4A2ZA

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a pyrazole sulphonamide ligand
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of a novel class of orally active trypanocidal N-myristoyltransferase inhibitors.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 120
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4a2zA00
4UCMA 5AG7A 4B13A 4CAEA 5A27A 4C2YA 5A28A 2YNEA 4C2XA 4UFXA 4C68A 4CAFA 5G1ZA 3H5ZA 5AG6A 5G20A 2WSAA 4CYPA 3IU1A 2YNCC 4A33A 2WUUA 3IWEA 4CGOA 4CYOA 4BBHA 5AG5A 3IU2A 2YNDA 4B11A 4CYNA 4UCNA 4UCPA 4A32A 4CGMA 4CYQA 5G21A 5AGEA 4CGNA 5AG4A 4CGPA 4UFWA 3JTKA 5G22A 4B10A 4B14A 4CGLA 4A2ZA 4C7IA 4B12A 4C2ZA 4A31A 4A30A 4UFVA 4A95A 4C7HA 2YNCA
chains in the Genus database with same CATH superfamily
1LRZA 1VHSA 1XFOA 3QAYA 2ZEMA 3MGDA 4H2KA 4R57A 4K3NA 4TNUA 3TO7A 1VHOA 5F09A 1Y0YA 1TIQA 3D7FA 4OKOA 3KKWA 1FT7A 3VARA 4KUBA 1XE4A 2R1IA 3SXNA 1TF9A 2CF4A 3FYNA 1R3NA 2I3CA 3B3TA 2ZXVA 2BSWA 3IJ3A 3EO4A 3B35A 3QAHA 3CPAA 1ZLHA 3D3SA 2G3TA 3ZJ0A 2F7VA 3PB4X 4MY0A 4CGLA 2PJ3A 2EK8A 3N5FA 2VEZA 2Z3OA 4FWUA 5EMIA 3RZAA 2D4OA 4H6ZA 2CTCA 2Z10A 4JYWA 3CZXA 3D7HA 3DR6A 4ONUA 3UY5A 3KQXA 2HQYA 2B58A 4PXBA 4CS0B 4P4IA 1YSJA 2Q0YA 2ZPAA 4C68A 4CRYB 5K8NA 3RNZA 5EBVA 1IU8A 1YLEA 2OR4A 4OIDA 4Z65A 4P4DA 3PP9A 4P10A 2QYVA 2Q4VA 1Y9KA 2Y0MA 3D68A 3PRTA 5LYIA 3P2FA 1OZPA 1M4LA 1B6BA 2RFHA 1Z4RA 1BO4A 3BJ7A 2ARHA 2I00A 3BLNA 2PE3A 5J8CA 4RUHA 4B14A 5LYFA 3QNVA 3H4QA 3LODA 3LD2A 4KOWA 2X7BA 3N7ZA 5KTDA 2O53A 2Z0ZA 5F47A 3S9LA 4P6YA 5H84A 3PB9X 1PUAA 3FX6A 4KOXA 4OC1A 1SQHA 4PV6A 3S9MA 2AFXA 3I3GA 4XPDC 2GE3A 2A4NA 3W6SA 2B3UA 3GY9A 4MHDA 3R9GA 3KQZA 2PQ8A 4AB7A 4YGOA 3EXNA 5LRJA 1BPNA 3RYOA 2PR1A 3NE7A 4NGRA 1Z8LA 1Z8TA 4LQ6A 4MHZA 4MXUA 2JLMA 4MJ8A 2O4HA 4ZGYB 3MN8A 4CGPA 4F9VA 4CAXA 5LRGA 3GUXA 2PJ5A 4BINA 3KASA 2AE6A 4HNWB 2Q44A 1LCPA 1YMEA 2PDOA 3WC7A 4MFJA 4MFLA 4UF4A 4A95A 4QBJA 1ARLA 2PJ7A 3NH8A 2VQYA 1TF8A 1GYTA 2EVNA 3JUWA 2PJBA 4OC3A 5A28A 3SXOA 4C2XA 2REEA 2PR8A 4P4BA 3FVLA 4AVBA 3TO9A 4NGNA 2CTBA 1RTQA 4TWEA 3FMCA 4UWIA 5CBMA 4DNCA 1YQEA 2C6PA 4OMEA 8CPAA 5FVJA 5AG5A 1CPSA 1X12A 2QECA 4F0YA 2P0WA 1M1DA 2DXQA 4CYQA 1XEBA 2JBKA 5F49A 2AFUA 4I49A 5K8MA 2RC4A 5LRKA 1QMUA 2VXKA 4M3SA 2CNSA 3NA6A 3KGQA 4XPLA 2BUEA 1YR0A 3FF3A 4UCMA 1YVKA 1I1DA 2G3AA 4NCZA 1UWYA 3SI1A 1S7KA 2F8HA 1XIXA 2PRQA 3IGRA 4ZBGA 4P4EA 5CPAA 3H8EA 1ZG7A 2CIJA 3IWEA 4GXHA 1XBUA 2YNDA 4AVCA 1S60A 2IQ6A 1KZFA 3DLJA 4UCPA 1MJ9A 5K8PA 2J8RA 3NE8A 2OZHA 5ELYA 4HNYB 5KTCA 3JVNA 3PBEA 4KOVA 2G0BA 4MY3A 3FXTA 4YFJA 3SJFA 1Y7RA 1ELLP 3SJEA 1QSRA 2HUZA 2OB0A 3QB8A 4X8IA 4EMEA 5HVFA 1DE4C 2BL1A 3CXSA 1Z8WA 1VGYA 3VWEA 1N71A 2YGWA 1WWZA 3E0KA 3ISXA 4IHMA 4LX9A 1KWMA 4MFQA 2G9DA 1L0CA 4FD6A 1MK4A 3OWCA 1BPMA 4KLWA 1FY7A 1NSAA 2GLFA 4FD4A 4KUAA 2WUUA 1A2ZA 2HV2A 3RAMA 3IU2A 2FXFA 4OC0A 4AXVA 5F48A 3R9FA 3D8PA 4LUAA 3TE4A 2EO8A 4UWJA 1S7FA 2EBJA 1R43A 1M4IA 3D4UA 4ORFA 4C7IA 5J1QA 2OZUA 4C2ZA 2FS5A 2XEFA 1AMPA 1K4JA 1XMBA 3BJ8A 3D2PA 1IYKA 3GKRA 1PCAA 4ZX9A 4BMHA 4CYNA 2Q4ZA 3LWUA 2EUIA 2FSRA 4PPZA 1PYTB 1QSTA 3VATA 4A37A 4A94A 4G1PA 2CY2A 1EE3P 4XPDB 2QVPA 4CPAA 3F5BA 3GIUA 3CT9A 5D29A 3T9YA 4CGOA 1VKCA 4P45A 4R3LA 4QVTA 4UCNA 2PIYA 1YW4A 2AFWA 2ZEEA 4IUSA 