2CNMA

Rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with a bisubstrate inhibitor (cterm-arg-arg-phe-tyr-arg-ala-n-alpha- acetyl-s-coa).
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
151
structure length
151
Chain Sequence
b'MNTISILSTTDLPAAWQIEQRAHAFPWSEKTFFGNQGERYLNLKLTADDRMAAFAITQVVLDEATLFNIAVDPDFQRRGLGRMLLEHLIDELETRGVVTLWLEVRASNAAAIALYESLGFNEATIRRNYYPTAQGHEDAIIMALPISMKLH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODIFICATION OF 30S RIBOSOMAL SUBUNIT PROTEIN S18
molecule tags Transferase
source organism Salmonella typhimurium lt2
publication title Crystal Structure of Rimi from Salmonella Typhimurium Lt2, the Gnat Responsible for N{Alpha}- Acetylation of Ribosomal Protein S18.
pubmed doi rcsb
total genus 46
structure length 151
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2cnmA00
3QB8A 2ATRA 3OWCA 4OAEA 4UWJA 4CRZB 5J8FA 2OZGA 4KVXA 5IV0A 2Z0ZA 1XIXA 4GS4A 5J8CA 5KTCA 4E8OA 4B5OA 2HQYA 2VBQA 2JDDA 3F0AA 1RO5A 4XPKA 4MY3A 1XMTA 4QC6A 1S7NA 2REFA 3D8PA 4DNCA 4Y49B 3RYOA 2ARHA 2FT0A 2QMLA 2ZW4A 2REEA 3R9GA 1QSOA 1CJWA 4YGOA 2Q04A 2G3TA 1YR0A 4B5PB 3G8WA 4L8AA 1PUAA 4JD6A 1KUXA 3LD2A 4H6ZA 3H4QA 1J4JA 4NCZA 3G3SA 5EC4A 4XPDC 3QAHA 4MJ8A 4XNHC 5KTDA 3FNCA 3E0KA 2FS5A 2Q7BA 4RI1A 3CXSA 2VI7A 3TO7A 4KOWA 1YVOA 2Y0MA 5IX3A 5I0CA 1S3ZA 2B4BA 2PDOA 4MHDA 3TE4A 2G3AA 3JUWA 3R95A 5JPHA 3F8KA 2KCWA 2WPXA 5DWNA 4U9YA 4KOUA 3PGPA 1Q2YA 1Q2DA 3D3SA 2AJ6A 4E0AA 1MK4A 3FBUA 2P0WA 4JWPA 4OADA 4HNYB 3S6GA 2PRBA 3PZJA 4MY0A 4NXYA 2A4NA 4K30A 4HKFA 3SXOA 1MJ9A 4KOVA 2CNMA 1I1DA 2BEIA 1GHEA 3FRMA 5F46A 4AG9A 1R57A 3N7ZA 4CAWA 1IIDA 4F0YA 2R98A 3GKRA 3WR7A 1OZPA 3DR6A 1Y9WA 3W91A 3S6FA 1XEBA 5EBVA 4R3KA 5F49A 1YVKA 1YX0A 3TTHA 4CS0B 4YFJA 5HH1A 3DSBA 2P6GA 4FD4A 4KUAA 3ZJ0A 4JJXA 2ZXVA 4YRHA 3BJ7A 5DWMA 3MGDA 3W6XA 1P4NA 2Q4YA 3DR8A 2BL1A 4AVAA 4R57A 1YGHA 1VHSA 4HNWB 2JEVA 1B87A 3GY9A 1S5KA 2J8NA 1BO4A 3P2HA 5E96A 4L89A 4MBUA 4X5KA 1QSMA 3EC4A 4UA3A 3I3GA 4LX9A 1K4JA 2CNSA 3D2PA 4KVME 1IB1E 4Y49C 3UY5A 2OU2A 2VZZA 3SHPA 2OB0A 4KOXA 4FD6A 1M4GA 2B4DB 1YREA 4AG7A 2EUIA 4XNHB 2X7BA 4XPDB 2NMTA 3SXNA 1MJAA 1BOBA 3FXTA 3DNSA 5C82A 2B3UA 4E2AA 3TO9A 5GCNA 4JXQA 1FY7A 2DXQA 3NE7A 1PU9A 2PQ8A 5C88A 4U9ZA 2B4DA 3EY5A 4FD5A 4KOTA 3F5BA 2FXFA 2I00A 4PK3A 1I12A 2FL4A 3CXPA 1Q2CA 1WK4A 1ON0A 4J3GA 2OZUA 2Q4VA 2Q0YA 2VXKA 5HMNA 2EVNA 3K9UA 3EXNA 1UFHA 2J8RA 4BMHA 2PR8A 3S6KA 2OZHA 2P6FA 2PC1A 1TIQA 3P2FA 2FSRA 1M4IA 4KLWA 3GYAA 4QB9A 5CNPA 4PSWA 2PR1A 4U5YA 1M1DA 4OLLA 4R9MA 1M44A 4R3LA 2HV2A 1XE4A 1YK3A 2VQYA 1IYKA 4JXRA 4KLVA 4FD7A 1B6BA 2OH1A 2F5IA 1P0HA 1S60A 2JDCA 2B58A 4KUBA 1QSTA 3R9EA 1NE9A 4AVCA 3TOBA 3IGRA 1XF8A 2CY2A 2ZW7A 3R1KA 2FCKA 4RS2A 3BJ8A 3TCVA 2AE6A 2GANA 2R8VA 2JLMA 4KORA 2GE3A 2ZW6A 2CNTA 1QSNA 4B5PA 2FIWA 3B8GA 3R9FA 2D4OA 4IUSA 2VZYA 2ZW5A 4NF1A 3VWEA 4KZTA 1V0CA 4R87A 2HUZA 3D2MA 3R96A 1KUYA 2QECA 5H84A 5F48A 1Z9UA 3EO4A 4LUAA 3BLNA 2BUEA 2FIAA 4M85A 3PP9A 2B3VA 3VWDA 5FVJA 4ORFA 1SQHA 1Z4EA 2B5GB 4IF5A 1MJBA 5ISVA 2O28A 5F47A 4ZBGA 3C26A 2IL4A 2R1IA 1Y9KA 3TT2A 1I21A 3IWGA 3TFYA 1N71A 5KTAA 1L0CA 4KOYA 1VKCA 1CM0A 2Z10A 4JLYA 1U6MA 3T9YA 1IYLA 4UBRA 4KOSA 3V8IA 3TO6A 4QBJA 4EVYA 4M3SA 3S6HA 5JQ4A 1KZFA 3FIXA 2BSWA 3W6SA 4II9A 2R7HA 1S7KA 1M4DA 2P6EA 4AVBA 2B5GA 4CAXA 1KUVA 1S7LA 5IB0A 4XPLA 3KKWA 4PK2A 4PSXA 2C27A 4CAVA 1NSLA 3CXQA 4ONUA 2J8MA 2PSWA 3ZZIA 3FB3A 2D4PA 5H86A 4F6AA 1S7FA 2I79A 2QIRA 2H5MA 1NMTA 4UWIA 4HNXB 1RXTA 3T90A 4CRYB 4QVTA 4KVOE 1Z4RA 4H6UA 2ZPAA 4PV6A 2GIVA 1YLEA 3LODA 3DDDA 4AB7A 2RC4A 1IICA 2FE7A 2G0BA 4NEXA 1Y7RA 2VEZA 4QUSA 2K5TA 3JVNA 3I9SA 4H89A 1QSRA 2WPWA 4NSQA 3FYNA 2Q44A 1WWZA 4I49A 3EFAA 4MI4A 3TOAA 1LRZA 2Z11A
chains in the Genus database with same CATH superfamily
