4A2ZA

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a pyrazole sulphonamide ligand
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
411
structure length
411
Chain Sequence
b'AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of a novel class of orally active trypanocidal N-myristoyltransferase inhibitors.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 120
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4a2zA00
2YNCA 4B10A 5G21A 4CGNA 4UCPA 4C7IA 5AG6A 5G1ZA 3IU2A 5AGEA 4A30A 4UFXA 3IU1A 5G20A 4UFVA 4A33A 5A28A 4B13A 4UCNA 4B12A 4UFWA 2YNCC 4A31A 4CGPA 4B11A 4CGLA 5A27A 4A95A 4CAEA 4C2YA 4CGMA 4CYNA 4A2ZA 4A32A 5G22A 4CGOA 3JTKA 4BBHA 2WUUA 4CAFA 4CYOA 4CYPA 4C2ZA 4C68A 5AG5A 4UCMA 4B14A 5AG7A 3H5ZA 2WSAA 4C7HA 4CYQA 5AG4A 2YNEA 3IWEA 2YNDA 4C2XA
chains in the Genus database with same CATH superfamily
1YVOA 1M4IA 4R6TA 5K8OA 1TKJA 2K5TA 1S7NA 4CGNA 4MFKA 3IU2A 4IHMA 3BLNA 4KSAA 1BLLE 2G0BA 3FMCA 4TWEA 2PCUA 4XNHC 2OZHA 2ZENA 3G8WA 2BO9A 3NE7A 3D3SA 1R57A 4MFQA 3KQZA 1MJAA 1S3ZA 2IQ6A 4KSFA 2VZYA 1CX8A 1Z8XA 4A32A 4B5OA 2JDCA 3IEHA 3BJ7A 4XPKA 1KWMA 2OB0A 3PFOA 2ZOFA 1S7KA 1XMBA 3BHXA 2Z3NA 3DGVA 4ZYQA 4NGQA 3V38A 3CZXA 3NH8A 4QB9A 2XEGA 3FECA 2YNEA 4NGNA 4PV6A 4KUAA 2QIRA 1F57A 2B4DA 3SI0A 2VEZA 3BXMA 4M3SA 2C1CA 4ONWA 4AVBA 4MMOA 4EWTA 1XF8A 1IYKA 1Y9WA 3VATA 3PB6X 5AGEA 3MN8A 2ANPA 4MFPA 3IC1A 2PR1A 3KR5A 2DF5A 2PJ3A 3CT9A 4BD9A 3WR7A 4B11A 1F2OA 5ISVA 4PXEA 3IWGA 2Z11A 5THWA 2Q44A 2B4BA 2AFUA 3P2HA 4ONUA 4IAVA 4P6YA 3KHXA 3SI2A 1CPSA 1FNOA 1FT7A 2AFSA 2V77A 2PSWA 3CPXA 3H4QA 4J3GA 4RI1A 4UWJA 3WC5A 4UCMA 4PPZA 4B14A 5AG4A 1LCPA 3VH9A 1R43A 3P2FA 2GANA 4QBJA 1ON0A 4H6UA 4LUAA 1VIXA 2ZELA 2P0WA 2YNDA 2ZEPA 3IJ3A 2FL4A 3RNZA 3TOAA 5HXDA 1B6BA 2RFHA 3PBBA 3WC6A 4U9ZA 4JXRA 2F5IA 4B5PB 3PB4X 4MY0A 4GXHA 5EBVA 1IU8A 1PU9A 4H6ZA 5CBMA 3IU1A 2O53A 4XPDC 1RTQA 4ORFA 3FXTA 2C6CA 3T8WA 4LQGA 4P4FA 2C6PA 3WC7A 5A27A 5K8NA 2NYQA 2B3VA 1Q2DA 3NFZA 3FVLA 3ISZA 1UFHA 3RAMA 4JZ0A 2X7BA 3L2NA 4C68A 3FIXA 5J8CA 2JDDA 2G3TA 1YVKA 3TOBA 4HNWB 4KOXA 1QSRA 1YR0A 1R3NA 1TIQA 2IL4A 1Z8LA 3BJ8A 4BINA 4CAVA 4TNUA 1Z2LA 4F0YA 3TC8A 3FYNA 4JLYA 4ZGYB 2QJ8A 4KOVA 4OADA 3K9UA 2REFA 5ELYA 3KHZA 2C27A 1P4NA 5DWMA 2Q4VA 2EVNA 1NMTA 2VXKA 5CNPA 3PZJA 5G20A 1LAPA 3QB8A 2OZUA 2PVVA 4B12A 3DR6A 4LX9A 1I12A 2BEIA 4HNYB 4KOUA 4NXYA 5G22A 1ARMA 1LRZA 4PSXA 2Z10A 4CYPA 4HPSA 5LYLA 3HUVA 2O28A 2BCOA 4OLLA 3LWUA 1AYEA 4CYQA 3F5BA 4OIWA 4DUKA 2Q7SA 4B5PA 1XFOA 1YLOA 2PRQA 4LQ6A 3MRUA 1QSTA 2J8RA 2I79A 1BPMA 5FVJA 2OU2A 1YQEA 1F2PA 4W9YA 4YU9A 2Q7BA 2WPWA 2WPXA 3N5FA 4NJQA 4ZY1A 4R8FA 5IX3A 4UFXA 1FY7A 4UFVA 2G9DA 4EVYA 1Z8TA 2HUZA 1IOIA 2GE3A 2CXAA 3D7DA 3D66A 1MK4A 5F46A 4KVOE 1ZLHA 4KUBA 4A39A 3JUWA 4DJLA 4ZX9A 1RO5A 4UA3A 2DPTA 4YRHA 3TO9A 1CJWA 5IB0A 1UWYA 2Q0YA 5JM6A 2PJ2A 3FB3A 1Q7LA 2ZW5A 4MHDA 1M4GA 4FD5A 4BMHA 4H2KA 4B10A 4GS4A 1QQ9A 3B7IA 4KSIA 4UWIA 3KZWA 4YWYA 2Q4YA 4OP4A 4CS0B 4NFRA 5K8PA 5J1QA 3PFEA 2Q04A 3OWCA 4NSQA 3D7HA 3IFEA 1TKHA 1VHOA 1YW4A 2YGWA 4X2TA 3PB8X 2ZW7A 4U9YA 4A94A 2ODFA 1LOKA 3SJGA 4CGLA 4CYNA 1PCAA 4KZTA 4NF1A 4CAWA 4OC1A 4RUHA 1WWZA 3LODA 2FVGA 2AFWA 4NCZA 1KZFA 1ELLP 1MJ9A 4OC5A 4UIBA 1NSAA 1QSNA 3V8IA 4OKOA 1BPNA 5LRJA 1BO4A 