2CNMA

Rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with a bisubstrate inhibitor (cterm-arg-arg-phe-tyr-arg-ala-n-alpha- acetyl-s-coa).
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
151
structure length
151
Chain Sequence
MNTISILSTTDLPAAWQIEQRAHAFPWSEKTFFGNQGERYLNLKLTADDRMAAFAITQVVLDEATLFNIAVDPDFQRRGLGRMLLEHLIDELETRGVVTLWLEVRASNAAAIALYESLGFNEATIRRNYYPTAQGHEDAIIMALPISMKLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Rimi from Salmonella Typhimurium Lt2, the Gnat Responsible for N{Alpha}- Acetylation of Ribosomal Protein S18.
pubmed doi rcsb
source organism Salmonella typhimurium lt2
molecule tags Transferase
molecule keywords MODIFICATION OF 30S RIBOSOMAL SUBUNIT PROTEIN S18
total genus 46
structure length 151
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2cnmA00
4UBRA 1M4GA 2Q4YA 1R57A 2HV2A 3FRMA 1Y9WA 3EY5A 1S60A 2VZZA 3I9SA 4PK3A 2VI7A 4U9YA 3N7ZA 4CAXA 2Q44A 3C26A 4JXQA 3TE4A 4QBJA 4MHDA 1P4NA 2P6FA 4KORA 2BSWA 3R9GA 2R1IA 2FS5A 5C82A 4QB9A 3B8GA 1TIQA 1S7FA 2ZW7A 4QC6A 4E0AA 2R8VA 1VHSA 4CAVA 1MK4A 1IB1E 2PRBA 3FIXA 3TFYA 1UFHA 3FBUA 2EUIA 3R1KA 4AB7A 2AJ6A 1BO4A 2CNTA 1M4DA 2ZW6A 3EO4A 2B4DA 4PV6A 5IX3A 2IL4A 4DNCA 2D4PA 4NSQA 3R9EA 4KOSA 1I12A 3I3GA 3P2FA 4KOXA 4KUAA 3DNSA 3GYAA 1S7LA 3BJ7A 2R7HA 4JLYA 3TOAA 2R98A 4M85A 3T9YA 5DWNA 3W6SA 2B4DB 4YFJA 4EVYA 2PR8A 2P6GA 4F6AA 2K5TA 4MY3A 2J8RA 4FD5A 3BLNA 2Q4VA 3DDDA 2J8NA 4R9MA 1M1DA 2QIRA 2Q7BA 1Z4EA 4AG9A 4MI4A 5CNPA 2REFA 3IGRA 4I49A 2FE7A 3TTHA 2CNMA 1QSMA 4B5PA 4CRZB 2FIWA 5FVJA 1KUVA 4L8AA 2RC4A 1IICA 3EFAA 2ZW5A 4HNWB 3QAHA 3T90A 4XPDB 3F8KA 2ZXVA 4HNYB 3MGDA 5C88A 3NE7A 1MJAA 4GS4A 2PQ8A 3JUWA 4B5PB 5IB0A 1YLEA 1RO5A 2WPXA 3FYNA 3FNCA 2JLMA 5H86A 1B6BA 2B5GB 3R95A 2Q04A 1XMTA 2ATRA 2VEZA 1QSRA 4AG7A 2ZPAA 2ZW4A 2B3VA 1YGHA 1B87A 1Q2CA 1GHEA 3P2HA 5EC4A 1KUXA 1XIXA 5KTDA 3DR8A 4KOYA 4JJXA 5KTAA 2REEA 4JD6A 3RYOA 4H6ZA 1S3ZA 4PSXA 4MJ8A 3D2MA 5J8FA 5J8CA 2FCKA 2PSWA 2I00A 1QSTA 1YREA 3SXOA 3W91A 1YVKA 1NSLA 3KKWA 3PGPA 4YRHA 2GANA 4UWIA 3LODA 5I0CA 1XEBA 2VBQA 3DR6A 3G3SA 2JEVA 3EXNA 2FIAA 1N71A 4CS0B 4OAEA 1NE9A 1S5KA 2OZGA 4AVCA 1YK3A 1Y7RA 2CY2A 2QMLA 2FSRA 1Z9UA 2VQYA 2G3AA 2BL1A 1YR0A 4ZBGA 4BMHA 1BOBA 1NMTA 3E0KA 5KTCA 1Q2DA 4E8OA 4MBUA 2OU2A 4Y49C 1FY7A 2B5GA 1OZPA 1Q2YA 4KZTA 2KCWA 1Z4RA 1IIDA 4ONUA 3BJ8A 4LX9A 1S7NA 2CNSA 4UA3A 2F5IA 3S6KA 4X5KA 1YVOA 4NXYA 2VXKA 3UY5A 4RI1A 2Z0ZA 3SXNA 4U5YA 4QVTA 2AE6A 3PP9A 2P6EA 3R96A 2PDOA 2Z10A 2WPWA 1M44A 3G8WA 1M4IA 3F0AA 2H5MA 3R9FA 2OB0A 4YGOA 3D3SA 3VWEA 2Z11A 4R3LA 3S6GA 1P0HA 1VKCA 4H89A 4H6UA 2PR1A 2Q0YA 4JWPA 4E2AA 2OH1A 1J4JA 4KLWA 3TCVA 1MJ9A 4QUSA 5E96A 5JPHA 4XNHC 3TOBA 4FD6A 3CXQA 4FD4A 3JVNA 2VZYA 4Y49B 3TO9A 4U9ZA 5H84A 4ORFA 4M3SA 3H4QA 2EVNA 2BEIA 4R3KA 4J3GA 4IF5A 3EC4A 1CJWA 2NMTA 3W6XA 4AVAA 4OADA 2HUZA 5JQ4A 4FD7A 4R57A 2B4BA 4LUAA 2OZUA 4L89A 4CAWA 4PK2A 3QB8A 4UWJA 4B5OA 4KVOE 4JXRA 2X7BA 2B58A 1U6MA 4K30A 2Y0MA 2OZHA 1QSOA 4HKFA 4KOUA 1KZFA 2HQYA 3TT2A 3ZZIA 2QECA 2DXQA 1WWZA 4MY0A 5F46A 1L0CA 4RS2A 2C27A 3S6HA 3TO7A 4KUBA 1XE4A 1V0CA 3VWDA 4XPLA 1I1DA 2FT0A 3FB3A 2FXFA 2A4NA 5F49A 5GCNA 4XNHB 1MJBA 2GE3A 4NF1A 1IYLA 2P0WA 4KOWA 4OLLA 3OWCA 4KVME 3ZJ0A 3PZJA 2GIVA 1CM0A 1KUYA 3CXPA 3IWGA 1LRZA 3D8PA 1S7KA 3D2PA 1K4JA 4AVBA 5F48A 1WK4A 1IYKA 1Y9KA 1YX0A 3CXSA 3SHPA 1RXTA 4HNXB 3FXTA 3WR7A 4KVXA 3GKRA 5HMNA 3LD2A 4KOTA 5F47A 4XPKA 2J8MA 3S6FA 4R87A 2JDDA 3F5BA 5EBVA 1XF8A 2ARHA 4XPDC 4NCZA 4KOVA 4II9A 1PU9A 3DSBA 4KLVA 5ISVA 1SQHA 2G0BA 3GY9A 1QSNA 4CRYB 1I21A 2FL4A 5DWMA 2G3TA 2O28A 4F0YA 5HH1A 2BUEA 2B3UA 1ON0A 4IUSA 3V8IA 2PC1A 3TO6A 3K9UA 1PUAA 2I79A 2D4OA 5IV0A 4NEXA 4PSWA 2JDCA
chains in the Genus database with same CATH superfamily
