2CNMA

Rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with a bisubstrate inhibitor (cterm-arg-arg-phe-tyr-arg-ala-n-alpha- acetyl-s-coa).
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
151
structure length
151
Chain Sequence
MNTISILSTTDLPAAWQIEQRAHAFPWSEKTFFGNQGERYLNLKLTADDRMAAFAITQVVLDEATLFNIAVDPDFQRRGLGRMLLEHLIDELETRGVVTLWLEVRASNAAAIALYESLGFNEATIRRNYYPTAQGHEDAIIMALPISMKLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Rimi from Salmonella Typhimurium Lt2, the Gnat Responsible for N{Alpha}- Acetylation of Ribosomal Protein S18.
pubmed doi rcsb
source organism Salmonella typhimurium lt2
molecule tags Transferase
molecule keywords MODIFICATION OF 30S RIBOSOMAL SUBUNIT PROTEIN S18
total genus 46
structure length 151
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2cnmA00
1NMTA 3QAHA 1M4IA 5H86A 1YGHA 3I3GA 1N71A 4AVCA 3TFYA 3R9GA 3ZZIA 3TOAA 4FD4A 3G8WA 4M85A 3D2PA 1XF8A 1P4NA 1KUXA 4KOWA 2QMLA 4B5OA 2OZGA 3FRMA 4KLWA 5GCNA 2OB0A 2B4DB 4KOVA 5J8CA 3R95A 2PC1A 3W91A 1MJBA 2AE6A 2FSRA 1PUAA 2KCWA 3TO6A 2RC4A 4PV6A 1RXTA 4L89A 2Z11A 4PK3A 3IGRA 4X5KA 4JD6A 2GE3A 2ZW6A 3D2MA 4AB7A 5HMNA 2Q4YA 2REEA 3K9UA 2JEVA 3TE4A 3BJ8A 1U6MA 2B58A 4EVYA 2F5IA 1LRZA 2ZXVA 3D8PA 1CJWA 4PK2A 4HKFA 4JLYA 2ZW5A 3TOBA 4NEXA 3BJ7A 2R98A 2OZHA 3LODA 2Z0ZA 2B5GB 3OWCA 2R7HA 1B87A 2VZYA 3FIXA 1RO5A 1Y9WA 4KLVA 2BEIA 4OADA 3W6SA 2Q04A 1M1DA 2R8VA 4L8AA 4QBJA 1I1DA 5KTCA 2VBQA 3JUWA 1WK4A 1QSNA 2CY2A 1TIQA 3R9FA 4XNHC 2PR1A 2B4DA 4MI4A 3MGDA 5I0CA 3S6GA 1QSTA 2I00A 1Z9UA 1IICA 1MK4A 2X7BA 1YR0A 2Q7BA 4MY3A 5HH1A 3PGPA 2HQYA 5JPHA 3S6HA 4KOTA 1Q2DA 2H5MA 1R57A 4F0YA 3FYNA 2PRBA 2B3UA 3R96A 3CXSA 3T9YA 4R3KA 1S60A 3IWGA 4JXRA 5IX3A 2FCKA 4LX9A 1WWZA 2J8RA 1KUYA 4HNWB 2QECA 1Y7RA 4XPKA 4GS4A 1XEBA 2I79A 4J3GA 3SHPA 4AG7A 2FT0A 3FBUA 3TCVA 2Q4VA 2FIWA 5F47A 3EXNA 1M44A 4JXQA 3TTHA 3W6XA 5J8FA 1K4JA 5C82A 2B3VA 3N7ZA 3C26A 3FXTA 4AVAA 2VEZA 2ZW4A 5F48A 1S7FA 4E8OA 2FXFA 3JVNA 4JJXA 2Y0MA 4KOYA 2G3AA 4U9ZA 4KOSA 5DWMA 4CRZB 4CAXA 2VXKA 3FNCA 2VI7A 1L0CA 4ZBGA 2P0WA 3PP9A 3SXNA 1QSOA 4DNCA 3GY9A 5IB0A 3TO7A 1V0CA 2P6GA 4U9YA 1XIXA 4KVOE 5JQ4A 4YGOA 4KZTA 2GIVA 1BOBA 4FD7A 4YFJA 2JDCA 4QB9A 2FIAA 3WR7A 3G3SA 1I12A 4UWJA 5F49A 3VWDA 4NXYA 5H84A 3T90A 2NMTA 4R87A 2ATRA 3ZJ0A 4AVBA 4H89A 2OU2A 5EBVA 3UY5A 3F0AA 2FE7A 4BMHA 3GKRA 4PSXA 2AJ6A 4KVME 1NSLA 2D4OA 3KKWA 3RYOA 4NCZA 2VZZA 1KUVA 1Z4EA 3R9EA 4ONUA 1IYLA 3F8KA 4B5PA 3VWEA 1IB1E 5KTAA 2G0BA 1IYKA 4H6ZA 1MJ9A 4JWPA 4IUSA 4OLLA 1YX0A 4RS2A 2ZW7A 2PR8A 1ON0A 1CM0A 1KZFA 1S7NA 1GHEA 2D4PA 2G3TA 4XPDC 2Q44A 3P2HA 2VQYA 2HUZA 1YREA 4UWIA 2K5TA 1J4JA 1NE9A 3CXQA 1S7LA 2PDOA 1M4GA 4CS0B 2GANA 3QB8A 1IIDA 2JDDA 2A4NA 4FD6A 5E96A 4KOUA 2P6EA 4MHDA 4XPDB 2CNTA 2OH1A 3F5BA 2Q0YA 2REFA 2WPXA 2J8MA 4UBRA 2WPWA 2OZUA 3PZJA 3LD2A 2BL1A 2DXQA 1MJAA 4MY0A 5DWNA 3DR6A 3R1KA 4CAVA 4H6UA 4IF5A 2FL4A 2CNSA 1XMTA 5IV0A 4CRYB 4OAEA 2PSWA 4QUSA 3EY5A 4E0AA 3CXPA 1S3ZA 2CNMA 3H4QA 4QVTA 1Q2CA 1S5KA 1XE4A 3DR8A 1UFHA 1VHSA 1YVOA 3BLNA 1OZPA 4QC6A 2BSWA 1VKCA 2QIRA 5EC4A 4F6AA 1YLEA 4II9A 1YVKA 4KUBA 5ISVA 1BO4A 4PSWA 3DDDA 2EVNA 2JLMA 2BUEA 1QSMA 5FVJA 2HV2A 4XNHB 4UA3A 1B6BA 1PU9A 4U5YA 4KORA 5F46A 2FS5A 1Y9KA 2IL4A 4Y49B 5CNPA 1Z4RA 4R57A 3EC4A 1M4DA 4R9MA 1S7KA 3TO9A 3EO4A 2PQ8A 4R3LA 2B4BA 3I9SA 4XPLA 3FB3A 2P6FA 3GYAA 4KVXA 2C27A 2EUIA 2ARHA 4HNXB 3D3SA 4MJ8A 3DSBA 3EFAA 4NF1A 1QSRA 3SXOA 2B5GA 4FD5A 4Y49C 4AG9A 3S6KA 4LUAA 2R1IA 1P0HA 4NSQA 2O28A 4M3SA 4K30A 4MBUA 4HNYB 4CAWA 2ZPAA 3TT2A 2Z10A 1FY7A 1YK3A 1SQHA 5KTDA 4ORFA 3E0KA 4KUAA 4E2AA 4YRHA 4KOXA 5C88A 3S6FA 4RI1A 1I21A 1Q2YA 3B8GA 3DNSA 4B5PB 4I49A 2J8NA 3NE7A 3P2FA 3V8IA
chains in the Genus database with same CATH superfamily
