2CNMA

Rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with a bisubstrate inhibitor (cterm-arg-arg-phe-tyr-arg-ala-n-alpha- acetyl-s-coa).
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
151
structure length
151
Chain Sequence
MNTISILSTTDLPAAWQIEQRAHAFPWSEKTFFGNQGERYLNLKLTADDRMAAFAITQVVLDEATLFNIAVDPDFQRRGLGRMLLEHLIDELETRGVVTLWLEVRASNAAAIALYESLGFNEATIRRNYYPTAQGHEDAIIMALPISMKLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MODIFICATION OF 30S RIBOSOMAL SUBUNIT PROTEIN S18
publication title Crystal Structure of Rimi from Salmonella Typhimurium Lt2, the Gnat Responsible for N{Alpha}- Acetylation of Ribosomal Protein S18.
pubmed doi rcsb
source organism Salmonella typhimurium lt2
total genus 46
structure length 151
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2cnmA00
2CY2A 4CAVA 3FYNA 4UA3A 1M1DA 2Q4YA 4JLYA 2B5GB 1I1DA 2VI7A 3DSBA 4KUBA 2QMLA 3DDDA 4AVBA 5DWNA 2NMTA 3EY5A 2X7BA 5FVJA 4IUSA 1XF8A 2HQYA 1S7LA 4JD6A 3G8WA 3CXSA 4LX9A 3EFAA 4JJXA 1K4JA 3G3SA 3F8KA 3ZZIA 2FCKA 5IB0A 4XPLA 1YR0A 4PSXA 1Q2DA 2B4DB 3GY9A 2OZGA 2PRBA 1MJBA 4XNHC 4CRZB 1IYLA 2J8MA 2Z10A 3E0KA 3R1KA 1QSMA 1BO4A 5J8FA 1XEBA 3P2FA 4M85A 4R57A 1L0CA 1KZFA 1BOBA 2A4NA 1RXTA 2GE3A 4B5PA 3V8IA 4IF5A 4E0AA 2REEA 5DWMA 2HV2A 3EC4A 5F49A 3DR6A 4E2AA 4Y49B 5F47A 1U6MA 4QB9A 4UWJA 1S3ZA 2ATRA 4RI1A 4XPKA 4KVME 2Q0YA 1MJAA 3SXNA 3F5BA 5CNPA 4AG7A 2KCWA 2K5TA 3SHPA 4ORFA 5JQ4A 4OAEA 2BSWA 3R9EA 4KUAA 1KUXA 2ZW4A 4KOTA 3SXOA 4E8OA 2I00A 3W6SA 2PDOA 1Y7RA 3S6KA 3TTHA 2B3VA 3UY5A 1N71A 2HUZA 4JXRA 4U5YA 2Z11A 2GANA 3VWEA 2QECA 2PQ8A 4M3SA 1VKCA 1ON0A 4B5OA 3JVNA 1QSRA 2OU2A 1IIDA 1S7NA 1J4JA 1OZPA 2AJ6A 4R87A 2BUEA 5H86A 2ZW6A 3EO4A 1QSNA 2B5GA 4KOSA 2R1IA 4FD6A 1WK4A 2Q4VA 3DNSA 4EVYA 4CAXA 2BEIA 1Z4EA 4UBRA 4PV6A 5C88A 1XIXA 3TOBA 2VZYA 3TT2A 3TO6A 4OLLA 2R98A 1Z9UA 2OZUA 3BLNA 3PP9A 2OH1A 3JUWA 4MY3A 3LD2A 4NCZA 2B4DA 3K9UA 2PR8A 2FXFA 1M4IA 4XPDB 1QSTA 1RO5A 2WPXA 3BJ7A 2Q44A 2PR1A 1PUAA 4KORA 5C82A 4R9MA 2VBQA 4MBUA 3R9FA 2P0WA 2F5IA 1UFHA 2R8VA 3PGPA 1S7KA 2CNTA 4H6UA 4CRYB 2D4OA 2EVNA 2JDDA 4HNWB 2FSRA 1YREA 1SQHA 4UWIA 4JXQA 2B58A 2O28A 4X5KA 2Q7BA 1CJWA 4HNYB 5F46A 1PU9A 1IB1E 5EC4A 2ARHA 1S60A 1KUYA 2VXKA 5HH1A 5E96A 5HMNA 4AB7A 5KTCA 4XNHB 2B3UA 4PSWA 2P6FA 3W6XA 1Q2CA 4MJ8A 4KVOE 4JWPA 4NSQA 4HKFA 3KKWA 4QC6A 4NEXA 1S5KA 2VZZA 4NXYA 2PSWA 4B5PB 4U9ZA 2FS5A 3FRMA 2WPWA 3TE4A 2I79A 4PK3A 4KOYA 4H89A 3R9GA 4F0YA 1P0HA 4F6AA 2Y0MA 3MGDA 1M44A 4HNXB 3ZJ0A 1YX0A 4AVCA 4KOXA 2Z0ZA 1M4DA 3BJ8A 3FBUA 1IICA 5ISVA 3C26A 1P4NA 1QSOA 5H84A 4KOUA 1CM0A 1XE4A 2GIVA 5EBVA 2G3AA 2Q04A 3OWCA 2CNSA 4LUAA 3FXTA 3R96A 1FY7A 2ZW5A 2EUIA 4QVTA 4J3GA 3P2HA 1I12A 2FIWA 2JEVA 2OB0A 1LRZA 4FD7A 2FIAA 3D2MA 4I49A 3TO9A 5I0CA 1M4GA 4KVXA 3QB8A 2BL1A 3VWDA 2P6GA 1XMTA 1V0CA 3DR8A 3EXNA 3T9YA 2FL4A 4RS2A 1I21A 3IWGA 3F0AA 4KOWA 4CAWA 3RYOA 3S6HA 2ZW7A 1WWZA 2IL4A 2RC4A 4PK2A 1Q2YA 1TIQA 4KLWA 4Y49C 4YRHA 1YVOA 5GCNA 4QBJA 2FT0A 4KOVA 3FIXA 3I9SA 2CNMA 3FNCA 1GHEA 4FD5A 4AG9A 4KZTA 4MY0A 2B4BA 4ONUA 4L8AA 1B87A 2R7HA 4R3KA 5KTDA 3T90A 5J8CA 4QUSA 4R3LA 2G3TA 2PC1A 1S7FA 1Y9WA 1YLEA 2OZHA 4ZBGA 3TO7A 4YFJA 3D3SA 4CS0B 1NMTA 1KUVA 2G0BA 3H4QA 3D2PA 1NE9A 2DXQA 3D8PA 2D4PA 3PZJA 1YVKA 2REFA 1B6BA 3TFYA 3W91A 3TCVA 5IV0A 3S6FA 4II9A 4KLVA 2ZPAA 3N7ZA 3NE7A 3R95A 4BMHA 2J8RA 4FD4A 2VEZA 4OADA 3FB3A 1NSLA 2QIRA 1R57A 3WR7A 3GKRA 1VHSA 1MJ9A 3S6GA 3QAHA 3B8GA 4H6ZA 3GYAA 3CXPA 3TOAA 5IX3A 1IYKA 4MHDA 4K30A 4L89A 1Y9KA 3IGRA 4GS4A 5F48A 1Z4RA 1MK4A 2ZXVA 3LODA 4AVAA 2P6EA 5JPHA 2AE6A 2JLMA 2JDCA 3I3GA 4YGOA 4NF1A 1YK3A 4MI4A 2H5MA 2FE7A 5KTAA 4U9YA 3CXQA 2J8NA 4XPDC 4DNCA 2VQYA 2C27A 1YGHA
chains in the Genus database with same CATH superfamily