4UBRA 1M4GA 2Q4YA 4C2XA 4R76A 1R57A 3FX6A 2HV2A 8CPAA 1FNOA 3FRMA 3KASA 2EWBA 1Y9WA 3EY5A 1S60A 2VZZA 1LOKA 4A31A 1M4LA 4OC0A 5HVHA 2HB6A 4ZI6A 2AFZA 3I9SA 3ISXA 4PK3A 2VI7A 4MFQA 4UCPA 3H5ZA 4U9YA 3N7ZA 2C6PA 1IGBA 4P4JA 4UF4A 4CAXA 3S9LA 1BAVA 1FT7A 4OIDA 3BHXA 4A30A 2Q44A 3C26A 3DLJA 4JXQA 4QBJA 3TE4A 4P44A 4MHDA 1P4NA 2P6FA 3CDXA 4KORA 5IB9A 2BSWA 3R9GA 5K8PA 4R8FA 2R1IA 4DUKA 2PCUA 3IWWA 2FS5A 5C82A 4QB9A 4B14A 3V38A 3B8GA 4B11A 2ZOGA 2WYRA 1TIQA 3WC5A 4FWUA 1S7FA 2ZW7A 4QC6A 4E0AA 4TNUA 2R8VA 1OBRA 2PJ5A 3PB7X 1VHSA 1ELLP 4CAVA 4MFJA 1NSAA 1MK4A 2PJ9A 1IB1E 2JBKA 2PRBA 4YWYA 1CP7A 3FIXA 4OC3A 1EE3P 3TFYA 1CX8A 1UFHA 3FBUA 2EUIA 3JRUA 4UIAA 3R1KA 4P45A 4AB7A 2AJ6A 1BO4A 2ZEMA 4OIWA 2CNTA 1M4DA 3H8FA 4OMEA 4AXVA 2ZW6A 3VWEA 3EO4A 4PXEA 3B3CA 4ZY2A 2B4DA 4PV6A 5IX3A 1Y0RA 2IL4A 4DNCA 4A39A 2D4PA 1HDUA 1QMUA 2AFSA 2ANPA 4NSQA 3R9EA 3PB6X 3KL9A 4KOSA 1I12A 1TF9A 3I3GA 3P2FA 4W9YA 4KOXA 5HVGA 1YSJA 3CZXA 1TF8A 4KUAA 1HEEA 2Q43A 2V77A 2Z3OA 3KHXA 3DNSA 4ZX9A 3B3VA 3GYAA 1S7LA 5G21A 1VIXA 3BJ7A 1CG2A 2R7HA 4JLYA 3TOAA 1VHEA 2R98A 4M85A 4MHYA 5DWNA 3T9YA 1Z8WA 4OC2A 2B4DB 3L2NA 3W6SA 4YFJA 4PXBA 5AG4A 4BINA 4MCSA 2GREA 4EVYA 2PJ2A 2PR8A 3NH4A 4FUUA 2P6GA 4F6AA 4A2ZA 3B3TA 1DTDA 2K5TA 4MY3A 2J8RA 4FD5A 3NFZA 3BLNA 2Q4VA 3DDDA 2J8NA 4R9MA 2ODFA 1M1DA 2QIRA 3IWEA 1IOIA 1Z4EA 2Q7BA 4AG9A 4MCQA 4MI4A 5I4MA 1F2PA 2REFA 4X8IA 2ZEDA 3IGRA 4I49A 5CNPA 2FE7A 3TTHA 1XOVA 2CNMA 3N5FA 1QSMA 1TKJA 2PJ1A 3IIBA 1YMEA 2PJ4A 4B5PA 4CRZB 4ZX8A 2FIWA 2Z3LA 5FVJA 1KUVA 2OOTA 2V8GA 4L8AA 2RC4A 1IICA 4ONWA 4UFXA 3EFAA 4A94A 3D66A 5CPAA 2ZW5A 4HNWB 1PYTB 2CXAA 3IEHA 4MFZA 3QAHA 3T90A 4R6TA 2JEWA 3SJFA 2O53A 5AG7A 4XPDB 2Z3MA 3F8KA 4NJRA 2ZXVA 4HNYB 3MGDA 3WC6A 3KZWA 5C88A 3NE7A 6CPAA 3HUVA 1MJAA 2IMOA 4GS4A 2PQ8A 3JUWA 4B5PB 4ZY1A 5IB0A 1YLEA 2YNEA 2BOAA 3VATA 1RO5A 2WPXA 3FYNA 1DE4C 3FNCA 4OKOA 4FBEA 2JLMA 5LYDA 3CT9A 2XEIA 5H86A 1LFWA 2AFWA 1B6BA 2B5GB 2IJZA 4H2KA 4MRIA 4P4FA 2J9AA 2Q04A 1XMTA 2ATRA 4JYWA 4PPZA 4Q36A 3R95A 4CGNA 3NH5A 2VEZA 4JZ0A 1QSRA 4AG7A 2PVWA 1ZG8A 4F9VA 2ZPAA 2ZW4A 1RTQA 2B3VA 1YGHA 1B87A 4M6IA 4ZY0A 1Q2CA 4UIBA 1GHEA 2Q7SA 3P2HA 3FEEA 5EC4A 2FVGA 1KUXA 1HDQA 4LQ6A 5ELYA 1XIXA 2ZOFA 5AG6A 3VARA 3RAMA 2NYQA 5KTDA 3B3SA 2PJ7A 3DR8A 4KOYA 4JJXA 5KTAA 2CIJA 1A2ZA 2ZEHA 1YW6A 2REEA 2ZELA 3K9TA 4JD6A 1YW4A 4GXHA 4MCPA 3D68A 4H6ZA 3RYOA 1S3ZA 3JTKA 4PSXA 4MJ8A 2DF5A 4DYOA 3PFOA 3D2MA 4OC1A 5J8FA 5J8CA 2DPTA 3D67A 2FCKA 2PSWA 4WWVA 2I00A 4CGMA 1QSTA 1YREA 5JH9A 5LRJA 3SXOA 3BI1A 5G1ZA 2QYVA 4OP4A 2G9DA 2YGWA 3W91A 3DGVA 1YVKA 4NJQA 2PIZA 3KKWA 3PGPA 1NSLA 4YRHA 2GANA 4KSAA 1YQEA 4MFPA 4B6ZA 3SJGA 4UWIA 3LODA 2ZENA 5I0CA 2PJ6A 2EBJA 1XEBA 2VBQA 3DR6A 4P4IA 2F8HA 3G3SA 3RNZA 2JEVA 2PVVA 4NGMA 5HVFA 3EXNA 5THWA 3B2YA 3PB9X 4MHPA 2FIAA 1N71A 4CS0B 1BPMA 3FH4A 4PQAA 2C6CA 4OAEA 1NE9A 2AFMA 5G22A 2XEFA 5K8OA 3NH8A 2CTBA 1S5KA 2OZGA 4AVCA 5JM6A 1YK3A 5A27A 4OC5A 1XRYA 1Y7RA 2CY2A 1F2OA 2QMLA 2ZEGA 2Q4ZA 3NE8A 2FSRA 4UFWA 1Z9UA 2VQYA 2G3AA 5K8MA 1Z8XA 2BL1A 1YR0A 4ZBGA 1ARMA 3KI9A 1TXRA 4BMHA 1BOBA 1CPXA 1NMTA 2NSMA 3E0KA 5KTCA 5LRKA 1Q2DA 4PXDA 2C1CA 4E8OA 4MBUA 2OU2A 2V8DA 4C68A 4M6HA 4UFVA 3LACA 1FY7A 4Y49C 2B5GA 1OZPA 3CPXA 1Q2YA 4EWTA 4EMEA 4KZTA 3S9MA 2KCWA 1Z4RA 1IIDA 4Q38A 4Q7AA 3QNVA 2EK9A 3RBUA 5A28A 4ONUA 2AFOA 3BJ8A 1AMPA 3KQZA 4LX9A 1S7NA 2CNSA 4UA3A 2WSAA 2F5IA 3S6KA 3WABA 4LQGA 2ZEOA 2GU2A 4X5KA 1YVOA 2Q51A 1ELMP 4NXYA 2VXKA 3SI2A 3UY5A 4RI1A 4NGPA 4MHZA 5F09A 1Z8TA 2Z0ZA 4CGPA 3D7DA 3SXNA 3B7IA 4P4BA 4U5YA 4QVTA 4WJBA 2ZEEA 5EMIA 4ZGYB 4B13A 4KSFA 2AE6A 2YNCC 4CGOA 3PP9A 1XMBA 2P6EA 3R96A 2PDOA 2Z10A 2WPWA 4C2ZA 4CYQA 1M44A 3G8WA 2ZEPA 3B35A 3PB8X 4A32A 5LYIA 1M4IA 3KR5A 3F0AA 3V8IA 2H5MA 3R9FA 2OB0A 3BI0A 2O4HA 4C7IA 1XBUA 2GLJA 3D7HA 4YGOA 2PRQA 3D3SA 3ISZA 2Z11A 4R3LA 3S6GA 1P0HA 4X3RA 1VKCA 4H89A 4H6UA 2PR1A 2Q0YA 3SI1A 1GYTA 1Y7EA 4JWPA 1PCAA 1Z8LA 3IJ3A 2EK8A 4MFKA 4E2AA 4BD9A 2BO9A 2OH1A 1J4JA 3WT4A 1Y0YA 4KLWA 4F0XA 1JWQA 3D4UA 3TCVA 1TKFA 1MJ9A 2PE3A 4QUSA 5E96A 4Z65A 5JPHA 4M6GA 4UEFA 3TC8A 1IU8A 4B12A 3FEDA 1KWMA 3CPAA 4XNHC 2I3CA 3KGQA 3TOBA 5J1QA 2HC9A 1IY7A 3T8WA 4EFDA 2XEJA 2JBJA 3FJUA 4FD6A 5CBMA 5JGFA 3CXQA 3IO1A 1Q7LA 4KSIA 3GLJA 4FD4A 4O23A 2PJ3A 3JVNA 1ZO0A 2VZYA 3GUXA 1XFOA 4Y49B 3TO9A 4UEEA 1Z5RA 2AFUA 4U9ZA 4IK2A 4DJLA 3PBBA 5H84A 2F7VA 1VHOA 4A37A 1AUGA 2DEAA 4ORFA 3RO0A 4M3SA 3H4QA 1BLLE 2EVNA 4UEZA 1ZLHA 