1NMTA 2JBJA 3QAHA 1M4IA 5H86A 1YGHA 3I3GA 1N71A 4AVCA 3FEEA 4BBHA 4A39A 3TFYA 3PFOA 3R9GA 4CYNA 5HVFA 1F2OA 5LRGA 3ZZIA 1YLOA 3TOAA 5A27A 4FD4A 2ZEEA 3HUVA 3G8WA 2OR4A 3D2PA 4M85A 1XF8A 2Z3KA 5JM6A 4P4IA 2PVWA 1ZO0A 1P4NA 5AG6A 1KUXA 4KOWA 4RN7A 2J9AA 1VGYA 4ZY1A 3KQZA 3D67A 2QMLA 4X8IA 1X10A 4B5OA 2OZGA 3B3TA 3FRMA 4KLWA 1Z8WA 4NGPA 4UIBA 5GCNA 4CGPA 1VIXA 3PB9X 2WSAA 2OB0A 3FMCA 2B4DB 3ISZA 4FUUA 4KOVA 1IY7A 5J8CA 5CPAA 2IMOA 3R95A 2PC1A 3W91A 1MJBA 2AE6A 2WYRA 5LYDA 2F8HA 2FSRA 4UCMA 4UIAA 1PUAA 2KCWA 4MFJA 3TO6A 2RC4A 4PV6A 3RNZA 1RXTA 4L89A 2Z11A 4C2XA 4PK3A 4F0XA 4ZY0A 3IGRA 2PJ9A 4X5KA 4UEEA 4JD6A 1ZLHA 2GE3A 2XEJA 4UFVA 3B7IA 2ZEOA 2ZW6A 1UWYA 4C68A 1TKFA 3D2MA 2PJ6A 3PB4X 5HVGA 2V77A 4AB7A 1Z8XA 5HMNA 2Q4YA 2REEA 2XEFA 3K9UA 5KTCA 2JEVA 1DTDA 4X3RA 5LYFA 3RO0A 3TE4A 2C1CA 2POKA 3BJ8A 1Y7EA 2YNCA 1U6MA 2Q4ZA 2B58A 4EVYA 4YU9A 3GUXA 2F5IA 4UFXA 4A32A 5K8PA 4IK2A 5EMIA 1LRZA 2ZXVA 4C7IA 2YNEA 3D8PA 4OC0A 1CJWA 4C2ZA 1VHOA 2PE3A 3B3SA 4PK2A 4CAFA 4HKFA 4JLYA 3NH5A 2ZW5A 3TOBA 3VH9A 4JYWA 3BJ7A 2R98A 2OZHA 2EK8A 3LODA 3PBBA 4NEXA 5THWA 2Z0ZA 2B5GB 2PJ1A 3JRUA 2R7HA 3OWCA 5K8NA 3K2KA 2ZEGA 4O23A 2QJ8A 5ELYA 1XBUA 1LAMA 2ZEMA 1B87A 3IIBA 2VZYA 3FIXA 3I1UA 2WUUA 1RO5A 4CGOA 1YW6A 4M6HA 4RUHA 1Y9WA 4MMOA 4KLVA 2BEIA 5G20A 3V38A 4OADA 2ANPA 3W6SA 2Q04A 1CPSA 1XJOA 1Z2LA 1M1DA 1KWMA 1YSJA 1ZLIA 2R8VA 1I1DA 1JWQA 3KZWA 4L8AA 3B3WA 2VBQA 4OC3A 4QBJA 2PIZA 1BPNA 1WK4A 3JUWA 2ZEHA 1QSNA 2CY2A 1TIQA 3R9FA 4XNHC 2PR1A 2PJCA 4IHMA 2B4DA 2RB7A 4IAVA 3MGDA 4MI4A 4ZYQA 5I0CA 3KHZA 3S6GA 1YW4A 1QSTA 2QYVA 2I00A 1Z9UA 2AFSA 1IICA 3BXMA 5J1QA 3SI1A 5CBMA 1MK4A 1TXRA 2X7BA 1YR0A 2Q7BA 4F9UA 3NE8A 2PJ0A 4MY3A 4CGNA 4ZX8A 2ZELA 1CPXA 4CYOA 3SI2A 4R8FA 5HH1A 3PGPA 3D7DA 2HQYA 4OKOA 5JPHA 2ZEFA 3S6HA 4KOTA 2VL1A 1Q2DA 2H5MA 1R57A 3IFEA 4F0YA 4Q36A 3FYNA 3WT4A 2GLFA 2B3UA 2PRBA 2ZOGA 1ZG9A 3CXSA 3R96A 4ONWA 3T9YA 3IEHA 4R3KA 1S60A 3IWGA 2DPTA 2EWBA 4JXRA 1OBRA 2FCKA 4LX9A 4OIDA 4UCNA 1WWZA 2J8RA 5LRKA 5LRJA 1KUYA 4HNWB 4X2TA 1Y0RA 2QECA 1Y7RA 3PEIA 4PQAA 4XPKA 4GS4A 1XEBA 1CP6A 2I79A 3CPXA 4J3GA 3SHPA 2FT0A 4AG7A 4FWUA 3FBUA 3TCVA 6CPAA 4MRIA 2BOAA 4YWYA 2Q4VA 2FVGA 2FIWA 5F47A 3EXNA 3FECA 1M44A 4JXQA 3TTHA 3W6XA 5IX3A 4W9YA 2V8VA 3IWWA 5J8FA 3MRUA 1K4JA 5C82A 4TNUA 2B3VA 2AFZA 3N7ZA 4PXEA 4B12A 3C26A 4A94A 3FXTA 4AVAA 1XOVA 2VEZA 2ZW4A 5F48A 3GIUA 1F57A 1S7FA 4E8OA 4UFWA 2V8HA 2FXFA 3JVNA 4ZI6A 4R7MA 3VATA 3K9TA 2IQ6A 4JJXA 3A9LA 2Y0MA 2PJ4A 1BLLE 4UF4A 4G1PA 4P45A 4KOYA 4MFQA 3L2NA 2G3AA 1A2ZA 2Z3LA 4U9ZA 4KOSA 2PJBA 5DWMA 4CRZB 4OIWA 1Z8TA 2YNCC 4CAXA 2VXKA 1CP7A 4KSIA 3FNCA 2VI7A 4MHNA 4Z65A 8CPAA 2GREA 1L0CA 4ZBGA 4CYQA 1X12A 1AYEA 2P0WA 3PP9A 3SXNA 4NGRA 3IWEA 1QSOA 3H8EA 4DNCA 3GY9A 5IB0A 3TO7A 2WZNA 1V0CA 2P6GA 4NJQA 4U9YA 1XIXA 4KVOE 4MHZA 5F09A 5JQ4A 1ELMP 2XEIA 3KASA 5G1ZA 1IGBA 3FVLA 4OP4A 4YGOA 3D7GA 4KZTA 2PJ2A 2QVPA 5G21A 2GIVA 2PVVA 1BOBA 5AGEA 3T8WA 3KHXA 4FD7A 3DLJA 4EMEA 4YFJA 3ISXA 5I4MA 1FT7A 2Z3PA 2JDCA 2PJ8A 3BI1A 4R6TA 4A37A 2DF5A 2CXAA 3RBUA 4OC5A 1LCPA 4QB9A 2FIAA 3WR7A 2PJAA 1I12A 1TF8A 3G3SA 4UWJA 5F49A 3SJGA 1IOIA 1QMUA 3VWDA 1AUGA 4B11A 3QAYA 1ARMA 4P10A 4FAIA 3S9LA 5D8NA 4MCQA 3GLJA 4NXYA 1EE3P 5H84A 2NSMA 3T90A 2NMTA 3D66A 4R87A 2ATRA 4MHYA 3ZJ0A 4AVBA 4AXVA 3LWUA 3CT9A 3FX6A 1RTQA 3DGVA 4H89A 2OU2A 4UEZA 3KL9A 5EBVA 3UY5A 3F0AA 3B35A 1M4LA 5IB9A 2FE7A 3IJ3A 3KI9A 4BMHA 2GLJA 4NGMA 3GKRA 2GU2A 1HDQA 3IU1A 2AJ6A 4PSXA 1JQGA 2V8DA 2NYQA 4MFLA 2JBKA 4H2KA 4KVME 1NSLA 4M6GA 2D4OA 3D4UA 3KKWA 3RYOA 3LMSA 4KSFA 4NCZA 2VZZA 1KUVA 1Z4EA 2GFQA 5LYLA 3R9EA 5K8OA 4ONUA 1IYLA 3F8KA 3FF3A 4PPZA 3IO1A 3VWEA 4B10A 4B5PA 5JGFA 1IB1E 5KTAA 4MFPA 3NH4A 3WC7A 2G0BA 1IYKA 4H6ZA 1MJ9A 2XEGA 4JWPA 4IUSA 4OLLA 2CIJA 2ZENA 2CTBA 1YX0A 4UCPA 2ZW7A 4RS2A 1XMBA 2PR8A 1ON0A 2I3CA 1CM0A 1KZFA 4BD9A 1S7NA 4OC4A 1GHEA 2D4PA 3RAMA 2G3TA 1VHEA 4C2YA 2PRQA 2C6GA 4ZGYB 3KGQA 2ZEPA 4LQGA 4XPDC 2Q44A 4OMEA 3P2HA 4ZY2A 2VQYA 1CBXA 1YREA 2HUZA 4OC2A 4UWIA 2O53A 3GB0A 4DUKA 5DS0A 1HDUA 2K5TA 1J4JA 1NE9A 3SJEA 3CXQA 2YGWA 1S7LA 2PDOA 1M4GA 1XRYA 3N5FA 1CX8A 4CS0B 5LYIA 5G22A 2YNDA 2EBJA 2GANA 3QB8A 1IIDA 2JDDA 2A4NA 4FD6A 5E96A 3RZAA 4A31A 2PJ5A 2C6PA 4KOUA 2G9DA 2PCUA 3IC1A 3VARA 4A2ZA 3IU2A 4B14A 1IU8A 2P6EA 3NFZA 4MHDA 4XPDB 2V8GA 2CNTA 2OH1A 2Q7SA 2Q0YA 3F5BA 4LQ6A 2REFA 2Z3MA 4Q7AA 2WPXA 3S9MA 4B6ZA 4MCPA 2J8MA 4UBRA 5HVHA 2WPWA 2OZUA 3PZJA 3LD2A 1AMPA 