3IWEA 1R43A 1YLOA 2EWBA 4ZY2A 1ARMA 1F2OA 3H5ZA 1IOIA 5IB9A 2CY2A 4C7IA 1OBRA 4CAVA 2PJ4A 3FYNA 4UA3A 1M1DA 2Q4YA 4JLYA 4F9VA 3S9NA 3NH5A 1AUGA 1I1DA 2B5GB 2VI7A 3DSBA 4KUBA 2QMLA 3B35A 1BAVA 3DDDA 5G22A 5DWNA 4AVBA 2NMTA 4B14A 3EY5A 3SJEA 5LRJA 2X7BA 5FVJA 3KHXA 3FF3A 5D29A 2V8DA 3RO0A 3KR4A 4IUSA 4P4IA 2O53A 1TKJA 1XF8A 2HQYA 7CPAA 2PE3A 1S7LA 5HXDA 2AFXA 5LYIA 4JD6A 4NGRA 3G8WA 3CXSA 4BINA 5J1QA 4IAVA 4OC0A 4X8IA 4B6ZA 4LX9A 5F09A 3EFAA 4WWVA 4JJXA 1DE4C 2XEIA 1TKFA 1K4JA 3G3SA 6CPAA 3F8KA 3ZZIA 2FCKA 2ZEEA 2PCUA 5IB0A 2HC9A 4XPLA 1JWQA 1YR0A 3PB9X 4PSXA 1Q2DA 4K3NA 4YU9A 2B4DB 4AXVA 3GY9A 4MFKA 3SJFA 3V38A 2OZGA 3IO1A 4A32A 2GREA 2V8VA 4MFJA 2PRBA 1MJBA 4UEEA 1Y7EA 4F9UA 4A38A 4XNHC 4FBEA 4CRZB 1IYLA 2J8MA 2Z10A 3E0KA 3K9TA 4UIBA 3R1KA 1QSMA 1BO4A 5J8FA 1RTQA 4A37A 1XEBA 3P2FA 3FMCA 2AFUA 4M85A 4A33A 5JH9A 4R57A 4CPAA 1L0CA 5JGFA 1KZFA 8CPAA 1BOBA 2A4NA 2HB6A 1RXTA 2FVGA 4A30A 4ZYQA 2GE3A 4B5PA 3V8IA 4IF5A 4C2XA 4E0AA 1F2PA 2REEA 5DWMA 2HV2A 2AFOA 4C2ZA 2NSMA 3D7GA 3EC4A 4NGPA 1Z8TA 1FT7A 3LACA 4P10A 1LOKA 3DR6A 5F49A 4E2AA 2WZNA 1AMPA 4Y49B 1U6MA 4QB9A 4UWJA 5F47A 2J9AA 1S3ZA 2ATRA 4RI1A 1LAPA 4XPKA 2JBKA 4KVME 2Q0YA 2PVVA 3MN8A 1MJAA 4X3RA 3SXNA 2PJ6A 3F5BA 1XOVA 4KS9A 4MHZA 5CNPA 4AG7A 2KCWA 4A31A 3BXMA 2K5TA 1BPNA 3SHPA 4ORFA 5JQ4A 4CYNA 1X12A 4OAEA 4Z65A 2CXAA 2BSWA 4MHYA 3R9EA 1TF8A 2PVWA 4KUAA 1KUXA 2ZW4A 2F7VA 3SI0A 4KOTA 3SXOA 3CZXA 5BWAB 2POKA 2I00A 2Q43A 4NGNA 4E8OA 3TC8A 3W6SA 4RUHA 2PDOA 1VGYA 2GLFA 1Y7RA 3S6KA 4ZI6A 4P4BA 2B3VA 3TTHA 2PJ8A 3UY5A 1N71A 2HUZA 4JXRA 4U5YA 2I3CA 2Z11A 3B3WA 2OR4A 3D7DA 2PJBA 2OOTA 2EBJA 2GANA 4IHMA 4MCSA 2JBJA 2AFMA 2QECA 2PQ8A 2V8HA 1VKCA 1ON0A 4M3SA 5THWA 3VWEA 4B5OA 3JVNA 1QSRA 2PJ7A 4OC2A 5A27A 2NYQA 2IJZA 2OU2A 1IIDA 1S7NA 3CPAA 2DPSA 1J4JA 2PJCA 1OZPA 2VL1A 1KWMA 2AJ6A 4R87A 1GYTA 2BUEA 1DTDA 5H86A 4WJBA 2Q7SA 2ZW6A 3EO4A 4HPSA 1QSNA 3D7HA 3PB4X 2B5GA 3VARA 1HDQA 4CGMA 2PRQA 4KOSA 1XFOA 2R1IA 1H8LA 3LWUA 4FD6A 1WK4A 2JEWA 2Q4VA 3DNSA 2QYVA 4OP4A 4EVYA 3GB0A 2IQ6A 2BEIA 1Z4EA 4NGTA 3FX6A 4UBRA 4CAXA 4PV6A 1XBUA 2AFSA 3KHZA 1IY7A 4P4FA 3PRTA 4CYQA 5C88A 5JM6A 4O23A 1XIXA 4DUKA 3TOBA 2VZYA 3TT2A 3TO6A 3HUVA 4OLLA 2XEJA 2C6GA 3B7IA 2R98A 3T8WA 4LQ6A 1FNOA 1Z9UA 2OZUA 3BLNA 1LANA 3PP9A 3NH8A 4UF4A 2PJ3A 2OH1A 3FJUA 3JUWA 3LD2A 3I1UA 4MY3A 5LYFA 4DYOA 4NCZA 2B4DA 3K9UA 2PR8A 1CG2A 1M4IA 2FXFA 4XPDB 1QSTA 4G1PA 1RO5A 2WPXA 4UCMA 3BJ7A 4ONWA 4CGOA 2Q44A 2PR1A 1PUAA 4KORA 1IU8A 4R9MA 3RZAA 4BBHA 2Z3NA 2VBQA 5C82A 4MBUA 1ZLHA 3R9FA 4TWEA 2WYRA 4NGMA 4M6GA 2P0WA 2F5IA 1UFHA 4UFWA 5K8MA 1BLLE 1YW4A 3WC6A 5HVGA 5K8NA 2R8VA 3PGPA 1S7KA 2CNTA 4H6UA 4CYOA 3HLPA 4P45A 4CRYB 4NGSA 3BHXA 4UFXA 2Z3MA 3GIUA 3WC5A 1ZO0A 2D4OA 4RN7A 1Z8LA 2PJ1A 2QVPA 3IU1A 1CP6A 1ELMP 2EVNA 2JDDA 3VATA 4HNWB 3CT9A 3IIBA 4CGLA 4EWTA 2FSRA 1ZLIA 4LQGA 1YREA 2C6PA 4CGNA 5HVHA 1SQHA 4UWIA 2C1CA 2O4HA 2ZEMA 4JXQA 4X2TA 2B58A 2O28A 4X5KA 2Q7BA 1CJWA 4HNYB 3NFZA 5F46A 3JTKA 4OIWA 1QQ9A 4MHPA 4P44A 4W9YA 4GXHA 4A95A 1PU9A 3IJ3A 1IB1E 4MCQA 5EC4A 2ARHA 4F0XA 1S60A 1Y0YA 2PJ9A 1HEEA 1Z8WA 4TNUA 3NA6A 4OC5A 1IOFA 2DEAA 1KUYA 2VXKA 2ZENA 4NJRA 2PJ2A 1Z2LA 3CDXA 5E96A 5HH1A 3IU2A 4Q36A 4R8FA 5HMNA 4OMEA 4AB7A 4CAEA 5KTCA 1CPSA 3V7ZA 4XNHB 2B3UA 1CPXA 2V8GA 4PSWA 2P6FA 5AG6A 3W6XA 3KQXA 1Q2CA 1LFWA 4MJ8A 2YGWA 2GU2A 4KVOE 4JWPA 4NSQA 4HKFA 4Q7AA 2PIYA 5LYDA 3KKWA 3KR5A 4QC6A 4MCRA 1Z8XA 4NEXA 1QMUA 1S5KA 3ISZA 2VZZA 2ZEGA 4ZX8A 4NXYA 2PSWA 5G21A 4B5PB 4ZY0A 4U9ZA 2ZOFA 3WC7A 2FS5A 4OC1A 3WABA 3FRMA 2WPWA 3TE4A 1XMBA 1YMEA 2RB7A 4R76A 2I79A 2ZEDA 5G20A 4PK3A 4KOYA 4H2KA 4PXDA 5LRGA 2CIJA 4H89A 3RAMA 3R9GA 1R3NA 4F0YA 1P0HA 2YNCA 4F6AA 3H8GA 2Y0MA 3B3TA 2BCOA 3IFEA 3D66A 3MGDA 2IMOA 4PXBA 3TX8A 1M44A 1UWYA 2PIZA 4UCNA 1YSJA 3A9LA 4HNXB 2ZEOA 1ELLP 3NH4A 3ZJ0A 4MHNA 3KI9A 1JQGA 1YX0A 2WSAA 4AVCA 4KOXA 4CAFA 1NSAA 2Z0ZA 1M4DA 3BJ8A 3FBUA 4PXCA 1IICA 5ISVA 3C26A 4FUUA 4IK2A 1P4NA 1Q7LA 4JYWA 1QSOA 3PB7X 5H84A 4KOUA 3S9LA 1CM0A 1XE4A 4MFPA 2GIVA 1X10A 1LCPA 3GLJA 5EBVA 4FWUA 5CPAA 2Z3KA 2PJAA 4MXUA 2BO9A 5HVFA 1ZG8A 2BOAA 2G3AA 4UCPA 3SJGA 3KGQA 2Q04A 2EK9A 3IC1A 3OWCA 3PBBA 3JRUA 2CNSA 4LUAA 5I4MA 4A2ZA 3FXTA 4MFZA 4NFRA 1VHEA 1FY7A 2Q4ZA 3LMSA 4R6TA 1ARLA 3R96A 2ZW5A 1CBXA 5CBMA 3D68A 3S9MA 2V77A 4M6HA 2EUIA 4QVTA 4J3GA 5LYLA 3FEDA 3KASA 3P2HA 2EK8A 1I12A 3N5FA 2FIWA 2JEVA 4Q38A 2OB0A 4ZX9A 3IWWA 3RNZA 3WT4A 1EE3P 1LRZA 2ZEFA 2ZELA 2CTCA 