4A2ZA

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a pyrazole sulphonamide ligand
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of a novel class of orally active trypanocidal N-myristoyltransferase inhibitors.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 120
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4a2zA00
3JTKA 4CYQA 4UFXA 4A2ZA 2WSAA 4A95A 4CGLA 4CYNA 4C2ZA 4A30A 3H5ZA 5AG6A 4UCMA 4C7HA 4CAEA 4UFWA 3IWEA 5A28A 4CGPA 4UCNA 5AG7A 4CGOA 3IU1A 5A27A 2YNDA 5AG5A 4CYPA 5G1ZA 5G21A 4BBHA 4UFVA 5G20A 4C68A 4CGMA 4B14A 4B10A 5AG4A 4A33A 5G22A 4CGNA 4A32A 2WUUA 4C2XA 4CYOA 4UCPA 3IU2A 2YNCA 2YNEA 4B11A 4C7IA 4C2YA 2YNCC 4B12A 4CAFA 5AGEA 4A31A 4B13A
chains in the Genus database with same CATH superfamily
2B4DB 3CPXA 3KKWA 4MHDA 4OC4A 3UY5A 4AVBA 5C82A 1ELMP 2FS5A 4EMEA 2PJ0A 2IL4A 4P4IA 1IGBA 1UWYA 2PVVA 2ZEFA 4MJ8A 1S7KA 4MI4A 4Q7AA 5F49A 4AB7A 3V38A 2EVNA 4H89A 4X8IA 2J8RA 1S7FA 3T9YA 2PRBA 3RZAA 1P0HA 4FD4A 4AG7A 3DNSA 4F9UA 2D4PA 2F7VA 1TF9A 4NGTA 1RXTA 4KVME 5K8OA 3CZXA 3CXSA 4Q36A 3H8EA 3N5FA 5KTAA 4C2YA 2PJAA 3PB6X 1IB1E 5LRJA 1ZG9A 3JVNA 4KOXA 2ODFA 5LYDA 3FB3A 4KUAA 4C7HA 4F0YA 3WC5A 1PU9A 1IICA 4JXRA 1LOKA 1QSNA 4CRYB 1Z2LA 2ZPAA 2H5MA 1BAVA 4MRIA 2NYQA 3DGVA 2AE6A 3D7FA 1M4DA 3KQZA 5DWMA 3TE4A 1B6BA 4XPDC 1CPSA 5ELYA 3S6FA 4RI1A 3V7ZA 1X12A 5THWA 2VBQA 3QB8A 3TOAA 8CPAA 1BPNA 2Z3MA 3FEDA 2YNEA 3T90A 3B8GA 1L0CA 4QVTA 5FVJA 2BOAA 2PDOA 1FT7A 3E0KA 4OC5A 3GIUA 2PJ1A 4MCPA 1YREA 3K2KA 3PZJA 2V8GA 4NJQA 4PXBA 1FY7A 2ARHA 2R98A 3IWEA 2C1CA 4MMOA 1J4JA 3MN8A 4CGPA 1XOVA 3D7GA 3GY9A 4FUUA 2PJ2A 4K3NA 2PR1A 2BUEA 4MFQA 5E96A 2JDDA 3D68A 4OADA 4XNHC 4CGNA 3NH5A 2G3AA 2IQ6A 4XPLA 3CT9A 1YQEA 4PPZA 3IGRA 1QQ9A 5JGFA 1ARLA 3FF3A 2ZELA 4R3LA 4JLYA 4XPKA 3KR5A 1ZLHA 2BSWA 3JTKA 3VATA 1ON0A 3I9SA 3LD2A 4J3GA 2ATRA 2OR4A 3C26A 3IWGA 4U5YA 1B87A 2BEIA 4HNYB 4PK2A 3RNZA 4CAEA 2JEWA 3T8WA 1KWMA 1Q2CA 3GYAA 3MRUA 4P6YA 4P45A 1ELLP 2AJ6A 4MHZA 2CNTA 4NXYA 5G20A 3DDDA 1YSJA 5HMNA 2ZEMA 3FNCA 1K4JA 4W9YA 1BOBA 3BJ8A 1LAPA 5HVFA 2Q4YA 3IEHA 3OWCA 1M4GA 1XMBA 3EY5A 3FX6A 2QMLA 2HC9A 4YU9A 3BHXA 2Z3PA 3B3SA 2O53A 2R1IA 4WWVA 4ZY0A 5D8NA 1OBRA 2ZEGA 4PSXA 2PJ9A 3BI0A 2DEAA 3FMCA 4MHNA 2NMTA 1KUYA 3I1UA 2Q44A 4KOUA 3TX8A 4R8FA 4F0XA 4UFWA 4CPAA 1OZPA 1UFHA 1HEEA 2PJCA 4R3KA 4JD6A 2YNDA 4KLVA 5G1ZA 4ZI6A 4AXVA 2ZEHA 3KHXA 3GKRA 4H6UA 1CX8A 1M4LA 2B4DA 5F47A 1ARMA 1NE9A 1CP7A 4QBJA 4CYOA 2AFSA 1XE4A 1Z8XA 2ZW4A 3S9LA 3DR8A 4HPSA 4TNUA 4LQGA 5LYIA 3B3TA 1Y9KA 2YNCC 4F9VA 3H4QA 3WT4A 3QAHA 3TCVA 4KORA 3P2FA 4KVXA 1HDQA 3KL9A 3PRTA 4FD5A 4R76A 3B7IA 2WPXA 3D3SA 1YX0A 4MFKA 5C88A 4C2ZA 2PCUA 2PJ4A 2Z0ZA 1GHEA 1WWZA 3R95A 1SQHA 2FT0A 4OC3A 4KUBA 2I3CA 1KZFA 3PFOA 1IOIA 2GU2A 1IYKA 2EWBA 4ZX9A 3SI2A 2G3TA 3H8FA 4MHPA 2Q04A 4U9ZA 4RN7A 5H86A 4JXQA 4A33A 2AFZA 2DPTA 4MCRA 2PIYA 1LAMA 1S60A 3RO0A 1NMTA 1XEBA 4QB9A 4Z65A 2VZYA 4MFZA 2EBJA 2Z3KA 4YWYA 3CXQA 3DSBA 5HH1A 1Z8LA 2Z3LA 4PXDA 4H6ZA 1JQGA 1EE3P 1QMUA 2Z10A 3PB4X 4MFLA 4MCQA 4CYQA 5K8PA 3TO9A 2V8HA 5IB0A 3KZWA 2JEVA 1LFWA 1F2PA 4UF4A 1PYTB 2X7BA 4IK2A 4UIAA 3B3VA 2PE3A 2Z3OA 4TWEA 1YLOA 3WR7A 3D7DA 3NE8A 3KQXA 2XEIA 1IU8A 3WC6A 2XEJA 4BINA 4KVOE 1VIXA 5F46A 3FH4A 4UFVA 2Z11A 