2CNMA

Rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with a bisubstrate inhibitor (cterm-arg-arg-phe-tyr-arg-ala-n-alpha- acetyl-s-coa).
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
151
structure length
151
Chain Sequence
MNTISILSTTDLPAAWQIEQRAHAFPWSEKTFFGNQGERYLNLKLTADDRMAAFAITQVVLDEATLFNIAVDPDFQRRGLGRMLLEHLIDELETRGVVTLWLEVRASNAAAIALYESLGFNEATIRRNYYPTAQGHEDAIIMALPISMKLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODIFICATION OF 30S RIBOSOMAL SUBUNIT PROTEIN S18
publication title Crystal Structure of Rimi from Salmonella Typhimurium Lt2, the Gnat Responsible for N{Alpha}- Acetylation of Ribosomal Protein S18.
pubmed doi rcsb
source organism Salmonella typhimurium lt2
molecule tags Transferase
total genus 46
structure length 151
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2006-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2cnmA00
1YVKA 3FYNA 4KVME 4Y49B 4IUSA 4PV6A 4KZTA 2FT0A 3S6KA 4HNYB 3TCVA 3S6GA 1M4DA 2FE7A 2ATRA 4FD5A 4AVAA 3EFAA 1IICA 4AG7A 4U5YA 1B6BA 3TE4A 2J8RA 2J8MA 2B3UA 1XMTA 1IYKA 2BSWA 3EXNA 4EVYA 4QBJA 3IGRA 3D8PA 3SHPA 5IX3A 3PGPA 2EVNA 2B58A 4F6AA 4PK2A 2Q04A 5ISVA 4H89A 4R57A 2ARHA 4NCZA 4AG9A 2OB0A 4PK3A 2G3TA 5E96A 1N71A 2D4PA 4KUBA 1Z4EA 4R3LA 1PU9A 4OADA 1KUVA 3S6HA 1CM0A 3R95A 3W6XA 2Q4VA 3D2MA 2GIVA 5DWNA 1XEBA 3QB8A 2OU2A 2GANA 2Z10A 2JDDA 4E2AA 1Q2DA 2B4BA 1UFHA 2QECA 2P6FA 4XPDC 5CNPA 2ZW4A 4KOVA 1SQHA 1LRZA 2P6EA 1TIQA 1VHSA 1MJBA 2QMLA 3S6FA 3SXNA 2VZZA 1WWZA 4LUAA 4FD6A 3F8KA 1L0CA 4KOTA 4UWJA 3D2PA 3DR8A 2R8VA 1CJWA 4E0AA 3FIXA 3MGDA 4R9MA 5EBVA 2EUIA 1S5KA 2BL1A 4J3GA 3GYAA 3C26A 1GHEA 4QC6A 4CRYB 3I9SA 4UBRA 3DDDA 4M85A 3DNSA 3GY9A 2OZGA 3SXOA 3R1KA 5H84A 2AE6A 4YGOA 4H6ZA 2JEVA 2BEIA 2I79A 1S7KA 2Z11A 2Z0ZA 2ZW6A 1R57A 4GS4A 2PR1A 2BUEA 2PR8A 2R1IA 4F0YA 1NSLA 4QUSA 2VI7A 5C88A 4KOSA 2K5TA 1PUAA 5HMNA 3TOBA 4HNXB 2WPWA 2P6GA 4QVTA 4R3KA 2C27A 1Q2YA 3VWEA 1S7NA 4KLVA 4UA3A 1QSNA 3I3GA 3V8IA 3CXPA 2VXKA 4YFJA 4U9ZA 3TTHA 5DWMA 2H5MA 5KTCA 1KUXA 3CXSA 3TO6A 2D4OA 3LD2A 1YLEA 5IV0A 3EC4A 1M4GA 3TT2A 2QIRA 3JUWA 1Y7RA 1S60A 3F0AA 3R9FA 4AVCA 4KOYA 4LX9A 4MI4A 4OAEA 1M4IA 2NMTA 4KVXA 2ZPAA 4BMHA 3TFYA 4JXQA 2OZHA 2JLMA 1KZFA 3FB3A 2FIAA 1Z9UA 3P2FA 2Q44A 4FD4A 1OZPA 3G3SA 2REFA 4X5KA 3TO9A 4NEXA 1IB1E 2IL4A 3PZJA 2X7BA 5KTDA 1Y9KA 2Q7BA 2PQ8A 2PSWA 4JLYA 4B5PA 1M44A 2OZUA 4B5PB 4K30A 3WR7A 4OLLA 3DR6A 3T9YA 1FY7A 2RC4A 4KOUA 5F48A 1Z4RA 4JJXA 4MY3A 4RS2A 1S7FA 3DSBA 1U6MA 4U9YA 3H4QA 1Q2CA 4IF5A 5F46A 3BJ8A 1IIDA 4Y49C 1BOBA 4R87A 2GE3A 2PDOA 1YREA 4NSQA 3ZJ0A 5F47A 4JXRA 3JVNA 1S3ZA 2DXQA 3EY5A 3FRMA 4HKFA 1VKCA 2AJ6A 1QSOA 4B5OA 1MJ9A 2Q4YA 3W91A 2PRBA 3IWGA 4ORFA 3TO7A 1QSRA 4L89A 4FD7A 4ZBGA 3F5BA 3B8GA 3D3SA 3R9EA 2CNTA 2F5IA 2A4NA 1P0HA 4MBUA 3KKWA 4L8AA 2O28A 3T90A 1NMTA 2I00A 2J8NA 5JQ4A 3TOAA 4KOXA 3R9GA 4CAXA 1NE9A 2HV2A 2G3AA 4CAVA 2FL4A 4CRZB 2OH1A 2FIWA 4H6UA 3EO4A 1YR0A 2HQYA 3ZZIA 3UY5A 2R98A 1XF8A 1B87A 3K9UA 3LODA 3RYOA 3OWCA 3FBUA 3VWDA 2P0WA 4XNHB 