2CNMA

Rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with a bisubstrate inhibitor (cterm-arg-arg-phe-tyr-arg-ala-n-alpha- acetyl-s-coa).
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
151
structure length
151
Chain Sequence
MNTISILSTTDLPAAWQIEQRAHAFPWSEKTFFGNQGERYLNLKLTADDRMAAFAITQVVLDEATLFNIAVDPDFQRRGLGRMLLEHLIDELETRGVVTLWLEVRASNAAAIALYESLGFNEATIRRNYYPTAQGHEDAIIMALPISMKLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODIFICATION OF 30S RIBOSOMAL SUBUNIT PROTEIN S18
publication title Crystal Structure of Rimi from Salmonella Typhimurium Lt2, the Gnat Responsible for N{Alpha}- Acetylation of Ribosomal Protein S18.
pubmed doi rcsb
source organism Salmonella typhimurium lt2
molecule tags Transferase
total genus 46
structure length 151
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2cnmA00
3VWDA 4JWPA 2VEZA 4PK2A 4F6AA 2VI7A 5ISVA 1KZFA 1K4JA 1MJ9A 1YR0A 3TFYA 1Z4EA 1QSNA 4JD6A 4QUSA 1IYLA 4OADA 1N71A 4AVCA 3I3GA 2OZGA 1FY7A 3OWCA 3D2MA 1B87A 5H84A 2Q7BA 4F0YA 1MJAA 2B5GB 3R96A 3S6HA 2CNTA 3JUWA 1XIXA 1YLEA 4BMHA 3FYNA 3FBUA 1OZPA 2VXKA 4HNYB 2EVNA 5IX3A 2OB0A 3C26A 4KZTA 1XE4A 2GE3A 2B3VA 4ORFA 2B4DB 1J4JA 1NSLA 4U9ZA 4NSQA 4FD5A 1S3ZA 3FRMA 4JXRA 1YGHA 3GY9A 2G3TA 3S6GA 3EO4A 4OAEA 3TTHA 2FL4A 3R9GA 4FD6A 1YVOA 2QIRA 2IL4A 4YFJA 1SQHA 2Z10A 4M85A 1R57A 2KCWA 2Y0MA 1TIQA 4KOTA 5I0CA 5EBVA 3TT2A 3R1KA 1CM0A 3GYAA 4MHDA 3KKWA 4U5YA 1YX0A 3TO9A 2B3UA 2B58A 3TOAA 4AB7A 5H86A 2FE7A 4H89A 2Z11A 1YK3A 1QSTA 4FD7A 3QAHA 4KOXA 4UBRA 3RYOA 1Q2YA 3E0KA 2NMTA 1NMTA 2PRBA 2HV2A 2H5MA 2BSWA 2FIWA 3BJ7A 1Y9KA 4KOUA 2BUEA 2C27A 1MJBA 2PR1A 4L8AA 1M44A 2PDOA 2D4OA 2J8RA 4U9YA 2B4BA 4KVXA 3EXNA 2GANA 3CXPA 4KORA 2HUZA 5F46A 2J8MA 3G3SA 5JQ4A 2AE6A 2Q4VA 3QB8A 4HNWB 3BLNA 2ATRA 3FIXA 3I9SA 3F8KA 2B5GA 1M1DA 4R3LA 1VHSA 2JDDA 3N7ZA 5F48A 4KOVA 2BL1A 5E96A 4JXQA 3EFAA 5IB0A 3BJ8A 4IUSA 3NE7A 2PSWA 2HQYA 1IB1E 2A4NA 2X7BA 4KOWA 2B4DA 1B6BA 2OU2A 2WPWA 2P6EA 3EC4A 1S7LA 2JDCA 4XPDC 4XNHB 3R9EA 2P6FA 5EC4A 4UA3A 2FS5A 4MY0A 2Q0YA 3R95A 1WWZA 3B8GA 4CRYB 2REEA 3DNSA 4II9A 4AVBA 1VKCA 1UFHA 3W6XA 4KOYA 1P0HA 1QSMA 1XMTA 2O28A 2JLMA 4AVAA 1M4DA 3FB3A 3TCVA 3G8WA 3FXTA 4QVTA 2R98A 4JJXA 4R87A 4R3KA 1NE9A 1GHEA 5C82A 1I1DA 4MI4A 5JPHA 5DWNA 1YREA 2I00A 4R57A 5KTDA 1V0CA 3P2FA 2G3AA 2D4PA 2GIVA 3F5BA 3EY5A 3SHPA 3IWGA 2WPXA 4NCZA 3T90A 5FVJA 4UWJA 4PK3A 1XF8A 2FXFA 4MJ8A 4NXYA 2ZXVA 4HKFA 2ZPAA 4H6UA 3LODA 1Y9WA 1Z4RA 1S5KA 4QC6A 3DDDA 2G0BA 4Y49C 5J8FA 4CAWA 2ZW5A 2P6GA 2Z0ZA 1LRZA 4KVME 4PSXA 4KUAA 5F47A 3ZZIA 1Q2DA 1RXTA 1P4NA 3DR6A 4JLYA 3UY5A 1U6MA 4XPKA 4J3GA 2Q4YA 3FNCA 4LX9A 2Q44A 1RO5A 4NF1A 3TE4A 1S7FA 4M3SA 5HH1A 1BO4A 2BEIA 2VBQA 4B5PB 3CXSA 1QSRA 1YVKA 1Z9UA 4E0AA 1S7NA 4YRHA 4KUBA 3GKRA 2OH1A 5DWMA 1Q2CA 4X5KA 4YGOA 2K5TA 3D3SA 1KUXA 4QB9A 2ZW6A 1ON0A 2R1IA 1XEBA 3VWEA 3K9UA 4RI1A 3JVNA 2REFA 3DSBA 5IV0A 4AG9A 4L89A 1KUYA 3DR8A 4K30A 4E8OA 2FT0A 3F0AA 4I49A 4PV6A 3S6KA 1IYKA 3P2HA 4E2AA 4CAVA 5GCNA 2P0WA 4CAXA 4R9MA 4QBJA 1PU9A 2AJ6A 2VZYA 2QECA 2DXQA 4H6ZA 3PGPA 2OZUA 3W91A 5HMNA 2ARHA 2PQ8A 2PC1A 3MGDA 2FIAA 2Q04A 2VZZA 4MBUA 4ONUA 2F5IA 4XPLA 4IF5A 3H4QA 5J8CA 5KTAA 1S60A 2R7HA 1PUAA 4KVOE 2ZW7A 4RS2A 3SXOA 3T9YA 4OLLA 3TOBA 1MK4A 3IGRA 4KLWA 4XPDB 2FCKA 5CNPA 3D8PA 3PP9A 2ZW4A 2EUIA 2CNSA 5KTCA 1BOBA 3V8IA 1Y7RA 1I21A 3R9FA 2I79A 4AG7A 4CS0B 2JEVA 4FD4A 2R8VA 1L0CA 4B5PA 4GS4A 2VQYA 3D2PA 1I12A 1M4GA 4KLVA 4ZBGA 4B5OA 4NEXA 4DNCA 2FSRA 2QMLA 3TO6A 2PR8A 3WR7A 3CXQA 1IIDA 1S7KA 3ZJ0A 1CJWA 3W6SA 2CNMA 4MY3A 4PSWA 2J8NA 4XNHC 3PZJA 1KUVA 2RC4A 4HNXB 5F49A 1WK4A 2OZHA 4CRZB 4EVYA 3TO7A 2CY2A 4Y49B 4KOSA 3SXNA 5C88A 1M4IA 4UWIA 4LUAA 1QSOA 1IICA 3S6FA 3LD2A
chains in the Genus database with same CATH superfamily
