4A2ZA

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a pyrazole sulphonamide ligand
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of a novel class of orally active trypanocidal N-myristoyltransferase inhibitors.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 120
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4a2zA00
2WSAA 4CYQA 2YNCC 5AG5A 4CYOA 5AG6A 4UFXA 3H5ZA 4CGMA 4CGLA 3IU2A 4C2YA 4CGOA 4C2ZA 4UCMA 4CAEA 4BBHA 4CGNA 4B14A 4B11A 4A2ZA 5G21A 5G20A 5G1ZA 4A33A 4C2XA 2YNCA 4CGPA 5AGEA 4A31A 4CAFA 4CYPA 4A32A 4C7IA 4A95A 3IWEA 2YNEA 4UCNA 2YNDA 5AG7A 4B10A 5AG4A 5A27A 4A30A 4UCPA 5G22A 5A28A 2WUUA 4C68A 4CYNA 3IU1A 4UFWA 3JTKA 4B13A 4UFVA 4C7HA 4B12A
chains in the Genus database with same CATH superfamily
4XPDB 1CM0A 2YNCC 2Z3KA 4AVBA 4QBJA 4B5OA 2CY2A 2GU2A 1M4LA 3RBUA 1N71A 2AFXA 4UCMA 4FUUA 4MHZA 4YGOA 4FD7A 4NEXA 1MJBA 2ZOGA 3BI0A 2OU2A 4HNWB 1M4GA 2R98A 1Y0RA 1ZLHA 2DXQA 2XEJA 3QNVA 4ONWA 4UIAA 3S9MA 3ZJ0A 4B5PA 4C2XA 2P6GA 3PP9A 4NXYA 2JEWA 5C88A 2ZEOA 2JBJA 2EK9A 1IGBA 1YK3A 4MFZA 1VHOA 1AYEA 4OMEA 2CXAA 1HDQA 4JXRA 2PIZA 1XBUA 2OH1A 1KWMA 1B6BA 2Q51A 4MMOA 3KR5A 4AVAA 1IU8A 1LRZA 2A4NA 3KL9A 4UFVA 4BD9A 1WK4A 2WSAA 3FH4A 4H89A 4KOSA 1OZPA 2Q4YA 4OIDA 3D3SA 2GANA 5AG6A 3FVLA 4OKOA 4NF1A 4CGLA 1FY7A 2GE3A 1S5KA 2VBQA 2Z3PA 5I4MA 2O53A 2ARHA 4FWUA 3PB8X 4KOUA 3K2KA 4CAXA 5JQ4A 2PCUA 4PSXA 4MXUA 4E0AA 5HH1A 3D2MA 2PJ9A 4XNHC 3BXMA 1PU9A 1IY7A 1VHSA 4UBRA 3DR6A 3TX8A 6CPAA 3HUVA 3B2YA 4B10A 2YNDA 5KTCA 1NSAA 3F5BA 4P4BA 1YMEA 5LRKA 3EXNA 2BL1A 3CXQA 1F57A 2G9DA 3SHPA 2PR8A 4CYNA 5LYLA 4WJBA 1WWZA 4MFQA 2ZEFA 4DUKA 3HLPA 4GXHA 3FB3A 7CPAA 1AMPA 1OBRA 4UWJA 4YWYA 3CXPA 4JWPA 5JGFA 3C26A 4CGOA 3D2PA 1LOKA 2FXFA 4MHDA 4KLVA 4MBUA 3TT2A 3BHXA 1Q7LA 5K8OA 4P6YA 1QSTA 2HB6A 4CS0B 2Z10A 3FEEA 3CZXA 2RB7A 3L2NA 1AUGA 4L89A 4JJXA 1XMTA 4XPDC 4OC2A 3RZAA 2PSWA 1LAMA 2QYVA 1CJWA 1QSMA 2FIWA 5EMIA 2B4DB 3GLJA 4II9A 1XJOA 1NSLA 2EVNA 1ELLP 2OZHA 2Q04A 3SI0A 4P4IA 1S7KA 2B5GB 1NE9A 2R7HA 4O23A 4LQ6A 4NFRA 4UA3A 2VQYA 1KUXA 1R3NA 4MHPA 2DPTA 4IAVA 2ZEMA 3LD2A 2O4HA 2WPXA 2P0WA 2CTBA 5KTDA 1Z8XA 4A31A 4AB7A 2PJ3A 1TKFA 3FXTA 4A95A 1UFHA 2FCKA 4PPZA 2OZUA 2WZNA 3IO1A 4OLLA 2CF4A 2I3CA 4JYWA 1Z2LA 4MHNA 4QVTA 2AFZA 2BOAA 2HV2A 4UFWA 5F49A 3PBBA 4R57A 2VEZA 3EFAA 4PQAA 5GCNA 2XEIA 3WR7A 1ZO0A 3IWWA 1R43A 4F9VA 1ZG7A 3NE8A 3KHZA 3TTHA 3VWDA 3W6XA 5JH9A 4C2ZA 3PRTA 4CAEA 1XE4A 4MY0A 4F0YA 1ARLA 2QJ8A 1M44A 3NH4A 2NYQA 1Z8WA 4A33A 3I3GA 2BSWA 3GIUA 4KUBA 2J9AA 4BMHA 3OWCA 3CDXA 3MN8A 4A39A 4CPAA 4M6HA 2PJ7A 2NMTA 5AG7A 1ZLIA 2Q7BA 4NGTA 1U6MA 2PVWA 2PIYA 3H8FA 3ISXA 2G3TA 3KQZA 5LRGA 4G1PA 4HPSA 2BEIA 3JTKA 2JEVA 4MCRA 4C7HA 4DJLA 5HVGA 2PJ2A 3DGVA 3D7HA 4P4EA 3JUWA 4NGRA 5LRJA 4LX9A 1S7NA 4MRIA 3SI2A 3V7ZA 4HKFA 1IB1E 2P6FA 3PFEA 2C6PA 1A2ZA 1XMBA 2BUEA 2YNCA 4L8AA 2ZEPA 2OZGA 4KOWA 4CAFA 1CBXA 1DTDA 1X12A 1YVKA 1HEEA 4X8IA 5HVFA 4M6IA 4C7IA 5IB0A 1MJ9A 2C27A 2YNEA 2QECA 2XEFA 3V8IA 3KR4A 5JM6A 2D4PA 4IF5A 3FIXA 3KHXA 2PR1A 2V8VA 4K3NA 4LUAA 4X2TA 4KOTA 1FT7A 1IOFA 2F7VA 3IC1A 4PXDA 3E0KA 3RAMA 5J8CA 4NGMA 2B4DA 1LAPA 3RO0A 3W91A 4RUHA 3PFOA 4X3RA 3CT9A 2AJ6A 2PJ5A 4UEFA 2B5GA 3TCVA 2DPSA 3SJGA 3LACA 3QAHA 3B3TA 4CGNA 1Y9WA 