2IMOA 4JYWA 4OC1A 2PE3A 3IWWA 3QB8A 2ATRA 1Z2LA 3B3SA 3OWCA 4OAEA 4UWJA 4MFLA 4CRZB 5J8FA 2OZGA 4KVXA 3B3TA 4P4JA 4MHPA 2O4HA 4F8ZA 5IV0A 2YNEA 3LWUA 2Z0ZA 1XIXA 4GS4A 5J8CA 3NE8A 5KTCA 1IOIA 1NSAA 4E8OA 3B2YA 1F2PA 4OC2A 4A32A 1TKJA 2HQYA 4KSIA 4B5OA 2VBQA 3SI0A 3D7GA 2JDDA 3A9LA 3F0AA 1DE4C 3CT9A 1RO5A 3QNVA 4XPKA 4R8FA 3K2KA 3WC5A 1ELLP 4MY3A 1XMTA 4QC6A 1S7NA 2REFA 4P4BA 3IO1A 3D8PA 1XOVA 1KWMA 4DNCA 4PPZA 1HDQA 4Y49B 3RYOA 2ARHA 5CBMA 2FT0A 2QMLA 2ZW4A 1BPNA 2FVGA 3CPXA 4MCQA 4ZX8A 2V8VA 4P44A 5D8NA 5D29A 6CPAA 3S9NA 7CPAA 1RTQA 2REEA 3R9GA 1QSOA 1CJWA 2XEGA 4YGOA 2Q04A 4CAEA 2G3TA 1XBUA 1YR0A 1LOKA 3FH4A 3VARA 4B5PB 3DLJA 4MFZA 2O53A 3G8WA 4L8AA 4UFXA 4C2XA 1PUAA 3SJEA 4JD6A 1KUXA 3FEEA 3LD2A 4TNUA 4H6ZA 1ZLHA 3H4QA 2C1CA 4KSAA 1J4JA 3H8EA 4DJLA 4NCZA 3G3SA 1LCPA 1ELMP 4XPDC 3QAHA 5EC4A 2PVWA 4K3NA 4MJ8A 5LRJA 4IAVA 4UCNA 4XNHC 5ELYA 4F0XA 3FNCA 4BINA 5KTDA 4MFPA 3E0KA 4X8IA 2FS5A 3V38A 3D66A 2Q7BA 5F09A 4RI1A 2ZEEA 3CXSA 1QMUA 1XJOA 1Y7EA 2VI7A 3TO7A 4KOWA 4C68A 1YVOA 2Y0MA 2BOAA 5IX3A 2J9AA 5I0CA 3NH5A 1S3ZA 2B4BA 2PDOA 4MHDA 3TE4A 2G3AA 3JUWA 3R95A 3KHXA 3L2NA 3F8KA 5JPHA 2KCWA 2WPXA 5DWNA 2IJZA 3K9TA 4U9YA 1Y0YA 4KOUA 3PGPA 3IEHA 1YLOA 4EFDA 4M6GA 2WZNA 1BLLE 2AFUA 4MCSA 1Q2YA 1Q2DA 2PJ9A 2AJ6A 3D3SA 2ZEHA 1MK4A 4E0AA 3FBUA 1IOFA 2PJBA 2P0WA 4PXDA 5K8OA 3B7IA 1QQ9A 4MXUA 4YWYA 4JWPA 1X10A 4OADA 4HNYB 1CP7A 4PXBA 3S6GA 2PRBA 2ZOFA 5LYFA 3IU1A 3PZJA 4MY0A 2RFHA 4KSFA 4NXYA 2A4NA 2ZOGA 1YW6A 4MCRA 4C7HA 1BAVA 5LYIA 4K30A 3PEIA 3H8GA 4HKFA 4FWUA 4O23A 4NGRA 3SXOA 3PB4X 2EWBA 3KR4A 1MJ9A 2CNMA 4KOVA 1I1DA 4Q38A 4Q36A 4UCMA 3SI1A 2BEIA 5G21A 5BWAB 1GHEA 2XEFA 3FRMA 2DEAA 5K8NA 3NH8A 5F46A 4AG9A 1R57A 1ZG8A 3N7ZA 4ONWA 4CAWA 1IIDA 4F0YA 4NGPA 2R98A 3RAMA 4A95A 1DTDA 2NYQA 3GKRA 3WR7A 1OZPA 3DR6A 2DPTA 1Y9WA 3KR5A 2ZEPA 3W91A 3S6FA 1XEBA 5EBVA 4WJBA 4R3KA 4Q7AA 3ISXA 4NGNA 3FEDA 1XFOA 4AXVA 5F49A 3WC7A 2Z3KA 1YVKA 1YX0A 3KQXA 4ZX9A 4MFQA 3S9MA 3TTHA 4CS0B 4YFJA 4ZY2A 4BD9A 2ZEGA 1CBXA 5HH1A 3DSBA 2P6GA 4X3RA 4FD4A 4KUAA 1CX8A 3ZJ0A 3IFEA 1F57A 2ZXVA 4JJXA 4P4FA 4B13A 1LFWA 5EMIA 3KL9A 4FAIA 1VGYA 3BJ7A 4YRHA 5DWMA 3TC8A 1A2ZA 1IGBA 3FECA 4JZ0A 3MGDA 2ZEOA 4DYOA 2ZEDA 3W6XA 1P4NA 2Q4YA 3DR8A 2BL1A 3KHZA 3B3CA 4AVAA 4R57A 1LANA 3V7ZA 1YGHA 1VHSA 3D67A 4HNWB 5A27A 2JEVA 1B87A 2CF4A 4ZI6A 3GY9A 2CXAA 2Q43A 1S5KA 3KI9A 2J8NA 1BO4A 1F2OA 2ABZA 3P2HA 5E96A 1AUGA 4L89A 4MBUA 4GXHA 4OP4A 4C2YA 4X5KA 5LYLA 3IIBA 1QSMA 2V77A 3EC4A 4UA3A 4A30A 3I3GA 4GM5A 4LX9A 1K4JA 2CNSA 4OIWA 1YQEA 3D2PA 4KVME 3IU2A 2EK8A 1IB1E 5AG7A 4Y49C 3UY5A 5LRKA 5HXDA 4FUUA 2HB6A 2OU2A 2Z3NA 3PB8X 2VZZA 2PJ4A 3SHPA 2OB0A 4OMEA 4KOXA 4FD6A 2PIZA 3FJUA 1M4GA 2OR4A 2DPSA 2C6GA 4M6HA 4UIBA 2B4DB 1YREA 3BXMA 2AFOA 2ZENA 4AG7A 2PJ3A 2EUIA 4XNHB 4B6ZA 4CYQA 2IQ6A 5AGEA 1TKFA 2X7BA 4W9YA 3NA6A 2NMTA 4UCPA 4XPDB 1MJAA 3SXNA 1BOBA 2DF5A 2GREA 3DNSA 3FXTA 4F9UA 2B3UA 5C82A 3BI1A 4HPSA 4E2AA 3TO9A 5GCNA 4JXQA 5G22A 1FY7A 2DXQA 1CG2A 3NE7A 1PU9A 2PQ8A 1Z5RA 3VH9A 5C88A 4CYOA 4C7IA 4U9ZA 1XRYA 2PJ0A 3NH4A 2B4DA 3EY5A 4FD5A 4KOTA 4OC3A 5A28A 3F5BA 2FXFA 2I00A 2C6PA 4PK3A 1I12A 2EK9A 1Z8TA 3LACA 2FL4A 1TF8A 4NJRA 3CXPA 3D68A 1TKHA 4CGOA 1Q2CA 1WK4A 1ON0A 5CPAA 4CYNA 1GYTA 3NFZA 4J3GA 2OZUA 4EWTA 2Q4VA 2Q0YA 2VXKA 3MRUA 5HMNA 2EVNA 3IC1A 3K9UA 2GFQA 3EXNA 4OC4A 4ZY0A 4CPAA 2WSAA 1UFHA 2J8RA 2BO9A 4BMHA 2HC9A 4IHMA 2PR8A 2PJCA 1X12A 1CPXA 2OZHA 2Z3MA 2P6FA 2PC1A 4UFVA 3S6KA 1HEEA 4X2TA 2CTCA 1TIQA 2JBKA 1YMEA 4A39A 3I1UA 3P2FA 2FSRA 4UFWA 3RNZA 1M4IA 4CGPA 2Z3PA 2YNCC 4KLWA 3GYAA 4QB9A 3B3VA 2VL1A 5CNPA 4PSWA 4B11A 3H8FA 4CGNA 2PR1A 4U5YA 3PRTA 2EO8A 3BHXA 1M1DA 4UIAA 4OLLA 3PFOA 1ZG7A 4TWEA 4R9MA 3RO0A 2PJ5A 4P6YA 1M44A 4R3LA 5IB9A 2HV2A 1XE4A 2PJ8A 1YK3A 2Z3LA 4MHYA 2VQYA 5HVFA 4Z65A 4ZGYB 1IYKA 4JXRA 1PCAA 3D7DA 4KLVA 2GLFA 4FD7A 4A37A 3KZWA 3PB6X 1B6BA 2CIJA 1AYEA 4EMEA 2OH1A 2F5IA 2PJ2A 2AFWA 1P0HA 1S60A 2BCOA 2JDCA 1JWQA 1ZLIA 3FMCA 3SJXA 2B58A 4KUBA 3PBBA 2G9DA 1QSTA 1BPMA 3R9EA 1NE9A 2PJAA 2Q7SA 1TXRA 4AVCA 3TOBA 3N5FA 3CPAA 3IGRA 4NFRA 1YW4A 1XF8A 2CY2A 2Z3OA 2PJ7A 2V8GA 2YGWA 2ZW7A 2FCKA 3GLJA 3R1KA 4RS2A 5DS0A 5K8MA 4UEZA 3BJ8A 3TCVA 1R43A 2GU2A 2AE6A 2GANA 3PBEA 2R8VA 4KS9A 4B12A 2JLMA 4KORA 2GE3A 1VIXA 3IJ3A 4MFKA 1AMPA 2AFMA 2ZW6A 5G1ZA 4C2ZA 2POKA 2CNTA 3WABA 3T8WA 2C6CA 1QSNA 1XMBA 2FIWA 3JRUA 4B5PA 4R6TA 4PQAA 4WWVA 1JQGA 2XEIA 2F8HA 3GIUA 4ZYQA 