4MHYA 5LYLA 5F09A 2PC1A 2F5IA 4UIBA 1I1DA 2ZEEA 1XBUA 1GYTA 2FL4A 4NFRA 4NGMA 5GCNA 2J8MA 3FECA 1Y7RA 4OLLA 3FRMA 3FBUA 1VGYA 2OB0A 5DWNA 3SXNA 4EWTA 4PK3A 1V0CA 1XFOA 3R9EA 7CPAA 3EXNA 5CNPA 3ISXA 4CYNA 3TO7A 3H5ZA 1CPXA 1YVOA 2BCOA 5EC4A 3S6GA 3IIBA 2IJZA 3D8PA 1QSOA 4UEZA 4NGNA 4ZX8A 2JBKA 4KZTA 4P10A 2BO9A 2P6GA 1S7NA 1R43A 4P4BA 5AG7A 4CGOA 2OU2A 4K30A 1KUXA 4CYPA 1HDUA 4CAXA 1VHEA 1BLLE 2PJ8A 4UEFA 3W6XA 4DYOA 4R87A 3PB7X 4UWJA 1XRYA 3LMSA 4MXUA 3TFYA 1X10A 4U9YA 4A94A 1CP6A 3FIXA 4NCZA 5G22A 1Y9WA 2POKA 1NSLA 4HKFA 4NGRA 2PJ5A 5DS0A 4ZYQA 4JJXA 2EK9A 3B3WA 4QC6A 1H8LA 2O28A 5ISVA 4OIDA 3CPAA 3WC7A 4A2ZA 3DR6A 2WSAA 1S3ZA 3CXPA 4NEXA 1YW4A 4DUKA 4RUHA 4FD7A 2DPSA 4KOYA 2REEA 2B4BA 1RO5A 3MGDA 2PIZA 3KGQA 2EUIA 2CXAA 2RC4A 4M6IA 4UEEA 5LRKA 2FSRA 4AG9A 4LUAA 2PQ8A 2G0BA 4B5OA 3ISZA 3QAYA 1YLEA 2AFUA 3SHPA 3FJUA 5AG4A 4CS0B 1F57A 2A4NA 2C6PA 2J9AA 2GANA 2RB7A 3B3CA 3VWDA 3GUXA 1XMTA 2YGWA 1IIDA 4B11A 1YK3A 2JBJA 4B12A 4CAFA 1DE4C 1Y0RA 3I3GA 2WPWA 4A31A 2FE7A 4CAWA 1M1DA 1PUAA 4PV6A 4Y49C 2ZW5A 4IAVA 3S9NA 4II9A 1TKHA 4HNWB 3W91A 2OZUA 2PSWA 4ZBGA 1TIQA 2ZEPA 1Y0YA 5EBVA 1VKCA 3V8IA 3K9TA 4LQ6A 3RAMA 4E8OA 3B35A 1ZLIA 5G21A 4BBHA 4EFDA 4NGQA 1BPMA 2VEZA 1Z4EA 4OIWA 4FWUA 3K9UA 1CJWA 4JWPA 4ONWA 2VZZA 2QYVA 4FAIA 3D2PA 2ANPA 4OMEA 3F8KA 4O23A 2GFQA 2V77A 2VXKA 3IU2A 4P4DA 3WABA 3PBEA 3JRUA 4KSIA 4R6TA 1Y7EA 2REFA 3FXTA 4AVCA 3CDXA 3BXMA 3GB0A 3PEIA 3IFEA 4GS4A 5AGEA 5J8CA 1XF8A 1S5KA 3BJ7A 4FD6A 4NJRA 4P4EA 4NGSA 3ZJ0A 1MJAA 5HVGA 2CIJA 4ORFA 2VL1A 2PRQA 4NGPA 4DNCA 2WYRA 1MK4A 2HUZA 3PB8X 2ZOFA 4I49A 3W6SA 4NSQA 3NH8A 2PJ3A 2KCWA 2GREA 2QECA 2B5GB 3NFZA 4X5KA 2Q4VA 4EVYA 1IOFA 4OC1A 5IB9A 2DXQA 2Q0YA 4H2KA 4KSFA 4OAEA 1R3NA 3TT2A 4YFJA 3LWUA 4P4FA 4B5PB 1YVKA 1Q2DA 2PVWA 2PR8A 4XPDB 3SXOA 5CBMA 2CF4A 2VI7A 2C6CA 1CBXA 3VWEA 3G3SA 4PXCA 4A95A 4OKOA 1I21A 1VHSA 3F0AA 2RFHA 4R7MA 1IY7A 2O4HA 4A30A 5IX3A 3EC4A 5CPAA 5I4MA 4PSWA 2EK8A 4X2TA 2AFWA 4KOVA 5A27A 2HV2A 3G8WA 3S6HA 2AFMA 2P0WA 5LRGA 3KASA 4A38A 3GLJA 4E2AA 4KS9A 1LANA 4LX9A 4BD9A 2CNMA 2IMOA 5IV0A 2I79A 2OZGA 1FNOA 3DLJA 1QSMA 1TXRA 2CTCA 2WUUA 1N71A 4BMHA 2J8NA 2JLMA 2AFXA 2GE3A 3RBUA 4GXHA 4UBRA 2QJ8A 4C7IA 2XEGA 4M85A 1Z8WA 5JQ4A 3D67A 4MFJA 3R96A 4IUSA 1YGHA 1ZO0A 1MJ9A 2ABZA 2Z3NA 4XNHB 3TC8A 1LCPA 3SI1A 5F48A 4CGLA 4F6AA 5I0CA 2Q7SA 4UCMA 4KLWA 2XEFA 2ZW6A 3PGPA 2F8HA 2NSMA 4CAVA 2B3UA 3IU1A 2OOTA 1LRZA 4JZ0A 2B58A 5AG5A 4ZGYB 3F5BA 1RTQA 3VARA 4M6GA 4C68A 5JPHA 2QIRA 1WK4A 4B14A 2FXFA 2OH1A 3SI0A 3PB9X 4KOSA 1F2OA 4MY0A 4OC2A 4PQAA 4B10A 4A32A 1Z4RA 2ZXVA 1AMPA 3BI1A 4R9MA 3IC1A 1TKFA 3R1KA 3JUWA 2ZOGA 3R9FA 2K5TA 4M3SA 4B13A 3SJFA 3VH9A 2P6FA 3EFAA 1MJBA 2B3VA 2V8DA 3FEEA 1CG2A 3ZZIA 3SJXA 2GIVA 4MFPA 1TF8A 2FIAA 1TKJA 2Q51A 2ZW7A 1M4IA 2CTBA 2I00A 4L89A 3TTHA 2AFOA 1ZG7A 4ONUA 2PJBA 4Q38A 1NSAA 1YW6A 3LACA 2C27A 2R8VA 4Y49B 3H8GA 1ZG8A 1Z9UA 4KSAA 4UA3A 1PCAA 3D66A 2CNSA 1QSTA 5J1QA 4OP4A 3S6KA 1Z8TA 3N7ZA 4HNXB 4OC0A 3HLPA 4IF5A 3S9MA 3D7HA 3SJEA 2YNCA 5KTDA 4X3RA 4WJBA 2V8VA 3EO4A 2Q7BA 1S7LA 4R57A 3KI9A 5LYFA 3FVLA 4E0AA 2QVPA 4PXEA 5K8MA 1R57A 1JWQA 4UFXA 2JDCA 2DF5A 2FVGA 2Q4ZA 4QUSA 3IJ3A 3HUVA 2Y0MA 2FCKA 3P2HA 5AG6A 1VHOA 3NE7A 4M6HA 1I12A 2C6GA 4UCNA 4KOWA 