1CG2A 1OZPA 5DS0A 5I0CA 3K2KA 3FF3A 3NA6A 4KOWA 5LYDA 4M85A 3DR8A 2PJ6A 1HDUA 3T9YA 2I3CA 5IV0A 5HVFA 1I21A 2GLJA 1Y7RA 2OOTA 1U6MA 4A33A 2EK8A 2ZEMA 3S6KA 3I9SA 2R8VA 4Q36A 2R7HA 8CPAA 3W6SA 1DTDA 3R96A 2AFXA 2XEIA 2ZEHA 2EWBA 5I4MA 4OC0A 1K4JA 4P10A 2DEAA 4OC2A 4CGOA 2FIWA 4PXCA 3VWDA 4QC6A 1L0CA 4ZBGA 3E0KA 2WUUA 4MFZA 4CAFA 2R98A 5LRKA 3IWWA 4C2ZA 3DSBA 5JPHA 1SQHA 2PRBA 1MJBA 2ABZA 1CM0A 1GHEA 4MXUA 4K30A 4R3LA 2V8HA 2Z3OA 1Z8WA 1Z9UA 4M6GA 4NGPA 1ZG7A 1S5KA 4IK2A 1QSMA 2PJ7A 3KASA 3R1KA 1Z4EA 1M44A 4P45A 3IIBA 2QECA 2ZPAA 3TCVA 3NH4A 5C88A 5A28A 4DNCA 2ARHA 2C6GA 3GKRA 2F8HA 3QNVA 1Y7EA 5F48A 4CGPA 2P6EA 3I1UA 4KOSA 5LRGA 5F47A 3PBEA 2ZW6A 1B87A 3D7GA 4RN7A 4WJBA 4P4IA 3MGDA 2B58A 4RS2A 5D29A 3H5ZA 2D4OA 5E96A 4P4DA 2HQYA 6CPAA 4IUSA 4Y49B 3JRUA 3H8FA 3F0AA 2FE7A 2RB7A 3RYOA 3TT2A 2AFMA 2JEWA 1XIXA 1IB1E 3VARA 1CBXA 2YNCA 1J4JA 4A38A 2CIJA 4I49A 4GM5A 3S9NA 4UCPA 2J8MA 3D7FA 3W6XA 3FEDA 4AXVA 2V8DA 1BAVA 3S9MA 4CRYB 3QAYA 1PYTB 3B8GA 4QUSA 2FS5A 2CF4A 3PB7X 4MHPA 4CGMA 2VBQA 4F9VA 3SJEA 3QAHA 2P6GA 2REEA 4FD4A 4JWPA 1YLEA 4MFJA 4NJRA 1P0HA 4R7MA 1QSOA 4NGMA 3GUXA 5HH1A 4C7HA 2DXQA 4M6HA 5BWAB 4FWUA 1ZLIA 2PJ1A 5CPAA 2AFZA 7CPAA 1ZO0A 4II9A 2J8NA 4F0XA 2NSMA 4AVCA 2VZZA 4OIDA 2JBJA 3T90A 4MY3A 2Q51A 4M6IA 3WABA 5KTCA 3B3WA 1NSLA 2GFQA 4HKFA 4UBRA 4XNHB 2CNTA 1VKCA 3GLJA 2FSRA 4AG7A 4MJ8A 5JGFA 1DE4C 1Z4RA 4KLWA 4FBEA 4OC3A 4HNXB 3HLPA 1ELMP 2PVWA 3DLJA 2PJCA 2EO8A 2PIYA 3TX8A 2GU2A 1AUGA 1XRYA 4MCPA 4MCQA 2KCWA 4X3RA 1Q2CA 3CDXA 3EO4A 4WWVA 3EFAA 2BOAA 2ZEFA 3DNSA 4PK2A 2XEFA 1S7FA 4ZI6A 4ZY0A 4NGTA 1X10A 5GCNA 2QVPA 3R9GA 1XOVA 4B6ZA 2AFOA 4UEEA 2EBJA 1S60A 2IJZA 3R9EA 4NGRA 2OZGA 1H8LA 2WZNA 4L8AA 3BI0A 4O23A 1CP7A 4A31A 4A95A 3B3SA 2ZEGA 1HEEA 2ZOGA 2PR8A 4E0AA 4JD6A 2PIZA 2PJAA 1LANA 1YW6A 2G3AA 2J9AA 3CXQA 4CYOA 2AE6A 5KTDA 2Y0MA 4MCSA 4PQAA 4Q38A 3W91A 2V8GA 2FT0A 3PRTA 2R1IA 2ATRA 2WSAA 2ZXVA 3R95A 3RBUA 3KR4A 4DYOA 2PJ8A 4R9MA 2XEJA 5F49A 1VHSA 4XPLA 4IF5A 3RO0A 2CTBA 4FAIA 1YX0A 2PQ8A 3NH5A 4ZY2A 5LYIA 4MCRA 4Q7AA 2ZEDA 2JLMA 3CXPA 5HVHA 5G1ZA 1V0CA 4KORA 1S7LA 4XPDB 2FIAA 3UY5A 3WT4A 2CY2A 3F8KA 3S6GA 3ZZIA 1JQGA 4QVTA 4MI4A 3I3GA 1ARLA 4AB7A 1A2ZA 3FNCA 2GREA 4U5YA 3SXOA 1IICA 4CAEA 3TE4A 4A37A 4CRZB 3B3CA 2PJ0A 2ZEEA 2CNMA 1XMTA 2Z3LA 3ZJ0A 4PK3A 3TTHA 4MHYA 1TKFA 2HC9A 4KOYA 2BUEA 3K9TA 2GIVA 3CPAA 2Z0ZA 1WK4A 3D4UA 1Y0RA 4KVXA 1RXTA 4MFLA 3JVNA 5C82A 5HMNA 1OBRA 5EMIA 4F9UA 1TF8A 2POKA 3B3VA 3KL9A 1KUXA 3SXNA 1KUYA 1KUVA 2I00A 4JJXA 4X5KA 2ZW4A 4P44A 4E2AA 2CTCA 3B35A 3S6FA 1CP6A 1XEBA 4P4EA 4B13A 1VHEA 5H84A 4MRIA 3TO7A 4UFWA 1XBUA 2PJ9A 1TXRA 4AVAA 4A2ZA 3KKWA 2B5GB 3C26A 4JYWA 3KI9A 4E8OA 4NGSA 3SJFA 4R76A 1LAMA 1QMUA 5F09A 4PXBA 3LMSA 4UEZA 2PJBA 2RC4A 2Z3MA 1IGBA 3IGRA 4CPAA 3EXNA 2WYRA 3S9LA 3B2YA 2JBKA 3GYAA 1ZG8A 4MHNA 2P6FA 3IO1A 1NE9A 4MBUA 3TO6A 4F8ZA 3FBUA 2A4NA 2JEVA 2VQYA 2VL1A 5AG6A 2Q43A 4R57A 2EUIA 5KTAA 3GIUA 4KOTA 1TF9A 5K8MA 4UIAA 2YNCC 1M1DA 4CAXA 4EFDA 2OR4A 3V7ZA 1JWQA 2Z3PA 4P4BA 1LFWA 1Y9KA 4ZX8A 2DPSA 5JH9A 2FCKA 4OAEA 5AG5A 3G3SA 1YREA 2OH1A 3NE8A 3PB9X 1IOFA 1AMPA 3H8GA 3IWEA 4UF4A 2B3UA 1PUAA 3LD2A 3BI1A 4OMEA 3D8PA 1M4DA 2H5MA 1CPXA 3N7ZA 1BOBA 4X8IA 4L89A 1XE4A 3LACA 2EK9A 5EC4A 4C2XA 1Q2YA 5H86A 