3FMCA 2BEIA 4R3KA 2IQ6A 4NGQA 4J3GA 4IF5A 1H8LA 1CJWA 2NMTA 3EC4A 3FF3A 3W6XA 4AVAA 4OADA 4P4DA 4YU9A 4BBHA 2HUZA 2PJAA 5JQ4A 4FD7A 4R57A 3FECA 2B4BA 4LUAA 2RB7A 5K8NA 2OZUA 4L89A 4CAWA 4PK2A 4NGRA 2QVPA 3QB8A 4UWJA 4FAIA 4B5OA 1R3NA 3HLPA 2EO8A 4KVOE 2VL1A 2POKA 4JXRA 4PXCA 2YNDA 1UWYA 2X7BA 2B58A 3SI0A 1X10A 2C6GA 3WC7A 4CYNA 1U6MA 4K30A 2Y0MA 2OZHA 4P10A 1QSOA 3H8EA 4HKFA 4P4EA 4CGLA 2WUUA 4KOUA 3SJXA 1KZFA 2HQYA 3TT2A 3I1UA 3ZZIA 5AG5A 5HXDA 1BPNA 2DXQA 2QECA 4IHMA 4RN7A 3VH9A 3QAYA 1WWZA 3FVLA 4MY0A 5F46A 4NGNA 1L0CA 1AYEA 2C27A 4RS2A 5D29A 1X12A 3S6HA 1Z2LA 4MFLA 3TO7A 4KUBA 1XE4A 1V0CA 3VWDA 4XPLA 1I1DA 1LAPA 2PJCA 3H8GA 2FT0A 3FB3A 2FXFA 2A4NA 5F49A 5GCNA 2CTCA 4CAEA 4XNHB 3PBEA 4ZYQA 5AGEA 1TKHA 1MJBA 2GE3A 3A9LA 4X2TA 4NF1A 2GFQA 2PJBA 1IYLA 3KQXA 3PEIA 3GIUA 3IFEA 2P0WA 4C7HA 4KOWA 4OLLA 2PJ0A 1LAMA 3OWCA 3SJEA 5BWAB 3MN8A 4KVME 3ZJ0A 3BXMA 4RUHA 2AFXA 2QJ8A 3PZJA 4MCRA 1ZG7A 2GIVA 1CM0A 4R7MA 3V7ZA 2CF4A 3KHZA 1ZG9A 1ARLA 5LYFA 4CAFA 1KUYA 4NGTA 3CXPA 3GB0A 1LRZA 3D8PA 3IWGA 4A38A 4MHNA 1S7KA 3D2PA 1K4JA 4AVBA 4MXUA 1CBXA 4UCMA 3PB4X 2V8HA 4CYOA 5F48A 4GM5A 5LYLA 4IAVA 1IYKA 1WK4A 1CPSA 1ZLIA 2ZEFA 3IU2A 1Y9KA 1YX0A 3CXSA 3SHPA 1RXTA 4HNXB 1CP6A 2OR4A 4MMOA 3FXTA 3WR7A 4KVXA 1IOFA 3GKRA 5HMNA 1QQ9A 3LMSA 3LD2A 3K2KA 4KOTA 3NA6A 5F47A 5LRGA 4A33A 1YLOA 4XPKA 4KS9A 4HPSA 2J8MA 4UCNA 3S6FA 4R87A 2JDDA 3KR4A 1LCPA 4CYPA 3IC1A 3F5BA 5EBVA 1XF8A 2ABZA 2ARHA 3D7GA 4XPDC 5G20A 2Z3KA 4NCZA 5D8NA 2PIYA 3PFEA 2BCOA 2Z3PA 3D7FA 3MRUA 4KOVA 4P6YA 4TWEA 4CPAA 4NFRA 1PU9A 3DSBA 4KLVA 4F8ZA 2Z3NA 5ISVA 4II9A 1SQHA 2G0BA 2RFHA 4NGSA 2WZNA 3RZAA 2YNCA 3GY9A 1QSNA 3S9NA 4CRYB 3LWUA 4B10A 1F57A 1I21A 2FL4A 3PRTA 4C2YA 5DWMA 2PJ8A 2G3TA 2O28A 4F0YA 4K3NA 3IU1A 5HH1A 4OC4A 4F9UA 2V8VA 2BUEA 2B3UA 1R43A 2XEGA 4G1PA 2DPSA 1ON0A 4IUSA 5DS0A 2PC1A 3TO6A 3K9UA 1XJOA 3TX8A 1PUAA 2GLFA 2D4OA 2I79A 4A95A 3B3WA 1VGYA 1JQGA 7CPAA 5IV0A 4NEXA 4PSWA 1LANA 2JDCA
chains in the Genus database with same CATH topology
4UBRA 1M4GA 2Q4YA 4C2XA 1R57A 2HV2A 3FRMA 1Y9WA 3EY5A 1S60A 2VZZA 4A31A 3I9SA 4PK3A 4UCPA 2VI7A 4MFQA 3H5ZA 4U9YA 3N7ZA 4CAXA 4A30A 2Q44A 3C26A 4JXQA 3TE4A 4QBJA 4MHDA 1P4NA 2P6FA 4KORA 2BSWA 3R9GA 2R1IA 2FS5A 5C82A 4QB9A 4B14A 3B8GA 4B11A 1TIQA 1S7FA 2ZW7A 4QC6A 4E0AA 2R8VA 1VHSA 4CAVA 4MFJA 1MK4A 1IB1E 2PRBA 3FIXA 3TFYA 1UFHA 3FBUA 2EUIA 3R1KA 4AB7A 2AJ6A 1BO4A 2CNTA 1M4DA 2ZW6A 3EO4A 2B4DA 4PV6A 5IX3A 2IL4A 4DNCA 2D4PA 4NSQA 3R9EA 4KOSA 1I12A 3I3GA 3P2FA 4KOXA 4KUAA 2Z3OA 3DNSA 3GYAA 1S7LA 5G21A 3BJ7A 2R7HA 4JLYA 3TOAA 2R98A 4M85A 3T9YA 5DWNA 3W6SA 2B4DB 4YFJA 5AG4A 4EVYA 2PR8A 2P6GA 4F6AA 4A2ZA 2K5TA 4MY3A 2J8RA 4FD5A 3BLNA 2Q4VA 3DDDA 2J8NA 4R9MA 1M1DA 2QIRA 3IWEA 1Z4EA 2Q7BA 4AG9A 4MI4A 5CNPA 2REFA 3IGRA 4I49A 2FE7A 3TTHA 2CNMA 1QSMA 4B5PA 4CRZB 2FIWA 2Z3LA 5FVJA 1KUVA 4L8AA 2RC4A 1IICA 4UFXA 3EFAA 2ZW5A 4HNWB 2CXAA 4MFZA 3QAHA 3T90A 5AG7A 4XPDB 2Z3MA 3F8KA 2ZXVA 4HNYB 3MGDA 5C88A 3NE7A 1MJAA 4GS4A 2PQ8A 3JUWA 4B5PB 5IB0A 1YLEA 2YNEA 1RO5A 2WPXA 3FYNA 3FNCA 2JLMA 5H86A 1B6BA 2B5GB 3R95A 2Q04A 1XMTA 2ATRA 4Q36A 4CGNA 2VEZA 1QSRA 4AG7A 2ZPAA 2ZW4A 2B3VA 1YGHA 1B87A 1Q2CA 1GHEA 3P2HA 5EC4A 1KUXA 1XIXA 5AG6A 5KTDA 3DR8A 4KOYA 4JJXA 5KTAA 2REEA 4JD6A 3RYOA 4H6ZA 1S3ZA 3JTKA 4PSXA 4MJ8A 3D2MA 5J8FA 5J8CA 2DPTA 2FCKA 2PSWA 2I00A 4CGMA 1QSTA 1YREA 3SXOA 5G1ZA 2YGWA 3W91A 1YVKA 1NSLA 3KKWA 3PGPA 4YRHA 2GANA 4KSAA 4MFPA 4UWIA 3LODA 5I0CA 1XEBA 2VBQA 3DR6A 3G3SA 2JEVA 3EXNA 2FIAA 1N71A 4CS0B 4OAEA 1NE9A 5G22A 1S5KA 2OZGA 4AVCA 1YK3A 5A27A 1Y7RA 2CY2A 4UFWA 2QMLA 2FSRA 1Z9UA 2VQYA 2G3AA 2BL1A 1YR0A 4ZBGA 4BMHA 1BOBA 1NMTA 3E0KA 5KTCA 1Q2DA 4E8OA 4MBUA 2OU2A 4C68A 4UFVA 4Y49C 1FY7A 2B5GA 1OZPA 1Q2YA 4KZTA 2KCWA 1Z4RA 1IIDA 4Q38A 5A28A 4ONUA 3BJ8A 4LX9A 1S7NA 2CNSA 4UA3A 2WSAA 2F5IA 3S6KA 4X5KA 1YVOA 4NXYA 2VXKA 3UY5A 4RI1A 2Z0ZA 4CGPA 3SXNA 4U5YA 4QVTA 4ZGYB 4B13A 4KSFA 2AE6A 2YNCC 4CGOA 3PP9A 2P6EA 3R96A 2PDOA 2Z10A 2WPWA 4C2ZA 4CYQA 1M44A 3G8WA 4A32A 1M4IA 3F0AA 2H5MA 3R9FA 2OB0A 4C7IA 4YGOA 3D3SA 3VWEA 2Z11A 4R3LA 3S6GA 1P0HA 1VKCA 