3PP9A 4JYWA 1BO4A 4IHMA 3PFEA 1M44A 4P44A 5K8NA 3TOBA 4B6ZA 1P4NA 3KR4A 4ZY2A 5EMIA 4AVAA 1DTDA 4NF1A 1U6MA 4UWIA 4C2XA 4G1PA 4YRHA 2G9DA 1A2ZA 2PJ7A 4UCPA 5BWAB 4CRZB 1CM0A 3IWWA 3L2NA 1XIXA 2D4OA 3NA6A 5D29A 2ZENA 1Z5RA 2HB6A 4GM5A 3B2YA 2ZEOA 1Q7LA 1XJOA 3R9GA 5JM6A 2GLJA 2VQYA 1AUGA 3KHZA 3PBBA 3NH4A 1YR0A 4A39A 4A37A 2B5GA 3A9LA 2GLFA 3IO1A 4L8AA 2BL1A 5KTCA 4KOTA 5A28A 6CPAA 3BLNA 3QNVA 2EO8A 4P4JA 4FBEA 4MCSA 4MY3A 5JH9A 4B5PA 3LODA 2FIWA 4MBUA 4CGMA 1YMEA 4RS2A 3D4UA 4YGOA 5J8FA 2ZEDA 1IYLA 3D2MA 3RYOA 2CY2A 5HVHA 2Q43A 1KUVA 1AYEA 3TO6A 4DJLA 4F8ZA 4ZY1A 2PJ6A 1Q2YA 3FYNA 3SJGA 2WZNA 5H84A 5HXDA 2R7HA 2HQYA 2OZHA 2P6EA 1QSRA
chains in the Genus database with same CATH topology
2B4DB 3KKWA 4MHDA 3UY5A 4AVBA 5C82A 2FS5A 2IL4A 4MJ8A 1S7KA 4MI4A 5F49A 4AB7A 2EVNA 4H89A 2J8RA 1S7FA 3T9YA 2PRBA 1P0HA 4FD4A 4AG7A 3DNSA 2D4PA 1RXTA 4KVME 3CXSA 4Q36A 5KTAA 4C2YA 1IB1E 3JVNA 4KOXA 3FB3A 4KUAA 4C7HA 4F0YA 1PU9A 1IICA 4JXRA 1QSNA 4CRYB 2ZPAA 2H5MA 2AE6A 5DWMA 1M4DA 3TE4A 1B6BA 4XPDC 3S6FA 4RI1A 2VBQA 3QB8A 3TOAA 2Z3MA 2YNEA 3T90A 3B8GA 1L0CA 4QVTA 5FVJA 2PDOA 3E0KA 1YREA 3PZJA 1FY7A 2ARHA 2R98A 3IWEA 4CGPA 1J4JA 3GY9A 2PR1A 2BUEA 4MFQA 5E96A 2JDDA 4OADA 4XNHC 4CGNA 2G3AA 4XPLA 3IGRA 4R3LA 4JLYA 4XPKA 2BSWA 3JTKA 1ON0A 3I9SA 3LD2A 4J3GA 2ATRA 3IWGA 3C26A 4U5YA 1B87A 2BEIA 4HNYB 4PK2A 4CAEA 1Q2CA 3GYAA 2AJ6A 2CNTA 4NXYA 5G20A 3DDDA 5HMNA 3FNCA 1K4JA 1BOBA 3BJ8A 2Q4YA 3OWCA 1M4GA 3EY5A 2QMLA 2Z3PA 2R1IA 4PSXA 2NMTA 1KUYA 2Q44A 4KOUA 4F0XA 4UFWA 1OZPA 1UFHA 4R3KA 4JD6A 2YNDA 4KLVA 5G1ZA 3GKRA 4H6UA 2B4DA 5F47A 1NE9A 4QBJA 4CYOA 1XE4A 2ZW4A 3DR8A 1Y9KA 2YNCC 3H4QA 3QAHA 3TCVA 4KORA 3P2FA 4KVXA 4FD5A 2WPXA 3D3SA 1YX0A 4MFKA 5C88A 4C2ZA 2Z0ZA 1GHEA 1WWZA 3R95A 1SQHA 2FT0A 4KUBA 1KZFA 1IYKA 2G3TA 4U9ZA 2Q04A 5H86A 4JXQA 4A33A 2DPTA 1S60A 1NMTA 1XEBA 4QB9A 2VZYA 4MFZA 2Z3KA 3CXQA 3DSBA 5HH1A 2Z3LA 4H6ZA 2Z10A 4MFLA 4CYQA 3TO9A 5IB0A 2JEVA 2X7BA 2Z3OA 3WR7A 4KVOE 5F46A 4UFVA 2Z11A 2PC1A 2F5IA 1I1DA 2FL4A 5GCNA 2J8MA 5DWNA 1Y7RA 4OLLA 3FRMA 3FBUA 2OB0A 3SXNA 4PK3A 1V0CA 3R9EA 3EXNA 5CNPA 4CYNA 3TO7A 3H5ZA 1YVOA 5EC4A 3S6GA 3D8PA 1QSOA 4KZTA 5AG7A 2P6GA 4CGOA 1S7NA 2OU2A 4K30A 1KUXA 4CYPA 4CAXA 3W6XA 4R87A 4UWJA 3TFYA 4U9YA 3FIXA 4NCZA 5G22A 1Y9WA 1NSLA 4HKFA 4JJXA 4QC6A 2O28A 5ISVA 4A2ZA 3DR6A 2WSAA 1S3ZA 3CXPA 4NEXA 4FD7A 2DPSA 4KOYA 2REEA 2B4BA 1RO5A 3MGDA 2EUIA 2CXAA 2RC4A 2FSRA 4AG9A 4LUAA 2PQ8A 2G0BA 4B5OA 1YLEA 3SHPA 5AG4A 4CS0B 2A4NA 2GANA 3VWDA 1XMTA 2YGWA 1IIDA 4B11A 1YK3A 4B12A 4CAFA 3I3GA 2WPWA 4A31A 2FE7A 4CAWA 1M1DA 1PUAA 4PV6A 4Y49C 2ZW5A 4II9A 4HNWB 3W91A 2OZUA 2PSWA 4ZBGA 1TIQA 5EBVA 1VKCA 3V8IA 4E8OA 5G21A 4BBHA 2VEZA 1Z4EA 3K9UA 1CJWA 4JWPA 2VZZA 3D2PA 3F8KA 2VXKA 3IU2A 2REFA 3FXTA 4AVCA 5AGEA 5J8CA 4GS4A 1XF8A 1S5KA 3BJ7A 4FD6A 3ZJ0A 1MJAA 4ORFA 4DNCA 1MK4A 2HUZA 4I49A 3W6SA 4NSQA 2KCWA 2QECA 2B5GB 4X5KA 2Q4VA 4EVYA 2DXQA 2Q0YA 4KSFA 4OAEA 3TT2A 4YFJA 4B5PB 1YVKA 1Q2DA 4XPDB 2PR8A 3SXOA 2VI7A 3VWEA 3G3SA 4A95A 1I21A 1VHSA 3F0AA 5IX3A 4A30A 3EC4A 4PSWA 4KOVA 5A27A 2HV2A 3G8WA 3S6HA 2P0WA 4E2AA 4KS9A 4LX9A 2CNMA 5IV0A 2I79A 2OZGA 1QSMA 2WUUA 1N71A 4BMHA 2J8NA 2JLMA 2GE3A 4UBRA 4C7IA 4M85A 5JQ4A 4MFJA 3R96A 4IUSA 1YGHA 1ZO0A 1MJ9A 2Z3NA 