1GYTA 1IY7A 3FH4A 1IYLA 4K3NA 4KLVA 4PXDA 4A30A 2BSWA 2B5GA 2HV2A 5JQ4A 2F7VA 4F6AA 4UCNA 3A9LA 4G1PA 2PE3A 5DWNA 5IB9A 3RZAA 3S6HA 4C2YA 3D2MA 3KGQA 3D67A 3FEEA 4FD7A 2IMOA 4MHZA 5HVGA 3JTKA 2QMLA 3PP9A 4BBHA 3FJUA 1I1DA 3CXSA 2NMTA 4YFJA 4JXQA 2CNSA 4KS9A 2VI7A 1YGHA 5LYFA 2Z3KA 4NEXA 3PGPA 4Y49C 2PJ4A 1M4LA 3FRMA 2HB6A 2V8VA 3KQXA 1IIDA 5G21A 1VGYA 2B4DB 4C7IA 4YGOA 2Q4ZA 2D4PA 1XJOA 2FXFA 3GY9A 2QYVA 2O4HA 1YSJA 2ZEOA 3SHPA 3SJXA 4FUUA 3GB0A 3EY5A 2PJ5A 4R87A 2BL1A 2AJ6A 4OC4A 3H8EA 1YMEA 1Z5RA 1Y0YA 3EC4A 3D68A 4P4JA 3DDDA 3R9FA 2PDOA 1YK3A 1N71A 1X12A 4FD6A 3VWEA 1HDQA 3TFYA 3FX6A 3PEIA 2GLFA 5AG7A 5D8NA 3D2PA 1ZG9A 3SI1A 4EMEA 1EE3P 4H89A 2PC1A 4UEFA 4R3KA 4AG9A 5J8FA 4KVME 4PSWA 4Z65A 3B3TA 3ISXA
chains in the Genus database with same CATH topology
1YVOA 1M4IA 2K5TA 1S7NA 4CGNA 4MFKA 3IU2A 4XNHC 3BLNA 4KSAA 2G0BA 2OZHA 3G8WA 3NE7A 3D3SA 1R57A 4MFQA 1MJAA 1S3ZA 4KSFA 2VZYA 4A32A 4B5OA 2JDCA 4XPKA 3BJ7A 2OB0A 1S7KA 2Z3NA 4QB9A 2YNEA 4PV6A 4KUAA 2QIRA 2B4DA 2VEZA 4M3SA 4AVBA 1XF8A 1IYKA 1Y9WA 5AGEA 4MFPA 2PR1A 3WR7A 4B11A 5ISVA 3IWGA 2Z11A 2Q44A 2B4BA 3P2HA 4ONUA 4UWJA 2PSWA 4RI1A 3H4QA 4J3GA 4UCMA 4B14A 5AG4A 3P2FA 2GANA 4QBJA 1ON0A 4H6UA 4LUAA 2P0WA 2YNDA 2FL4A 3TOAA 1B6BA 4B5PB 4U9ZA 4JXRA 2F5IA 4MY0A 5EBVA 4H6ZA 1PU9A 3IU1A 4XPDC 4ORFA 3FXTA 5A27A 2B3VA 1Q2DA 1UFHA 2X7BA 4C68A 3FIXA 5J8CA 2JDDA 2G3TA 1YVKA 3TOBA 4HNWB 4KOXA 1QSRA 1YR0A 1TIQA 2IL4A 3BJ8A 4CAVA 4F0YA 3FYNA 4JLYA 4ZGYB 4KOVA 4OADA 3K9UA 2REFA 2C27A 1P4NA 5DWMA 2Q4VA 2EVNA 1NMTA 2VXKA 5CNPA 3PZJA 5G20A 3QB8A 2OZUA 4B12A 3DR6A 4LX9A 1I12A 2BEIA 4HNYB 4KOUA 4NXYA 5G22A 1LRZA 4PSXA 2Z10A 4CYPA 2O28A 4OLLA 4CYQA 3F5BA 4B5PA 1QSTA 2J8RA 2I79A 5FVJA 2OU2A 2Q7BA 2WPWA 2WPXA 5IX3A 4UFXA 1FY7A 4UFVA 4EVYA 2HUZA 2GE3A 2CXAA 1MK4A 5F46A 4KVOE 4KUBA 3JUWA 1RO5A 4UA3A 2DPTA 4YRHA 3TO9A 1CJWA 5IB0A 2Q0YA 3FB3A 4MHDA 2ZW5A 1M4GA 4FD5A 4BMHA 4B10A 4GS4A 4UWIA 2Q4YA 4CS0B 2Q04A 3OWCA 4NSQA 2YGWA 4CGLA 4U9YA 2ZW7A 4CYNA 4NF1A 4KZTA 4CAWA 1WWZA 3LODA 4NCZA 1KZFA 1MJ9A 1QSNA 3V8IA 1BO4A 1OZPA 5I0CA 4KOWA 4M85A 3DR8A 3T9YA 5IV0A 1I21A 1Y7RA 1U6MA 4A33A 3S6KA 3I9SA 2R8VA 4Q36A 2R7HA 3W6SA 3R96A 1K4JA 4CGOA 2FIWA 4QC6A 1L0CA 4ZBGA 3E0KA 2WUUA 4MFZA 4CAFA 2R98A 4C2ZA 3DSBA 5JPHA 1SQHA 2PRBA 1MJBA 1CM0A 1GHEA 4K30A 4R3LA 2Z3OA 1Z9UA 1S5KA 1QSMA 3R1KA 1Z4EA 1M44A 2QECA 2ZPAA 3TCVA 5C88A 5A28A 4DNCA 2ARHA 3GKRA 5F48A 4CGPA 2P6EA 4KOSA 5F47A 2ZW6A 1B87A 3MGDA 2B58A 4RS2A 3H5ZA 2D4OA 5E96A 2HQYA 4IUSA 4Y49B 3F0AA 2FE7A 3RYOA 3TT2A 1IB1E 1XIXA 2YNCA 1J4JA 4I49A 4UCPA 2J8MA 3W6XA 4CRYB 3B8GA 4QUSA 2FS5A 4CGMA 2VBQA 3QAHA 2P6GA 2REEA 4FD4A 4JWPA 1YLEA 4MFJA 1P0HA 1QSOA 5HH1A 4C7HA 2DXQA 5BWAB 1ZO0A 4II9A 2J8NA 4F0XA 4AVCA 2VZZA 3T90A 4MY3A 5KTCA 1NSLA 4HKFA 4UBRA 4XNHB 2CNTA 1VKCA 2FSRA 4AG7A 4MJ8A 1Z4RA 4KLWA 4HNXB 2KCWA 1Q2CA 3EO4A 3EFAA 3DNSA 4PK2A 1S7FA 5GCNA 3R9GA 1S60A 3R9EA 2OZGA 4L8AA 4A31A 4A95A 2PR8A 4E0AA 4JD6A 3CXQA 2G3AA 4CYOA 2AE6A 5KTDA 2Y0MA 3W91A 4Q38A 2FT0A 2ZXVA 2R1IA 2ATRA 2WSAA 3R95A 4R9MA 5F49A 1VHSA 4XPLA 4IF5A 1YX0A 2PQ8A 2JLMA 3CXPA 5G1ZA 1V0CA 4KORA 1S7LA 4XPDB 2FIAA 3UY5A 2CY2A 3F8KA 3S6GA 3ZZIA 4QVTA 4MI4A 3I3GA 4AB7A 3TE4A 3FNCA 4U5YA 3SXOA 4CAEA 1IICA 4CRZB 2CNMA 1XMTA 2Z3LA 