ A;  2A68 C;  1B9M A;  2PIY A;  3KQX A;  1DTD A;  1BPM A;  4NGP A;  1IW7 D;  2A6E C;  3HGB A;  1Q90 A;  2NN6 H;  2PJ9 A;  1TKH A;  3JRU A;  1ARM A;  1CFM A;  1ZG8 A;  3K2K A;  1CP7 A;  2JXM B;  5K8P A;  4IQZ A;  1Y0Y A;  3M4Y A;  2BOA A;  2ZEP A;  1Y8P B;  1H9R A;  1VF7 A;  1BLL E;  1GUT A;  4OC3 A;  3KR5 A;  5JGF A;  2ZEL A;  1GUS A;  1DE4 C;  1DCZ A;  4EWT A;  3NH8 A;  1FYC A;  1A6X A;  2QYV A;  4DJL A;  3IJ3 A;  3N6R A;  1XBU A;  2HB6 A;  4KKS A;  4OC2 A;  1UWY A;  2K33 A;  1Z5R A;  2NYQ A;  1XMB A;  2PJB A;  3B35 A;  2RB7 A;  2ZEE A;  1IW7 C;  3D31 A;  1AMP A;  1PCA A;  3FEC A;  4P4E A;  2PJ6 A;  2ZOG A;  3IFE A;  3L2N A;  1Z2L A;  2AFU A;  1EE3 P;  3FED A;  1Q7L A;  3CRK C;  3LWU A;  4EFD A;  3VA7 A;  4MCP A;  2K7V A;  1VCI A;  2Q51 A;  1E2W A;  4OID A;  5IB9 A;  4P44 A;  4ZI6 A;  1VHO A;  2ZEN A;  3PB4 X;  2PJ3 A;  2PJC A;  3QJY A;  3IC1 A;  3A8J E;  4OME A;  3D7F A;  2AFM A;  5K8O A;  2ZEF A;  4WJB A;  2KCC A;  1KWM A;  2AFZ A;  3PB6 X;  1Y69 U;  1YNJ C;  4X2T A;  1TKF A;  1OXX K;  3K9T A;  2D2C C;  3D7D A;  2EJG C;  1GYT A;  1H9K A;  5JEA G;  2K32 A;  4GZY C;  6CPA A;  3MRU A;  4P4J A;  3IEH A;  2G9D A;  2AFO A;  4BA2 I;  4MHY A;  1K8M A;  4PXB A;  3T53 B;  3OW7 A;  2L5T A;  4BA1 I;  3GD7 A;  1LCP A;  4I7Z C;  4ONW A;  5HXD A;  5LYD A;  2AFX A;  2PJ7 A;  4UIB A;  4G7O C;  3B3W A;  4P4I A;  4OO1 H;  3VR3 A;  1AYE A;  3PBB A;  1F2O A;  1F57 A;  3NFZ A;  3WDN A;  1H9J A;  1Q12 A;  4OC0 A;  4MMO A;  1ELL P;  4MHN A;  1LAM A;  4NGN A;  4IHM A;  4W9Y A;  2IQ6 A;  3V7Z A;  4YWY A;  2JBK A;  1B9N A;  2C1C A;  1M4L A;  3B7I A;  2HC9 A;  4NGT A;  2BE5 D;  1H9S A;  5LYF A;  3RBU A;  3I72 A;  2NSM A;  3H8E A;  2PPB C;  3QG1 A;  5LRG A;  3HLP A;  3A7L A;  4R7M A;  1E2V A;  4R6T A;  2A69 C;  4P4B A;  3GB0 A;  4UEF A;  3S9M A;  2XEI A;  2ZED A;  4OC5 A;  2BCO A;  2AFS A;  4NJQ A;  3OOC A;  3KR4 A;  4B6Z A;  2D62 A;  5K36 G;  4DK0 A;  1R3N A;  3PBE A;  3WC5 A;  3BHX A;  5CPA A;  5A35 A;  2EK8 A;  3B3C A;  5C0X G;  7CPA A;  3HUV A;  3PB9 X;  4KI0 A;  2XEG A;  2GRE A;  3MN8 A;  3PFE A;  3VAT A;  1HEE A;  1Y8N B;  3S9N A;  2BE5 C;  2DNC A;  3I73 A;  4F9V A;  4GM5 A;  4FWU A;  4TNU A;  3FJU A;  4H13 C;  5KNB A;  1VHE A;  2JBJ A;  4DYO A;  2V8D A;  2YYZ A;  2XEJ A;  3RZA A;  3TZU A;  3T8W A;  4Z65 A;  1CP6 A;  4UEE A;  3NH4 A;  1GHJ A;  1T5E A;  2ZEM A;  2AUK A;  4A39 A;  5JH9 A;  1QJO A;  2O4H A;  4L8J A;  3FF3 A;  4PQA A;  1YW4 A;  4XIG S;  2CTC A;  3FVL A;  5D8N A;  4NGQ A;  2OOT A;  1HDU A;  2CTB A;  4MCR A;  3WC7 A;  4A38 A;  3ND8 A;  1NSA A;  3FMC A;  2ZOF A;  3PB8 X;  4BD9 A;  1EWH A;  2EDG A;  2DNE A;  3B3V A;  2J9A A;  3D7H A;  2IMO A;  4F8Z A;  5THW A;  2QF7 A;  5K8N A;  4MCS A;  1HCZ A;  1CPS A;  4OKO A;  2IT1 A;  1YME A;  2PJ0 A;  2D5D A;  1ZG9 A;  4LQG A;  4DUK A;  2KA7 A;  1OXS C;  3IFT A;  4MRI A;  4PXD A;  4ZY2 A;  2PJ5 A;  4KN7 C;  1JQG A;  2GLJ A;  1BPN A;  4AXV A;  4KHZ A;  5KNC A;  1I6V C;  2NN6 I;  5J1Q A;  3PUZ A;  3FX6 A;  5CBM A;  3D4R A;  4TWE A;  2EK9 A;  2CF4 A;  2OR4 A;  1O7L A;  1GHK A;  4H44 C;  3DLJ A;  3SI0 A;  3SJX A;  2PNR C;  1VGY A;  4JYW A;  2PJ4 A;  1CX8 A;  1V8Q A;  3A7A B;  4TKO B;  5JEA H;  3SJG A;  4CPA A;  1H9M A;  2C6G A;  2E75 C;  2F8H A;  4X3R A;  1F2P A;  2GU2 A;  3D66 A;  5LYI A;  1VIX A;  3PRT A;  1ELM P;  1XJO A;  4RUH A;  3GUX A;  2EJM A;  4UIA A;  3KGQ A;  4P10 A;  4MHZ A;  3B2Y A;  3VR5 A;  4IK2 A;  3ND9 A;  4P6Y A;  2A69 D;  4PXE A;  5HVH A;  3WC6 A;  4LK1 C;  3T56 B;  2BO9 A;  2FVG A;  3PEI A;  5ELY A;  2PJ2 A;  3PB7 X;  2ZT9 C;  1XRY A;  1LAP A;  2E76 C;  4K3N A;  4WWV A;  2PJA A;  4PXC A;  3W3A A;  2EJF C;  3VR2 A;  2B8F A;  4MHP A;  1Y8O B;  3TC8 A;  4IAV A;  4P4D A;  1FT7 A;  2BA1 A;  3SI1 A;  2PRQ A;  5BN5 A;  5I4M A;  1H8L A;  4ZX9 A;  1GUO A;  1VF5 C;  3VH9 A;  1ZYR C;  3QIA A;  3U9S A;  4H0L C;  3T51 B;  3IO1 A;  3WT4 A;  1QQ9 A;  1TU2 B;  5K36 H;  1CG2 A;  3NH5 A;  4R8F A;  2QVP A;  3P20 A;  4ZY0 A;  3SJF A;  3PUY A;  3KQZ A;  5C0X H;  2AFW A;  3H8F A;  2ZEH A;  3NA6 A;  3A8K E;  3KAS A;  2PVW A;  4MXU A;  4IFD G;  1DXM A;  3FEE A;  3KI9 A;  4O23 A;  1OXU A;  2BA0 A;  4YU9 A;  3CPA A;  4F9U A;  3N5F A;  1LAB A;  3KLR A;  1ZLI A;  5HVF A;  1GJX A;  3KHX A;  1TF9 A;  4OIW A;  4DNR B;  1CPX A;  4JK1 C;  1LFW A;  1TKW B;  2V8V A;  2LMC B;  1R43 A;  2V8G A;  2CIJ A;  4X8I A;  3GLJ A;  1XFO A;  1G29 1;  1ARL A;  4P4F A;  4A94 A;  2O53 A;  1E2Z A;  1Z8L A;  3MFY A;  2POK A;  2Q4Z A;  2F1M A;  2O5I C;  1Y7E A;  2DEA A;  1HDQ A;  2F7V A;  1IGB A;  4KKU A;  4EME A;  3M7N A;  3TX8 A;  3I1U A;  3QNV A;  5LRK A; 