4MHPA 4MCSA 3CPXA 4TNUA 3VWDA 2PJ5A 1AMPA 2ZELA 4MFQA 4JWPA 4CGOA 2VEZA 1Z5RA 4PK2A 5HVGA 4F6AA 2PE3A 2VI7A 3PRTA 3FJUA 4R76A 5G22A 5ISVA 3VATA 1KZFA 4ZYQA 1K4JA 1MJ9A 1YR0A 3TFYA 3BXMA 1Z4EA 1QSNA 4JD6A 4QUSA 3BI1A 1IYLA 4OADA 4MCPA 1N71A 2JBJA 3I3GA 2OZGA 1TF9A 4AVCA 1FY7A 3OWCA 3D2MA 1B87A 5H84A 4F0XA 1ARLA 2Q7BA 4F0YA 1MJAA 2PJ6A 3RZAA 2B5GB 2IQ6A 3R96A 3S6HA 2CNTA 2OR4A 3IC1A 3JUWA 4M6HA 5AG6A 1XIXA 1YLEA 4BMHA 3FYNA 3FF3A 2PJ0A 5DS0A 3FBUA 4LQGA 3KR4A 2BCOA 3IWWA 3WT4A 4NGTA 5LYDA 4OC0A 5K8NA 1OZPA 2VXKA 1LAPA 1UWYA 1YMEA 4HNYB 2EVNA 6CPAA 5IX3A 2OB0A 3C26A 2NYQA 1XE4A 4KZTA 2GE3A 3TC8A 4A94A 2B3VA 4ORFA 2B4DB 1J4JA 1NSLA 4U9ZA 4NSQA 2HB6A 5IB9A 4FD5A 1TF8A 1S3ZA 1BAVA 2ANPA 3FRMA 3KL9A 2DPTA 4MHYA 3QNVA 5CBMA 4JXRA 1YGHA 1RTQA 3FX6A 3D67A 3SI1A 3GY9A 2G3TA 3D7GA 3S6GA 3EO4A 4OAEA 3TTHA 5LRGA 4P4EA 2RB7A 2FL4A 3GUXA 3R9GA 2CF4A 2AFSA 4FD6A 1YVOA 2QIRA 2IL4A 5J1QA 4YFJA 1SQHA 4DJLA 5LYLA 4Z65A 2Z10A 4MFKA 3IIBA 4M85A 1R57A 2XEIA 4UF4A 4UIAA 2KCWA 2Y0MA 1TIQA 1YQEA 4KOTA 2QJ8A 1Z8LA 4C2ZA 5I0CA 5EBVA 3TT2A 4P4JA 4CYPA 4B14A 3R1KA 1ZO0A 1CM0A 3GYAA 4MHDA 4A32A 3KKWA 3FEEA 3IU1A 4U5YA 1YX0A 3TO9A 2B3UA 2B58A 3TOAA 1ZG8A 3PFOA 4MCQA 1FNOA 5H86A 4AB7A 2FE7A 4H89A 5JM6A 2YNEA 2ZEEA 5I4MA 1ZG9A 2PJ9A 2Z11A 4R8FA 2F7VA 2WZNA 1YK3A 2V77A 3SJGA 4B6ZA 1QSTA 4MFPA 3D7DA 4FD7A 4UCNA 5AG4A 3QAHA 5G21A 1JQGA 4KOXA 3PB4X 3IEHA 4KS9A 7CPAA 4UBRA 3WABA 2PJ4A 4MFLA 2YGWA 3RYOA 1Q2YA 3E0KA 5CPAA 2NMTA 3FMCA 4FAIA 1NMTA 2PRBA 2HV2A 4IK2A 2I3CA 1JWQA 2H5MA 4JZ0A 3CZXA 4NFRA 3WC5A 3B3CA 2AFWA 2BSWA 2FIWA 3B3VA 3BJ7A 1Y9KA 4KOUA 4WWVA 2BUEA 2C27A 1MJBA 2PR1A 4L8AA 1M44A 2PDOA 2D4OA 2J8RA 4U9YA 1A2ZA 2B4BA 4KVXA 2EK9A 3EXNA 2O53A 4P4IA 2GANA 1XJOA 4A2ZA 1LFWA 4P45A 1IU8A 2IMOA 3CXPA 1Y7EA 4EMEA 1QMUA 4KORA 1HDUA 2HUZA 5F46A 3PBBA 2J8MA 4UEFA 3G3SA 5JQ4A 4KSAA 4TWEA 2AE6A 2Q4VA 3QB8A 3SI2A 3BHXA 2V8DA 2WSAA 4HNWB 3BLNA 2ATRA 2QYVA 3FIXA 3N5FA 3PB7X 4A33A 4LQ6A 3I9SA 1HDQA 1CP6A 1VIXA 2ABZA 2PIZA 4R6TA 2ZOGA 3F8KA 2B5GA 3B2YA 3KZWA 4UFXA 3SJEA 5K8MA 1M1DA 4MXUA 4R3LA 1VHSA 3S9NA 2J9AA 4BBHA 4CYQA 2JDDA 3FVLA 4R7MA 2PJBA 4CYOA 1VGYA 5A28A 2ZENA 3N7ZA 5HVHA 1X12A 1LOKA 3GLJA 5F48A 4KOVA 2BL1A 5E96A 4JXQA 2EWBA 4NGPA 3EFAA 5IB0A 3BJ8A 4IUSA 1LANA 1Z8TA 3NE7A 4FWUA 4OIWA 2PSWA 2HQYA 4CYNA 1IB1E 2C1CA 4PXCA 2A4NA 2F8HA 2X7BA 2PRQA 4KOWA 4OC3A 2B4DA 1B6BA 2OU2A 2WPWA 1HEEA 3B3WA 2PJCA 3S9MA 2P6EA 3PBEA 1DTDA 5G1ZA 3EC4A 4IHMA 2AFOA 5K8PA 1S7LA 2JDCA 4FUUA 4ZX9A 3KI9A 2AFUA 1TKJA 4XPDC 1R3NA 4CGMA 4XNHB 3R9EA 2P6FA 2EK8A 2VL1A 4UEEA 5EC4A 3TX8A 3FEDA 4UA3A 4CGPA 2FS5A 1Y0YA 4OMEA 1Q7LA 4MY0A 2PJ2A 4A30A 3SI0A 2Q0YA 5LYFA 3H5ZA 3R95A 1WWZA 3B8GA 1FT7A 1XRYA 2ODFA 4CRYB 2REEA 3DNSA 4II9A 4AVBA 1VKCA 4C68A 1UFHA 3IU2A 3W6XA 4KOYA 1P0HA 1QSMA 1XMTA 2O28A 2JLMA 4AVAA 1M4DA 4Q36A 3FB3A 3TCVA 3G8WA 2WYRA 3FXTA 2FVGA 4QVTA 1PCAA 2R98A 4CGLA 4JJXA 4R87A 4R3KA 2JEWA 1NE9A 1GHEA 4F9UA 3IFEA 5C82A 1I1DA 4MI4A 5JPHA 5DWNA 5THWA 4W9YA 2YNCA 1YREA 2I00A 3NH8A 5AG7A 5D29A 2Z3NA 2GU2A 4R57A 4B13A 2YNCC 4FBEA 5KTDA 1V0CA 4NGSA 3P2FA 1EE3P 2CIJA 2G3AA 3H8EA 4IAVA 2D4PA 2GIVA 3F5BA 4X8IA 3H8FA 4X3RA 1Z8XA 2AFZA 2YNDA 3EY5A 4A37A 4BD9A 3SHPA 4A38A 3IWGA 2Z3KA 2WPXA 4NCZA 3T90A 1BPMA 4PQAA 4UIBA 1KWMA 5FVJA 4UWJA 1XFOA 4PK3A 4RN7A 2Z3MA 4YU9A 4EFDA 3WC7A 4KSFA 1YW4A 2GFQA 1XF8A 2FXFA 2Z3LA 2DPSA 4MJ8A 1ZLIA 3GB0A 3I1UA 4NXYA 4PXEA 4PPZA 2ZXVA 2PJ1A 4P10A 1TKHA 3HLPA 4HKFA 2ZPAA 4H6UA 3LODA 3KQXA 1Y9WA 1Z4RA 1BPNA 4OP4A 1S5KA 3RO0A 3IJ3A 4QC6A 3DDDA 2XEGA 2G0BA 4Y49C 5J8FA 4NGMA 5ELYA 4CAWA 2ZW5A 1LAMA 1F57A 1ELLP 2P6GA 3ISZA 2Z0ZA 1LRZA 4KVME 4PSXA 3JRUA 4UFVA 4MRIA 4KSIA 4KUAA 4B10A 2BO9A 5F47A 4NGRA 2Z3OA 1Q2DA 1BLLE 1RXTA 2CTCA 4WJBA 3ZZIA 1CX8A 1P4NA 2PJ7A 3PB6X 1XMBA 2PIYA 4UCMA 1IOIA 3DR6A 2IJZA 3L2NA 4JLYA 2G9DA 2OOTA 3UY5A 3KQZA 4H2KA 1IGBA 3D66A 4A95A 1U6MA 4XPKA 1Z8WA 3NE8A 1ZLHA 2RFHA 4J3GA 2Q4YA 4AXVA 3SJXA 3FNCA 4A39A 1CPXA 4LX9A 2Q44A 1RO5A 4NF1A 5HVFA 2Q43A 3TE4A 1S7FA 3B3SA 4M3SA 5HH1A 1BO4A 2BEIA 2VBQA 4EWTA 4M6IA 4O23A 3LD2A 4B5PB 3CXSA 2PVWA 4Q38A 3B7IA 2XEJA 1QSRA 5JGFA 1YVKA 1Z9UA 2PJ3A 4E0AA 1S7NA 1QQ9A 3CT9A 1YLOA 1AYEA 4YRHA 1M4LA 4KUBA 3GKRA 4DYOA 2OH1A 1DE4C 1NSAA 1OBRA 2C6GA 5DWMA 1Q2CA 3LMSA 1TKFA 4X5KA 4YGOA 2K5TA 3D3SA 1KUXA 4QB9A 3DLJA 5AG5A 2ZW6A 4C7IA 2GLJA 1ON0A 2R1IA 4UCPA 1XEBA 3VWEA 3K9UA 4NGNA 2ZEHA 4RI1A 3JVNA 2REFA 3DSBA 4M6GA 