2AFSA 1KZFA 2GLJA 5D8NA 4AVCA 4NJQA 2ZW4A 3FF3A 1Y9KA 5G20A 1Y7RA 2EO8A 2FIAA 2Q44A 4OAEA 3S6FA 3TOBA 2Z3MA 4A94A 4AXVA 4A32A 2Z3LA 1CG2A 1Q2CA 2F5IA 3FRMA 4TNUA 4IHMA 1ZG8A 4UCNA 5LYIA 1ARMA 2FE7A 2J8NA 3DR8A 1GYTA 4UCPA 4KVOE 1K4JA 1Q2YA 2KCWA 3F0AA 4HNXB 4YU9A 1CP7A 3B3SA 3K9TA 3KZWA 5BWAB 3I1UA 4QB9A 3A9LA 1ON0A 2ATRA 2O28A 2ZOFA 4EVYA 4JD6A 4ZY1A 2BO9A 3R95A 4OC5A 2PRBA 4WWVA 3P2FA 2PJ8A 2AFUA 4R6TA 1LFWA 3TE4A 2OR4A 2PJAA 3QAYA 2Q0YA 3NA6A 5ELYA 1Q2DA 2PDOA 1R57A 1IYLA 1Z4EA 4ZY2A 3IEHA 3SJEA 4GS4A 4R9MA 5K8MA 4FD4A 5K8NA 4MFJA 1YLEA 4PXEA 2B3VA 3NFZA 2REFA 4Q36A 5F09A 3FX6A 1M4IA 4ORFA 4R8FA 3P2HA 4Z65A 2Z3NA 4FD5A 5J1QA 2ZELA 2REEA 4KVME 2P6EA 1CX8A 5C82A 1XF8A 1YX0A 2PJCA 2C6GA 3PB6X 4J3GA 4B13A 1XEBA 5EC4A 2AFMA 2ZPAA 4KZTA 4EMEA 2JLMA 4DYOA 3PB9X 4YRHA 1F2OA 2V8DA 2D4OA 1S7FA 2G0BA 2PC1A 1KUVA 1KUYA 4B14A 4NJRA 4GM5A 1L0CA 2AE6A 3H8EA 4PXBA 2PJ0A 3VATA 5I0CA 2FT0A 1VHEA 1CPSA 2FL4A 4U9ZA 1PYTB 5LYDA 2X7BA 4QC6A 3S6HA 1Z9UA 2CNMA 4X5KA 4DNCA 2ZEDA 4K30A 1BPMA 4FBEA 2PVVA 5J8FA 3NH5A 4Y49B 4P4FA 4F8ZA 1PUAA 1QSRA 2QIRA 5G22A 3PB7X 1ZG9A 3H8GA 3PZJA 4Q7AA 4UIBA 5IX3A 2AFOA 3S9LA 4U9YA 3JVNA 2R1IA 5CNPA 2ZEGA 4BINA 2IQ6A 2JDDA 4KSAA 2PJ1A 3FECA 4CYOA 4OIWA 3KI9A 5KTAA 2QVPA 3GKRA 3S6GA 2RC4A 1JWQA 2CTCA 3KKWA 1I1DA 3N7ZA 3IIBA 1RO5A 2PE3A 3ISZA 4A2ZA 3TFYA 2WYRA 3TC8A 1XFOA 3TO6A 3SJFA 3N5FA 5F47A 2ZW7A 2F8HA 3B3WA 2ABZA 2EWBA 5F48A 4ZGYB 4M85A 3H4QA 5A27A 1LANA 1P0HA 4R7MA 3UY5A 4A30A 4F0XA 1YGHA 4AG9A 1TIQA 2WUUA 1P4NA 2B3UA 4ZI6A 3B3VA 3GY9A 3LMSA 1NMTA 2PJ6A 4UEEA 4ZX8A 1F2PA 4PK3A 4F9UA 1JQGA 4KVXA 1Y0YA 3FBUA 2ZW6A 3QB8A 2ZENA 4JZ0A 1S60A 5HMNA 3DNSA 3IJ3A 2G3AA 5CPAA 4ZX9A 4W9YA 5E96A 2PRQA 4UEZA 4CRYB 1LCPA 2V77A 2VZZA 1MK4A 1BLLE 1XIXA 3SXNA 4UF4A 3WT4A 4ZYQA 4KSFA 5D29A 2K5TA 2ZXVA 2DEAA 4KOVA 2QMLA 3SI1A 1I12A 4MHYA 5THWA 3DDDA 4Q38A 3MGDA 5HVHA 2OB0A 2IL4A 4KOYA 4NSQA 3DLJA 4CYQA 4IUSA 4MY3A 1QSNA 3WC6A 2GFQA 3I9SA 4AG7A 2VZYA 3B8GA 4PK2A 3LWUA 3R1KA 3WABA 1GHEA 4CGMA 1CPXA 4C2YA 1DE4C 2JBKA 4KSIA 1Z8LA 4RS2A 2PJBA 4B11A 2FSRA 3K9UA 1IICA 4P4DA 1QMUA 3NH8A 5G1ZA 4Y49C 1UWYA 5AGEA 3TO7A 4I49A 1HDUA 3R9FA 3BJ8A 1TXRA 3B3CA 3IFEA 4NGNA 3R9GA 1YLOA 2HUZA 2PQ8A 3W6SA 2GREA 4H6UA 1X10A 2GLFA 1VKCA 4IK2A 4F6AA 4P4JA 4C68A 5A28A 4OC4A 1YW6A 4MFLA 5F46A 4XPLA 1IIDA 1RTQA 4MJ8A 3D66A 4M6GA 4OADA 4UFXA 4OP4A 4A37A 8CPAA 4NGSA 1RXTA 3IU2A 3R9EA 4PSWA 3WC7A 3B7IA 2B58A 2EUIA 2EBJA 5G21A 5HXDA 1VIXA 2Z3OA 3FMCA 4E8OA 1YQEA 2B4BA 3IGRA 4FD6A 1Z4RA 3D68A 5K8PA 2GIVA 4ZBGA 2Q7SA 2V8GA 1FNOA 2Z11A 4M3SA 5AG4A 3IWGA 3SJXA 2J8MA 2ODFA 2Q43A 3FJUA 5IV0A 2I79A 3T8WA 1S3ZA 3T9YA 3D67A 3G8WA 4P10A 3RYOA 2Y0MA 3PEIA 5CBMA 4OC3A 4UWIA 4R3LA 5EBVA 1M1DA 1SQHA 1TKHA 4NGPA 1Z5RA 3EO4A 3CPXA 2Z0ZA 1IYKA 2CIJA 3T90A 1J4JA 2HQYA 4KLWA 4LQGA 3BJ7A 4BBHA 5IB9A 3VWEA 2EK8A 2FVGA 3PB4X 3FNCA 2PJ4A 1YVOA 2I00A 4B5PB 4RN7A 4OC1A 2RFHA 3D7FA 2CNTA 3SXOA 4CGPA 1XRYA 3S9NA 1BPNA 1I21A 2Q4ZA 2ZW5A 4KUAA 1CP6A 3CPAA 5ISVA 5JPHA 4CAWA 2H5MA 3GYAA 1XOVA 3D8PA 1EE3P 4RI1A 1VGYA 3TO9A 3G3SA 1Z8TA 1BOBA 2VL1A 3IU1A 5LYFA 3EC4A 1TF8A 2BCOA 5H84A 4NGQA 2C1CA 1TKJA 1IOIA 1YREA 1BAVA 5AG5A 1B87A 2IMOA 3JRUA 1H8LA 4KS9A 4R87A 3H5ZA 1M4DA 3GUXA 2R8VA 4MCSA 2ZEEA 1S7LA 