#chains in the Genus database with same CATH topology
 1HTL D;  4N8X 1;  1X56 A;  4FXD A;  4GXH A;  3E0E A;  1ESR A;  1U4R A;  4K5X A;  2K4K A;  1LOK A;  4JG2 A;  3K57 A;  1HZ9 A;  2CH4 A;  1EIH A;  2RF4 A;  3NK9 A;  1XMO Q;  3L7Z C;  4R1J A;  3WOE A;  3EIV A;  1IBM L;  2MP1 A;  4XPD C;  5HGT A;  4DAV A;  4EQP A;  2IL4 A;  3H8G A;  1JWU D;  3FPP A;  1SDF A;  1U4L A;  1ASY A;  1LUZ A;  2Z0Z A;  4AVB A;  3UDX A;  3S14 B;  1MJ9 A;  2CCZ A;  5LL6 S;  2PIZ A;  4A33 A;  3H94 A;  5CBE E;  2AUJ D;  1JOO A;  5ELC A;  1KXL A;  3F0A A;  2IJ0 A;  5AGE A;  5M3F G;  4DNT B;  2QIR A;  3PO2 B;  3SE0 A;  1HFN A;  2Z4I A;  3V38 A;  4C3H H;  3PZJ A;  2Q2H A;  3M4P A;  4WJW A;  3HOW B;  4HAE A;  2RCF A;  4O42 A;  3FBU A;  3HKZ E;  1KDB A;  2PW5 A;  5IGF A;  1Q82 C;  5IP9 G;  4JI5 Q;  2OCE A;  4MFK A;  4NF1 A;  3SJE A;  4HTH A;  3ZYY X;  3BI0 A;  1SMY C;  4DV4 L;  1XMQ Q;  1YX0 A;  4FD6 A;  1B87 A;  3M7G A;  2NYZ D;  1HNZ Q;  1LTR D;  1SN8 A;  4JCV E;  1SND A;  3B3T A;  2EE1 A;  3CD6 A;  3VAR A;  4XPL A;  4MBU A;  2F5I A;  4JI3 Q;  1OXT A;  3H09 A;  3VYT A;  2E2J H;  3KHZ A;  1YJN A;  1YVK A;  1HTP A;  1LT4 D;  4X3T A;  2ZM6 Q;  1IBK L;  4BMH A;  1AEX A;  5C44 B;  1KD1 C;  3D67 A;  4NGM A;  2EXD A;  1FNO A;  1MSH A;  4R3K A;  5F49 A;  1CTM A;  4HIK A;  4ZX8 A;  4L8A A;  4AQY L;  3J7Y W;  2K1B A;  4OL7 A;  5IGD A;  3PF5 A;  3ISX A;  3PFO A;  4JI6 L;  2B63 G;  4FUU A;  5DLQ E;  1FR3 A;  3LD2 A;  1S5K A;  4A3M H;  4NGS A;  1HNX Q;  1O78 A;  3EVQ A;  1F9S A;  2PCF B;  1NSN S;  4JC0 A;  4NFR A;  4A3J G;  4LJZ C;  1SNC A;  4KY7 A;  1ZG7 A;  2V77 A;  1XTD A;  4X3S A;  1I1D A;  5FLX c;  1PYW D;  5FOB B;  4A3G G;  1IBL Q;  1EEF D;  3HOX B;  4OO1 G;  2CNT A;  1W6J A;  2RHS B;  3K0Y A;  3EXN A;  5DWN A;  4KSI A;  4X66 Q;  2Y0S G;  4DK6 C;  4A3E B;  2V4D A;  1LRZ A;  2A6H C;  3I4L A;  2K5T A;  3CC2 A;  3A74 A;  4KSA A;  2OZG A;  4MJ8 A;  5IOD A;  3GKR A;  2RDF A;  3G6E A;  3S9L A;  4CGN A;  1Z9F A;  2Z9H A;  3UDF A;  4J15 A;  4C68 A;  1F2Y A;  5IWA L;  1I4X A;  4A93 G;  1OTC A;  1SSO A;  2WAQ G;  1CBX A;  1Y0R A;  2Q8I B;  4GS4 A;  4Q38 A;  2N88 A;  2ATR A;  1TXR A;  2ABZ A;  1KAA A;  4DPG A;  4P45 A;  1A2T A;  1I5F A;  3GTL B;  2EIF A;  1YVC A;  3RO0 A;  3BU2 A;  1JC7 A;  3C46 A;  1PHJ A;  2EYJ A;  2ZEO A;  1H95 A;  2NVX H;  4DR5 Q;  3BYT B;  4CAF A;  4OGQ C;  1TWA H;  1VS0 A;  5DAU A;  4HNW B;  4NXN L;  2XVS A;  4PV6 A;  2Q7S A;  1Z7T A;  3BDO A;  3MHB A;  2VW9 A;  1KIX A;  3TCV A;  4KVX A;  3ERO A;  4QUS A;  4UDU C;  2R92 H;  1JJG A;  4MCQ A;  5EBV A;  5E4X A;  2A68 C;  1B9M A;  4FF3 A;  3CCL A;  1M4V A;  4KUB A;  3KK7 A;  3GTQ B;  4F6A A;  4NMZ A;  2NB0 A;  5D3D A;  1JR0 D;  3K2K A;  1WTV A;  4YHH Q;  1X10 A;  2EYM A;  3M4Y A;  3F8K A;  3L2P A;  4IZ8 A;  2OZH A;  2ZEP A;  4MTK A;  1VF7 A;  5FO8 B;  1NMT A;  1D1I A;  2ZEL A;  1GUS A;  4JI2 Q;  1WWZ A;  1FNV A;  3D3S A;  1JB7 A;  2LS0 1;  3NH8 A;  3MGD A;  3T1Y L;  2QYV A;  4DJL A;  1JOR A;  2OT2 A;  1XBU A;  3IJ3 A;  5J8F A;  4B9W A;  3QAY A;  4A30 A;  2HB6 A;  4LFA L;  4KKS A;  4LF9 L;  3I4M B;  4OC2 A;  4U9Y A;  4L5S A;  3C26 A;  3P7J A;  5I9O A;  1X3P A;  1HZC A;  3C3L A;  3D31 A;  2RSN A;  4P4E A;  3LX0 A;  4K14 A;  1PXU A;  4CKB A;  2EQS A;  1Q2C A;  3S14 H;  4LNQ A;  1FJG L;  4R4T A;  3BVZ A;  4UBR A;  1Z4R A;  3H4Q A;  4E0A A;  2NVT H;  2Q51 A;  3STB D;  1ESF A;  2XSC A;  1PH2 A;  2JJQ A;  2DY8 A;  1S72 A;  5FJ8 G;  4KOU A;  1VQP A;  4GLX A;  3PB4 X;  4QL5 A;  2PJC A;  3A8J E;  4LUO A;  4CJ1 B;  3PO2 G;  4B3S L;  1O80 A;  5ELB A;  1KZF A;  3NTH A;  4U5Y A;  5E7N A;  4WJB A;  4RGN A;  3RUZ A;  1VMC A;  3JC6 6;  3HOZ B;  1STB A;  3HOW G;  3KFU A;  1TKF A;  3J80 i;  2SNM A;  1WTX A;  4DUZ L;  1PH6 A;  4JI4 L;  1GVP A;  2EJG C;  1YRE A;  2UUA L;  5I2X A;  4N9P A;  2K32 A;  3F2B A;  3QB3 A;  4UPA A;  3FXT A;  2G9D A;  3D2M A;  2N3S A;  1MIU A;  4ME5 A;  1UAP A;  1RXT A;  1CZG A;  3J80 L;  1K28 A;  2ZTD A;  4MHY A;  2K5D A;  1HR0 L;  1ILQ A;  2L5T A;  2VB3 X;  3F8T A;  3GD7 A;  4B3M Q;  3S2H B;  1J5E Q;  2PJ7 A;  4G7O C;  1HH2 P;  5LMN L;  4MY3 A;  5IGB A;  3M3Y B;  3B3W A;  4II9 A;  4QUF A;  5IGG A;  1KTK A;  2MJ8 A;  5C44 G;  2PC1 A;  3E6Z X;  2AQ1 B;  3PBB A;  1XJV A;  1F2O A;  1F57 A;  1EOT A;  5JJK A;  5C3E B;  2A73 B;  1BNZ A;  4Y49 C;  4WJ3 M;  