2Q51A 4QB9A 1V0CA 1XOVA 2WZNA 1M4GA 4KORA 2NSMA 4UIBA 2FIAA 5F46A 3C26A 3SI2A 1Z5RA 2AFMA 4AG7A 3FH4A 4UFVA 4KZTA 3RBUA 4A33A 4C7HA 4FAIA 1UFHA 1XJOA 4BD9A 2QMLA 2O28A 4B5PB 1NMTA 2Z3NA 4B6ZA 4C2YA 4UEEA 2ZEOA 2P6FA 3KHXA 3H8FA 4ZYQA 2IJZA 1TKFA 4R3KA 4MFPA 4P4FA 1CJWA 5HVGA 2Z3MA 4Q38A 3S6GA 4X5KA 5CNPA 4NEXA 2CXAA 4KOSA 4H6UA 4FBEA 2JBJA 4W9YA 1YK3A 1Z4EA 4XNHC 4M6IA 1IICA 2GANA 4A32A 2HB6A 7CPAA 3T90A 1CP6A 2REFA 3CXPA 4OP4A 4XNHB 4UBRA 3DR8A 5DS0A 3SHPA 1IOIA 2GIVA 3TC8A 5IB0A 5JGFA 1CPXA 2Q43A 3PFOA 3V38A 4CRZB 1MJBA 2PJ1A 3KI9A 3K2KA 2PJAA 4U9YA 2ABZA 1Q2DA 2VL1A 4L8AA 2GLJA 4CAEA 2KCWA 2OU2A 4NFRA 2I79A 5HMNA 3CXQA 2OZGA 3FEDA 4WWVA 5LYDA 1ZG8A 4NSQA 2ODFA 2VZZA 1S7NA 4GM5A 3EC4A 1DTDA 2VZYA 1QSOA 3TOAA 1RO5A 3G8WA 2BCOA 3FIXA 3PBBA 1IYLA 4E0AA 2GREA 1B87A 2DF5A 3NH5A 3EFAA 3HUVA 4ONWA 3WABA 5HH1A 3S9NA 2PJ8A 3PGPA 1NSLA 5G21A 1LAPA 3D7DA 1Q2YA 2C6GA 2PCUA 5K8OA 1HDQA 4IK2A 2P6GA 2EK9A 4GS4A 3RO0A 1F2PA 2VBQA 2WYRA 2B4DA 4J3GA 1Z9UA 1ELMP 1S3ZA 1ZO0A 2DPSA 1Y0RA 2B4BA 2ZEPA 4YWYA 4M85A 1J4JA 3BI0A 5AG7A 2FCKA 5JM6A 4FD7A 3D2MA 4B5PA 2YNEA 4UFXA 3WC6A 5DWMA 1YX0A 4MFZA 3FRMA 4JLYA 5AG6A 3VH9A 5HXDA 2R8VA 1S7LA 3PZJA 3I9SA 3TOBA 3TT2A 4Q7AA 3W6XA 4O23A 2ZEDA 3I1UA 2Q7BA 4E2AA 2VI7A 3S6FA 1X10A 3PB6X 4OC4A 3B8GA 4PK3A 4KOYA 2D4PA 3KR4A 4EFDA 1IGBA 2BEIA 2QIRA 4YU9A 1Z8XA 3GB0A 3R96A 3JRUA 1CX8A 2ZENA 5IV0A 1TXRA 1JWQA 4FUUA 4AVAA 2DPTA 2H5MA 1I12A 1BOBA 2R7HA 4MHYA 3TFYA 2PRBA 4K30A 5D8NA 3FNCA 1CP7A 1QSMA 2GU2A 4FD5A 5DWNA 2OOTA 4B13A 4HNXB 1KUYA 1TKJA 2IL4A 2ZEFA 5ISVA 1Q2CA 2PVVA 1M44A 3B3WA 4UA3A 1VHEA 5G1ZA 2JEVA 4R6TA 1IB1E 3D7GA 4U9ZA 4NGSA 2J8NA 1BLLE 4Q36A 3IWGA 3MRUA 2NYQA 2B4DB 4IAVA 4U5YA 4BBHA 2V8VA 4MMOA 4NXYA 2C27A 4UEZA 4JWPA 4WJBA 3B3CA 4JJXA 4NJQA 6CPAA 2B5GA 3WR7A 4UFWA 2P6EA 2J8MA 2PC1A 5KTAA 4B12A 1QQ9A 3B3VA 1AUGA 3FBUA 3DSBA 2JEWA 4JXQA 5HVHA 4QUSA 2V8GA 1IY7A 2ZW4A 2C6CA 4MCSA 5IB9A 2CNMA 5JPHA 3DNSA 4HPSA 4OADA 3SJXA 5G20A 1ZG9A 2AFSA 4NJRA 5J8FA 1F2OA 3IU1A 1LFWA 2YNCC 3CPXA 2WPXA 1MJAA 3ZZIA 3KL9A 1M4DA 2XEJA 4MFKA 4R76A 2HC9A 3S6KA 3VWDA 4ZY2A 4DYOA 5JH9A 5JQ4A 3TX8A 4CGMA 3G3SA 2JDDA 4MRIA 4IF5A 4MCPA 3TO6A 4PK2A 3DGVA 4CAVA 2RB7A 3JTKA 1HDUA 2PJ2A 3KR5A 1Y7EA 4PXEA 4XPKA 5G22A 2V8HA 3FECA 3K9TA 1P0HA 3IO1A 4ZY0A 1ZLIA 4YRHA 3IC1A 2BOAA 3H8GA 3D66A 1YGHA 4R7MA 4KOTA 4Y49C 4KVOE 4R87A 2QJ8A 2AJ6A 3IFEA 2Q04A 3GYAA 4OC2A 3TTHA 5GCNA 1WK4A 4AG9A 4RN7A 2AFZA 2V77A 3EY5A 3BHXA 4KSAA 1NE9A 2R98A 4ZX8A 4L89A 1BAVA 4OLLA 4CAWA 1JQGA 4NGMA 3V7ZA 3A9LA 3PFEA 2JDCA 5C88A 4MHNA 2Z11A 3B3SA 3LACA 4R8FA 4MHPA 2WPWA 4B10A 2PVWA 1LAMA 4OIWA 2Z3LA 1YW6A 4KSFA 2Z3PA 2V8DA 2IMOA 4PSXA 1HEEA 1CM0A 3K9UA 2YNCA 3FB3A 4F9UA 5I0CA 2ZEGA 4KLVA 4PXCA 1XRYA 2CNTA 2DEAA 4F8ZA 4M6GA 2WSAA 4RI1A 2XEIA 1IOFA 1AYEA 3BXMA 3D67A 3PEIA 3IIBA 2POKA 3KHZA 2PJ0A 2ZEHA 4DUKA 2PJ4A 3GLJA 1XF8A 4JZ0A 2C1CA 2F5IA 2PSWA 3PB7X 5IX3A 3F0AA 4F0XA 2NMTA 2B3VA 2XEGA 2FVGA 4MCRA 4Y49B 1LOKA 4P4JA 2PJ9A 3IEHA 4A39A 4DJLA 4H89A 4A31A 4B5OA 4E8OA 5BWAB 2BO9A 1XMTA 4KS9A 2ZW7A 5H86A 5A27A 2ATRA 3KZWA 4EWTA 3SI0A 5E96A 4X2TA 3H5ZA 4QC6A 4CYPA 4ZI6A 1F57A 1IIDA 3PB8X 1YREA 1RXTA 1CBXA 1FNOA 3WT4A 2ZOFA 1QSNA 3R95A 4RS2A 4JXRA 1Z2LA 4KVXA 4B11A 1KUVA 4LQGA 