4H89A 4H6UA 2PR1A 2Q0YA 4JWPA 4MFKA 4E2AA 2OH1A 1J4JA 4KLWA 4F0XA 3TCVA 1MJ9A 4QUSA 5E96A 5JPHA 4B12A 4XNHC 3TOBA 4FD6A 3CXQA 4FD4A 3JVNA 1ZO0A 2VZYA 4Y49B 3TO9A 4U9ZA 5H84A 4ORFA 4M3SA 3H4QA 2EVNA 2BEIA 4R3KA 4J3GA 4IF5A 3EC4A 1CJWA 2NMTA 3W6XA 4AVAA 4OADA 4BBHA 2HUZA 5JQ4A 4FD7A 4R57A 2B4BA 4LUAA 2OZUA 4L89A 4CAWA 4PK2A 3QB8A 4UWJA 4B5OA 4KVOE 4JXRA 2YNDA 2X7BA 2B58A 4CYNA 1U6MA 4K30A 2Y0MA 2OZHA 1QSOA 4CGLA 4HKFA 2WUUA 4KOUA 1KZFA 2HQYA 3TT2A 3ZZIA 5AG5A 2QECA 2DXQA 1WWZA 4MY0A 5F46A 1L0CA 4RS2A 2C27A 3S6HA 4MFLA 3TO7A 4KUBA 1XE4A 1V0CA 3VWDA 4XPLA 1I1DA 2FT0A 3FB3A 2FXFA 2A4NA 5F49A 5GCNA 4CAEA 4XNHB 5AGEA 1MJBA 2GE3A 3A9LA 4NF1A 1IYLA 2P0WA 4C7HA 4KOWA 4OLLA 3OWCA 5BWAB 4KVME 3ZJ0A 3PZJA 2GIVA 1CM0A 4CAFA 1KUYA 3CXPA 3IWGA 1LRZA 3D8PA 1S7KA 3D2PA 1K4JA 4AVBA 4UCMA 4CYOA 5F48A 1WK4A 1IYKA 3IU2A 1Y9KA 1YX0A 3CXSA 3SHPA 1RXTA 4HNXB 3FXTA 3WR7A 4KVXA 3GKRA 5HMNA 3LD2A 4KOTA 5F47A 4A33A 4XPKA 4KS9A 2J8MA 4UCNA 3S6FA 4R87A 2JDDA 4CYPA 3F5BA 5EBVA 1XF8A 2ARHA 4XPDC 5G20A 2Z3KA 4NCZA 2Z3PA 4KOVA 4II9A 1PU9A 3DSBA 4KLVA 2Z3NA 5ISVA 1SQHA 2G0BA 2YNCA 3GY9A 1QSNA 4CRYB 4B10A 1I21A 2FL4A 4C2YA 5DWMA 2G3TA 2O28A 4F0YA 3IU1A 5HH1A 2BUEA 2B3UA 2DPSA 1ON0A 4IUSA 3V8IA 2PC1A 3TO6A 3K9UA 1PUAA 2I79A 2D4OA 4A95A 5IV0A 4NEXA 4PSWA 2JDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UBR A;  1M4G A;  2Q4Y A;  1R57 A;  2HV2 A;  3FRM A;  1Y9W A;  3EY5 A;  1S60 A;  2VZZ A;  3I9S A;  4PK3 A;  2VI7 A;  4U9Y A;  3N7Z A;  4CAX A;  2Q44 A;  3C26 A;  4JXQ A;  3TE4 A;  4QBJ A;  4MHD A;  1P4N A;  2P6F A;  4KOR A;  2BSW A;  3R9G A;  2R1I A;  2FS5 A;  5C82 A;  4QB9 A;  3B8G A;  1TIQ A;  1S7F A;  2ZW7 A;  4QC6 A;  4E0A A;  2R8V A;  1VHS A;  4CAV A;  1MK4 A;  1IB1 E;  2PRB A;  3FIX A;  3TFY A;  1UFH A;  3FBU A;  2EUI A;  3R1K A;  4AB7 A;  2AJ6 A;  1BO4 A;  2CNT A;  1M4D A;  2ZW6 A;  3EO4 A;  2B4D A;  4PV6 A;  5IX3 A;  2IL4 A;  4DNC A;  2D4P A;  4NSQ A;  3R9E A;  4KOS A;  1I12 A;  3I3G A;  3P2F A;  4KOX A;  4KUA A;  3DNS A;  3GYA A;  1S7L A;  3BJ7 A;  2R7H A;  4JLY A;  3TOA A;  2R98 A;  4M85 A;  3T9Y A;  5DWN A;  3W6S A;  2B4D B;  4YFJ A;  4EVY A;  2PR8 A;  2P6G A;  4F6A A;  2K5T A;  4MY3 A;  2J8R A;  4FD5 A;  3BLN A;  2Q4V A;  3DDD A;  2J8N A;  4R9M A;  1M1D A;  2QIR A;  2Q7B A;  1Z4E A;  4AG9 A;  4MI4 A;  5CNP A;  2REF A;  3IGR A;  4I49 A;  2FE7 A;  3TTH A;  2CNM A;  1QSM A;  4B5P A;  4CRZ B;  2FIW A;  5FVJ A;  1KUV A;  4L8A A;  2RC4 A;  1IIC A;  3EFA A;  2ZW5 A;  4HNW B;  3QAH A;  3T90 A;  4XPD B;  3F8K A;  2ZXV A;  4HNY B;  3MGD A;  5C88 A;  3NE7 A;  1MJA A;  4GS4 A;  2PQ8 A;  3JUW A;  4B5P B;  5IB0 A;  1YLE A;  1RO5 A;  2WPX A;  3FYN A;  3FNC A;  2JLM A;  5H86 A;  1B6B A;  2B5G B;  3R95 A;  2Q04 A;  1XMT A;  2ATR A;  2VEZ A;  1QSR A;  4AG7 A;  2ZPA A;  2ZW4 A;  2B3V A;  1YGH A;  1B87 A;  1Q2C A;  1GHE A;  3P2H A;  5EC4 A;  1KUX A;  1XIX A;  5KTD A;  3DR8 A;  4KOY A;  4JJX A;  5KTA A;  2REE A;  4JD6 A;  3RYO A;  4H6Z A;  1S3Z A;  4PSX A;  4MJ8 A;  3D2M A;  5J8F A;  5J8C A;  2FCK A;  2PSW A;  2I00 A;  1QST A;  1YRE A;  3SXO A;  3W91 A;  1YVK A;  1NSL A;  3KKW A;  3PGP A;  4YRH A;  2GAN A;  4UWI A;  3LOD A;  5I0C A;  1XEB A;  2VBQ A;  3DR6 A;  3G3S A;  2JEV A;  3EXN A;  2FIA A;  1N71 A;  4CS0 B;  4OAE A;  1NE9 A;  1S5K A;  2OZG A;  4AVC A;  1YK3 A;  1Y7R A;  2CY2 A;  2QML A;  2FSR A;  1Z9U A;  2VQY A;  2G3A A;  2BL1 A;  1YR0 A;  4ZBG A;  4BMH A;  1BOB A;  1NMT A;  3E0K A;  5KTC A;  1Q2D A;  4E8O A;  4MBU A;  2OU2 A;  4Y49 C;  1FY7 A;  2B5G A;  1OZP A;  1Q2Y A;  4KZT A;  2KCW A;  1Z4R A;  1IID A;  4ONU A;  3BJ8 A;  4LX9 A;  1S7N A;  2CNS A;  4UA3 A;  2F5I A;  3S6K A;  4X5K A;  1YVO A;  4NXY A;  2VXK A;  3UY5 A;  4RI1 A;  2Z0Z A;  3SXN A;  4U5Y A;  4QVT A;  2AE6 A;  3PP9 A;  2P6E A;  3R96 A;  2PDO A;  2Z10 A;  2WPW A;  1M44 A;  3G8W A;  1M4I A;  3F0A A;  2H5M A;  3R9F A;  2OB0 A;  4YGO A;  3D3S A;  3VWE A;  2Z11 A;  4R3L A;  3S6G A;  1P0H A;  1VKC A;  4H89 A;  4H6U A;  2PR1 A;  2Q0Y A;  4JWP A;  4E2A A;  2OH1 A;  1J4J A;  4KLW A;  3TCV A;  1MJ9 A;  4QUS A;  5E96 A;  5JPH A;  4XNH C;  3TOB A;  4FD6 A;  3CXQ A;  4FD4 A;  3JVN A;  2VZY A;  4Y49 B;  3TO9 A;  4U9Z A;  5H84 A;  4ORF A;  4M3S A;  3H4Q A;  2EVN A;  2BEI A;  4R3K A;  4J3G A;  4IF5 A;  3EC4 A;  1CJW A;  2NMT A;  3W6X A;  4AVA A;  4OAD A;  2HUZ A;  5JQ4 A;  4FD7 A;  4R57 A;  2B4B A;  4LUA A;  2OZU A;  4L89 A;  4CAW A;  4PK2 A;  3QB8 A;  4UWJ A;  4B5O A;  4KVO E;  4JXR A;  2X7B A;  2B58 A;  1U6M A;  4K30 A;  2Y0M A;  2OZH A;  1QSO A;  4HKF A;  4KOU A;  1KZF A;  2HQY A;  3TT2 A;  3ZZI A;  2QEC A;  2DXQ A;  1WWZ A;  4MY0 A;  5F46 A;  1L0C A;  4RS2 A;  2C27 A;  3S6H A;  3TO7 A;  4KUB A;  1XE4 A;  1V0C A;  3VWD A;  4XPL A;  1I1D A;  2FT0 A;  3FB3 A;  2FXF A;  2A4N A;  5F49 A;  5GCN A;  4XNH B;  1MJB A;  2GE3 A;  4NF1 A;  1IYL A;  2P0W A;  4KOW A;  4OLL A;  3OWC A;  4KVM E;  3ZJ0 A;  3PZJ A;  2GIV A;  1CM0 A;  1KUY A;  3CXP A;  3IWG A;  1LRZ A;  3D8P A;  1S7K A;  3D2P A;  1K4J A;  4AVB A;  5F48 A;  1WK4 A;  1IYK A;  1Y9K A;  1YX0 A;  3CXS A;  3SHP A;  1RXT A;  4HNX B;  3FXT A;  3WR7 A;  4KVX A;  3GKR A;  5HMN A;  3LD2 A;  4KOT A;  5F47 A;  4XPK A;  2J8M A;  3S6F A;  4R87 A;  2JDD A;  3F5B A;  5EBV A;  1XF8 A;  2ARH A;  4XPD C;  4NCZ A;  4KOV A;  4II9 A;  1PU9 A;  3DSB A;  4KLV A;  5ISV A;  1SQH A;  2G0B A;  3GY9 A;  1QSN A;  4CRY B;  1I21 A;  2FL4 A;  5DWM A;  2G3T A;  2O28 A;  4F0Y A;  5HH1 A;  2BUE A;  2B3U A;  1ON0 A;  4IUS A;  3V8I A;  2PC1 A;  3TO6 A;  3K9U A;  1PUA A;  2I79 A;  2D4O A;  5IV0 A;  4NEX A;  4PSW A;  2JDC A; 
#chains in the Genus database with same CATH topology
 4UBR A;  1M4G A;  2Q4Y A;  4C2X A;  4R76 A;  1R57 A;  3FX6 A;  2HV2 A;  8CPA A;  1FNO A;  3FRM A;  3KAS A;  2EWB A;  1Y9W A;  3EY5 A;  1S60 A;  2VZZ A;  1LOK A;  4A31 A;  1M4L A;  4OC0 A;  5HVH A;  2HB6 A;  4ZI6 A;  2AFZ A;  3I9S A;  3ISX A;  4PK3 A;  2VI7 A;  4MFQ A;  4UCP A;  3H5Z A;  4U9Y A;  3N7Z A;  2C6P A;  1IGB A;  4P4J A;  4UF4 A;  4CAX A;  3S9L A;  1BAV A;  1FT7 A;  4OID A;  3BHX A;  4A30 A;  2Q44 A;  3C26 A;  3DLJ A;  4JXQ A;  4QBJ A;  3TE4 A;  4P44 A;  4MHD A;  1P4N A;  2P6F A;  3CDX A;  4KOR A;  5IB9 A;  2BSW A;  3R9G A;  5K8P A;  4R8F A;  2R1I A;  4DUK A;  2PCU A;  3IWW A;  2FS5 A;  5C82 A;  4QB9 A;  4B14 A;  3V38 A;  3B8G A;  4B11 A;  2ZOG A;  2WYR A;  1TIQ A;  3WC5 A;  4FWU A;  1S7F A;  2ZW7 A;  4QC6 A;  4E0A A;  4TNU A;  2R8V A;  1OBR A;  2PJ5 A;  3PB7 X;  1VHS A;  1ELL P;  4CAV A;  4MFJ A;  1NSA A;  1MK4 A;  2PJ9 A;  1IB1 E;  2JBK A;  2PRB A;  4YWY A;  1CP7 A;  3FIX A;  4OC3 A;  1EE3 P;  3TFY A;  1CX8 A;  1UFH A;  3FBU A;  2EUI A;  3JRU A;  4UIA A;  3R1K A;  4P45 A;  4AB7 A;  2AJ6 A;  1BO4 A;  2ZEM A;  4OIW A;  2CNT A;  1M4D A;  3H8F A;  4OME A;  4AXV A;  2ZW6 A;  3VWE A;  3EO4 A;  4PXE A;  3B3C A;  4ZY2 A;  2B4D A;  4PV6 A;  5IX3 A;  1Y0R A;  2IL4 A;  4DNC A;  4A39 A;  2D4P A;  1HDU A;  1QMU A;  2AFS A;  2ANP A;  4NSQ A;  3R9E A;  3PB6 X;  3KL9 A;  4KOS A;  1I12 A;  1TF9 A;  3I3G A;  3P2F A;  4W9Y A;  4KOX A;  5HVG A;  1YSJ A;  3CZX A;  1TF8 A;  4KUA A;  1HEE A;  2Q43 A;  2V77 A;  2Z3O A;  3KHX A;  3DNS A;  4ZX9 A;  3B3V A;  3GYA A;  1S7L A;  5G21 A;  1VIX A;  3BJ7 A;  1CG2 A;  2R7H A;  4JLY A;  3TOA A;  1VHE A;  2R98 A;  4M85 A;  4MHY A;  5DWN A;  3T9Y A;  1Z8W A;  4OC2 A;  2B4D B;  3L2N A;  3W6S A;  4YFJ A;  4PXB A;  5AG4 A;  4BIN A;  4MCS A;  2GRE A;  4EVY A;  2PJ2 A;  2PR8 A;  3NH4 A;  4FUU A;  2P6G A;  4F6A A;  4A2Z A;  3B3T A;  1DTD A;  2K5T A;  4MY3 A;  2J8R A;  4FD5 A;  3NFZ A;  3BLN A;  2Q4V A;  3DDD A;  2J8N A;  4R9M A;  2ODF A;  1M1D A;  2QIR A;  3IWE A;  1IOI A;  1Z4E A;  2Q7B A;  4AG9 A;  4MCQ A;  4MI4 A;  5I4M A;  1F2P A;  2REF A;  4X8I A;  2ZED A;  3IGR A;  4I49 A;  5CNP A;  2FE7 A;  3TTH A;  1XOV A;  2CNM A;  3N5F A;  1QSM A;  1TKJ A;  2PJ1 A;  3IIB A;  1YME A;  2PJ4 A;  4B5P A;  4CRZ B;  4ZX8 A;  2FIW A;  2Z3L A;  5FVJ A;  1KUV A;  2OOT A;  2V8G A;  4L8A A;  2RC4 A;  1IIC A;  4ONW A;  4UFX A;  3EFA A;  4A94 A;  3D66 A;  5CPA A;  2ZW5 A;  4HNW B;  1PYT B;  2CXA A;  3IEH A;  4MFZ A;  3QAH A;  