4XNHB 4CGLA 5F48A 4F6AA 5I0CA 4UCMA 4KLWA 2ZW6A 3PGPA 4CAVA 2B3UA 3IU1A 1LRZA 2B58A 5AG5A 4ZGYB 3F5BA 4C68A 5JPHA 2QIRA 1WK4A 4B14A 2FXFA 2OH1A 4MY0A 4KOSA 4B10A 4A32A 1Z4RA 2ZXVA 4R9MA 3R1KA 3JUWA 3R9FA 2K5TA 4M3SA 4B13A 3ZZIA 2P6FA 3EFAA 1MJBA 2B3VA 2GIVA 4MFPA 2FIAA 3TTHA 2ZW7A 1M4IA 2I00A 4L89A 4ONUA 4Q38A 2C27A 2R8VA 4Y49B 1Z9UA 4KSAA 4UA3A 2CNSA 1QSTA 3S6KA 3N7ZA 4HNXB 4IF5A 2YNCA 5KTDA 2Q7BA 3EO4A 1S7LA 4R57A 4E0AA 1R57A 4UFXA 2JDCA 4QUSA 2Y0MA 2FCKA 3P2HA 5AG6A 3NE7A 4UCNA 1I12A 4KOWA 3PP9A 1BO4A 1M44A 3TOBA 1P4NA 4AVAA 4NF1A 1U6MA 4UWIA 4C2XA 4YRHA 5BWAB 4UCPA 4CRZB 1CM0A 1XIXA 2D4OA 3R9GA 2VQYA 1YR0A 2B5GA 3A9LA 4L8AA 2BL1A 5KTCA 4KOTA 5A28A 3BLNA 4MY3A 4B5PA 3LODA 2FIWA 4MBUA 4CGMA 4RS2A 4YGOA 5J8FA 1IYLA 3D2MA 3RYOA 2CY2A 1KUVA 3TO6A 1Q2YA 3FYNA 5H84A 2R7HA 2HQYA 2OZHA 2P6EA 1QSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTK A;  4CYQ A;  4UFX A;  4A2Z A;  2WSA A;  4A95 A;  4CGL A;  4CYN A;  4C2Z A;  4A30 A;  3H5Z A;  5AG6 A;  4UCM A;  4C7H A;  4CAE A;  4UFW A;  3IWE A;  5A28 A;  4CGP A;  4UCN A;  5AG7 A;  4CGO A;  3IU1 A;  5A27 A;  2YND A;  5AG5 A;  4CYP A;  5G1Z A;  5G21 A;  4BBH A;  4UFV A;  5G20 A;  4C68 A;  4CGM A;  4B14 A;  4B10 A;  5AG4 A;  4A33 A;  5G22 A;  4CGN A;  4A32 A;  2WUU A;  4C2X A;  4CYO A;  4UCP A;  3IU2 A;  2YNC A;  2YNE A;  4B11 A;  4C7I A;  4C2Y A;  2YNC C;  4B12 A;  4CAF A;  5AGE A;  4A31 A;  4B13 A; 
#chains in the Genus database with same CATH topology
 2B4D B;  3CPX A;  3KKW A;  4MHD A;  4OC4 A;  3UY5 A;  4AVB A;  5C82 A;  1ELM P;  2FS5 A;  4EME A;  2PJ0 A;  2IL4 A;  4P4I A;  1IGB A;  1UWY A;  2PVV A;  2ZEF A;  4MJ8 A;  1S7K A;  4MI4 A;  4Q7A A;  5F49 A;  4AB7 A;  3V38 A;  2EVN A;  4H89 A;  4X8I A;  2J8R A;  1S7F A;  3T9Y A;  2PRB A;  3RZA A;  1P0H A;  4FD4 A;  4AG7 A;  3DNS A;  4F9U A;  2D4P A;  2F7V A;  1TF9 A;  4NGT A;  1RXT A;  4KVM E;  5K8O A;  3CZX A;  3CXS A;  4Q36 A;  3H8E A;  3N5F A;  5KTA A;  4C2Y A;  2PJA A;  3PB6 X;  1IB1 E;  5LRJ A;  1ZG9 A;  3JVN A;  4KOX A;  2ODF A;  5LYD A;  3FB3 A;  4KUA A;  4C7H A;  4F0Y A;  3WC5 A;  1PU9 A;  1IIC A;  4JXR A;  1LOK A;  1QSN A;  4CRY B;  1Z2L A;  2ZPA A;  2H5M A;  1BAV A;  4MRI A;  2NYQ A;  3DGV A;  2AE6 A;  3D7F A;  1M4D A;  3KQZ A;  5DWM A;  3TE4 A;  1B6B A;  4XPD C;  1CPS A;  5ELY A;  3S6F A;  4RI1 A;  3V7Z A;  1X12 A;  5THW A;  2VBQ A;  3QB8 A;  3TOA A;  8CPA A;  1BPN A;  2Z3M A;  3FED A;  2YNE A;  3T90 A;  3B8G A;  1L0C A;  4QVT A;  5FVJ A;  2BOA A;  2PDO A;  1FT7 A;  3E0K A;  4OC5 A;  3GIU A;  2PJ1 A;  4MCP A;  1YRE A;  3K2K A;  3PZJ A;  2V8G A;  4NJQ A;  4PXB A;  1FY7 A;  2ARH A;  2R98 A;  3IWE A;  2C1C A;  4MMO A;  1J4J A;  3MN8 A;  4CGP A;  1XOV A;  3D7G A;  3GY9 A;  4FUU A;  2PJ2 A;  4K3N A;  2PR1 A;  2BUE A;  4MFQ A;  5E96 A;  2JDD A;  3D68 A;  4OAD A;  4XNH C;  4CGN A;  3NH5 A;  2G3A A;  2IQ6 A;  4XPL A;  3CT9 A;  1YQE A;  4PPZ A;  3IGR A;  1QQ9 A;  5JGF A;  1ARL A;  3FF3 A;  2ZEL A;  4R3L A;  4JLY A;  4XPK A;  3KR5 A;  1ZLH A;  2BSW A;  3JTK A;  3VAT A;  1ON0 A;  3I9S A;  3LD2 A;  4J3G A;  2ATR A;  2OR4 A;  3C26 A;  3IWG A;  4U5Y A;  1B87 A;  2BEI A;  4HNY B;  4PK2 A;  3RNZ A;  4CAE A;  2JEW A;  3T8W A;  1KWM A;  1Q2C A;  