4M6HA 2EWBA 3P2HA 1P4NA 4CGNA 1R57A 1S5KA 4EVYA 1KUXA 3ISZA 2FIWA 4KSIA 4UIAA 2OH1A 2PIZA 5I4MA 2FE7A 1PU9A 1ON0A 2FT0A 3LMSA 4OC5A 5LYLA 3L2NA 2ZW6A 1Q7LA 4OAEA 1YVOA 2ANPA 1OBRA 3R9EA 3V8IA 1TKHA 4A38A 3HLPA 3TCVA 3SJGA 1I21A 4CAFA 2FL4A 4MBUA 2AFOA 1VIXA 1Y9WA 1ARMA 3T8WA 2B5GB 2Q7SA 3B7IA 3R1KA 2Q4YA 4JD6A 3B2YA 4NGTA 4MI4A 4PSWA 4F6AA 3NH4A 4HKFA 2K5TA 3CDXA 4UEFA 4KVME 4CYOA 3DDDA 2GFQA 1CG2A 2ZOGA 1LANA 3FEEA 3IWWA 3WC5A 3F8KA 2ZW5A 3W91A 5AGEA 5AG4A 1H8LA 2J9AA 5THWA 5EC4A 1GHEA 1U6MA 3FJUA 4P44A 4NF1A 5C82A 4II9A 1YLOA 4KOUA 3S6HA 4A2ZA 4PXDA 2ZELA 3BI1A 4NGPA 2PJ6A 4R9MA 2Z3KA 3NFZA 4PQAA 2PJCA 4A30A 4NGQA 4ZY1A 4X3RA 4MCQA
chains in the Genus database with same CATH topology
1LRZA 1VHSA 3MGDA 4R57A 3TO7A 1TIQA 3KKWA 4KUBA 1XE4A 2R1IA 3SXNA 3FYNA 2ZXVA 2BSWA 3EO4A 3QAHA 3D3SA 2G3TA 3ZJ0A 4MY0A 4CGLA 2VEZA 2Z3OA 2D4OA 4H6ZA 4ONUA 2Z10A 3DR6A 3UY5A 2HQYA 2B58A 4CS0B 2Q0YA 2ZPAA 4C68A 4CRYB 5EBVA 1YLEA 3PP9A 2Q4VA 1Y9KA 2Y0MA 3P2FA 1OZPA 1B6BA 1Z4RA 1BO4A 3BJ7A 2ARHA 2I00A 3BLNA 5J8CA 4B14A 3H4QA 3LODA 4KOWA 3LD2A 3N7ZA 2X7BA 5KTDA 2Z0ZA 5F47A 5H84A 1PUAA 4KOXA 1SQHA 4PV6A 3I3GA 4XPDC 2GE3A 2A4NA 3W6SA 2B3UA 3GY9A 4MHDA 3R9GA 2PQ8A 4AB7A 4YGOA 3EXNA 3RYOA 2PR1A 3NE7A 2JLMA 4MJ8A 4ZGYB 4CGPA 4CAXA 2AE6A 4HNWB 2Q44A 2PDOA 4MFJA 4MFLA 4A95A 4QBJA 2VQYA 2EVNA 3JUWA 5A28A 3SXOA 4C2XA 2REEA 2PR8A 4AVBA 3TO9A 4UWIA 4DNCA 5FVJA 5AG5A 2QECA 4F0YA 2P0WA 1M1DA 2DXQA 4CYQA 1XEBA 5F49A 4I49A 2RC4A 2VXKA 4M3SA 2CNSA 4XPLA 2BUEA 1YR0A 4UCMA 1YVKA 1I1DA 2G3AA 4NCZA 1S7KA 1XIXA 3IGRA 4ZBGA 3IWEA 2YNDA 4AVCA 1S60A 1KZFA 4UCPA 1MJ9A 2J8RA 2OZHA 4HNYB 5KTCA 3JVNA 4KOVA 2G0BA 4MY3A 3FXTA 4YFJA 1Y7RA 1QSRA 2HUZA 2OB0A 3QB8A 2BL1A 3CXSA 3VWEA 1N71A 2YGWA 1WWZA 3E0KA 4LX9A 4MFQA 1L0CA 4FD6A 1MK4A 3OWCA 4KLWA 1FY7A 4FD4A 4KUAA 2WUUA 2HV2A 3IU2A 2FXFA 5F48A 3R9FA 3D8PA 4LUAA 3TE4A 4UWJA 1S7FA 1M4IA 4ORFA 4C7IA 2OZUA 4C2ZA 2FS5A 1K4JA 3D2PA 3BJ8A 3GKRA 1IYKA 4BMHA 4CYNA 2EUIA 2FSRA 1QSTA 2CY2A 4XPDB 3F5BA 4CGOA 3T9YA 1VKCA 4R3LA 4QVTA 4UCNA 4IUSA 4QB9A 1V0CA 1M4GA 4KORA 2FIAA 5F46A 3C26A 4AG7A 4UFVA 4KZTA 4A33A 4C7HA 1UFHA 2QMLA 2O28A 4B5PB 1NMTA 2Z3NA 4C2YA 2P6FA 4R3KA 4MFPA 1CJWA 2Z3MA 4Q38A 3S6GA 4X5KA 5CNPA 4NEXA 2CXAA 4KOSA 4H6UA 1YK3A 1Z4EA 4XNHC 1IICA 2GANA 4A32A 3T90A 2REFA 3CXPA 4XNHB 5JQ4A 4UBRA 3DR8A 3SHPA 5IB0A 2GIVA 4CRZB 1MJBA 4U9YA 1Q2DA 4L8AA 4CAEA 2KCWA 2OU2A 2I79A 5HMNA 3CXQA 2OZGA 4NSQA 2VZZA 1S7NA 3EC4A 2VZYA 3TOAA 1QSOA 1RO5A 3G8WA 3FIXA 4E0AA 1IYLA 1B87A 3EFAA 5HH1A 3PGPA 1NSLA 5G21A 1Q2YA 2P6GA 4GS4A 2VBQA 4J3GA 2B4DA 1Z9UA 1ZO0A 1S3ZA 2DPSA 2B4BA 4M85A 1J4JA 5AG7A 2FCKA 4FD7A 3D2MA 4B5PA 2YNEA 4UFXA 5DWMA 1YX0A 4MFZA 3FRMA 4JLYA 5AG6A 2R8VA 1S7LA 3PZJA 3I9SA 3TOBA 3TT2A 3W6XA 2Q7BA 4E2AA 2VI7A 3S6FA 3B8GA 4PK3A 4KOYA 2D4PA 2BEIA 2QIRA 3R96A 5IV0A 4AVAA 2DPTA 2H5MA 1I12A 1BOBA 2R7HA 3TFYA 2PRBA 4K30A 3FNCA 1QSMA 4FD5A 5DWNA 4B13A 4HNXB 1KUYA 2IL4A 5ISVA 1Q2CA 1M44A 5G1ZA 4UA3A 2JEVA 1IB1E 4U9ZA 2J8NA 4Q36A 3IWGA 2B4DB 4U5YA 4BBHA 4NXYA 2C27A 4JWPA 4JJXA 2B5GA 3WR7A 4UFWA 2P6EA 2J8MA 2PC1A 5KTAA 4B12A 3FBUA 4JXQA 3DSBA 4QUSA 2ZW4A 2CNMA 5JPHA 3DNSA 4OADA 5G20A 5J8FA 3IU1A 2YNCC 2WPXA 1MJAA 3ZZIA 1M4DA 4MFKA 3S6KA 3VWDA 4CGMA 3G3SA 2JDDA 