3T90 A;  4R6T A;  2JEW A;  3SJF A;  2O53 A;  5AG7 A;  4XPD B;  2Z3M A;  3F8K A;  4NJR A;  2ZXV A;  4HNY B;  3MGD A;  3WC6 A;  3KZW A;  5C88 A;  3NE7 A;  6CPA A;  3HUV A;  1MJA A;  2IMO A;  4GS4 A;  2PQ8 A;  3JUW A;  4B5P B;  4ZY1 A;  5IB0 A;  1YLE A;  2YNE A;  2BOA A;  3VAT A;  1RO5 A;  2WPX A;  3FYN A;  1DE4 C;  3FNC A;  4OKO A;  4FBE A;  2JLM A;  5LYD A;  3CT9 A;  2XEI A;  5H86 A;  1LFW A;  2AFW A;  1B6B A;  2B5G B;  2IJZ A;  4H2K A;  4MRI A;  4P4F A;  2J9A A;  2Q04 A;  1XMT A;  2ATR A;  4JYW A;  4PPZ A;  4Q36 A;  3R95 A;  4CGN A;  3NH5 A;  2VEZ A;  4JZ0 A;  1QSR A;  4AG7 A;  2PVW A;  1ZG8 A;  4F9V A;  2ZPA A;  2ZW4 A;  1RTQ A;  2B3V A;  1YGH A;  1B87 A;  4M6I A;  4ZY0 A;  1Q2C A;  4UIB A;  1GHE A;  2Q7S A;  3P2H A;  3FEE A;  5EC4 A;  2FVG A;  1KUX A;  1HDQ A;  4LQ6 A;  5ELY A;  1XIX A;  2ZOF A;  5AG6 A;  3VAR A;  3RAM A;  2NYQ A;  5KTD A;  3B3S A;  2PJ7 A;  3DR8 A;  4KOY A;  4JJX A;  5KTA A;  2CIJ A;  1A2Z A;  2ZEH A;  1YW6 A;  2REE A;  2ZEL A;  3K9T A;  4JD6 A;  1YW4 A;  4GXH A;  4MCP A;  3D68 A;  4H6Z A;  3RYO A;  1S3Z A;  3JTK A;  4PSX A;  4MJ8 A;  2DF5 A;  4DYO A;  3PFO A;  3D2M A;  4OC1 A;  5J8F A;  5J8C A;  2DPT A;  3D67 A;  2FCK A;  2PSW A;  4WWV A;  2I00 A;  4CGM A;  1QST A;  1YRE A;  5JH9 A;  5LRJ A;  3SXO A;  3BI1 A;  5G1Z A;  2QYV A;  4OP4 A;  2G9D A;  2YGW A;  3W91 A;  3DGV A;  1YVK A;  4NJQ A;  2PIZ A;  3KKW A;  3PGP A;  1NSL A;  4YRH A;  2GAN A;  4KSA A;  1YQE A;  4MFP A;  4B6Z A;  3SJG A;  4UWI A;  3LOD A;  2ZEN A;  5I0C A;  2PJ6 A;  2EBJ A;  1XEB A;  2VBQ A;  3DR6 A;  4P4I A;  2F8H A;  3G3S A;  3RNZ A;  2JEV A;  2PVV A;  4NGM A;  5HVF A;  3EXN A;  5THW A;  3B2Y A;  3PB9 X;  4MHP A;  2FIA A;  1N71 A;  4CS0 B;  1BPM A;  3FH4 A;  4PQA A;  2C6C A;  4OAE A;  1NE9 A;  2AFM A;  5G22 A;  2XEF A;  5K8O A;  3NH8 A;  2CTB A;  1S5K A;  2OZG A;  4AVC A;  5JM6 A;  1YK3 A;  5A27 A;  4OC5 A;  1XRY A;  1Y7R A;  2CY2 A;  1F2O A;  2QML A;  2ZEG A;  2Q4Z A;  3NE8 A;  2FSR A;  4UFW A;  1Z9U A;  2VQY A;  2G3A A;  5K8M A;  1Z8X A;  2BL1 A;  1YR0 A;  4ZBG A;  1ARM A;  3KI9 A;  1TXR A;  4BMH A;  1BOB A;  1CPX A;  1NMT A;  2NSM A;  3E0K A;  5KTC A;  5LRK A;  1Q2D A;  4PXD A;  2C1C A;  4E8O A;  4MBU A;  2OU2 A;  2V8D A;  4C68 A;  4M6H A;  4UFV A;  3LAC A;  1FY7 A;  4Y49 C;  2B5G A;  1OZP A;  3CPX A;  1Q2Y A;  4EWT A;  4EME A;  4KZT A;  3S9M A;  2KCW A;  1Z4R A;  1IID A;  4Q38 A;  4Q7A A;  3QNV A;  2EK9 A;  3RBU A;  5A28 A;  4ONU A;  2AFO A;  3BJ8 A;  1AMP A;  3KQZ A;  4LX9 A;  1S7N A;  2CNS A;  4UA3 A;  2WSA A;  2F5I A;  3S6K A;  3WAB A;  4LQG A;  2ZEO A;  2GU2 A;  4X5K A;  1YVO A;  2Q51 A;  1ELM P;  4NXY A;  2VXK A;  3SI2 A;  3UY5 A;  4RI1 A;  4NGP A;  4MHZ A;  5F09 A;  1Z8T A;  2Z0Z A;  4CGP A;  3D7D A;  3SXN A;  3B7I A;  4P4B A;  4U5Y A;  4QVT A;  4WJB A;  2ZEE A;  5EMI A;  4ZGY B;  4B13 A;  4KSF A;  2AE6 A;  2YNC C;  4CGO A;  3PP9 A;  1XMB A;  2P6E A;  3R96 A;  2PDO A;  2Z10 A;  2WPW A;  4C2Z A;  4CYQ A;  1M44 A;  3G8W A;  2ZEP A;  3B35 A;  3PB8 X;  4A32 A;  5LYI A;  1M4I A;  3KR5 A;  3F0A A;  3V8I A;  2H5M A;  3R9F A;  2OB0 A;  3BI0 A;  2O4H A;  4C7I A;  1XBU A;  2GLJ A;  3D7H A;  4YGO A;  2PRQ A;  3D3S A;  3ISZ A;  2Z11 A;  4R3L A;  3S6G A;  1P0H A;  4X3R A;  1VKC A;  4H89 A;  4H6U A;  2PR1 A;  2Q0Y A;  3SI1 A;  1GYT A;  1Y7E A;  4JWP A;  1PCA A;  1Z8L A;  3IJ3 A;  2EK8 A;  4MFK A;  4E2A A;  4BD9 A;  2BO9 A;  2OH1 A;  1J4J A;  3WT4 A;  1Y0Y A;  4KLW A;  4F0X A;  1JWQ A;  3D4U A;  3TCV A;  1TKF A;  1MJ9 A;  2PE3 A;  4QUS A;  5E96 A;  4Z65 A;  5JPH A;  4M6G A;  4UEF A;  3TC8 A;  1IU8 A;  4B12 A;  3FED A;  1KWM A;  3CPA A;  4XNH C;  2I3C A;  3KGQ A;  3TOB A;  5J1Q A;  2HC9 A;  1IY7 A;  3T8W A;  4EFD A;  2XEJ A;  2JBJ A;  3FJU A;  4FD6 A;  5CBM A;  5JGF A;  3CXQ A;  3IO1 A;  1Q7L A;  4KSI A;  3GLJ A;  4FD4 A;  4O23 A;  2PJ3 A;  3JVN A;  1ZO0 A;  2VZY A;  3GUX A;  1XFO A;  4Y49 B;  3TO9 A;  4UEE A;  1Z5R A;  2AFU A;  4U9Z A;  4IK2 A;  4DJL A;  3PBB A;  5H84 A;  2F7V A;  1VHO A;  4A37 A;  1AUG A;  2DEA A;  4ORF A;  3RO0 A;  