3B8GA 4R76A 4LQ6A 3R9FA 2D4OA 3GUXA 4IUSA 4A31A 2VZYA 2ZW5A 4NF1A 3WC6A 3KGQA 4PXCA 4KZTA 3VWEA 1V0CA 2XEJA 4R87A 2HUZA 3D2MA 4B10A 1CP6A 1PYTB 3R96A 1KUYA 4IK2A 4P4DA 2QECA 5JM6A 4A94A 5H84A 2I3CA 5F48A 5AG6A 3SI2A 1Z9UA 3EO4A 4LUAA 1R3NA 2PVVA 3BLNA 1Z8LA 3D7FA 1Z8WA 2BUEA 5JGFA 2FIAA 2ANPA 5LRGA 1H8LA 4M85A 1Q7LA 3PP9A 4NGSA 4A2ZA 3PB9X 2WUUA 1IY7A 2B3VA 4F9VA 4NGMA 3VWDA 4YU9A 4H2KA 4OC5A 4P10A 4ORFA 5FVJA 1SQHA 1Z4EA 2B5GB 4P45A 4IF5A 4ZY1A 1MJBA 5ISVA 4M6IA 2O28A 4NGTA 5HVGA 3DGVA 4G1PA 5F47A 4ZBGA 4MFJA 3C26A 2YNDA 3WT4A 2WYRA 2PJ6A 1FNOA 3LMSA 2IL4A 2R1IA 3KASA 3TX8A 1Y9KA 3TT2A 1I21A 3IWGA 5G20A 3TFYA 1N71A 1Y0RA 3KQZA 5KTAA 3CDXA 4CAFA 1HDUA 4CGLA 2OOTA 1L0CA 4KOYA 1VKCA 1CM0A 2Z10A 4JLYA 4UF4A 4DUKA 1U6MA 2ZEFA 3T9YA 1UWYA 4FBEA 2QJ8A 4MHNA 2YNCA 1IYLA 3VATA 4UBRA 2PRQA 2ODFA 4LQGA 4KOSA 3V8IA 1LAPA 3D4UA 3TO6A 4A33A 4UEFA 4EVYA 4QBJA 4M3SA 4RN7A 3S6HA 2PCUA 5JQ4A 1KZFA 1VHEA 1M4LA 3FIXA 3IWEA 3PFEA 2BSWA 3W6SA 4II9A 2AFSA 2R7HA 4MCPA 1Z8XA 3FX6A 1S7KA 2GLJA 1M4DA 2P6EA 4OKOA 3RBUA 2QYVA 4AVBA 4OIDA 1VHOA 3JTKA 4OC0A 4CGMA 2B5GA 4CAXA 3CZXA 3QAYA 5AG4A 3SJFA 1KUVA 4PXEA 2F7VA 1S7LA 5IB0A 4XPLA 2NSMA 3KKWA 5LYDA 5K8PA 2EBJA 4PK2A 3GB0A 4UEEA 4PSXA 2JBJA 1EE3P 2C27A 4CAVA 3BI0A 1NSLA 3CXQA 3PB7X 1CPSA 2J8MA 4ONUA 1IU8A 2PSWA 2QVPA 3ZZIA 5HVHA 3FB3A 3SJGA 2V8HA 4A38A 1OBRA 3HLPA 2D4PA 3FVLA 3S9LA 5H86A 2PIYA 1ARLA 5THWA 2Q4ZA 4F6AA 1TF9A 5I4MA 3B35A 1S7FA 2ZEMA 2I79A 2QIRA 3RZAA 2H5MA 2V8DA 1NMTA 4UWIA 4HNXB 1RXTA 2JEWA 4MMOA 3MN8A 4RUHA 3T90A 4CRYB 4QVTA 4KVOE 1Z4RA 2RB7A 4NGQA 4H6UA 2ZPAA 4PV6A 3B3WA 2GIVA 4BBHA 2AFXA 1YLEA 1ZO0A 3D7HA 3DDDA 3LODA 4P4IA 4AB7A 4B14A 2RC4A 4CYPA 1IICA 3ISZA 2ZELA 2FE7A 2G0BA 4NEXA 4P4EA 1Y7RA 2PJ1A 1ZG9A 2K5TA 2VEZA 3JVNA 4QUSA 3I9SA 4H89A 1QSRA 2WPWA 3FF3A 4NJQA 5JH9A 5AG5A 2AFZA 3H5ZA 4NSQA 1YSJA 3HUVA 3FYNA 2Q44A 1LAMA 1WWZA 2CTBA 4I49A 5J1QA 3EFAA 4MI4A 2Q51A 4R7MA 1FT7A 3TOAA 1LRZA 4MRIA 1ARMA 4MHZA 2Z11A 8CPAA
chains in the Genus database with same CATH topology
3QB8A 2ATRA 3OWCA 4OAEA 4UWJA 4MFLA 4CRZB 5J8FA 2OZGA 4KVXA 5IV0A 2YNEA 2Z0ZA 1XIXA 4GS4A 5J8CA 5KTCA 4E8OA 4A32A 4B5OA 2HQYA 2VBQA 2JDDA 3A9LA 3F0AA 1RO5A 4XPKA 4MY3A 1XMTA 4QC6A 1S7NA 2REFA 3D8PA 4DNCA 4Y49B 3RYOA 2ARHA 2FT0A 2QMLA 2ZW4A 2REEA 3R9GA 1QSOA 1CJWA 4YGOA 2Q04A 4CAEA 2G3TA 1YR0A 4B5PB 4MFZA 3G8WA 4UFXA 4L8AA 4C2XA 1PUAA 4JD6A 1KUXA 3LD2A 4H6ZA 3H4QA 4KSAA 1J4JA 4NCZA 3G3SA 5EC4A 4XPDC 3QAHA 4MJ8A 4UCNA 4XNHC 4F0XA 5KTDA 3FNCA 4MFPA 3E0KA 2FS5A 2Q7BA 4RI1A 3CXSA 4C68A 2VI7A 3TO7A 4KOWA 1YVOA 2Y0MA 5IX3A 5I0CA 1S3ZA 2B4BA 2PDOA 4MHDA 3TE4A 2G3AA 3JUWA 3R95A 5JPHA 3F8KA 2KCWA 2WPXA 5DWNA 4U9YA 4KOUA 3PGPA 1Q2YA 1Q2DA 3D3SA 2AJ6A 4E0AA 1MK4A 3FBUA 2P0WA 4JWPA 4OADA 4HNYB 3S6GA 2PRBA 3PZJA 3IU1A 4MY0A 4KSFA 4NXYA 2A4NA 4C7HA 4K30A 4HKFA 3SXOA 1MJ9A 4KOVA 2CNMA 1I1DA 4Q38A 4Q36A 4UCMA 5BWAB 2BEIA 5G21A 1GHEA 3FRMA 5F46A 4AG9A 1R57A 3N7ZA 4CAWA 1IIDA 4F0YA 2R98A 4A95A 3GKRA 3WR7A 1OZPA 3DR6A 2DPTA 1Y9WA 3W91A 3S6FA 1XEBA 5EBVA 4R3KA 5F49A 2Z3KA 1YVKA 1YX0A 3TTHA 4CS0B 4MFQA 4YFJA 5HH1A 3DSBA 2P6GA 4FD4A 4KUAA 3ZJ0A 4JJXA 2ZXVA 4B13A 4YRHA 3BJ7A 5DWMA 3MGDA 3W6XA 1P4NA 2Q4YA 3DR8A 2BL1A 4AVAA 4R57A 1YGHA 1VHSA 4HNWB 5A27A 2JEVA 1B87A 3GY9A 2CXAA 1S5KA 2J8NA 1BO4A 3P2HA 5E96A 4L89A 4MBUA 4C2YA 4X5KA 1QSMA 3EC4A 4UA3A 4A30A 3I3GA 4LX9A 1K4JA 2CNSA 3D2PA 4KVME 3IU2A 1IB1E 5AG7A 4Y49C 3UY5A 2OU2A 2Z3NA 2VZZA 3SHPA 2OB0A 4KOXA 4FD6A 1M4GA 2DPSA 2B4DB 1YREA 4AG7A 2EUIA 4XNHB 4CYQA 5AGEA 2X7BA 4XPDB 2NMTA 4UCPA 3SXNA 1MJAA 1BOBA 3FXTA 3DNSA 5C82A 2B3UA 4E2AA 3TO9A 5GCNA 4JXQA 5G22A 1FY7A 2DXQA 3NE7A 1PU9A 2PQ8A 5C88A 4CYOA 4C7IA 4U9ZA 2B4DA 3EY5A 4FD5A 4KOTA 5A28A 3F5BA 2FXFA 2I00A 4PK3A 1I12A 2FL4A 4CGOA 3CXPA 1Q2CA 1WK4A 1ON0A 4CYNA 4J3GA 2OZUA 2Q4VA 2Q0YA 2VXKA 5HMNA 2EVNA 3K9UA 3EXNA 2WSAA 1UFHA 2J8RA 4BMHA 2PR8A 3S6KA 2OZHA 2Z3MA 2P6FA 2PC1A 4UFVA 1TIQA 3P2FA 2FSRA 4UFWA 1M4IA 4CGPA 2Z3PA 2YNCC 4KLWA 3GYAA 4QB9A 5CNPA 4B11A 4PSWA 4CGNA 2PR1A 4U5YA 1M1DA 4OLLA 4R9MA 1M44A 4R3LA 2HV2A 1XE4A 2Z3LA 1YK3A 4ZGYB 2VQYA 