1YK3A 3PP9A 4E8OA 3N7ZA 4M3SA 2CY2A 3CXQA 2Y0MA 2VBQA 4AB7A 1I1DA 1YVOA 2CNMA 1QSMA 2REEA 4ONUA 2FCKA 1MJAA 1KUYA 1RO5A 5H86A 5I0CA 2FS5A 1I12A 2B3VA 3GKRA 4I49A 5HH1A 2ZW5A 1P4NA 5JPHA 1M1DA 2ZW7A 4PSXA 4NXYA 2WPXA 1QSTA 1S7LA 2VEZA 4MY0A 4XPKA 5F49A 4MJ8A 1J4JA 4DNCA 1YGHA 2Q0YA 1Y9WA 1XE4A 2B4DA 3W6SA 2B4DB 3BLNA 2HUZA 4KLWA 4KORA 4KOWA 1BO4A 2VQYA 2PC1A 5J8CA 4KUAA 1IYLA 3E0KA 2CNSA 1YX0A 2ZXVA 1V0CA 3FXTA 4CAWA 4CS0B 2VZYA 3P2HA 5KTAA 5C82A 4JD6A 4QB9A 4KVOE 5GCNA 3R96A 3QAHA 4NF1A 4UWIA 4HNWB 2B5GA 1RXTA 2B5GB 4XPLA 3BJ7A 4JWPA 2FSRA 4MHDA 4PSWA 1XIXA 4II9A 3G8WA 2FXFA 4XPDB 4RI1A 1K4JA 1ON0A 5EC4A 2JDCA 3FNCA 1I21A 5IB0A 4YRHA 4XNHC 2G0BA 5J8FA 4AVBA 2R7HA 5FVJA 3NE7A 1WK4A 1MK4A 2KCWA
chains in the Genus database with same CATH superfamily
1YVKA 3KHXA 1Z8WA 2PJ4A 5CBMA 3FYNA 4KVME 4Y49B 4IUSA 4PV6A 4KZTA 5JGFA 3I1UA 2RFHA 1XMBA 4LQ6A 4KSAA 1TF9A 4IHMA 3FH4A 4P4FA 1AYEA 2FT0A 3S6KA 4HNYB 2PVVA 3TCVA 5J1QA 1YLOA 1M4DA 3S6GA 1YW6A 2FE7A 3GIUA 5F48A 1FT7A 4CGOA 2ATRA 4FD5A 3D67A 3KZWA 3RO0A 4AVAA 4P4JA 4GXHA 4B6ZA 6CPAA 1ZG8A 2GLFA 3CT9A 3SI2A 2Q4ZA 1CP7A 3EFAA 4CYPA 4ZGYB 4UEZA 3VARA 4ONWA 1IICA 3KR5A 4AG7A 4U5YA 1B6BA 4P10A 3TE4A 1BAVA 2J8RA 5JH9A 3GUXA 2YNCC 2J8MA 2B3UA 3VATA 4NGQA 5LYDA 1XMTA 1IYKA 2BSWA 1AUGA 3EXNA 4EVYA 5F09A 5G1ZA 3JTKA 4QBJA 3IGRA 3D8PA 3SHPA 1CPXA 5IX3A 4CPAA 3PGPA 3KHZA 4MXUA 2EVNA 2B58A 4F6AA 1FNOA 4PK2A 3LWUA 2Q04A 3SJEA 4FUUA 5ISVA 4WWVA 2ZEFA 4H89A 2AFXA 2ARHA 4R57A 3SI1A 4NCZA 4AG9A 2OB0A 1PCAA 1JWQA 4PK3A 2G3TA 1Z8XA 4CGNA 2V8HA 5E96A 1N71A 4JZ0A 4F9UA 4MHYA 7CPAA 2ZEHA 3K2KA 2D4PA 4MFLA 2FVGA 4MCSA 4KUBA 1Z4EA 4R3LA 1Y0YA 1PU9A 3QNVA 4BINA 5A28A 2V8GA 4OADA 3GLJA 1KUVA 1ZLHA 5G22A 2IQ6A 3S6HA 1CM0A 5DS0A 4OP4A 3B3CA 3R95A 2Q4VA 3W6XA 5HVGA 3D2MA 2DPTA 2GIVA 5ELYA 4NJQA 4PXEA 5AGEA 4P4IA 1XEBA 5DWNA 3QB8A 2OU2A 2GANA 4M6HA 3B2YA 2CTCA 3CPAA 2Z10A 2JDDA 3IC1A 3BHXA 4DUKA 4E2AA 3IIBA 1Q2DA 4C7IA 3KQZA 1Z5RA 4MCRA 2B4BA 4C2ZA 1UFHA 4OIWA 3N5FA 2QECA 2P6FA 3CDXA 1LCPA 1H8LA 1A2ZA 4XPDC 4MHZA 2ZW4A 2YNDA 2JEWA 4KOVA 1SQHA 5CNPA 3KGQA 4F8ZA 3NH8A 1LRZA 2P6EA 1TIQA 4A30A 1VHSA 4NGNA 1MJBA 3L2NA 2QMLA 2POKA 3S9LA 3B7IA 5CPAA 3S6FA 4GM5A 4P6YA 3SXNA 2VZZA 1WWZA 4LUAA 3IWEA 1YMEA 2C6CA 4FD6A 2PJ3A 2V8VA 1ELLP 1IU8A 2Z3LA 3H8FA 3F8KA 1L0CA 4KOTA 2XEGA 3PFOA 4UWJA 3D2PA 3DR8A 2F8HA 3BXMA 4Q7AA 2R8VA 4R7MA 3IEHA 5G21A 3FX6A 1CJWA 3WC7A 4C2YA 4E0AA 3FIXA 3MGDA 4R9MA 5EBVA 2EUIA 1S5KA 4C7HA 2BL1A 4J3GA 4Q38A 3RZAA 3GYAA 3C26A 1GHEA 4QC6A 1Z8TA 1VIXA 4CRYB 3I9SA 4UBRA 3FVLA 3DDDA 4M85A 3V7ZA 3IWWA 3DNSA 3GY9A 4ZX9A 2OZGA 3B3SA 3SXOA 3R1KA 3H8EA 5H84A 2AE6A 4NGPA 4YGOA 4H6ZA 2C6PA 1ZO0A 2JEVA 2BEIA 2I79A 2ANPA 3PEIA 4CAEA 5D29A 1S7KA 4PXDA 2Z11A 2Z0ZA 4R8FA 3JRUA 2CTBA 2ZW6A 5HVHA 4NJRA 1R57A 1Z2LA 4GS4A 3SI0A 3TX8A 2PJ2A 2PR1A 5LRJA 5K8OA 4EMEA 2BUEA 2WZNA 4MFQA 2PR8A 3D7GA 2R1IA 2EBJA 4K3NA 4F0YA 4A94A 1NSLA 3V38A 4QUSA 4ZYQA 3LACA 3S9NA 3LMSA 4A95A 1AMPA 2ODFA 2VI7A 4PXCA 5C88A 1XRYA 4KOSA 2K5TA 1PUAA 1IY7A 