4FD7A 5AG4A 4KSFA 4KSAA 1LAMA 2FIAA 3D2MA 3SI2A 4I49A 4EMEA 4MRIA 3TO9A 4ZY1A 1M4GA 4KVXA 4R7MA 5I0CA 4YWYA 3QB8A 2BL1A 3VWDA 2P6GA 3GUXA 4MMOA 3PB6X 2Z3PA 4P6YA 1XMTA 4A94A 5AG7A 1V0CA 3FEEA 3DR8A 2RFHA 2DPTA 2WUUA 4B12A 3EXNA 3T9YA 2FL4A 2ANPA 4RS2A 1I21A 2Z3LA 3PFEA 3IWGA 3F0AA 4KOWA 4CAWA 3RYOA 2DF5A 3S6HA 2ZW7A 3H8FA 2QJ8A 1PYTB 5ELYA 1WWZA 2IL4A 3CPXA 2RC4A 4PK2A 1Q2YA 1TIQA 4KLWA 4Y49C 4YRHA 1AYEA 1YVOA 5GCNA 2FT0A 4BD9A 1YW6A 1ZG7A 4KOVA 4QBJA 3FIXA 3I9SA 5AG5A 4NJQA 2CNMA 3FNCA 4CYPA 1GHEA 4FD5A 1IGBA 4AG9A 1Z5RA 3KQZA 4KZTA 4MY0A 2B4BA 4NGQA 4EFDA 4PQAA 4ONUA 3H8EA 2AFZA 2GFQA 1XJOA 1Y0RA 4L8AA 5DS0A 1B87A 2R7HA 4R3KA 5KTDA 3T90A 3D67A 4MFLA 3NE8A 3PBEA 3PEIA 3QAYA 2YNDA 4P4EA 1ZG9A 4QUSA 5J8CA 4R3LA 2G3TA 2PC1A 1PCAA 4PXEA 1S7FA 1Y9WA 1YLEA 2OZHA 2ZOGA 4GM5A 4ZBGA 3TO7A 4YFJA 3D3SA 2AFWA 4CS0B 4B11A 1NMTA 3DLJA 2GLJA 5K8PA 2G9DA 1KUVA 3FECA 3PFOA 2G0BA 3H4QA 3BI0A 2PJ0A 3D2PA 2YNEA 3BI1A 1NE9A 1CP7A 2DXQA 2Z3OA 5D8NA 3B3SA 3D8PA 2D4PA 3PZJA 1YVKA 2XEGA 5LRKA 3MRUA 2REFA 4F8ZA 1B6BA 3TFYA 1YQEA 1CX8A 4UFVA 1F57A 3W91A 3TCVA 5IV0A 3S6FA 4OKOA 4II9A 2F8HA 2YNCC 4OC3A 1VHOA 5G1ZA 2PJ5A 4KSIA 4KLVA 4B10A 2ZPAA 3N7ZA 5K8OA 1TKHA 3NE7A 3SJXA 3R95A 2C6CA 4C68A 4FAIA 2ZEPA 4M6IA 4BMHA 2J8RA 4FD4A 2VEZA 4OADA 2Q51A 3FB3A 1NSLA 3FH4A 2XEFA 3KZWA 2QIRA 1R57A 3VH9A 3ISXA 4MFQA 3WR7A 4OC4A 2CF4A 1VHSA 1MJ9A 1VIXA 3GKRA 4CGPA 3S6GA 3D7FA 4JZ0A 4MCPA 3QAHA 3B2YA 3B8GA 4ZGYB 4H6ZA 4PPZA 1BPMA 3GYAA 1XRYA 3CXPA 3IEHA 3K2KA 3TOAA 1TF9A 4B13A 4C7HA 5IX3A 4P4DA 1IYKA 3L2NA 4MHDA 4K30A 2ODFA 1A2ZA 3DGVA 4L89A 4A39A 3PB8X 1Y9KA 1TXRA 3IGRA 3KL9A 4OIDA 4GS4A 4UEFA 5F48A 5A28A 2ZEHA 2ABZA 1Z4RA 4P4JA 1MK4A 2ZXVA 3LODA 4UIAA 4AVAA 2P6EA 3SI1A 5JPHA 3D4UA 2AE6A 2JLMA 5AGEA 2JDCA 3I3GA 1HDUA 2EO8A 4YGOA 4NF1A 5EMIA 1YK3A 3B3CA 2CTBA 4MI4A 4DJLA 2H5MA 2FE7A 4UEZA 4U9YA 3RBUA 5KTAA 3CXQA 2J8NA 4C2YA 4XPDC 1M4LA 2VQYA 3QNVA 2C27A 4DNCA 3B3VA 1YGHA 3FVLA
chains in the Genus database with same CATH topology
3IWEA 3H5ZA 2CY2A 4C7IA 4CAVA 3FYNA 4UA3A 1M1DA 2Q4YA 4JLYA 2B5GB 1I1DA 2VI7A 3DSBA 4KUBA 2QMLA 4B14A 3DDDA 5G22A 5DWNA 4AVBA 2NMTA 3EY5A 2X7BA 5FVJA 4IUSA 1XF8A 2HQYA 1S7LA 4JD6A 3G8WA 3CXSA 4LX9A 3EFAA 4JJXA 1K4JA 3G3SA 3F8KA 3ZZIA 2FCKA 5IB0A 4XPLA 1YR0A 4PSXA 1Q2DA 2B4DB 3GY9A 4MFKA 2OZGA 4A32A 4MFJA 2PRBA 1MJBA 4XNHC 4CRZB 1IYLA 2J8MA 2Z10A 3E0KA 3R1KA 1QSMA 1BO4A 5J8FA 1XEBA 3P2FA 4M85A 4A33A 4R57A 1L0CA 1KZFA 1BOBA 2A4NA 4A30A 1RXTA 2GE3A 4B5PA 3V8IA 4IF5A 4C2XA 4E0AA 2REEA 5DWMA 2HV2A 4C2ZA 3EC4A 5F49A 3DR6A 4E2AA 4Y49B 5F47A 1U6MA 4QB9A 4UWJA 1S3ZA 2ATRA 4RI1A 4XPKA 4KVME 2Q0YA 1MJAA 3SXNA 3F5BA 4KS9A 5CNPA 4AG7A 2KCWA 4A31A 2K5TA 3SHPA 4ORFA 5JQ4A 4CYNA 4OAEA 2CXAA 2BSWA 3R9EA 4KUAA 1KUXA 2ZW4A 4KOTA 3SXOA 5BWAB 4E8OA 2I00A 3W6SA 2PDOA 1Y7RA 3S6KA 3TTHA 2B3VA 3UY5A 1N71A 2HUZA 4JXRA 4U5YA 2Z11A 2GANA 3VWEA 2QECA 2PQ8A 4M3SA 1VKCA 1ON0A 4B5OA 3JVNA 1QSRA 5A27A 2OU2A 1IIDA 1S7NA 2DPSA 1J4JA 1OZPA 2AJ6A 4R87A 2BUEA 5H86A 2ZW6A 3EO4A 1QSNA 2B5GA 4CGMA 4KOSA 2R1IA 4FD6A 1WK4A 2Q4VA 3DNSA 4EVYA 4CAXA 2BEIA 1Z4EA 4UBRA 4PV6A 5C88A 4CYQA 1XIXA 3TOBA 2VZYA 3TT2A 3TO6A 4OLLA 2R98A 1Z9UA 2OZUA 3BLNA 3PP9A 2OH1A 3JUWA 4MY3A 3LD2A 4NCZA 2B4DA 3K9UA 2PR8A 2FXFA 1M4IA 4XPDB 1QSTA 1RO5A 2WPXA 4UCMA 3BJ7A 4CGOA 2Q44A 2PR1A 1PUAA 4KORA 4BBHA 4R9MA 5C82A 2Z3NA 2VBQA 4MBUA 3R9FA 2P0WA 2F5IA 1UFHA 4UFWA 2R8VA 3PGPA 1S7KA 2CNTA 4H6UA 4CYOA 4CRYB 4UFXA 2Z3MA 1ZO0A 2D4OA 3IU1A 2EVNA 2JDDA 4HNWB 4CGLA 2FSRA 1YREA 4CGNA 1SQHA 4UWIA 4JXQA 2B58A 2O28A 4X5KA 2Q7BA 1CJWA 4HNYB 5F46A 3JTKA 4A95A 1PU9A 1IB1E 5EC4A 2ARHA 4F0XA 1S60A 1KUYA 2VXKA 5HH1A 5E96A 3IU2A 4Q36A 5HMNA 4AB7A 4CAEA 5KTCA 4XNHB 2B3UA 5AG6A 4PSWA 2P6FA 3W6XA 1Q2CA 4MJ8A 2YGWA 4KVOE 4JWPA 4NSQA 4HKFA 3KKWA 4QC6A 4NEXA 1S5KA 2VZZA 4NXYA 2PSWA 5G21A 4B5PB 4U9ZA 2FS5A 3FRMA 2WPWA 3TE4A 2I79A 5G20A 4PK3A 4KOYA 4H89A 3R9GA 4F0YA 1P0HA 2YNCA 4F6AA 2Y0MA 3MGDA 1M44A 4UCNA 3A9LA 4HNXB 3ZJ0A 1YX0A 2WSAA 4AVCA 4KOXA 4CAFA 2Z0ZA 1M4DA 3BJ8A 3FBUA 1IICA 5ISVA 3C26A 1P4NA 1QSOA 5H84A 4KOUA 1CM0A 1XE4A 