1IKL A;  4W9Y A;  3IRB A;  1PYB A;  3V7Z A;  1JB3 A;  1HA5 A;  4UP8 A;  4NGT A;  1JJ2 A;  1UUP A;  3PO3 H;  2HC9 A;  3EBE A;  1TS4 A;  4LF7 L;  4FXK C;  1Y14 B;  3HOU H;  2B5G B;  2Z3O A;  1L0X B;  3OW2 A;  3QG1 A;  5LRG A;  2F4V L;  4UCN A;  4A76 A;  1I3Q B;  3A7L A;  2JA8 H;  4PNY A;  3EY5 A;  1I4Q A;  4XQJ A;  1JE5 A;  4EVO A;  4HJA A;  4IUS A;  2A69 C;  3HOX G;  3CXP A;  1QSN A;  4UEF A;  1XOV A;  4A3D B;  1SYE A;  4DR1 L;  2ZW7 A;  4KTA A;  2PI2 A;  4A3E G;  3KR4 A;  3G3S A;  1QOH A;  4DK0 A;  1VQF A;  2A5H A;  3WC5 A;  5CPA A;  4XT1 B;  3S9W A;  2RQX A;  4HPS A;  3PB9 X;  4CGL A;  2XEG A;  3OTO L;  4GKK L;  1HEE A;  4B5O A;  1AE3 A;  1V1O A;  4Q0F A;  1RD9 D;  4F7X A;  4H13 C;  3GV3 A;  3FNC A;  2V8D A;  2YYZ A;  3J81 E;  1L0Y B;  4IFD I;  2O28 A;  4YWL A;  3RZA A;  5J39 A;  4HIM A;  2KBN A;  3MXP A;  3ULP A;  4UEE A;  4JOI A;  1T5E A;  2K28 A;  1MKH A;  1SXT A;  1TWF H;  4B11 A;  3SXH A;  1QJO A;  1EY7 A;  1YW4 A;  3U4V A;  2J8N A;  3TP7 A;  2HQY A;  1PU9 A;  4K8J A;  1EY5 A;  2PZU A;  1HA6 A;  3I3G A;  5D8N A;  2L11 A;  1MSG A;  4DU9 A;  1WCM H;  5KYL A;  2ZOF A;  2AMC B;  1EWH A;  4QIW E;  1FGB D;  2F0K A;  1HNW L;  5JJL A;  3PB8 X;  2DNE A;  5G20 A;  2C35 B;  5C4X B;  2LSS A;  2IMO A;  1LO5 D;  3R9G A;  5K8N A;  4MCS A;  3W1B A;  3S15 B;  2I00 A;  1YEZ A;  4WJ4 A;  2D5D A;  4A2Z A;  2XNA C;  5KTA A;  4DUK A;  3NEL A;  1C9O A;  1ZO0 A;  2ZW4 A;  4XT3 B;  1CHP D;  2ICE C;  3GTP H;  2PJ5 A;  1TWG H;  3HZX A;  3NWT A;  3FP9 A;  2F3W A;  4HJ7 A;  1DJR D;  1XMT A;  3OYY A;  5C0X J;  4JD6 A;  2L9H A;  4R4I A;  5J1Q A;  2EY1 A;  5CBM A;  2EXZ A;  1DON A;  1JIC A;  4TWE A;  2FJ2 A;  3I4M G;  3TT2 A;  5HGQ A;  4PG3 A;  3H0G B;  4H44 C;  1SBB B;  5DNF A;  5C5M A;  3JVN A;  1RDP D;  2RHQ B;  5CV6 A;  1N36 Q;  2UUB Q;  3BZC A;  2HIV A;  2G5D A;  2KCM A;  1QG7 A;  1CX8 A;  1V8Q A;  4BBS H;  4TKO B;  3SJG A;  2F0O A;  1IYK A;  2JDC A;  4JI8 Q;  4CJ2 C;  1XNR Q;  2C6G A;  4GOP B;  2B3U A;  2F8H A;  4B13 A;  1N32 L;  4R4C A;  4H6Z A;  5EC4 A;  1VQ7 A;  1PVO A;  1ELM P;  2ENB A;  4OAE A;  2HHH Q;  1JOK A;  4KY5 A;  3PIO 3;  1EYC A;  2RA4 A;  3VA5 A;  3GUX A;  3R9E A;  3MA2 B;  1STN A;  2K52 A;  1B2T A;  4UIA A;  1ZYR D;  2VNU D;  3KGQ A;  3CCR A;  4MHZ A;  4RA8 A;  1SLJ A;  4IK2 A;  3ND9 A;  2A69 D;  3HOZ G;  2BO9 A;  3T56 B;  4EQO A;  1M4D A;  2R7D A;  3BJU A;  2BH2 A;  4PK3 A;  1KLG D;  1XPU A;  1KNE A;  3I55 A;  1GOZ A;  3G4S A;  2Z6K C;  3I7F A;  5IYC H;  5C3W A;  1WTO A;  4RN7 A;  2N49 A;  1X55 A;  5JVH 3;  2FIW A;  2PJA A;  2QDL A;  3S1M H;  1QSM A;  1Y1W B;  3TC8 A;  1RHP A;  1GM5 A;  2ASB A;  4YWK A;  2PYK A;  4IN3 A;  3EC4 A;  3J80 c;  2OH1 A;  2GN5 A;  4CGY B;  2BA1 A;  2PO4 A;  4DA2 A;  4CYQ A;  4NCZ A;  1HQR D;  5M5W B;  4AVA A;  5I4M A;  1H8L A;  4F0Y A;  2MHV A;  3TZD A;  3VH9 A;  2VQE Q;  2CY2 A;  1IU8 A;  2I46 A;  4H0L C;  3T51 B;  3IO1 A;  4BY7 H;  3WT4 A;  4P75 A;  4CRZ B;  2Y0M A;  1QUQ B;  5C3E G;  3CMA A;  2VY3 A;  4RAU C;  3NH5 A;  1GUW A;  2VBQ A;  3GYA A;  1FNW A;  2QVP A;  5I0C A;  3PUY A;  2Q0Y A;  5LMU L;  3M9B A;  5C0X H;  4POF A;  3H8F A;  3CZX A;  4KOT A;  4ID6 A;  4IFD G;  2UXD Q;  1NJI C;  1I94 L;  3G8W A;  3S1N H;  3K8A A;  1LAB A;  2K14 A;  1ZLI A;  5HVF A;  1N33 L;  5KEE A;  4YCV A;  4JBK A;  5IX3 A;  1SNM A;  4IOC A;  1OZP A;  1T9H A;  4A3D G;  1R43 A;  1K8A C;  3W6S A;  5C4J B;  2PQA A;  2L15 A;  5KIX A;  2K5W A;  3T1H Q;  2N55 A;  4KJO A;  1LM0 A;  3Q0A A;  1I4R A;  3MEH A;  1AZQ A;  2D0O A;  3K7A B;  4LF5 L;  4HED A;  1Z8L A;  2EYL A;  3HRZ C;  3RMH A;  3ICE A;  2M00 A;  1C0A A;  2POK A;  2GVA A;  2IX0 A;  3S1Q H;  2O5I C;  3ZJ0 A;  3RZO H;  1SYB A;  2F7V A;  3TO9 A;  4KKU A;  2JA5 B;  5CV8 A;  4KHP L;  4YGO A;  2CNS A;  3HOY H;  3G6J B;  4DV1 Q;  1VQA A;  4H6U A;  1GUG A;  4I7A A;  2WII B;  2EVB A;  3PIP 3;  3PUW A;  4C1N K;  3I4N H;  2F4I A;  1S4Z A;  1TVX A;  2R6G A;  3KZW A;  2WZN A;  4PSW A;  1L0W A;  3OPO A;  2ZJR A;  4OP4 A;  3I4N G;  4X6A H;  1AZP A;  4K2K A;  4CDD C;  1WI5 A;  1E7Z A;  3HOV H;  4B3R Q;  2PE3 A;  4NXY A;  5COR A;  1SFO H;  2YNC A;  2E2H H;  2KCN A;  1X3G A;  2B2Y A;  3AU7 A;  4F87 A;  3D2P A;  1K3B C;  1S7L A;  5C4X G;  1M4G A;  1BOB A;  4Q7A A;  2KVM A;  5F2D A;  5E96 A;  2UXB Q;  5IP7 G;  3S1R B;  2ZW5 A;  3D7G A;  1Y1V H;  4JV5 L;  4MHD A;  4UEZ A;  2OTJ A;  2DF5 A;  3S2D H;  1BCP B;  4DN4 M;  5ELE A;  3CRL C;  5HH1 A;  4XQQ A;  1BQQ T;  1YVO A;  4IJH A;  