4A2ZA

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a pyrazole sulphonamide ligand
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of a novel class of orally active trypanocidal N-myristoyltransferase inhibitors.
pubmed doi rcsb
source organism Leishmania major
total genus 120
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4a2zA00
4CGPA 4B10A 4B11A 5G22A 4B13A 4CGMA 4A30A 4C2ZA 4CGNA 5AG7A 4BBHA 4UFXA 4A32A 4CYNA 4CYPA 5AG5A 3IWEA 4UCMA 4UCNA 4A95A 4CGLA 4A31A 4C2XA 2YNDA 5A27A 4CAEA 4A33A 2WUUA 4C7HA 4UCPA 5G20A 2WSAA 3H5ZA 4B12A 2YNCA 3IU2A 3JTKA 4CYOA 4B14A 5G1ZA 4C68A 4C7IA 4UFWA 5AG4A 4C2YA 5AG6A 4UFVA 2YNCC 2YNEA 4CAFA 4CYQA 4CGOA 5G21A 3IU1A 4A2ZA 5A28A 5AGEA
chains in the Genus database with same CATH superfamily
4P4BA 3DR6A 3F0AA 2XEFA 4MCPA 2DEAA 1VHOA 2YGWA 2Z10A 4L8AA 3S6GA 4C2ZA 3VARA 4UWJA 3PGPA 5HXDA 2NYQA 3D7HA 1R43A 1QSNA 3GKRA 2QMLA 3FNCA 4YWYA 4B5PA 2O28A 4ZY2A 1ON0A 2C27A 3KL9A 4KVOE 4BINA 2CNTA 4B12A 3FMCA 1CJWA 2ZPAA 3H8EA 4P45A 1WK4A 1CM0A 4XPKA 2Q7BA 2CNMA 2D4PA 3PBEA 4H89A 1RTQA 3TO6A 5I0CA 1XEBA 3FH4A 2EVNA 3G3SA 4KSIA 3WC6A 3BXMA 2FL4A 3K9TA 2GIVA 4F8ZA 4XNHC 4NGTA 2ZOGA 5AG7A 2FS5A 3TOAA 3R1KA 4CYPA 1YVOA 3H8GA 4CAEA 1ZG7A 2Y0MA 4NFRA 3RAMA 3B3SA 1MK4A 3W91A 1HEEA 3B7IA 1XF8A 3IIBA 3KASA 4MCRA 2R7HA 4KVXA 3IWWA 2CNSA 1P4NA 3V7ZA 3R9FA 4A94A 4Y49C 1LRZA 4F9UA 4CRYB 5K8MA 1TKFA 5HH1A 4R57A 3KR4A 5EC4A 1K4JA 1XFOA 2OZHA 2PCUA 1RO5A 2JDDA 2PJ0A 2Q4ZA 4IK2A 4KZTA 4MY3A 1MJAA 3D68A 4MHZA 4NGSA 4PK2A 4U9YA 5HVFA 4ZY1A 1YLEA 1H8LA 2Z11A 4UEEA 4CGNA 2P6EA 3P2FA 4B6ZA 1DE4C 1MJBA 4X8IA 4MI4A 4GXHA 3F5BA 4UCMA 4KLVA 4I49A 2OOTA 3WC7A 3QB8A 3PFEA 4OP4A 2V8HA 2XEIA 3HUVA 5JM6A 3EO4A 4KLWA 1NSAA 1VIXA 3B3TA 2PJ8A 3KZWA 5F47A 5FVJA 5EMIA 4FAIA 2HQYA 4UA3A 4H6UA 4G1PA 4EMEA 1VHEA 3G8WA 5F09A 4KOSA 2PSWA 3SJXA 3VWDA 3DR8A 2PVVA 3BJ8A 4OC1A 4UFVA 3TO7A 4K30A 3NA6A 2FSRA 3IU1A 3MGDA 2VQYA 2CTCA 3KR5A 2B5GB 2JLMA 2OZUA 1R3NA 1ARLA 2V8GA 1Z5RA 4HNYB 3GB0A 4MFJA 2BL1A 4PXCA 1Q2CA 3SHPA 4C7HA 1CPXA 2B4DB 2VEZA 2ABZA 4LUAA 3BI0A 4U5YA 4MHYA 4AVBA 2QYVA 4YGOA 5HVHA 3DDDA 3BHXA 3WABA 2WYRA 2AFWA 2BOAA 3W6XA 3PB8X 3R9GA 3SJGA 4MRIA 1JWQA 4M85A 1IIDA 2CXAA 3R95A 2ZXVA 2VXKA 2ZEEA 4CYQA 1VKCA 4CAWA 3H4QA 1CBXA 4NGRA 2RFHA 5DWNA 1QMUA 2RC4A 2BO9A 4P4DA 2J8RA 1S7KA 1ELMP 3KKWA 4JLYA 3EXNA 3IFEA 2PQ8A 4BBHA 2PJBA 2FCKA 1GYTA 4XPDC 3KHZA 1KZFA 1LOKA 1CPSA 1CP6A 1Y0YA 4FD4A 5F49A 3SI0A 1XIXA 3RNZA 2HV2A 4KSAA 1Y9KA 3K9UA 4O23A 4EFDA 4C2YA 5AG4A 3T90A 2ZOFA 1XBUA 3TX8A 2G0BA 3PB6X 3IGRA 4Q36A 4QC6A 4OC2A 5F48A 3W6SA 3VH9A 4CAFA 3NFZA 2AJ6A 2Z3MA 3TOBA 4KOUA 4CGLA 2ZEOA 4JZ0A 1XMBA 4CGPA 2OH1A 5I4MA 3P2HA 5G22A 5IB9A 4X3RA 1MJ9A 2P6GA 4MMOA 4WWVA 5JGFA 4NJRA 2G3AA 3BI1A 2AFSA 4KOWA 5D8NA 2POKA 5LYFA 5LYLA 1UFHA 2B5GA 3IWEA 4HPSA 4PV6A 2O53A 1S3ZA 4Q7AA 4RN7A 3CXQA 2GE3A 3DSBA 2I79A 4DJLA 5CBMA 2QVPA 1HDUA 2FXFA 5BWAB 2EBJA 3MN8A 3FECA 1CG2A 2QIRA 2B4DA 4UEZA 1Z4RA 4H2KA 2C1CA 2ZW6A 2F7VA 3GLJA 4ONWA 1QSMA 1SQHA 1Y7EA 5G1ZA 3GYAA 1YMEA 1PYTB 3CPAA 5LRJA 4LX9A 1B6BA 4FWUA 4MCSA 4BD9A 2PJCA 2ZELA 3KQZA 2A4NA 3E0KA 4AVAA 3WR7A 4A2ZA 1XRYA 2WZNA 3WC5A 4UEFA 5K8PA 3LACA 1OBRA 1YGHA 3H8FA 4WJBA 2J8NA 4UWIA 1VGYA 3DLJA 3R9EA 4A30A 