3FF3A 4MFJA 4R76A 1XJOA 2WSAA 2QYVA 3D4UA 5HMNA 3D7DA 3TOBA 1GYTA 4HNXB 4TWEA 1OBRA 4DYOA 2WPWA 4KS9A 2P6GA 4MCPA 4BBHA 2XEIA 4UFXA 4PPZA 4QVTA 4R3KA 2CXAA 2ZOGA 2C27A 1Q2YA 3DGVA 3VWEA 1XFOA 2DF5A 2O53A 1S7NA 4KLVA 4MFZA 2J9AA 4UA3A 1QSNA 3I3GA 3V8IA 3CXPA 3KASA 3PB7X 1HEEA 1ZG9A 2VXKA 4U9ZA 4YFJA 3TTHA 5DWMA 1Z8LA 1TKHA 2V8DA 2H5MA 5KTCA 1KUXA 3NA6A 3D7FA 2ZENA 3SJFA 3CXSA 4IK2A 1IOIA 3TO6A 4AXVA 1CX8A 4UFVA 3TC8A 2D4OA 2IJZA 5AG5A 3T8WA 3LD2A 4CYOA 4OC1A 4OC5A 1YLEA 5IV0A 4UIAA 3EC4A 1M4GA 4OMEA 3TT2A 4A33A 4F9VA 2QIRA 3PB8X 3JUWA 3KI9A 2ABZA 4UFWA 1Y7RA 1S60A 3F0AA 3WABA 3B3WA 2PJ1A 3R9FA 4AVCA 1F57A 4KOYA 4CGLA 4LX9A 4MI4A 4OAEA 5G20A 1M4IA 1UWYA 2NMTA 3MN8A 4KVXA 4A39A 2ZPAA 2Z3PA 4BMHA 3TFYA 3IU2A 4JXQA 3S9MA 2OZHA 2JLMA 1KZFA 2Z3KA 3FB3A 2FIAA 1Z9UA 3ISZA 2Q44A 1Y7EA 1DE4C 3P2FA 3PRTA 4FD4A 1BLLE 4KSFA 1OZPA 3HUVA 2VL1A 3G3SA 2PJ5A 4MHPA 4CYNA 1LAPA 2REFA 4OC4A 2YNCA 4X5KA 3TO9A 2ZEEA 4NEXA 1IB1E 4UEEA 2GREA 2IL4A 2WUUA 2ZEOA 3PZJA 2X7BA 4DJLA 4A37A 5KTDA 1Y9KA 4M6IA 2Q7BA 2PQ8A 4UCNA 4OC3A 2PJCA 2AFWA 2PSWA 1M44A 2OZUA 4JLYA 4P44A 4B5PA 2CF4A 3RAMA 4NGSA 1QMUA 3SJXA 4B5PB 4K30A 1YQEA 1LOKA 2NSMA 3CPXA 2PCUA 4OLLA 3WR7A 3PB9X 3DR6A 1CG2A 3T9YA 3IJ3A 1FY7A 1CP6A 2RC4A 3NE8A 4KOUA 4HPSA 1Z4RA 3B3VA 4JJXA 4MY3A 3D68A 4RS2A 1S7FA 3DSBA 4MHNA 1U6MA 2PJ7A 4U9YA 5HXDA 4FAIA 3H4QA 4IAVA 1Q2CA 4IF5A 5F46A 2PJ8A 3BJ8A 1IIDA 3WC6A 2ZELA 2IMOA 2PJ0A 4MFPA 1BOBA 4Y49C 2YGWA 4R87A 2GE3A 2PDOA 1YREA 2C6GA 2DEAA 2V77A 3KL9A 4NSQA 2ZOFA 4MRIA 3ZJ0A 5F47A 2QVPA 1LANA 3IU1A 5IB9A 4JXRA 1XOVA 3JVNA 2ZEGA 1S3ZA 4C2XA 2DXQA 2AFOA 2RB7A 3CZXA 3EY5A 3RNZA 3FRMA 8CPAA 1NSAA 2XEJA 4HKFA 2I3CA 1VKCA 4O23A 5AG6A 2AJ6A 1QSOA 1Y0RA 5K8PA 3BI0A 3MRUA 4B5OA 4B11A 1MJ9A 2Q4YA 3W91A 3WC5A 3H8GA 1BPNA 2PRBA 1RTQA 3H5ZA 3FJUA 3IWGA 3K9TA 4ORFA 1QSRA 3TO7A 5LRGA 4L89A 4FD7A 4P4BA 4A2ZA 4ZBGA 3F5BA 3B8GA 3D3SA 3R9EA 2CNTA 2F5IA 5LYIA 2A4NA 4NGRA 1P0HA 4MBUA 3KKWA 4EWTA 1TKFA 3NH4A 1YW4A 4L8AA 4X8IA 2O28A 3T90A 4B14A 1NMTA 4OIDA 2I00A 1X12A 2G9DA 2PIYA 2J8NA 5JQ4A 3TOAA 4MMOA 4BD9A 4FBEA 4KOXA 2AFMA 4UEFA 4KSIA 3A9LA 2XEFA 4A38A 3R9GA 1HDQA 5AG4A 4CAXA 3RBUA 1NE9A 4A32A 4NFRA 3PB6X 3D7HA 4OKOA 1ZG7A 2HV2A 4PQAA 2G3AA 1LFWA 2Q51A 2F7VA 3VH9A 4CAVA 2FL4A 1LAMA 1KWMA 4CRZB 2AFUA 2FIWA 2OH1A 2DPSA 2PRQA 4H6UA 3EO4A 4Q36A 1M4LA 1YR0A 2ZEDA 2HQYA 3ZZIA 2PJAA 2EO8A 3FEDA 1QQ9A 3UY5A 2R98A 1XF8A 3IO1A 2BCOA 3WT4A 1B87A 3K9UA 4X2TA 2Z3NA 3LODA 3RYOA 3OWCA 1R3NA 4B12A 4NGTA 5A27A 3FBUA 3VWDA 2P0WA 4XNHB 1ARLA 1YK3A 2JBJA 3PP9A 2AFSA 4P45A 3B3TA 4E8OA 3N7ZA 2Z3MA 4TNUA 4R6TA 1YSJA 4M3SA 2CY2A 4FWUA 5BWAB 3CXQA 4UCMA 1ARMA 2Y0MA 2VBQA 2CIJA 4AB7A 1VGYA 1I1DA 1YVOA 5K8MA 2CNMA 2HC9A 3NFZA 1QSMA 4Z65A 5JM6A 3B35A 2REEA 4ONUA 3QAYA 2FCKA 1TF8A 1MJAA 4C68A 1KUYA 1RO5A 5H86A 2HB6A 4MFKA 2NYQA 5I0CA 2FS5A 3KR4A 1I12A 2B3VA 3FECA 3GKRA 4I49A 5HH1A 3HLPA 5D8NA 5HVFA 2ZW5A 1P4NA 5JPHA 1M1DA 2ZW7A 4PSXA 4NXYA 2WPXA 1Q7LA 1QSTA 1VHEA 1S7LA 4W9YA 4B10A 2VEZA 4MY0A 5EMIA 1F2OA 4XPKA 4WJBA 