3ZJ0A 4PK3A 3TTHA 4KOYA 2BUEA 2GIVA 2Z0ZA 1WK4A 4KVXA 4MFLA 1RXTA 5C82A 3JVNA 5HMNA 1KUXA 3SXNA 1KUYA 1KUVA 2I00A 4JJXA 4X5KA 2ZW4A 4E2AA 3S6FA 1XEBA 4B13A 5H84A 3TO7A 4UFWA 4AVAA 4A2ZA 3KKWA 2B5GB 3C26A 4E8OA 2RC4A 2Z3MA 3IGRA 3EXNA 3GYAA 2P6FA 1NE9A 4MBUA 3TO6A 3FBUA 2A4NA 2JEVA 2VQYA 5AG6A 4R57A 2EUIA 5KTAA 4KOTA 2YNCC 1M1DA 4CAXA 2Z3PA 1Y9KA 2DPSA 2FCKA 4OAEA 5AG5A 3G3SA 1YREA 2OH1A 3IWEA 2B3UA 1PUAA 3LD2A 3N7ZA 1M4DA 2H5MA 3D8PA 1BOBA 4L89A 1XE4A 5EC4A 4C2XA 1Q2YA 5H86A 1IYLA 4A30A 4KLVA 5JQ4A 2BSWA 2B5GA 2HV2A 4F6AA 4UCNA 3A9LA 5DWNA 3S6HA 4C2YA 3D2MA 4FD7A 3JTKA 2QMLA 3PP9A 4BBHA 1I1DA 3CXSA 2NMTA 4YFJA 4JXQA 2CNSA 4KS9A 2VI7A 1YGHA 2Z3KA 4NEXA 3PGPA 4Y49C 3FRMA 5G21A 1IIDA 2B4DB 4C7IA 4YGOA 2D4PA 2FXFA 3GY9A 3VWDA 3SHPA 4R87A 3EY5A 2BL1A 2AJ6A 3EC4A 3R9FA 3DDDA 2PDOA 1YK3A 1N71A 4FD6A 3VWEA 3TFYA 5AG7A 3D2PA 4H89A 2PC1A 4R3KA 4AG9A 5J8FA 4KVME 4PSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNC A;  4B10 A;  5G21 A;  4CGN A;  4UCP A;  4C7I A;  5AG6 A;  5G1Z A;  3IU2 A;  5AGE A;  4A30 A;  4UFX A;  3IU1 A;  5G20 A;  4UFV A;  4A33 A;  5A28 A;  4B13 A;  4UCN A;  4B12 A;  4UFW A;  2YNC C;  4A31 A;  4CGP A;  4B11 A;  4CGL A;  5A27 A;  4A95 A;  4CAE A;  4C2Y A;  4CGM A;  4CYN A;  4A2Z A;  4A32 A;  5G22 A;  4CGO A;  3JTK A;  4BBH A;  2WUU A;  4CAF A;  4CYO A;  4CYP A;  4C2Z A;  4C68 A;  5AG5 A;  4UCM A;  4B14 A;  5AG7 A;  3H5Z A;  2WSA A;  4C7H A;  4CYQ A;  5AG4 A;  2YNE A;  3IWE A;  2YND A;  4C2X A; 
#chains in the Genus database with same CATH topology
 1YVO A;  1M4I A;  4R6T A;  5K8O A;  1TKJ A;  2K5T A;  1S7N A;  4CGN A;  4MFK A;  3IU2 A;  4IHM A;  3BLN A;  4KSA A;  1BLL E;  2G0B A;  3FMC A;  4TWE A;  2PCU A;  4XNH C;  2OZH A;  2ZEN A;  3G8W A;  2BO9 A;  3NE7 A;  3D3S A;  1R57 A;  4MFQ A;  3KQZ A;  1MJA A;  1S3Z A;  2IQ6 A;  4KSF A;  2VZY A;  1CX8 A;  1Z8X A;  4A32 A;  4B5O A;  2JDC A;  3IEH A;  3BJ7 A;  4XPK A;  1KWM A;  2OB0 A;  3PFO A;  2ZOF A;  1S7K A;  1XMB A;  3BHX A;  2Z3N A;  3DGV A;  4ZYQ A;  4NGQ A;  3V38 A;  3CZX A;  3NH8 A;  4QB9 A;  2XEG A;  3FEC A;  2YNE A;  4NGN A;  4PV6 A;  4KUA A;  2QIR A;  1F57 A;  2B4D A;  3SI0 A;  2VEZ A;  3BXM A;  4M3S A;  2C1C A;  4ONW A;  4AVB A;  4MMO A;  4EWT A;  1XF8 A;  1IYK A;  1Y9W A;  3VAT A;  3PB6 X;  5AGE A;  3MN8 A;  2ANP A;  4MFP A;  3IC1 A;  2PR1 A;  3KR5 A;  2DF5 A;  2PJ3 A;  3CT9 A;  4BD9 A;  3WR7 A;  4B11 A;  1F2O A;  5ISV A;  4PXE A;  3IWG A;  2Z11 A;  5THW A;  2Q44 A;  2B4B A;  2AFU A;  3P2H A;  4ONU A;  4IAV A;  4P6Y A;  3KHX A;  3SI2 A;  1CPS A;  1FNO A;  1FT7 A;  2AFS A;  2V77 A;  2PSW A;  3CPX A;  3H4Q A;  4J3G A;  4RI1 A;  4UWJ A;  3WC5 A;  4UCM A;  4PPZ A;  4B14 A;  5AG4 A;  1LCP A;  3VH9 A;  1R43 A;  3P2F A;  2GAN A;  4QBJ A;  1ON0 A;  4H6U A;  4LUA A;  1VIX A;  2ZEL A;  2P0W A;  2YND A;  2ZEP A;  3IJ3 A;  2FL4 A;  3RNZ A;  3TOA A;  5HXD A;  1B6B A;  2RFH A;  3PBB A;  3WC6 A;  4U9Z A;  4JXR A;  2F5I A;  4B5P B;  3PB4 X;  4MY0 A;  4GXH A;  5EBV A;  1IU8 A;  1PU9 A;  4H6Z A;  5CBM A;  3IU1 A;  2O53 A;  4XPD C;  1RTQ A;  4ORF A;  3FXT A;  2C6C A;  3T8W A;  4LQG A;  4P4F A;  2C6P A;  3WC7 A;  5A27 A;  5K8N A;  2NYQ A;  2B3V A;  1Q2D A;  3NFZ A;  3FVL A;  3ISZ A;  1UFH A;  3RAM A;  