4ZY0A 1ELMP 2ZEHA 1QSOA 4MFPA 1QQ9A 3BI1A 4MCPA 3RNZA 3VH9A 3S6KA 2FS5A 3LODA 1V0CA 4JXQA 4E2AA 2CNSA 2V8HA 3TOAA 5FVJA 4U5YA 4CAVA 4YFJA 2IJZA 4NCZA 2HC9A 4PXCA 4R3KA 3D7DA 3KASA 4TWEA 3KQXA 4XNHB 5DS0A 2J8RA 1TF9A 3D7GA 1YSJA 1MJAA 3NE7A 4JLYA 5DWNA 4B6ZA 3GB0A 4B12A 3MRUA 3V38A 2VI7A 2Q4VA 2OOTA 4A38A 1PCAA 3BLNA 1YR0A 2YGWA 4OC0A 3ZZIA 1BO4A 3F8KA 1Y7EA 4MFKA 3FYNA 4ONUA 3KGQA 5DWMA 3DSBA 5H86A 4QUSA 3EY5A 3VARA 4MCQA 4MI4A 4H6ZA 4KOXA 2VXKA 2XEGA 4CYPA 4FAIA 2POKA 4HNYB 2AFWA 3D4UA 3FEDA 3PBEA 3IWEA 4P45A 4EFDA 2DF5A 2C6CA 4PV6A 2NSMA 3CXSA 2WPWA 4P44A 4KORA 4H2KA 3WC5A 3PGPA 4EWTA 3B35A 3R96A 4R76A 1YW4A 2ANPA 4XPKA 4CRZB 2JDCA
chains in the Genus database with same CATH topology
4XPDB 1CM0A 2YNCC 2Z3KA 4AVBA 4QBJA 4B5OA 2CY2A 1N71A 4UCMA 4YGOA 4FD7A 4NEXA 1MJBA 2OU2A 4HNWB 1M4GA 2R98A 2DXQA 3ZJ0A 4C2XA 4B5PA 2P6GA 3PP9A 4NXYA 5C88A 1YK3A 4MFZA 2CXAA 4JXRA 2OH1A 1B6BA 4AVAA 1LRZA 2A4NA 4UFVA 1WK4A 2WSAA 4H89A 4KOSA 1OZPA 2Q4YA 3D3SA 2GANA 5AG6A 4NF1A 4CGLA 1FY7A 2GE3A 1S5KA 2VBQA 2Z3PA 2ARHA 4KOUA 4CAXA 5JQ4A 4PSXA 4E0AA 5HH1A 3D2MA 4XNHC 1PU9A 1VHSA 4UBRA 3DR6A 4B10A 2YNDA 5KTCA 3F5BA 3EXNA 2BL1A 3CXQA 3SHPA 2PR8A 4CYNA 1WWZA 4MFQA 3FB3A 4UWJA 3CXPA 4JWPA 3C26A 4CGOA 3D2PA 2FXFA 4MHDA 4KLVA 4MBUA 3TT2A 1QSTA 4CS0B 2Z10A 4L89A 4JJXA 1XMTA 4XPDC 2PSWA 1CJWA 1QSMA 2FIWA 2B4DB 4II9A 1NSLA 2EVNA 2Q04A 2OZHA 1S7KA 2B5GB 1NE9A 2R7HA 4UA3A 2VQYA 1KUXA 2DPTA 3LD2A 2WPXA 2P0WA 5KTDA 4A31A 4AB7A 3FXTA 4A95A 1UFHA 2FCKA 2OZUA 4OLLA 4QVTA 4UFWA 2HV2A 5F49A 4R57A 2VEZA 3EFAA 5GCNA 3WR7A 1ZO0A 3TTHA 3VWDA 3W6XA 4C2ZA 4CAEA 1XE4A 4MY0A 4F0YA 1M44A 4A33A 3I3GA 2BSWA 4KUBA 4BMHA 3OWCA 2NMTA 5AG7A 2Q7BA 1U6MA 2G3TA 2BEIA 3JTKA 2JEVA 4C7HA 3JUWA 4LX9A 1S7NA 4HKFA 1IB1E 2P6FA 2YNCA 4L8AA 2BUEA 2OZGA 4KOWA 4CAFA 5IB0A 1YVKA 4C7IA 1MJ9A 2C27A 2YNEA 2QECA 3V8IA 2D4PA 4IF5A 3FIXA 2PR1A 4LUAA 4KOTA 5J8CA 3E0KA 2B4DA 3W91A 2AJ6A 2B5GA 3TCVA 3QAHA 4CGNA 1Y9WA 1KZFA 4AVCA 2ZW4A 1Y9KA 5G20A 1Y7RA 2FIAA 4OAEA 2Q44A 3S6FA 3TOBA 2Z3MA 4A32A 2Z3LA 1Q2CA 2F5IA 3FRMA 4UCNA 2FE7A 2J8NA 3DR8A 4UCPA 4KVOE 1K4JA 1Q2YA 2KCWA 3F0AA 4HNXB 5BWAB 4QB9A 3A9LA 1ON0A 2ATRA 2O28A 4EVYA 4JD6A 3R95A 2PRBA 3P2FA 3TE4A 2Q0YA 1Q2DA 2PDOA 1R57A 1IYLA 1Z4EA 4GS4A 4R9MA 4FD4A 4MFJA 1YLEA 2B3VA 2REFA 4Q36A 1M4IA 4ORFA 3P2HA 2Z3NA 4FD5A 2REEA 4KVME 2P6EA 5C82A 1XF8A 1YX0A 4J3GA 4B13A 1XEBA 5EC4A 2ZPAA 4KZTA 2JLMA 4YRHA 2D4OA 1S7FA 2G0BA 2PC1A 1KUVA 1KUYA 4B14A 1L0CA 2AE6A 5I0CA 2FT0A 2FL4A 4U9ZA 2X7BA 4QC6A 3S6HA 1Z9UA 2CNMA 4X5KA 4DNCA 5J8FA 4K30A 4Y49B 1PUAA 1QSRA 2QIRA 5G22A 3PZJA 5IX3A 4U9YA 3JVNA 2R1IA 5CNPA 2JDDA 4KSAA 4CYOA 5KTAA 3GKRA 3S6GA 2RC4A 3KKWA 1I1DA 3N7ZA 3TFYA 1RO5A 4A2ZA 3TO6A 5F47A 2ZW7A 5F48A 4ZGYB 4M85A 3H4QA 5A27A 1P0HA 4A30A 3UY5A 4F0XA 1YGHA 4AG9A 1TIQA 2WUUA 1P4NA 2B3UA 3GY9A 1NMTA 4PK3A 4KVXA 3FBUA 2ZW6A 3QB8A 1S60A 5HMNA 3DNSA 2G3AA 5E96A 4CRYB 2VZZA 1MK4A 1XIXA 3SXNA 4KSFA 2K5TA 2ZXVA 4KOVA 2QMLA 1I12A 3DDDA 4Q38A 3MGDA 2OB0A 2IL4A 4KOYA 4NSQA 4CYQA 4IUSA 4MY3A 1QSNA 3I9SA 4AG7A 2VZYA 3B8GA 4PK2A 3R1KA 1GHEA 4CGMA 4C2YA 4RS2A 4B11A 2FSRA 3K9UA 1IICA 5G1ZA 4Y49C 5AGEA 3TO7A 4I49A 3R9FA 3BJ8A 3R9GA 2HUZA 2PQ8A 3W6SA 4H6UA 1VKCA 4F6AA 5A28A 4C68A 4MFLA 5F46A 4XPLA 