2BL1A 3FJUA 2DXQA 4CYPA 2O4HA 1MJAA 4B13A 4MY0A 2HB6A 5DWNA 1BPMA 3DR6A 3R1KA 1DE4C 4WJBA 3PBEA 3PB7X 2DEAA 4TWEA 4ZX9A 4CAVA 4H6UA 1CG2A 4IF5A 3TC8A 3H5ZA 2FL4A 2CNSA 1XMTA 5AG5A 3KQXA 2AFWA 5IV0A 1QQ9A 4PXDA 1ARLA 4CRYB 1R3NA 4OAEA 4P4DA 2PSWA 3S9NA 4QUSA 3EY5A 4E0AA 3CXPA 1S3ZA 2CNMA 3PB6X 4KS9A 2C6CA 3H4QA 4QVTA 1Q2CA 1S5KA 1XE4A 4P4FA 2CF4A 1UFHA 3DR8A 1PCAA 3B2YA 2AFXA 4FBEA 2HC9A 3H8GA 4NGSA 4NFRA 1VHSA 1YVOA 5D29A 3BLNA 5JH9A 1OZPA 1F2PA 4QC6A 2BSWA 4CAEA 4MCRA 1Z8LA 1VKCA 2QIRA 3NH8A 5EC4A 4F6AA 3BI0A 1YLEA 1FNOA 4II9A 1Y0YA 1YVKA 3FEDA 4KUBA 4P4JA 3KR4A 5ISVA 5AG4A 4DYOA 4GXHA 1R43A 4F9VA 1IOFA 1NSAA 1BO4A 4PSWA 3DDDA 4Q38A 3PFEA 1PYTB 2EVNA 2JLMA 2Q43A 3PB8X 3FH4A 2BUEA 4A38A 2CTCA 1QSMA 3H8FA 4R76A 3WC5A 5A28A 5FVJA 4A30A 5BWAB 4JZ0A 2HV2A 4XNHB 4UA3A 4PXBA 1B6BA 3WC6A 1PU9A 2OOTA 4U5YA 4KORA 5F46A 2FS5A 1Y9KA 2IL4A 4Y49B 5CNPA 1Z4RA 4R57A 3EC4A 1M4DA 2AFMA 4R9MA 1S7KA 1ZG8A 4A33A 4CPAA 3PRTA 3KR5A 3B3CA 3TO9A 2F7VA 1Q7LA 4MFKA 4CGMA 2PJ3A 4P44A 1YQEA 3EO4A 2PQ8A 4P4BA 4R3LA 4MCSA 2B4BA 2EK9A 2RFHA 3I9SA 2ZOFA 4NGNA 4XPLA 2JEWA 1TKJA 2P6FA 3FB3A 2ZEDA 3GYAA 3B3VA 2AFOA 4KVXA 1ELLP 5AG7A 4C7HA 2C27A 2EUIA 2ARHA 1XFOA 3D68A 4HNXB 3CDXA 3D3SA 3DSBA 3EFAA 4MJ8A 1QSRA 4HPSA 4NF1A 3SXOA 4M6IA 1LOKA 2EO8A 7CPAA 3SJFA 3SJXA 2B5GA 1TF9A 4FD5A 4Y49C 2Z3OA 3MN8A 4AG9A 4OC1A 4MXUA 4P6YA 3S6KA 2AFUA 4UEFA 4LUAA 3D7HA 2R1IA 1P0HA 4DJLA 2DPSA 3QNVA 4GM5A 2PJ7A 1TKHA 3CPAA 3WABA 4A95A 4NSQA 2O28A 4M3SA 4K30A 1LANA 4MBUA 3JTKA 1H8LA 5K8MA 4NGQA 4HNYB 1BAVA 2ABZA 4CAWA 4KSAA 5HXDA 2ZPAA 3D7FA 3TT2A 3LACA 2Z10A 1Z5RA 4WWVA 1FY7A 2Z3NA 3SI0A 4NJRA 1YK3A 2Q51A 1SQHA 4BINA 4K3NA 1ZG7A 5KTDA 1HEEA 4MHPA 4ORFA 3E0KA 4PXCA 4KUAA 4E2AA 2ODFA 1YMEA 1GYTA 4P4EA 4EWTA 4YRHA 4KOXA 5C88A 3V7ZA 3S6FA 4CGLA 4RI1A 4NGTA 1LAPA 3BHXA 4MFZA 1I21A 1Q2YA 3B8GA 3DNSA 3HLPA 2BCOA 3TX8A 2IJZA 4B5PB 4EFDA 2BO9A 3NA6A 4I49A 1LFWA 2J8NA 2PIYA 3NE7A 3P2FA 4F8ZA 3V8IA 3CZXA
chains in the Genus database with same CATH topology
1NMTA 3QAHA 1M4IA 5H86A 1YGHA 3I3GA 1N71A 4AVCA 4BBHA 3TFYA 4CYNA 3R9GA 3ZZIA 3TOAA 5A27A 4FD4A 3G8WA 4M85A 3D2PA 1XF8A 2Z3KA 1ZO0A 1P4NA 5AG6A 1KUXA 4KOWA 2QMLA 4B5OA 2OZGA 3FRMA 4KLWA 5GCNA 4CGPA 2WSAA 2OB0A 2B4DB 4KOVA 5J8CA 3R95A 2PC1A 3W91A 1MJBA 2AE6A 2FSRA 4UCMA 1PUAA 2KCWA 4MFJA 3TO6A 2RC4A 4PV6A 1RXTA 4L89A 2Z11A 4C2XA 4PK3A 4F0XA 3IGRA 4X5KA 4JD6A 2GE3A 4UFVA 2ZW6A 4C68A 3D2MA 4AB7A 5HMNA 2Q4YA 2REEA 3K9UA 2JEVA 3TE4A 3BJ8A 2YNCA 1U6MA 2B58A 4EVYA 2F5IA 4UFXA 4A32A 1LRZA 2ZXVA 4C7IA 2YNEA 3D8PA 1CJWA 4C2ZA 4PK2A 4CAFA 4HKFA 4JLYA 2ZW5A 3TOBA 4NEXA 3BJ7A 2R98A 2OZHA 3LODA 2Z0ZA 2B5GB 3OWCA 2R7HA 1B87A 2VZYA 3FIXA 2WUUA 1RO5A 4CGOA 1Y9WA 4KLVA 2BEIA 5G20A 4OADA 3W6SA 2Q04A 1M1DA 2R8VA 4L8AA 4QBJA 1I1DA 5KTCA 2VBQA 3JUWA 1WK4A 1QSNA 2CY2A 1TIQA 3R9FA 4XNHC 2PR1A 2B4DA 4MI4A 3MGDA 5I0CA 3S6GA 1QSTA 2I00A 1Z9UA 1IICA 1MK4A 2X7BA 1YR0A 2Q7BA 4MY3A 4CGNA 4CYOA 5HH1A 3PGPA 2HQYA 5JPHA 3S6HA 4KOTA 1Q2DA 2H5MA 1R57A 4F0YA 4Q36A 3FYNA 2PRBA 2B3UA 3R96A 3CXSA 3T9YA 4R3KA 1S60A 3IWGA 2DPTA 4JXRA 5IX3A 2FCKA 4UCNA 4LX9A 1WWZA 2J8RA 1KUYA 4HNWB 2QECA 1Y7RA 4XPKA 4GS4A 1XEBA 2I79A 4J3GA 3SHPA 4AG7A 2FT0A 3FBUA 3TCVA 2Q4VA 2FIWA 5F47A 3EXNA 1M44A 4JXQA 3TTHA 3W6XA 5J8FA 1K4JA 5C82A 2B3VA 4B12A 3N7ZA 3C26A 3FXTA 4AVAA 2VEZA 2ZW4A 5F48A 1S7FA 4E8OA 4UFWA 2FXFA 3JVNA 4JJXA 3A9LA 2Y0MA 4KOYA 4MFQA 2G3AA 2Z3LA 4U9ZA 4KOSA 5DWMA 4CRZB 2YNCC 4CAXA 2VXKA 3FNCA 2VI7A 1L0CA 4ZBGA 4CYQA 2P0WA 3PP9A 3SXNA 3IWEA 1QSOA 4DNCA 3GY9A 5IB0A 3TO7A 1V0CA 2P6GA 4U9YA 1XIXA 4KVOE 5JQ4A 5G1ZA 4YGOA 4KZTA 5G21A 2GIVA 5AGEA 1BOBA 4FD7A 4YFJA 2Z3PA 2JDCA 2CXAA 4QB9A 2FIAA 3WR7A 3G3SA 1I12A 4UWJA 5F49A 3VWDA 4B11A 4NXYA 5H84A 3T90A 2NMTA 4R87A 2ATRA 3ZJ0A 4AVBA 4H89A 2OU2A 5EBVA 3UY5A 3F0AA 2FE7A 4BMHA 3GKRA 3IU1A 4PSXA 2AJ6A 4MFLA 4KVME 1NSLA 2D4OA 3KKWA 3RYOA 4NCZA 4KSFA 2VZZA 1KUVA 1Z4EA 3R9EA 4ONUA 1IYLA 3F8KA 4B5PA 4B10A 3VWEA 1IB1E 5KTAA 4MFPA 2G0BA 1IYKA 4H6ZA 1MJ9A 4JWPA 4IUSA 4OLLA 1YX0A 4UCPA 2ZW7A 4RS2A 2PR8A 1ON0A 1CM0A 1KZFA 1S7NA 1GHEA 2D4PA 2G3TA 