4JZ0 A;  2X7B A;  3L2N A;  4C68 A;  3FIX A;  5J8C A;  2JDD A;  2G3T A;  1YVK A;  3TOB A;  4HNW B;  4KOX A;  1QSR A;  1YR0 A;  1R3N A;  1TIQ A;  2IL4 A;  1Z8L A;  3BJ8 A;  4BIN A;  4CAV A;  4TNU A;  1Z2L A;  4F0Y A;  3TC8 A;  3FYN A;  4JLY A;  4ZGY B;  2QJ8 A;  4KOV A;  4OAD A;  3K9U A;  2REF A;  5ELY A;  3KHZ A;  2C27 A;  1P4N A;  5DWM A;  2Q4V A;  2EVN A;  1NMT A;  2VXK A;  5CNP A;  3PZJ A;  5G20 A;  1LAP A;  3QB8 A;  2OZU A;  2PVV A;  4B12 A;  3DR6 A;  4LX9 A;  1I12 A;  2BEI A;  4HNY B;  4KOU A;  4NXY A;  5G22 A;  1ARM A;  1LRZ A;  4PSX A;  2Z10 A;  4CYP A;  4HPS A;  5LYL A;  3HUV A;  2O28 A;  2BCO A;  4OLL A;  3LWU A;  1AYE A;  4CYQ A;  3F5B A;  4OIW A;  4DUK A;  2Q7S A;  4B5P A;  1XFO A;  1YLO A;  2PRQ A;  4LQ6 A;  3MRU A;  1QST A;  2J8R A;  2I79 A;  1BPM A;  5FVJ A;  2OU2 A;  1YQE A;  1F2P A;  4W9Y A;  4YU9 A;  2Q7B A;  2WPW A;  2WPX A;  3N5F A;  4NJQ A;  4ZY1 A;  4R8F A;  5IX3 A;  4UFX A;  1FY7 A;  4UFV A;  2G9D A;  4EVY A;  1Z8T A;  2HUZ A;  1IOI A;  2GE3 A;  2CXA A;  3D7D A;  3D66 A;  1MK4 A;  5F46 A;  4KVO E;  1ZLH A;  4KUB A;  4A39 A;  3JUW A;  4DJL A;  4ZX9 A;  1RO5 A;  4UA3 A;  2DPT A;  4YRH A;  3TO9 A;  1CJW A;  5IB0 A;  1UWY A;  2Q0Y A;  5JM6 A;  2PJ2 A;  3FB3 A;  1Q7L A;  2ZW5 A;  4MHD A;  1M4G A;  4FD5 A;  4BMH A;  4H2K A;  4B10 A;  4GS4 A;  1QQ9 A;  3B7I A;  4KSI A;  4UWI A;  3KZW A;  4YWY A;  2Q4Y A;  4OP4 A;  4CS0 B;  4NFR A;  5K8P A;  5J1Q A;  3PFE A;  2Q04 A;  3OWC A;  4NSQ A;  3D7H A;  3IFE A;  1TKH A;  1VHO A;  1YW4 A;  2YGW A;  4X2T A;  3PB8 X;  2ZW7 A;  4U9Y A;  4A94 A;  2ODF A;  1LOK A;  3SJG A;  4CGL A;  4CYN A;  1PCA A;  4KZT A;  4NF1 A;  4CAW A;  4OC1 A;  4RUH A;  1WWZ A;  3LOD A;  2FVG A;  2AFW A;  4NCZ A;  1KZF A;  1ELL P;  1MJ9 A;  4OC5 A;  4UIB A;  1NSA A;  1QSN A;  3V8I A;  4OKO A;  1BPN A;  5LRJ A;  1BO4 A;  1CG2 A;  1OZP A;  5DS0 A;  5I0C A;  3K2K A;  3FF3 A;  3NA6 A;  4KOW A;  5LYD A;  4M85 A;  3DR8 A;  2PJ6 A;  1HDU A;  3T9Y A;  2I3C A;  5IV0 A;  5HVF A;  1I21 A;  2GLJ A;  1Y7R A;  2OOT A;  1U6M A;  4A33 A;  2EK8 A;  2ZEM A;  3S6K A;  3I9S A;  2R8V A;  4Q36 A;  2R7H A;  8CPA A;  3W6S A;  1DTD A;  3R96 A;  2AFX A;  2XEI A;  2ZEH A;  2EWB A;  5I4M A;  4OC0 A;  1K4J A;  4P10 A;  2DEA A;  4OC2 A;  4CGO A;  2FIW A;  4PXC A;  3VWD A;  4QC6 A;  1L0C A;  4ZBG A;  3E0K A;  2WUU A;  4MFZ A;  4CAF A;  2R98 A;  5LRK A;  3IWW A;  4C2Z A;  3DSB A;  5JPH A;  1SQH A;  2PRB A;  1MJB A;  2ABZ A;  1CM0 A;  1GHE A;  4MXU A;  4K30 A;  4R3L A;  2V8H A;  2Z3O A;  1Z8W A;  1Z9U A;  4M6G A;  4NGP A;  1ZG7 A;  1S5K A;  4IK2 A;  1QSM A;  2PJ7 A;  3KAS A;  3R1K A;  1Z4E A;  1M44 A;  4P45 A;  3IIB A;  2QEC A;  2ZPA A;  3TCV A;  3NH4 A;  5C88 A;  5A28 A;  4DNC A;  2ARH A;  2C6G A;  3GKR A;  2F8H A;  3QNV A;  1Y7E A;  5F48 A;  4CGP A;  2P6E A;  3I1U A;  4KOS A;  5LRG A;  5F47 A;  3PBE A;  2ZW6 A;  1B87 A;  3D7G A;  4RN7 A;  4WJB A;  4P4I A;  3MGD A;  2B58 A;  4RS2 A;  5D29 A;  3H5Z A;  2D4O A;  5E96 A;  4P4D A;  2HQY A;  6CPA A;  4IUS A;  4Y49 B;  3JRU A;  3H8F A;  3F0A A;  2FE7 A;  2RB7 A;  3RYO A;  3TT2 A;  2AFM A;  2JEW A;  1XIX A;  1IB1 E;  3VAR A;  1CBX A;  2YNC A;  1J4J A;  4A38 A;  2CIJ A;  4I49 A;  4GM5 A;  3S9N A;  4UCP A;  2J8M