4M3S A;  3H4Q A;  1BLL E;  2EVN A;  4UEZ A;  1ZLH A;  3FMC A;  2BEI A;  4R3K A;  2IQ6 A;  4NGQ A;  4J3G A;  4IF5 A;  1H8L A;  1CJW A;  2NMT A;  3EC4 A;  3FF3 A;  3W6X A;  4AVA A;  4OAD A;  4P4D A;  4YU9 A;  4BBH A;  2HUZ A;  2PJA A;  5JQ4 A;  4FD7 A;  4R57 A;  3FEC A;  2B4B A;  4LUA A;  2RB7 A;  5K8N A;  2OZU A;  4L89 A;  4CAW A;  4PK2 A;  4NGR A;  2QVP A;  3QB8 A;  4UWJ A;  4FAI A;  4B5O A;  1R3N A;  3HLP A;  2EO8 A;  4KVO E;  2VL1 A;  2POK A;  4JXR A;  4PXC A;  2YND A;  1UWY A;  2X7B A;  2B58 A;  3SI0 A;  1X10 A;  2C6G A;  3WC7 A;  4CYN A;  1U6M A;  4K30 A;  2Y0M A;  2OZH A;  4P10 A;  1QSO A;  3H8E A;  4HKF A;  4P4E A;  4CGL A;  2WUU A;  4KOU A;  3SJX A;  1KZF A;  2HQY A;  3TT2 A;  3I1U A;  3ZZI A;  5AG5 A;  5HXD A;  1BPN A;  2DXQ A;  2QEC A;  4IHM A;  4RN7 A;  3VH9 A;  3QAY A;  1WWZ A;  3FVL A;  4MY0 A;  5F46 A;  4NGN A;  1L0C A;  1AYE A;  2C27 A;  4RS2 A;  5D29 A;  1X12 A;  3S6H A;  1Z2L A;  4MFL A;  3TO7 A;  4KUB A;  1XE4 A;  1V0C A;  3VWD A;  4XPL A;  1I1D A;  1LAP A;  2PJC A;  3H8G A;  2FT0 A;  3FB3 A;  2FXF A;  2A4N A;  5F49 A;  5GCN A;  2CTC A;  4CAE A;  4XNH B;  3PBE A;  4ZYQ A;  5AGE A;  1TKH A;  1MJB A;  2GE3 A;  3A9L A;  4X2T A;  4NF1 A;  2GFQ A;  2PJB A;  1IYL A;  3KQX A;  3PEI A;  3GIU A;  3IFE A;  2P0W A;  4C7H A;  4KOW A;  4OLL A;  2PJ0 A;  1LAM A;  3OWC A;  3SJE A;  5BWA B;  3MN8 A;  4KVM E;  3ZJ0 A;  3BXM A;  4RUH A;  2AFX A;  2QJ8 A;  3PZJ A;  4MCR A;  1ZG7 A;  2GIV A;  1CM0 A;  4R7M A;  3V7Z A;  2CF4 A;  3KHZ A;  1ZG9 A;  1ARL A;  5LYF A;  4CAF A;  1KUY A;  4NGT A;  3CXP A;  3GB0 A;  1LRZ A;  3D8P A;  3IWG A;  4A38 A;  4MHN A;  1S7K A;  3D2P A;  1K4J A;  4AVB A;  4MXU A;  1CBX A;  4UCM A;  3PB4 X;  2V8H A;  4CYO A;  5F48 A;  4GM5 A;  5LYL A;  4IAV A;  1IYK A;  1WK4 A;  1CPS A;  1ZLI A;  2ZEF A;  3IU2 A;  1Y9K A;  1YX0 A;  3CXS A;  3SHP A;  1RXT A;  4HNX B;  1CP6 A;  2OR4 A;  4MMO A;  3FXT A;  3WR7 A;  4KVX A;  1IOF A;  3GKR A;  5HMN A;  1QQ9 A;  3LMS A;  3LD2 A;  3K2K A;  4KOT A;  3NA6 A;  5F47 A;  5LRG A;  4A33 A;  1YLO A;  4XPK A;  4KS9 A;  4HPS A;  2J8M A;  4UCN A;  3S6F A;  4R87 A;  2JDD A;  3KR4 A;  1LCP A;  4CYP A;  3IC1 A;  3F5B A;  5EBV A;  1XF8 A;  2ABZ A;  2ARH A;  3D7G A;  4XPD C;  5G20 A;  2Z3K A;  4NCZ A;  5D8N A;  2PIY A;  3PFE A;  2BCO A;  2Z3P A;  3D7F A;  3MRU A;  4KOV A;  4P6Y A;  4TWE A;  4CPA A;  4NFR A;  1PU9 A;  3DSB A;  4KLV A;  4F8Z A;  2Z3N A;  5ISV A;  4II9 A;  1SQH A;  2G0B A;  2RFH A;  4NGS A;  2WZN A;  3RZA A;  2YNC A;  3GY9 A;  1QSN A;  3S9N A;  4CRY B;  3LWU A;  4B10 A;  1F57 A;  1I21 A;  2FL4 A;  3PRT A;  4C2Y A;  5DWM A;  2PJ8 A;  2G3T A;  2O28 A;  4F0Y A;  4K3N A;  3IU1 A;  5HH1 A;  4OC4 A;  4F9U A;  2V8V A;  2BUE A;  2B3U A;  1R43 A;  2XEG A;  4G1P A;  2DPS A;  1ON0 A;  4IUS A;  5DS0 A;  2PC1 A;  3TO6 A;  3K9U A;  1XJO A;  3TX8 A;  1PUA A;  2GLF A;  2D4O A;  2I79 A;  4A95 A;  3B3W A;  1VGY A;  1JQG A;  7CPA A;  5IV0 A;  4NEX A;  4PSW A;  1LAN A;  2JDC A; 
#chains in the Genus database with same CATH homology
 4UBR A;  1M4G A;  2Q4Y A;  4C2X A;  1R57 A;  2HV2 A;  3FRM A;  1Y9W A;  3EY5 A;  1S60 A;  2VZZ A;  4A31 A;  3I9S A;  4PK3 A;  4UCP A;  2VI7 A;  4MFQ A;  3H5Z A;  4U9Y A;  3N7Z A;  4CAX A;  4A30 A;  2Q44 A;  3C26 A;  4JXQ A;  3TE4 A;  4QBJ A;  4MHD A;  1P4N A;  2P6F A;  4KOR A;  2BSW A;  3R9G A;  2R1I A;  2FS5 A;  5C82 A;  4QB9 A;  4B14 A;  3B8G A;  4B11 A;  1TIQ A;  1S7F A;  2ZW7 A;  4QC6 A;  4E0A A;  2R8V A;  1VHS A;  4CAV A;  4MFJ A;  1MK4 A;  1IB1 E;  2PRB A;  3FIX A;  3TFY A;  1UFH A;  3FBU A;  2EUI A;  3R1K A;  4AB7 A;  2AJ6 A;  1BO4 A;  2CNT A;  1M4D A;  2ZW6 A;  3EO4 A;  2B4D A;  4PV6 A;  5IX3 A;  2IL4 A;  4DNC A;  2D4P A;  4NSQ A;  3R9E A;  4KOS A;  1I12 A;  3I3G A;  3P2F A;  4KOX A;  4KUA A;  2Z3O A;  3DNS A;  3GYA A;  1S7L A;  5G21 A;  3BJ7 A;  2R7H A;  4JLY A;  3TOA A;  2R98 A;  4M85 A;  3T9Y A;  5DWN A;  3W6S A;  2B4D B;  4YFJ A;  5AG4 A;  4EVY A;  2PR8 A;  2P6G A;  4F6A A;  4A2Z A;  2K5T A;  4MY3 A;  2J8R A;  4FD5 A;  3BLN A;  2Q4V A;  3DDD