4C2YA 4ZGYB 4XPDC 2Q44A 3P2HA 2VQYA 2HUZA 1YREA 4UWIA 2K5TA 1J4JA 1NE9A 3CXQA 2YGWA 1S7LA 2PDOA 1M4GA 4CS0B 5G22A 2YNDA 2GANA 3QB8A 1IIDA 2JDDA 2A4NA 4FD6A 5E96A 4A31A 4KOUA 4A2ZA 4B14A 3IU2A 2P6EA 4MHDA 4XPDB 2CNTA 2OH1A 3F5BA 2Q0YA 2REFA 2Z3MA 2WPXA 2J8MA 4UBRA 2WPWA 2OZUA 3PZJA 3LD2A 2BL1A 2DXQA 4CYPA 4B13A 1MJAA 4MY0A 5DWNA 3DR6A 3R1KA 4CAVA 4H6UA 4IF5A 3H5ZA 2FL4A 2CNSA 1XMTA 5AG5A 5IV0A 4CRYB 4OAEA 2PSWA 4QUSA 3EY5A 4E0AA 3CXPA 1S3ZA 2CNMA 4KS9A 3H4QA 4QVTA 1Q2CA 1S5KA 1XE4A 3DR8A 1UFHA 1VHSA 1YVOA 3BLNA 1OZPA 4QC6A 2BSWA 1VKCA 2QIRA 5EC4A 4F6AA 1YLEA 4II9A 1YVKA 4KUBA 5ISVA 5AG4A 1BO4A 4PSWA 3DDDA 4Q38A 2EVNA 2JLMA 2BUEA 1QSMA 5A28A 5FVJA 4A30A 5BWAB 2HV2A 4XNHB 4UA3A 1B6BA 1PU9A 4U5YA 4KORA 5F46A 2FS5A 1Y9KA 2IL4A 4Y49B 5CNPA 1Z4RA 4R57A 3EC4A 1M4DA 4R9MA 4A33A 1S7KA 3TO9A 4MFKA 4CGMA 3EO4A 2PQ8A 4R3LA 2B4BA 3I9SA 4XPLA 3FB3A 2P6FA 3GYAA 4KVXA 5AG7A 4C7HA 2C27A 2EUIA 2ARHA 4HNXB 3D3SA 4MJ8A 3DSBA 3EFAA 4NF1A 1QSRA 3SXOA 2B5GA 4FD5A 4Y49C 2Z3OA 4AG9A 3S6KA 4LUAA 2R1IA 1P0HA 2DPSA 4A95A 4NSQA 2O28A 4M3SA 4K30A 4MBUA 3JTKA 4HNYB 4CAWA 4KSAA 2ZPAA 3TT2A 2Z10A 1FY7A 2Z3NA 1YK3A 1SQHA 5KTDA 4ORFA 3E0KA 4KUAA 4E2AA 4YRHA 4KOXA 5C88A 3S6FA 4CGLA 4RI1A 4MFZA 1I21A 1Q2YA 3B8GA 3DNSA 4B5PB 4I49A 2J8NA 3NE7A 3P2FA 3V8IA 4CAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NMT A;  3QAH A;  1M4I A;  5H86 A;  1YGH A;  3I3G A;  1N71 A;  4AVC A;  3TFY A;  3R9G A;  3ZZI A;  3TOA A;  4FD4 A;  3G8W A;  4M85 A;  3D2P A;  1XF8 A;  1P4N A;  1KUX A;  4KOW A;  2QML A;  4B5O A;  2OZG A;  3FRM A;  4KLW A;  5GCN A;  2OB0 A;  2B4D B;  4KOV A;  5J8C A;  3R95 A;  2PC1 A;  3W91 A;  1MJB A;  2AE6 A;  2FSR A;  1PUA A;  2KCW A;  3TO6 A;  2RC4 A;  4PV6 A;  1RXT A;  4L89 A;  2Z11 A;  4PK3 A;  3IGR A;  4X5K A;  4JD6 A;  2GE3 A;  2ZW6 A;  3D2M A;  4AB7 A;  5HMN A;  2Q4Y A;  2REE A;  3K9U A;  2JEV A;  3TE4 A;  3BJ8 A;  1U6M A;  2B58 A;  4EVY A;  2F5I A;  1LRZ A;  2ZXV A;  3D8P A;  1CJW A;  4PK2 A;  4HKF A;  4JLY A;  2ZW5 A;  3TOB A;  4NEX A;  3BJ7 A;  2R98 A;  2OZH A;  3LOD A;  2Z0Z A;  2B5G B;  3OWC A;  2R7H A;  1B87 A;  2VZY A;  3FIX A;  1RO5 A;  1Y9W A;  4KLV A;  2BEI A;  4OAD A;  3W6S A;  2Q04 A;  1M1D A;  2R8V A;  4L8A A;  4QBJ A;  1I1D A;  5KTC A;  2VBQ A;  3JUW A;  1WK4 A;  1QSN A;  2CY2 A;  1TIQ A;  3R9F A;  4XNH C;  2PR1 A;  2B4D A;  4MI4 A;  3MGD A;  5I0C A;  3S6G A;  1QST A;  2I00 A;  1Z9U A;  1IIC A;  1MK4 A;  2X7B A;  1YR0 A;  2Q7B A;  4MY3 A;  5HH1 A;  3PGP A;  2HQY A;  5JPH A;  3S6H A;  4KOT A;  1Q2D A;  2H5M A;  1R57 A;  4F0Y A;  3FYN A;  2PRB A;  2B3U A;  3R96 A;  3CXS A;  3T9Y A;  4R3K A;  1S60 A;  3IWG A;  4JXR A;  5IX3 A;  2FCK A;  4LX9 A;  1WWZ A;  2J8R A;  1KUY A;  4HNW B;  2QEC A;  1Y7R A;  4XPK A;  4GS4 A;  1XEB A;  2I79 A;  4J3G A;  3SHP A;  4AG7 A;  2FT0 A;  3FBU A;  3TCV A;  2Q4V A;  2FIW A;  5F47 A;  3EXN A;  1M44 A;  4JXQ A;  3TTH A;  3W6X A;  5J8F A;  1K4J A;  5C82 A;  2B3V A;  3N7Z A;  3C26 A;  3FXT A;  4AVA A;  2VEZ A;  2ZW4 A;  5F48 A;  1S7F A;  4E8O A;  2FXF A;  3JVN A;  4JJX A;  2Y0M A;  4KOY A;  2G3A A;  4U9Z A;  4KOS A;  5DWM A;  4CRZ B;  4CAX A;  2VXK A;  3FNC A;  2VI7 A;  1L0C A;  4ZBG A;  2P0W A;  3PP9 A;  3SXN A;  1QSO A;  4DNC A;  3GY9 A;  5IB0 A;  3TO7 A;  1V0C A;  2P6G A;  4U9Y A;  1XIX A;  4KVO E;  5JQ4 A;  4YGO A;  4KZT A;  2GIV A;  1BOB A;  4FD7 A;  4YFJ A;  2JDC A;  4QB9 A;  2FIA A;  3WR7 A;  3G3S A;  1I12 A;  4UWJ A;  5F49 A;  3VWD A;  4NXY A;  5H84 A;  3T90 A;  2NMT A;  4R87 A;  2ATR A;  3ZJ0 A;  4AVB A;  4H89 A;  2OU2 A;  5EBV A;  3UY5 A;  3F0A A;  2FE7 A;  4BMH A;  3GKR A;  4PSX A;  2AJ6 A;  4KVM E;  1NSL A;  2D4O A;  3KKW A;  3RYO A;  4NCZ A;  2VZZ A;  1KUV A;  1Z4E A;  3R9E A;  4ONU A;  1IYL A;  3F8K A;  4B5P A;  3VWE A;  1IB1 E;  5KTA A;  2G0B A;  1IYK A;  4H6Z A;  1MJ9 A;  4JWP A;  4IUS A;  4OLL A;  1YX0 A;  4RS2 A;  2ZW7 A;  2PR8 A;  1ON0 A;  1CM0 A;  1KZF A;  1S7N A;  1GHE A;  2D4P A;  2G3T A;  4XPD C;  2Q44 A;  3P2H A;  2VQY A;  2HUZ A;  1YRE A;  4UWI A;  2K5T A;  1J4J A;  1NE9 A;  3CXQ A;  1S7L A;  2PDO A;  1M4G A;  4CS0 B;  2GAN A;  3QB8 A;  1IID A;  2JDD A;  2A4N A;  4FD6 A;  5E96 A;  4KOU A;  2P6E A;  4MHD A;  4XPD B;  2CNT A;  2OH1 A;  3F5B A;  2Q0Y A;  2REF A;  2WPX A;  2J8M A;  4UBR A;  2WPW A;  2OZU A;  3PZJ A;  3LD2 A;  2BL1 A;  2DXQ A;  1MJA A;  4MY0 A;  5DWN A;  3DR6 A;  3R1K A;  4CAV A;  4H6U A;  4IF5 A;  2FL4 A;  2CNS A;  1XMT A;  5IV0 A;  4CRY B;  4OAE A;  2PSW A;  4QUS A;  3EY5 A;  4E0A A;  3CXP A;  1S3Z A;  2CNM A;  3H4Q A;  4QVT A;  1Q2C A;  1S5K A;  1XE4 A;  3DR8 A;  1UFH A;  1VHS A;  1YVO A;  3BLN A;  1OZP A;  4QC6 A;  2BSW A;  1VKC A;  2QIR A;  5EC4 A;  4F6A A;  1YLE A;  4II9 A;  1YVK A;  4KUB A;  5ISV A;  1BO4 A;  4PSW A;  3DDD A;  2EVN A;  2JLM A;  2BUE A;  1QSM A;  5FVJ A;  2HV2 A;  4XNH B;  4UA3 A;  1B6B A;  1PU9 A;  4U5Y A;  4KOR A;  5F46 A;  2FS5 A;  1Y9K A;  2IL4 A;  4Y49 B;  5CNP A;  1Z4R A;  4R57 A;  3EC4 A;  1M4D A;  4R9M A;  1S7K A;  3TO9 A;  3EO4 A;  2PQ8 A;  4R3L A;  2B4B A;  3I9S A;  4XPL A;  3FB3 A;  2P6F A;  3GYA A;  4KVX A;  2C27 A;  2EUI A;  2ARH A;  4HNX B;  3D3S A;  4MJ8 A;  3DSB A;  3EFA A;  4NF1 A;  1QSR A;  3SXO A;  2B5G A;  4FD5 A;  4Y49 C;  4AG9 A;  3S6K A;  4LUA A;  2R1I A;  1P0H A;  4NSQ A;  2O28 A;  4M3S A;  4K30 A;  4MBU A;  4HNY B;  4CAW A;  2ZPA A;  3TT2 A;  2Z10 A;  1FY7 A;  1YK3 A;  1SQH A;  5KTD A;  4ORF A;  3E0K A;  4KUA A;  4E2A A;  4YRH A;  4KOX A;  5C88 A;  3S6F A;  4RI1 A;  1I21 A;  1Q2Y A;  3B8G A;  3DNS A;  4B5P B;  4I49 A;  2J8N A;  3NE7 A;  3P2F A;  3V8I A; 
#chains in the Genus database with same CATH topology
 1NMT A;  2JBJ A;  3QAH A;  1M4I A;  5H86 A;  1YGH A;  3I3G A;  1N71 A;  4AVC A;  3FEE A;  4BBH A;  4A39 A;  3TFY A;  3PFO A;  3R9G A;  4CYN A;  5HVF A;  1F2O A;  5LRG A;  3ZZI A;  1YLO A;  3TOA A;  5A27 A;  4FD4 A;  2ZEE A;  3HUV A;  3G8W A;  2OR4 A;  3D2P A;  4M85 A;  1XF8 A;  2Z3K A;  5JM6 A;  4P4I A;  2PVW A;  1ZO0 A;  1P4N A;  5AG6 A;  1KUX A;  4KOW A;  4RN7 A;  2J9A A;  1VGY A;  4ZY1 A;  3KQZ A;  3D67 A;  2QML A;  4X8I A;  1X10 A;  4B5O A;  2OZG A;  3B3T A;  3FRM A;  4KLW A;  1Z8W A;  4NGP A;  4UIB A;  5GCN A;  4CGP A;  1VIX A;  3PB9 X;  2WSA A;  2OB0 A;  3FMC A;  2B4D B;  3ISZ A;  4FUU A;  4KOV A;  1IY7 A;  5J8C A;  5CPA A;  2IMO A;  3R95 A;  2PC1 A;  3W91 A;  1MJB A;  2AE6 A;  2WYR A;  5LYD A;  2F8H A;  2FSR A;  4UCM A;  4UIA A;  1PUA A;  2KCW A;  4MFJ A;  3TO6 A;  2RC4 A;  4PV6 A;  3RNZ A;  1RXT A;  4L89 A;  2Z11 A;  4C2X A;  4PK3 A;  4F0X A;  4ZY0 A;  3IGR A;  2PJ9 A;  4X5K A;  4UEE A;  4JD6 A;  1ZLH A;  2GE3 A;  2XEJ A;  4UFV A;  3B7I A;  2ZEO A;  2ZW6 A;  1UWY A;  4C68 A;  1TKF A;  3D2M A;  2PJ6 A;  3PB4 X;  5HVG A;  2V77 A;  4AB7 A;  1Z8X A;  5HMN A;  2Q4Y A;  2REE A;  2XEF A;  3K9U A;  5KTC A;  2JEV A;  1DTD A;  4X3R A;  5LYF A;  3RO0 A;  3TE4 A;  2C1C A;  2POK A;  3BJ8 A;  1Y7E A;  2YNC A;  1U6M A;  2Q4Z A;  2B58 A;  4EVY A;  4YU9 A;  3GUX A;  2F5I A;  4UFX A;  4A32 A;  5K8P A;  4IK2 A;  5EMI A;  1LRZ A;  2ZXV A;  4C7I A;  2YNE A;  3D8P A;  4OC0 A;  1CJW A;  4C2Z A;  1VHO A;  2PE3 A;  3B3S A;  4PK2 A;  4CAF A;  4HKF A;  4JLY A;  3NH5 A;  2ZW5 A;  3TOB A;  3VH9 A;  4JYW A;  3BJ7 A;  2R98 A;  2OZH A;  2EK8 A;  3LOD A;  3PBB A;  4NEX A;  5THW A;  2Z0Z A;  2B5G B;  2PJ1 A;  3JRU A;  2R7H A;  3OWC A;  5K8N A;  3K2K A;  2ZEG A;  4O23 A;  2QJ8 A;  5ELY A;  1XBU A;  1LAM A;  2ZEM A;  1B87 A;  3IIB A;  2VZY A;  3FIX A;  3I1U A;  2WUU A;  1RO5 A;  4CGO A;  1YW6 A;  4M6H A;  4RUH A;  1Y9W A;  4MMO A;  4KLV A;  2BEI A;  5G20 A;  3V38 A;  4OAD A;  2ANP A;  3W6S A;  2Q04 A;  1CPS A;  1XJO A;  1Z2L A;  1M1D A;  1KWM A;  1YSJ A;  1ZLI A;  2R8V A;  1I1D A;  1JWQ A;  3KZW A;  4L8A A;  3B3W A;  2VBQ A;  4OC3 A;  4QBJ A;  2PIZ A;  1BPN A;  1WK4 A;  3JUW A;  2ZEH A;  1QSN A;  2CY2 A;  1TIQ A;  3R9F A;  4XNH C;  2PR1 A;  2PJC A;  4IHM A;  2B4D A;  2RB7 A;  4IAV A;  3MGD A;  4MI4 A;  4ZYQ A;  5I0C A;  3KHZ A;  3S6G A;  1YW4 A;  1QST A;  2QYV A;  2I00 A;  1Z9U A;  2AFS A;  1IIC A;  3BXM A;  5J1Q A;  3SI1 A;  5CBM A;  1MK4 A;  1TXR A;  