1IIDA 4MJ8A 4OADA 4UFXA 1RXTA 3IU2A 3R9EA 4PSWA 2B58A 2EUIA 5G21A 2Z3OA 4E8OA 2B4BA 3IGRA 4FD6A 1Z4RA 2GIVA 4ZBGA 2Z11A 4M3SA 5AG4A 3IWGA 2J8MA 5IV0A 2I79A 1S3ZA 3T9YA 3G8WA 3RYOA 2Y0MA 4UWIA 4R3LA 5EBVA 1M1DA 1SQHA 3EO4A 3T90A 2Z0ZA 1IYKA 1J4JA 2HQYA 4KLWA 3BJ7A 4BBHA 3VWEA 3FNCA 4B5PB 1YVOA 2I00A 2CNTA 3SXOA 4CGPA 1I21A 2ZW5A 4KUAA 5ISVA 5JPHA 4CAWA 2H5MA 3GYAA 3D8PA 4RI1A 3TO9A 3G3SA 1BOBA 3IU1A 3EC4A 5H84A 1YREA 5AG5A 1B87A 4KS9A 4R87A 3H5ZA 1M4DA 2R8VA 1S7LA 1QSOA 4MFPA 3S6KA 2FS5A 3LODA 1V0CA 4JXQA 4E2AA 2CNSA 3TOAA 5FVJA 4U5YA 4CAVA 4YFJA 4NCZA 4R3KA 4XNHB 2J8RA 1MJAA 3NE7A 4JLYA 5DWNA 4B12A 2VI7A 2Q4VA 3BLNA 1YR0A 2YGWA 3ZZIA 1BO4A 3F8KA 4MFKA 3FYNA 4ONUA 5DWMA 3DSBA 5H86A 4QUSA 3EY5A 4MI4A 4H6ZA 4KOXA 2VXKA 4CYPA 4HNYB 3IWEA 4PV6A 3CXSA 2WPWA 4KORA 3PGPA 3R96A 4CRZB 2DPSA 4XPKA 2JDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSA A;  4CYQ A;  2YNC C;  5AG5 A;  4CYO A;  5AG6 A;  4UFX A;  3H5Z A;  4CGM A;  4CGL A;  3IU2 A;  4C2Y A;  4CGO A;  4C2Z A;  4UCM A;  4CAE A;  4BBH A;  4CGN A;  4B14 A;  4B11 A;  4A2Z A;  5G21 A;  5G20 A;  5G1Z A;  4A33 A;  4C2X A;  2YNC A;  4CGP A;  5AGE A;  4A31 A;  4CAF A;  4CYP A;  4A32 A;  4C7I A;  4A95 A;  3IWE A;  2YNE A;  4UCN A;  2YND A;  5AG7 A;  4B10 A;  5AG4 A;  5A27 A;  4A30 A;  4UCP A;  5G22 A;  5A28 A;  2WUU A;  4C68 A;  4CYN A;  3IU1 A;  4UFW A;  3JTK A;  4B13 A;  4UFV A;  4C7H A;  4B12 A; 
#chains in the Genus database with same CATH topology
 4XPD B;  1CM0 A;  2YNC C;  2Z3K A;  4AVB A;  4QBJ A;  4B5O A;  2CY2 A;  2GU2 A;  1M4L A;  3RBU A;  1N71 A;  2AFX A;  4UCM A;  4FUU A;  4MHZ A;  4YGO A;  4FD7 A;  4NEX A;  1MJB A;  2ZOG A;  3BI0 A;  2OU2 A;  4HNW B;  1M4G A;  2R98 A;  1Y0R A;  1ZLH A;  2DXQ A;  2XEJ A;  3QNV A;  4ONW A;  4UIA A;  3S9M A;  3ZJ0 A;  4B5P A;  4C2X A;  2P6G A;  3PP9 A;  4NXY A;  2JEW A;  5C88 A;  2ZEO A;  2JBJ A;  2EK9 A;  1IGB A;  1YK3 A;  4MFZ A;  1VHO A;  1AYE A;  4OME A;  2CXA A;  1HDQ A;  4JXR A;  2PIZ A;  1XBU A;  2OH1 A;  1KWM A;  1B6B A;  2Q51 A;  4MMO A;  3KR5 A;  4AVA A;  1IU8 A;  1LRZ A;  2A4N A;  3KL9 A;  4UFV A;  4BD9 A;  1WK4 A;  2WSA A;  3FH4 A;  4H89 A;  4KOS A;  1OZP A;  2Q4Y A;  4OID A;  3D3S A;  2GAN A;  5AG6 A;  3FVL A;  4OKO A;  4NF1 A;  4CGL A;  1FY7 A;  2GE3 A;  1S5K A;  2VBQ A;  2Z3P A;  5I4M A;  2O53 A;  2ARH A;  4FWU A;  3PB8 X;  4KOU A;  3K2K A;  4CAX A;  5JQ4 A;  2PCU A;  4PSX A;  4MXU A;  4E0A A;  5HH1 A;  3D2M A;  2PJ9 A;  4XNH C;  3BXM A;  1PU9 A;  1IY7 A;  1VHS A;  4UBR A;  3DR6 A;  3TX8 A;  6CPA A;  3HUV A;  3B2Y A;  4B10 A;  2YND A;  5KTC A;  1NSA A;  3F5B A;  4P4B A;  1YME A;  5LRK A;  3EXN A;  2BL1 A;  3CXQ A;  1F57 A;  2G9D A;  3SHP A;  2PR8 A;  4CYN A;  5LYL A;  4WJB A;  1WWZ A;  4MFQ A;  2ZEF A;  4DUK A;  3HLP A;  4GXH A;  3FB3 A;  7CPA A;  1AMP A;  1OBR A;  4UWJ A;  4YWY A;  3CXP A;  4JWP A;  5JGF A;  3C26 A;  4CGO A;  3D2P A;  1LOK A;  2FXF A;  4MHD A;  4KLV A;  4MBU A;  3TT2 A;  3BHX A;  1Q7L A;  5K8O A;  4P6Y A;  1QST A;  2HB6 A;  4CS0 B;  2Z10 A;  3FEE A;  3CZX A;  2RB7 A;  3L2N A;  1AUG A;  4L89 A;  4JJX A;  1XMT A;  4XPD C;  4OC2 A;  3RZA A;  2PSW A;  1LAM A;  2QYV A;  1CJW A;  1QSM A;  2FIW A;  5EMI A;  2B4D B;  