4P4DA 5F49A 1CPSA 2OR4A 1J4JA 4G1PA 4MJ8A 4ZY2A 4DNCA 4CGPA 3PFEA 1YGHA 1EE3P 1IOFA 3IFEA 2Q0YA 4ZX8A 4ZI6A 1IGBA 1Y9WA 3GB0A 1DTDA 1XE4A 2PE3A 1F2PA 1XBUA 5THWA 2B4DA 3W6SA 4NGMA 1TKJA 2B4DB 4UF4A 2PIZA 5LYFA 1BPMA 3BLNA 2HUZA 2GLJA 3PBBA 4KLWA 4KORA 4KOWA 1BO4A 5K8NA 1CBXA 2BOAA 2VQYA 4PXBA 2PC1A 4M6GA 1R43A 5J8CA 1TXRA 4MCQA 2WYRA 2QJ8A 4KUAA 4ZY1A 1PYTB 1IYLA 1VHOA 2CNSA 1YX0A 2ZXVA 1V0CA 1X10A 2ZEMA 3E0KA 3FXTA 4CAWA 4CS0B 4JYWA 2PJ9A 4OC0A 2VZYA 2JBKA 3BI1A 3SJGA 2Q7SA 4RUHA 5LYLA 3FMCA 3P2HA 3FEEA 2PJBA 3PB4X 5C82A 5KTAA 3PBEA 2PVWA 2C1CA 4JD6A 4QB9A 4B13A 4KVOE 5GCNA 4CAFA 3R96A 3QAHA 2OOTA 4NF1A 4UIBA 4RN7A 2AFZA 2EWBA 2Z3OA 4HNWB 4UWIA 1JQGA 2B5GA 2YNEA 1RXTA 2B5GB 4XPLA 3BJ7A 2PJ6A 3ISXA 4JWPA 4YWYA 2FSRA 3NH5A 5AG7A 4F0XA 4UCPA 4MHDA 4PSWA 1XIXA 4ZY0A 1HDUA 3D66A 4II9A 1ZLIA 2ZEPA 4A31A 2GFQA 4CGMA 4H2KA 3G8WA 2FXFA 4EFDA 5LRKA 2O4HA 4XPDB 4RI1A 1K4JA 1ON0A 2EK9A 5I4MA 5EC4A 2BO9A 2JDCA 3FNCA 4LQGA 1I21A 4CYQA 4YU9A 4OC2A 4YRHA 5IB0A 2Q43A 4XNHC 2EK8A 2G0BA 5J8FA 4AVBA 3DLJA 1ELMP 2GU2A 4X3RA 2R7HA 3KQXA 5FVJA 3NE7A 1WK4A 1MK4A 2KCWA 4P4EA
chains in the Genus database with same CATH topology
1YVKA 3FYNA 4KVME 4Y49B 4IUSA 4PV6A 4KZTA 4KSAA 2FT0A 3S6KA 4HNYB 3TCVA 3S6GA 1M4DA 4CGOA 2FE7A 2ATRA 4FD5A 4AVAA 3EFAA 4ZGYB 4CYPA 1IICA 4AG7A 4U5YA 1B6BA 3TE4A 2J8RA 2YNCC 2J8MA 2B3UA 1XMTA 1IYKA 2BSWA 3EXNA 4EVYA 5G1ZA 3JTKA 4QBJA 3IGRA 3D8PA 3SHPA 5IX3A 3PGPA 2EVNA 2B58A 4F6AA 4PK2A 2Q04A 5ISVA 4H89A 4R57A 2ARHA 4NCZA 4AG9A 2OB0A 4PK3A 2G3TA 4CGNA 5E96A 1N71A 2D4PA 4MFLA 4KUBA 1Z4EA 4R3LA 1PU9A 5A28A 4OADA 1KUVA 5G22A 3S6HA 1CM0A 3R95A 3W6XA 2Q4VA 3D2MA 2DPTA 2GIVA 5AGEA 5DWNA 1XEBA 3QB8A 2OU2A 2GANA 2Z10A 2JDDA 4E2AA 1Q2DA 4C7IA 2B4BA 4C2ZA 1UFHA 2QECA 2P6FA 4XPDC 5CNPA 2ZW4A 2YNDA 4KOVA 1SQHA 1LRZA 2P6EA 1TIQA 4A30A 1VHSA 1MJBA 2QMLA 3S6FA 3SXNA 2VZZA 1WWZA 4LUAA 3IWEA 4FD6A 2Z3LA 3F8KA 1L0CA 4KOTA 4UWJA 3D2PA 3DR8A 2R8VA 5G21A 1CJWA 4E0AA 4C2YA 3FIXA 3MGDA 4R9MA 5EBVA 2EUIA 1S5KA 4C7HA 2BL1A 4J3GA 4Q38A 3GYAA 3C26A 1GHEA 4QC6A 4CRYB 3I9SA 4UBRA 3DDDA 4M85A 3DNSA 3GY9A 2OZGA 3SXOA 3R1KA 5H84A 2AE6A 4YGOA 4H6ZA 1ZO0A 2JEVA 2BEIA 2I79A 4CAEA 1S7KA 2Z11A 2Z0ZA 2ZW6A 1R57A 4GS4A 2PR1A 2BUEA 4MFQA 2PR8A 2R1IA 4F0YA 1NSLA 4QUSA 4A95A 2VI7A 5C88A 4KOSA 2K5TA 1PUAA 4MFJA 2WSAA 5HMNA 3TOBA 4HNXB 2WPWA 4KS9A 2P6GA 4BBHA 4UFXA 4QVTA 4R3KA 2CXAA 2C27A 1Q2YA 3VWEA 1S7NA 4KLVA 4MFZA 4UA3A 1QSNA 3I3GA 3V8IA 3CXPA 2VXKA 4YFJA 4U9ZA 3TTHA 5DWMA 2H5MA 5KTCA 1KUXA 3CXSA 3TO6A 4UFVA 2D4OA 5AG5A 3LD2A 4CYOA 1YLEA 5IV0A 3EC4A 1M4GA 3TT2A 4A33A 2QIRA 3JUWA 4UFWA 1Y7RA 1S60A 3F0AA 3R9FA 4AVCA 4KOYA 4CGLA 4LX9A 4MI4A 4OAEA 5G20A 1M4IA 2NMTA 4KVXA 2ZPAA 2Z3PA 4BMHA 3TFYA 3IU2A 4JXQA 2OZHA 2JLMA 1KZFA 2Z3KA 3FB3A 2FIAA 1Z9UA 3P2FA 2Q44A 4FD4A 4KSFA 1OZPA 3G3SA 4CYNA 2REFA 2YNCA 4X5KA 3TO9A 4NEXA 1IB1E 2IL4A 2WUUA 3PZJA 2X7BA 5KTDA 1Y9KA 2Q7BA 2PQ8A 4UCNA 2PSWA 4JLYA 4B5PA 1M44A 2OZUA 4B5PB 4K30A 3WR7A 4OLLA 3DR6A 3T9YA 1FY7A 2RC4A 4KOUA 5F48A 1Z4RA 