4IF5A 3TO6A 4PK2A 4CAVA 3JTKA 4XPKA 5G22A 1P0HA 4YRHA 1YGHA 4KOTA 4Y49C 4KVOE 4R87A 2AJ6A 3TTHA 2Q04A 3GYAA 5GCNA 1WK4A 4AG9A 3EY5A 4KSAA 1NE9A 2R98A 4L89A 4OLLA 4CAWA 3A9LA 2JDCA 5C88A 2Z11A 2WPWA 4B10A 2Z3LA 4KSFA 2Z3PA 4PSXA 1CM0A 3K9UA 2YNCA 3FB3A 5I0CA 4KLVA 2CNTA 2WSAA 4RI1A 1XF8A 2PSWA 2F5IA 5IX3A 3F0AA 2NMTA 2B3VA 4Y49B 4H89A 4A31A 4B5OA 4E8OA 5BWAB 1XMTA 4KS9A 2ZW7A 5H86A 5A27A 2ATRA 5E96A 3H5ZA 4QC6A 4CYPA 1IIDA 1YREA 1RXTA 1QSNA 3R95A 4RS2A 4JXRA 4KVXA 4B11A 1KUVA 3P2HA 1P4NA 4CGNA 1R57A 1S5KA 4EVYA 1KUXA 2FIWA 2OH1A 2FE7A 1PU9A 1ON0A 2FT0A 2ZW6A 4OAEA 3R9EA 1YVOA 3V8IA 3TCVA 1I21A 4CAFA 2FL4A 4MBUA 1Y9WA 4F0XA 2B5GB 3R1KA 2Q4YA 4JD6A 4PSWA 4MI4A 4F6AA 4HKFA 2K5TA 4KVME 4CYOA 3DDDA 3F8KA 2ZW5A 3W91A 5AGEA 5AG4A 5EC4A 1GHEA 1U6MA 5C82A 4NF1A 4II9A 4KOUA 3S6HA 4A2ZA 4R9MA 2Z3KA 4A30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UCM A;  5AG7 A;  4B13 A;  4CAE A;  5A27 A;  4C2Y A;  5A28 A;  2YNE A;  4C2X A;  4UFX A;  4C68 A;  4CAF A;  5G1Z A;  3H5Z A;  5AG6 A;  5G20 A;  2WSA A;  4CYP A;  3IU1 A;  2YNC C;  4A33 A;  2WUU A;  3IWE A;  4CGO A;  4CYO A;  4BBH A;  5AG5 A;  3IU2 A;  2YND A;  4B11 A;  4CYN A;  4UCN A;  4UCP A;  4A32 A;  4CGM A;  4CYQ A;  5G21 A;  5AGE A;  4CGN A;  5AG4 A;  4CGP A;  4UFW A;  3JTK A;  5G22 A;  4B10 A;  4B14 A;  4CGL A;  4A2Z A;  4C7I A;  4B12 A;  4C2Z A;  4A31 A;  4A30 A;  4UFV A;  4A95 A;  4C7H A;  2YNC A; 
#chains in the Genus database with same CATH topology
 1LRZ A;  1VHS A;  1XFO A;  3QAY A;  2ZEM A;  3MGD A;  4H2K A;  4R57 A;  4K3N A;  4TNU A;  3TO7 A;  1VHO A;  5F09 A;  1Y0Y A;  1TIQ A;  3D7F A;  4OKO A;  3KKW A;  1FT7 A;  3VAR A;  4KUB A;  1XE4 A;  2R1I A;  3SXN A;  1TF9 A;  2CF4 A;  3FYN A;  1R3N A;  2I3C A;  3B3T A;  2ZXV A;  2BSW A;  3IJ3 A;  3EO4 A;  3B35 A;  3QAH A;  3CPA A;  1ZLH A;  3D3S A;  2G3T A;  3ZJ0 A;  2F7V A;  3PB4 X;  4MY0 A;  4CGL A;  2PJ3 A;  2EK8 A;  3N5F A;  2VEZ A;  2Z3O A;  4FWU A;  5EMI A;  3RZA A;  2D4O A;  4H6Z A;  2CTC A;  2Z10 A;  4JYW A;  3CZX A;  3D7H A;  3DR6 A;  4ONU A;  3UY5 A;  3KQX A;  2HQY A;  2B58 A;  4PXB A;  4CS0 B;  4P4I A;  1YSJ A;  2Q0Y A;  2ZPA A;  4C68 A;  4CRY B;  5K8N A;  3RNZ A;  5EBV A;  1IU8 A;  1YLE A;  2OR4 A;  4OID A;  4Z65 A;  4P4D A;  3PP9 A;  4P10 A;  2QYV A;  2Q4V A;  1Y9K A;  2Y0M A;  3D68 A;  3PRT A;  5LYI A;  3P2F A;  1OZP A;  1M4L A;  1B6B A;  2RFH A;  1Z4R A;  1BO4 A;  3BJ7 A;  2ARH A;  2I00 A;  3BLN A;  2PE3 A;  5J8C A;  4RUH A;  4B14 A;  5LYF A;  3QNV A;  3H4Q A;  3LOD A;  3LD2 A;  4KOW A;  2X7B A;  3N7Z A;  5KTD A;  2O53 A;  2Z0Z A;  5F47 A;  3S9L A;  4P6Y A;  5H84 A;  3PB9 X;  1PUA A;  3FX6 A;  4KOX A;  4OC1 A;  1SQH A;  4PV6 A;  3S9M A;  2AFX A;  3I3G A;  4XPD C;  2GE3 A;  2A4N A;  3W6S A;  2B3U A;  3GY9 A;  4MHD A;  3R9G A;  3KQZ A;  2PQ8 A;  4AB7 A;  4YGO A;  3EXN A;  5LRJ A;  1BPN A;  3RYO A;  2PR1 A;  3NE7 A;  4NGR A;  1Z8L A;  1Z8T A;  4LQ6 A;  4MHZ A;  4MXU A;  2JLM A;  4MJ8 A;  2O4H A;  4ZGY B;  3MN8 A;  4CGP A;  4F9V A;  4CAX A;  5LRG A;  3GUX A;  2PJ5 A;  4BIN A;  3KAS A;  2AE6 A;  4HNW B;  2Q44 A;  1LCP A;  1YME A;  2PDO A;  3WC7 A;  4MFJ A;  4MFL A;  4UF4 A;  4A95 A;  4QBJ A;  1ARL A;  2PJ7 A;  3NH8 A;  2VQY A;  