2X7B A;  1YR0 A;  2Q7B A;  4F9U A;  3NE8 A;  2PJ0 A;  4MY3 A;  4CGN A;  4ZX8 A;  2ZEL A;  1CPX A;  4CYO A;  3SI2 A;  4R8F A;  5HH1 A;  3PGP A;  3D7D A;  2HQY A;  4OKO A;  5JPH A;  2ZEF A;  3S6H A;  4KOT A;  2VL1 A;  1Q2D A;  2H5M A;  1R57 A;  3IFE A;  4F0Y A;  4Q36 A;  3FYN A;  3WT4 A;  2GLF A;  2B3U A;  2PRB A;  2ZOG A;  1ZG9 A;  3CXS A;  3R96 A;  4ONW A;  3T9Y A;  3IEH A;  4R3K A;  1S60 A;  3IWG A;  2DPT A;  2EWB A;  4JXR A;  1OBR A;  2FCK A;  4LX9 A;  4OID A;  4UCN A;  1WWZ A;  2J8R A;  5LRK A;  5LRJ A;  1KUY A;  4HNW B;  4X2T A;  1Y0R A;  2QEC A;  1Y7R A;  3PEI A;  4PQA A;  4XPK A;  4GS4 A;  1XEB A;  1CP6 A;  2I79 A;  3CPX A;  4J3G A;  3SHP A;  2FT0 A;  4AG7 A;  4FWU A;  3FBU A;  3TCV A;  6CPA A;  4MRI A;  2BOA A;  4YWY A;  2Q4V A;  2FVG A;  2FIW A;  5F47 A;  3EXN A;  3FEC A;  1M44 A;  4JXQ A;  3TTH A;  3W6X A;  5IX3 A;  4W9Y A;  2V8V A;  3IWW A;  5J8F A;  3MRU A;  1K4J A;  5C82 A;  4TNU A;  2B3V A;  2AFZ A;  3N7Z A;  4PXE A;  4B12 A;  3C26 A;  4A94 A;  3FXT A;  4AVA A;  1XOV A;  2VEZ A;  2ZW4 A;  5F48 A;  3GIU A;  1F57 A;  1S7F A;  4E8O A;  4UFW A;  2V8H A;  2FXF A;  3JVN A;  4ZI6 A;  4R7M A;  3VAT A;  3K9T A;  2IQ6 A;  4JJX A;  3A9L A;  2Y0M A;  2PJ4 A;  1BLL E;  4UF4 A;  4G1P A;  4P45 A;  4KOY A;  4MFQ A;  3L2N A;  2G3A A;  1A2Z A;  2Z3L A;  4U9Z A;  4KOS A;  2PJB A;  5DWM A;  4CRZ B;  4OIW A;  1Z8T A;  2YNC C;  4CAX A;  2VXK A;  1CP7 A;  4KSI A;  3FNC A;  2VI7 A;  4MHN A;  4Z65 A;  8CPA A;  2GRE A;  1L0C A;  4ZBG A;  4CYQ A;  1X12 A;  1AYE A;  2P0W A;  3PP9 A;  3SXN A;  4NGR A;  3IWE A;  1QSO A;  3H8E A;  4DNC A;  3GY9 A;  5IB0 A;  3TO7 A;  2WZN A;  1V0C A;  2P6G A;  4NJQ A;  4U9Y A;  1XIX A;  4KVO E;  4MHZ A;  5F09 A;  5JQ4 A;  1ELM P;  2XEI A;  3KAS A;  5G1Z A;  1IGB A;  3FVL A;  4OP4 A;  4YGO A;  3D7G A;  4KZT A;  2PJ2 A;  2QVP A;  5G21 A;  2GIV A;  2PVV A;  1BOB A;  5AGE A;  3T8W A;  3KHX A;  4FD7 A;  3DLJ A;  4EME A;  4YFJ A;  3ISX A;  5I4M A;  1FT7 A;  2Z3P A;  2JDC A;  2PJ8 A;  3BI1 A;  4R6T A;  4A37 A;  2DF5 A;  2CXA A;  3RBU A;  4OC5 A;  1LCP A;  4QB9 A;  2FIA A;  3WR7 A;  2PJA A;  1I12 A;  1TF8 A;  3G3S A;  4UWJ A;  5F49 A;  3SJG A;  1IOI A;  1QMU A;  3VWD A;  1AUG A;  4B11 A;  3QAY A;  1ARM A;  4P10 A;  4FAI A;  3S9L A;  5D8N A;  4MCQ A;  3GLJ A;  4NXY A;  1EE3 P;  5H84 A;  2NSM A;  3T90 A;  2NMT A;  3D66 A;  4R87 A;  2ATR A;  4MHY A;  3ZJ0 A;  4AVB A;  4AXV A;  3LWU A;  3CT9 A;  3FX6 A;  1RTQ A;  3DGV A;  4H89 A;  2OU2 A;  4UEZ A;  3KL9 A;  5EBV A;  3UY5 A;  3F0A A;  3B35 A;  1M4L A;  5IB9 A;  2FE7 A;  3IJ3 A;  3KI9 A;  4BMH A;  2GLJ A;  4NGM A;  3GKR A;  2GU2 A;  1HDQ A;  3IU1 A;  2AJ6 A;  4PSX A;  1JQG A;  2V8D A;  2NYQ A;  4MFL A;  2JBK A;  4H2K A;  4KVM E;  1NSL A;  4M6G A;  2D4O A;  3D4U A;  3KKW A;  3RYO A;  3LMS A;  4KSF A;  4NCZ A;  2VZZ A;  1KUV A;  1Z4E A;  2GFQ A;  5LYL A;  3R9E A;  5K8O A;  4ONU A;  1IYL A;  3F8K A;  3FF3 A;  4PPZ A;  3IO1 A;  3VWE A;  4B10 A;  4B5P A;  5JGF A;  1IB1 E;  5KTA A;  4MFP A;  3NH4 A;  3WC7 A;  2G0B A;  1IYK A;  4H6Z A;  1MJ9 A;  2XEG A;  4JWP A;  4IUS A;  4OLL A;  2CIJ A;  2ZEN A;  2CTB A;  1YX0 A;  4UCP A;  2ZW7 A;  4RS2 A;  1XMB A;  2PR8 A;  1ON0 A;  2I3C A;  1CM0 A;  1KZF A;  4BD9 A;  1S7N A;  4OC4 A;  1GHE A;  2D4P A;  3RAM A;  2G3T A;  1VHE A;  4C2Y A;  2PRQ A;  2C6G A;  4ZGY B;  3KGQ A;  2ZEP A;  4LQG A;  4XPD C;  2Q44 A;  4OME A;  3P2H A;  4ZY2 A;  2VQY A;  1CBX A;  1YRE A;  2HUZ A;  4OC2 A;  4UWI A;  2O53 A;  3GB0 A;  4DUK A;  5DS0 A;  1HDU A;  2K5T A;  1J4J A;  1NE9 A;  3SJE A;  3CXQ A;  2YGW A;  1S7L A;  2PDO A;  1M4G A;  1XRY A;  3N5F A;  1CX8 A;  4CS0 B;  5LYI A;  5G22 A;  2YND A;  2EBJ A;  2GAN A;  3QB8 A;  1IID A;  2JDD A;  2A4N A;  4FD6 A;  5E96 A;  3RZA A;  4A31 A;  2PJ5 A;  2C6P A;  4KOU A;  2G9D A;  2PCU A;  3IC1 A;  3VAR A;  4A2Z A;  3IU2 A;  4B14 A;  1IU8 A;  2P6E A;  3NFZ A;  4MHD A;  4XPD B;  2V8G A;  2CNT A;  2OH1 A;  2Q7S A;  2Q0Y A;  3F5B A;  4LQ6 A;  2REF A;  2Z3M A;  4Q7A A;  2WPX A;  3S9M A;  4B6Z A;  4MCP A;  2J8M A;  4UBR A;  