4JJXA 4MY3A 4RS2A 1S7FA 3DSBA 1U6MA 4U9YA 3H4QA 1Q2CA 4IF5A 5F46A 3BJ8A 1IIDA 4Y49C 4MFPA 1BOBA 2YGWA 4R87A 2GE3A 2PDOA 1YREA 4NSQA 3ZJ0A 5F47A 3IU1A 4JXRA 3JVNA 1S3ZA 4C2XA 2DXQA 3EY5A 3FRMA 4HKFA 1VKCA 5AG6A 2AJ6A 1QSOA 4B5OA 4B11A 1MJ9A 2Q4YA 3W91A 2PRBA 3H5ZA 3IWGA 4ORFA 3TO7A 1QSRA 4L89A 4FD7A 4A2ZA 4ZBGA 3F5BA 3B8GA 3D3SA 3R9EA 2CNTA 2F5IA 2A4NA 1P0HA 4MBUA 3KKWA 4L8AA 2O28A 3T90A 4B14A 1NMTA 2I00A 2J8NA 5JQ4A 3TOAA 4KOXA 3A9LA 3R9GA 5AG4A 4CAXA 1NE9A 4A32A 2HV2A 2G3AA 4CAVA 2FL4A 4CRZB 2OH1A 2FIWA 4H6UA 2DPSA 3EO4A 4Q36A 1YR0A 2HQYA 3ZZIA 3UY5A 2R98A 1XF8A 1B87A 3K9UA 2Z3NA 3LODA 3RYOA 3OWCA 4B12A 5A27A 3FBUA 3VWDA 2P0WA 4XNHB 1YK3A 3PP9A 4E8OA 3N7ZA 2Z3MA 4M3SA 2CY2A 5BWAB 3CXQA 4UCMA 2Y0MA 2VBQA 4AB7A 1I1DA 1YVOA 2CNMA 1QSMA 2REEA 4ONUA 2FCKA 4C68A 1MJAA 1KUYA 1RO5A 5H86A 4MFKA 5I0CA 2FS5A 1I12A 2B3VA 3GKRA 4I49A 5HH1A 2ZW5A 1P4NA 5JPHA 1M1DA 2ZW7A 4PSXA 4NXYA 2WPXA 1QSTA 1S7LA 4B10A 2VEZA 4MY0A 4XPKA 5F49A 4MJ8A 1J4JA 4DNCA 4CGPA 1YGHA 2Q0YA 1Y9WA 1XE4A 2B4DA 3W6SA 2B4DB 3BLNA 2HUZA 4KLWA 4KORA 4KOWA 1BO4A 2VQYA 2PC1A 5J8CA 4KUAA 1IYLA 3E0KA 2CNSA 1YX0A 2ZXVA 1V0CA 3FXTA 4CAWA 4CS0B 2VZYA 3P2HA 5KTAA 5C82A 4JD6A 4CAFA 4QB9A 4B13A 4KVOE 5GCNA 3R96A 3QAHA 4NF1A 2Z3OA 4UWIA 4HNWB 2B5GA 2YNEA 1RXTA 2B5GB 4XPLA 3BJ7A 4JWPA 2FSRA 5AG7A 4F0XA 4UCPA 4MHDA 4PSWA 1XIXA 4II9A 4A31A 4CGMA 3G8WA 2FXFA 4XPDB 4RI1A 1K4JA 1ON0A 5EC4A 2JDCA 3FNCA 1I21A 4CYQA 5IB0A 4YRHA 4XNHC 2G0BA 5J8FA 4AVBA 2R7HA 5FVJA 3NE7A 1WK4A 1MK4A 2KCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YVK A;  3FYN A;  4KVM E;  4Y49 B;  4IUS A;  4PV6 A;  4KZT A;  2FT0 A;  3S6K A;  4HNY B;  3TCV A;  3S6G A;  1M4D A;  2FE7 A;  2ATR A;  4FD5 A;  4AVA A;  3EFA A;  1IIC A;  4AG7 A;  4U5Y A;  1B6B A;  3TE4 A;  2J8R A;  2J8M A;  2B3U A;  1XMT A;  1IYK A;  2BSW A;  3EXN A;  4EVY A;  4QBJ A;  3IGR A;  3D8P A;  3SHP A;  5IX3 A;  3PGP A;  2EVN A;  2B58 A;  4F6A A;  4PK2 A;  2Q04 A;  5ISV A;  4H89 A;  4R57 A;  2ARH A;  4NCZ A;  4AG9 A;  2OB0 A;  4PK3 A;  2G3T A;  5E96 A;  1N71 A;  2D4P A;  4KUB A;  1Z4E A;  4R3L A;  1PU9 A;  4OAD A;  1KUV A;  3S6H A;  1CM0 A;  3R95 A;  3W6X A;  2Q4V A;  3D2M A;  2GIV A;  5DWN A;  1XEB A;  3QB8 A;  2OU2 A;  2GAN A;  2Z10 A;  2JDD A;  4E2A A;  1Q2D A;  2B4B A;  1UFH A;  2QEC A;  2P6F A;  4XPD C;  5CNP A;  2ZW4 A;  4KOV A;  1SQH A;  1LRZ A;  2P6E A;  1TIQ A;  1VHS A;  1MJB A;  2QML A;  3S6F A;  3SXN A;  2VZZ A;  1WWZ A;  4LUA A;  4FD6 A;  3F8K A;  1L0C A;  4KOT A;  4UWJ A;  3D2P A;  3DR8 A;  2R8V A;  1CJW A;  4E0A A;  3FIX A;  3MGD A;  4R9M A;  5EBV A;  2EUI A;  1S5K A;  2BL1 A;  4J3G A;  3GYA A;  3C26 A;  1GHE A;  4QC6 A;  4CRY B;  3I9S A;  4UBR A;  3DDD A;  4M85 A;  3DNS A;  3GY9 A;  2OZG A;  3SXO A;  3R1K A;  5H84 A;  2AE6 A;  4YGO A;  4H6Z A;  2JEV A;  2BEI A;  2I79 A;  1S7K A;  2Z11 A;  2Z0Z A;  2ZW6 A;  1R57 A;  4GS4 A;  2PR1 A;  2BUE A;  2PR8 A;  2R1I A;  4F0Y A;  1NSL A;  4QUS A;  2VI7 A;  5C88 A;  4KOS A;  2K5T A;  1PUA A;  5HMN A;  3TOB