A;  2J8N A;  4R9M A;  1M1D A;  2QIR A;  3IWE A;  1Z4E A;  2Q7B A;  4AG9 A;  4MI4 A;  5CNP A;  2REF A;  3IGR A;  4I49 A;  2FE7 A;  3TTH A;  2CNM A;  1QSM A;  4B5P A;  4CRZ B;  2FIW A;  2Z3L A;  5FVJ A;  1KUV A;  4L8A A;  2RC4 A;  1IIC A;  4UFX A;  3EFA A;  2ZW5 A;  4HNW B;  2CXA A;  4MFZ A;  3QAH A;  3T90 A;  5AG7 A;  4XPD B;  2Z3M A;  3F8K A;  2ZXV A;  4HNY B;  3MGD A;  5C88 A;  3NE7 A;  1MJA A;  4GS4 A;  2PQ8 A;  3JUW A;  4B5P B;  5IB0 A;  1YLE A;  2YNE A;  1RO5 A;  2WPX A;  3FYN A;  3FNC A;  2JLM A;  5H86 A;  1B6B A;  2B5G B;  3R95 A;  2Q04 A;  1XMT A;  2ATR A;  4Q36 A;  4CGN A;  2VEZ A;  1QSR A;  4AG7 A;  2ZPA A;  2ZW4 A;  2B3V A;  1YGH A;  1B87 A;  1Q2C A;  1GHE A;  3P2H A;  5EC4 A;  1KUX A;  1XIX A;  5AG6 A;  5KTD A;  3DR8 A;  4KOY A;  4JJX A;  5KTA A;  2REE A;  4JD6 A;  3RYO A;  4H6Z A;  1S3Z A;  3JTK A;  4PSX A;  4MJ8 A;  3D2M A;  5J8F A;  5J8C A;  2DPT A;  2FCK A;  2PSW A;  2I00 A;  4CGM A;  1QST A;  1YRE A;  3SXO A;  5G1Z A;  2YGW A;  3W91 A;  1YVK A;  1NSL A;  3KKW A;  3PGP A;  4YRH A;  2GAN A;  4KSA A;  4MFP A;  4UWI A;  3LOD A;  5I0C A;  1XEB A;  2VBQ A;  3DR6 A;  3G3S A;  2JEV A;  3EXN A;  2FIA A;  1N71 A;  4CS0 B;  4OAE A;  1NE9 A;  5G22 A;  1S5K A;  2OZG A;  4AVC A;  1YK3 A;  5A27 A;  1Y7R A;  2CY2 A;  4UFW A;  2QML A;  2FSR A;  1Z9U A;  2VQY A;  2G3A A;  2BL1 A;  1YR0 A;  4ZBG A;  4BMH A;  1BOB A;  1NMT A;  3E0K A;  5KTC A;  1Q2D A;  4E8O A;  4MBU A;  2OU2 A;  4C68 A;  4UFV A;  4Y49 C;  1FY7 A;  2B5G A;  1OZP A;  1Q2Y A;  4KZT A;  2KCW A;  1Z4R A;  1IID A;  4Q38 A;  5A28 A;  4ONU A;  3BJ8 A;  4LX9 A;  1S7N A;  2CNS A;  4UA3 A;  2WSA A;  2F5I A;  3S6K A;  4X5K A;  1YVO A;  4NXY A;  2VXK A;  3UY5 A;  4RI1 A;  2Z0Z A;  4CGP A;  3SXN A;  4U5Y A;  4QVT A;  4ZGY B;  4B13 A;  4KSF A;  2AE6 A;  2YNC C;  4CGO A;  3PP9 A;  2P6E A;  3R96 A;  2PDO A;  2Z10 A;  2WPW A;  4C2Z A;  4CYQ A;  1M44 A;  3G8W A;  4A32 A;  1M4I A;  3F0A A;  2H5M A;  3R9F A;  2OB0 A;  4C7I A;  4YGO A;  3D3S A;  3VWE A;  2Z11 A;  4R3L A;  3S6G A;  1P0H A;  1VKC A;  4H89 A;  4H6U A;  2PR1 A;  2Q0Y A;  4JWP A;  4MFK A;  4E2A A;  2OH1 A;  1J4J A;  4KLW A;  4F0X A;  3TCV A;  1MJ9 A;  4QUS A;  5E96 A;  5JPH A;  4B12 A;  4XNH C;  3TOB A;  4FD6 A;  3CXQ A;  4FD4 A;  3JVN A;  1ZO0 A;  2VZY A;  4Y49 B;  3TO9 A;  4U9Z A;  5H84 A;  4ORF A;  4M3S A;  3H4Q A;  2EVN A;  2BEI A;  4R3K A;  4J3G A;  4IF5 A;  3EC4 A;  1CJW A;  2NMT A;  3W6X A;  4AVA A;  4OAD A;  4BBH A;  2HUZ A;  5JQ4 A;  4FD7 A;  4R57 A;  2B4B A;  4LUA A;  2OZU A;  4L89 A;  4CAW A;  4PK2 A;  3QB8 A;  4UWJ A;  4B5O A;  4KVO E;  4JXR A;  2YND A;  2X7B A;  2B58 A;  4CYN A;  1U6M A;  4K30 A;  2Y0M A;  2OZH A;  1QSO A;  4CGL A;  4HKF A;  2WUU A;  4KOU A;  1KZF A;  2HQY A;  3TT2 A;  3ZZI A;  5AG5 A;  2QEC A;  2DXQ A;  1WWZ A;  4MY0 A;  5F46 A;  1L0C A;  4RS2 A;  2C27 A;  3S6H A;  4MFL A;  3TO7 A;  4KUB A;  1XE4 A;  1V0C A;  3VWD A;  4XPL A;  1I1D A;  2FT0 A;  3FB3 A;  2FXF A;  2A4N A;  5F49 A;  5GCN A;  4CAE A;  4XNH B;  5AGE A;  1MJB A;  2GE3 A;  3A9L A;  4NF1 A;  1IYL A;  2P0W A;  4C7H A;  4KOW A;  4OLL A;  3OWC A;  5BWA B;  4KVM E;  3ZJ0 A;  3PZJ A;  2GIV A;  1CM0 A;  4CAF A;  1KUY A;  3CXP A;  3IWG A;  1LRZ A;  3D8P A;  1S7K A;  3D2P A;  1K4J A;  4AVB A;  4UCM A;  4CYO A;  5F48 A;  1WK4 A;  1IYK A;  3IU2 A;  1Y9K A;  1YX0 A;  3CXS A;  3SHP A;  1RXT A;  4HNX B;  3FXT A;  3WR7 A;  4KVX A;  3GKR A;  5HMN A;  3LD2 A;  4KOT A;  5F47 A;  4A33 A;  4XPK A;  4KS9 A;  2J8M A;  4UCN A;  3S6F A;  4R87 A;  2JDD A;  4CYP A;  3F5B A;  5EBV A;  1XF8 A;  2ARH A;  4XPD C;  5G20 A;  2Z3K A;  4NCZ A;  2Z3P A;  4KOV A;  4II9 A;  1PU9 A;  3DSB A;  4KLV A;  2Z3N A;  5ISV A;  1SQH A;  2G0B A;  2YNC A;  3GY9 A;  1QSN A;  4CRY B;  4B10 A;  1I21 A;  2FL4 A;  4C2Y A;  5DWM A;  2G3T A;  2O28 A;  4F0Y A;  3IU1 A;  5HH1 A;  2BUE A;  2B3U A;  2DPS A;  1ON0 A;  4IUS A;  3V8I A;  2PC1 A;  3TO6 A;  3K9U A;  1PUA A;  2I79 A;  2D4O A;  4A95 A;  5IV0 A;  4NEX A;  4PSW A;  2JDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...