5HVH A;  2WPW A;  2OZU A;  3PZJ A;  3LD2 A;  1AMP A;  2BL1 A;  3FJU A;  2DXQ A;  4CYP A;  2O4H A;  1MJA A;  4B13 A;  4MY0 A;  2HB6 A;  5DWN A;  1BPM A;  3DR6 A;  3R1K A;  1DE4 C;  4WJB A;  3PBE A;  3PB7 X;  2DEA A;  4TWE A;  4ZX9 A;  4CAV A;  4H6U A;  1CG2 A;  4IF5 A;  3TC8 A;  3H5Z A;  2FL4 A;  2CNS A;  1XMT A;  5AG5 A;  3KQX A;  2AFW A;  5IV0 A;  1QQ9 A;  4PXD A;  1ARL A;  4CRY B;  1R3N A;  4OAE A;  4P4D A;  2PSW A;  3S9N A;  4QUS A;  3EY5 A;  4E0A A;  3CXP A;  1S3Z A;  2CNM A;  3PB6 X;  4KS9 A;  2C6C A;  3H4Q A;  4QVT A;  1Q2C A;  1S5K A;  1XE4 A;  4P4F A;  2CF4 A;  1UFH A;  3DR8 A;  1PCA A;  3B2Y A;  2AFX A;  4FBE A;  2HC9 A;  3H8G A;  4NGS A;  4NFR A;  1VHS A;  1YVO A;  5D29 A;  3BLN A;  5JH9 A;  1OZP A;  1F2P A;  4QC6 A;  2BSW A;  4CAE A;  4MCR A;  1Z8L A;  1VKC A;  2QIR A;  3NH8 A;  5EC4 A;  4F6A A;  3BI0 A;  1YLE A;  1FNO A;  4II9 A;  1Y0Y A;  1YVK A;  3FED A;  4KUB A;  4P4J A;  3KR4 A;  5ISV A;  5AG4 A;  4DYO A;  4GXH A;  1R43 A;  4F9V A;  1IOF A;  1NSA A;  1BO4 A;  4PSW A;  3DDD A;  4Q38 A;  3PFE A;  1PYT B;  2EVN A;  2JLM A;  2Q43 A;  3PB8 X;  3FH4 A;  2BUE A;  4A38 A;  2CTC A;  1QSM A;  3H8F A;  4R76 A;  3WC5 A;  5A28 A;  5FVJ A;  4A30 A;  5BWA B;  4JZ0 A;  2HV2 A;  4XNH B;  4UA3 A;  4PXB A;  1B6B A;  3WC6 A;  1PU9 A;  2OOT A;  4U5Y A;  4KOR A;  5F46 A;  2FS5 A;  1Y9K A;  2IL4 A;  4Y49 B;  5CNP A;  1Z4R A;  4R57 A;  3EC4 A;  1M4D A;  2AFM A;  4R9M A;  1S7K A;  1ZG8 A;  4A33 A;  4CPA A;  3PRT A;  3KR5 A;  3B3C A;  3TO9 A;  2F7V A;  1Q7L A;  4MFK A;  4CGM A;  2PJ3 A;  4P44 A;  1YQE A;  3EO4 A;  2PQ8 A;  4P4B A;  4R3L A;  4MCS A;  2B4B A;  2EK9 A;  2RFH A;  3I9S A;  2ZOF A;  4NGN A;  4XPL A;  2JEW A;  1TKJ A;  2P6F A;  3FB3 A;  2ZED A;  3GYA A;  3B3V A;  2AFO A;  4KVX A;  1ELL P;  5AG7 A;  4C7H A;  2C27 A;  2EUI A;  2ARH A;  1XFO A;  3D68 A;  4HNX B;  3CDX A;  3D3S A;  3DSB A;  3EFA A;  4MJ8 A;  1QSR A;  4HPS A;  4NF1 A;  3SXO A;  4M6I A;  1LOK A;  2EO8 A;  7CPA A;  3SJF A;  3SJX A;  2B5G A;  1TF9 A;  4FD5 A;  4Y49 C;  2Z3O A;  3MN8 A;  4AG9 A;  4OC1 A;  4MXU A;  4P6Y A;  3S6K A;  2AFU A;  4UEF A;  4LUA A;  3D7H A;  2R1I A;  1P0H A;  4DJL A;  2DPS A;  3QNV A;  4GM5 A;  2PJ7 A;  1TKH A;  3CPA A;  3WAB A;  4A95 A;  4NSQ A;  2O28 A;  4M3S A;  4K30 A;  1LAN A;  4MBU A;  3JTK A;  1H8L A;  5K8M A;  4NGQ A;  4HNY B;  1BAV A;  2ABZ A;  4CAW A;  4KSA A;  5HXD A;  2ZPA A;  3D7F A;  3TT2 A;  3LAC A;  2Z10 A;  1Z5R A;  4WWV A;  1FY7 A;  2Z3N A;  3SI0 A;  4NJR A;  1YK3 A;  2Q51 A;  1SQH A;  4BIN A;  4K3N A;  1ZG7 A;  5KTD A;  1HEE A;  4MHP A;  4ORF A;  3E0K A;  4PXC A;  4KUA A;  4E2A A;  2ODF A;  1YME A;  1GYT A;  4P4E A;  4EWT A;  4YRH A;  4KOX A;  5C88 A;  3V7Z A;  3S6F A;  4CGL A;  4RI1 A;  4NGT A;  1LAP A;  3BHX A;  4MFZ A;  1I21 A;  1Q2Y A;  3B8G A;  3DNS A;  3HLP A;  2BCO A;  3TX8 A;  2IJZ A;  4B5P B;  4EFD A;  2BO9 A;  3NA6 A;  4I49 A;  1LFW A;  2J8N A;  2PIY A;  3NE7 A;  3P2F A;  4F8Z A;  3V8I A;  3CZX A; 
#chains in the Genus database with same CATH homology
 1NMT A;  3QAH A;  1M4I A;  5H86 A;  1YGH A;  3I3G A;  1N71 A;  4AVC A;  4BBH A;  3TFY A;  4CYN A;  3R9G A;  3ZZI A;  3TOA A;  5A27 A;  4FD4 A;  3G8W A;  4M85 A;  3D2P A;  1XF8 A;  2Z3K A;  1ZO0 A;  1P4N A;  5AG6 A;  1KUX A;  4KOW A;  2QML A;  4B5O A;  2OZG A;  3FRM A;  4KLW A;  5GCN A;  4CGP A;  2WSA A;  2OB0 A;  2B4D B;  4KOV A;  5J8C A;  3R95 A;  2PC1 A;  3W91 A;  1MJB A;  2AE6 A;  2FSR A;  4UCM A;  1PUA A;  2KCW A;  4MFJ A;  3TO6 A;  2RC4 A;  4PV6 A;  1RXT A;  4L89 A;  2Z11 A;  4C2X A;  4PK3 A;  4F0X A;  3IGR A;  4X5K A;  4JD6 A;  2GE3 A;  4UFV A;  2ZW6 A;  4C68 A;  3D2M A;  4AB7 A;  5HMN A;  2Q4Y A;  2REE A;  3K9U A;  2JEV A;  3TE4 A;  3BJ8 A;  2YNC A;  1U6M A;  2B58 A;  4EVY A;  2F5I A;  4UFX A;  4A32 A;  1LRZ A;  2ZXV A;  4C7I A;  2YNE A;  3D8P A;  1CJW A;  4C2Z A;  4PK2 A;  4CAF A;  4HKF A;  4JLY A;  2ZW5 A;  3TOB A;  4NEX A;  3BJ7 A;  2R98 A;  2OZH A;  3LOD A;  2Z0Z A;  2B5G B;  3OWC A;  2R7H A;  1B87 A;  2VZY A;  3FIX A;  2WUU A;  1RO5 A;  4CGO