3GLJ A;  4II9 A;  1XJO A;  1NSL A;  2EVN A;  1ELL P;  2OZH A;  2Q04 A;  3SI0 A;  4P4I A;  1S7K A;  2B5G B;  1NE9 A;  2R7H A;  4O23 A;  4LQ6 A;  4NFR A;  4UA3 A;  2VQY A;  1KUX A;  1R3N A;  4MHP A;  2DPT A;  4IAV A;  2ZEM A;  3LD2 A;  2O4H A;  2WPX A;  2P0W A;  2CTB A;  5KTD A;  1Z8X A;  4A31 A;  4AB7 A;  2PJ3 A;  1TKF A;  3FXT A;  4A95 A;  1UFH A;  2FCK A;  4PPZ A;  2OZU A;  2WZN A;  3IO1 A;  4OLL A;  2CF4 A;  2I3C A;  4JYW A;  1Z2L A;  4MHN A;  4QVT A;  2AFZ A;  2BOA A;  2HV2 A;  4UFW A;  5F49 A;  3PBB A;  4R57 A;  2VEZ A;  3EFA A;  4PQA A;  5GCN A;  2XEI A;  3WR7 A;  1ZO0 A;  3IWW A;  1R43 A;  4F9V A;  1ZG7 A;  3NE8 A;  3KHZ A;  3TTH A;  3VWD A;  3W6X A;  5JH9 A;  4C2Z A;  3PRT A;  4CAE A;  1XE4 A;  4MY0 A;  4F0Y A;  1ARL A;  2QJ8 A;  1M44 A;  3NH4 A;  2NYQ A;  1Z8W A;  4A33 A;  3I3G A;  2BSW A;  3GIU A;  4KUB A;  2J9A A;  4BMH A;  3OWC A;  3CDX A;  3MN8 A;  4A39 A;  4CPA A;  4M6H A;  2PJ7 A;  2NMT A;  5AG7 A;  1ZLI A;  2Q7B A;  4NGT A;  1U6M A;  2PVW A;  2PIY A;  3H8F A;  3ISX A;  2G3T A;  3KQZ A;  5LRG A;  4G1P A;  4HPS A;  2BEI A;  3JTK A;  2JEV A;  4MCR A;  4C7H A;  4DJL A;  5HVG A;  2PJ2 A;  3DGV A;  3D7H A;  4P4E A;  3JUW A;  4NGR A;  5LRJ A;  4LX9 A;  1S7N A;  4MRI A;  3SI2 A;  3V7Z A;  4HKF A;  1IB1 E;  2P6F A;  3PFE A;  2C6P A;  1A2Z A;  1XMB A;  2BUE A;  2YNC A;  4L8A A;  2ZEP A;  2OZG A;  4KOW A;  4CAF A;  1CBX A;  1DTD A;  1X12 A;  1YVK A;  1HEE A;  4X8I A;  5HVF A;  4M6I A;  4C7I A;  5IB0 A;  1MJ9 A;  2C27 A;  2YNE A;  2QEC A;  2XEF A;  3V8I A;  3KR4 A;  5JM6 A;  2D4P A;  4IF5 A;  3FIX A;  3KHX A;  2PR1 A;  2V8V A;  4K3N A;  4LUA A;  4X2T A;  4KOT A;  1FT7 A;  1IOF A;  2F7V A;  3IC1 A;  4PXD A;  3E0K A;  3RAM A;  5J8C A;  4NGM A;  2B4D A;  1LAP A;  3RO0 A;  3W91 A;  4RUH A;  3PFO A;  4X3R A;  3CT9 A;  2AJ6 A;  2PJ5 A;  4UEF A;  2B5G A;  3TCV A;  2DPS A;  3SJG A;  3LAC A;  3QAH A;  3B3T A;  4CGN A;  1Y9W A;  2AFS A;  1KZF A;  2GLJ A;  5D8N A;  4AVC A;  4NJQ A;  2ZW4 A;  3FF3 A;  1Y9K A;  5G20 A;  1Y7R A;  2EO8 A;  2FIA A;  2Q44 A;  4OAE A;  3S6F A;  3TOB A;  2Z3M A;  4A94 A;  4AXV A;  4A32 A;  2Z3L A;  1CG2 A;  1Q2C A;  2F5I A;  3FRM A;  4TNU A;  4IHM A;  1ZG8 A;  4UCN A;  5LYI A;  1ARM A;  2FE7 A;  2J8N A;  3DR8 A;  1GYT A;  4UCP A;  4KVO E;  1K4J A;  1Q2Y A;  2KCW A;  3F0A A;  4HNX B;  4YU9 A;  1CP7 A;  3B3S A;  3K9T A;  3KZW A;  5BWA B;  3I1U A;  4QB9 A;  3A9L A;  1ON0 A;  2ATR A;  2O28 A;  2ZOF A;  4EVY A;  4JD6 A;  4ZY1 A;  2BO9 A;  3R95 A;  4OC5 A;  2PRB A;  4WWV A;  3P2F A;  2PJ8 A;  2AFU A;  4R6T A;  1LFW A;  3TE4 A;  2OR4 A;  2PJA A;  3QAY A;  2Q0Y A;  3NA6 A;  5ELY A;  1Q2D A;  2PDO A;  1R57 A;  1IYL A;  1Z4E A;  4ZY2 A;  3IEH A;  3SJE A;  4GS4 A;  4R9M A;  5K8M A;  4FD4 A;  5K8N A;  4MFJ A;  1YLE A;  4PXE A;  2B3V A;  3NFZ A;  2REF A;  4Q36 A;  5F09 A;  3FX6 A;  1M4I A;  4ORF A;  4R8F A;  3P2H A;  4Z65 A;  2Z3N A;  4FD5 A;  5J1Q A;  2ZEL A;  2REE A;  4KVM E;  2P6E A;  1CX8 A;  5C82 A;  1XF8 A;  1YX0 A;  2PJC A;  2C6G A;  3PB6 X;  4J3G A;  4B13 A;  1XEB A;  5EC4 A;  2AFM A;  2ZPA A;  4KZT A;  4EME A;  2JLM A;  4DYO A;  3PB9 X;  4YRH A;  1F2O A;  2V8D A;  2D4O A;  1S7F A;  2G0B A;  2PC1 A;  1KUV A;  1KUY A;  4B14 