A;  3D7F A;  3W6X A;  3FED A;  4AXV A;  2V8D A;  1BAV A;  3S9M A;  4CRY B;  3QAY A;  1PYT B;  3B8G A;  4QUS A;  2FS5 A;  2CF4 A;  3PB7 X;  4MHP A;  4CGM A;  2VBQ A;  4F9V A;  3SJE A;  3QAH A;  2P6G A;  2REE A;  4FD4 A;  4JWP A;  1YLE A;  4MFJ A;  4NJR A;  1P0H A;  4R7M A;  1QSO A;  4NGM A;  3GUX A;  5HH1 A;  4C7H A;  2DXQ A;  4M6H A;  5BWA B;  4FWU A;  1ZLI A;  2PJ1 A;  5CPA A;  2AFZ A;  7CPA A;  1ZO0 A;  4II9 A;  2J8N A;  4F0X A;  2NSM A;  4AVC A;  2VZZ A;  4OID A;  2JBJ A;  3T90 A;  4MY3 A;  2Q51 A;  4M6I A;  3WAB A;  5KTC A;  3B3W A;  1NSL A;  2GFQ A;  4HKF A;  4UBR A;  4XNH B;  2CNT A;  1VKC A;  3GLJ A;  2FSR A;  4AG7 A;  4MJ8 A;  5JGF A;  1DE4 C;  1Z4R A;  4KLW A;  4FBE A;  4OC3 A;  4HNX B;  3HLP A;  1ELM P;  2PVW A;  3DLJ A;  2PJC A;  2EO8 A;  2PIY A;  3TX8 A;  2GU2 A;  1AUG A;  1XRY A;  4MCP A;  4MCQ A;  2KCW A;  4X3R A;  1Q2C A;  3CDX A;  3EO4 A;  4WWV A;  3EFA A;  2BOA A;  2ZEF A;  3DNS A;  4PK2 A;  2XEF A;  1S7F A;  4ZI6 A;  4ZY0 A;  4NGT A;  1X10 A;  5GCN A;  2QVP A;  3R9G A;  1XOV A;  4B6Z A;  2AFO A;  4UEE A;  2EBJ A;  1S60 A;  2IJZ A;  3R9E A;  4NGR A;  2OZG A;  1H8L A;  2WZN A;  4L8A A;  3BI0 A;  4O23 A;  1CP7 A;  4A31 A;  4A95 A;  3B3S A;  2ZEG A;  1HEE A;  2ZOG A;  2PR8 A;  4E0A A;  4JD6 A;  2PIZ A;  2PJA A;  1LAN A;  1YW6 A;  2G3A A;  2J9A A;  3CXQ A;  4CYO A;  2AE6 A;  5KTD A;  2Y0M A;  4MCS A;  4PQA A;  4Q38 A;  3W91 A;  2V8G A;  2FT0 A;  3PRT A;  2R1I A;  2ATR A;  2WSA A;  2ZXV A;  3R95 A;  3RBU A;  3KR4 A;  4DYO A;  2PJ8 A;  4R9M A;  2XEJ A;  5F49 A;  1VHS A;  4XPL A;  4IF5 A;  3RO0 A;  2CTB A;  4FAI A;  1YX0 A;  2PQ8 A;  3NH5 A;  4ZY2 A;  5LYI A;  4MCR A;  4Q7A A;  2ZED A;  2JLM A;  3CXP A;  5HVH A;  5G1Z A;  1V0C A;  4KOR A;  1S7L A;  4XPD B;  2FIA A;  3UY5 A;  3WT4 A;  2CY2 A;  3F8K A;  3S6G A;  3ZZI A;  1JQG A;  4QVT A;  4MI4 A;  3I3G A;  1ARL A;  4AB7 A;  1A2Z A;  3FNC A;  2GRE A;  4U5Y A;  3SXO A;  1IIC A;  4CAE A;  3TE4 A;  4A37 A;  4CRZ B;  3B3C A;  2PJ0 A;  2ZEE A;  2CNM A;  1XMT A;  2Z3L A;  3ZJ0 A;  4PK3 A;  3TTH A;  4MHY A;  1TKF A;  2HC9 A;  4KOY A;  2BUE A;  3K9T A;  2GIV A;  3CPA A;  2Z0Z A;  1WK4 A;  3D4U A;  1Y0R A;  4KVX A;  1RXT A;  4MFL A;  3JVN A;  5C82 A;  5HMN A;  1OBR A;  5EMI A;  4F9U A;  1TF8 A;  2POK A;  3B3V A;  3KL9 A;  1KUX A;  3SXN A;  1KUY A;  1KUV A;  2I00 A;  4JJX A;  4X5K A;  2ZW4 A;  4P44 A;  4E2A A;  2CTC A;  3B35 A;  3S6F A;  1CP6 A;  1XEB A;  4P4E A;  4B13 A;  1VHE A;  5H84 A;  4MRI A;  3TO7 A;  4UFW A;  1XBU A;  2PJ9 A;  1TXR A;  4AVA A;  4A2Z A;  3KKW A;  2B5G B;  3C26 A;  4JYW A;  3KI9 A;  4E8O A;  4NGS A;  3SJF A;  4R76 A;  1LAM A;  1QMU A;  5F09 A;  4PXB A;  3LMS A;  4UEZ A;  2PJB A;  2RC4 A;  2Z3M A;  1IGB A;  3IGR A;  4CPA A;  3EXN A;  2WYR A;  3S9L A;  3B2Y A;  2JBK A;  3GYA A;  1ZG8 A;  4MHN A;  2P6F A;  3IO1 A;  1NE9 A;  4MBU A;  3TO6 A;  4F8Z A;  3FBU A;  2A4N A;  2JEV A;  2VQY A;  2VL1 A;  5AG6 A;  2Q43 A;  4R57 A;  2EUI A;  5KTA A;  3GIU A;  4KOT A;  1TF9 A;  5K8M A;  4UIA A;  2YNC C;  1M1D A;  4CAX A;  4EFD A;  2OR4 A;  3V7Z A;  1JWQ A;  2Z3P A;  4P4B A;  1LFW A;  1Y9K A;  4ZX8 A;  2DPS A;  5JH9 A;  2FCK A;  4OAE A;  5AG5 A;  3G3S A;  1YRE A;  2OH1 A;  3NE8 A;  3PB9 X;  