4MFPA 2GIVA 5EBVA 2Z3KA 2G3AA 4UCPA 2Q04A 3OWCA 2CNSA 4LUAA 4A2ZA 3FXTA 4MFZA 3R96A 1FY7A 2ZW5A 2EUIA 4QVTA 4J3GA 3P2HA 1I12A 2FIWA 2JEVA 4Q38A 2OB0A 1LRZA 5AG4A 4FD7A 4KSFA 4KSAA 2FIAA 3D2MA 4I49A 3TO9A 5I0CA 1M4GA 4KVXA 3QB8A 2BL1A 3VWDA 2P6GA 2Z3PA 1XMTA 5AG7A 1V0CA 3DR8A 4B12A 2DPTA 2WUUA 3EXNA 3T9YA 2FL4A 4RS2A 1I21A 2Z3LA 3IWGA 3F0AA 4KOWA 4CAWA 3RYOA 3S6HA 2ZW7A 1WWZA 2IL4A 2RC4A 4PK2A 1Q2YA 1TIQA 4KLWA 4Y49C 4YRHA 1YVOA 5GCNA 4QBJA 2FT0A 4KOVA 3FIXA 3I9SA 5AG5A 2CNMA 3FNCA 4CYPA 1GHEA 4FD5A 4AG9A 4KZTA 4MY0A 2B4BA 4ONUA 4L8AA 1B87A 2R7HA 4R3KA 5KTDA 3T90A 4MFLA 2YNDA 5J8CA 4QUSA 4R3LA 2G3TA 2PC1A 1S7FA 1Y9WA 1YLEA 2OZHA 4ZBGA 3TO7A 4YFJA 3D3SA 4CS0B 4B11A 1NMTA 1KUVA 2G0BA 3H4QA 3D2PA 2YNEA 1NE9A 2DXQA 2Z3OA 3D8PA 2D4PA 3PZJA 1YVKA 2REFA 1B6BA 3TFYA 4UFVA 3W91A 3TCVA 5IV0A 3S6FA 4II9A 2YNCC 5G1ZA 4B10A 4KLVA 2ZPAA 3N7ZA 3NE7A 3R95A 4C68A 4BMHA 2J8RA 4FD4A 2VEZA 4OADA 3FB3A 1NSLA 2QIRA 1R57A 4MFQA 3WR7A 3GKRA 1VHSA 1MJ9A 4CGPA 3S6GA 3QAHA 3B8GA 4ZGYB 4H6ZA 3GYAA 3CXPA 3TOAA 4B13A 4C7HA 5IX3A 1IYKA 4MHDA 4K30A 4L89A 1Y9KA 3IGRA 4GS4A 5F48A 5A28A 1Z4RA 1MK4A 2ZXVA 3LODA 4AVAA 2P6EA 5JPHA 2AE6A 2JLMA 5AGEA 2JDCA 3I3GA 4YGOA 4NF1A 1YK3A 4MI4A 2H5MA 2FE7A 5KTAA 4U9YA 3CXQA 2J8NA 4C2YA 4XPDC 4DNCA 2VQYA 2C27A 1YGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CY2 A;  4CAV A;  3FYN A;  4UA3 A;  1M1D A;  2Q4Y A;  4JLY A;  2B5G B;  1I1D A;  2VI7 A;  3DSB A;  4KUB A;  2QML A;  3DDD A;  4AVB A;  5DWN A;  2NMT A;  3EY5 A;  2X7B A;  5FVJ A;  4IUS A;  1XF8 A;  2HQY A;  1S7L A;  4JD6 A;  3G8W A;  3CXS A;  4LX9 A;  3EFA A;  4JJX A;  1K4J A;  3G3S A;  3F8K A;  3ZZI A;  2FCK A;  5IB0 A;  4XPL A;  1YR0 A;  4PSX A;  1Q2D A;  2B4D B;  3GY9 A;  2OZG A;  2PRB A;  1MJB A;  4XNH C;  4CRZ B;  1IYL A;  2J8M A;  2Z10 A;  3E0K A;  3R1K A;  1QSM A;  1BO4 A;  5J8F A;  1XEB A;  3P2F A;  4M85 A;  4R57 A;  1L0C A;  1KZF A;  1BOB A;  2A4N A;  1RXT A;  2GE3 A;  4B5P A;  3V8I A;  4IF5 A;  4E0A A;  2REE A;  5DWM A;  2HV2 A;  3EC4 A;  5F49 A;  3DR6 A;  4E2A A;  4Y49 B;  5F47 A;  1U6M A;  4QB9 A;  4UWJ A;  1S3Z A;  2ATR A;  4RI1 A;  4XPK A;  4KVM E;  2Q0Y A;  1MJA A;  3SXN A;  3F5B A;  5CNP A;  4AG7 A;  2KCW A;  2K5T A;  3SHP A;  4ORF A;  5JQ4 A;  4OAE A;  2BSW A;  3R9E A;  4KUA A;  1KUX A;  2ZW4 A;  4KOT A;  3SXO A;  4E8O A;  2I00 A;  3W6S A;  2PDO A;  1Y7R A;  3S6K A;  3TTH A;  2B3V A;  3UY5 A;  1N71 A;  2HUZ A;  4JXR A;  4U5Y A;  2Z11 A;  2GAN A;  3VWE A;  2QEC A;  2PQ8 A;  4M3S A;  1VKC A;  1ON0 A;  4B5O A;  3JVN A;  1QSR A;  2OU2 A;  1IID A;  1S7N A;  1J4J A;  1OZP A;  2AJ6 A;  4R87 A;  2BUE A;  5H86 A;  2ZW6 A;  3EO4 A;  1QSN A;  2B5G A;  4KOS A;  2R1I A;  4FD6 A;  1WK4 A;  2Q4V A;  3DNS A;  4EVY A;  4CAX A;  2BEI A;  1Z4E A;  4UBR A;  4PV6 A;  5C88 A;  1XIX A;  3TOB A;  2VZY A;  3TT2 A;  3TO6 A;  4OLL A;  2R98 A;  1Z9U A;  2OZU A;  3BLN A;  3PP9 A;  2OH1 A;  3JUW A;  4MY3 A;  3LD2 A;  4NCZ A;  2B4D A;  3K9U A;  2PR8 A;  2FXF A;  1M4I A;  4XPD B;  1QST A;  1RO5 A;  2WPX A;  3BJ7 A;  2Q44 A;  2PR1 A;  1PUA A;  4KOR A;  5C82 A;  4R9M A;  2VBQ A;  4MBU A;  3R9F A;  2P0W A;  2F5I A;  1UFH A;  2R8V A;  3PGP A;  1S7K A;  2CNT A;  4H6U A;  4CRY B;  2D4O A;  2EVN A;  2JDD A;  4HNW B;  2FSR A;  1YRE A;  1SQH A;  4UWI A;  4JXQ A;  2B58 A;  2O28 A;  4X5K A;  2Q7B A;  1CJW A;  4HNY B;  5F46 A;  1PU9 A;  1IB1 E;  5EC4 A;  2ARH A;  1S60 A;  1KUY A;  2VXK A;  5HH1 A;  5E96 A;  5HMN A;  4AB7 A;  5KTC A;  4XNH B;  2B3U A;  4PSW A;  2P6F A;  3W6X A;  1Q2C A;  4MJ8 A;  4KVO E;  4JWP A;  4NSQ A;  4HKF A;  3KKW A;  4QC6 A;  4NEX A;  1S5K A;  2VZZ A;  4NXY A;  2PSW A;  4B5P B;  4U9Z A;  2FS5 A;  3FRM A;  2WPW A;  3TE4 A;  2I79 A;  4PK3 A;  4KOY A;  4H89 A;  3R9G A;  4F0Y A;  1P0H A;  4F6A A;  2Y0M A;  3MGD A;  1M44 A;  4HNX B;  3ZJ0 A;  1YX0 A;  4AVC A;  4KOX A;  2Z0Z A;  1M4D A;  3BJ8 A;  3FBU A;  1IIC A;  5ISV A;  3C26 A;  1P4N A;  1QSO A;  5H84 A;  4KOU A;  1CM0 A;  1XE4 A;  2GIV A;  5EBV A;  2G3A A;  2Q04 A;  3OWC A;  2CNS A;  4LUA A;  3FXT A;  3R96 