1IYKA 4OIWA 4Z65A 4UCNA 1XMTA 2BSWA 2REFA 1ZG9A 4OC0A 1NSLA 5A27A 4GS4A 2B4BA 2VZZA 1YX0A 4E0AA 5IB0A 2Q43A 1M4LA 7CPAA 2ODFA 3IJ3A 2ZEFA 2EK9A 3JTKA 1N71A 3BJ7A 1Y9WA 2FIWA 1Q7LA 4UFWA 4NGNA 4F9VA 1A2ZA 3BLNA 3D66A 3D2PA 4PK3A 6CPAA 4PXDA 4X5KA 4U9ZA 2R8VA 2Z3NA 2IL4A 2R1IA 4YU9A 3PB7X 3LD2A 4KOVA 2Q4YA 4FD5A 4Q38A 1AMPA 1S60A 2PC1A 4IF5A 4TNUA 5JQ4A 4J3GA 2OB0A 3F8KA 4TWEA 5K8OA 4A95A 2PIYA 4A31A 4DUKA 2B3VA 3CZXA 2FVGA 2X7BA 1M4GA 1IU8A 3JUWA 2Z3PA 3DNSA 3LODA 3UY5A 3VATA 4ZI6A 5J8CA 4QBJA 4QUSA 4UIAA 4CYOA 2PJ3A 3IO1A 3GUXA 4C68A 2CY2A 1FY7A 1Q2DA 4JXQA 5AG6A 2HB6A 5HMNA 3PP9A 4MY0A 2DPSA 4MHDA 4NSQA 4XPLA 3CPXA 3CDXA 2ZW4A 4ZGYB 4JXRA 4R87A 4RI1A 3A9LA 1QSTA 2J8MA 4KSFA 4LQ6A 4MFQA 4QB9A 3RBUA 2Q0YA 4M6IA 2AFOA 4MFZA 3V38A 1YVKA 2ZEPA 4NJQA 4R9MA 4A32A 1B87A 1S5KA 2JDCA 3C26A 3OWCA 1Z8TA 3KQXA 2YNDA 4NF1A 3EC4A 4PXBA 1R57A 5G20A 4KUBA 5ISVA 1VHSA 3IC1A 2RB7A 1X12A 4NEXA 1Q2YA 3B3WA 3PRTA 3TO9A 2O4HA 4M6HA 3I1UA 1M1DA 3SXNA 3LWUA 2V8VA 2DXQA 1Y0RA 4GM5A 2Q7SA 5HVGA 1Z8LA 2NSMA 2H5MA 3KGQA 4B10A 1X10A 1TF9A 2K5TA 4B5PB 1Y7RA 4AB7A 3JVNA 3D2MA 4FD7A 2I00A 3TC8A 4B5OA 5KTDA 2VI7A 1M44A 3PZJA 4FD6A 4UFXA 2PJ9A 2PR8A 3QAHA 3KI9A 5CNPA 2ZEMA 2J9AA 1KWMA 1YREA 3TCVA 2P0WA 1TXRA 2QECA 4KOXA 2BCOA 2YNCA 1WWZA 5LYDA 1Z8XA 1XOVA 1BAVA 2Z3LA 2DF5A 1LFWA 2IJZA 2ANPA 4K3NA 4ZX8A 1RXTA 2ZEDA 3GY9A 4A38A 2V77A 3SJEA 2C6GA 2HC9A 2Z0ZA 1DTDA 4IAVA 4YFJA 4A37A 4KS9A 1YK3A 3NE8A 2ZEHA 2BEIA 4PQAA 2AFZA 2GREA 4P44A 3D7DA 4R3KA 1Z9UA 3L2NA 4CPAA 3MRUA 3V8IA 4NCZA 1ELLP 1IGBA 4II9A 2XEJA 2HUZA 2ARHA 4OC4A 4ZBGA 5H84A 4F0YA 2AFMA 3K2KA 1YLOA 2P6FA 1NMTA 1S7LA 4OC5A 1YW4A 3D8PA 2VZYA 1CX8A 4FUUA 1HDQA 1YR0A 2XEGA 1LAPA 2Z3OA 3B35A 3PB4X 4JD6A 4AXVA 2R98A 5J1QA 1LANA 2C6PA 3I9SA 1PU9A 2PR1A 2QJ8A 4DYOA 2I3CA 4PSWA 4OC3A 3TT2A 3CXSA 3DGVA 3LMSA 4IUSA 2DPTA 3S9MA 4XPDB 5IX3A 3D7FA 4MJ8A 3PFOA 2PRBA 1Z2LA 1ZLHA 3CXPA 4QVTA 4OAEA 5C82A 4MCQA 2AFXA 3NH5A 4MFKA 5IV0A 3KHXA 3D67A 3B3CA 4B13A 1ZO0A 2Z3KA 2PJ4A 4L89A 1IYLA 3JRUA 1BOBA 4R8FA 3SI1A 1FT7A 3NE7A 5AG5A 5C88A 3IWGA 2AE6A 3QAYA 1V0CA 3S6FA 2CTBA 2WPXA 3CT9A 4NXYA 4KORA 3H5ZA 5LRKA 4R7MA 4E2AA 3IU2A 3FBUA 4UBRA 2PJ2A 1ZLIA 1JQGA 3S6HA 1QSOA 4MXUA 2YNCC 4P4FA 3N7ZA 2JBKA 4NGPA 5ELYA 4RUHA 3FIXA 4B14A 1YSJA 3D3SA 5KTAA 5KTCA 1Z4EA 3ISZA 2AFUA 4HNWB 1LCPA 4FBEA 1NE9A 4BMHA 1UWYA 4CGMA 3FEDA 3EFAA 1FNOA 2D4OA 4ORFA 4P4JA 4F0XA 3B3VA 1I12A 1F2PA 2WPWA 1LAMA 4RS2A 2JEVA 2GANA 4HKFA 1GHEA 5JH9A 1AUGA 4MFLA 2EUIA 4MFPA 1AYEA 1IB1E 2WSAA 3B8GA 3PBBA 4OMEA 2B3UA 3R96A 4P6YA 2ZEGA 3QNVA 4UIBA 2V8DA 1TIQA 5DS0A 1YQEA 4XNHB 4DNCA 1S7FA 1F57A 2PJ7A 4NGQA 4NGMA 3SJFA 4PSXA 2ZENA 1IY7A 1KUYA 5THWA 4ZYQA 2YNEA 2PDOA 3SXOA 1TF8A 4EWTA 2GLFA 2FE7A 1IOIA 1KUVA 2IMOA 2JEWA 2PVWA 1U6MA 4MBUA 4OKOA 8CPAA 1KUXA 2PRQA 2G3TA 4ZX9A 3RYOA 2REEA 3FVLA 1ZG8A 2OU2A 4PPZA 4CAVA 4Y49B 1BPMA 4CYNA 1BPNA 4JYWA 1L0CA 4PXEA 3RZAA 4C2XA 4HNXB 1QSRA 3FF3A 3T9YA 1I21A 1Z8WA 4LQGA 4OLLA 5LYIA 5DWMA 4F6AA 4H6ZA 1OZPA 5JPHA 3FXTA 5D29A 4P4IA 3S6KA 3WT4A 4C7IA 2EK8A 1BO4A 2FT0A 1M4IA 3FJUA 3FRMA 3N5FA 3NH4A 4M6GA 4W9YA 4X2TA 1TKJA 2PJAA 2Q44A 3FYNA 4JWPA 4CGOA 4KOYA 3VWEA 4CS0B 5A28A 2Q51A 3ISXA 1TKHA 2CF4A 1I1DA 4B11A 4EVYA 1J4JA 3NH8A 3SI2A 2OR4A 