A;  4HNX B;  2WPW A;  2P6G A;  4QVT A;  4R3K A;  2C27 A;  1Q2Y A;  3VWE A;  1S7N A;  4KLV A;  4UA3 A;  1QSN A;  3I3G A;  3V8I A;  3CXP A;  2VXK A;  4YFJ A;  4U9Z A;  3TTH A;  5DWM A;  2H5M A;  5KTC A;  1KUX A;  3CXS A;  3TO6 A;  2D4O A;  3LD2 A;  1YLE A;  5IV0 A;  3EC4 A;  1M4G A;  3TT2 A;  2QIR A;  3JUW A;  1Y7R A;  1S60 A;  3F0A A;  3R9F A;  4AVC A;  4KOY A;  4LX9 A;  4MI4 A;  4OAE A;  1M4I A;  2NMT A;  4KVX A;  2ZPA A;  4BMH A;  3TFY A;  4JXQ A;  2OZH A;  2JLM A;  1KZF A;  3FB3 A;  2FIA A;  1Z9U A;  3P2F A;  2Q44 A;  4FD4 A;  1OZP A;  3G3S A;  2REF A;  4X5K A;  3TO9 A;  4NEX A;  1IB1 E;  2IL4 A;  3PZJ A;  2X7B A;  5KTD A;  1Y9K A;  2Q7B A;  2PQ8 A;  2PSW A;  4JLY A;  4B5P A;  1M44 A;  2OZU A;  4B5P B;  4K30 A;  3WR7 A;  4OLL A;  3DR6 A;  3T9Y A;  1FY7 A;  2RC4 A;  4KOU A;  5F48 A;  1Z4R A;  4JJX A;  4MY3 A;  4RS2 A;  1S7F A;  3DSB A;  1U6M A;  4U9Y A;  3H4Q A;  1Q2C A;  4IF5 A;  5F46 A;  3BJ8 A;  1IID A;  4Y49 C;  1BOB A;  4R87 A;  2GE3 A;  2PDO A;  1YRE A;  4NSQ A;  3ZJ0 A;  5F47 A;  4JXR A;  3JVN A;  1S3Z A;  2DXQ A;  3EY5 A;  3FRM A;  4HKF A;  1VKC A;  2AJ6 A;  1QSO A;  4B5O A;  1MJ9 A;  2Q4Y A;  3W91 A;  2PRB A;  3IWG A;  4ORF A;  3TO7 A;  1QSR A;  4L89 A;  4FD7 A;  4ZBG A;  3F5B A;  3B8G A;  3D3S A;  3R9E A;  2CNT A;  2F5I A;  2A4N A;  1P0H A;  4MBU A;  3KKW A;  4L8A A;  2O28 A;  3T90 A;  1NMT A;  2I00 A;  2J8N A;  5JQ4 A;  3TOA A;  4KOX A;  3R9G A;  4CAX A;  1NE9 A;  2HV2 A;  2G3A A;  4CAV A;  2FL4 A;  4CRZ B;  2OH1 A;  2FIW A;  4H6U A;  3EO4 A;  1YR0 A;  2HQY A;  3ZZI A;  3UY5 A;  2R98 A;  1XF8 A;  1B87 A;  3K9U A;  3LOD A;  3RYO A;  3OWC A;  3FBU A;  3VWD A;  2P0W A;  4XNH B;  1YK3 A;  3PP9 A;  4E8O A;  3N7Z A;  4M3S A;  2CY2 A;  3CXQ A;  2Y0M A;  2VBQ A;  4AB7 A;  1I1D A;  1YVO A;  2CNM A;  1QSM A;  2REE A;  4ONU A;  2FCK A;  1MJA A;  1KUY A;  1RO5 A;  5H86 A;  5I0C A;  2FS5 A;  1I12 A;  2B3V A;  3GKR A;  4I49 A;  5HH1 A;  2ZW5 A;  1P4N A;  5JPH A;  1M1D A;  2ZW7 A;  4PSX A;  4NXY A;  2WPX A;  1QST A;  1S7L A;  2VEZ A;  4MY0 A;  4XPK A;  5F49 A;  4MJ8 A;  1J4J A;  4DNC A;  1YGH A;  2Q0Y A;  1Y9W A;  1XE4 A;  2B4D A;  3W6S A;  2B4D B;  3BLN A;  2HUZ A;  4KLW A;  4KOR A;  4KOW A;  1BO4 A;  2VQY A;  2PC1 A;  5J8C A;  4KUA A;  1IYL A;  3E0K A;  2CNS A;  1YX0 A;  2ZXV A;  1V0C A;  3FXT A;  4CAW A;  4CS0 B;  2VZY A;  3P2H A;  5KTA A;  5C82 A;  4JD6 A;  4QB9 A;  4KVO E;  5GCN A;  3R96 A;  3QAH A;  4NF1 A;  4UWI A;  4HNW B;  2B5G A;  1RXT A;  2B5G B;  4XPL A;  3BJ7 A;  4JWP A;  2FSR A;  4MHD A;  4PSW A;  1XIX A;  4II9 A;  3G8W A;  2FXF A;  4XPD B;  4RI1 A;  1K4J A;  1ON0 A;  5EC4 A;  2JDC A;  3FNC A;  1I21 A;  5IB0 A;  4YRH A;  4XNH C;  2G0B A;  5J8F A;  4AVB A;  2R7H A;  5FVJ A;  3NE7 A;  1WK4 A;  1MK4 A;  2KCW A; 
#chains in the Genus database with same CATH topology