1TF8 A;  1GYT A;  2EVN A;  3JUW A;  2PJB A;  4OC3 A;  5A28 A;  3SXO A;  4C2X A;  2REE A;  2PR8 A;  4P4B A;  3FVL A;  4AVB A;  3TO9 A;  4NGN A;  2CTB A;  1RTQ A;  4TWE A;  3FMC A;  4UWI A;  5CBM A;  4DNC A;  1YQE A;  2C6P A;  4OME A;  8CPA A;  5FVJ A;  5AG5 A;  1CPS A;  1X12 A;  2QEC A;  4F0Y A;  2P0W A;  1M1D A;  2DXQ A;  4CYQ A;  1XEB A;  2JBK A;  5F49 A;  2AFU A;  4I49 A;  5K8M A;  2RC4 A;  5LRK A;  1QMU A;  2VXK A;  4M3S A;  2CNS A;  3NA6 A;  3KGQ A;  4XPL A;  2BUE A;  1YR0 A;  3FF3 A;  4UCM A;  1YVK A;  1I1D A;  2G3A A;  4NCZ A;  1UWY A;  3SI1 A;  1S7K A;  2F8H A;  1XIX A;  2PRQ A;  3IGR A;  4ZBG A;  4P4E A;  5CPA A;  3H8E A;  1ZG7 A;  2CIJ A;  3IWE A;  4GXH A;  1XBU A;  2YND A;  4AVC A;  1S60 A;  2IQ6 A;  1KZF A;  3DLJ A;  4UCP A;  1MJ9 A;  5K8P A;  2J8R A;  3NE8 A;  2OZH A;  5ELY A;  4HNY B;  5KTC A;  3JVN A;  3PBE A;  4KOV A;  2G0B A;  4MY3 A;  3FXT A;  4YFJ A;  3SJF A;  1Y7R A;  1ELL P;  3SJE A;  1QSR A;  2HUZ A;  2OB0 A;  3QB8 A;  4X8I A;  4EME A;  5HVF A;  1DE4 C;  2BL1 A;  3CXS A;  1Z8W A;  1VGY A;  3VWE A;  1N71 A;  2YGW A;  1WWZ A;  3E0K A;  3ISX A;  4IHM A;  4LX9 A;  1KWM A;  4MFQ A;  2G9D A;  1L0C A;  4FD6 A;  1MK4 A;  3OWC A;  1BPM A;  4KLW A;  1FY7 A;  1NSA A;  2GLF A;  4FD4 A;  4KUA A;  2WUU A;  1A2Z A;  2HV2 A;  3RAM A;  3IU2 A;  2FXF A;  4OC0 A;  4AXV A;  5F48 A;  3R9F A;  3D8P A;  4LUA A;  3TE4 A;  2EO8 A;  4UWJ A;  1S7F A;  2EBJ A;  1R43 A;  1M4I A;  3D4U A;  4ORF A;  4C7I A;  5J1Q A;  2OZU A;  4C2Z A;  2FS5 A;  2XEF A;  1AMP A;  1K4J A;  1XMB A;  3BJ8 A;  3D2P A;  1IYK A;  3GKR A;  1PCA A;  4ZX9 A;  4BMH A;  4CYN A;  2Q4Z A;  3LWU A;  2EUI A;  2FSR A;  4PPZ A;  1PYT B;  1QST A;  3VAT A;  4A37 A;  4A94 A;  4G1P A;  2CY2 A;  1EE3 P;  4XPD B;  2QVP A;  4CPA A;  3F5B A;  3GIU A;  3CT9 A;  5D29 A;  3T9Y A;  4CGO A;  1VKC A;  4P45 A;  4R3L A;  4QVT A;  4UCN A;  2PIY A;  1YW4 A;  2AFW A;  2ZEE A;  4IUS A;  2Q51 A;  4QB9 A;  1V0C A;  1XOV A;  2WZN A;  1M4G A;  4KOR A;  2NSM A;  4UIB A;  2FIA A;  5F46 A;  3C26 A;  3SI2 A;  1Z5R A;  2AFM A;  4AG7 A;  3FH4 A;  4UFV A;  4KZT A;  3RBU A;  4A33 A;  4C7H A;  4FAI A;  1UFH A;  1XJO A;  4BD9 A;  2QML A;  2O28 A;  4B5P B;  1NMT A;  2Z3N A;  4B6Z A;  4C2Y A;  4UEE A;  2ZEO A;  2P6F A;  3KHX A;  3H8F A;  4ZYQ A;  2IJZ A;  1TKF A;  4R3K A;  4MFP A;  4P4F A;  1CJW A;  5HVG A;  2Z3M A;  4Q38 A;  3S6G A;  4X5K A;  5CNP A;  4NEX A;  2CXA A;  4KOS A;  4H6U A;  4FBE A;  2JBJ A;  4W9Y A;  1YK3 A;  1Z4E A;  4XNH C;  4M6I A;  1IIC A;  2GAN A;  4A32 A;  2HB6 A;  7CPA A;  3T90 A;  1CP6 A;  2REF A;  3CXP A;  4OP4 A;  4XNH B;  4UBR A;  3DR8 A;  5DS0 A;  3SHP A;  1IOI A;  2GIV A;  3TC8 A;  5IB0 A;  5JGF A;  1CPX A;  2Q43 A;  3PFO A;  3V38 A;  4CRZ B;  1MJB A;  2PJ1 A;  3KI9 A;  3K2K A;  2PJA A;  4U9Y A;  2ABZ A;  1Q2D A;  2VL1 A;  4L8A A;  2GLJ A;  4CAE A;  2KCW A;  2OU2 A;  4NFR A;  2I79 A;  5HMN A;  3CXQ A;  2OZG A;  3FED A;  4WWV A;  5LYD A;  1ZG8 A;  4NSQ A;  2ODF A;  2VZZ A;  1S7N A;  4GM5 A;  3EC4 A;  1DTD A;  2VZY A;  1QSO A;  3TOA A;  1RO5 A;  3G8W A;  2BCO A;  3FIX A;  3PBB A;  1IYL A;  4E0A A;  2GRE A;  1B87 A;  2DF5 A;  3NH5 A;  3EFA A;  3HUV A;  4ONW A;  3WAB A;  5HH1 A;  3S9N A;  2PJ8 