A;  4NJR A;  4GM5 A;  1L0C A;  2AE6 A;  3H8E A;  4PXB A;  2PJ0 A;  3VAT A;  5I0C A;  2FT0 A;  1VHE A;  1CPS A;  2FL4 A;  4U9Z A;  1PYT B;  5LYD A;  2X7B A;  4QC6 A;  3S6H A;  1Z9U A;  2CNM A;  4X5K A;  4DNC A;  2ZED A;  4K30 A;  1BPM A;  4FBE A;  2PVV A;  5J8F A;  3NH5 A;  4Y49 B;  4P4F A;  4F8Z A;  1PUA A;  1QSR A;  2QIR A;  5G22 A;  3PB7 X;  1ZG9 A;  3H8G A;  3PZJ A;  4Q7A A;  4UIB A;  5IX3 A;  2AFO A;  3S9L A;  4U9Y A;  3JVN A;  2R1I A;  5CNP A;  2ZEG A;  4BIN A;  2IQ6 A;  2JDD A;  4KSA A;  2PJ1 A;  3FEC A;  4CYO A;  4OIW A;  3KI9 A;  5KTA A;  2QVP A;  3GKR A;  3S6G A;  2RC4 A;  1JWQ A;  2CTC A;  3KKW A;  1I1D A;  3N7Z A;  3IIB A;  1RO5 A;  2PE3 A;  3ISZ A;  4A2Z A;  3TFY A;  2WYR A;  3TC8 A;  1XFO A;  3TO6 A;  3SJF A;  3N5F A;  5F47 A;  2ZW7 A;  2F8H A;  3B3W A;  2ABZ A;  2EWB A;  5F48 A;  4ZGY B;  4M85 A;  3H4Q A;  5A27 A;  1LAN A;  1P0H A;  4R7M A;  3UY5 A;  4A30 A;  4F0X A;  1YGH A;  4AG9 A;  1TIQ A;  2WUU A;  1P4N A;  2B3U A;  4ZI6 A;  3B3V A;  3GY9 A;  3LMS A;  1NMT A;  2PJ6 A;  4UEE A;  4ZX8 A;  1F2P A;  4PK3 A;  4F9U A;  1JQG A;  4KVX A;  1Y0Y A;  3FBU A;  2ZW6 A;  3QB8 A;  2ZEN A;  4JZ0 A;  1S60 A;  5HMN A;  3DNS A;  3IJ3 A;  2G3A A;  5CPA A;  4ZX9 A;  4W9Y A;  5E96 A;  2PRQ A;  4UEZ A;  4CRY B;  1LCP A;  2V77 A;  2VZZ A;  1MK4 A;  1BLL E;  1XIX A;  3SXN A;  4UF4 A;  3WT4 A;  4ZYQ A;  4KSF A;  5D29 A;  2K5T A;  2ZXV A;  2DEA A;  4KOV A;  2QML A;  3SI1 A;  1I12 A;  4MHY A;  5THW A;  3DDD A;  4Q38 A;  3MGD A;  5HVH A;  2OB0 A;  2IL4 A;  4KOY A;  4NSQ A;  3DLJ A;  4CYQ A;  4IUS A;  4MY3 A;  1QSN A;  3WC6 A;  2GFQ A;  3I9S A;  4AG7 A;  2VZY A;  3B8G A;  4PK2 A;  3LWU A;  3R1K A;  3WAB A;  1GHE A;  4CGM A;  1CPX A;  4C2Y A;  1DE4 C;  2JBK A;  4KSI A;  1Z8L A;  4RS2 A;  2PJB A;  4B11 A;  2FSR A;  3K9U A;  1IIC A;  4P4D A;  1QMU A;  3NH8 A;  5G1Z A;  4Y49 C;  1UWY A;  5AGE A;  3TO7 A;  4I49 A;  1HDU A;  3R9F A;  3BJ8 A;  1TXR A;  3B3C A;  3IFE A;  4NGN A;  3R9G A;  1YLO A;  2HUZ A;  2PQ8 A;  3W6S A;  2GRE A;  4H6U A;  1X10 A;  2GLF A;  1VKC A;  4IK2 A;  4F6A A;  4P4J A;  4C68 A;  5A28 A;  4OC4 A;  1YW6 A;  4MFL A;  5F46 A;  4XPL A;  1IID A;  1RTQ A;  4MJ8 A;  3D66 A;  4M6G A;  4OAD A;  4UFX A;  4OP4 A;  4A37 A;  8CPA A;  4NGS A;  1RXT A;  3IU2 A;  3R9E A;  4PSW A;  3WC7 A;  3B7I A;  2B58 A;  2EUI A;  2EBJ A;  5G21 A;  5HXD A;  1VIX A;  2Z3O A;  3FMC A;  4E8O A;  1YQE A;  2B4B A;  3IGR A;  4FD6 A;  1Z4R A;  3D68 A;  5K8P A;  2GIV A;  4ZBG A;  2Q7S A;  2V8G A;  1FNO A;  2Z11 A;  4M3S A;  5AG4 A;  3IWG A;  3SJX A;  2J8M A;  2ODF A;  2Q43 A;  3FJU A;  5IV0 A;  2I79 A;  3T8W A;  1S3Z A;  3T9Y A;  3D67 A;  3G8W A;  4P10 A;  3RYO A;  2Y0M A;  3PEI A;  5CBM A;  4OC3 A;  4UWI A;  4R3L A;  5EBV A;  1M1D A;  1SQH A;  1TKH A;  4NGP A;  1Z5R A;  3EO4 A;  3CPX A;  2Z0Z A;  1IYK A;  2CIJ A;  3T90 A;  1J4J A;  2HQY A;  4KLW A;  4LQG A;  3BJ7 A;  4BBH A;  5IB9 A;  3VWE A;  2EK8 A;  2FVG A;  3PB4 X;  3FNC A;  2PJ4 A;  1YVO A;  2I00 A;  4B5P B;  4RN7 A;  4OC1 A;  2RFH A;  3D7F A;  2CNT A;  3SXO A;  4CGP A;  1XRY A;  3S9N A;  1BPN A;  1I21 A;  2Q4Z A;  2ZW5 A;  4KUA A;  1CP6 A;  3CPA A;  5ISV A;  5JPH A;  4CAW A;  2H5M A;  3GYA A;  1XOV A;  3D8P A;  