4ONUA 3RO0A 1IOFA 5E96A 3I3GA 2FIAA 3D4UA 3PEIA 5EBVA 5GCNA 1YW6A 2VBQA 4R76A 4IHMA 3S9NA 4YRHA 1EE3P 1PCAA 3ZJ0A 4OIDA 4UF4A 4CAXA 4AG9A 3TFYA 2Q04A 5CPAA 2PE3A 3T8WA 1P0HA 2VL1A 2EWBA 2F8HA 4MHPA 3ZZIA 2Q4VA 2PJ1A 3HLPA 2C6CA 2EO8A 3EY5A 2OZGA 4AVCA 3S9LA 2PJ6A 1XE4A 1S7NA 4R3LA 5AGEA 2ZW7A 2ZW5A 5K8NA 5F46A 2GLJA 4OADA 3D7GA 2KCWA 2IQ6A 5H86A 3FB3A 3B2YA 4R6TA 2GFQA 2NMTA 4KOTA 3FEEA 2CIJA 4KUAA 4MHNA 4P4EA 3FX6A 3GIUA 4ZY0A 4A33A 2WUUA 1QQ9A 4UCPA 2PJ5A 1IICA 1BLLE 2BUEA 3PB9X 3TE4A 1PUAA 1CP7A 4JJXA 2F5IA 4AG7A 4M3SA 4CRZB 5LRGA 1ARMA 2G9DA 4P10A 3IEHA 2GU2A 3TTHA 1M4DA 4E8OA 4KVME 5G21A 5J8FA 1F2OA 1XJOA 2JBJA 2PIZA 2ATRA 2B58A 4A39A
chains in the Genus database with same CATH topology
3DR6A 3F0AA 2YGWA 2Z10A 4L8AA 3S6GA 4C2ZA 4UWJA 3PGPA 1QSNA 3GKRA 2QMLA 3FNCA 4B5PA 2O28A 1ON0A 2C27A 4KVOE 2CNTA 4B12A 1CJWA 2ZPAA 1WK4A 1CM0A 4XPKA 2Q7BA 2CNMA 2D4PA 4H89A 3TO6A 5I0CA 1XEBA 2EVNA 3G3SA 2FL4A 2GIVA 4XNHC 5AG7A 2FS5A 3TOAA 3R1KA 4CYPA 1YVOA 4CAEA 2Y0MA 1MK4A 3W91A 1XF8A 2R7HA 4KVXA 2CNSA 1P4NA 3R9FA 4Y49C 1LRZA 4CRYB 5HH1A 4R57A 5EC4A 1K4JA 5GCNA 2OZHA 4KZTA 1RO5A 2JDDA 4U9YA 4MY3A 1MJAA 4PK2A 1YLEA 2Z11A 4CGNA 2P6EA 3P2FA 1MJBA 4MI4A 3F5BA 4UCMA 4KLVA 4I49A 3QB8A 3EO4A 4KLWA 5F47A 5FVJA 2HQYA 4UA3A 4H6UA 3G8WA 4KOSA 2PSWA 3VWDA 3DR8A 4UFVA 3BJ8A 3TO7A 4K30A 2FSRA 3IU1A 3MGDA 2VQYA 2B5GB 2JLMA 2OZUA 4HNYB 4MFJA 2BL1A 1Q2CA 3SHPA 4C7HA 2B4DB 2VEZA 4LUAA 4U5YA 4AVBA 4YGOA 3DDDA 3W6XA 3R9GA 4M85A 1IIDA 2CXAA 3R95A 2ZXVA 2VXKA 4CYQA 1VKCA 4CAWA 3H4QA 5DWNA 2RC4A 2J8RA 1S7KA 3KKWA 4JLYA 3EXNA 2PQ8A 4BBHA 2FCKA 4XPDC 1KZFA 4FD4A 5F49A 1XIXA 2HV2A 4KSAA 1Y9KA 3K9UA 5AG4A 4C2YA 3T90A 3W6SA 2G0BA 4Q36A 3IGRA 5F48A 4QC6A 4CAFA 2AJ6A 2Z3MA 3TOBA 4KOUA 4CGLA 4CGPA 2OH1A 3P2HA 5G22A 1MJ9A 2P6GA 2G3AA 4KOWA 1UFHA 2B5GA 3IWEA 4PV6A 1S3ZA 3CXQA 2GE3A 3DSBA 2I79A 5BWAB 2FXFA 2QIRA 2B4DA 1Z4RA 2ZW6A 3VWEA 4B14A 5G1ZA 1QSMA 1SQHA 3GYAA 4LX9A 1B6BA 4AVAA 2A4NA 3E0KA 3WR7A 4A2ZA 1YGHA 2J8NA 4UWIA 3R9EA 4A30A 1IYKA 4UCNA 1XMTA 2BSWA 2REFA 1NSLA 5A27A 4GS4A 2B4BA 2VZZA 1YX0A 4E0AA 5IB0A 3JTKA 1N71A 3BJ7A 1Y9WA 2FIWA 4UFWA 3BLNA 3D2PA 4PK3A 4X5KA 4U9ZA 2R8VA 2Z3NA 2IL4A 2R1IA 3LD2A 4KOVA 2Q4YA 4FD5A 4Q38A 1S60A 2PC1A 4IF5A 5JQ4A 4J3GA 2OB0A 3F8KA 4A95A 4A31A 2B3VA 2X7BA 1M4GA 3JUWA 2Z3PA 3DNSA 3LODA 3UY5A 5J8CA 4QBJA 4QUSA 4CYOA 4C68A 2CY2A 1FY7A 1Q2DA 4JXQA 5AG6A 5HMNA 3PP9A 4MY0A 2DPSA 4MHDA 4NSQA 4XPLA 2ZW4A 4ZGYB 4JXRA 4R87A 4RI1A 3A9LA 1QSTA 2J8MA 4KSFA 4MFQA 4QB9A 2Q0YA 1YVKA 4R9MA 4A32A 1B87A 1S5KA 2JDCA 3C26A 3OWCA 2YNDA 4NF1A 3EC4A 1R57A 5G20A 4KUBA 5ISVA 1VHSA 4NEXA 1Q2YA 3TO9A 1M1DA 3SXNA 2DXQA 2H5MA 4B10A 2K5TA 4B5PB 1Y7RA 4AB7A 3JVNA 3D2MA 4FD7A 2I00A 4B5OA 5KTDA 2VI7A 1M44A 3PZJA 4FD6A 4UFXA 2PR8A 3QAHA 5CNPA 1YREA 3TCVA 2P0WA 2QECA 4KOXA 2YNCA 1WWZA 2Z3LA 1RXTA 3GY9A 2Z0ZA 4YFJA 4KS9A 1YK3A 2BEIA 4R3KA 1Z9UA 3V8IA 4NCZA 4II9A 2HUZA 2ARHA 4ZBGA 5H84A 4F0YA 2P6FA 1NMTA 1S7LA 3D8PA 2VZYA 1YR0A 2Z3OA 4JD6A 2R98A 3I9SA 1PU9A 2PR1A 4PSWA 3TT2A 3CXSA 4IUSA 2DPTA 4XPDB 5IX3A 4MJ8A 2PRBA 3CXPA 4QVTA 4OAEA 5C82A 4MFKA 5IV0A 4B13A 1ZO0A 2Z3KA 4L89A 1IYLA 1BOBA 3NE7A 5AG5A 5C88A 3IWGA 2AE6A 1V0CA 3S6FA 2WPXA 4NXYA 4KORA 3H5ZA 4E2AA 3IU2A 3FBUA 4UBRA 3S6HA 