5IV0A 2GLFA 4AG9A 4L89A 1KUYA 1IOFA 3CPAA 3DR8A 4NGQA 3VH9A 4K30A 3WC6A 4E8OA 1XOVA 2FT0A 3F0AA 4I49A 4PV6A 3S6KA 4CAFA 2ZEDA 4JYWA 1IYKA 3P2HA 4GM5A 4E2AA 3B35A 4CAVA 5GCNA 4DUKA 4B12A 2P0WA 1ELMP 4CAXA 3A9LA 2CXAA 3PEIA 4R9MA 1CBXA 4CGNA 1PU9A 4QBJA 4ZI6A 2AJ6A 3B3TA 2VZYA 3MN8A 2C6PA 3KGQA 2QECA 2DXQA 4H6ZA 3NH4A 1H8LA 4OC1A 4UFWA 3PGPA 2OZUA 3W91A 2O4HA 5LRJA 5HMNA 5F09A 2ARHA 5A27A 2PQ8A 3K2KA 3IWEA 2PC1A 4HPSA 4MFZA 3MGDA 4CAEA 2PJ8A 2FIAA 2Z3PA 1AUGA 4MHZA 4Q7AA 4MMOA 2Q04A 3SJFA 3NA6A 4P4DA 3RBUA 3VARA 3PFEA 2VZZA 3LWUA 3CDXA 2F5IA 3KHXA 4MBUA 4ONUA 4XPLA 4OIDA 1VHEA 4IF5A 3H4QA 5J8CA 5KTAA 1S60A 2R7HA 3FH4A 1PUAA 4RUHA 2C6CA 4KVOE 1F2OA 3JTKA 4OC2A 2ZW7A 4RS2A 3SXOA 3V38A 4NJRA 3T9YA 4OLLA 3TOBA 1MK4A 3IGRA 3PB9X 4KLWA 4XPDB 5LYIA 2FCKA 5JH9A 5CNPA 4P44A 3D8PA 2Q51A 3LACA 3PP9A 2ZW4A 3IO1A 4C7HA 2EUIA 3KHZA 3NH5A 2CNSA 2PJAA 3FECA 2V8HA 5KTCA 1BOBA 3V8IA 1Y7RA 1I21A 2CTBA 3PB8X 3R9FA 3GIUA 3RNZA 3DGVA 3D4UA 3D7FA 3MRUA 4C2XA 2I79A 2ZEOA 2Q7SA 4AG7A 2ZOFA 1Z2LA 3KR5A 1IY7A 2ZEFA 4BINA 3RAMA 1YW6A 4CS0B 1VHOA 2JEVA 4FD4A 4ZGYB 2R8VA 3HUVA 3K9TA 1L0CA 4B5PA 1TXRA 5BWAB 2PVVA 4GS4A 3QAYA 2VQYA 3D2PA 1I12A 1M4GA 2ZEGA 1GYTA 4KLVA 4X2TA 4NEXA 4ZBGA 3V7ZA 4B5OA 4DNCA 8CPAA 2Q4ZA 2FSRA 4GXHA 2QMLA 1YSJA 1XBUA 3TO6A 1CG2A 5K8OA 4MFJA 2QVPA 2EO8A 3NFZA 1CP7A 4A31A 2NSMA 3H8GA 2PR8A 3WR7A 3CXQA 3D7HA 1X10A 1ZG7A 2XEFA 1IIDA 4NJQA 4PXDA 5AGEA 2EBJA 1F2PA 1S7KA 4G1PA 3ZJ0A 1CJWA 3W6SA 2DF5A 2POKA 4F8ZA 2CNMA 1CPSA 4K3NA 4OKOA 1ARMA 4OC5A 4MY3A 4ONWA 4PSWA 4P6YA 2J8NA 4ZY0A 4XNHC 3PZJA 4UEZA 3T8WA 4C2YA 5EMIA 5LRKA 1KUVA 3KASA 4YWYA 3S9LA 5G20A 2RC4A 2ZEPA 2HC9A 4HNXB 5D8NA 5F49A 4B11A 4CPAA 1PYTB 2JBKA 4MHNA 4PXBA 1WK4A 2OZHA 4F9VA 2V8VA 2BOAA 4CRZB 4EVYA 4ZY2A 3ISXA 2CY2A 4OC4A 3TO7A 4MCRA 4P4FA 4P4BA 5HXDA 2PCUA 4Y49B 4KOSA 3SXNA 5C88A 1M4IA 4ZX8A 1R43A 4UWIA 3BI0A 2DEAA 4LUAA 1LCPA 1QSOA 1IICA 1Y0RA 2GREA 4ZY1A 3S6FA 2AFXA 2WUUA 2V8GA 2AFMA 2ZEMA 3D68A
chains in the Genus database with same CATH topology
3VWDA 4MFQA 4JWPA 4CGOA 2VEZA 4PK2A 4F6AA 2VI7A 5G22A 5ISVA 1KZFA 1K4JA 1MJ9A 1YR0A 3TFYA 1Z4EA 1QSNA 4JD6A 4QUSA 1IYLA 4OADA 1N71A 4AVCA 3I3GA 2OZGA 1FY7A 3OWCA 3D2MA 1B87A 5H84A 4F0XA 2Q7BA 4F0YA 1MJAA 2B5GB 3R96A 3S6HA 2CNTA 3JUWA 5AG6A 1XIXA 1YLEA 4BMHA 3FYNA 3FBUA 1OZPA 2VXKA 4HNYB 2EVNA 5IX3A 2OB0A 3C26A 4KZTA 1XE4A 2GE3A 2B3VA 4ORFA 2B4DB 1J4JA 1NSLA 4U9ZA 4NSQA 4FD5A 1S3ZA 3FRMA 2DPTA 4JXRA 1YGHA 3GY9A 2G3TA 3S6GA 3EO4A 4OAEA 3TTHA 2FL4A 3R9GA 4FD6A 1YVOA 2QIRA 2IL4A 4YFJA 1SQHA 2Z10A 4MFKA 4M85A 1R57A 2KCWA 2Y0MA 1TIQA 4KOTA 4C2ZA 5I0CA 5EBVA 3TT2A 4CYPA 4B14A 3R1KA 1ZO0A 1CM0A 3GYAA 4MHDA 4A32A 3KKWA 3IU1A 4U5YA 1YX0A 3TO9A 2B3UA 2B58A 3TOAA 4AB7A 5H86A 2FE7A 4H89A 2YNEA 2Z11A 1YK3A 1QSTA 4MFPA 4FD7A 4UCNA 5AG4A 3QAHA 5G21A 4KOXA 4KS9A 4UBRA 4MFLA 2YGWA 3RYOA 1Q2YA 3E0KA 2NMTA 1NMTA 2PRBA 2HV2A 2H5MA 2BSWA 2FIWA 3BJ7A 1Y9KA 4KOUA 2BUEA 2C27A 1MJBA 2PR1A 4L8AA 1M44A 2PDOA 2D4OA 2J8RA 4U9YA 2B4BA 4KVXA 3EXNA 2GANA 4A2ZA 3CXPA 4KORA 2HUZA 5F46A 2J8MA 3G3SA 5JQ4A 4KSAA 2AE6A 2Q4VA 3QB8A 2WSAA 4HNWB 3BLNA 2ATRA 3FIXA 4A33A 3I9SA 3F8KA 2B5GA 4UFXA 1M1DA 4R3LA 1VHSA 4BBHA 4CYQA 2JDDA 4CYOA 5A28A 3N7ZA 5F48A 4KOVA 2BL1A 5E96A 4JXQA 3EFAA 5IB0A 3BJ8A 4IUSA 3NE7A 2PSWA 2HQYA 4CYNA 1IB1E 2A4NA 2X7BA 4KOWA 2B4DA 1B6BA 2OU2A 2WPWA 2P6EA 5G1ZA 3EC4A 1S7LA 2JDCA 4XPDC 4CGMA 4XNHB 3R9EA 2P6FA 4CGPA 5EC4A 4UA3A 2FS5A 4MY0A 4A30A 2Q0YA 3H5ZA 3R95A 1WWZA 3B8GA 4CRYB 2REEA 3DNSA 4II9A 4AVBA 1VKCA 4C68A 1UFHA 3IU2A 3W6XA 4KOYA 1P0HA 1QSMA 1XMTA 2O28A 2JLMA 4AVAA 1M4DA 4Q36A 3FB3A 3TCVA 3G8WA 3FXTA 4QVTA 2R98A 4CGLA 4JJXA 4R87A 4R3KA 1NE9A 1GHEA 5C82A 1I1DA 4MI4A 5JPHA 5DWNA 5AG7A 2YNCA 1YREA 2I00A 4B13A 2Z3NA 4R57A 2YNCC 5KTDA 1V0CA 3P2FA 2G3AA 2D4PA 2GIVA 3F5BA 2YNDA 3EY5A 3SHPA 3IWGA 2Z3KA 2WPXA 4NCZA 3T90A 5FVJA 4UWJA 4PK3A 2Z3MA 4KSFA 1XF8A 2FXFA 2Z3LA 2DPSA 4MJ8A 4NXYA 2ZXVA 4HKFA 2ZPAA 4H6UA 3LODA 1Y9WA 1Z4RA 1S5KA 4QC6A 3DDDA 2G0BA 4Y49C 5J8FA 4CAWA 2ZW5A 2P6GA 2Z0ZA 1LRZA 4KVME 4PSXA 4UFVA 4KUAA 4B10A 5F47A 3ZZIA 2Z3OA 