1IYKA 4JXRA 4KLVA 4FD7A 1B6BA 2OH1A 2F5IA 1P0HA 1S60A 2JDCA 2B58A 4KUBA 1QSTA 3R9EA 1NE9A 4AVCA 3TOBA 3IGRA 1XF8A 2CY2A 2Z3OA 2YGWA 2ZW7A 2FCKA 3R1KA 4RS2A 3BJ8A 3TCVA 2AE6A 2GANA 2R8VA 4KS9A 4B12A 2JLMA 4KORA 2GE3A 4MFKA 4C2ZA 2ZW6A 5G1ZA 2CNTA 1QSNA 4B5PA 2FIWA 3B8GA 3R9FA 2D4OA 4IUSA 4A31A 2VZYA 2ZW5A 4NF1A 3VWEA 4KZTA 1V0CA 4R87A 4B10A 2HUZA 3D2MA 3R96A 1KUYA 2QECA 5H84A 5F48A 5AG6A 1Z9UA 3EO4A 4LUAA 3BLNA 2BUEA 2FIAA 4M85A 3PP9A 4A2ZA 2WUUA 2B3VA 3VWDA 5FVJA 4ORFA 1SQHA 1Z4EA 2B5GB 4IF5A 1MJBA 5ISVA 2O28A 5F47A 4ZBGA 4MFJA 3C26A 2YNDA 2IL4A 2R1IA 1Y9KA 3TT2A 1I21A 3IWGA 5G20A 3TFYA 1N71A 5KTAA 4CAFA 4CGLA 1L0CA 4KOYA 1VKCA 1CM0A 2Z10A 4JLYA 1U6MA 3T9YA 2YNCA 1IYLA 4UBRA 4KOSA 3V8IA 3TO6A 4A33A 4EVYA 4QBJA 4M3SA 3S6HA 5JQ4A 1KZFA 3FIXA 3IWEA 2BSWA 3W6SA 4II9A 2R7HA 1S7KA 1M4DA 2P6EA 4AVBA 3JTKA 4CGMA 2B5GA 4CAXA 5AG4A 1KUVA 1S7LA 5IB0A 4XPLA 3KKWA 4PK2A 4PSXA 2C27A 4CAVA 1NSLA 3CXQA 4ONUA 2J8MA 2PSWA 3ZZIA 3FB3A 2D4PA 5H86A 4F6AA 1S7FA 2I79A 2QIRA 2H5MA 1NMTA 4UWIA 4HNXB 1RXTA 3T90A 4CRYB 4QVTA 4KVOE 1Z4RA 4H6UA 2ZPAA 4PV6A 2GIVA 4BBHA 1YLEA 1ZO0A 3LODA 3DDDA 4AB7A 4B14A 2RC4A 4CYPA 1IICA 2FE7A 2G0BA 4NEXA 1Y7RA 2VEZA 2K5TA 3JVNA 4QUSA 3I9SA 4H89A 1QSRA 2WPWA 5AG5A 3H5ZA 4NSQA 3FYNA 2Q44A 1WWZA 4I49A 3EFAA 4MI4A 3TOAA 1LRZA 2Z11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QB8 A;  2ATR A;  3OWC A;  4OAE A;  4UWJ A;  4CRZ B;  5J8F A;  2OZG A;  4KVX A;  5IV0 A;  2Z0Z A;  1XIX A;  4GS4 A;  5J8C A;  5KTC A;  4E8O A;  4B5O A;  2HQY A;  2VBQ A;  2JDD A;  3F0A A;  1RO5 A;  4XPK A;  4MY3 A;  1XMT A;  4QC6 A;  1S7N A;  2REF A;  3D8P A;  4DNC A;  4Y49 B;  3RYO A;  2ARH A;  2FT0 A;  2QML A;  2ZW4 A;  2REE A;  3R9G A;  1QSO A;  1CJW A;  4YGO A;  2Q04 A;  2G3T A;  1YR0 A;  4B5P B;  3G8W A;  4L8A A;  1PUA A;  4JD6 A;  1KUX A;  3LD2 A;  4H6Z A;  3H4Q A;  1J4J A;  4NCZ A;  3G3S A;  5EC4 A;  4XPD C;  3QAH A;  4MJ8 A;  4XNH C;  5KTD A;  3FNC A;  3E0K A;  2FS5 A;  2Q7B A;  4RI1 A;  3CXS A;  2VI7 A;  3TO7 A;  4KOW A;  1YVO A;  2Y0M A;  5IX3 A;  5I0C A;  1S3Z A;  2B4B A;  2PDO A;  4MHD A;  3TE4 A;  2G3A A;  3JUW A;  3R95 A;  5JPH A;  3F8K A;  2KCW A;  2WPX A;  5DWN A;  4U9Y A;  4KOU A;  3PGP A;  1Q2Y A;  1Q2D A;  3D3S A;  2AJ6 A;  4E0A A;  1MK4 A;  3FBU A;  2P0W A;  4JWP A;  4OAD A;  4HNY B;  3S6G A;  2PRB A;  3PZJ A;  4MY0 A;  4NXY A;  2A4N A;  4K30 A;  4HKF A;  3SXO A;  1MJ9 A;  4KOV A;  2CNM A;  1I1D A;  2BEI A;  1GHE A;  3FRM A;  5F46 A;  4AG9 A;  1R57 A;  3N7Z A;  4CAW A;  1IID A;  4F0Y A;  2R98 A;  3GKR A;  3WR7 A;  1OZP A;  3DR6 A;  1Y9W A;  3W91 A;  3S6F A;  1XEB A;  5EBV A;  4R3K A;  5F49 A;  1YVK A;  1YX0 A;  3TTH A;  4CS0 B;  4YFJ A;  5HH1 A;  3DSB A;  2P6G A;  4FD4 A;  4KUA A;  3ZJ0 A;  4JJX A;  2ZXV A;  4YRH A;  3BJ7 A;  5DWM A;  3MGD A;  3W6X A;  1P4N A;  2Q4Y A;  3DR8 A;  2BL1 A;  4AVA A;  4R57 A;  1YGH A;  1VHS A;  4HNW B;  2JEV A;  1B87 A;  3GY9 A;  1S5K A;  2J8N A;  1BO4 A;  3P2H A;  5E96 A;  4L89 A;  4MBU A;  4X5K A;  1QSM A;  3EC4 A;  4UA3 A;  3I3G A;  4LX9 A;  1K4J A;  2CNS A;  3D2P A;  4KVM E;  1IB1 E;  4Y49 C;  3UY5 A;  2OU2 A;  2VZZ A;  3SHP A;  2OB0 A;  4KOX A;  4FD6 A;  1M4G A;  2B4D B;  1YRE A;  4AG7 A;  2EUI A;  4XNH B;  2X7B A;  4XPD B;  2NMT A;  3SXN A;  1MJA A;  1BOB A;  3FXT A;  3DNS A;  5C82 A;  2B3U A;  4E2A A;  3TO9 A;  5GCN A;  4JXQ A;  1FY7 A;  2DXQ A;  3NE7 A;  1PU9 A;  2PQ8 A;  5C88 A;  4U9Z A;  2B4D A;  3EY5 A;  4FD5 A;  4KOT A;  3F5B A;  2FXF A;  2I00 A;  4PK3 A;  1I12 A;  2FL4 A;  3CXP A;  1Q2C A;  1WK4 A;  1ON0 A;  4J3G A;  2OZU A;  2Q4V A;  2Q0Y A;  2VXK A;  5HMN A;  2EVN A;  3K9U A;  3EXN A;  1UFH A;  2J8R A;  4BMH A;  2PR8 A;  3S6K A;  2OZH A;  2P6F A;  2PC1 A;  1TIQ A;  3P2F A;  2FSR A;  1M4I A;  4KLW A;  3GYA A;  4QB9 A;  5CNP A;  4PSW A;  2PR1 A;  4U5Y A;  1M1D A;  4OLL A;  4R9M A;  1M44 A;  4R3L A;  2HV2 A;  1XE4 A;  1YK3 A;  2VQY A;  1IYK A;  4JXR A;  4KLV A;  4FD7 A;  1B6B A;  2OH1 A;  2F5I A;  1P0H A;  1S60 A;  2JDC A;  2B58 A;  4KUB A;  1QST A;  3R9E A;  1NE9 A;  4AVC A;  