1QSOA 2YNCC 3N7ZA 3FIXA 3D3SA 5KTAA 5KTCA 1Z4EA 4HNWB 1NE9A 4BMHA 4CGMA 3EFAA 2D4OA 4ORFA 4F0XA 1I12A 2WPWA 4RS2A 2JEVA 2GANA 4HKFA 1GHEA 4MFLA 2EUIA 4MFPA 2WSAA 1IB1E 3B8GA 2B3UA 3R96A 1TIQA 4XNHB 4DNCA 1S7FA 4PSXA 1KUYA 2YNEA 2PDOA 3SXOA 2FE7A 1KUVA 4MBUA 1U6MA 1KUXA 2G3TA 3RYOA 2REEA 4CAVA 4CYNA 2OU2A 4Y49B 4C2XA 1L0CA 4HNXB 1QSRA 3T9YA 1I21A 4OLLA 5DWMA 4F6AA 4H6ZA 1OZPA 5JPHA 3FXTA 3S6KA 4C7IA 1BO4A 2FT0A 1M4IA 3FRMA 2Q44A 3FYNA 4JWPA 4CGOA 4KOYA 4CS0B 5A28A 1I1DA 4B11A 4EVYA 1J4JA 4ONUA 5E96A 3I3GA 2FIAA 5EBVA 2VBQA 4YRHA 4CAXA 3ZJ0A 4AG9A 3TFYA 2Q04A 1P0HA 3ZZIA 2Q4VA 3EY5A 2OZGA 4AVCA 1XE4A 1S7NA 4R3LA 5AGEA 2ZW7A 2ZW5A 5F46A 4OADA 2KCWA 5H86A 3FB3A 4KOTA 2NMTA 4KUAA 4A33A 2WUUA 4UCPA 1IICA 2BUEA 3TE4A 1PUAA 4JJXA 2F5IA 4AG7A 4M3SA 4CRZB 3TTHA 1M4DA 4E8OA 4KVME 5G21A 5J8FA 4MFZA 2ATRA 2B58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGP A;  4B10 A;  4B11 A;  5G22 A;  4B13 A;  4CGM A;  4A30 A;  4C2Z A;  4CGN A;  5AG7 A;  4BBH A;  4UFX A;  4A32 A;  4CYN A;  4CYP A;  5AG5 A;  3IWE A;  4UCM A;  4UCN A;  4A95 A;  4CGL A;  4A31 A;  4C2X A;  2YND A;  5A27 A;  4CAE A;  4A33 A;  2WUU A;  4C7H A;  4UCP A;  5G20 A;  2WSA A;  3H5Z A;  4B12 A;  2YNC A;  3IU2 A;  3JTK A;  4CYO A;  4B14 A;  5G1Z A;  4C68 A;  4C7I A;  4UFW A;  5AG4 A;  4C2Y A;  5AG6 A;  4UFV A;  2YNC C;  2YNE A;  4CAF A;  4CYQ A;  4CGO A;  5G21 A;  3IU1 A;  4A2Z A;  5A28 A;  5AGE A; 
#chains in the Genus database with same CATH topology
 4P4B A;  3DR6 A;  3F0A A;  2XEF A;  4MCP A;  2DEA A;  1VHO A;  2YGW A;  2Z10 A;  4L8A A;  3S6G A;  4C2Z A;  3VAR A;  4UWJ A;  3PGP A;  5HXD A;  2NYQ A;  3D7H A;  1R43 A;  1QSN A;  3GKR A;  2QML A;  3FNC A;  4YWY A;  4B5P A;  2O28 A;  4ZY2 A;  1ON0 A;  2C27 A;  3KL9 A;  4KVO E;  4BIN A;  2CNT A;  4B12 A;  3FMC A;  1CJW A;  2ZPA A;  3H8E A;  4P45 A;  1WK4 A;  1CM0 A;  4XPK A;  2Q7B A;  2CNM A;  2D4P A;  3PBE A;  4H89 A;  1RTQ A;  3TO6 A;  5I0C A;  1XEB A;  3FH4 A;  2EVN A;  3G3S A;  4KSI A;  3WC6 A;  3BXM A;  2FL4 A;  3K9T A;  2GIV A;  4F8Z A;  4XNH C;  4NGT A;  2ZOG A;  5AG7 A;  2FS5 A;  3TOA A;  3R1K A;  4CYP A;  1YVO A;  3H8G A;  4CAE A;  1ZG7 A;  2Y0M A;  4NFR A;  3RAM A;  3B3S A;  1MK4 A;  3W91 A;  1HEE A;  3B7I A;  1XF8 A;  3IIB A;  3KAS A;  4MCR A;  2R7H A;  4KVX A;  3IWW A;  2CNS A;  1P4N A;  3V7Z A;  3R9F A;  4A94 A;  4Y49 C;  1LRZ A;  4F9U A;  4CRY B;  5K8M A;  1TKF A;  5HH1 A;  4R57 A;  3KR4 A;  5EC4 A;  1K4J A;  1XFO A;  2OZH A;  2PCU A;  1RO5 A;  2JDD A;  2PJ0 A;  2Q4Z A;  4IK2 A;  4KZT A;  4MY3 A;  1MJA A;  3D68 A;  4MHZ A;  4NGS A;  4PK2 A;  4U9Y A;  5HVF A;  4ZY1 A;  1YLE A;  1H8L A;  2Z11 A;  4UEE A;  4CGN A;  2P6E A;  3P2F A;  4B6Z A;  1DE4 C;  1MJB A;  4X8I A;  4MI4 A;  4GXH A;  3F5B A;  4UCM A;  4KLV A;  4I49 A;  2OOT A;  3WC7 A;  3QB8 A;  3PFE A;  4OP4 A;  2V8H A;  2XEI A;  3HUV A;  5JM6 A;  3EO4 A;  4KLW A;  1NSA A;  1VIX A;  3B3T A;  2PJ8 A;  3KZW A;  5F47 A;  5FVJ A;  5EMI A;  4FAI A;  2HQY A;  4UA3 A;  4H6U A;  4G1P A;  4EME A;  1VHE A;  3G8W A;  5F09 A;  4KOS A;  2PSW A;  3SJX A;  3VWD A;  3DR8 A;  2PVV A;  3BJ8 A;  4OC1 A;  4UFV A;  3TO7 A;  4K30 A;  3NA6 A;  2FSR A;  3IU1 A;  3MGD A;  2VQY A;  2CTC A;  3KR5 A;  