5CGK A;  4UFX A;  4NJR A;  1I6H H;  5EMI A;  3R2T A;  1UWV A;  1LT3 D;  1YNN D;  4GNX B;  1PH9 A;  2P6F A;  1CQF A;  1CI3 M;  4RCN A;  4C2Y A;  3M85 A;  3O13 A;  4DUY Q;  2GLF A;  2JA7 H;  5F48 A;  5IYD H;  4PZ8 A;  4A3B B;  2R3Z A;  1K8O A;  4DR6 Q;  1Q1B A;  1WD1 A;  1EUJ A;  3NE5 B;  4UWI A;  4PV1 C;  3H0G G;  3CME A;  1VMP A;  5HVG A;  5IT9 L;  4LUV A;  4TQU S;  1GKH A;  3PUV A;  1TS2 A;  1CM0 A;  5IYB G;  5M5X B;  4CDF C;  5IGE A;  4KV6 A;  4BY1 B;  1B44 D;  2CHB D;  2L0C A;  3A55 A;  4ZLT F;  4BXX H;  3NE8 A;  4DR4 Q;  1E3P A;  2HIX A;  5F09 A;  1PTO H;  1C7Y A;  5EJW A;  4PPZ A;  2PMZ E;  1VQE A;  1TY2 A;  5KND A;  3EFX D;  4IOA A;  4LX9 A;  4C2Z A;  2F0M A;  2XGT A;  1TIQ A;  2MO1 A;  2CWP A;  2NTT A;  3A5Z B;  4FF4 A;  2WPW A;  3KL9 A;  1QUQ A;  1ZKO A;  3WAB A;  4JZ0 A;  1NSL A;  1A63 A;  3FEW X;  3GO5 A;  2F0S A;  2JA6 H;  2Z6B A;  3I3C A;  2EYO A;  5ELD A;  4UP7 A;  3BLN A;  1HRJ A;  3V05 A;  2IY5 B;  2ZTE A;  2RVL A;  5FVJ A;  3IKJ A;  4A3C H;  4G1P A;  3I4O A;  1QVC A;  4DR7 Q;  1LTB D;  2RKS A;  1Y9W A;  4OC1 A;  4JI0 Q;  4JBW A;  3WWV A;  3TO6 A;  1DZ1 A;  1M4I A;  2R7Z B;  2YND A;  3DGV A;  4XNH C;  3DM3 A;  2E2I H;  1ILP A;  3KDF A;  4H89 A;  1Y1W G;  2VEZ A;  2I0Q A;  3P2F A;  3I8Z A;  4R8N A;  2JE6 I;  1KAB A;  1YNX A;  4KMU C;  3MWY W;  3JAM E;  1Z8X A;  2ZM6 L;  1EL0 A;  2XWJ B;  3R9F A;  2XWB B;  2Z11 A;  2DN8 A;  4EGV A;  1Z9U A;  3PIO A;  1GO3 E;  1D1K A;  2BL1 A;  4JYA Q;  2WIN B;  1SR3 A;  3WOF A;  1PZJ D;  3DM1 A;  1X12 A;  3NUC A;  1B1Z A;  3KF8 A;  2B2T A;  3AB9 A;  4HN7 A;  2QJ8 A;  4OAD A;  4XTC S;  4FVM A;  1TKJ A;  3I70 A;  3D4U A;  2R61 A;  1ON0 A;  1L1O B;  1IY7 A;  3BVM A;  1H9S B;  3I2Z A;  2F0V A;  3ERQ A;  1RTQ A;  1PYT B;  5EBC A;  2KEC A;  2PCU A;  4UF4 A;  3MFG A;  1PMR A;  1BBX C;  1S7F A;  3CPF A;  2VB2 X;  1W2B A;  4R4Q A;  4C3J H;  4BBR B;  4DV3 L;  4A3I H;  4QBJ A;  3L3O C;  2C9O A;  2F0H A;  2N78 A;  1OXV A;  3PGZ A;  4UY8 C;  1JCK B;  1ROD A;  4A3I G;  1WTQ A;  2G0B A;  1G91 A;  1D6E C;  4NW2 A;  3IL8 A;  1IW7 D;  3KBX A;  4X66 L;  3HGB A;  4QIW B;  2LKV A;  2YU9 H;  4HJ5 A;  4X65 Q;  3MXG A;  1KUV A;  5C3X A;  1EYA A;  2LFN A;  3TP8 A;  5K8P A;  1NAP A;  5E3F A;  1VQ6 A;  4R57 A;  2PZT A;  4IQZ A;  5EKL A;  1BO0 A;  1R57 A;  4HMJ A;  4R9M A;  1LT6 D;  2XTI A;  4L63 B;  5CBA E;  1Q7Y C;  3GTJ B;  1GUT A;  2JA5 H;  1N71 A;  2F03 A;  4MFP A;  4O1N A;  4GN3 B;  1DE4 C;  1Q2D A;  4NEX A;  2JA5 G;  1YK3 A;  3SR1 A;  2FMC A;  1FYC A;  4GNX A;  3N6R A;  2F0G A;  4DR5 L;  3OWF A;  5M3F H;  1XXG A;  2E5L Q;  2EYH A;  4X62 Q;  4CS0 B;  1UWY A;  1P0H A;  1XMB A;  2SDF A;  3QAH A;  2RB7 A;  4K6D A;  1YHB A;  1PDQ A;  1G2T A;  4A3K B;  5ISV A;  3FEC A;  4J6H A;  4LFC Q;  1WTH A;  4M1U B;  2RBM A;  1STG A;  5IGC A;  1ET9 A;  1Q7L A;  5ELF A;  5IP9 H;  1XPR A;  1XNQ Q;  4CGO A;  4MCP A;  1IB1 E;  1NTG A;  1W3S A;  2PDO A;  1E2W A;  4P44 A;  2FMM A;  2MNA A;  4PMC A;  4YHH L;  4ZI6 A;  2E8G A;  2PJ3 A;  1YHA A;  2VXW A;  2B2U A;  4OME A;  1TII D;  3M4O B;  1G51 A;  2D4P A;  4QJF A;  2F0Q A;  1XE4 A;  4JI2 L;  2VUM B;  1TR5 A;  2AFZ A;  5IV0 A;  1A3T A;  1Y69 U;  4LF8 Q;  4MFL A;  1YNJ C;  4X2T A;  1NR4 A;  3PIP A;  1N8R C;  4P72 A;  1SE2 A;  2R1I A;  2YTY A;  3S16 B;  5CC4 A;  4DV2 L;  2B63 H;  2EY5 A;  3DDD A;  1F2M A;  4A3B G;  5JEA G;  3E0K A;  1X6O A;  4X5K A;  4UA3 A;  4A31 A;  2BSW A;  2HQE A;  3MC0 B;  3MEF A;  3SK8 A;  3I9S A;  6CPA A;  5JPH A;  1SE4 A;  3PMF A;  1B53 A;  3H5Z A;  3D3R A;  3STB C;  4A3J H;  4PXB A;  1V1P B;  4ONW A;  4I7Z C;  1QZG A;  3D8G A;  2AFX A;  3U50 C;  4BY1 G;  4L89 A;  5IT9 c;  2B2V C;  1EQR A;  4P4I A;  4A3G H;  4OO1 H;  3H3V H;  4POG A;  4B3T Q;  1VQJ A;  2PQE A;  4JOI C;  4PZ7 A;  1Q8K A;  3NXW A;  4IUR A;  3WDN A;  1XEB A;  5C88 A;  4X64 Q;  4KLK A;  4JPB W;  4MHN A;  4ULL A;  1C48 A;  4C3I B;  3HG9 A;  2IQ6 A;  5COY A;  1TY0 A;  2REE A;  1R9T B;  1KRT A;  2G9H D;  2NVQ H;  3IWE A;  1H9S A;  1PZI D;  3AFQ A;  4ZAI A;  3URY A;  1WFQ A;  2GE3 A;  5DWM A;  2B4B A;  3CHB D;  2ZXV A;  4A93 H;  2OQ0 A;  2PPB C;  3ER0 A;  2EY6 A;  1T5X D;  1DOM A;  1WOC A;  4C1N I;  1YJ9 A;  1EQQ A;  1VQ8 A;  2CFM A;  1KDA A;  4H7B A;  5JPN C;  3NBI A;  3VDY A;  3CAM A;  1E0B A;  1K83 H;  2F0I A;  1CKN B;  1JE4 A;  3H6M A;  4B08 A;  1Q81 C;  1Z8W A;  4J3G A;  4R6T A;  4XPD B;  4UFV A;  3S9M A;  2R7Z G;  2AE6 A;  2ZED A;  2J8R A;  4NJQ A;  1ENC A;  3OOC A;  4B3M