A;  3PGP A;  1NSL A;  5G21 A;  1LAP A;  3D7D A;  1Q2Y A;  2C6G A;  2PCU A;  5K8O A;  1HDQ A;  4IK2 A;  2P6G A;  2EK9 A;  4GS4 A;  3RO0 A;  1F2P A;  2VBQ A;  2WYR A;  2B4D A;  4J3G A;  1Z9U A;  1ELM P;  1S3Z A;  1ZO0 A;  2DPS A;  1Y0R A;  2B4B A;  2ZEP A;  4YWY A;  4M85 A;  1J4J A;  3BI0 A;  5AG7 A;  2FCK A;  5JM6 A;  4FD7 A;  3D2M A;  4B5P A;  2YNE A;  4UFX A;  3WC6 A;  5DWM A;  1YX0 A;  4MFZ A;  3FRM A;  4JLY A;  5AG6 A;  3VH9 A;  5HXD A;  2R8V A;  1S7L A;  3PZJ A;  3I9S A;  3TOB A;  3TT2 A;  4Q7A A;  3W6X A;  4O23 A;  2ZED A;  3I1U A;  2Q7B A;  4E2A A;  2VI7 A;  3S6F A;  1X10 A;  3PB6 X;  4OC4 A;  3B8G A;  4PK3 A;  4KOY A;  2D4P A;  3KR4 A;  4EFD A;  1IGB A;  2BEI A;  2QIR A;  4YU9 A;  1Z8X A;  3GB0 A;  3R96 A;  3JRU A;  1CX8 A;  2ZEN A;  5IV0 A;  1TXR A;  1JWQ A;  4FUU A;  4AVA A;  2DPT A;  2H5M A;  1I12 A;  1BOB A;  2R7H A;  4MHY A;  3TFY A;  2PRB A;  4K30 A;  5D8N A;  3FNC A;  1CP7 A;  1QSM A;  2GU2 A;  4FD5 A;  5DWN A;  2OOT A;  4B13 A;  4HNX B;  1KUY A;  1TKJ A;  2IL4 A;  2ZEF A;  5ISV A;  1Q2C A;  2PVV A;  1M44 A;  3B3W A;  4UA3 A;  1VHE A;  5G1Z A;  2JEV A;  4R6T A;  1IB1 E;  3D7G A;  4U9Z A;  4NGS A;  2J8N A;  1BLL E;  4Q36 A;  3IWG A;  3MRU A;  2NYQ A;  2B4D B;  4IAV A;  4U5Y A;  4BBH A;  2V8V A;  4MMO A;  4NXY A;  2C27 A;  4UEZ A;  4JWP A;  4WJB A;  3B3C A;  4JJX A;  4NJQ A;  6CPA A;  2B5G A;  3WR7 A;  4UFW A;  2P6E A;  2J8M A;  2PC1 A;  5KTA A;  4B12 A;  1QQ9 A;  3B3V A;  1AUG A;  3FBU A;  3DSB A;  2JEW A;  4JXQ A;  5HVH A;  4QUS A;  2V8G A;  1IY7 A;  2ZW4 A;  2C6C A;  4MCS A;  5IB9 A;  2CNM A;  5JPH A;  3DNS A;  4HPS A;  4OAD A;  3SJX A;  5G20 A;  1ZG9 A;  2AFS A;  4NJR A;  5J8F A;  1F2O A;  3IU1 A;  1LFW A;  2YNC C;  3CPX A;  2WPX A;  1MJA A;  3ZZI A;  3KL9 A;  1M4D A;  2XEJ A;  4MFK A;  4R76 A;  2HC9 A;  3S6K A;  3VWD A;  4ZY2 A;  4DYO A;  5JH9 A;  5JQ4 A;  3TX8 A;  4CGM A;  3G3S A;  2JDD A;  4MRI A;  4IF5 A;  4MCP A;  3TO6 A;  4PK2 A;  3DGV A;  4CAV A;  2RB7 A;  3JTK A;  1HDU A;  2PJ2 A;  3KR5 A;  1Y7E A;  4PXE A;  4XPK A;  5G22 A;  2V8H A;  3FEC A;  3K9T A;  1P0H A;  3IO1 A;  4ZY0 A;  1ZLI A;  4YRH A;  3IC1 A;  2BOA A;  3H8G A;  3D66 A;  1YGH A;  4R7M A;  4KOT A;  4Y49 C;  4KVO E;  4R87 A;  2QJ8 A;  2AJ6 A;  3IFE A;  2Q04 A;  3GYA A;  4OC2 A;  3TTH A;  5GCN A;  1WK4 A;  4AG9 A;  4RN7 A;  2AFZ A;  2V77 A;  3EY5 A;  3BHX A;  4KSA A;  1NE9 A;  2R98 A;  4ZX8 A;  4L89 A;  1BAV A;  4OLL A;  4CAW A;  1JQG A;  4NGM A;  3V7Z A;  3A9L A;  3PFE A;  2JDC A;  5C88 A;  4MHN A;  2Z11 A;  3B3S A;  3LAC A;  4R8F A;  4MHP A;  2WPW A;  4B10 A;  2PVW A;  1LAM A;  4OIW A;  2Z3L A;  1YW6 A;  4KSF A;  2Z3P A;  2V8D A;  2IMO A;  4PSX A;  1HEE A;  1CM0 A;  3K9U A;  2YNC A;  3FB3 A;  4F9U A;  5I0C A;  2ZEG A;  4KLV A;  4PXC A;  1XRY A;  2CNT A;  2DEA A;  4F8Z A;  4M6G A;  2WSA A;  4RI1 A;  2XEI A;  1IOF A;  1AYE A;  3BXM A;  3D67 A;  3PEI A;  3IIB A;  2POK A;  3KHZ A;  2PJ0 A;  2ZEH A;  4DUK A;  2PJ4 A;  3GLJ A;  1XF8 A;  4JZ0 A;  2C1C A;  2F5I A;  2PSW A;  3PB7 X;  5IX3 A;  3F0A A;  4F0X A;  2NMT A;  2B3V A;  2XEG A;  2FVG A;  4MCR A;  4Y49 B;  1LOK A;  4P4J A;  2PJ9 A;  3IEH A;  4A39 A;  4DJL A;  4H89 A;  4A31 A;  4B5O A;  4E8O A;  5BWA B;  