2B5G B;  2JLM A;  2OZU A;  1R3N A;  1ARL A;  2V8G A;  1Z5R A;  4HNY B;  3GB0 A;  4MFJ A;  2BL1 A;  4PXC A;  1Q2C A;  3SHP A;  4C7H A;  1CPX A;  2B4D B;  2VEZ A;  2ABZ A;  4LUA A;  3BI0 A;  4U5Y A;  4MHY A;  4AVB A;  2QYV A;  4YGO A;  5HVH A;  3DDD A;  3BHX A;  3WAB A;  2WYR A;  2AFW A;  2BOA A;  3W6X A;  3PB8 X;  3R9G A;  3SJG A;  4MRI A;  1JWQ A;  4M85 A;  1IID A;  2CXA A;  3R95 A;  2ZXV A;  2VXK A;  2ZEE A;  4CYQ A;  1VKC A;  4CAW A;  3H4Q A;  1CBX A;  4NGR A;  2RFH A;  5DWN A;  1QMU A;  2RC4 A;  2BO9 A;  4P4D A;  2J8R A;  1S7K A;  1ELM P;  3KKW A;  4JLY A;  3EXN A;  3IFE A;  2PQ8 A;  4BBH A;  2PJB A;  2FCK A;  1GYT A;  4XPD C;  3KHZ A;  1KZF A;  1LOK A;  1CPS A;  1CP6 A;  1Y0Y A;  4FD4 A;  5F49 A;  3SI0 A;  1XIX A;  3RNZ A;  2HV2 A;  4KSA A;  1Y9K A;  3K9U A;  4O23 A;  4EFD A;  4C2Y A;  5AG4 A;  3T90 A;  2ZOF A;  1XBU A;  3TX8 A;  2G0B A;  3PB6 X;  3IGR A;  4Q36 A;  4QC6 A;  4OC2 A;  5F48 A;  3W6S A;  3VH9 A;  4CAF A;  3NFZ A;  2AJ6 A;  2Z3M A;  3TOB A;  4KOU A;  4CGL A;  2ZEO A;  4JZ0 A;  1XMB A;  4CGP A;  2OH1 A;  5I4M A;  3P2H A;  5G22 A;  5IB9 A;  4X3R A;  1MJ9 A;  2P6G A;  4MMO A;  4WWV A;  5JGF A;  4NJR A;  2G3A A;  3BI1 A;  2AFS A;  4KOW A;  5D8N A;  2POK A;  5LYF A;  5LYL A;  1UFH A;  2B5G A;  3IWE A;  4HPS A;  4PV6 A;  2O53 A;  1S3Z A;  4Q7A A;  4RN7 A;  3CXQ A;  2GE3 A;  3DSB A;  2I79 A;  4DJL A;  5CBM A;  2QVP A;  1HDU A;  2FXF A;  5BWA B;  2EBJ A;  3MN8 A;  3FEC A;  1CG2 A;  2QIR A;  2B4D A;  4UEZ A;  1Z4R A;  4H2K A;  2C1C A;  2ZW6 A;  2F7V A;  3GLJ A;  4ONW A;  1QSM A;  1SQH A;  1Y7E A;  5G1Z A;  3GYA A;  1YME A;  1PYT B;  3CPA A;  5LRJ A;  4LX9 A;  1B6B A;  4FWU A;  4MCS A;  4BD9 A;  2PJC A;  2ZEL A;  3KQZ A;  2A4N A;  3E0K A;  4AVA A;  3WR7 A;  4A2Z A;  1XRY A;  2WZN A;  3WC5 A;  4UEF A;  5K8P A;  3LAC A;  1OBR A;  1YGH A;  3H8F A;  4WJB A;  2J8N A;  4UWI A;  1VGY A;  3DLJ A;  3R9E A;  4A30 A;  1IYK A;  4OIW A;  4Z65 A;  4UCN A;  1XMT A;  2BSW A;  2REF A;  1ZG9 A;  4OC0 A;  1NSL A;  5A27 A;  4GS4 A;  2B4B A;  2VZZ A;  1YX0 A;  4E0A A;  5IB0 A;  2Q43 A;  1M4L A;  7CPA A;  2ODF A;  3IJ3 A;  2ZEF A;  2EK9 A;  3JTK A;  1N71 A;  3BJ7 A;  1Y9W A;  2FIW A;  1Q7L A;  4UFW A;  4NGN A;  4F9V A;  1A2Z A;  3BLN A;  3D66 A;  3D2P A;  4PK3 A;  6CPA A;  4PXD A;  4X5K A;  4U9Z A;  2R8V A;  2Z3N A;  2IL4 A;  2R1I A;  4YU9 A;  3PB7 X;  3LD2 A;  4KOV A;  2Q4Y A;  4FD5 A;  4Q38 A;  1AMP A;  1S60 A;  2PC1 A;  4IF5 A;  4TNU A;  5JQ4 A;  4J3G A;  2OB0 A;  3F8K A;  4TWE A;  5K8O A;  4A95 A;  2PIY A;  4A31 A;  4DUK A;  2B3V A;  3CZX A;  2FVG A;  2X7B A;  1M4G A;  1IU8 A;  3JUW A;  2Z3P A;  3DNS A;  3LOD A;  3UY5 A;  3VAT A;  4ZI6 A;  5J8C A;  4QBJ A;  4QUS A;  4UIA A;  4CYO A;  2PJ3 A;  3IO1 A;  3GUX A;  4C68 A;  2CY2 A;  1FY7 A;  1Q2D A;  4JXQ A;  5AG6 A;  2HB6 A;  5HMN A;  3PP9 A;  4MY0 A;  2DPS A;  4MHD A;  4NSQ A;  4XPL A;  3CPX A;  3CDX A;  2ZW4 A;  4ZGY B;  4JXR A;  4R87 A;  4RI1 A;  3A9L A;  1QST A;  2J8M A;  4KSF A;  4LQ6 A;  4MFQ A;  4QB9 A;  3RBU A;  2Q0Y A;  4M6I A;  2AFO A;  4MFZ A;  3V38 A;  1YVK A;  2ZEP A;  4NJQ A;  4R9M A;  4A32 A;  1B87 A;  1S5K A;  2JDC A;  3C26 A;  3OWC A;  1Z8T A;  3KQX A;  2YND A;  4NF1 A;  3EC4 A;  4PXB