3GYA A;  3MRU A;  4P6Y A;  4P45 A;  1ELL P;  2AJ6 A;  4MHZ A;  2CNT A;  4NXY A;  5G20 A;  3DDD A;  1YSJ A;  5HMN A;  2ZEM A;  3FNC A;  1K4J A;  4W9Y A;  1BOB A;  3BJ8 A;  1LAP A;  5HVF A;  2Q4Y A;  3IEH A;  3OWC A;  1M4G A;  1XMB A;  3EY5 A;  3FX6 A;  2QML A;  2HC9 A;  4YU9 A;  3BHX A;  2Z3P A;  3B3S A;  2O53 A;  2R1I A;  4WWV A;  4ZY0 A;  5D8N A;  1OBR A;  2ZEG A;  4PSX A;  2PJ9 A;  3BI0 A;  2DEA A;  3FMC A;  4MHN A;  2NMT A;  1KUY A;  3I1U A;  2Q44 A;  4KOU A;  3TX8 A;  4R8F A;  4F0X A;  4UFW A;  4CPA A;  1OZP A;  1UFH A;  1HEE A;  2PJC A;  4R3K A;  4JD6 A;  2YND A;  4KLV A;  5G1Z A;  4ZI6 A;  4AXV A;  2ZEH A;  3KHX A;  3GKR A;  4H6U A;  1CX8 A;  1M4L A;  2B4D A;  5F47 A;  1ARM A;  1NE9 A;  1CP7 A;  4QBJ A;  4CYO A;  2AFS A;  1XE4 A;  1Z8X A;  2ZW4 A;  3S9L A;  3DR8 A;  4HPS A;  4TNU A;  4LQG A;  5LYI A;  3B3T A;  1Y9K A;  2YNC C;  4F9V A;  3H4Q A;  3WT4 A;  3QAH A;  3TCV A;  4KOR A;  3P2F A;  4KVX A;  1HDQ A;  3KL9 A;  3PRT A;  4FD5 A;  4R76 A;  3B7I A;  2WPX A;  3D3S A;  1YX0 A;  4MFK A;  5C88 A;  4C2Z A;  2PCU A;  2PJ4 A;  2Z0Z A;  1GHE A;  1WWZ A;  3R95 A;  1SQH A;  2FT0 A;  4OC3 A;  4KUB A;  2I3C A;  1KZF A;  3PFO A;  1IOI A;  2GU2 A;  1IYK A;  2EWB A;  4ZX9 A;  3SI2 A;  2G3T A;  3H8F A;  4MHP A;  2Q04 A;  4U9Z A;  4RN7 A;  5H86 A;  4JXQ A;  4A33 A;  2AFZ A;  2DPT A;  4MCR A;  2PIY A;  1LAM A;  1S60 A;  3RO0 A;  1NMT A;  1XEB A;  4QB9 A;  4Z65 A;  2VZY A;  4MFZ A;  2EBJ A;  2Z3K A;  4YWY A;  3CXQ A;  3DSB A;  5HH1 A;  1Z8L A;  2Z3L A;  4PXD A;  4H6Z A;  1JQG A;  1EE3 P;  1QMU A;  2Z10 A;  3PB4 X;  4MFL A;  4MCQ A;  4CYQ A;  5K8P A;  3TO9 A;  2V8H A;  5IB0 A;  3KZW A;  2JEV A;  1LFW A;  1F2P A;  4UF4 A;  1PYT B;  2X7B A;  4IK2 A;  4UIA A;  3B3V A;  2PE3 A;  2Z3O A;  4TWE A;  1YLO A;  3WR7 A;  3D7D A;  3NE8 A;  3KQX A;  2XEI A;  1IU8 A;  3WC6 A;  2XEJ A;  4BIN A;  4KVO E;  1VIX A;  5F46 A;  3FH4 A;  4UFV A;  2Z11 A;  4MHY A;  5LYL A;  5F09 A;  2PC1 A;  2F5I A;  4UIB A;  1I1D A;  2ZEE A;  1XBU A;  1GYT A;  2FL4 A;  4NFR A;  4NGM A;  5GCN A;  2J8M A;  3FEC A;  1Y7R A;  4OLL A;  3FRM A;  3FBU A;  1VGY A;  2OB0 A;  5DWN A;  3SXN A;  4EWT A;  4PK3 A;  1V0C A;  1XFO A;  3R9E A;  7CPA A;  3EXN A;  5CNP A;  3ISX A;  4CYN A;  3TO7 A;  3H5Z A;  1CPX A;  1YVO A;  2BCO A;  5EC4 A;  3S6G A;  3IIB A;  2IJZ A;  3D8P A;  1QSO A;  4UEZ A;  4NGN A;  4ZX8 A;  2JBK A;  4KZT A;  4P10 A;  2BO9 A;  2P6G A;  1S7N A;  1R43 A;  4P4B A;  5AG7 A;  4CGO A;  2OU2 A;  4K30 A;  1KUX A;  4CYP A;  1HDU A;  4CAX A;  1VHE A;  1BLL E;  2PJ8 A;  4UEF A;  3W6X A;  4DYO A;  4R87 A;  3PB7 X;  4UWJ A;  1XRY A;  3LMS A;  4MXU A;  3TFY A;  1X10 A;  4U9Y A;  4A94 A;  1CP6 A;  3FIX A;  4NCZ A;  5G22 A;  1Y9W A;  2POK A;  1NSL A;  4HKF A;  4NGR A;  2PJ5 A;  5DS0 A;  4ZYQ A;  4JJX A;  2EK9 A;  3B3W A;  4QC6 A;  1H8L A;  2O28 A;  5ISV A;  4OID A;  3CPA A;  3WC7 A;  4A2Z A;  3DR6 A;  2WSA A;  1S3Z A;  3CXP A;  4NEX A;  1YW4 A;  4DUK A;  4RUH A;  4FD7 A;  2DPS A;  4KOY A;  2REE A;  2B4B A;  1RO5 A;  3MGD A;  2PIZ A;  3KGQ A;  2EUI A;  2CXA A;  2RC4 A;  4M6I A;  4UEE A;  5LRK A;  2FSR A;  4AG9 A;  4LUA A;  2PQ8 A;  2G0B A;  4B5O A;  3ISZ A;  3QAY A;  1YLE A;  2AFU A;  3SHP A;  3FJU