1EE3 P;  4RI1 A;  1VGY A;  3TO9 A;  3G3S A;  1Z8T A;  1BOB A;  2VL1 A;  3IU1 A;  5LYF A;  3EC4 A;  1TF8 A;  2BCO A;  5H84 A;  4NGQ A;  2C1C A;  1TKJ A;  1IOI A;  1YRE A;  1BAV A;  5AG5 A;  1B87 A;  2IMO A;  3JRU A;  1H8L A;  4KS9 A;  4R87 A;  3H5Z A;  1M4D A;  3GUX A;  2R8V A;  4MCS A;  2ZEE A;  1S7L A;  4ZY0 A;  1ELM P;  2ZEH A;  1QSO A;  4MFP A;  1QQ9 A;  3BI1 A;  4MCP A;  3RNZ A;  3VH9 A;  3S6K A;  2FS5 A;  3LOD A;  1V0C A;  4JXQ A;  4E2A A;  2CNS A;  2V8H A;  3TOA A;  5FVJ A;  4U5Y A;  4CAV A;  4YFJ A;  2IJZ A;  4NCZ A;  2HC9 A;  4PXC A;  4R3K A;  3D7D A;  3KAS A;  4TWE A;  3KQX A;  4XNH B;  5DS0 A;  2J8R A;  1TF9 A;  3D7G A;  1YSJ A;  1MJA A;  3NE7 A;  4JLY A;  5DWN A;  4B6Z A;  3GB0 A;  4B12 A;  3MRU A;  3V38 A;  2VI7 A;  2Q4V A;  2OOT A;  4A38 A;  1PCA A;  3BLN A;  1YR0 A;  2YGW A;  4OC0 A;  3ZZI A;  1BO4 A;  3F8K A;  1Y7E A;  4MFK A;  3FYN A;  4ONU A;  3KGQ A;  5DWM A;  3DSB A;  5H86 A;  4QUS A;  3EY5 A;  3VAR A;  4MCQ A;  4MI4 A;  4H6Z A;  4KOX A;  2VXK A;  2XEG A;  4CYP A;  4FAI A;  2POK A;  4HNY B;  2AFW A;  3D4U A;  3FED A;  3PBE A;  3IWE A;  4P45 A;  4EFD A;  2DF5 A;  2C6C A;  4PV6 A;  2NSM A;  3CXS A;  2WPW A;  4P44 A;  4KOR A;  4H2K A;  3WC5 A;  3PGP A;  4EWT A;  3B35 A;  3R96 A;  4R76 A;  1YW4 A;  2ANP A;  4XPK A;  4CRZ B;  2JDC A; 
#chains in the Genus database with same CATH homology
 4XPD B;  1CM0 A;  2YNC C;  2Z3K A;  4AVB A;  4QBJ A;  4B5O A;  2CY2 A;  1N71 A;  4UCM A;  4YGO A;  4FD7 A;  4NEX A;  1MJB A;  2OU2 A;  4HNW B;  1M4G A;  2R98 A;  2DXQ A;  3ZJ0 A;  4C2X A;  4B5P A;  2P6G A;  3PP9 A;  4NXY A;  5C88 A;  1YK3 A;  4MFZ A;  2CXA A;  4JXR A;  2OH1 A;  1B6B A;  4AVA A;  1LRZ A;  2A4N A;  4UFV A;  1WK4 A;  2WSA A;  4H89 A;  4KOS A;  1OZP A;  2Q4Y A;  3D3S A;  2GAN A;  5AG6 A;  4NF1 A;  4CGL A;  1FY7 A;  2GE3 A;  1S5K A;  2VBQ A;  2Z3P A;  2ARH A;  4KOU A;  4CAX A;  5JQ4 A;  4PSX A;  4E0A A;  5HH1 A;  3D2M A;  4XNH C;  1PU9 A;  1VHS A;  4UBR A;  3DR6 A;  4B10 A;  2YND A;  5KTC A;  3F5B A;  3EXN A;  2BL1 A;  3CXQ A;  3SHP A;  2PR8 A;  4CYN A;  1WWZ A;  4MFQ A;  3FB3 A;  4UWJ A;  3CXP A;  4JWP A;  3C26 A;  4CGO A;  3D2P A;  2FXF A;  4MHD A;  4KLV A;  4MBU A;  3TT2 A;  1QST A;  4CS0 B;  2Z10 A;  4L89 A;  4JJX A;  1XMT A;  4XPD C;  2PSW A;  1CJW A;  1QSM A;  2FIW A;  2B4D B;  4II9 A;  1NSL A;  2EVN A;  2Q04 A;  2OZH A;  1S7K A;  2B5G B;  1NE9 A;  2R7H A;  4UA3 A;  2VQY A;  1KUX A;  2DPT A;  3LD2 A;  2WPX A;  2P0W A;  5KTD A;  4A31 A;  4AB7 A;  3FXT A;  4A95 A;  1UFH A;  2FCK A;  2OZU A;  4OLL A;  4QVT A;  4UFW A;  2HV2 A;  5F49 A;  4R57 A;  2VEZ A;  3EFA A;  5GCN A;  3WR7 A;  1ZO0 A;  3TTH A;  3VWD A;  3W6X A;  4C2Z A;  4CAE A;  1XE4 A;  4MY0 A;  4F0Y A;  1M44 A;  4A33 A;  3I3G A;  2BSW A;  4KUB A;  4BMH A;  3OWC A;  2NMT A;  5AG7 A;  2Q7B A;  1U6M A;  2G3T A;  2BEI A;  3JTK A;  2JEV A;  4C7H A;  3JUW A;  4LX9 A;  1S7N A;  4HKF A;  1IB1 E;  2P6F A;  2YNC A;  4L8A A;  2BUE A;  2OZG A;  4KOW A;  4CAF A;  5IB0 A;  1YVK A;  4C7I A;  1MJ9 A;  2C27 A;  2YNE A;  2QEC A;  3V8I A;  2D4P A;  4IF5 A;  3FIX A;  2PR1 A;  4LUA A;  4KOT A;  5J8C A;  3E0K A;  2B4D A;  3W91 A;  2AJ6 A;  2B5G A;  3TCV A;  3QAH A;  4CGN A;  1Y9W A;  