1Q2DA 1RXTA 1P4NA 4UCMA 3DR6A 4JLYA 3UY5A 4A95A 1U6MA 4XPKA 4J3GA 2Q4YA 3FNCA 4LX9A 2Q44A 1RO5A 4NF1A 3TE4A 1S7FA 4M3SA 5HH1A 1BO4A 2BEIA 2VBQA 4B5PB 3CXSA 4Q38A 1QSRA 1YVKA 1Z9UA 4E0AA 1S7NA 4YRHA 4KUBA 3GKRA 2OH1A 5DWMA 1Q2CA 4X5KA 4YGOA 2K5TA 3D3SA 1KUXA 4QB9A 5AG5A 2ZW6A 4C7IA 1ON0A 2R1IA 4UCPA 1XEBA 3VWEA 3K9UA 4RI1A 3JVNA 2REFA 3DSBA 5IV0A 4AG9A 4L89A 1KUYA 3DR8A 4K30A 4E8OA 2FT0A 3F0AA 4I49A 4PV6A 3S6KA 4CAFA 1IYKA 3P2HA 4E2AA 4CAVA 5GCNA 4B12A 2P0WA 4CAXA 3A9LA 2CXAA 4R9MA 4CGNA 4QBJA 1PU9A 2AJ6A 2VZYA 2QECA 2DXQA 4H6ZA 4UFWA 3PGPA 2OZUA 3W91A 5HMNA 2ARHA 5A27A 2PQ8A 3IWEA 2PC1A 4MFZA 3MGDA 4CAEA 2FIAA 2Z3PA 2Q04A 2VZZA 4MBUA 4ONUA 2F5IA 4XPLA 4IF5A 3H4QA 5J8CA 5KTAA 1S60A 2R7HA 1PUAA 4KVOE 3JTKA 2ZW7A 4RS2A 3SXOA 3T9YA 4OLLA 3TOBA 1MK4A 3IGRA 4KLWA 4XPDB 2FCKA 5CNPA 3D8PA 3PP9A 2ZW4A 4C7HA 2EUIA 2CNSA 5KTCA 1BOBA 3V8IA 1Y7RA 1I21A 3R9FA 4C2XA 2I79A 4AG7A 4CS0B 2JEVA 4FD4A 4ZGYB 2R8VA 1L0CA 4B5PA 5BWAB 4GS4A 2VQYA 3D2PA 1I12A 1M4GA 4KLVA 4ZBGA 4B5OA 4NEXA 4DNCA 2FSRA 2QMLA 3TO6A 4MFJA 4A31A 2PR8A 3WR7A 3CXQA 5AGEA 1IIDA 1S7KA 3ZJ0A 1CJWA 3W6SA 2CNMA 4MY3A 4PSWA 2J8NA 4XNHC 3PZJA 4C2YA 1KUVA 5G20A 2RC4A 4HNXB 5F49A 4B11A 1WK4A 2OZHA 4CRZB 4EVYA 3TO7A 2CY2A 4Y49B 4KOSA 3SXNA 5C88A 1M4IA 4UWIA 4LUAA 1QSOA 1IICA 3S6FA 2WUUA 3LD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VWD A;  4JWP A;  2VEZ A;  4PK2 A;  4F6A A;  2VI7 A;  5ISV A;  1KZF A;  1K4J A;  1MJ9 A;  1YR0 A;  3TFY A;  1Z4E A;  1QSN A;  4JD6 A;  4QUS A;  1IYL A;  4OAD A;  1N71 A;  4AVC A;  3I3G A;  2OZG A;  1FY7 A;  3OWC A;  3D2M A;  1B87 A;  5H84 A;  2Q7B A;  4F0Y A;  1MJA A;  2B5G B;  3R96 A;  3S6H A;  2CNT A;  3JUW A;  1XIX A;  1YLE A;  4BMH A;  3FYN A;  3FBU A;  1OZP A;  2VXK A;  4HNY B;  2EVN A;  5IX3 A;  2OB0 A;  3C26 A;  4KZT A;  1XE4 A;  2GE3 A;  2B3V A;  4ORF A;  2B4D B;  1J4J A;  1NSL A;  4U9Z A;  4NSQ A;  4FD5 A;  1S3Z A;  3FRM A;  4JXR A;  1YGH A;  3GY9 A;  2G3T A;  3S6G A;  3EO4 A;  4OAE A;  3TTH A;  2FL4 A;  3R9G A;  4FD6 A;  1YVO A;  2QIR A;  2IL4 A;  4YFJ A;  1SQH A;  2Z10 A;  4M85 A;  1R57 A;  2KCW A;  2Y0M A;  1TIQ A;  4KOT A;  5I0C A;  5EBV A;  3TT2 A;  3R1K A;  1CM0 A;  3GYA A;  4MHD A;  3KKW A;  4U5Y A;  1YX0 A;  3TO9 A;  2B3U A;  2B58 A;  3TOA A;  4AB7 A;  5H86 A;  2FE7 A;  4H89 A;  2Z11 A;  1YK3 A;  1QST A;  4FD7 A;  3QAH A;  4KOX A;  4UBR A;  3RYO A;  1Q2Y A;  3E0K A;  2NMT A;  1NMT A;  2PRB A;  2HV2 A;  2H5M A;  2BSW A;  2FIW A;  3BJ7 A;  1Y9K A;  4KOU A;  2BUE A;  2C27 A;  1MJB A;  2PR1 A;  4L8A A;  1M44 A;  2PDO A;  2D4O A;  2J8R A;  4U9Y A;  2B4B A;  4KVX A;  3EXN A;  2GAN A;  3CXP A;  4KOR A;  2HUZ A;  5F46 A;  2J8M A;  3G3S A;  5JQ4 A;  2AE6 A;  2Q4V A;  3QB8 A;  4HNW B;  3BLN A;  2ATR A;  3FIX A;  3I9S A;  3F8K A;  2B5G A;  1M1D A;  4R3L A;  1VHS A;  2JDD A;  3N7Z A;  5F48 A;  4KOV A;  2BL1 A;  5E96 A;  4JXQ A;  3EFA A;  5IB0 A;  3BJ8 A;  4IUS A;  3NE7 A;  2PSW A;  2HQY A;  1IB1 E;  2A4N A;  2X7B A;  4KOW A;  2B4D A;  1B6B A;  2OU2 A;  2WPW A;  2P6E A;  3EC4 A;  1S7L A;  2JDC A;  4XPD C;  4XNH B;  3R9E A;  2P6F A;  5EC4 A;  4UA3 A;  2FS5 A;  4MY0 A;  2Q0Y A;  3R95 A;  1WWZ A;  3B8G A;  4CRY B;  2REE A;  3DNS A;  4II9 A;  4AVB A;  1VKC A;  1UFH A;  3W6X A;  4KOY A;  1P0H A;  1QSM A;  1XMT A;  2O28 A;  2JLM A;  4AVA A;  1M4D A;  3FB3 A;  3TCV A;  3G8W A;  3FXT A;  4QVT A;  2R98 A;  4JJX A;  4R87 A;  4R3K A;  1NE9 A;  1GHE A;  5C82 A;  1I1D A;  4MI4 A;  5JPH A;  5DWN A;  1YRE A;  2I00 A;  4R57 A;  5KTD A;  1V0C A;  3P2F A;  2G3A A;  2D4P A;  2GIV A;  3F5B A;  3EY5 A;  3SHP A;  3IWG A;  2WPX A;  4NCZ A;  3T90 A;  5FVJ A;  4UWJ A;  4PK3 A;  1XF8 A;  2FXF A;  4MJ8 A;  4NXY A;  2ZXV A;  4HKF A;  2ZPA A;  4H6U A;  3LOD A;  1Y9W A;  1Z4R A;  1S5K A;  4QC6 A;  3DDD A;  2G0B A;  4Y49 C;  5J8F A;  4CAW A;  2ZW5 A;  2P6G A;  2Z0Z A;  1LRZ A;  4KVM E;  4PSX A;  4KUA A;  5F47 A;  3ZZI A;  1Q2D A;  1RXT A;  1P4N A;  3DR6 A;  4JLY A;  3UY5 A;  1U6M A;  4XPK A;  4J3G A;  2Q4Y A;  3FNC A;  4LX9 A;  2Q44 A;  1RO5 A;  4NF1 A;  3TE4 A;  1S7F A;  4M3S A;  5HH1 A;  1BO4 A;  2BEI A;  2VBQ A;  4B5P B;  3CXS A;  1QSR A;  1YVK A;  1Z9U A;  4E0A A;  1S7N A;  4YRH A;  4KUB A;  3GKR A;  2OH1 A;  5DWM A;  1Q2C A;  4X5K A;  4YGO A;  2K5T A;  3D3S A;  1KUX A;  4QB9 A;  2ZW6 A;  1ON0 A;  2R1I A;  1XEB A;  3VWE A;  3K9U A;  4RI1 A;  3JVN A;  2REF A;  3DSB A;  5IV0 A;  4AG9 A;  4L89 A;  1KUY A;  3DR8 A;  4K30 A;  4E8O A;  2FT0 A;  3F0A A;  4I49 A;  4PV6 A;  3S6K A;  1IYK A;  3P2H A;  4E2A A;  4CAV A;  5GCN A;  2P0W A;  4CAX A;  4R9M A;  4QBJ A;  1PU9 A;  2AJ6 A;  2VZY A;  2QEC A;  2DXQ A;  4H6Z A;  3PGP A;  2OZU A;  3W91 A;  5HMN A;  2ARH A;  2PQ8 A;  2PC1 A;  3MGD A;  2FIA A;  2Q04 A;  2VZZ A;  4MBU A;  4ONU A;  2F5I A;  4XPL A;  4IF5 A;  3H4Q A;  5J8C A;  5KTA A;  1S60 A;  2R7H A;  1PUA A;  4KVO E;  2ZW7 A;  4RS2 A;  3SXO A;  3T9Y A;  4OLL A;  3TOB A;  1MK4 A;  3IGR A;  4KLW A;  4XPD B;  2FCK A;  5CNP A;  3D8P A;  3PP9 A;  2ZW4 A;  2EUI A;  2CNS A;  5KTC A;  1BOB A;  3V8I A;  1Y7R A;  1I21 A;  3R9F A;  2I79 A;  4AG7 A;  4CS0 B;  2JEV A;  4FD4 A;  2R8V A;  1L0C A;  4B5P A;  4GS4 A;  2VQY A;  3D2P A;  1I12 A;  1M4G A;  4KLV A;  4ZBG A;  4B5O A;  4NEX A;  4DNC A;  2FSR A;  2QML A;  3TO6 A;  2PR8 A;  3WR7 A;  3CXQ A;  1IID A;  1S7K A;  3ZJ0 A;  1CJW A;  3W6S A;  2CNM A;  4MY3 A;  4PSW A;  2J8N A;  4XNH C;  3PZJ A;  1KUV A;  2RC4 A;  4HNX B;  5F49 A;  1WK4 A;  2OZH A;  4CRZ B;  4EVY A;  3TO7 A;  2CY2 A;  4Y49 B;  4KOS A;  3SXN A;  5C88 A;  1M4I A;  4UWI A;  4LUA A;  1QSO A;  1IIC A;  3S6F A;  3LD2 A; 
#chains in the Genus database with same CATH topology
 4MHP A;  4MCS A;  3CPX A;  4TNU A;  3VWD A;  2PJ5 A;  1AMP A;  2ZEL A;  4MFQ A;  4JWP A;  4CGO A;  2VEZ A;  1Z5R A;  4PK2 A;  5HVG A;  4F6A A;  2PE3 A;  2VI7 A;  3PRT A;  3FJU A;  4R76 A;  5G22 A;  5ISV A;  3VAT A;  1KZF A;  4ZYQ A;  1K4J A;  1MJ9 A;  1YR0 A;  3TFY A;  3BXM A;  1Z4E A;  1QSN A;  4JD6 A;  4QUS A;  3BI1 A;  1IYL A;  4OAD A;  4MCP A;  1N71 A;  2JBJ A;  3I3G A;  2OZG A;  1TF9 A;  4AVC A;  1FY7 A;  3OWC A;  3D2M A;  1B87 A;  5H84 A;  4F0X A;  1ARL A;  2Q7B A;  4F0Y A;  1MJA A;  2PJ6 A;  3RZA A;  2B5G B;  2IQ6 A;  3R96 A;  3S6H A;  2CNT A;  2OR4 A;  3IC1 A;  3JUW A;  4M6H A;  5AG6 A;  1XIX A;  1YLE A;  4BMH A;  3FYN A;  3FF3 A;  2PJ0 A;  5DS0 A;  3FBU A;  4LQG A;  3KR4 A;  2BCO A;  3IWW A;  3WT4 A;  4NGT A;  5LYD A;  4OC0 A;  5K8N A;  1OZP A;  2VXK A;  1LAP A;  1UWY A;  1YME A;  4HNY B;  2EVN A;  6CPA A;  5IX3 A;  2OB0 A;  3C26 A;  2NYQ A;  1XE4 A;  4KZT A;  2GE3 A;  3TC8 A;  4A94 A;  2B3V A;  4ORF A;  2B4D B;  1J4J A;  1NSL A;  4U9Z A;  4NSQ A;  2HB6 A;  5IB9 A;  4FD5 A;  1TF8 A;  1S3Z A;  1BAV A;  2ANP A;  3FRM A;  3KL9 A;  2DPT A;  4MHY A;  3QNV A;  5CBM A;  4JXR A;  1YGH A;  1RTQ A;  3FX6 A;  3D67 A;  3SI1 A;  3GY9 A;  2G3T A;  3D7G A;  3S6G A;  3EO4 A;  4OAE A;  3TTH A;  5LRG A;  4P4E A;  2RB7 A;  2FL4 A;  3GUX A;  3R9G A;  2CF4 A;  2AFS A;  4FD6 A;  1YVO A;  2QIR A;  2IL4 A;  5J1Q A;  4YFJ A;  1SQH A;  4DJL A;  5LYL A;  4Z65 A;  2Z10 A;  4MFK A;  3IIB A;  4M85 A;  1R57 A;  2XEI A;  4UF4 A;  4UIA A;  2KCW A;  2Y0M A;  1TIQ A;  1YQE A;  4KOT A;  2QJ8 A;  1Z8L A;  4C2Z A;  5I0C A;  5EBV A;  3TT2 A;  4P4J A;  4CYP A;  4B14 A;  3R1K A;  1ZO0 A;  1CM0 A;  3GYA A;  4MHD A;  4A32 A;  3KKW A;  3FEE A;  3IU1 A;  4U5Y A;  1YX0 A;  3TO9 A;  2B3U A;  2B58 A;  3TOA A;  1ZG8 A;  3PFO A;  4MCQ A;  1FNO A;  5H86 A;  4AB7 A;  2FE7 A;  4H89 A;  5JM6 A;  2YNE A;  2ZEE A;  5I4M A;  1ZG9 A;  2PJ9 A;  2Z11 A;  4R8F A;  2F7V A;  2WZN A;  1YK3 A;  2V77 A;  3SJG A;  4B6Z A;  1QST A;  4MFP A;  3D7D A;  4FD7 A;  4UCN A;  5AG4 A;  3QAH A;  5G21 A;  1JQG A;  4KOX A;  3PB4 X;  3IEH A;  4KS9 A;  7CPA A;  4UBR A;  3WAB A;  2PJ4 A;  4MFL A;  2YGW A;  3RYO A;  1Q2Y A;  3E0K A;  5CPA A;  2NMT A;  3FMC A;  4FAI A;  1NMT A;  2PRB A;  2HV2 A;  4IK2 A;  2I3C A;  1JWQ A;  2H5M A;  4JZ0 A;  3CZX A;  4NFR A;  3WC5 A;  3B3C A;  2AFW A;  2BSW A;  2FIW A;  3B3V A;  3BJ7 A;  1Y9K A;  4KOU A;  4WWV A;  2BUE A;  2C27 A;  1MJB A;  2PR1 A;  4L8A A;  1M44 