L;  2D62 A;  1J5E L;  3ULJ A;  4GKJ Q;  1R3N A;  3PBE A;  4E8O A;  2QEJ C;  1SE3 A;  2EK8 A;  4ZUJ A;  1S3Z A;  2EYP A;  3MN8 A;  4J1M A;  1QNU A;  3W6X A;  1NE9 A;  2DNC A;  1IBM Q;  3N52 A;  4UHV A;  3EJI A;  4OIJ A;  3GTM H;  1HZB A;  1L2F A;  4FWU A;  3DNS A;  4TNU A;  4AG9 A;  5KNB A;  2IW3 A;  4DYO A;  4MNO A;  1QZH A;  1VQM A;  4Z65 A;  1VQO A;  2MUY A;  4YCU A;  2P5Z X;  1FL0 A;  4TRD A;  1WJJ A;  3GTO B;  1B6B A;  1PFN A;  4A39 A;  3Q6S A;  4BBR G;  4PMW A;  2O4H A;  2F0P A;  4L8J A;  5EKK A;  4C2M H;  4JBM A;  2FXQ A;  2HDM A;  3VWE A;  3R8B A;  4XIG S;  3OIP A;  5EPK A;  4PZ6 A;  2CTC A;  3FVL A;  2KHJ A;  4NGQ A;  4N9T A;  2CTB A;  4MCR A;  3WC7 A;  4A38 A;  3ND8 A;  1I12 A;  1RO5 A;  4LW1 A;  1X9N A;  1EIG A;  5DEH A;  3AFP A;  2J9A A;  3D7H A;  3OSO A;  1I4G A;  1YNJ D;  5I4D A;  4A95 A;  1HCZ A;  1CPS A;  4DV4 Q;  1YME A;  3FYN A;  1UEA B;  4K8I A;  1TWH B;  2WKD A;  3TRZ A;  1YI2 A;  2KA7 A;  5NUC A;  3ULL A;  3X3M A;  1OXS C;  2G3A A;  3T16 A;  2Z3M A;  2UXC Q;  4KN7 C;  3S24 A;  4NPS A;  5FJ8 H;  4AXV A;  4RI1 A;  5EAY A;  4KHZ A;  4RFB A;  4DV0 Q;  2NN6 I;  1SE8 A;  2FE7 A;  1QIL A;  3PO2 H;  1NCV A;  1E22 A;  2F3I A;  2OR4 A;  2AHO B;  4AIM A;  4A3K G;  1MI2 A;  2LY7 A;  3KLS A;  4M3S A;  3HOW H;  3FRP B;  2VS1 A;  4DFA A;  1FVI A;  4JYW A;  1RTO A;  2ODF A;  2H1E A;  1J4J A;  1QVG A;  2DPS A;  2PJ4 A;  1V1P A;  1VHS A;  5G3L D;  3A7A B;  3E5S A;  2OEO A;  2X69 A;  3KLS X;  1F2L A;  5H86 A;  3UI2 A;  1F2P A;  2GU2 A;  3D66 A;  5LYI A;  3M4O H;  1S5F D;  5JAV A;  3PRT A;  2EPB A;  1A62 A;  3CQZ B;  3MZ5 A;  3GTG B;  1C8C A;  4AYB B;  2MO0 A;  1WTP A;  3GY9 A;  2WV6 D;  5FLM G;  5C5L A;  4O0A A;  2VUM G;  5KRU A;  4P10 A;  5C44 H;  1VQD A;  3VR5 A;  1IXR A;  2WUU A;  2FVG A;  5FLX E;  2Z1C A;  4KOY A;  2RCN A;  4ZQ3 A;  2XIW A;  3TOA A;  4YCW A;  1AN8 A;  5I6W A;  2CXA A;  3B8G A;  2RDG A;  1RL2 A;  4JI7 L;  1MJA A;  3NSW A;  5LHY 1;  3IU2 A;  4MFJ A;  4UCM A;  1I50 B;  5L37 A;  5GAD C;  1PRT D;  5IOC A;  4PXC A;  1HJP A;  2UUB L;  4Q5V A;  5T1G A;  2K03 A;  1AH9 A;  4EVY A;  4WFN 3;  1VKC A;  1G6P A;  3SXO A;  3NP8 A;  4AG7 A;  1RTN A;  2PW7 A;  5CV5 A;  5AJ3 Q;  2PRQ A;  4RKL A;  1XX8 A;  3TP5 A;  3SXN A;  4V19 0;  1XNR L;  4QB9 A;  3I91 A;  3HOX H;  1PV4 A;  4K2L A;  1ZYR C;  3QIA A;  4OEM B;  3U9S A;  2FCK A;  3JUW A;  3GP7 A;  2EUI A;  1DGS A;  2HHH L;  1X3E A;  4HJ9 A;  4KLV A;  1B8A A;  4A3E H;  1M44 A;  4HJ8 A;  1CG2 A;  4R8F A;  1LTL A;  4C3I G;  1PRT F;  4KLW A;  2C5C A;  1AFP A;  4ZY0 A;  2Y0S E;  4O2D A;  2BDN A;  4IPD A;  4MIU A;  1PH1 A;  2AFW A;  3NA6 A;  4IF5 A;  1SRO A;  2D9U A;  3A8K E;  3V2T A;  3K7U C;  2B2Y C;  1LTG D;  1FGU A;  3FEE A;  2VQF L;  4O23 A;  3RZD B;  4ZGY B;  2BA0 A;  4F9U A;  4P73 A;  4OX9 L;  2H5M A;  4HKF A;  4DXF A;  3S6H A;  1KL9 A;  1PFS A;  1CZW A;  2A1A A;  5M3M B;  3GTL H;  1PTO C;  1UE6 A;  3BZK A;  4MTN A;  1TF9 A;  1IKM A;  4OIW A;  1EY9 A;  1YHQ A;  4JK1 C;  3NEM A;  4K0K Q;  1LFW A;  1ML0 D;  3K59 A;  1TS5 A;  1SNQ A;  1J9O A;  4G4K A;  1PFB A;  2GVB A;  3VYR A;  3PSI A;  4MY0 A;  1RF2 D;  4KOR A;  3K58 A;  1SNP A;  1E2Z A;  4NXM L;  2O53 A;  3U58 A;  5C82 A;  3EFA A;  2IX1 A;  1SNO A;  3E0J A;  3GTQ H;  4L5T A;  2F1M A;  2R8V A;  2DEA A;  3T4A C;  1IGB A;  4RGM A;  5BR8 Q;  4DR2 Q;  2KHI A;  5M9O A;  1NR2 A;  2IWH A;  3QNV A;  2I3C A;  1D5X C;  1B7Y B;  4U68 A;  2C6P A;  2EO8 A;  2NN6 G;  2JEB I;  3VR4 A;  3LMS A;  3CKI B;  2QKI C;  1E1T A;  3DHQ A;  2PVV A;  3OWE B;  3S17 B;  2UUC L;  1LLR D;  2JEW A;  4QGU A;  5FO9 B;  3RNU A;  4JI1 Q;  4FD4 A;  1M90 C;  3B3S A;  1F9P A;  2KUM A;  3FKI B;  2NZO A;  3CT9 A;  1IL2 A;  4IFD J;  3CCJ A;  3I4M H;  2FS5 A;  3HKZ B;  1PZK D;  2AWO A;  2Q43 A;  3T1H L;  2B8G A;  4GLA C;  2R93 B;  1BKB A;  2ARH A;  5A27 A;  4JW0 A;  1X32 A;  2F0D A;  5A28 A;  4DK3 C;  4Y49 B;  1ONL A;  1TWC B;  5GAG C;  1S5E D;  3IWG A;  3SI2 A;  3W91 A;  5G22 A;  1BDO A;  1HR0 Q;  3QOJ A;  4Y7N B;  4BIN A;  2K01 A;  1M1K C;  5LMN Q;  2DXQ A;  4DV1 L;  3ISZ A;  2VXK A;  3NBH B;  3D6C A;  4ABN A;  3OMG A;  3SHP A;  1ZLH A;  1QNK A;  1JT8 A;  1XF8 A;  3DXJ C;  3R96 A;  1CK1 A;  5IIF A;  3HOZ H;  3S6G A;  1GUN A;  2O5J C;  4A3F B;  2UU9 Q;  4MZ9 A;  3RYO A;  2MFI A;  2VZA A;  3D4D A;  1PH5 A;  2NBF A;  4B3R L;  3DEP A;  4LF4 L;  3A56 A;  3CP0 A;  4OC4 A;  5D3I B;  1QCB D;  3NQI A;  4OON A;  2ZEG A;  2VL6 A;  2B5G A;  5C4Z A;  4DK1 A;  4NGR