A;  1FY7 A;  2ZW5 A;  2EUI A;  4QVT A;  4J3G A;  3P2H A;  1I12 A;  2FIW A;  2JEV A;  2OB0 A;  1LRZ A;  4FD7 A;  2FIA A;  3D2M A;  4I49 A;  3TO9 A;  5I0C A;  1M4G A;  4KVX A;  3QB8 A;  2BL1 A;  3VWD A;  2P6G A;  1XMT A;  1V0C A;  3DR8 A;  3EXN A;  3T9Y A;  2FL4 A;  4RS2 A;  1I21 A;  3IWG A;  3F0A A;  4KOW A;  4CAW A;  3RYO A;  3S6H A;  2ZW7 A;  1WWZ A;  2IL4 A;  2RC4 A;  4PK2 A;  1Q2Y A;  1TIQ A;  4KLW A;  4Y49 C;  4YRH A;  1YVO A;  5GCN A;  4QBJ A;  2FT0 A;  4KOV A;  3FIX A;  3I9S A;  2CNM A;  3FNC A;  1GHE A;  4FD5 A;  4AG9 A;  4KZT A;  4MY0 A;  2B4B A;  4ONU A;  4L8A A;  1B87 A;  2R7H A;  4R3K A;  5KTD A;  3T90 A;  5J8C A;  4QUS A;  4R3L A;  2G3T A;  2PC1 A;  1S7F A;  1Y9W A;  1YLE A;  2OZH A;  4ZBG A;  3TO7 A;  4YFJ A;  3D3S A;  4CS0 B;  1NMT A;  1KUV A;  2G0B A;  3H4Q A;  3D2P A;  1NE9 A;  2DXQ A;  3D8P A;  2D4P A;  3PZJ A;  1YVK A;  2REF A;  1B6B A;  3TFY A;  3W91 A;  3TCV A;  5IV0 A;  3S6F A;  4II9 A;  4KLV A;  2ZPA A;  3N7Z A;  3NE7 A;  3R95 A;  4BMH A;  2J8R A;  4FD4 A;  2VEZ A;  4OAD A;  3FB3 A;  1NSL A;  2QIR A;  1R57 A;  3WR7 A;  3GKR A;  1VHS A;  1MJ9 A;  3S6G A;  3QAH A;  3B8G A;  4H6Z A;  3GYA A;  3CXP A;  3TOA A;  5IX3 A;  1IYK A;  4MHD A;  4K30 A;  4L89 A;  1Y9K A;  3IGR A;  4GS4 A;  5F48 A;  1Z4R A;  1MK4 A;  2ZXV A;  3LOD A;  4AVA A;  2P6E A;  5JPH A;  2AE6 A;  2JLM A;  2JDC A;  3I3G A;  4YGO A;  4NF1 A;  1YK3 A;  4MI4 A;  2H5M A;  2FE7 A;  5KTA A;  4U9Y A;  3CXQ A;  2J8N A;  4XPD C;  4DNC A;  2VQY A;  2C27 A;  1YGH A; 
#chains in the Genus database with same CATH topology
 3IWE A;  1R43 A;  1YLO A;  2EWB A;  4ZY2 A;  1ARM A;  1F2O A;  3H5Z A;  1IOI A;  5IB9 A;  2CY2 A;  4C7I A;  1OBR A;  4CAV A;  2PJ4 A;  3FYN A;  4UA3 A;  1M1D A;  2Q4Y A;  4JLY A;  4F9V A;  3S9N A;  3NH5 A;  1AUG A;  1I1D A;  2B5G B;  2VI7 A;  3DSB A;  4KUB A;  2QML A;  3B35 A;  1BAV A;  3DDD A;  5G22 A;  5DWN A;  4AVB A;  2NMT A;  4B14 A;  3EY5 A;  3SJE A;  5LRJ A;  2X7B A;  5FVJ A;  3KHX A;  3FF3 A;  5D29 A;  2V8D A;  3RO0 A;  3KR4 A;  4IUS A;  4P4I A;  2O53 A;  1TKJ A;  1XF8 A;  2HQY A;  7CPA A;  2PE3 A;  1S7L A;  5HXD A;  2AFX A;  5LYI A;  4JD6 A;  4NGR A;  3G8W A;  3CXS A;  4BIN A;  5J1Q A;  4IAV A;  4OC0 A;  4X8I A;  4B6Z A;  4LX9 A;  5F09 A;  3EFA A;  4WWV A;  4JJX A;  1DE4 C;  2XEI A;  1TKF A;  1K4J A;  3G3S A;  6CPA A;  3F8K A;  3ZZI A;  2FCK A;  2ZEE A;  2PCU A;  5IB0 A;  2HC9 A;  4XPL A;  1JWQ A;  1YR0 A;  3PB9 X;  4PSX A;  1Q2D A;  4K3N A;  4YU9 A;  2B4D B;  4AXV A;  3GY9 A;  4MFK A;  3SJF A;  3V38 A;  2OZG A;  3IO1 A;  4A32 A;  2GRE A;  2V8V A;  4MFJ A;  2PRB A;  1MJB A;  4UEE A;  1Y7E A;  4F9U A;  4A38 A;  4XNH C;  4FBE A;  4CRZ B;  1IYL A;  2J8M A;  2Z10 A;  3E0K A;  3K9T A;  4UIB A;  3R1K A;  1QSM A;  1BO4 A;  5J8F A;  1RTQ A;  4A37 A;  1XEB A;  3P2F A;  3FMC A;  2AFU A;  4M85 A;  4A33 A;  5JH9 A;  4R57 A;  4CPA A;  1L0C A;  5JGF A;  1KZF A;  8CPA A;  1BOB A;  2A4N A;  2HB6 A;  1RXT A;  2FVG A;  4A30 A;  4ZYQ A;  2GE3 A;  4B5P A;  3V8I A;  4IF5 A;  4C2X A;  4E0A A;  1F2P A;  2REE A;  5DWM A;  2HV2 A;  2AFO A;  4C2Z A;  2NSM A;  3D7G A;  3EC4 A;  4NGP A;  1Z8T A;  1FT7 A;  3LAC A;  4P10 A;  1LOK A;  3DR6 A;  5F49 A;  4E2A A;  2WZN A;  1AMP A;  4Y49 B;  1U6M A;  4QB9 A;  4UWJ A;  5F47 A;  2J9A A;  1S3Z A;  2ATR A;  4RI1 A;  1LAP A;  4XPK A;  2JBK A;  4KVM E;  2Q0Y A;  2PVV A;  3MN8 A;  1MJA A;  4X3R A;  3SXN A;  2PJ6 A;  3F5B A;  1XOV A;  4KS9 A;  4MHZ A;  5CNP A;  4AG7 A;  2KCW A;  4A31 A;  3BXM A;  2K5T A;  1BPN A;  3SHP A;  4ORF A;  5JQ4 A;  4CYN A;  1X12 A;  4OAE A;  4Z65 A;  2CXA A;  2BSW A;  4MHY A;  3R9E A;  1TF8 A;  2PVW A;  4KUA A;  1KUX A;  2ZW4 A;  2F7V A;  3SI0 A;  4KOT A;  3SXO A;  3CZX A;  5BWA B;  2POK A;  2I00 A;  2Q43 A;  4NGN A;  4E8O A;  3TC8 A;  3W6S A;  4RUH A;  2PDO A;  1VGY A;  2GLF A;  1Y7R A;  3S6K A;  4ZI6 A;  4P4B A;  2B3V A;  3TTH A;  2PJ8 A;  3UY5 A;  1N71 A;  2HUZ A;  4JXR A;  4U5Y A;  2I3C A;  2Z11 A;  3B3W A;  2OR4 A;  3D7D A;  2PJB A;  2OOT A;  2EBJ A;  2GAN A;  4IHM A;  4MCS A;  2JBJ A;  2AFM A;  2QEC A;  2PQ8 A;  2V8H A;  1VKC A;  1ON0 A;  4M3S A;  5THW A;  3VWE A;  4B5O A;  3JVN A;  1QSR A;  2PJ7 A;  4OC2 A;  5A27 A;  2NYQ A;  2IJZ A;  2OU2 A;  1IID A;  1S7N A;  3CPA A;  2DPS A;  1J4J A;  2PJC A;  1OZP A;  2VL1 A;  1KWM A;  2AJ6 A;  4R87 A;  1GYT A;  2BUE A;  1DTD A;  5H86 A;  4WJB A;  2Q7S A;  2ZW6 A;  3EO4 A;  4HPS A;  1QSN A;  3D7H A;  3PB4 X;  2B5G A;  3VAR A;  1HDQ A;  4CGM A;  2PRQ A;  4KOS A;  1XFO A;  2R1I A;  1H8L A;  3LWU A;  4FD6 A;  1WK4 A;  2JEW A;  2Q4V A;  3DNS A;  2QYV A;  4OP4 A;  4EVY A;  3GB0 A;  2IQ6 A;  2BEI A;  1Z4E A;  4NGT A;  3FX6 A;  4UBR A;  4CAX A;  4PV6 A;  1XBU A;  2AFS A;  3KHZ A;  1IY7 A;  4P4F A;  3PRT A;  4CYQ A;  5C88 A;  5JM6 A;  4O23 A;  1XIX A;  4DUK A;  3TOB A;  2VZY A;  3TT2 A;  3TO6 A;  3HUV A;  4OLL A;  2XEJ A;  2C6G A;  3B7I A;  2R98 A;  3T8W A;  4LQ6 A;  1FNO A;  1Z9U A;  2OZU A;  3BLN A;  1LAN A;  3PP9 A;  3NH8 A;  4UF4 A;  2PJ3 A;  2OH1 A;  3FJU A;  3JUW A;  3LD2 A;  3I1U A;  4MY3 A;  5LYF A;  4DYO A;  4NCZ A;  2B4D A;  3K9U A;  2PR8 A;  1CG2 A;  1M4I A;  2FXF A;  4XPD B;  1QST A;  4G1P A;  1RO5 A;  2WPX A;  4UCM A;  3BJ7 A;  4ONW A;  4CGO A;  2Q44 A;  2PR1 A;  1PUA A;  4KOR A;  1IU8 A;  4R9M A;  3RZA A;  4BBH A;  2Z3N A;  2VBQ A;  5C82 A;  4MBU A;  1ZLH A;  3R9F A;  4TWE A;  2WYR A;  4NGM A;  4M6G A;  2P0W A;  2F5I A;  1UFH A;  4UFW A;  5K8M A;  1BLL E;  1YW4 A;  3WC6 A;  5HVG A;  5K8N A;  2R8V A;  3PGP A;  1S7K A;  2CNT A;  4H6U A;  4CYO A;  3HLP A;  4P45 A;  4CRY B;  4NGS A;  3BHX A;  4UFX A;  2Z3M A;  3GIU A;  3WC5 A;  1ZO0 A;  2D4O A;  4RN7 A;  1Z8L A;  2PJ1 A;  2QVP A;  3IU1 A;  1CP6 A;  1ELM P;  2EVN A;  2JDD A;  3VAT A;  4HNW B;  3CT9 A;  3IIB A;  4CGL A;  4EWT A;  2FSR A;  1ZLI A;  4LQG A;  1YRE A;  2C6P A;  4CGN A;  5HVH A;  1SQH A;  4UWI A;  2C1C A;  2O4H A;  2ZEM A;  4JXQ A;  4X2T A;  2B58 A;  2O28 A;  4X5K A;  2Q7B A;  1CJW A;  4HNY B;  3NFZ A;  5F46 A;  3JTK A;  4OIW A;  1QQ9 A;  4MHP A;  4P44 A;  4W9Y A;  4GXH A;  4A95 A;  1PU9 A;  3IJ3 A;  1IB1 E;  4MCQ A;  5EC4 A;  2ARH A;  4F0X A;  1S60 A;  1Y0Y A;  2PJ9 A;  1HEE A;  1Z8W A;  4TNU A;  3NA6 A;  4OC5 A;  1IOF A;  2DEA A;  1KUY A;  2VXK A;  2ZEN A;  4NJR A;  2PJ2 A;  1Z2L A;  3CDX A;  5E96 A;  5HH1 A;  3IU2 A;  4Q36 A;  4R8F A;  5HMN A;  4OME A;  4AB7 A;  4CAE A;  5KTC A;  1CPS A;  3V7Z A;  4XNH B;  2B3U A;  1CPX A;  2V8G A;  4PSW A;  2P6F A;  5AG6 A;  3W6X A;  3KQX A;  1Q2C A;  1LFW A;  4MJ8 A;  2YGW A;  2GU2 A;  4KVO E;  4JWP A;  4NSQ A;  4HKF A;  4Q7A A;  2PIY A;  5LYD A;  3KKW A;  3KR5 A;  4QC6 A;  4MCR A;  1Z8X A;  4NEX A;  1QMU A;  1S5K A;  3ISZ A;  2VZZ A;  2ZEG A;  4ZX8 A;  4NXY A;  2PSW A;  5G21 A;  4B5P B;  4ZY0 A;  4U9Z A;  2ZOF A;  3WC7 A;  2FS5 A;  4OC1 A;  3WAB A;  3FRM A;  2WPW A;  3TE4 A;  1XMB A;  1YME A;  2RB7 A;  4R76 A;  2I79 A;  2ZED A;  5G20 A;  4PK3 A;  4KOY A;  4H2K A;  4PXD A;  5LRG A;  2CIJ A;  4H89 A;  3RAM A;  3R9G A;  1R3N A;  4F0Y A;  1P0H A;  2YNC A;  4F6A A;  3H8G A;  2Y0M A;  3B3T A;  2BCO A;  3IFE A;  3D66 A;  3MGD A;  2IMO A;  4PXB A;  3TX8 A;  1M44 A;  1UWY A;  2PIZ A;  4UCN A;  1YSJ A;  3A9L A;  4HNX B;  2ZEO A;  1ELL P;  3NH4 A;  3ZJ0 A;  4MHN A;  3KI9 A;  1JQG A;  1YX0 A;  2WSA A;  4AVC A;  4KOX A;  4CAF A;  1NSA A;  2Z0Z A;  1M4D A;  3BJ8 A;  3FBU A;  4PXC A;  1IIC A;  5ISV A;  3C26 A;  4FUU A;  4IK2 A;  1P4N A;  1Q7L A;  4JYW A;  1QSO A;  3PB7 X;  5H84 A;  4KOU A;  3S9L A;  1CM0 A;  1XE4 A;  4MFP A;  2GIV A;  1X10 A;  1LCP A;  3GLJ A;  5EBV A;  4FWU A;  5CPA A;  2Z3K A;  2PJA A;  4MXU A;  2BO9 A;  5HVF A;  1ZG8 A;  2BOA A;  2G3A A;  4UCP A;  3SJG A;  3KGQ A;  2Q04 A;  2EK9 A;  3IC1 A;  3OWC A;  3PBB A;  3JRU A;  2CNS A;  4LUA A;  5I4M A;  4A2Z A;  3FXT A;  4MFZ A;  4NFR A;  1VHE A;  1FY7 A;  2Q4Z A;  3LMS A;  4R6T A;  1ARL A;  3R96 A;  2ZW5 A;  1CBX A;  5CBM A;  3D68 A;  3S9M A;  2V77 A;  4M6H A;  2EUI A;  4QVT A;  4J3G A;  5LYL A;  3FED A;  3KAS A;  3P2H A;  2EK8 A;  1I12 A;  3N5F A;  2FIW A;  2JEV A;  4Q38 A;  2OB0 A;  4ZX9 A;  3IWW A;  