3TOB A;  3IGR A;  1XF8 A;  2CY2 A;  2ZW7 A;  3R1K A;  2FCK A;  4RS2 A;  3BJ8 A;  3TCV A;  2AE6 A;  2GAN A;  2R8V A;  2JLM A;  4KOR A;  2GE3 A;  2ZW6 A;  2CNT A;  1QSN A;  4B5P A;  2FIW A;  3B8G A;  3R9F A;  2D4O A;  4IUS A;  2VZY A;  2ZW5 A;  4NF1 A;  3VWE A;  4KZT A;  1V0C A;  4R87 A;  2HUZ A;  3D2M A;  3R96 A;  1KUY A;  2QEC A;  5H84 A;  5F48 A;  1Z9U A;  3EO4 A;  4LUA A;  3BLN A;  2BUE A;  2FIA A;  4M85 A;  3PP9 A;  2B3V A;  3VWD A;  5FVJ A;  4ORF A;  1SQH A;  1Z4E A;  2B5G B;  4IF5 A;  1MJB A;  5ISV A;  2O28 A;  5F47 A;  4ZBG A;  3C26 A;  2IL4 A;  2R1I A;  1Y9K A;  3TT2 A;  1I21 A;  3IWG A;  3TFY A;  1N71 A;  5KTA A;  1L0C A;  4KOY A;  1VKC A;  1CM0 A;  2Z10 A;  4JLY A;  1U6M A;  3T9Y A;  1IYL A;  4UBR A;  4KOS A;  3V8I A;  3TO6 A;  4QBJ A;  4EVY A;  4M3S A;  3S6H A;  5JQ4 A;  1KZF A;  3FIX A;  2BSW A;  3W6S A;  4II9 A;  2R7H A;  1S7K A;  1M4D A;  2P6E A;  4AVB A;  2B5G A;  4CAX A;  1KUV A;  1S7L A;  5IB0 A;  4XPL A;  3KKW A;  4PK2 A;  4PSX A;  2C27 A;  4CAV A;  1NSL A;  3CXQ A;  4ONU A;  2J8M A;  2PSW A;  3ZZI A;  3FB3 A;  2D4P A;  5H86 A;  4F6A A;  1S7F A;  2I79 A;  2QIR A;  2H5M A;  1NMT A;  4UWI A;  4HNX B;  1RXT A;  3T90 A;  4CRY B;  4QVT A;  4KVO E;  1Z4R A;  4H6U A;  2ZPA A;  4PV6 A;  2GIV A;  1YLE A;  3LOD A;  3DDD A;  4AB7 A;  2RC4 A;  1IIC A;  2FE7 A;  2G0B A;  4NEX A;  1Y7R A;  2VEZ A;  4QUS A;  2K5T A;  3JVN A;  3I9S A;  4H89 A;  1QSR A;  2WPW A;  4NSQ A;  3FYN A;  2Q44 A;  1WWZ A;  4I49 A;  3EFA A;  4MI4 A;  3TOA A;  1LRZ A;  2Z11 A; 
#chains in the Genus database with same CATH topology
 2IMO A;  4JYW A;  4OC1 A;  2PE3 A;  3IWW A;  3QB8 A;  2ATR A;  1Z2L A;  3B3S A;  3OWC A;  4OAE A;  4UWJ A;  4MFL A;  4CRZ B;  5J8F A;  2OZG A;  4KVX A;  3B3T A;  4P4J A;  4MHP A;  2O4H A;  4F8Z A;  5IV0 A;  2YNE A;  3LWU A;  2Z0Z A;  1XIX A;  4GS4 A;  5J8C A;  3NE8 A;  5KTC A;  1IOI A;  1NSA A;  4E8O A;  3B2Y A;  1F2P A;  4OC2 A;  4A32 A;  1TKJ A;  2HQY A;  4KSI A;  4B5O A;  2VBQ A;  3SI0 A;  3D7G A;  2JDD A;  3A9L A;  3F0A A;  1DE4 C;  3CT9 A;  1RO5 A;  3QNV A;  4XPK A;  4R8F A;  3K2K A;  3WC5 A;  1ELL P;  4MY3 A;  1XMT A;  4QC6 A;  1S7N A;  2REF A;  4P4B A;  3IO1 A;  3D8P A;  1XOV A;  1KWM A;  4DNC A;  4PPZ A;  1HDQ A;  4Y49 B;  3RYO A;  2ARH A;  5CBM A;  2FT0 A;  2QML A;  2ZW4 A;  1BPN A;  2FVG A;  3CPX A;  4MCQ A;  4ZX8 A;  2V8V A;  4P44 A;  5D8N A;  5D29 A;  6CPA A;  3S9N A;  7CPA A;  1RTQ A;  2REE A;  3R9G A;  1QSO A;  1CJW A;  2XEG A;  4YGO A;  2Q04 A;  4CAE A;  2G3T A;  1XBU A;  1YR0 A;  1LOK A;  3FH4 A;  3VAR A;  4B5P B;  3DLJ A;  4MFZ A;  2O53 A;  3G8W A;  4L8A A;  4UFX A;  4C2X A;  1PUA A;  3SJE A;  4JD6 A;  1KUX A;  3FEE A;  3LD2 A;  4TNU A;  4H6Z A;  1ZLH A;  3H4Q A;  2C1C A;  4KSA A;  1J4J A;  3H8E A;  4DJL A;  4NCZ A;  3G3S A;  1LCP A;  1ELM P;  4XPD C;  3QAH A;  5EC4 A;  2PVW A;  4K3N A;  4MJ8 A;  5LRJ A;  4IAV A;  4UCN A;  4XNH C;  5ELY A;  4F0X A;  3FNC A;  4BIN A;  5KTD A;  4MFP A;  3E0K A;  4X8I A;  2FS5 A;  3V38 A;  3D66 A;  2Q7B A;  5F09 A;  4RI1 A;  2ZEE A;  3CXS A;  1QMU A;  1XJO A;  1Y7E A;  2VI7 A;  3TO7 A;  4KOW A;  4C68 A;  1YVO A;  2Y0M A;  2BOA A;  5IX3 A;  2J9A A;  5I0C A;  3NH5 A;  1S3Z A;  2B4B A;  2PDO A;  4MHD A;  3TE4 A;  2G3A A;  3JUW A;  3R95 A;  3KHX A;  3L2N A;  3F8K A;  5JPH A;  2KCW A;  2WPX A;  5DWN A;  2IJZ A;  3K9T A;  4U9Y A;  1Y0Y A;  4KOU A;  3PGP A;  3IEH A;  1YLO A;  4EFD A;  4M6G A;  2WZN A;  1BLL E;  2AFU A;  4MCS A;  1Q2Y A;  1Q2D A;  2PJ9 A;  2AJ6 A;  3D3S A;  2ZEH A;  1MK4 A;  4E0A A;  3FBU A;  1IOF A;  2PJB A;  2P0W A;  4PXD A;  5K8O A;  3B7I A;  1QQ9 A;  4MXU A;  4YWY A;  4JWP A;  1X10 A;  4OAD A;  4HNY B;  1CP7 A;  4PXB A;  3S6G A;  2PRB A;  2ZOF A;  5LYF A;  3IU1 A;  3PZJ A;  4MY0 A;  2RFH A;  4KSF A;  4NXY A;  2A4N A;  2ZOG A;  1YW6 A;  4MCR A;  4C7H A;  1BAV A;  5LYI A;  4K30 A;  3PEI A;  3H8G A;  4HKF A;  4FWU A;  4O23 A;  4NGR A;  3SXO A;  3PB4 X;  2EWB A;  3KR4 A;  1MJ9 A;  2CNM A;  4KOV A;  1I1D A;  4Q38 A;  4Q36 A;  4UCM A;  3SI1 A;  2BEI A;  5G21 A;  