A;  2F0L A;  1EQT A;  1CA5 A;  1KUY A;  2F4V Q;  1YSJ A;  1G6Z A;  5D29 A;  2UXB L;  4FD7 A;  4L5R C;  4FAI A;  2AQ3 B;  4RG1 A;  1EY4 A;  4TSS A;  4QQB X;  3LNN A;  3K9U A;  1YNN C;  4GS3 A;  1HR0 W;  1JOQ A;  2Z0S A;  4AYB G;  4A75 A;  3S2H H;  3RLF A;  4APV A;  5M5Y B;  1ENF A;  4CYP A;  4CGM A;  4RHR A;  3M3Y H;  1S5C D;  5LMN W;  1PTO D;  4XYO A;  5DS0 A;  4RGO S;  1EOV A;  5GAH C;  1Z6H A;  3BG3 A;  2OWO A;  1Q1E A;  3TDQ A;  3T90 A;  5C3E H;  3AYH B;  5JJZ A;  2CNM A;  1QB5 D;  4DR3 Q;  4LFB L;  2M2L A;  4L6T B;  1DD2 A;  3PV0 A;  4GKK Q;  4AB7 A;  4FD5 A;  1EZ6 A;  3R3O A;  1YR0 A;  3D68 A;  5JJI A;  1ASZ A;  4KKT A;  4IFD H;  3GTK B;  2WB1 E;  4IUT A;  2C27 A;  2PSW A;  4FBE A;  1I3Q H;  4DR4 L;  2ANP A;  1NUC A;  4CAV A;  2FFK B;  1PTO F;  3MAQ A;  4CYO A;  4FXG C;  1D2B A;  3RAM A;  4HR7 B;  1QE6 A;  2A6E D;  3BJ7 A;  1EYG A;  1VDZ A;  4NDX A;  4AH6 A;  1B3Q A;  4IPC A;  4P71 A;  4ZKB B;  2NVY B;  4QUC A;  4A3D H;  2BH8 A;  1QSR A;  3SDZ A;  2P6G A;  2R7H A;  1UNS A;  3ITP A;  3CCM A;  4P74 A;  3PQI A;  2LXJ A;  2PR8 A;  1HQM C;  2JK8 A;  2F0U A;  1Z47 A;  3K80 C;  1W6K A;  1IHZ A;  2KEE A;  3IIB A;  1TQO A;  2B2W A;  1U4P A;  5BN4 A;  2Z10 A;  4LF6 L;  4DR7 L;  4XYQ A;  2I5L X;  5M3M G;  4JI0 L;  1D8L A;  3NTI A;  4DV6 L;  1HPC A;  5K8M A;  3H3V C;  1BBW A;  2A19 A;  1YGH A;  3CC7 A;  1DTD A;  1F9R A;  1J6Q A;  3DWQ A;  2EY2 A;  4GN4 B;  1BPM A;  4CGP A;  1FY7 A;  3HP3 A;  1Q90 A;  2DJG C;  2K50 A;  1TKH A;  1ARM A;  1ZG8 A;  1KC8 C;  1Q46 A;  4OWW B;  4DAY B;  3V96 A;  3UDI A;  2KOL A;  3R1K A;  2K5N A;  2DGY A;  4JYA L;  2F52 A;  2AKW B;  2BOA A;  1CHQ D;  1F9Q A;  1H9R A;  2O4X A;  5HMN A;  1YIJ A;  3U9O A;  3KR5 A;  4OC3 A;  1BR9 A;  3NEN A;  3AQQ A;  1DCZ A;  1M8A A;  1K0R A;  1UE5 A;  3G7L A;  4WRD A;  2PI2 E;  5C4X H;  2IX3 A;  4A32 A;  4EWT A;  3DEO A;  2QW7 A;  1VQC A;  5IP7 H;  4XDX A;  3D8P A;  4JJX A;  1HHV A;  2FL4 A;  3S15 H;  4LWC A;  2FIA A;  2I79 A;  1IYJ B;  3S6K A;  5C6A A;  2K33 A;  2HT1 A;  4DAM A;  4GOP A;  1N32 Q;  2NYQ A;  3B35 A;  3DR6 A;  2OXP A;  2ZEE A;  1IW7 C;  1AMP A;  3SEB A;  4IPH A;  4CAX A;  1JWS D;  2PJ6 A;  3L2N A;  4CKC A;  1Z2L A;  1S5D D;  3TSS A;  3FKI G;  2F0J A;  3CRK C;  2P0W A;  3LWU A;  3TBI B;  4X65 L;  3HKZ G;  4C3H B;  3CW2 C;  3H0G H;  4KUA A;  1I21 A;  4OID A;  1BUV T;  5IB9 A;  2R93 G;  1U6M A;  1K73 C;  1VHO A;  4CAE A;  3CCU A;  3KF6 B;  2ZEN A;  5IYB H;  3QJY A;  3J81 j;  3CCQ A;  2EZV A;  1HZA A;  4DXG A;  1XMO L;  3D7F A;  5GQO A;  1LT5 D;  1STY A;  1G8Z D;  1KWM A;  2Q44 A;  3SHL A;  3PB6 X;  1CKM A;  4KK7 A;  3BVG A;  1II3 A;  1BCP D;  1IYL A;  3DR8 A;  1MD2 D;  2OB0 A;  1YQE A;  3N7Z A;  4MI4 A;  4IUU A;  2E2J B;  3D7D A;  1A2U A;  2E5L L;  4X62 L;  3EA6 A;  1SYF A;  1HUN A;  4YFJ A;  4DV7 Q;  1LTA D;  3D4W A;  4GZY C;  2OU2 A;  1D7Q A;  3MRU A;  4P4J A;  3IEH A;  4RCO A;  2VZZ A;  1OO9 B;  3J80 E;  2OTL A;  2L1B A;  2HDL A;  4BA2 I;  1LYL A;  1K8M A;  3U4Z A;  4A3F G;  3OW7 A;  4BA1 I;  1XTC D;  1LCP A;  5HXD A;  1XNQ L;  3J7Z C;  3HKS A;  2J8M A;  4A3M B;  4JI5 L;  1I94 Q;  1E24 A;  2D4O A;  1KNA A;  4UP9 A;  3VR3 A;  1K0S A;  5FK9 C;  4C7H A;  1A0I A;  1XMQ L;  3I56 A;  1Y1W H;  1N33 Q;  1HNZ L;  4ME3 A;  1Q12 A;  4OC0 A;  4MMO A;  1ELL P;  4NGN A;  4IHM A;  5AG5 A;  4R4O A;  5I9P A;  2B4D B;  2DY7 A;  4JI3 L;  5M5W H;  4YWY A;  4LF8 L;  1B9N A;  4E2A A;  5LYF A;  3B7I A;  2BE5 D;  2PNH A;  4FO2 A;  3I72 A;  1X54 A;  4Z9C B;  2ATW A;  1O7I A;  2NSM A;  3H8E A;  5IB0 A;  4QB4 A;  1JWQ A;  1HUM A;  3OIQ A;  3HLP A;  3KBG A;  4QCL A;  1WTR A;  5F46 A;  3E9H A;  2NTS A;  4OHJ A;  4KOX A;  1ICW A;  4R7M A;  4A3L G;  4KD4 A;  1Q2Y A;  3OMC A;  3GB0 A;  3W2D A;  3NTK A;  2XEI A;  4OC5 A;  2BCO A;  1EWC A;  1A2Z A;  4CJ0 B;  1HNX L;  1N34 Q;  3UY5 A;  5K36 G;  5T1I A;  1EYD A;  4CHT B;  5JEA J;  2B3V A;  4CKE A;  2NZ1 D;  7CPA A;  1N9W A;  2DPT A;  3J81 i;  4KI0 A;  1CA6 A;  3HUV A;  4B3T L;  2NVX B;  3PFE A;  4FDB A;  1TWA B;  1IBL L;  1MJC A;  5J3B A;  3S9N A;  4X64 L;  3I73 A;  4F9V A;  5C4J H;  1U0L A;  3V8I A;  1VHE A;  2JBJ A;  3CCS A;  2R92 B;  3J81 L;  2FT0 A;  2RSO A;  3CCV A;  3K7A H;  2ALY B;  1V9P A;  1PH7 A;  1IID A;  5I6Y A;  3KJP A;  1CP6 A;  3IU1 A;  3NH4 A;  2ZEM A;  5JPM C;  2I5H A;  2Z6K A;  5A2Q L;  3F2C A;  1SMX A;  1D5Z C;  4PQA A;  1TXY A;  2Q8R E;  4IAL A;  1PA6 A;  3F2U A;  4FF1 A;  2L12 A;  2SEB D;  4JXQ A;  3FMC A;  4BBH