A;  5AG4 A;  4CS0 B;  1F57 A;  2A4N A;  2C6P A;  2J9A A;  2GAN A;  2RB7 A;  3B3C A;  3VWD A;  3GUX A;  1XMT A;  2YGW A;  1IID A;  4B11 A;  1YK3 A;  2JBJ A;  4B12 A;  4CAF A;  1DE4 C;  1Y0R A;  3I3G A;  2WPW A;  4A31 A;  2FE7 A;  4CAW A;  1M1D A;  1PUA A;  4PV6 A;  4Y49 C;  2ZW5 A;  4IAV A;  3S9N A;  4II9 A;  1TKH A;  4HNW B;  3W91 A;  2OZU A;  2PSW A;  4ZBG A;  1TIQ A;  2ZEP A;  1Y0Y A;  5EBV A;  1VKC A;  3V8I A;  3K9T A;  4LQ6 A;  3RAM A;  4E8O A;  3B35 A;  1ZLI A;  5G21 A;  4BBH A;  4EFD A;  4NGQ A;  1BPM A;  2VEZ A;  1Z4E A;  4OIW A;  4FWU A;  3K9U A;  1CJW A;  4JWP A;  4ONW A;  2VZZ A;  2QYV A;  4FAI A;  3D2P A;  2ANP A;  4OME A;  3F8K A;  4O23 A;  2GFQ A;  2V77 A;  2VXK A;  3IU2 A;  4P4D A;  3WAB A;  3PBE A;  3JRU A;  4KSI A;  4R6T A;  1Y7E A;  2REF A;  3FXT A;  4AVC A;  3CDX A;  3BXM A;  3GB0 A;  3PEI A;  3IFE A;  4GS4 A;  5AGE A;  5J8C A;  1XF8 A;  1S5K A;  3BJ7 A;  4FD6 A;  4NJR A;  4P4E A;  4NGS A;  3ZJ0 A;  1MJA A;  5HVG A;  2CIJ A;  4ORF A;  2VL1 A;  2PRQ A;  4NGP A;  4DNC A;  2WYR A;  1MK4 A;  2HUZ A;  3PB8 X;  2ZOF A;  4I49 A;  3W6S A;  4NSQ A;  3NH8 A;  2PJ3 A;  2KCW A;  2GRE A;  2QEC A;  2B5G B;  3NFZ A;  4X5K A;  2Q4V A;  4EVY A;  1IOF A;  4OC1 A;  5IB9 A;  2DXQ A;  2Q0Y A;  4H2K A;  4KSF A;  4OAE A;  1R3N A;  3TT2 A;  4YFJ A;  3LWU A;  4P4F A;  4B5P B;  1YVK A;  1Q2D A;  2PVW A;  2PR8 A;  4XPD B;  3SXO A;  5CBM A;  2CF4 A;  2VI7 A;  2C6C A;  1CBX A;  3VWE A;  3G3S A;  4PXC A;  4A95 A;  4OKO A;  1I21 A;  1VHS A;  3F0A A;  2RFH A;  4R7M A;  1IY7 A;  2O4H A;  4A30 A;  5IX3 A;  3EC4 A;  5CPA A;  5I4M A;  4PSW A;  2EK8 A;  4X2T A;  2AFW A;  4KOV A;  5A27 A;  2HV2 A;  3G8W A;  3S6H A;  2AFM A;  2P0W A;  5LRG A;  3KAS A;  4A38 A;  3GLJ A;  4E2A A;  4KS9 A;  1LAN A;  4LX9 A;  4BD9 A;  2CNM A;  2IMO A;  5IV0 A;  2I79 A;  2OZG A;  1FNO A;  3DLJ A;  1QSM A;  1TXR A;  2CTC A;  2WUU A;  1N71 A;  4BMH A;  2J8N A;  2JLM A;  2AFX A;  2GE3 A;  3RBU A;  4GXH A;  4UBR A;  2QJ8 A;  4C7I A;  2XEG A;  4M85 A;  1Z8W A;  5JQ4 A;  3D67 A;  4MFJ A;  3R96 A;  4IUS A;  1YGH A;  1ZO0 A;  1MJ9 A;  2ABZ A;  2Z3N A;  4XNH B;  3TC8 A;  1LCP A;  3SI1 A;  5F48 A;  4CGL A;  4F6A A;  5I0C A;  2Q7S A;  4UCM A;  4KLW A;  2XEF A;  2ZW6 A;  3PGP A;  2F8H A;  2NSM A;  4CAV A;  2B3U A;  3IU1 A;  2OOT A;  1LRZ A;  4JZ0 A;  2B58 A;  5AG5 A;  4ZGY B;  3F5B A;  1RTQ A;  3VAR A;  4M6G A;  4C68 A;  5JPH A;  2QIR A;  1WK4 A;  4B14 A;  2FXF A;  2OH1 A;  3SI0 A;  3PB9 X;  4KOS A;  1F2O A;  4MY0 A;  4OC2 A;  4PQA A;  4B10 A;  4A32 A;  1Z4R A;  2ZXV A;  1AMP A;  3BI1 A;  4R9M A;  3IC1 A;  1TKF A;  3R1K A;  3JUW A;  2ZOG A;  3R9F A;  2K5T A;  4M3S A;  4B13 A;  3SJF A;  3VH9 A;  2P6F A;  3EFA A;  1MJB A;  2B3V A;  2V8D A;  3FEE A;  1CG2 A;  3ZZI A;  3SJX A;  2GIV A;  4MFP A;  1TF8 A;  2FIA A;  1TKJ A;  2Q51 A;  2ZW7 A;  1M4I A;  2CTB A;  2I00 A;  4L89 A;  3TTH A;  2AFO A;  1ZG7 A;  4ONU A;  2PJB A;  4Q38 A;  1NSA A;  1YW6 A;  3LAC A;  2C27 A;  2R8V A;  4Y49 B;  3H8G A;  1ZG8 A;  1Z9U A;  4KSA A;  4UA3 A;  1PCA A;  3D66 A;  2CNS A;  1QST A;  5J1Q A;  4OP4 A;  3S6K A;  1Z8T A;  3N7Z A;  4HNX B;  4OC0 A;  3HLP A;  4IF5 A;  3S9M A;  3D7H A;  3SJE A;  2YNC A;  5KTD A;  4X3R A;  