A;  2PDO A;  2D4O A;  2J8R A;  4U9Y A;  1A2Z A;  2B4B A;  4KVX A;  2EK9 A;  3EXN A;  2O53 A;  4P4I A;  2GAN A;  1XJO A;  4A2Z A;  1LFW A;  4P45 A;  1IU8 A;  2IMO A;  3CXP A;  1Y7E A;  4EME A;  1QMU A;  4KOR A;  1HDU A;  2HUZ A;  5F46 A;  3PBB A;  2J8M A;  4UEF A;  3G3S A;  5JQ4 A;  4KSA A;  4TWE A;  2AE6 A;  2Q4V A;  3QB8 A;  3SI2 A;  3BHX A;  2V8D A;  2WSA A;  4HNW B;  3BLN A;  2ATR A;  2QYV A;  3FIX A;  3N5F A;  3PB7 X;  4A33 A;  4LQ6 A;  3I9S A;  1HDQ A;  1CP6 A;  1VIX A;  2ABZ A;  2PIZ A;  4R6T A;  2ZOG A;  3F8K A;  2B5G A;  3B2Y A;  3KZW A;  4UFX A;  3SJE A;  5K8M A;  1M1D A;  4MXU A;  4R3L A;  1VHS A;  3S9N A;  2J9A A;  4BBH A;  4CYQ A;  2JDD A;  3FVL A;  4R7M A;  2PJB A;  4CYO A;  1VGY A;  5A28 A;  2ZEN A;  3N7Z A;  5HVH A;  1X12 A;  1LOK A;  3GLJ A;  5F48 A;  4KOV A;  2BL1 A;  5E96 A;  4JXQ A;  2EWB A;  4NGP A;  3EFA A;  5IB0 A;  3BJ8 A;  4IUS A;  1LAN A;  1Z8T A;  3NE7 A;  4FWU A;  4OIW A;  2PSW A;  2HQY A;  4CYN A;  1IB1 E;  2C1C A;  4PXC A;  2A4N A;  2F8H A;  2X7B A;  2PRQ A;  4KOW A;  4OC3 A;  2B4D A;  1B6B A;  2OU2 A;  2WPW A;  1HEE A;  3B3W A;  2PJC A;  3S9M A;  2P6E A;  3PBE A;  1DTD A;  5G1Z A;  3EC4 A;  4IHM A;  2AFO A;  5K8P A;  1S7L A;  2JDC A;  4FUU A;  4ZX9 A;  3KI9 A;  2AFU A;  1TKJ A;  4XPD C;  1R3N A;  4CGM A;  4XNH B;  3R9E A;  2P6F A;  2EK8 A;  2VL1 A;  4UEE A;  5EC4 A;  3TX8 A;  3FED A;  4UA3 A;  4CGP A;  2FS5 A;  1Y0Y A;  4OME A;  1Q7L A;  4MY0 A;  2PJ2 A;  4A30 A;  3SI0 A;  2Q0Y A;  5LYF A;  3H5Z A;  3R95 A;  1WWZ A;  3B8G A;  1FT7 A;  1XRY A;  2ODF A;  4CRY B;  2REE A;  3DNS A;  4II9 A;  4AVB A;  1VKC A;  4C68 A;  1UFH A;  3IU2 A;  3W6X A;  4KOY A;  1P0H A;  1QSM A;  1XMT A;  2O28 A;  2JLM A;  4AVA A;  1M4D A;  4Q36 A;  3FB3 A;  3TCV A;  3G8W A;  2WYR A;  3FXT A;  2FVG A;  4QVT A;  1PCA A;  2R98 A;  4CGL A;  4JJX A;  4R87 A;  4R3K A;  2JEW A;  1NE9 A;  1GHE A;  4F9U A;  3IFE A;  5C82 A;  1I1D A;  4MI4 A;  5JPH A;  5DWN A;  5THW A;  4W9Y A;  2YNC A;  1YRE A;  2I00 A;  3NH8 A;  5AG7 A;  5D29 A;  2Z3N A;  2GU2 A;  4R57 A;  4B13 A;  2YNC C;  4FBE A;  5KTD A;  1V0C A;  4NGS A;  3P2F A;  1EE3 P;  2CIJ A;  2G3A A;  3H8E A;  4IAV A;  2D4P A;  2GIV A;  3F5B A;  4X8I A;  3H8F A;  4X3R A;  1Z8X A;  2AFZ A;  2YND A;  3EY5 A;  4A37 A;  4BD9 A;  3SHP A;  4A38 A;  3IWG A;  2Z3K A;  2WPX A;  4NCZ A;  3T90 A;  1BPM A;  4PQA A;  4UIB A;  1KWM A;  5FVJ A;  4UWJ A;  1XFO A;  4PK3 A;  4RN7 A;  2Z3M A;  4YU9 A;  4EFD A;  3WC7 A;  4KSF A;  1YW4 A;  2GFQ A;  1XF8 A;  2FXF A;  2Z3L A;  2DPS A;  4MJ8 A;  1ZLI A;  3GB0 A;  3I1U A;  4NXY A;  4PXE A;  4PPZ A;  2ZXV A;  2PJ1 A;  4P10 A;  1TKH A;  3HLP A;  4HKF A;  2ZPA A;  4H6U A;  3LOD A;  3KQX A;  1Y9W A;  1Z4R A;  1BPN A;  4OP4 A;  1S5K A;  3RO0 A;  3IJ3 A;  4QC6 A;  3DDD A;  2XEG A;  2G0B A;  4Y49 C;  5J8F A;  4NGM A;  5ELY A;  4CAW A;  2ZW5 A;  1LAM A;  1F57 A;  1ELL P;  2P6G A;  3ISZ A;  2Z0Z A;  1LRZ A;  4KVM E;  4PSX A;  3JRU A;  4UFV A;  4MRI A;  4KSI A;  4KUA A;  4B10 A;  2BO9 A;  5F47 A;  4NGR A;  2Z3O A;  1Q2D A;  1BLL E;  1RXT A;  2CTC A;  4WJB A;  3ZZI A;  1CX8 A;  1P4N A;  2PJ7 A;  3PB6 X;  1XMB A;  2PIY A;  4UCM A;  1IOI A;  3DR6 A;  2IJZ A;  3L2N A;  4JLY A;  2G9D A;  2OOT A;  3UY5 A;  3KQZ A;  4H2K A;  1IGB A;  3D66 A;  4A95 A;  1U6M A;  4XPK A;  1Z8W A;  3NE8 A;  1ZLH A;  2RFH A;  4J3G A;  2Q4Y A;  4AXV A;  3SJX A;  3FNC A;  4A39 A;  1CPX A;  4LX9 A;  2Q44 A;  1RO5 A;  4NF1 A;  5HVF A;  2Q43 A;  3TE4 A;  1S7F A;  3B3S A;  4M3S A;  5HH1 A;  1BO4 A;  2BEI A;  2VBQ A;  4EWT A;  4M6I A;  4O23 A;  3LD2 A;  4B5P B;  3CXS A;  2PVW A;  4Q38 A;  3B7I A;  2XEJ A;  1QSR A;  5JGF A;  1YVK A;  1Z9U A;  2PJ3 A;  4E0A A;  1S7N A;  1QQ9 A;  3CT9 A;  1YLO A;  1AYE A;  4YRH A;  1M4L A;  4KUB A;  3GKR A;  4DYO A;  2OH1 A;  1DE4 C;  1NSA A;  1OBR A;  2C6G A;  5DWM A;  1Q2C A;  3LMS A;  1TKF A;  4X5K A;  4YGO A;  2K5T A;  3D3S A;  1KUX A;  4QB9 A;  3DLJ A;  5AG5 A;  2ZW6 A;  4C7I A;  2GLJ A;  1ON0 A;  2R1I A;  4UCP A;  1XEB A;  3VWE A;  3K9U A;  4NGN A;  2ZEH A;  4RI1 