2BO9 A;  1XMT A;  4KS9 A;  2ZW7 A;  5H86 A;  5A27 A;  2ATR A;  3KZW A;  4EWT A;  3SI0 A;  5E96 A;  4X2T A;  3H5Z A;  4QC6 A;  4CYP A;  4ZI6 A;  1F57 A;  1IID A;  3PB8 X;  1YRE A;  1RXT A;  1CBX A;  1FNO A;  3WT4 A;  2ZOF A;  1QSN A;  3R95 A;  4RS2 A;  4JXR A;  1Z2L A;  4KVX A;  4B11 A;  1KUV A;  4LQG A;  4M6H A;  2EWB A;  3P2H A;  1P4N A;  4CGN A;  1R57 A;  1S5K A;  4EVY A;  1KUX A;  3ISZ A;  2FIW A;  4KSI A;  4UIA A;  2OH1 A;  2PIZ A;  5I4M A;  2FE7 A;  1PU9 A;  1ON0 A;  2FT0 A;  3LMS A;  4OC5 A;  5LYL A;  3L2N A;  2ZW6 A;  1Q7L A;  4OAE A;  1YVO A;  2ANP A;  1OBR A;  3R9E A;  3V8I A;  1TKH A;  4A38 A;  3HLP A;  3TCV A;  3SJG A;  1I21 A;  4CAF A;  2FL4 A;  4MBU A;  2AFO A;  1VIX A;  1Y9W A;  1ARM A;  3T8W A;  2B5G B;  2Q7S A;  3B7I A;  3R1K A;  2Q4Y A;  4JD6 A;  3B2Y A;  4NGT A;  4MI4 A;  4PSW A;  4F6A A;  3NH4 A;  4HKF A;  2K5T A;  3CDX A;  4UEF A;  4KVM E;  4CYO A;  3DDD A;  2GFQ A;  1CG2 A;  2ZOG A;  1LAN A;  3FEE A;  3IWW A;  3WC5 A;  3F8K A;  2ZW5 A;  3W91 A;  5AGE A;  5AG4 A;  1H8L A;  2J9A A;  5THW A;  5EC4 A;  1GHE A;  1U6M A;  3FJU A;  4P44 A;  4NF1 A;  5C82 A;  4II9 A;  1YLO A;  4KOU A;  3S6H A;  4A2Z A;  4PXD A;  2ZEL A;  3BI1 A;  4NGP A;  2PJ6 A;  4R9M A;  2Z3K A;  3NFZ A;  4PQA A;  2PJC A;  4A30 A;  4NGQ A;  4ZY1 A;  4X3R A;  4MCQ A; 
#chains in the Genus database with same CATH homology
 1LRZ A;  1VHS A;  3MGD A;  4R57 A;  3TO7 A;  1TIQ A;  3KKW A;  4KUB A;  1XE4 A;  2R1I A;  3SXN A;  3FYN A;  2ZXV A;  2BSW A;  3EO4 A;  3QAH A;  3D3S A;  2G3T A;  3ZJ0 A;  4MY0 A;  4CGL A;  2VEZ A;  2Z3O A;  2D4O A;  4H6Z A;  4ONU A;  2Z10 A;  3DR6 A;  3UY5 A;  2HQY A;  2B58 A;  4CS0 B;  2Q0Y A;  2ZPA A;  4C68 A;  4CRY B;  5EBV A;  1YLE A;  3PP9 A;  2Q4V A;  1Y9K A;  2Y0M A;  3P2F A;  1OZP A;  1B6B A;  1Z4R A;  1BO4 A;  3BJ7 A;  2ARH A;  2I00 A;  3BLN A;  5J8C A;  4B14 A;  3H4Q A;  3LOD A;  4KOW A;  3LD2 A;  3N7Z A;  2X7B A;  5KTD A;  2Z0Z A;  5F47 A;  5H84 A;  1PUA A;  4KOX A;  1SQH A;  4PV6 A;  3I3G A;  4XPD C;  2GE3 A;  2A4N A;  3W6S A;  2B3U A;  3GY9 A;  4MHD A;  3R9G A;  2PQ8 A;  4AB7 A;  4YGO A;  3EXN A;  3RYO A;  2PR1 A;  3NE7 A;  2JLM A;  4MJ8 A;  4ZGY B;  4CGP A;  4CAX A;  2AE6 A;  4HNW B;  2Q44 A;  2PDO A;  4MFJ A;  4MFL A;  4A95 A;  4QBJ A;  2VQY A;  2EVN A;  3JUW A;  5A28 A;  3SXO A;  4C2X A;  2REE A;  2PR8 A;  4AVB A;  3TO9 A;  4UWI A;  4DNC A;  5FVJ A;  5AG5 A;  2QEC A;  4F0Y A;  2P0W A;  1M1D A;  2DXQ A;  4CYQ A;  1XEB A;  5F49 A;  4I49 A;  2RC4 A;  2VXK A;  4M3S A;  2CNS A;  4XPL A;  2BUE A;  1YR0 A;  4UCM A;  1YVK A;  1I1D A;  2G3A A;  4NCZ A;  1S7K A;  1XIX A;  3IGR A;  4ZBG A;  3IWE A;  2YND A;  4AVC A;  1S60 A;  1KZF A;  4UCP A;  1MJ9 A;  2J8R A;  2OZH A;  4HNY B;  5KTC A;  3JVN A;  4KOV A;  2G0B A;  4MY3 A;  3FXT A;  4YFJ A;  1Y7R A;  1QSR A;  2HUZ A;  2OB0 A;  3QB8 A;  2BL1 A;  3CXS A;  3VWE A;  1N71 A;  2YGW A;  1WWZ A;  3E0K A;  4LX9 A;  4MFQ A;  1L0C A;  4FD6 A;  1MK4 A;  3OWC A;  4KLW A;  1FY7 A;  4FD4 A;  4KUA A;  2WUU A;  2HV2 A;  3IU2 A;  2FXF A;  5F48 A;  3R9F A;  3D8P A;  4LUA A;  3TE4 A;  4UWJ A;  1S7F A;  1M4I A;  4ORF A;  4C7I A;  2OZU A;  4C2Z A;  2FS5 A;  1K4J A;  3D2P A;  3BJ8 A;  3GKR A;  1IYK A;  