5BWA B;  1GHE A;  2XEF A;  3FRM A;  2DEA A;  5K8N A;  3NH8 A;  5F46 A;  4AG9 A;  1R57 A;  1ZG8 A;  3N7Z A;  4ONW A;  4CAW A;  1IID A;  4F0Y A;  4NGP A;  2R98 A;  3RAM A;  4A95 A;  1DTD A;  2NYQ A;  3GKR A;  3WR7 A;  1OZP A;  3DR6 A;  2DPT A;  1Y9W A;  3KR5 A;  2ZEP A;  3W91 A;  3S6F A;  1XEB A;  5EBV A;  4WJB A;  4R3K A;  4Q7A A;  3ISX A;  4NGN A;  3FED A;  1XFO A;  4AXV A;  5F49 A;  3WC7 A;  2Z3K A;  1YVK A;  1YX0 A;  3KQX A;  4ZX9 A;  4MFQ A;  3S9M A;  3TTH A;  4CS0 B;  4YFJ A;  4ZY2 A;  4BD9 A;  2ZEG A;  1CBX A;  5HH1 A;  3DSB A;  2P6G A;  4X3R A;  4FD4 A;  4KUA A;  1CX8 A;  3ZJ0 A;  3IFE A;  1F57 A;  2ZXV A;  4JJX A;  4P4F A;  4B13 A;  1LFW A;  5EMI A;  3KL9 A;  4FAI A;  1VGY A;  3BJ7 A;  4YRH A;  5DWM A;  3TC8 A;  1A2Z A;  1IGB A;  3FEC A;  4JZ0 A;  3MGD A;  2ZEO A;  4DYO A;  2ZED A;  3W6X A;  1P4N A;  2Q4Y A;  3DR8 A;  2BL1 A;  3KHZ A;  3B3C A;  4AVA A;  4R57 A;  1LAN A;  3V7Z A;  1YGH A;  1VHS A;  3D67 A;  4HNW B;  5A27 A;  2JEV A;  1B87 A;  2CF4 A;  4ZI6 A;  3GY9 A;  2CXA A;  2Q43 A;  1S5K A;  3KI9 A;  2J8N A;  1BO4 A;  1F2O A;  2ABZ A;  3P2H A;  5E96 A;  1AUG A;  4L89 A;  4MBU A;  4GXH A;  4OP4 A;  4C2Y A;  4X5K A;  5LYL A;  3IIB A;  1QSM A;  2V77 A;  3EC4 A;  4UA3 A;  4A30 A;  3I3G A;  4GM5 A;  4LX9 A;  1K4J A;  2CNS A;  4OIW A;  1YQE A;  3D2P A;  4KVM E;  3IU2 A;  2EK8 A;  1IB1 E;  5AG7 A;  4Y49 C;  3UY5 A;  5LRK A;  5HXD A;  4FUU A;  2HB6 A;  2OU2 A;  2Z3N A;  3PB8 X;  2VZZ A;  2PJ4 A;  3SHP A;  2OB0 A;  4OME A;  4KOX A;  4FD6 A;  2PIZ A;  3FJU A;  1M4G A;  2OR4 A;  2DPS A;  2C6G A;  4M6H A;  4UIB A;  2B4D B;  1YRE A;  3BXM A;  2AFO A;  2ZEN A;  4AG7 A;  2PJ3 A;  2EUI A;  4XNH B;  4B6Z A;  4CYQ A;  2IQ6 A;  5AGE A;  1TKF A;  2X7B A;  4W9Y A;  3NA6 A;  2NMT A;  4UCP A;  4XPD B;  1MJA A;  3SXN A;  1BOB A;  2DF5 A;  2GRE A;  3DNS A;  3FXT A;  4F9U A;  2B3U A;  5C82 A;  3BI1 A;  4HPS A;  4E2A A;  3TO9 A;  5GCN A;  4JXQ A;  5G22 A;  1FY7 A;  2DXQ A;  1CG2 A;  3NE7 A;  1PU9 A;  2PQ8 A;  1Z5R A;  3VH9 A;  5C88 A;  4CYO A;  4C7I A;  4U9Z A;  1XRY A;  2PJ0 A;  3NH4 A;  2B4D A;  3EY5 A;  4FD5 A;  4KOT A;  4OC3 A;  5A28 A;  3F5B A;  2FXF A;  2I00 A;  2C6P A;  4PK3 A;  1I12 A;  2EK9 A;  1Z8T A;  3LAC A;  2FL4 A;  1TF8 A;  4NJR A;  3CXP A;  3D68 A;  1TKH A;  4CGO A;  1Q2C A;  1WK4 A;  1ON0 A;  5CPA A;  4CYN A;  1GYT A;  3NFZ A;  4J3G A;  2OZU A;  4EWT A;  2Q4V A;  2Q0Y A;  2VXK A;  3MRU A;  5HMN A;  2EVN A;  3IC1 A;  3K9U A;  2GFQ A;  3EXN A;  4OC4 A;  4ZY0 A;  4CPA A;  2WSA A;  1UFH A;  2J8R A;  2BO9 A;  4BMH A;  2HC9 A;  4IHM A;  2PR8 A;  2PJC A;  1X12 A;  1CPX A;  2OZH A;  2Z3M A;  2P6F A;  2PC1 A;  4UFV A;  3S6K A;  1HEE A;  4X2T A;  2CTC A;  1TIQ A;  2JBK A;  1YME A;  4A39 A;  3I1U A;  3P2F A;  2FSR A;  4UFW A;  3RNZ A;  1M4I A;  4CGP A;  2Z3P A;  2YNC C;  4KLW A;  3GYA A;  4QB9 A;  3B3V A;  2VL1 A;  5CNP A;  4PSW A;  4B11 A;  3H8F A;  4CGN A;  2PR1 A;  4U5Y A;  3PRT A;  2EO8 A;  3BHX A;  1M1D A;  4UIA A;  4OLL A;  3PFO A;  1ZG7 A;  4TWE A;  4R9M A;  3RO0 A;  2PJ5 A;  4P6Y A;  1M44 A;  4R3L A;  5IB9 A;  2HV2 A;  1XE4 A;  2PJ8 A;  1YK3 A;  2Z3L A;  4MHY A;  2VQY A;  5HVF A;  4Z65 A;  4ZGY B;  1IYK A;  4JXR A;  1PCA A;  3D7D A;  4KLV A;  2GLF A;  4FD7 A;  4A37 A;  3KZW A;  3PB6 X;  1B6B A;  2CIJ A;  1AYE A;  4EME A;  2OH1 A;  2F5I A;  2PJ2 A;  2AFW A;  1P0H A;  1S60 A;  2BCO A;  2JDC A;  1JWQ A;  1ZLI A;  3FMC A;  3SJX A;  2B58 A;  4KUB A;  3PBB A;  2G9D A;  1QST A;  1BPM A;  3R9E A;  1NE9 A;  2PJA A;  2Q7S A;  1TXR A;  4AVC A;  3TOB A;  3N5F A;  3CPA A;  3IGR A;  4NFR A;  1YW4 A;  1XF8 A;  2CY2 A;  2Z3O A;  2PJ7 A;  2V8G A;  2YGW A;  2ZW7 A;  2FCK A;  3GLJ A;  3R1K A;  4RS2 A;  5DS0 A;  5K8M A;  4UEZ A;  3BJ8 A;  3TCV A;  1R43 A;  2GU2 A;  2AE6 A;  2GAN A;  3PBE A;  2R8V A;  4KS9 A;  4B12 A;  2JLM A;  4KOR A;  2GE3 A;  1VIX A;  3IJ3 A;  4MFK A;  1AMP A;  2AFM A;  2ZW6 A;  5G1Z A;  4C2Z A;  2POK A;  2CNT A;  3WAB A;  3T8W A;  2C6C A;  1QSN A;  1XMB A;  2FIW A;  3JRU A;  4B5P A;  4R6T A;  4PQA A;  4WWV A;  1JQG A;  2XEI