A;  4BD9 A;  5J22 A;  1EY8 A;  2EDG A;  2D0P A;  1GD7 A;  4M6G A;  3NHH A;  2Q04 A;  4HSV A;  4FF2 A;  4GKJ L;  3B3V A;  4B5P B;  3Q23 A;  3FRM A;  1EQV A;  5CMD A;  4OKO A;  2IT1 A;  2PJ0 A;  4UCP A;  1C4Q A;  3KF6 A;  4JXR A;  3CCE A;  4HIO A;  1XPO A;  2A4N A;  1SJE D;  5AG7 A;  4EQN A;  3QWN A;  1SJH D;  1O7Z A;  3SVM A;  2KEN A;  1IZ6 A;  4MRI A;  4ZY2 A;  2EBJ A;  1JQG A;  2GLJ A;  2F0E A;  1BPN A;  3S1R H;  2F0N A;  3A0J A;  5EQ0 A;  1AE2 A;  4B9X A;  5JVG 3;  3TO7 A;  1EIF A;  1BOS A;  3D4R A;  4PSX A;  2EK9 A;  2NVT B;  1O7L A;  4YY3 Q;  1S40 A;  4F0X A;  2JN4 A;  4XNH B;  2B3G A;  1VGY A;  1K3R A;  1LV9 A;  1TT2 A;  3KJO A;  5D65 A;  1VQ9 A;  1VQK A;  1VQL A;  4A3B H;  5JEA H;  4ORF A;  1CQV A;  4C56 C;  2CH4 W;  4QMG A;  4C3H G;  1B70 B;  4X3R A;  4MHE A;  1ZXT A;  1VIX A;  2N8N A;  4KHV A;  2K05 A;  1XJO A;  5ISR A;  5M5X H;  3RN5 A;  2J4X A;  5KTD A;  2QCP X;  4BY1 H;  1WVL A;  2K5H A;  1PUA A;  2JDD A;  2JA9 A;  3NWS A;  3E9I A;  2H4O A;  1IL8 A;  2UXC L;  3K5O A;  2QDB A;  2IPK D;  3RD4 A;  2B4D A;  2R98 A;  3WC6 A;  4KVO E;  3K5M A;  3GIU A;  4DV0 L;  4QY7 A;  2Z3K A;  2JLM A;  3KLW A;  3HS0 C;  4BS9 A;  2PJ2 A;  2ZXR A;  4ILW A;  1F2Z A;  2ZT9 C;  1XRY A;  2Z4H A;  2E76 C;  4K3N A;  4PQX A;  1MJB A;  3W3A A;  4DV5 Q;  2WP8 J;  2EJF C;  2KQ3 A;  4MHP A;  1CJW A;  1Y8O B;  1L1O A;  2WB1 B;  1UE1 A;  1MBY A;  5H1S E;  4IAV A;  1AW7 A;  5E1F A;  1J8I A;  1S7K A;  4P4D A;  5EGT A;  2HCI A;  4A3M G;  3PO3 B;  1GUO A;  4R3L A;  4ZX9 A;  3M4Q A;  1VF5 C;  3HOU B;  2GA4 B;  4B12 A;  2R7Z H;  2BEI A;  4DV3 Q;  3K81 C;  3RR5 A;  3GDE A;  1VQG A;  2EVN A;  4NSQ A;  1QQ9 A;  3RN2 A;  2JA8 B;  1QVF A;  3NE7 A;  3P20 A;  1Y7R A;  2I07 B;  3SJF A;  2A74 C;  3FIX A;  3CU7 A;  4TVA B;  3K5L A;  1MJE A;  1XWE A;  5ELN A;  5G21 A;  3KAS A;  4V0B A;  4F88 A;  2JQO A;  2ZJQ A;  2PVW A;  4NKL A;  4MXU A;  1PRT C;  1KHI A;  1UFH A;  1EZ8 A;  4P2C B;  2V1C C;  4UWJ A;  3KLR A;  4ZBG A;  1GJX A;  3DWA A;  3GV6 A;  4DNR B;  1EIY B;  1L0C A;  2VQY A;  1TKW B;  1SYC A;  2V8G A;  2YTX A;  4X8I A;  4F8M A;  1VQH A;  2Q8T A;  2QA4 A;  3WR7 A;  3W5O A;  1CUK A;  5AJ3 L;  4BBR H;  1ARL A;  2F0W A;  3K5N A;  5K5P A;  2REF A;  2EOT A;  4A94 A;  4B5P A;  2R7F A;  1BBU A;  3TOB A;  2Z3P A;  4JWP A;  2ES2 A;  1WD0 A;  1TWF B;  3QB8 A;  4K5V A;  1SQH A;  1IIC A;  3M7N A;  3J7A F;  3F5B A;  3TX8 A;  2R92 G;  1ENA A;  1I4P A;  3PGP A;  5LRK A;  1WTW A;  4HNY B;  3UE0 A;  4ZRZ A;  3C1E A;  1WCM B;  3DUZ A;  3SGI A;  1IYU A;  2WKC A;  3J81 c;  3GTJ H;  4G7Z C;  1UEB A;  2QEC A;  2K6A A;  1Y9K A;  1ET6 A;  4RGT A;  4LQ6 A;  1BAV A;  5AG4 A;  2B58 A;  2FSR A;  5TSS A;  3TE4 A;  1SMY D;  3DMU A;  4K0K L;  5JM6 A;  2PJ8 A;  3VWD A;  3PUX A;  4OEL B;  4R76 A;  3IWW A;  2RFH A;  2V8H A;  1BVS A;  1VQN A;  1IBK Q;  4Y52 H;  1P16 A;  2NMT A;  5CYU A;  1YW6 A;  3GTP B;  3FPU B;  3A8I E;  2XEF A;  2JEA I;  3KUP A;  1TWG B;  3F1Z A;  4DNC A;  4DV2 Q;  5FKA C;  4A3K H;  1X65 A;  4AQY Q;  2J0T D;  4S3S A;  3T13 A;  4JI6 Q;  4JVZ A;  4XQN A;  3FVQ A;  4CRY B;  2F0T A;  3EQL C;  4GLV B;  4X3U A;  1PH8 A;  1TF8 A;  4RHS A;  1IYV A;  1P8L A;  3D0F A;  1YBY A;  5BR8 L;  4DR2 L;  4HSP A;  1F77 A;  2KJX A;  4IJL A;  4KOS A;  2QIL A;  4KD3 A;  1X3Q A;  2PMZ B;  4IUP A;  4QF4 A;  4K6L A;  2WFW A;  4YIJ A;  4BBS B;  1M1D A;  8CPA A;  3OHX C;  4ZCK A;  2K75 A;  2WAC A;  5FLM H;  3R2I A;  3TQY A;  3Q22 A;  3BI1 A;  2VUM H;  1OBR A;  2VL1 A;  4CDC C;  2ZXO A;  1Q86 C;  3JTK A;  1O7Y A;  2B29 A;  2HCC A;  5IT9 E;  4U9Z A;  4UFW A;  5LYL A;  5FO7 B;  4J8Q A;  4JI1 L;  4A37 A;  1D5M C;  2C6C A;  4KN4 C;  4DAP A;  3S16 H;  3J7A V;  4C7I A;  3Q8D A;  1WK4 A;  2OF1 A;  4M6I A;  1PRT B;  3J7A 5;  5G3L F;  3VR6 A;  2WYR A;  1V43 A;  2B2W C;  5CNP A;  2A6H D;  2H5X A;  5IWA Q;  3CDX A;  1XYI A;  4ZY1 A;  2BDO A;  3CXQ A;  1N36 L;  1QMU A;  2IJZ A;  4H2K A;  1CKN A;  4MN3 A;  2FHT A;  1EY6 A;  1SEB D;  3RLO A;  1IOI A;  1STH A;  4RWS C;  1EFW A;  1PH3 A;  3S1M B;  3FH4 A;  1S5B D;  1LTI D;  3MXN B;  4JI8 L;  3ZJY C;  2CQA A;  1G2S A;  4KJN A;  2E74 C;  4NXN Q;  3CPX A;  2YNE A;  4OXP A;  3JAM i;  2L55 A;  2PJ1 A;  1K9M C;  2ICI A;  4C3I H;  4ZYQ A;  2KCT A;  4QC6 A;  1R9T H;  1R4P B;  1PFM A;  1DOK A;  2UU9 L;  4BY7 B;  3DWP A;  3OWC A;  2WB1 G;  4LAA A;  5JQ4 A;  4ALP A;  3JAM L;  2YNC C;  5HY6 A;  1BF4 A;  4CYN A;  2A68 D;  1PH4 A;  3NPP A;  3PO3 G;  1LAC A;  2NZH A;  2CQO