3RNZ A;  3WT4 A;  1EE3 P;  1LRZ A;  2ZEF A;  2ZEL A;  2CTC A;  4FD7 A;  5AG4 A;  4KSF A;  4KSA A;  1LAM A;  2FIA A;  3D2M A;  3SI2 A;  4I49 A;  4EME A;  4MRI A;  3TO9 A;  4ZY1 A;  1M4G A;  4KVX A;  4R7M A;  5I0C A;  4YWY A;  3QB8 A;  2BL1 A;  3VWD A;  2P6G A;  3GUX A;  4MMO A;  3PB6 X;  2Z3P A;  4P6Y A;  1XMT A;  4A94 A;  5AG7 A;  1V0C A;  3FEE A;  3DR8 A;  2RFH A;  2DPT A;  2WUU A;  4B12 A;  3EXN A;  3T9Y A;  2FL4 A;  2ANP A;  4RS2 A;  1I21 A;  2Z3L A;  3PFE A;  3IWG A;  3F0A A;  4KOW A;  4CAW A;  3RYO A;  2DF5 A;  3S6H A;  2ZW7 A;  3H8F A;  2QJ8 A;  1PYT B;  5ELY A;  1WWZ A;  2IL4 A;  3CPX A;  2RC4 A;  4PK2 A;  1Q2Y A;  1TIQ A;  4KLW A;  4Y49 C;  4YRH A;  1AYE A;  1YVO A;  5GCN A;  2FT0 A;  4BD9 A;  1YW6 A;  1ZG7 A;  4KOV A;  4QBJ A;  3FIX A;  3I9S A;  5AG5 A;  4NJQ A;  2CNM A;  3FNC A;  4CYP A;  1GHE A;  4FD5 A;  1IGB A;  4AG9 A;  1Z5R A;  3KQZ A;  4KZT A;  4MY0 A;  2B4B A;  4NGQ A;  4EFD A;  4PQA A;  4ONU A;  3H8E A;  2AFZ A;  2GFQ A;  1XJO A;  1Y0R A;  4L8A A;  5DS0 A;  1B87 A;  2R7H A;  4R3K A;  5KTD A;  3T90 A;  3D67 A;  4MFL A;  3NE8 A;  3PBE A;  3PEI A;  3QAY A;  2YND A;  4P4E A;  1ZG9 A;  4QUS A;  5J8C A;  4R3L A;  2G3T A;  2PC1 A;  1PCA A;  4PXE A;  1S7F A;  1Y9W A;  1YLE A;  2OZH A;  2ZOG A;  4GM5 A;  4ZBG A;  3TO7 A;  4YFJ A;  3D3S A;  2AFW A;  4CS0 B;  4B11 A;  1NMT A;  3DLJ A;  2GLJ A;  5K8P A;  2G9D A;  1KUV A;  3FEC A;  3PFO A;  2G0B A;  3H4Q A;  3BI0 A;  2PJ0 A;  3D2P A;  2YNE A;  3BI1 A;  1NE9 A;  1CP7 A;  2DXQ A;  2Z3O A;  5D8N A;  3B3S A;  3D8P A;  2D4P A;  3PZJ A;  1YVK A;  2XEG A;  5LRK A;  3MRU A;  2REF A;  4F8Z A;  1B6B A;  3TFY A;  1YQE A;  1CX8 A;  4UFV A;  1F57 A;  3W91 A;  3TCV A;  5IV0 A;  3S6F A;  4OKO A;  4II9 A;  2F8H A;  2YNC C;  4OC3 A;  1VHO A;  5G1Z A;  2PJ5 A;  4KSI A;  4KLV A;  4B10 A;  2ZPA A;  3N7Z A;  5K8O A;  1TKH A;  3NE7 A;  3SJX A;  3R95 A;  2C6C A;  4C68 A;  4FAI A;  2ZEP A;  4M6I A;  4BMH A;  2J8R A;  4FD4 A;  2VEZ A;  4OAD A;  2Q51 A;  3FB3 A;  1NSL A;  3FH4 A;  2XEF A;  3KZW A;  2QIR A;  1R57 A;  3VH9 A;  3ISX A;  4MFQ A;  3WR7 A;  4OC4 A;  2CF4 A;  1VHS A;  1MJ9 A;  1VIX A;  3GKR A;  4CGP A;  3S6G A;  3D7F A;  4JZ0 A;  4MCP A;  3QAH A;  3B2Y A;  3B8G A;  4ZGY B;  4H6Z A;  4PPZ A;  1BPM A;  3GYA A;  1XRY A;  3CXP A;  3IEH A;  3K2K A;  3TOA A;  1TF9 A;  4B13 A;  4C7H A;  5IX3 A;  4P4D A;  1IYK A;  3L2N A;  4MHD A;  4K30 A;  2ODF A;  1A2Z A;  3DGV A;  4L89 A;  4A39 A;  3PB8 X;  1Y9K A;  1TXR A;  3IGR A;  3KL9 A;  4OID A;  4GS4 A;  4UEF A;  5F48 A;  5A28 A;  2ZEH A;  2ABZ A;  1Z4R A;  4P4J A;  1MK4 A;  2ZXV A;  3LOD A;  4UIA A;  4AVA A;  2P6E A;  3SI1 A;  5JPH A;  3D4U A;  2AE6 A;  2JLM A;  5AGE A;  2JDC A;  3I3G A;  1HDU A;  2EO8 A;  4YGO A;  4NF1 A;  5EMI A;  1YK3 A;  3B3C A;  2CTB A;  4MI4 A;  4DJL A;  2H5M A;  2FE7 A;  4UEZ A;  4U9Y A;  3RBU A;  5KTA A;  3CXQ A;  2J8N A;  4C2Y A;  4XPD C;  1M4L A;  2VQY A;  3QNV A;  2C27 A;  4DNC A;  3B3V A;  1YGH A;  3FVL A; 
#chains in the Genus database with same CATH homology
 3IWE A;  3H5Z A;  2CY2 A;  4C7I A;  4CAV A;  3FYN A;  4UA3 A;  1M1D A;  2Q4Y A;  4JLY A;  2B5G B;  1I1D A;  2VI7 A;  3DSB A;  4KUB A;  2QML A;  4B14 A;  3DDD A;  5G22 A;  5DWN A;  4AVB A;  2NMT A;  3EY5 A;  2X7B A;  5FVJ A;  4IUS A;  1XF8 A;  2HQY A;  1S7L A;  4JD6 A;  3G8W A;  3CXS A;  4LX9 A;  3EFA A;  4JJX A;  1K4J A;  3G3S A;  3F8K A;  3ZZI A;  2FCK A;  5IB0 A;  4XPL A;  1YR0 A;  4PSX A;  1Q2D A;  2B4D B;  3GY9 A;  4MFK A;  2OZG A;  4A32 A;  4MFJ A;  2PRB A;  1MJB A;  4XNH C;  4CRZ B;  1IYL A;  2J8M A;  2Z10 A;  3E0K A;  3R1K A;  1QSM A;  1BO4 A;  5J8F A;  1XEB A;  3P2F A;  4M85 A;  4A33 A;  4R57 A;  1L0C A;  1KZF A;  1BOB A;  2A4N A;  4A30 A;  1RXT A;  2GE3 A;  4B5P A;  3V8I A;  4IF5 A;  4C2X A;  4E0A A;  2REE A;  5DWM A;  2HV2 A;  4C2Z A;  3EC4 A;  5F49 A;  3DR6 A;  4E2A A;  4Y49 B;  5F47 A;  1U6M A;  4QB9 A;  4UWJ A;  1S3Z A;  2ATR A;  4RI1 A;  4XPK A;  4KVM E;  2Q0Y A;  1MJA A;  3SXN A;  3F5B A;  4KS9 A;  5CNP A;  4AG7 A;  2KCW A;  4A31 A;  2K5T A;  