A;  1R57 A;  5G20 A;  4KUB A;  5ISV A;  1VHS A;  3IC1 A;  2RB7 A;  1X12 A;  4NEX A;  1Q2Y A;  3B3W A;  3PRT A;  3TO9 A;  2O4H A;  4M6H A;  3I1U A;  1M1D A;  3SXN A;  3LWU A;  2V8V A;  2DXQ A;  1Y0R A;  4GM5 A;  2Q7S A;  5HVG A;  1Z8L A;  2NSM A;  2H5M A;  3KGQ A;  4B10 A;  1X10 A;  1TF9 A;  2K5T A;  4B5P B;  1Y7R A;  4AB7 A;  3JVN A;  3D2M A;  4FD7 A;  2I00 A;  3TC8 A;  4B5O A;  5KTD A;  2VI7 A;  1M44 A;  3PZJ A;  4FD6 A;  4UFX A;  2PJ9 A;  2PR8 A;  3QAH A;  3KI9 A;  5CNP A;  2ZEM A;  2J9A A;  1KWM A;  1YRE A;  3TCV A;  2P0W A;  1TXR A;  2QEC A;  4KOX A;  2BCO A;  2YNC A;  1WWZ A;  5LYD A;  1Z8X A;  1XOV A;  1BAV A;  2Z3L A;  2DF5 A;  1LFW A;  2IJZ A;  2ANP A;  4K3N A;  4ZX8 A;  1RXT A;  2ZED A;  3GY9 A;  4A38 A;  2V77 A;  3SJE A;  2C6G A;  2HC9 A;  2Z0Z A;  1DTD A;  4IAV A;  4YFJ A;  4A37 A;  4KS9 A;  1YK3 A;  3NE8 A;  2ZEH A;  2BEI A;  4PQA A;  2AFZ A;  2GRE A;  4P44 A;  3D7D A;  4R3K A;  1Z9U A;  3L2N A;  4CPA A;  3MRU A;  3V8I A;  4NCZ A;  1ELL P;  1IGB A;  4II9 A;  2XEJ A;  2HUZ A;  2ARH A;  4OC4 A;  4ZBG A;  5H84 A;  4F0Y A;  2AFM A;  3K2K A;  1YLO A;  2P6F A;  1NMT A;  1S7L A;  4OC5 A;  1YW4 A;  3D8P A;  2VZY A;  1CX8 A;  4FUU A;  1HDQ A;  1YR0 A;  2XEG A;  1LAP A;  2Z3O A;  3B35 A;  3PB4 X;  4JD6 A;  4AXV A;  2R98 A;  5J1Q A;  1LAN A;  2C6P A;  3I9S A;  1PU9 A;  2PR1 A;  2QJ8 A;  4DYO A;  2I3C A;  4PSW A;  4OC3 A;  3TT2 A;  3CXS A;  3DGV A;  3LMS A;  4IUS A;  2DPT A;  3S9M A;  4XPD B;  5IX3 A;  3D7F A;  4MJ8 A;  3PFO A;  2PRB A;  1Z2L A;  1ZLH A;  3CXP A;  4QVT A;  4OAE A;  5C82 A;  4MCQ A;  2AFX A;  3NH5 A;  4MFK A;  5IV0 A;  3KHX A;  3D67 A;  3B3C A;  4B13 A;  1ZO0 A;  2Z3K A;  2PJ4 A;  4L89 A;  1IYL A;  3JRU A;  1BOB A;  4R8F A;  3SI1 A;  1FT7 A;  3NE7 A;  5AG5 A;  5C88 A;  3IWG A;  2AE6 A;  3QAY A;  1V0C A;  3S6F A;  2CTB A;  2WPX A;  3CT9 A;  4NXY A;  4KOR A;  3H5Z A;  5LRK A;  4R7M A;  4E2A A;  3IU2 A;  3FBU A;  4UBR A;  2PJ2 A;  1ZLI A;  1JQG A;  3S6H A;  1QSO A;  4MXU A;  2YNC C;  4P4F A;  3N7Z A;  2JBK A;  4NGP A;  5ELY A;  4RUH A;  3FIX A;  4B14 A;  1YSJ A;  3D3S A;  5KTA A;  5KTC A;  1Z4E A;  3ISZ A;  2AFU A;  4HNW B;  1LCP A;  4FBE A;  1NE9 A;  4BMH A;  1UWY A;  4CGM A;  3FED A;  3EFA A;  1FNO A;  2D4O A;  4ORF A;  4P4J A;  4F0X A;  3B3V A;  1I12 A;  1F2P A;  2WPW A;  1LAM A;  4RS2 A;  2JEV A;  2GAN A;  4HKF A;  1GHE A;  5JH9 A;  1AUG A;  4MFL A;  2EUI A;  4MFP A;  1AYE A;  1IB1 E;  2WSA A;  3B8G A;  3PBB A;  4OME A;  2B3U A;  3R96 A;  4P6Y A;  2ZEG A;  3QNV A;  4UIB A;  2V8D A;  1TIQ A;  5DS0 A;  1YQE A;  4XNH B;  4DNC A;  1S7F A;  1F57 A;  2PJ7 A;  4NGQ A;  4NGM A;  3SJF A;  4PSX A;  2ZEN A;  1IY7 A;  1KUY A;  5THW A;  4ZYQ A;  2YNE A;  2PDO A;  3SXO A;  1TF8 A;  4EWT A;  2GLF A;  2FE7 A;  1IOI A;  1KUV A;  2IMO A;  2JEW A;  2PVW A;  1U6M A;  4MBU A;  4OKO A;  8CPA A;  1KUX A;  2PRQ A;  2G3T A;  4ZX9 A;  3RYO A;  2REE A;  3FVL A;  1ZG8 A;  2OU2 A;  4PPZ A;  4CAV A;  4Y49 B;  1BPM A;  4CYN A;  1BPN A;  4JYW A;  1L0C A;  4PXE A;  3RZA A;  4C2X A;  4HNX B;  1QSR A;  3FF3 A;  3T9Y A;  1I21 A;  1Z8W A;  4LQG A;  4OLL A;  5LYI A;  5DWM A;  4F6A A;  4H6Z A;  1OZP A;  5JPH A;  3FXT A;  5D29 A;  4P4I A;  3S6K A;  3WT4 A;  