 1YVK A;  3KHX A;  1Z8W A;  2PJ4 A;  5CBM A;  3FYN A;  4KVM E;  4Y49 B;  4IUS A;  4PV6 A;  4KZT A;  5JGF A;  3I1U A;  2RFH A;  1XMB A;  4LQ6 A;  4KSA A;  1TF9 A;  4IHM A;  3FH4 A;  4P4F A;  1AYE A;  2FT0 A;  3S6K A;  4HNY B;  2PVV A;  3TCV A;  5J1Q A;  1YLO A;  1M4D A;  3S6G A;  1YW6 A;  2FE7 A;  3GIU A;  5F48 A;  1FT7 A;  4CGO A;  2ATR A;  4FD5 A;  3D67 A;  3KZW A;  3RO0 A;  4AVA A;  4P4J A;  4GXH A;  4B6Z A;  6CPA A;  1ZG8 A;  2GLF A;  3CT9 A;  3SI2 A;  2Q4Z A;  1CP7 A;  3EFA A;  4CYP A;  4ZGY B;  4UEZ A;  3VAR A;  4ONW A;  1IIC A;  3KR5 A;  4AG7 A;  4U5Y A;  1B6B A;  4P10 A;  3TE4 A;  1BAV A;  2J8R A;  5JH9 A;  3GUX A;  2YNC C;  2J8M A;  2B3U A;  3VAT A;  4NGQ A;  5LYD A;  1XMT A;  1IYK A;  2BSW A;  1AUG A;  3EXN A;  4EVY A;  5F09 A;  5G1Z A;  3JTK A;  4QBJ A;  3IGR A;  3D8P A;  3SHP A;  1CPX A;  5IX3 A;  4CPA A;  3PGP A;  3KHZ A;  4MXU A;  2EVN A;  2B58 A;  4F6A A;  1FNO A;  4PK2 A;  3LWU A;  2Q04 A;  3SJE A;  4FUU A;  5ISV A;  4WWV A;  2ZEF A;  4H89 A;  2AFX A;  2ARH A;  4R57 A;  3SI1 A;  4NCZ A;  4AG9 A;  2OB0 A;  1PCA A;  1JWQ A;  4PK3 A;  2G3T A;  1Z8X A;  4CGN A;  2V8H A;  5E96 A;  1N71 A;  4JZ0 A;  4F9U A;  4MHY A;  7CPA A;  2ZEH A;  3K2K A;  2D4P A;  4MFL A;  2FVG A;  4MCS A;  4KUB A;  1Z4E A;  4R3L A;  1Y0Y A;  1PU9 A;  3QNV A;  4BIN A;  5A28 A;  2V8G A;  4OAD A;  3GLJ A;  1KUV A;  1ZLH A;  5G22 A;  2IQ6 A;  3S6H A;  1CM0 A;  5DS0 A;  4OP4 A;  3B3C A;  3R95 A;  2Q4V A;  3W6X A;  5HVG A;  3D2M A;  2DPT A;  2GIV A;  5ELY A;  4NJQ A;  4PXE A;  5AGE A;  4P4I A;  1XEB A;  5DWN A;  3QB8 A;  2OU2 A;  2GAN A;  4M6H A;  3B2Y A;  2CTC A;  3CPA A;  2Z10 A;  2JDD A;  3IC1 A;  3BHX A;  4DUK A;  4E2A A;  3IIB A;  1Q2D A;  4C7I A;  3KQZ A;  1Z5R A;  4MCR A;  2B4B A;  4C2Z A;  1UFH A;  4OIW A;  3N5F A;  2QEC A;  2P6F A;  3CDX A;  1LCP A;  1H8L A;  1A2Z A;  4XPD C;  4MHZ A;  2ZW4 A;  2YND A;  2JEW A;  4KOV A;  1SQH A;  5CNP A;  3KGQ A;  4F8Z A;  3NH8 A;  1LRZ A;  2P6E A;  1TIQ A;  4A30 A;  1VHS A;  4NGN A;  1MJB A;  3L2N A;  2QML A;  2POK A;  3S9L A;  3B7I A;  5CPA A;  3S6F A;  4GM5 A;  4P6Y A;  3SXN A;  2VZZ A;  1WWZ A;  4LUA A;  3IWE A;  1YME A;  2C6C A;  4FD6 A;  2PJ3 A;  2V8V A;  1ELL P;  1IU8 A;  2Z3L A;  3H8F A;  3F8K A;  1L0C A;  4KOT A;  2XEG A;  3PFO A;  4UWJ A;  3D2P A;  3DR8 A;  2F8H A;  3BXM A;  4Q7A A;  2R8V A;  4R7M A;  3IEH A;  5G21 A;  3FX6 A;  1CJW A;  3WC7 A;  4C2Y A;  4E0A A;  3FIX A;  3MGD A;  4R9M A;  5EBV A;  2EUI A;  1S5K A;  4C7H A;  2BL1 A;  4J3G A;  4Q38 A;  3RZA A;  3GYA A;  3C26 A;  1GHE A;  4QC6 A;  1Z8T A;  1VIX A;  4CRY B;  3I9S A;  4UBR A;  3FVL A;  3DDD A;  4M85 A;  3V7Z A;  3IWW A;  3DNS A;  3GY9 A;  4ZX9 A;  2OZG A;  3B3S A;  3SXO A;  3R1K A;  3H8E A;  5H84 A;  2AE6 A;  4NGP A;  4YGO A;  4H6Z A;  2C6P A;  1ZO0 A;  2JEV A;  2BEI A;  2I79 A;  2ANP A;  3PEI A;  4CAE A;  5D29 A;  1S7K A;  4PXD A;  2Z11 A;  2Z0Z A;  4R8F A;  3JRU A;  2CTB A;  2ZW6 A;  5HVH A;  4NJR A;  1R57 A;  1Z2L A;  4GS4 A;  3SI0 A;  3TX8 A;  2PJ2 A;  2PR1 A;  5LRJ A;  5K8O A;  4EME A;  2BUE A;  2WZN A;  4MFQ A;  2PR8 A;  3D7G A;  2R1I A;  2EBJ A;  4K3N A;  4F0Y A;  4A94 A;  1NSL A;  3V38 A;  