3SHP A;  4ORF A;  5JQ4 A;  4CYN A;  4OAE A;  2CXA A;  2BSW A;  3R9E A;  4KUA A;  1KUX A;  2ZW4 A;  4KOT A;  3SXO A;  5BWA B;  4E8O A;  2I00 A;  3W6S A;  2PDO A;  1Y7R A;  3S6K A;  3TTH A;  2B3V A;  3UY5 A;  1N71 A;  2HUZ A;  4JXR A;  4U5Y A;  2Z11 A;  2GAN A;  3VWE A;  2QEC A;  2PQ8 A;  4M3S A;  1VKC A;  1ON0 A;  4B5O A;  3JVN A;  1QSR A;  5A27 A;  2OU2 A;  1IID A;  1S7N A;  2DPS A;  1J4J A;  1OZP A;  2AJ6 A;  4R87 A;  2BUE A;  5H86 A;  2ZW6 A;  3EO4 A;  1QSN A;  2B5G A;  4CGM A;  4KOS A;  2R1I A;  4FD6 A;  1WK4 A;  2Q4V A;  3DNS A;  4EVY A;  4CAX A;  2BEI A;  1Z4E A;  4UBR A;  4PV6 A;  5C88 A;  4CYQ A;  1XIX A;  3TOB A;  2VZY A;  3TT2 A;  3TO6 A;  4OLL A;  2R98 A;  1Z9U A;  2OZU A;  3BLN A;  3PP9 A;  2OH1 A;  3JUW A;  4MY3 A;  3LD2 A;  4NCZ A;  2B4D A;  3K9U A;  2PR8 A;  2FXF A;  1M4I A;  4XPD B;  1QST A;  1RO5 A;  2WPX A;  4UCM A;  3BJ7 A;  4CGO A;  2Q44 A;  2PR1 A;  1PUA A;  4KOR A;  4BBH A;  4R9M A;  5C82 A;  2Z3N A;  2VBQ A;  4MBU A;  3R9F A;  2P0W A;  2F5I A;  1UFH A;  4UFW A;  2R8V A;  3PGP A;  1S7K A;  2CNT A;  4H6U A;  4CYO A;  4CRY B;  4UFX A;  2Z3M A;  1ZO0 A;  2D4O A;  3IU1 A;  2EVN A;  2JDD A;  4HNW B;  4CGL A;  2FSR A;  1YRE A;  4CGN A;  1SQH A;  4UWI A;  4JXQ A;  2B58 A;  2O28 A;  4X5K A;  2Q7B A;  1CJW A;  4HNY B;  5F46 A;  3JTK A;  4A95 A;  1PU9 A;  1IB1 E;  5EC4 A;  2ARH A;  4F0X A;  1S60 A;  1KUY A;  2VXK A;  5HH1 A;  5E96 A;  3IU2 A;  4Q36 A;  5HMN A;  4AB7 A;  4CAE A;  5KTC A;  4XNH B;  2B3U A;  5AG6 A;  4PSW A;  2P6F A;  3W6X A;  1Q2C A;  4MJ8 A;  2YGW A;  4KVO E;  4JWP A;  4NSQ A;  4HKF A;  3KKW A;  4QC6 A;  4NEX A;  1S5K A;  2VZZ A;  4NXY A;  2PSW A;  5G21 A;  4B5P B;  4U9Z A;  2FS5 A;  3FRM A;  2WPW A;  3TE4 A;  2I79 A;  5G20 A;  4PK3 A;  4KOY A;  4H89 A;  3R9G A;  4F0Y A;  1P0H A;  2YNC A;  4F6A A;  2Y0M A;  3MGD A;  1M44 A;  4UCN A;  3A9L A;  4HNX B;  3ZJ0 A;  1YX0 A;  2WSA A;  4AVC A;  4KOX A;  4CAF A;  2Z0Z A;  1M4D A;  3BJ8 A;  3FBU A;  1IIC A;  5ISV A;  3C26 A;  1P4N A;  1QSO A;  5H84 A;  4KOU A;  1CM0 A;  1XE4 A;  4MFP A;  2GIV A;  5EBV A;  2Z3K A;  2G3A A;  4UCP A;  2Q04 A;  3OWC A;  2CNS A;  4LUA A;  4A2Z A;  3FXT A;  4MFZ A;  3R96 A;  1FY7 A;  2ZW5 A;  2EUI A;  4QVT A;  4J3G A;  3P2H A;  1I12 A;  2FIW A;  2JEV A;  4Q38 A;  2OB0 A;  1LRZ A;  5AG4 A;  4FD7 A;  4KSF A;  4KSA A;  2FIA A;  3D2M A;  4I49 A;  3TO9 A;  5I0C A;  1M4G A;  4KVX A;  3QB8 A;  2BL1 A;  3VWD A;  2P6G A;  2Z3P A;  1XMT A;  5AG7 A;  1V0C A;  3DR8 A;  4B12 A;  2DPT A;  2WUU A;  3EXN A;  3T9Y A;  2FL4 A;  4RS2 A;  1I21 A;  2Z3L A;  3IWG A;  3F0A A;  4KOW A;  4CAW A;  3RYO A;  3S6H A;  2ZW7 A;  1WWZ A;  2IL4 A;  2RC4 A;  4PK2 A;  1Q2Y A;  1TIQ A;  4KLW A;  4Y49 C;  4YRH A;  1YVO A;  5GCN A;  4QBJ A;  2FT0 A;  4KOV A;  3FIX A;  3I9S A;  5AG5 A;  2CNM A;  3FNC A;  4CYP A;  1GHE A;  4FD5 A;  4AG9 A;  4KZT A;  4MY0 A;  2B4B A;  4ONU A;  4L8A A;  1B87 A;  2R7H A;  4R3K A;  5KTD A;  3T90 A;  4MFL A;  2YND A;  5J8C A;  4QUS A;  4R3L A;  2G3T A;  2PC1 A;  1S7F A;  1Y9W A;  1YLE A;  2OZH A;  4ZBG A;  3TO7 A;  4YFJ A;  3D3S A;  4CS0 B;  4B11 A;  1NMT A;  1KUV A;  2G0B A;  3H4Q A;  3D2P A;  2YNE A;  1NE9 A;  2DXQ A;  2Z3O A;  3D8P A;  2D4P A;  3PZJ A;  1YVK A;  2REF A;  1B6B A;  3TFY A;  4UFV A;  3W91 A;  3TCV A;  5IV0 A;  3S6F A;  4II9 A;  2YNC C;  5G1Z A;  4B10 A;  4KLV A;  2ZPA A;  3N7Z A;  3NE7 A;  3R95 A;  4C68 A;  4BMH A;  2J8R A;  4FD4 A;  2VEZ A;  4OAD A;  3FB3 A;  1NSL A;  2QIR A;  1R57 A;  4MFQ A;  3WR7 A;  3GKR A;  1VHS A;  1MJ9 A;  4CGP A;  3S6G A;  3QAH A;  3B8G A;  4ZGY B;  4H6Z A;  3GYA A;  3CXP A;  3TOA A;  4B13 A;  4C7H A;  5IX3 A;  1IYK A;  4MHD A;  4K30 A;  4L89 A;  1Y9K A;  3IGR A;  4GS4 A;  5F48 A;  5A28 A;  1Z4R A;  1MK4 A;  2ZXV A;  3LOD A;  4AVA A;  2P6E A;  5JPH A;  2AE6 A;  2JLM A;  5AGE A;  2JDC A;  3I3G A;  4YGO A;  4NF1 A;  1YK3 A;  4MI4 A;  2H5M A;  2FE7 A;  5KTA A;  4U9Y A;  3CXQ A;  2J8N A;  4C2Y A;  4XPD C;  4DNC A;  2VQY A;  2C27 A;  1YGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...