4BMH A;  4CYN A;  2EUI A;  2FSR A;  1QST A;  2CY2 A;  4XPD B;  3F5B A;  4CGO A;  3T9Y A;  1VKC A;  4R3L A;  4QVT A;  4UCN A;  4IUS A;  4QB9 A;  1V0C A;  1M4G A;  4KOR A;  2FIA A;  5F46 A;  3C26 A;  4AG7 A;  4UFV A;  4KZT A;  4A33 A;  4C7H A;  1UFH A;  2QML A;  2O28 A;  4B5P B;  1NMT A;  2Z3N A;  4C2Y A;  2P6F A;  4R3K A;  4MFP A;  1CJW A;  2Z3M A;  4Q38 A;  3S6G A;  4X5K A;  5CNP A;  4NEX A;  2CXA A;  4KOS A;  4H6U A;  1YK3 A;  1Z4E A;  4XNH C;  1IIC A;  2GAN A;  4A32 A;  3T90 A;  2REF A;  3CXP A;  4XNH B;  5JQ4 A;  4UBR A;  3DR8 A;  3SHP A;  5IB0 A;  2GIV A;  4CRZ B;  1MJB A;  4U9Y A;  1Q2D A;  4L8A A;  4CAE A;  2KCW A;  2OU2 A;  2I79 A;  5HMN A;  3CXQ A;  2OZG A;  4NSQ A;  2VZZ A;  1S7N A;  3EC4 A;  2VZY A;  3TOA A;  1QSO A;  1RO5 A;  3G8W A;  3FIX A;  4E0A A;  1IYL A;  1B87 A;  3EFA A;  5HH1 A;  3PGP A;  1NSL A;  5G21 A;  1Q2Y A;  2P6G A;  4GS4 A;  2VBQ A;  4J3G A;  2B4D A;  1Z9U A;  1ZO0 A;  1S3Z A;  2DPS A;  2B4B A;  4M85 A;  1J4J A;  5AG7 A;  2FCK A;  4FD7 A;  3D2M A;  4B5P A;  2YNE A;  4UFX A;  5DWM A;  1YX0 A;  4MFZ A;  3FRM A;  4JLY A;  5AG6 A;  2R8V A;  1S7L A;  3PZJ A;  3I9S A;  3TOB A;  3TT2 A;  3W6X A;  2Q7B A;  4E2A A;  2VI7 A;  3S6F A;  3B8G A;  4PK3 A;  4KOY A;  2D4P A;  2BEI A;  2QIR A;  3R96 A;  5IV0 A;  4AVA A;  2DPT A;  2H5M A;  1I12 A;  1BOB A;  2R7H A;  3TFY A;  2PRB A;  4K30 A;  3FNC A;  1QSM A;  4FD5 A;  5DWN A;  4B13 A;  4HNX B;  1KUY A;  2IL4 A;  5ISV A;  1Q2C A;  1M44 A;  5G1Z A;  4UA3 A;  2JEV A;  1IB1 E;  4U9Z A;  2J8N A;  4Q36 A;  3IWG A;  2B4D B;  4U5Y A;  4BBH A;  4NXY A;  2C27 A;  4JWP A;  4JJX A;  2B5G A;  3WR7 A;  4UFW A;  2P6E A;  2J8M A;  2PC1 A;  5KTA A;  4B12 A;  3FBU A;  4JXQ A;  3DSB A;  4QUS A;  2ZW4 A;  2CNM A;  5JPH A;  3DNS A;  4OAD A;  5G20 A;  5J8F A;  3IU1 A;  2YNC C;  2WPX A;  1MJA A;  3ZZI A;  1M4D A;  4MFK A;  3S6K A;  3VWD A;  4CGM A;  3G3S A;  2JDD A;  4IF5 A;  3TO6 A;  4PK2 A;  4CAV A;  3JTK A;  4XPK A;  5G22 A;  1P0H A;  4YRH A;  1YGH A;  4KOT A;  4Y49 C;  4KVO E;  4R87 A;  2AJ6 A;  3TTH A;  2Q04 A;  3GYA A;  5GCN A;  1WK4 A;  4AG9 A;  3EY5 A;  4KSA A;  1NE9 A;  2R98 A;  4L89 A;  4OLL A;  4CAW A;  3A9L A;  2JDC A;  5C88 A;  2Z11 A;  2WPW A;  4B10 A;  2Z3L A;  4KSF A;  2Z3P A;  4PSX A;  1CM0 A;  3K9U A;  2YNC A;  3FB3 A;  5I0C A;  4KLV A;  2CNT A;  2WSA A;  4RI1 A;  1XF8 A;  2PSW A;  2F5I A;  5IX3 A;  3F0A A;  2NMT A;  2B3V A;  4Y49 B;  4H89 A;  4A31 A;  4B5O A;  4E8O A;  5BWA B;  1XMT A;  4KS9 A;  2ZW7 A;  5H86 A;  5A27 A;  2ATR A;  5E96 A;  3H5Z A;  4QC6 A;  4CYP A;  1IID A;  1YRE A;  1RXT A;  1QSN A;  3R95 A;  4RS2 A;  4JXR A;  4KVX A;  4B11 A;  1KUV A;  3P2H A;  1P4N A;  4CGN A;  1R57 A;  1S5K A;  4EVY A;  1KUX A;  2FIW A;  2OH1 A;  2FE7 A;  1PU9 A;  1ON0 A;  2FT0 A;  2ZW6 A;  4OAE A;  3R9E A;  1YVO A;  3V8I A;  3TCV A;  1I21 A;  4CAF A;  2FL4 A;  4MBU A;  1Y9W A;  4F0X A;  2B5G B;  3R1K A;  2Q4Y A;  4JD6 A;  4PSW A;  4MI4 A;  4F6A A;  4HKF A;  2K5T A;  4KVM E;  4CYO A;  3DDD A;  3F8K A;  2ZW5 A;  3W91 A;  5AGE A;  5AG4 A;  5EC4 A;  1GHE A;  1U6M A;  5C82 A;  4NF1 A;  4II9 A;  4KOU A;  3S6H A;  4A2Z A;  4R9M A;  2Z3K A;  4A30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...