4WJB A;  2V8V A;  3EO4 A;  2Q7B A;  1S7L A;  4R57 A;  3KI9 A;  5LYF A;  3FVL A;  4E0A A;  2QVP A;  4PXE A;  5K8M A;  1R57 A;  1JWQ A;  4UFX A;  2JDC A;  2DF5 A;  2FVG A;  2Q4Z A;  4QUS A;  3IJ3 A;  3HUV A;  2Y0M A;  2FCK A;  3P2H A;  5AG6 A;  1VHO A;  3NE7 A;  4M6H A;  1I12 A;  2C6G A;  4UCN A;  4KOW A;  3PP9 A;  4JYW A;  1BO4 A;  4IHM A;  3PFE A;  1M44 A;  4P44 A;  5K8N A;  3TOB A;  4B6Z A;  1P4N A;  3KR4 A;  4ZY2 A;  5EMI A;  4AVA A;  1DTD A;  4NF1 A;  1U6M A;  4UWI A;  4C2X A;  4G1P A;  4YRH A;  2G9D A;  1A2Z A;  2PJ7 A;  4UCP A;  5BWA B;  4CRZ B;  1CM0 A;  3IWW A;  3L2N A;  1XIX A;  2D4O A;  3NA6 A;  5D29 A;  2ZEN A;  1Z5R A;  2HB6 A;  4GM5 A;  3B2Y A;  2ZEO A;  1Q7L A;  1XJO A;  3R9G A;  5JM6 A;  2GLJ A;  2VQY A;  1AUG A;  3KHZ A;  3PBB A;  3NH4 A;  1YR0 A;  4A39 A;  4A37 A;  2B5G A;  3A9L A;  2GLF A;  3IO1 A;  4L8A A;  2BL1 A;  5KTC A;  4KOT A;  5A28 A;  6CPA A;  3BLN A;  3QNV A;  2EO8 A;  4P4J A;  4FBE A;  4MCS A;  4MY3 A;  5JH9 A;  4B5P A;  3LOD A;  2FIW A;  4MBU A;  4CGM A;  1YME A;  4RS2 A;  3D4U A;  4YGO A;  5J8F A;  2ZED A;  1IYL A;  3D2M A;  3RYO A;  2CY2 A;  5HVH A;  2Q43 A;  1KUV A;  1AYE A;  3TO6 A;  4DJL A;  4F8Z A;  4ZY1 A;  2PJ6 A;  1Q2Y A;  3FYN A;  3SJG A;  2WZN A;  5H84 A;  5HXD A;  2R7H A;  2HQY A;  2OZH A;  2P6E A;  1QSR A; 
#chains in the Genus database with same CATH homology
 2B4D B;  3KKW A;  4MHD A;  3UY5 A;  4AVB A;  5C82 A;  2FS5 A;  2IL4 A;  4MJ8 A;  1S7K A;  4MI4 A;  5F49 A;  4AB7 A;  2EVN A;  4H89 A;  2J8R A;  1S7F A;  3T9Y A;  2PRB A;  1P0H A;  4FD4 A;  4AG7 A;  3DNS A;  2D4P A;  1RXT A;  4KVM E;  3CXS A;  4Q36 A;  5KTA A;  4C2Y A;  1IB1 E;  3JVN A;  4KOX A;  3FB3 A;  4KUA A;  4C7H A;  4F0Y A;  1PU9 A;  1IIC A;  4JXR A;  1QSN A;  4CRY B;  2ZPA A;  2H5M A;  2AE6 A;  5DWM A;  1M4D A;  3TE4 A;  1B6B A;  4XPD C;  3S6F A;  4RI1 A;  2VBQ A;  3QB8 A;  3TOA A;  2Z3M A;  2YNE A;  3T90 A;  3B8G A;  1L0C A;  4QVT A;  5FVJ A;  2PDO A;  3E0K A;  1YRE A;  3PZJ A;  1FY7 A;  2ARH A;  2R98 A;  3IWE A;  4CGP A;  1J4J A;  3GY9 A;  2PR1 A;  2BUE A;  4MFQ A;  5E96 A;  2JDD A;  4OAD A;  4XNH C;  4CGN A;  2G3A A;  4XPL A;  3IGR A;  4R3L A;  4JLY A;  4XPK A;  2BSW A;  3JTK A;  1ON0 A;  3I9S A;  3LD2 A;  4J3G A;  2ATR A;  3IWG A;  3C26 A;  4U5Y A;  1B87 A;  2BEI A;  4HNY B;  4PK2 A;  4CAE A;  1Q2C A;  3GYA A;  2AJ6 A;  2CNT A;  4NXY A;  5G20 A;  3DDD A;  5HMN A;  3FNC A;  1K4J A;  1BOB A;  3BJ8 A;  2Q4Y A;  3OWC A;  1M4G A;  3EY5 A;  2QML A;  2Z3P A;  2R1I A;  4PSX A;  2NMT A;  1KUY A;  2Q44 A;  4KOU A;  4F0X A;  4UFW A;  1OZP A;  1UFH A;  4R3K A;  4JD6 A;  2YND A;  4KLV A;  5G1Z A;  3GKR A;  4H6U A;  2B4D A;  5F47 A;  1NE9 A;  4QBJ A;  4CYO A;  1XE4 A;  2ZW4 A;  3DR8 A;  1Y9K A;  2YNC C;  3H4Q A;  3QAH A;  3TCV A;  4KOR A;  3P2F A;  4KVX A;  4FD5 A;  2WPX A;  3D3S A;  1YX0 A;  4MFK A;  5C88 A;  4C2Z A;  2Z0Z A;  1GHE A;  1WWZ A;  3R95 A;  1SQH A;  2FT0 A;  4KUB A;  1KZF A;  1IYK A;  2G3T A;  4U9Z A;  2Q04 A;  5H86 A;  4JXQ A;  4A33 A;  2DPT A;  1S60 A;  1NMT A;  1XEB A;  4QB9 A;  2VZY A;  4MFZ A;  2Z3K A;  3CXQ A;  3DSB A;  5HH1 A;  2Z3L A;  4H6Z A;  2Z10 A;  4MFL A;  4CYQ A;  3TO9 A;  5IB0 A;  2JEV A;  2X7B A;  2Z3O A;  