A;  3JVN A;  2REF A;  3DSB A;  4M6G A;  5IV0 A;  2GLF A;  4AG9 A;  4L89 A;  1KUY A;  1IOF A;  3CPA A;  3DR8 A;  4NGQ A;  3VH9 A;  4K30 A;  3WC6 A;  4E8O A;  1XOV A;  2FT0 A;  3F0A A;  4I49 A;  4PV6 A;  3S6K A;  4CAF A;  2ZED A;  4JYW A;  1IYK A;  3P2H A;  4GM5 A;  4E2A A;  3B35 A;  4CAV A;  5GCN A;  4DUK A;  4B12 A;  2P0W A;  1ELM P;  4CAX A;  3A9L A;  2CXA A;  3PEI A;  4R9M A;  1CBX A;  4CGN A;  1PU9 A;  4QBJ A;  4ZI6 A;  2AJ6 A;  3B3T A;  2VZY A;  3MN8 A;  2C6P A;  3KGQ A;  2QEC A;  2DXQ A;  4H6Z A;  3NH4 A;  1H8L A;  4OC1 A;  4UFW A;  3PGP A;  2OZU A;  3W91 A;  2O4H A;  5LRJ A;  5HMN A;  5F09 A;  2ARH A;  5A27 A;  2PQ8 A;  3K2K A;  3IWE A;  2PC1 A;  4HPS A;  4MFZ A;  3MGD A;  4CAE A;  2PJ8 A;  2FIA A;  2Z3P A;  1AUG A;  4MHZ A;  4Q7A A;  4MMO A;  2Q04 A;  3SJF A;  3NA6 A;  4P4D A;  3RBU A;  3VAR A;  3PFE A;  2VZZ A;  3LWU A;  3CDX A;  2F5I A;  3KHX A;  4MBU A;  4ONU A;  4XPL A;  4OID A;  1VHE A;  4IF5 A;  3H4Q A;  5J8C A;  5KTA A;  1S60 A;  2R7H A;  3FH4 A;  1PUA A;  4RUH A;  2C6C A;  4KVO E;  1F2O A;  3JTK A;  4OC2 A;  2ZW7 A;  4RS2 A;  3SXO A;  3V38 A;  4NJR A;  3T9Y A;  4OLL A;  3TOB A;  1MK4 A;  3IGR A;  3PB9 X;  4KLW A;  4XPD B;  5LYI A;  2FCK A;  5JH9 A;  5CNP A;  4P44 A;  3D8P A;  2Q51 A;  3LAC A;  3PP9 A;  2ZW4 A;  3IO1 A;  4C7H A;  2EUI A;  3KHZ A;  3NH5 A;  2CNS A;  2PJA A;  3FEC A;  2V8H A;  5KTC A;  1BOB A;  3V8I A;  1Y7R A;  1I21 A;  2CTB A;  3PB8 X;  3R9F A;  3GIU A;  3RNZ A;  3DGV A;  3D4U A;  3D7F A;  3MRU A;  4C2X A;  2I79 A;  2ZEO A;  2Q7S A;  4AG7 A;  2ZOF A;  1Z2L A;  3KR5 A;  1IY7 A;  2ZEF A;  4BIN A;  3RAM A;  1YW6 A;  4CS0 B;  1VHO A;  2JEV A;  4FD4 A;  4ZGY B;  2R8V A;  3HUV A;  3K9T A;  1L0C A;  4B5P A;  1TXR A;  5BWA B;  2PVV A;  4GS4 A;  3QAY A;  2VQY A;  3D2P A;  1I12 A;  1M4G A;  2ZEG A;  1GYT A;  4KLV A;  4X2T A;  4NEX A;  4ZBG A;  3V7Z A;  4B5O A;  4DNC A;  8CPA A;  2Q4Z A;  2FSR A;  4GXH A;  2QML A;  1YSJ A;  1XBU A;  3TO6 A;  1CG2 A;  5K8O A;  4MFJ A;  2QVP A;  2EO8 A;  3NFZ A;  1CP7 A;  4A31 A;  2NSM A;  3H8G A;  2PR8 A;  3WR7 A;  3CXQ A;  3D7H A;  1X10 A;  1ZG7 A;  2XEF A;  1IID A;  4NJQ A;  4PXD A;  5AGE A;  2EBJ A;  1F2P A;  1S7K A;  4G1P A;  3ZJ0 A;  1CJW A;  3W6S A;  2DF5 A;  2POK A;  4F8Z A;  2CNM A;  1CPS A;  4K3N A;  4OKO A;  1ARM A;  4OC5 A;  4MY3 A;  4ONW A;  4PSW A;  4P6Y A;  2J8N A;  4ZY0 A;  4XNH C;  3PZJ A;  4UEZ A;  3T8W A;  4C2Y A;  5EMI A;  5LRK A;  1KUV A;  3KAS A;  4YWY A;  3S9L A;  5G20 A;  2RC4 A;  2ZEP A;  2HC9 A;  4HNX B;  5D8N A;  5F49 A;  4B11 A;  4CPA A;  1PYT B;  2JBK A;  4MHN A;  4PXB A;  1WK4 A;  2OZH A;  4F9V A;  2V8V A;  2BOA A;  4CRZ B;  4EVY A;  4ZY2 A;  3ISX A;  2CY2 A;  4OC4 A;  3TO7 A;  4MCR A;  4P4F A;  4P4B A;  5HXD A;  2PCU A;  4Y49 B;  4KOS A;  3SXN A;  5C88 A;  1M4I A;  4ZX8 A;  1R43 A;  4UWI A;  3BI0 A;  2DEA A;  4LUA A;  1LCP A;  1QSO A;  1IIC A;  1Y0R A;  2GRE A;  4ZY1 A;  3S6F A;  2AFX A;  2WUU A;  2V8G A;  2AFM A;  2ZEM A;  3D68 A; 
#chains in the Genus database with same CATH homology
 3VWD A;  4MFQ A;  4JWP A;  4CGO A;  2VEZ A;  4PK2 A;  4F6A A;  2VI7 A;  5G22 A;  5ISV A;  1KZF A;  1K4J A;  1MJ9 A;  1YR0 A;  3TFY A;  1Z4E A;  1QSN A;  4JD6 A;  4QUS A;  1IYL A;  4OAD A;  1N71 A;  4AVC A;  3I3G A;  2OZG A;  1FY7 A;  3OWC A;  3D2M A;  1B87 A;  5H84 A;  4F0X A;  2Q7B A;  4F0Y A;  1MJA A;  2B5G B;  3R96 A;  3S6H A;  2CNT A;  3JUW A;  5AG6 A;  1XIX A;  1YLE A;  4BMH A;  3FYN A;  3FBU A;  1OZP A;  2VXK A;  4HNY B;  2EVN A;  5IX3 A;  2OB0 A;  3C26 A;  4KZT A;  1XE4 A;  2GE3 A;  2B3V A;  4ORF A;  2B4D B;  1J4J A;  1NSL A;  4U9Z A;  4NSQ A;  4FD5 A;  1S3Z A;  3FRM A;  2DPT A;  4JXR A;  1YGH A;  3GY9 A;  2G3T A;  3S6G A;  3EO4 A;  4OAE A;  3TTH A;  2FL4 A;  3R9G A;  4FD6 A;  1YVO A;  2QIR A;  2IL4 A;  4YFJ A;  1SQH A;  2Z10 A;  4MFK A;  4M85 A;  1R57 A;  2KCW A;  2Y0M A;  1TIQ A;  4KOT A;  4C2Z A;  5I0C A;  5EBV A;  3TT2 A;  4CYP A;  4B14 A;  3R1K A;  1ZO0 A;  1CM0 A;  3GYA A;  4MHD A;  4A32 A;  3KKW A;  3IU1 A;  4U5Y A;  1YX0 A;  3TO9 A;  2B3U