4C7I A;  2EK8 A;  1BO4 A;  2FT0 A;  1M4I A;  3FJU A;  3FRM A;  3N5F A;  3NH4 A;  4M6G A;  4W9Y A;  4X2T A;  1TKJ A;  2PJA A;  2Q44 A;  3FYN A;  4JWP A;  4CGO A;  4KOY A;  3VWE A;  4CS0 B;  5A28 A;  2Q51 A;  3ISX A;  1TKH A;  2CF4 A;  1I1D A;  4B11 A;  4EVY A;  1J4J A;  3NH8 A;  3SI2 A;  2OR4 A;  4ONU A;  3RO0 A;  1IOF A;  5E96 A;  3I3G A;  2FIA A;  3D4U A;  3PEI A;  5EBV A;  5GCN A;  1YW6 A;  2VBQ A;  4R76 A;  4IHM A;  3S9N A;  4YRH A;  1EE3 P;  1PCA A;  3ZJ0 A;  4OID A;  4UF4 A;  4CAX A;  4AG9 A;  3TFY A;  2Q04 A;  5CPA A;  2PE3 A;  3T8W A;  1P0H A;  2VL1 A;  2EWB A;  2F8H A;  4MHP A;  3ZZI A;  2Q4V A;  2PJ1 A;  3HLP A;  2C6C A;  2EO8 A;  3EY5 A;  2OZG A;  4AVC A;  3S9L A;  2PJ6 A;  1XE4 A;  1S7N A;  4R3L A;  5AGE A;  2ZW7 A;  2ZW5 A;  5K8N A;  5F46 A;  2GLJ A;  4OAD A;  3D7G A;  2KCW A;  2IQ6 A;  5H86 A;  3FB3 A;  3B2Y A;  4R6T A;  2GFQ A;  2NMT A;  4KOT A;  3FEE A;  2CIJ A;  4KUA A;  4MHN A;  4P4E A;  3FX6 A;  3GIU A;  4ZY0 A;  4A33 A;  2WUU A;  1QQ9 A;  4UCP A;  2PJ5 A;  1IIC A;  1BLL E;  2BUE A;  3PB9 X;  3TE4 A;  1PUA A;  1CP7 A;  4JJX A;  2F5I A;  4AG7 A;  4M3S A;  4CRZ B;  5LRG A;  1ARM A;  2G9D A;  4P10 A;  3IEH A;  2GU2 A;  3TTH A;  1M4D A;  4E8O A;  4KVM E;  5G21 A;  5J8F A;  1F2O A;  1XJO A;  2JBJ A;  2PIZ A;  2ATR A;  2B58 A;  4A39 A; 
#chains in the Genus database with same CATH homology
 3DR6 A;  3F0A A;  2YGW A;  2Z10 A;  4L8A A;  3S6G A;  4C2Z A;  4UWJ A;  3PGP A;  1QSN A;  3GKR A;  2QML A;  3FNC A;  4B5P A;  2O28 A;  1ON0 A;  2C27 A;  4KVO E;  2CNT A;  4B12 A;  1CJW A;  2ZPA A;  1WK4 A;  1CM0 A;  4XPK A;  2Q7B A;  2CNM A;  2D4P A;  4H89 A;  3TO6 A;  5I0C A;  1XEB A;  2EVN A;  3G3S A;  2FL4 A;  2GIV A;  4XNH C;  5AG7 A;  2FS5 A;  3TOA A;  3R1K A;  4CYP A;  1YVO A;  4CAE A;  2Y0M A;  1MK4 A;  3W91 A;  1XF8 A;  2R7H A;  4KVX A;  2CNS A;  1P4N A;  3R9F A;  4Y49 C;  1LRZ A;  4CRY B;  5HH1 A;  4R57 A;  5EC4 A;  1K4J A;  5GCN A;  2OZH A;  4KZT A;  1RO5 A;  2JDD A;  4U9Y A;  4MY3 A;  1MJA A;  4PK2 A;  1YLE A;  2Z11 A;  4CGN A;  2P6E A;  3P2F A;  1MJB A;  4MI4 A;  3F5B A;  4UCM A;  4KLV A;  4I49 A;  3QB8 A;  3EO4 A;  4KLW A;  5F47 A;  5FVJ A;  2HQY A;  4UA3 A;  4H6U A;  3G8W A;  4KOS A;  2PSW A;  3VWD A;  3DR8 A;  4UFV A;  3BJ8 A;  3TO7 A;  4K30 A;  2FSR A;  3IU1 A;  3MGD A;  2VQY A;  2B5G B;  2JLM A;  2OZU A;  4HNY B;  4MFJ A;  2BL1 A;  1Q2C A;  3SHP A;  4C7H A;  2B4D B;  2VEZ A;  4LUA A;  4U5Y A;  4AVB A;  4YGO A;  3DDD A;  3W6X A;  3R9G A;  4M85 A;  1IID A;  2CXA A;  3R95 A;  2ZXV A;  2VXK A;  4CYQ A;  1VKC A;  4CAW A;  3H4Q A;  5DWN A;  2RC4 A;  2J8R A;  1S7K A;  3KKW A;  4JLY A;  3EXN A;  2PQ8 A;  4BBH A;  2FCK A;  4XPD C;  1KZF A;  4FD4 A;  5F49 A;  1XIX A;  2HV2 A;  4KSA A;  1Y9K A;  3K9U A;  5AG4 A;  4C2Y A;  3T90 A;  3W6S A;  2G0B A;  4Q36 A;  3IGR A;  5F48 A;  4QC6 A;  4CAF A;  2AJ6 A;  2Z3M A;  3TOB A;  4KOU A;  4CGL A;  4CGP A;  2OH1 A;  3P2H A;  5G22 A;  1MJ9 A;  2P6G A;  2G3A A;  4KOW A;  1UFH A;  2B5G A;  3IWE A;  4PV6 A;  1S3Z A;  3CXQ A;  2GE3 A;  3DSB A;  2I79 A;  5BWA B;  2FXF A;  2QIR A;  2B4D A;  1Z4R A;  2ZW6 A;  3VWE A;  4B14 A;  5G1Z A;  1QSM A;  1SQH A;  3GYA A;  4LX9 A;  1B6B A;  4AVA A;  2A4N A;  