3WR7 A;  4KVO E;  5F46 A;  4UFV A;  2Z11 A;  2PC1 A;  2F5I A;  1I1D A;  2FL4 A;  5GCN A;  2J8M A;  5DWN A;  1Y7R A;  4OLL A;  3FRM A;  3FBU A;  2OB0 A;  3SXN A;  4PK3 A;  1V0C A;  3R9E A;  3EXN A;  5CNP A;  4CYN A;  3TO7 A;  3H5Z A;  1YVO A;  5EC4 A;  3S6G A;  3D8P A;  1QSO A;  4KZT A;  5AG7 A;  2P6G A;  4CGO A;  1S7N A;  2OU2 A;  4K30 A;  1KUX A;  4CYP A;  4CAX A;  3W6X A;  4R87 A;  4UWJ A;  3TFY A;  4U9Y A;  3FIX A;  4NCZ A;  5G22 A;  1Y9W A;  1NSL A;  4HKF A;  4JJX A;  4QC6 A;  2O28 A;  5ISV A;  4A2Z A;  3DR6 A;  2WSA A;  1S3Z A;  3CXP A;  4NEX A;  4FD7 A;  2DPS A;  4KOY A;  2REE A;  2B4B A;  1RO5 A;  3MGD A;  2EUI A;  2CXA A;  2RC4 A;  2FSR A;  4AG9 A;  4LUA A;  2PQ8 A;  2G0B A;  4B5O A;  1YLE A;  3SHP A;  5AG4 A;  4CS0 B;  2A4N A;  2GAN A;  3VWD A;  1XMT A;  2YGW A;  1IID A;  4B11 A;  1YK3 A;  4B12 A;  4CAF A;  3I3G A;  2WPW A;  4A31 A;  2FE7 A;  4CAW A;  1M1D A;  1PUA A;  4PV6 A;  4Y49 C;  2ZW5 A;  4II9 A;  4HNW B;  3W91 A;  2OZU A;  2PSW A;  4ZBG A;  1TIQ A;  5EBV A;  1VKC A;  3V8I A;  4E8O A;  5G21 A;  4BBH A;  2VEZ A;  1Z4E A;  3K9U A;  1CJW A;  4JWP A;  2VZZ A;  3D2P A;  3F8K A;  2VXK A;  3IU2 A;  2REF A;  3FXT A;  4AVC A;  5AGE A;  5J8C A;  4GS4 A;  1XF8 A;  1S5K A;  3BJ7 A;  4FD6 A;  3ZJ0 A;  1MJA A;  4ORF A;  4DNC A;  1MK4 A;  2HUZ A;  4I49 A;  3W6S A;  4NSQ A;  2KCW A;  2QEC A;  2B5G B;  4X5K A;  2Q4V A;  4EVY A;  2DXQ A;  2Q0Y A;  4KSF A;  4OAE A;  3TT2 A;  4YFJ A;  4B5P B;  1YVK A;  1Q2D A;  4XPD B;  2PR8 A;  3SXO A;  2VI7 A;  3VWE A;  3G3S A;  4A95 A;  1I21 A;  1VHS A;  3F0A A;  5IX3 A;  4A30 A;  3EC4 A;  4PSW A;  4KOV A;  5A27 A;  2HV2 A;  3G8W A;  3S6H A;  2P0W A;  4E2A A;  4KS9 A;  4LX9 A;  2CNM A;  5IV0 A;  2I79 A;  2OZG A;  1QSM A;  2WUU A;  1N71 A;  4BMH A;  2J8N A;  2JLM A;  2GE3 A;  4UBR A;  4C7I A;  4M85 A;  5JQ4 A;  4MFJ A;  3R96 A;  4IUS A;  1YGH A;  1ZO0 A;  1MJ9 A;  2Z3N A;  4XNH B;  4CGL A;  5F48 A;  4F6A A;  5I0C A;  4UCM A;  4KLW A;  2ZW6 A;  3PGP A;  4CAV A;  2B3U A;  3IU1 A;  1LRZ A;  2B58 A;  5AG5 A;  4ZGY B;  3F5B A;  4C68 A;  5JPH A;  2QIR A;  1WK4 A;  4B14 A;  2FXF A;  2OH1 A;  4MY0 A;  4KOS A;  4B10 A;  4A32 A;  1Z4R A;  2ZXV A;  4R9M A;  3R1K A;  3JUW A;  3R9F A;  2K5T A;  4M3S A;  4B13 A;  3ZZI A;  2P6F A;  3EFA A;  1MJB A;  2B3V A;  2GIV A;  4MFP A;  2FIA A;  3TTH A;  2ZW7 A;  1M4I A;  2I00 A;  4L89 A;  4ONU A;  4Q38 A;  2C27 A;  2R8V A;  4Y49 B;  1Z9U A;  4KSA A;  4UA3 A;  2CNS A;  1QST A;  3S6K A;  3N7Z A;  4HNX B;  4IF5 A;  2YNC A;  5KTD A;  2Q7B A;  3EO4 A;  1S7L A;  4R57 A;  4E0A A;  1R57 A;  4UFX A;  2JDC A;  4QUS A;  2Y0M A;  2FCK A;  3P2H A;  5AG6 A;  3NE7 A;  4UCN A;  1I12 A;  4KOW A;  3PP9 A;  1BO4 A;  1M44 A;  3TOB A;  1P4N A;  4AVA A;  4NF1 A;  1U6M A;  4UWI A;  4C2X A;  4YRH A;  5BWA B;  4UCP A;  4CRZ B;  1CM0 A;  1XIX A;  2D4O A;  3R9G A;  2VQY A;  1YR0 A;  2B5G A;  3A9L A;  4L8A A;  2BL1 A;  5KTC A;  4KOT A;  5A28 A;  3BLN A;  4MY3 A;  4B5P A;  3LOD A;  2FIW A;  4MBU A;  4CGM A;  4RS2 A;  4YGO A;  5J8F A;  1IYL A;  3D2M A;  3RYO A;  2CY2 A;  1KUV A;  3TO6 A;  1Q2Y A;  3FYN A;  5H84 A;  2R7H A;  2HQY A;  2OZH A;  2P6E A;  1QSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...