A;  2B58 A;  3TOA A;  4AB7 A;  5H86 A;  2FE7 A;  4H89 A;  2YNE A;  2Z11 A;  1YK3 A;  1QST A;  4MFP A;  4FD7 A;  4UCN A;  5AG4 A;  3QAH A;  5G21 A;  4KOX A;  4KS9 A;  4UBR A;  4MFL A;  2YGW A;  3RYO A;  1Q2Y A;  3E0K A;  2NMT A;  1NMT A;  2PRB A;  2HV2 A;  2H5M A;  2BSW A;  2FIW A;  3BJ7 A;  1Y9K A;  4KOU A;  2BUE A;  2C27 A;  1MJB A;  2PR1 A;  4L8A A;  1M44 A;  2PDO A;  2D4O A;  2J8R A;  4U9Y A;  2B4B A;  4KVX A;  3EXN A;  2GAN A;  4A2Z A;  3CXP A;  4KOR A;  2HUZ A;  5F46 A;  2J8M A;  3G3S A;  5JQ4 A;  4KSA A;  2AE6 A;  2Q4V A;  3QB8 A;  2WSA A;  4HNW B;  3BLN A;  2ATR A;  3FIX A;  4A33 A;  3I9S A;  3F8K A;  2B5G A;  4UFX A;  1M1D A;  4R3L A;  1VHS A;  4BBH A;  4CYQ A;  2JDD A;  4CYO A;  5A28 A;  3N7Z A;  5F48 A;  4KOV A;  2BL1 A;  5E96 A;  4JXQ A;  3EFA A;  5IB0 A;  3BJ8 A;  4IUS A;  3NE7 A;  2PSW A;  2HQY A;  4CYN A;  1IB1 E;  2A4N A;  2X7B A;  4KOW A;  2B4D A;  1B6B A;  2OU2 A;  2WPW A;  2P6E A;  5G1Z A;  3EC4 A;  1S7L A;  2JDC A;  4XPD C;  4CGM A;  4XNH B;  3R9E A;  2P6F A;  4CGP A;  5EC4 A;  4UA3 A;  2FS5 A;  4MY0 A;  4A30 A;  2Q0Y A;  3H5Z A;  3R95 A;  1WWZ A;  3B8G A;  4CRY B;  2REE A;  3DNS A;  4II9 A;  4AVB A;  1VKC A;  4C68 A;  1UFH A;  3IU2 A;  3W6X A;  4KOY A;  1P0H A;  1QSM A;  1XMT A;  2O28 A;  2JLM A;  4AVA A;  1M4D A;  4Q36 A;  3FB3 A;  3TCV A;  3G8W A;  3FXT A;  4QVT A;  2R98 A;  4CGL A;  4JJX A;  4R87 A;  4R3K A;  1NE9 A;  1GHE A;  5C82 A;  1I1D A;  4MI4 A;  5JPH A;  5DWN A;  5AG7 A;  2YNC A;  1YRE A;  2I00 A;  4B13 A;  2Z3N A;  4R57 A;  2YNC C;  5KTD A;  1V0C A;  3P2F A;  2G3A A;  2D4P A;  2GIV A;  3F5B A;  2YND A;  3EY5 A;  3SHP A;  3IWG A;  2Z3K A;  2WPX A;  4NCZ A;  3T90 A;  5FVJ A;  4UWJ A;  4PK3 A;  2Z3M A;  4KSF A;  1XF8 A;  2FXF A;  2Z3L A;  2DPS A;  4MJ8 A;  4NXY A;  2ZXV A;  4HKF A;  2ZPA A;  4H6U A;  3LOD A;  1Y9W A;  1Z4R A;  1S5K A;  4QC6 A;  3DDD A;  2G0B A;  4Y49 C;  5J8F A;  4CAW A;  2ZW5 A;  2P6G A;  2Z0Z A;  1LRZ A;  4KVM E;  4PSX A;  4UFV A;  4KUA A;  4B10 A;  5F47 A;  3ZZI A;  2Z3O A;  1Q2D A;  1RXT A;  1P4N A;  4UCM A;  3DR6 A;  4JLY A;  3UY5 A;  4A95 A;  1U6M A;  4XPK A;  4J3G A;  2Q4Y A;  3FNC A;  4LX9 A;  2Q44 A;  1RO5 A;  4NF1 A;  3TE4 A;  1S7F A;  4M3S A;  5HH1 A;  1BO4 A;  2BEI A;  2VBQ A;  4B5P B;  3CXS A;  4Q38 A;  1QSR A;  1YVK A;  1Z9U A;  4E0A A;  1S7N A;  4YRH A;  4KUB A;  3GKR A;  2OH1 A;  5DWM A;  1Q2C A;  4X5K A;  4YGO A;  2K5T A;  3D3S A;  1KUX A;  4QB9 A;  5AG5 A;  2ZW6 A;  4C7I A;  1ON0 A;  2R1I A;  4UCP A;  1XEB A;  3VWE A;  3K9U A;  4RI1 A;  3JVN A;  2REF A;  3DSB A;  5IV0 A;  4AG9 A;  4L89 A;  1KUY A;  3DR8 A;  4K30 A;  4E8O A;  2FT0 A;  3F0A A;  4I49 A;  4PV6 A;  3S6K A;  4CAF A;  1IYK A;  3P2H A;  4E2A A;  4CAV A;  5GCN A;  4B12 A;  2P0W A;  4CAX A;  3A9L A;  2CXA A;  4R9M A;  4CGN A;  4QBJ A;  1PU9 A;  2AJ6 A;  2VZY A;  2QEC A;  2DXQ A;  4H6Z A;  4UFW A;  3PGP A;  2OZU A;  3W91 A;  5HMN A;  2ARH A;  5A27 A;  2PQ8 A;  3IWE A;  2PC1 A;  4MFZ A;  3MGD A;  4CAE A;  2FIA A;  2Z3P A;  2Q04 A;  2VZZ A;  4MBU A;  4ONU A;  2F5I A;  4XPL A;  4IF5 A;  3H4Q A;  5J8C A;  5KTA A;  1S60 A;  2R7H A;  1PUA A;  4KVO E;  3JTK A;  2ZW7 A;  4RS2 A;  3SXO A;  3T9Y A;  4OLL A;  3TOB A;  1MK4 A;  3IGR A;  4KLW A;  4XPD B;  2FCK A;  5CNP A;  3D8P A;  3PP9 A;  2ZW4 A;  4C7H A;  2EUI A;  2CNS A;  5KTC A;  1BOB A;  3V8I A;  1Y7R A;  1I21 A;  3R9F A;  4C2X A;  2I79 A;  4AG7 A;  4CS0 B;  2JEV A;  4FD4 A;  4ZGY B;  2R8V A;  1L0C A;  4B5P A;  5BWA B;  4GS4 A;  2VQY A;  3D2P A;  1I12 A;  1M4G A;  4KLV A;  4ZBG A;  4B5O A;  4NEX A;  4DNC A;  2FSR A;  2QML A;  3TO6 A;  4MFJ A;  4A31 A;  2PR8 A;  3WR7 A;  3CXQ A;  5AGE A;  1IID A;  1S7K A;  3ZJ0 A;  1CJW A;  3W6S A;  2CNM A;  4MY3 A;  4PSW A;  2J8N A;  4XNH C;  3PZJ A;  4C2Y A;  1KUV A;  5G20 A;  2RC4 A;  4HNX B;  5F49 A;  4B11 A;  1WK4 A;  2OZH A;  4CRZ B;  4EVY A;  3TO7 A;  2CY2 A;  4Y49 B;  4KOS A;  3SXN A;  5C88 A;  1M4I A;  4UWI A;  4LUA A;  1QSO A;  1IIC A;  3S6F A;  2WUU A;  3LD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...