A;  2F8H A;  3GIU A;  4ZYQ A;  3B8G A;  4R76 A;  4LQ6 A;  3R9F A;  2D4O A;  3GUX A;  4IUS A;  4A31 A;  2VZY A;  2ZW5 A;  4NF1 A;  3WC6 A;  3KGQ A;  4PXC A;  4KZT A;  3VWE A;  1V0C A;  2XEJ A;  4R87 A;  2HUZ A;  3D2M A;  4B10 A;  1CP6 A;  1PYT B;  3R96 A;  1KUY A;  4IK2 A;  4P4D A;  2QEC A;  5JM6 A;  4A94 A;  5H84 A;  2I3C A;  5F48 A;  5AG6 A;  3SI2 A;  1Z9U A;  3EO4 A;  4LUA A;  1R3N A;  2PVV A;  3BLN A;  1Z8L A;  3D7F A;  1Z8W A;  2BUE A;  5JGF A;  2FIA A;  2ANP A;  5LRG A;  1H8L A;  4M85 A;  1Q7L A;  3PP9 A;  4NGS A;  4A2Z A;  3PB9 X;  2WUU A;  1IY7 A;  2B3V A;  4F9V A;  4NGM A;  3VWD A;  4YU9 A;  4H2K A;  4OC5 A;  4P10 A;  4ORF A;  5FVJ A;  1SQH A;  1Z4E A;  2B5G B;  4P45 A;  4IF5 A;  4ZY1 A;  1MJB A;  5ISV A;  4M6I A;  2O28 A;  4NGT A;  5HVG A;  3DGV A;  4G1P A;  5F47 A;  4ZBG A;  4MFJ A;  3C26 A;  2YND A;  3WT4 A;  2WYR A;  2PJ6 A;  1FNO A;  3LMS A;  2IL4 A;  2R1I A;  3KAS A;  3TX8 A;  1Y9K A;  3TT2 A;  1I21 A;  3IWG A;  5G20 A;  3TFY A;  1N71 A;  1Y0R A;  3KQZ A;  5KTA A;  3CDX A;  4CAF A;  1HDU A;  4CGL A;  2OOT A;  1L0C A;  4KOY A;  1VKC A;  1CM0 A;  2Z10 A;  4JLY A;  4UF4 A;  4DUK A;  1U6M A;  2ZEF A;  3T9Y A;  1UWY A;  4FBE A;  2QJ8 A;  4MHN A;  2YNC A;  1IYL A;  3VAT A;  4UBR A;  2PRQ A;  2ODF A;  4LQG A;  4KOS A;  3V8I A;  1LAP A;  3D4U A;  3TO6 A;  4A33 A;  4UEF A;  4EVY A;  4QBJ A;  4M3S A;  4RN7 A;  3S6H A;  2PCU A;  5JQ4 A;  1KZF A;  1VHE A;  1M4L A;  3FIX A;  3IWE A;  3PFE A;  2BSW A;  3W6S A;  4II9 A;  2AFS A;  2R7H A;  4MCP A;  1Z8X A;  3FX6 A;  1S7K A;  2GLJ A;  1M4D A;  2P6E A;  4OKO A;  3RBU A;  2QYV A;  4AVB A;  4OID A;  1VHO A;  3JTK A;  4OC0 A;  4CGM A;  2B5G A;  4CAX A;  3CZX A;  3QAY A;  5AG4 A;  3SJF A;  1KUV A;  4PXE A;  2F7V A;  1S7L A;  5IB0 A;  4XPL A;  2NSM A;  3KKW A;  5LYD A;  5K8P A;  2EBJ A;  4PK2 A;  3GB0 A;  4UEE A;  4PSX A;  2JBJ A;  1EE3 P;  2C27 A;  4CAV A;  3BI0 A;  1NSL A;  3CXQ A;  3PB7 X;  1CPS A;  2J8M A;  4ONU A;  1IU8 A;  2PSW A;  2QVP A;  3ZZI A;  5HVH A;  3FB3 A;  3SJG A;  2V8H A;  4A38 A;  1OBR A;  3HLP A;  2D4P A;  3FVL A;  3S9L A;  5H86 A;  2PIY A;  1ARL A;  5THW A;  2Q4Z A;  4F6A A;  1TF9 A;  5I4M A;  3B35 A;  1S7F A;  2ZEM A;  2I79 A;  2QIR A;  3RZA A;  2H5M A;  2V8D A;  1NMT A;  4UWI A;  4HNX B;  1RXT A;  2JEW A;  4MMO A;  3MN8 A;  4RUH A;  3T90 A;  4CRY B;  4QVT A;  4KVO E;  1Z4R A;  2RB7 A;  4NGQ A;  4H6U A;  2ZPA A;  4PV6 A;  3B3W A;  2GIV A;  4BBH A;  2AFX A;  1YLE A;  1ZO0 A;  3D7H A;  3DDD A;  3LOD A;  4P4I A;  4AB7 A;  4B14 A;  2RC4 A;  4CYP A;  1IIC A;  3ISZ A;  2ZEL A;  2FE7 A;  2G0B A;  4NEX A;  4P4E A;  1Y7R A;  2PJ1 A;  1ZG9 A;  2K5T A;  2VEZ A;  3JVN A;  4QUS A;  3I9S A;  4H89 A;  1QSR A;  2WPW A;  3FF3 A;  4NJQ A;  5JH9 A;  5AG5 A;  2AFZ A;  3H5Z A;  4NSQ A;  1YSJ A;  3HUV A;  3FYN A;  2Q44 A;  1LAM A;  1WWZ A;  2CTB A;  4I49 A;  5J1Q A;  3EFA A;  4MI4 A;  2Q51 A;  4R7M A;  1FT7 A;  3TOA A;  1LRZ A;  4MRI A;  1ARM A;  4MHZ A;  2Z11 A;  8CPA A; 
#chains in the Genus database with same CATH homology
 3QB8 A;  2ATR A;  3OWC A;  4OAE A;  4UWJ A;  4MFL A;  4CRZ B;  5J8F A;  2OZG A;  4KVX A;  5IV0 A;  2YNE A;  2Z0Z A;  1XIX A;  4GS4 A;  5J8C A;  5KTC A;  4E8O A;  4A32 A;  4B5O A;  2HQY A;  2VBQ A;  2JDD A;  3A9L A;  3F0A A;  1RO5 A;  4XPK A;  4MY3 A;  1XMT A;  4QC6 A;  1S7N A;  2REF A;  3D8P A;  4DNC A;  4Y49 B;  3RYO A;  2ARH A;  2FT0 A;  2QML A;  2ZW4 A;  2REE A;  3R9G A;  1QSO A;  1CJW A;  4YGO A;  2Q04 A;  4CAE A;  2G3T A;  1YR0 A;  4B5P B;  4MFZ A;  3G8W A;  4UFX A;  4L8A A;  4C2X A;  1PUA A;  4JD6 A;  1KUX A;  3LD2 A;  4H6Z A;  3H4Q A;  4KSA A;  1J4J A;  4NCZ A;  3G3S A;  5EC4 A;  4XPD C;  3QAH A;  4MJ8 A;  4UCN A;  4XNH C;  4F0X A;  5KTD A;  3FNC A;  4MFP A;  3E0K A;  2FS5 A;  2Q7B A;  4RI1 A;  3CXS A;  4C68 A;  2VI7 A;  3TO7 A;  4KOW A;  1YVO A;  2Y0M A;  5IX3 A;  5I0C A;  1S3Z A;  2B4B A;  2PDO A;  4MHD A;  3TE4 A;  2G3A A;  3JUW A;  3R95 A;  5JPH A;  3F8K A;  2KCW A;  2WPX A;  5DWN A;  4U9Y A;  4KOU A;  3PGP A;  1Q2Y A;  1Q2D A;  3D3S A;  2AJ6 