3E0K A;  3WR7 A;  4A2Z A;  1YGH A;  2J8N A;  4UWI A;  3R9E A;  4A30 A;  1IYK A;  4UCN A;  1XMT A;  2BSW A;  2REF A;  1NSL A;  5A27 A;  4GS4 A;  2B4B A;  2VZZ A;  1YX0 A;  4E0A A;  5IB0 A;  3JTK A;  1N71 A;  3BJ7 A;  1Y9W A;  2FIW A;  4UFW A;  3BLN A;  3D2P A;  4PK3 A;  4X5K A;  4U9Z A;  2R8V A;  2Z3N A;  2IL4 A;  2R1I A;  3LD2 A;  4KOV A;  2Q4Y A;  4FD5 A;  4Q38 A;  1S60 A;  2PC1 A;  4IF5 A;  5JQ4 A;  4J3G A;  2OB0 A;  3F8K A;  4A95 A;  4A31 A;  2B3V A;  2X7B A;  1M4G A;  3JUW A;  2Z3P A;  3DNS A;  3LOD A;  3UY5 A;  5J8C A;  4QBJ A;  4QUS A;  4CYO A;  4C68 A;  2CY2 A;  1FY7 A;  1Q2D A;  4JXQ A;  5AG6 A;  5HMN A;  3PP9 A;  4MY0 A;  2DPS A;  4MHD A;  4NSQ A;  4XPL A;  2ZW4 A;  4ZGY B;  4JXR A;  4R87 A;  4RI1 A;  3A9L A;  1QST A;  2J8M A;  4KSF A;  4MFQ A;  4QB9 A;  2Q0Y A;  1YVK A;  4R9M A;  4A32 A;  1B87 A;  1S5K A;  2JDC A;  3C26 A;  3OWC A;  2YND A;  4NF1 A;  3EC4 A;  1R57 A;  5G20 A;  4KUB A;  5ISV A;  1VHS A;  4NEX A;  1Q2Y A;  3TO9 A;  1M1D A;  3SXN A;  2DXQ A;  2H5M A;  4B10 A;  2K5T A;  4B5P B;  1Y7R A;  4AB7 A;  3JVN A;  3D2M A;  4FD7 A;  2I00 A;  4B5O A;  5KTD A;  2VI7 A;  1M44 A;  3PZJ A;  4FD6 A;  4UFX A;  2PR8 A;  3QAH A;  5CNP A;  1YRE A;  3TCV A;  2P0W A;  2QEC A;  4KOX A;  2YNC A;  1WWZ A;  2Z3L A;  1RXT A;  3GY9 A;  2Z0Z A;  4YFJ A;  4KS9 A;  1YK3 A;  2BEI A;  4R3K A;  1Z9U A;  3V8I A;  4NCZ A;  4II9 A;  2HUZ A;  2ARH A;  4ZBG A;  5H84 A;  4F0Y A;  2P6F A;  1NMT A;  1S7L A;  3D8P A;  2VZY A;  1YR0 A;  2Z3O A;  4JD6 A;  2R98 A;  3I9S A;  1PU9 A;  2PR1 A;  4PSW A;  3TT2 A;  3CXS A;  4IUS A;  2DPT A;  4XPD B;  5IX3 A;  4MJ8 A;  2PRB A;  3CXP A;  4QVT A;  4OAE A;  5C82 A;  4MFK A;  5IV0 A;  4B13 A;  1ZO0 A;  2Z3K A;  4L89 A;  1IYL A;  1BOB A;  3NE7 A;  5AG5 A;  5C88 A;  3IWG A;  2AE6 A;  1V0C A;  3S6F A;  2WPX A;  4NXY A;  4KOR A;  3H5Z A;  4E2A A;  3IU2 A;  3FBU A;  4UBR A;  3S6H A;  1QSO A;  2YNC C;  3N7Z A;  3FIX A;  3D3S A;  5KTA A;  5KTC A;  1Z4E A;  4HNW B;  1NE9 A;  4BMH A;  4CGM A;  3EFA A;  2D4O A;  4ORF A;  4F0X A;  1I12 A;  2WPW A;  4RS2 A;  2JEV A;  2GAN A;  4HKF A;  1GHE A;  4MFL A;  2EUI A;  4MFP A;  2WSA A;  1IB1 E;  3B8G A;  2B3U A;  3R96 A;  1TIQ A;  4XNH B;  4DNC A;  1S7F A;  4PSX A;  1KUY A;  2YNE A;  2PDO A;  3SXO A;  2FE7 A;  1KUV A;  4MBU A;  1U6M A;  1KUX A;  2G3T A;  3RYO A;  2REE A;  4CAV A;  4CYN A;  2OU2 A;  4Y49 B;  4C2X A;  1L0C A;  4HNX B;  1QSR A;  3T9Y A;  1I21 A;  4OLL A;  5DWM A;  4F6A A;  4H6Z A;  1OZP A;  5JPH A;  3FXT A;  3S6K A;  4C7I A;  1BO4 A;  2FT0 A;  1M4I A;  3FRM A;  2Q44 A;  3FYN A;  4JWP A;  4CGO A;  4KOY A;  4CS0 B;  5A28 A;  1I1D A;  4B11 A;  4EVY A;  1J4J A;  4ONU A;  5E96 A;  3I3G A;  2FIA A;  5EBV A;  2VBQ A;  4YRH A;  4CAX A;  3ZJ0 A;  4AG9 A;  3TFY A;  2Q04 A;  1P0H A;  3ZZI A;  2Q4V A;  3EY5 A;  2OZG A;  4AVC A;  1XE4 A;  1S7N A;  4R3L A;  5AGE A;  2ZW7 A;  2ZW5 A;  5F46 A;  4OAD A;  2KCW A;  5H86 A;  3FB3 A;  4KOT A;  2NMT A;  4KUA A;  4A33 A;  2WUU A;  4UCP A;  1IIC A;  2BUE A;  3TE4 A;  1PUA A;  4JJX A;  2F5I A;  4AG7 A;  4M3S A;  4CRZ B;  3TTH A;  1M4D A;  4E8O A;  4KVM E;  5G21 A;  5J8F A;  4MFZ A;  2ATR A;  2B58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...