A;  1Y9W A;  4KLV A;  2BEI A;  5G20 A;  4OAD A;  3W6S A;  2Q04 A;  1M1D A;  2R8V A;  4L8A A;  4QBJ A;  1I1D A;  5KTC A;  2VBQ A;  3JUW A;  1WK4 A;  1QSN A;  2CY2 A;  1TIQ A;  3R9F A;  4XNH C;  2PR1 A;  2B4D A;  4MI4 A;  3MGD A;  5I0C A;  3S6G A;  1QST A;  2I00 A;  1Z9U A;  1IIC A;  1MK4 A;  2X7B A;  1YR0 A;  2Q7B A;  4MY3 A;  4CGN A;  4CYO A;  5HH1 A;  3PGP A;  2HQY A;  5JPH A;  3S6H A;  4KOT A;  1Q2D A;  2H5M A;  1R57 A;  4F0Y A;  4Q36 A;  3FYN A;  2PRB A;  2B3U A;  3R96 A;  3CXS A;  3T9Y A;  4R3K A;  1S60 A;  3IWG A;  2DPT A;  4JXR A;  5IX3 A;  2FCK A;  4UCN A;  4LX9 A;  1WWZ A;  2J8R A;  1KUY A;  4HNW B;  2QEC A;  1Y7R A;  4XPK A;  4GS4 A;  1XEB A;  2I79 A;  4J3G A;  3SHP A;  4AG7 A;  2FT0 A;  3FBU A;  3TCV A;  2Q4V A;  2FIW A;  5F47 A;  3EXN A;  1M44 A;  4JXQ A;  3TTH A;  3W6X A;  5J8F A;  1K4J A;  5C82 A;  2B3V A;  4B12 A;  3N7Z A;  3C26 A;  3FXT A;  4AVA A;  2VEZ A;  2ZW4 A;  5F48 A;  1S7F A;  4E8O A;  4UFW A;  2FXF A;  3JVN A;  4JJX A;  3A9L A;  2Y0M A;  4KOY A;  4MFQ A;  2G3A A;  2Z3L A;  4U9Z A;  4KOS A;  5DWM A;  4CRZ B;  2YNC C;  4CAX A;  2VXK A;  3FNC A;  2VI7 A;  1L0C A;  4ZBG A;  4CYQ A;  2P0W A;  3PP9 A;  3SXN A;  3IWE A;  1QSO A;  4DNC A;  3GY9 A;  5IB0 A;  3TO7 A;  1V0C A;  2P6G A;  4U9Y A;  1XIX A;  4KVO E;  5JQ4 A;  5G1Z A;  4YGO A;  4KZT A;  5G21 A;  2GIV A;  5AGE A;  1BOB A;  4FD7 A;  4YFJ A;  2Z3P A;  2JDC A;  2CXA A;  4QB9 A;  2FIA A;  3WR7 A;  3G3S A;  1I12 A;  4UWJ A;  5F49 A;  3VWD A;  4B11 A;  4NXY A;  5H84 A;  3T90 A;  2NMT A;  4R87 A;  2ATR A;  3ZJ0 A;  4AVB A;  4H89 A;  2OU2 A;  5EBV A;  3UY5 A;  3F0A A;  2FE7 A;  4BMH A;  3GKR A;  3IU1 A;  4PSX A;  2AJ6 A;  4MFL A;  4KVM E;  1NSL A;  2D4O A;  3KKW A;  3RYO A;  4NCZ A;  4KSF A;  2VZZ A;  1KUV A;  1Z4E A;  3R9E A;  4ONU A;  1IYL A;  3F8K A;  4B5P A;  4B10 A;  3VWE A;  1IB1 E;  5KTA A;  4MFP A;  2G0B A;  1IYK A;  4H6Z A;  1MJ9 A;  4JWP A;  4IUS A;  4OLL A;  1YX0 A;  4UCP A;  2ZW7 A;  4RS2 A;  2PR8 A;  1ON0 A;  1CM0 A;  1KZF A;  1S7N A;  1GHE A;  2D4P A;  2G3T A;  4C2Y A;  4ZGY B;  4XPD C;  2Q44 A;  3P2H A;  2VQY A;  2HUZ A;  1YRE A;  4UWI A;  2K5T A;  1J4J A;  1NE9 A;  3CXQ A;  2YGW A;  1S7L A;  2PDO A;  1M4G A;  4CS0 B;  5G22 A;  2YND A;  2GAN A;  3QB8 A;  1IID A;  2JDD A;  2A4N A;  4FD6 A;  5E96 A;  4A31 A;  4KOU A;  4A2Z A;  4B14 A;  3IU2 A;  2P6E A;  4MHD A;  4XPD B;  2CNT A;  2OH1 A;  3F5B A;  2Q0Y A;  2REF A;  2Z3M A;  2WPX A;  2J8M A;  4UBR A;  2WPW A;  2OZU A;  3PZJ A;  3LD2 A;  2BL1 A;  2DXQ A;  4CYP A;  4B13 A;  1MJA A;  4MY0 A;  5DWN A;  3DR6 A;  3R1K A;  4CAV A;  4H6U A;  4IF5 A;  3H5Z A;  2FL4 A;  2CNS A;  1XMT A;  5AG5 A;  5IV0 A;  4CRY B;  4OAE A;  2PSW A;  4QUS A;  3EY5 A;  4E0A A;  3CXP A;  1S3Z A;  2CNM A;  4KS9 A;  3H4Q A;  4QVT A;  1Q2C A;  1S5K A;  1XE4 A;  3DR8 A;  1UFH A;  1VHS A;  1YVO A;  3BLN A;  1OZP A;  4QC6 A;  2BSW A;  1VKC A;  2QIR A;  5EC4 A;  4F6A A;  1YLE A;  4II9 A;  1YVK A;  4KUB A;  5ISV A;  5AG4 A;  1BO4 A;  4PSW A;  3DDD A;  4Q38 A;  2EVN A;  2JLM A;  2BUE A;  1QSM A;  5A28 A;  5FVJ A;  4A30 A;  5BWA B;  2HV2 A;  4XNH B;  4UA3 A;  1B6B A;  1PU9 A;  4U5Y A;  4KOR A;  5F46 A;  2FS5 A;  1Y9K A;  2IL4 A;  4Y49 B;  5CNP A;  1Z4R A;  4R57 A;  3EC4 A;  1M4D A;  4R9M A;  4A33 A;  1S7K A;  3TO9 A;  4MFK A;  4CGM A;  3EO4 A;  2PQ8 A;  4R3L A;  2B4B A;  3I9S A;  4XPL A;  3FB3 A;  2P6F A;  3GYA A;  4KVX A;  5AG7 A;  4C7H A;  2C27 A;  2EUI A;  2ARH A;  4HNX B;  3D3S A;  4MJ8 A;  3DSB A;  3EFA A;  4NF1 A;  1QSR A;  3SXO A;  2B5G A;  4FD5 A;  4Y49 C;  2Z3O A;  4AG9 A;  3S6K A;  4LUA A;  2R1I A;  1P0H A;  2DPS A;  4A95 A;  4NSQ A;  2O28 A;  4M3S A;  4K30 A;  4MBU A;  3JTK A;  4HNY B;  4CAW A;  4KSA A;  2ZPA A;  3TT2 A;  2Z10 A;  1FY7 A;  2Z3N A;  1YK3 A;  1SQH A;  5KTD A;  4ORF A;  3E0K A;  4KUA A;  4E2A A;  4YRH A;  4KOX A;  5C88 A;  3S6F A;  4CGL A;  4RI1 A;  4MFZ A;  1I21 A;  1Q2Y A;  3B8G A;  3DNS A;  4B5P B;  4I49 A;  2J8N A;  3NE7 A;  3P2F A;  3V8I A;  4CAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...