1KZF A;  4AVC A;  2ZW4 A;  1Y9K A;  5G20 A;  1Y7R A;  2FIA A;  4OAE A;  2Q44 A;  3S6F A;  3TOB A;  2Z3M A;  4A32 A;  2Z3L A;  1Q2C A;  2F5I A;  3FRM A;  4UCN A;  2FE7 A;  2J8N A;  3DR8 A;  4UCP A;  4KVO E;  1K4J A;  1Q2Y A;  2KCW A;  3F0A A;  4HNX B;  5BWA B;  4QB9 A;  3A9L A;  1ON0 A;  2ATR A;  2O28 A;  4EVY A;  4JD6 A;  3R95 A;  2PRB A;  3P2F A;  3TE4 A;  2Q0Y A;  1Q2D A;  2PDO A;  1R57 A;  1IYL A;  1Z4E A;  4GS4 A;  4R9M A;  4FD4 A;  4MFJ A;  1YLE A;  2B3V A;  2REF A;  4Q36 A;  1M4I A;  4ORF A;  3P2H A;  2Z3N A;  4FD5 A;  2REE A;  4KVM E;  2P6E A;  5C82 A;  1XF8 A;  1YX0 A;  4J3G A;  4B13 A;  1XEB A;  5EC4 A;  2ZPA A;  4KZT A;  2JLM A;  4YRH A;  2D4O A;  1S7F A;  2G0B A;  2PC1 A;  1KUV A;  1KUY A;  4B14 A;  1L0C A;  2AE6 A;  5I0C A;  2FT0 A;  2FL4 A;  4U9Z A;  2X7B A;  4QC6 A;  3S6H A;  1Z9U A;  2CNM A;  4X5K A;  4DNC A;  5J8F A;  4K30 A;  4Y49 B;  1PUA A;  1QSR A;  2QIR A;  5G22 A;  3PZJ A;  5IX3 A;  4U9Y A;  3JVN A;  2R1I A;  5CNP A;  2JDD A;  4KSA A;  4CYO A;  5KTA A;  3GKR A;  3S6G A;  2RC4 A;  3KKW A;  1I1D A;  3N7Z A;  3TFY A;  1RO5 A;  4A2Z A;  3TO6 A;  5F47 A;  2ZW7 A;  5F48 A;  4ZGY B;  4M85 A;  3H4Q A;  5A27 A;  1P0H A;  4A30 A;  3UY5 A;  4F0X A;  1YGH A;  4AG9 A;  1TIQ A;  2WUU A;  1P4N A;  2B3U A;  3GY9 A;  1NMT A;  4PK3 A;  4KVX A;  3FBU A;  2ZW6 A;  3QB8 A;  1S60 A;  5HMN A;  3DNS A;  2G3A A;  5E96 A;  4CRY B;  2VZZ A;  1MK4 A;  1XIX A;  3SXN A;  4KSF A;  2K5T A;  2ZXV A;  4KOV A;  2QML A;  1I12 A;  3DDD A;  4Q38 A;  3MGD A;  2OB0 A;  2IL4 A;  4KOY A;  4NSQ A;  4CYQ A;  4IUS A;  4MY3 A;  1QSN A;  3I9S A;  4AG7 A;  2VZY A;  3B8G A;  4PK2 A;  3R1K A;  1GHE A;  4CGM A;  4C2Y A;  4RS2 A;  4B11 A;  2FSR A;  3K9U A;  1IIC A;  5G1Z A;  4Y49 C;  5AGE A;  3TO7 A;  4I49 A;  3R9F A;  3BJ8 A;  3R9G A;  2HUZ A;  2PQ8 A;  3W6S A;  4H6U A;  1VKC A;  4F6A A;  5A28 A;  4C68 A;  4MFL A;  5F46 A;  4XPL A;  1IID A;  4MJ8 A;  4OAD A;  4UFX A;  1RXT A;  3IU2 A;  3R9E A;  4PSW A;  2B58 A;  2EUI A;  5G21 A;  2Z3O A;  4E8O A;  2B4B A;  3IGR A;  4FD6 A;  1Z4R A;  2GIV A;  4ZBG A;  2Z11 A;  4M3S A;  5AG4 A;  3IWG A;  2J8M A;  5IV0 A;  2I79 A;  1S3Z A;  3T9Y A;  3G8W A;  3RYO A;  2Y0M A;  4UWI A;  4R3L A;  5EBV A;  1M1D A;  1SQH A;  3EO4 A;  3T90 A;  2Z0Z A;  1IYK A;  1J4J A;  2HQY A;  4KLW A;  3BJ7 A;  4BBH A;  3VWE A;  3FNC A;  4B5P B;  1YVO A;  2I00 A;  2CNT A;  3SXO A;  4CGP A;  1I21 A;  2ZW5 A;  4KUA A;  5ISV A;  5JPH A;  4CAW A;  2H5M A;  3GYA A;  3D8P A;  4RI1 A;  3TO9 A;  3G3S A;  1BOB A;  3IU1 A;  3EC4 A;  5H84 A;  1YRE A;  5AG5 A;  1B87 A;  4KS9 A;  4R87 A;  3H5Z A;  1M4D A;  2R8V A;  1S7L A;  1QSO A;  4MFP A;  3S6K A;  2FS5 A;  3LOD A;  1V0C A;  4JXQ A;  4E2A A;  2CNS A;  3TOA A;  5FVJ A;  4U5Y A;  4CAV A;  4YFJ A;  4NCZ A;  4R3K A;  4XNH B;  2J8R A;  1MJA A;  3NE7 A;  4JLY A;  5DWN A;  4B12 A;  2VI7 A;  2Q4V A;  3BLN A;  1YR0 A;  2YGW A;  3ZZI A;  1BO4 A;  3F8K A;  4MFK A;  3FYN A;  4ONU A;  5DWM A;  3DSB A;  5H86 A;  4QUS A;  3EY5 A;  4MI4 A;  4H6Z A;  4KOX A;  2VXK A;  4CYP A;  4HNY B;  3IWE A;  4PV6 A;  3CXS A;  2WPW A;  4KOR A;  3PGP A;  3R96 A;  4CRZ B;  2DPS A;  4XPK A;  2JDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...