1IOF A;  1AMP A;  3H8G A;  3IWE A;  4UF4 A;  2B3U A;  1PUA A;  3LD2 A;  3BI1 A;  4OME A;  3D8P A;  1M4D A;  2H5M A;  1CPX A;  3N7Z A;  1BOB A;  4X8I A;  4L89 A;  1XE4 A;  3LAC A;  2EK9 A;  5EC4 A;  4C2X A;  1Q2Y A;  5H86 A;  1GYT A;  1IY7 A;  3FH4 A;  1IYL A;  4K3N A;  4KLV A;  4PXD A;  4A30 A;  2BSW A;  2B5G A;  2HV2 A;  5JQ4 A;  2F7V A;  4F6A A;  4UCN A;  3A9L A;  4G1P A;  2PE3 A;  5DWN A;  5IB9 A;  3RZA A;  3S6H A;  4C2Y A;  3D2M A;  3KGQ A;  3D67 A;  3FEE A;  4FD7 A;  2IMO A;  4MHZ A;  5HVG A;  3JTK A;  2QML A;  3PP9 A;  4BBH A;  3FJU A;  1I1D A;  3CXS A;  2NMT A;  4YFJ A;  4JXQ A;  2CNS A;  4KS9 A;  2VI7 A;  1YGH A;  5LYF A;  2Z3K A;  4NEX A;  3PGP A;  4Y49 C;  2PJ4 A;  1M4L A;  3FRM A;  2HB6 A;  2V8V A;  3KQX A;  1IID A;  5G21 A;  1VGY A;  2B4D B;  4C7I A;  4YGO A;  2Q4Z A;  2D4P A;  1XJO A;  2FXF A;  3GY9 A;  2QYV A;  2O4H A;  1YSJ A;  2ZEO A;  3SHP A;  3SJX A;  4FUU A;  3GB0 A;  3EY5 A;  2PJ5 A;  4R87 A;  2BL1 A;  2AJ6 A;  4OC4 A;  3H8E A;  1YME A;  1Z5R A;  1Y0Y A;  3EC4 A;  3D68 A;  4P4J A;  3DDD A;  3R9F A;  2PDO A;  1YK3 A;  1N71 A;  1X12 A;  4FD6 A;  3VWE A;  1HDQ A;  3TFY A;  3FX6 A;  3PEI A;  2GLF A;  5AG7 A;  5D8N A;  3D2P A;  1ZG9 A;  3SI1 A;  4EME A;  1EE3 P;  4H89 A;  2PC1 A;  4UEF A;  4R3K A;  4AG9 A;  5J8F A;  4KVM E;  4PSW A;  4Z65 A;  3B3T A;  3ISX A; 
#chains in the Genus database with same CATH homology
 1YVO A;  1M4I A;  2K5T A;  1S7N A;  4CGN A;  4MFK A;  3IU2 A;  4XNH C;  3BLN A;  4KSA A;  2G0B A;  2OZH A;  3G8W A;  3NE7 A;  3D3S A;  1R57 A;  4MFQ A;  1MJA A;  1S3Z A;  4KSF A;  2VZY A;  4A32 A;  4B5O A;  2JDC A;  4XPK A;  3BJ7 A;  2OB0 A;  1S7K A;  2Z3N A;  4QB9 A;  2YNE A;  4PV6 A;  4KUA A;  2QIR A;  2B4D A;  2VEZ A;  4M3S A;  4AVB A;  1XF8 A;  1IYK A;  1Y9W A;  5AGE A;  4MFP A;  2PR1 A;  3WR7 A;  4B11 A;  5ISV A;  3IWG A;  2Z11 A;  2Q44 A;  2B4B A;  3P2H A;  4ONU A;  4UWJ A;  2PSW A;  4RI1 A;  3H4Q A;  4J3G A;  4UCM A;  4B14 A;  5AG4 A;  3P2F A;  2GAN A;  4QBJ A;  1ON0 A;  4H6U A;  4LUA A;  2P0W A;  2YND A;  2FL4 A;  3TOA A;  1B6B A;  4B5P B;  4U9Z A;  4JXR A;  2F5I A;  4MY0 A;  5EBV A;  4H6Z A;  1PU9 A;  3IU1 A;  4XPD C;  4ORF A;  3FXT A;  5A27 A;  2B3V A;  1Q2D A;  1UFH A;  2X7B A;  4C68 A;  3FIX A;  5J8C A;  2JDD A;  2G3T A;  1YVK A;  3TOB A;  4HNW B;  4KOX A;  1QSR A;  1YR0 A;  1TIQ A;  2IL4 A;  3BJ8 A;  4CAV A;  4F0Y A;  3FYN A;  4JLY A;  4ZGY B;  4KOV A;  4OAD A;  3K9U A;  2REF A;  2C27 A;  1P4N A;  5DWM A;  2Q4V A;  2EVN A;  1NMT A;  2VXK A;  5CNP A;  3PZJ A;  5G20 A;  3QB8 A;  2OZU A;  4B12 A;  3DR6 A;  4LX9 A;  1I12 A;  2BEI A;  4HNY B;  4KOU A;  4NXY A;  5G22 A;  1LRZ A;  4PSX A;  2Z10 A;  4CYP A;  2O28 A;  4OLL A;  4CYQ A;  3F5B A;  4B5P A;  1QST A;  2J8R A;  2I79 A;  5FVJ A;  2OU2 A;  2Q7B A;  2WPW A;  2WPX A;  5IX3 A;  4UFX A;  1FY7 A;  4UFV A;  4EVY A;  2HUZ A;  2GE3 A;  2CXA A;  1MK4 A;  5F46 A;  4KVO E;  4KUB A;  3JUW A;  1RO5 A;  4UA3 A;  2DPT A;  4YRH A;  3TO9 A;  1CJW A;  5IB0 A;  2Q0Y A;  3FB3 A;  4MHD A;  2ZW5 A;  1M4G A;  4FD5 A;  4BMH A;  4B10 A;  4GS4 A;  4UWI A;  2Q4Y A;  4CS0 B;  2Q04 A;  3OWC A;  4NSQ A;  2YGW A;  4CGL A;  4U9Y A;  2ZW7 A;  4CYN A;  4NF1 A;  4KZT A;  4CAW A;  1WWZ A;  3LOD A;  