A;  3HOU G;  1YLO A;  4GOP C;  2RDH A;  4Q36 A;  5H84 A;  4QVT A;  4XXE A;  3MXU A;  2WAQ E;  3TP6 A;  3S1N B;  3K6O A;  3BXM A;  1KRS A;  2EWB A;  2P6E A;  5BN3 A;  1S60 A;  3GQB A;  3RNZ A;  2JA8 G;  4JLY A;  5LRJ A;  1YJW A;  2I5M X;  1BXT A;  2CW0 C;  1JJC B;  2PZW A;  3T1Y Q;  3FB3 A;  4G7H C;  2M9V A;  3A5U A;  4OWX B;  4LFA Q;  5IE8 A;  3LGJ A;  4LF9 Q;  2Q7B A;  3TRE A;  2VQE L;  4DR3 L;  3SK6 A;  3UDG A;  1LAN A;  4M85 A;  5I2Y A;  3FHW A;  3C2P A;  5CR3 A;  1QWY A;  3IGR A;  5KYI A;  2PIY A;  3KQX A;  4ZUI A;  3S1Q B;  1SYG A;  3EN2 A;  5G1Z A;  4NGP A;  2A6E C;  1FJG Q;  2B2V A;  2NN6 H;  3RZO B;  3CPW A;  2PJ9 A;  3A54 A;  4DKA C;  3JRU A;  3GTO H;  1CFM A;  1CP7 A;  3PP9 A;  2UXD L;  2JXM B;  5KGU A;  5C0X I;  2WSA A;  2FXF A;  3DLL A;  4EX5 A;  1VQB A;  1Y0Y A;  4KVM E;  3HOY B;  1DOL A;  5A2Q E;  2O2L D;  1Y8P B;  4B3S Q;  2FIN B;  1BLL E;  5CV4 A;  3I4N B;  5KTC A;  5JGF A;  2K04 A;  1ICF B;  1CKO A;  5EBD A;  5BWA B;  2RC4 A;  2PQA B;  4KOV A;  1MK4 A;  1A6X A;  3HOV B;  1LTT D;  4DUZ Q;  4JI4 Q;  5CV9 A;  3P75 A;  3S6F A;  1SFO B;  1WCM G;  3SK5 A;  1TWH H;  4ZKC B;  3CF5 A;  2UUA Q;  2E2H B;  4E6I A;  1Z5R A;  2PJB A;  2Z3L A;  2DUD A;  2TMP A;  3KOJ A;  3D6W A;  1DYQ A;  1PCA A;  1A15 A;  4I49 A;  1EU3 A;  1Y1V B;  3IFE A;  4PMB A;  2ZOG A;  1TS3 A;  3QR8 A;  3S2D B;  2AFU A;  5C4H A;  1EE3 P;  4X3K A;  3FED A;  1U9R A;  3AEV A;  3UE1 A;  4EFD A;  3VA7 A;  4KS9 A;  2K7V A;  1VCI A;  4NP5 A;  4LUZ A;  1I6H B;  4FP5 D;  4AVC A;  3T9Y A;  3A9L A;  2LXK A;  4IPG A;  3BYY B;  4JI7 Q;  1AUG A;  1V1Q A;  1GHE A;  4DNI A;  2CKZ B;  1VQ4 A;  3IC1 A;  2JA7 B;  3ERS X;  2B2T C;  4UAI A;  2PR1 A;  2AFM A;  2VZY A;  4N8F A;  1HFG A;  3G71 A;  3L9A X;  2ZEF A;  5K8O A;  2KCC A;  3TN2 A;  1OXX K;  1PLF A;  4LF7 Q;  4HMI A;  3K9T A;  3B6Y A;  2D2C C;  3CQZ H;  3BDC A;  3GTG H;  3MXN A;  2ZJP A;  3KYH C;  4BBS G;  1GYT A;  3VYU A;  1H9K A;  4IO9 A;  3PF4 A;  2Q2T A;  1PTO B;  1Z4E A;  4DGZ A;  2HD3 A;  1CM9 A;  2K5V A;  3R95 A;  2AFO A;  3MTS A;  1UE7 A;  2JYO A;  2AQ2 B;  3T53 B;  4DR1 Q;  3E3X A;  4R9W A;  5LYD A;  3TS0 A;  3CC4 A;  1NBW A;  1RCV D;  4UIB A;  1S3O A;  5F47 A;  4NB3 A;  2JA6 B;  4DUY L;  1I50 H;  2XRS D;  5E4W C;  2VQF Q;  3BZD B;  1EEI D;  2CW0 D;  1CT1 D;  5EPJ A;  1AYE A;  2JP1 A;  4OX9 Q;  1Q8I A;  4IUN A;  4DR6 L;  1KUX A;  3OTO Q;  3NFZ A;  1H9J A;  3HEJ A;  3CXC A;  3KKW A;  3I90 A;  1BCP C;  1EFI D;  2XN9 C;  1STE A;  3IFD A;  5D14 A;  4A4I A;  1LAM A;  5IYC G;  2MQH A;  4DF7 A;  2QML A;  3TTH A;  2JBK A;  2C1C A;  1NMG A;  1M4L A;  2E2I B;  4GNX C;  3RBU A;  1CSQ A;  1JMC A;  1YZ6 A;  2VI7 A;  1NY4 A;  4K5W A;  3P1H A;  2B39 A;  4NXM Q;  4RMF A;  4DV7 L;  3H91 A;  1KDC A;  2ID0 A;  1E2V A;  4U67 3;  4P4B A;  1SAP A;  2MPM A;  1STA A;  5J8C A;  4BY7 G;  1EY0 A;  2AFS A;  1IOF A;  1HNW Q;  4B6Z A;  1FD7 D;  3RZD H;  5DM6 3;  3BJ8 A;  1V0C A;  3BHX A;  3NQT A;  5M3M H;  5A35 A;  3B3C A;  5C0X G;  1FNU A;  2IHF A;  2CWA A;  3QO2 A;  2YGW A;  1BO4 A;  4KZT A;  3JAM c;  2GRE A;  2ZPA A;  3VAT A;  2B2U C;  4ONU A;  1Y8N B;  5IY0 A;  2UUC Q;  2BE5 C;  2ZTC A;  4GM5 A;  2HUG A;  3KDF B;  5GRO A;  4C3J B;  4A3I B;  3FJU A;  1VQI A;  4YWM A;  1Q3L A;  2JSO A;  5DM7 3;  4CBV A;  2XEJ A;  3TZU A;  2QGQ A;  3T8W A;  2YU9 B;  3TME A;  1K4J A;  1GHJ A;  4B10 A;  2X7B A;  2AUK A;  5JH9 A;  4M6H A;  1YIT A;  1MGS A;  3KF8 B;  1X3F A;  4H02 A;  2Q4V A;  3FF3 A;  4OIK A;  4RKB A;  5CV7 A;  1S7N A;  2SNS A;  1Z8T A;  2OOT A;  1HDU A;  1MHW C;  4CAW A;  1NSA A;  2J7Z A;  1N34 L;  1B4O A;  4EQ5 A;  1A8V A;  3DSB A;  2JEV A;  4F8Z A;  3PCO B;  3IAY A;  4LUA A;  1KAW A;  1RKN A;  2QF7 A;  5THW A;  3S17 H;  1E1O A;  3NBH A;  2GIV A;  3BDL A;  5GAE C;  3SK4 A;  5LL6 X;  1NNX A;  3HOY G;  4KY6 A;  5M3F B;  2A8V A;  4HCS A;  3FKI H;  3LOD A;  1ZG9 A;  4LQG A;  1DM0 B;  4L5Q A;  3F2D A;  1EWI A;  3IFT A;  4RS2 A;  3TEH B;  4BWG B;  4PXD A;  4ZK9 B;  4LF4 Q;  2R93 H;  1L1O C;  4IUV A;  2L4N A;  2G3T A;  2ZXP A;  1B3A A;  4HNX B;  2X6G A;  3HOV G;  3R93 A;  5KNC A;  1R4Q B;  3W1G A;  1I6V C;  1GXD C;  4HID A;  3ZZI A;  3PUZ A;  3FX6 A;  2IL8 A;  2KHS A;  1K8G A;  1TWC H;  3C1F A;  2CF4 A;  2XRQ D;  2CVR A;  1GHK A;  3TS2 A;  4Y7N H;  3H15 A;  4PK2 A;  3DLJ A;  3SI0 A;  3SJX A;  2E2D C;  2X6L A;  2PNR C;  1Y1V G;  1U5K A;  2SOB A;  1RIP A;  4CPA A;  1H9M A;  2DJF C;  4M8A A;  5AG6 A;  5HUR A;  1VQ5 A;  2OZU A;  2E