A;  4E0A A;  1MK4 A;  3FBU A;  2P0W A;  4JWP A;  4OAD A;  4HNY B;  3S6G A;  2PRB A;  3PZJ A;  3IU1 A;  4MY0 A;  4KSF A;  4NXY A;  2A4N A;  4C7H A;  4K30 A;  4HKF A;  3SXO A;  1MJ9 A;  4KOV A;  2CNM A;  1I1D A;  4Q38 A;  4Q36 A;  4UCM A;  5BWA B;  2BEI A;  5G21 A;  1GHE A;  3FRM A;  5F46 A;  4AG9 A;  1R57 A;  3N7Z A;  4CAW A;  1IID A;  4F0Y A;  2R98 A;  4A95 A;  3GKR A;  3WR7 A;  1OZP A;  3DR6 A;  2DPT A;  1Y9W A;  3W91 A;  3S6F A;  1XEB A;  5EBV A;  4R3K A;  5F49 A;  2Z3K A;  1YVK A;  1YX0 A;  3TTH A;  4CS0 B;  4MFQ A;  4YFJ A;  5HH1 A;  3DSB A;  2P6G A;  4FD4 A;  4KUA A;  3ZJ0 A;  4JJX A;  2ZXV A;  4B13 A;  4YRH A;  3BJ7 A;  5DWM A;  3MGD A;  3W6X A;  1P4N A;  2Q4Y A;  3DR8 A;  2BL1 A;  4AVA A;  4R57 A;  1YGH A;  1VHS A;  4HNW B;  5A27 A;  2JEV A;  1B87 A;  3GY9 A;  2CXA A;  1S5K A;  2J8N A;  1BO4 A;  3P2H A;  5E96 A;  4L89 A;  4MBU A;  4C2Y A;  4X5K A;  1QSM A;  3EC4 A;  4UA3 A;  4A30 A;  3I3G A;  4LX9 A;  1K4J A;  2CNS A;  3D2P A;  4KVM E;  3IU2 A;  1IB1 E;  5AG7 A;  4Y49 C;  3UY5 A;  2OU2 A;  2Z3N A;  2VZZ A;  3SHP A;  2OB0 A;  4KOX A;  4FD6 A;  1M4G A;  2DPS A;  2B4D B;  1YRE A;  4AG7 A;  2EUI A;  4XNH B;  4CYQ A;  5AGE A;  2X7B A;  4XPD B;  2NMT A;  4UCP A;  3SXN A;  1MJA A;  1BOB A;  3FXT A;  3DNS A;  5C82 A;  2B3U A;  4E2A A;  3TO9 A;  5GCN A;  4JXQ A;  5G22 A;  1FY7 A;  2DXQ A;  3NE7 A;  1PU9 A;  2PQ8 A;  5C88 A;  4CYO A;  4C7I A;  4U9Z A;  2B4D A;  3EY5 A;  4FD5 A;  4KOT A;  5A28 A;  3F5B A;  2FXF A;  2I00 A;  4PK3 A;  1I12 A;  2FL4 A;  4CGO A;  3CXP A;  1Q2C A;  1WK4 A;  1ON0 A;  4CYN A;  4J3G A;  2OZU A;  2Q4V A;  2Q0Y A;  2VXK A;  5HMN A;  2EVN A;  3K9U A;  3EXN A;  2WSA A;  1UFH A;  2J8R A;  4BMH A;  2PR8 A;  3S6K A;  2OZH A;  2Z3M A;  2P6F A;  2PC1 A;  4UFV A;  1TIQ A;  3P2F A;  2FSR A;  4UFW A;  1M4I A;  4CGP A;  2Z3P A;  2YNC C;  4KLW A;  3GYA A;  4QB9 A;  5CNP A;  4B11 A;  4PSW A;  4CGN A;  2PR1 A;  4U5Y A;  1M1D A;  4OLL A;  4R9M A;  1M44 A;  4R3L A;  2HV2 A;  1XE4 A;  2Z3L A;  1YK3 A;  4ZGY B;  2VQY A;  1IYK A;  4JXR A;  4KLV A;  4FD7 A;  1B6B A;  2OH1 A;  2F5I A;  1P0H A;  1S60 A;  2JDC A;  2B58 A;  4KUB A;  1QST A;  3R9E A;  1NE9 A;  4AVC A;  3TOB A;  3IGR A;  1XF8 A;  2CY2 A;  2Z3O A;  2YGW A;  2ZW7 A;  2FCK A;  3R1K A;  4RS2 A;  3BJ8 A;  3TCV A;  2AE6 A;  2GAN A;  2R8V A;  4KS9 A;  4B12 A;  2JLM A;  4KOR A;  2GE3 A;  4MFK A;  4C2Z A;  2ZW6 A;  5G1Z A;  2CNT A;  1QSN A;  4B5P A;  2FIW A;  3B8G A;  3R9F A;  2D4O A;  4IUS A;  4A31 A;  2VZY A;  2ZW5 A;  4NF1 A;  3VWE A;  4KZT A;  1V0C A;  4R87 A;  4B10 A;  2HUZ A;  3D2M A;  3R96 A;  1KUY A;  2QEC A;  5H84 A;  5F48 A;  5AG6 A;  1Z9U A;  3EO4 A;  4LUA A;  3BLN A;  2BUE A;  2FIA A;  4M85 A;  3PP9 A;  4A2Z A;  2WUU A;  2B3V A;  3VWD A;  5FVJ A;  4ORF A;  1SQH A;  1Z4E A;  2B5G B;  4IF5 A;  1MJB A;  5ISV A;  2O28 A;  5F47 A;  4ZBG A;  4MFJ A;  3C26 A;  2YND A;  2IL4 A;  2R1I A;  1Y9K A;  3TT2 A;  1I21 A;  3IWG A;  5G20 A;  3TFY A;  1N71 A;  5KTA A;  4CAF A;  4CGL A;  1L0C A;  4KOY A;  1VKC A;  1CM0 A;  2Z10 A;  4JLY A;  1U6M A;  3T9Y A;  2YNC A;  1IYL A;  4UBR A;  4KOS A;  3V8I A;  3TO6 A;  4A33 A;  4EVY A;  4QBJ A;  4M3S A;  3S6H A;  5JQ4 A;  1KZF A;  3FIX A;  3IWE A;  2BSW A;  3W6S A;  4II9 A;  2R7H A;  1S7K A;  1M4D A;  2P6E A;  4AVB A;  3JTK A;  4CGM A;  2B5G A;  4CAX A;  5AG4 A;  1KUV A;  1S7L A;  5IB0 A;  4XPL A;  3KKW A;  4PK2 A;  4PSX A;  2C27 A;  4CAV A;  1NSL A;  3CXQ A;  4ONU A;  2J8M A;  2PSW A;  3ZZI A;  3FB3 A;  2D4P A;  5H86 A;  4F6A A;  1S7F A;  2I79 A;  2QIR A;  2H5M A;  1NMT A;  4UWI A;  4HNX B;  1RXT A;  3T90 A;  4CRY B;  4QVT A;  4KVO E;  1Z4R A;  4H6U A;  2ZPA A;  4PV6 A;  2GIV A;  4BBH A;  1YLE A;  1ZO0 A;  3LOD A;  3DDD A;  4AB7 A;  4B14 A;  2RC4 A;  4CYP A;  1IIC A;  2FE7 A;  2G0B A;  4NEX A;  1Y7R A;  2VEZ A;  2K5T A;  3JVN A;  4QUS A;  3I9S A;  4H89 A;  1QSR A;  2WPW A;  5AG5 A;  3H5Z A;  4NSQ A;  3FYN A;  2Q44 A;  1WWZ A;  4I49 A;  3EFA A;  4MI4 A;  3TOA A;  1LRZ A;  2Z11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...