4NCZ A;  1KZF A;  1MJ9 A;  1QSN A;  3V8I A;  1BO4 A;  1OZP A;  5I0C A;  4KOW A;  4M85 A;  3DR8 A;  3T9Y A;  5IV0 A;  1I21 A;  1Y7R A;  1U6M A;  4A33 A;  3S6K A;  3I9S A;  2R8V A;  4Q36 A;  2R7H A;  3W6S A;  3R96 A;  1K4J A;  4CGO A;  2FIW A;  4QC6 A;  1L0C A;  4ZBG A;  3E0K A;  2WUU A;  4MFZ A;  4CAF A;  2R98 A;  4C2Z A;  3DSB A;  5JPH A;  1SQH A;  2PRB A;  1MJB A;  1CM0 A;  1GHE A;  4K30 A;  4R3L A;  2Z3O A;  1Z9U A;  1S5K A;  1QSM A;  3R1K A;  1Z4E A;  1M44 A;  2QEC A;  2ZPA A;  3TCV A;  5C88 A;  5A28 A;  4DNC A;  2ARH A;  3GKR A;  5F48 A;  4CGP A;  2P6E A;  4KOS A;  5F47 A;  2ZW6 A;  1B87 A;  3MGD A;  2B58 A;  4RS2 A;  3H5Z A;  2D4O A;  5E96 A;  2HQY A;  4IUS A;  4Y49 B;  3F0A A;  2FE7 A;  3RYO A;  3TT2 A;  1IB1 E;  1XIX A;  2YNC A;  1J4J A;  4I49 A;  4UCP A;  2J8M A;  3W6X A;  4CRY B;  3B8G A;  4QUS A;  2FS5 A;  4CGM A;  2VBQ A;  3QAH A;  2P6G A;  2REE A;  4FD4 A;  4JWP A;  1YLE A;  4MFJ A;  1P0H A;  1QSO A;  5HH1 A;  4C7H A;  2DXQ A;  5BWA B;  1ZO0 A;  4II9 A;  2J8N A;  4F0X A;  4AVC A;  2VZZ A;  3T90 A;  4MY3 A;  5KTC A;  1NSL A;  4HKF A;  4UBR A;  4XNH B;  2CNT A;  1VKC A;  2FSR A;  4AG7 A;  4MJ8 A;  1Z4R A;  4KLW A;  4HNX B;  2KCW A;  1Q2C A;  3EO4 A;  3EFA A;  3DNS A;  4PK2 A;  1S7F A;  5GCN A;  3R9G A;  1S60 A;  3R9E A;  2OZG A;  4L8A A;  4A31 A;  4A95 A;  2PR8 A;  4E0A A;  4JD6 A;  3CXQ A;  2G3A A;  4CYO A;  2AE6 A;  5KTD A;  2Y0M A;  3W91 A;  4Q38 A;  2FT0 A;  2ZXV A;  2R1I A;  2ATR A;  2WSA A;  3R95 A;  4R9M A;  5F49 A;  1VHS A;  4XPL A;  4IF5 A;  1YX0 A;  2PQ8 A;  2JLM A;  3CXP A;  5G1Z A;  1V0C A;  4KOR A;  1S7L A;  4XPD B;  2FIA A;  3UY5 A;  2CY2 A;  3F8K A;  3S6G A;  3ZZI A;  4QVT A;  4MI4 A;  3I3G A;  4AB7 A;  3TE4 A;  3FNC A;  4U5Y A;  3SXO A;  4CAE A;  1IIC A;  4CRZ B;  2CNM A;  1XMT A;  2Z3L A;  3ZJ0 A;  4PK3 A;  3TTH A;  4KOY A;  2BUE A;  2GIV A;  2Z0Z A;  1WK4 A;  4KVX A;  4MFL A;  1RXT A;  5C82 A;  3JVN A;  5HMN A;  1KUX A;  3SXN A;  1KUY A;  1KUV A;  2I00 A;  4JJX A;  4X5K A;  2ZW4 A;  4E2A A;  3S6F A;  1XEB A;  4B13 A;  5H84 A;  3TO7 A;  4UFW A;  4AVA A;  4A2Z A;  3KKW A;  2B5G B;  3C26 A;  4E8O A;  2RC4 A;  2Z3M A;  3IGR A;  3EXN A;  3GYA A;  2P6F A;  1NE9 A;  4MBU A;  3TO6 A;  3FBU A;  2A4N A;  2JEV A;  2VQY A;  5AG6 A;  4R57 A;  2EUI A;  5KTA A;  4KOT A;  2YNC C;  1M1D A;  4CAX A;  2Z3P A;  1Y9K A;  2DPS A;  2FCK A;  4OAE A;  5AG5 A;  3G3S A;  1YRE A;  2OH1 A;  3IWE A;  2B3U A;  1PUA A;  3LD2 A;  3N7Z A;  1M4D A;  2H5M A;  3D8P A;  1BOB A;  4L89 A;  1XE4 A;  5EC4 A;  4C2X A;  1Q2Y A;  5H86 A;  1IYL A;  4A30 A;  4KLV A;  5JQ4 A;  2BSW A;  2B5G A;  2HV2 A;  4F6A A;  4UCN A;  3A9L A;  5DWN A;  3S6H A;  4C2Y A;  3D2M A;  4FD7 A;  3JTK A;  2QML A;  3PP9 A;  4BBH A;  1I1D A;  3CXS A;  2NMT A;  4YFJ A;  4JXQ A;  2CNS A;  4KS9 A;  2VI7 A;  1YGH A;  2Z3K A;  4NEX A;  3PGP A;  4Y49 C;  3FRM A;  5G21 A;  1IID A;  2B4D B;  4C7I A;  4YGO A;  2D4P A;  2FXF A;  3GY9 A;  3VWD A;  3SHP A;  4R87 A;  3EY5 A;  2BL1 A;  2AJ6 A;  3EC4 A;  3R9F A;  3DDD A;  2PDO A;  1YK3 A;  1N71 A;  4FD6 A;  3VWE A;  3TFY A;  5AG7 A;  3D2P A;  4H89 A;  2PC1 A;  4R3K A;  4AG9 A;  5J8F A;  4KVM E;  4PSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...