4QUS A;  4ZYQ A;  3LAC A;  3S9N A;  3LMS A;  4A95 A;  1AMP A;  2ODF A;  2VI7 A;  4PXC A;  5C88 A;  1XRY A;  4KOS A;  2K5T A;  1PUA A;  1IY7 A;  3FF3 A;  4MFJ A;  4R76 A;  1XJO A;  2WSA A;  2QYV A;  3D4U A;  5HMN A;  3D7D A;  3TOB A;  1GYT A;  4HNX B;  4TWE A;  1OBR A;  4DYO A;  2WPW A;  4KS9 A;  2P6G A;  4MCP A;  4BBH A;  2XEI A;  4UFX A;  4PPZ A;  4QVT A;  4R3K A;  2CXA A;  2ZOG A;  2C27 A;  1Q2Y A;  3DGV A;  3VWE A;  1XFO A;  2DF5 A;  2O53 A;  1S7N A;  4KLV A;  4MFZ A;  2J9A A;  4UA3 A;  1QSN A;  3I3G A;  3V8I A;  3CXP A;  3KAS A;  3PB7 X;  1HEE A;  1ZG9 A;  2VXK A;  4U9Z A;  4YFJ A;  3TTH A;  5DWM A;  1Z8L A;  1TKH A;  2V8D A;  2H5M A;  5KTC A;  1KUX A;  3NA6 A;  3D7F A;  2ZEN A;  3SJF A;  3CXS A;  4IK2 A;  1IOI A;  3TO6 A;  4AXV A;  1CX8 A;  4UFV A;  3TC8 A;  2D4O A;  2IJZ A;  5AG5 A;  3T8W A;  3LD2 A;  4CYO A;  4OC1 A;  4OC5 A;  1YLE A;  5IV0 A;  4UIA A;  3EC4 A;  1M4G A;  4OME A;  3TT2 A;  4A33 A;  4F9V A;  2QIR A;  3PB8 X;  3JUW A;  3KI9 A;  2ABZ A;  4UFW A;  1Y7R A;  1S60 A;  3F0A A;  3WAB A;  3B3W A;  2PJ1 A;  3R9F A;  4AVC A;  1F57 A;  4KOY A;  4CGL A;  4LX9 A;  4MI4 A;  4OAE A;  5G20 A;  1M4I A;  1UWY A;  2NMT A;  3MN8 A;  4KVX A;  4A39 A;  2ZPA A;  2Z3P A;  4BMH A;  3TFY A;  3IU2 A;  4JXQ A;  3S9M A;  2OZH A;  2JLM A;  1KZF A;  2Z3K A;  3FB3 A;  2FIA A;  1Z9U A;  3ISZ A;  2Q44 A;  1Y7E A;  1DE4 C;  3P2F A;  3PRT A;  4FD4 A;  1BLL E;  4KSF A;  1OZP A;  3HUV A;  2VL1 A;  3G3S A;  2PJ5 A;  4MHP A;  4CYN A;  1LAP A;  2REF A;  4OC4 A;  2YNC A;  4X5K A;  3TO9 A;  2ZEE A;  4NEX A;  1IB1 E;  4UEE A;  2GRE A;  2IL4 A;  2WUU A;  2ZEO A;  3PZJ A;  2X7B A;  4DJL A;  4A37 A;  5KTD A;  1Y9K A;  4M6I A;  2Q7B A;  2PQ8 A;  4UCN A;  4OC3 A;  2PJC A;  2AFW A;  2PSW A;  1M44 A;  2OZU A;  4JLY A;  4P44 A;  4B5P A;  2CF4 A;  3RAM A;  4NGS A;  1QMU A;  3SJX A;  4B5P B;  4K30 A;  1YQE A;  1LOK A;  2NSM A;  3CPX A;  2PCU A;  4OLL A;  3WR7 A;  3PB9 X;  3DR6 A;  1CG2 A;  3T9Y A;  3IJ3 A;  1FY7 A;  1CP6 A;  2RC4 A;  3NE8 A;  4KOU A;  4HPS A;  1Z4R A;  3B3V A;  4JJX A;  4MY3 A;  3D68 A;  4RS2 A;  1S7F A;  3DSB A;  4MHN A;  1U6M A;  2PJ7 A;  4U9Y A;  5HXD A;  4FAI A;  3H4Q A;  4IAV A;  1Q2C A;  4IF5 A;  5F46 A;  2PJ8 A;  3BJ8 A;  1IID A;  3WC6 A;  2ZEL A;  2IMO A;  2PJ0 A;  4MFP A;  1BOB A;  4Y49 C;  2YGW A;  4R87 A;  2GE3 A;  2PDO A;  1YRE A;  2C6G A;  2DEA A;  2V77 A;  3KL9 A;  4NSQ A;  2ZOF A;  4MRI A;  3ZJ0 A;  5F47 A;  2QVP A;  1LAN A;  3IU1 A;  5IB9 A;  4JXR A;  1XOV A;  3JVN A;  2ZEG A;  1S3Z A;  4C2X A;  2DXQ A;  2AFO A;  2RB7 A;  3CZX A;  3EY5 A;  3RNZ A;  3FRM A;  8CPA A;  1NSA A;  2XEJ A;  4HKF A;  2I3C A;  1VKC A;  4O23 A;  5AG6 A;  2AJ6 A;  1QSO A;  1Y0R A;  5K8P A;  3BI0 A;  3MRU A;  4B5O A;  4B11 A;  1MJ9 A;  2Q4Y A;  3W91 A;  3WC5 A;  3H8G A;  1BPN A;  2PRB A;  1RTQ A;  3H5Z A;  3FJU A;  3IWG A;  3K9T A;  4ORF A;  1QSR A;  3TO7 A;  5LRG A;  4L89 A;  4FD7 A;  4P4B A;  4A2Z A;  4ZBG A;  3F5B A;  3B8G A;  3D3S A;  3R9E A;  2CNT A;  2F5I A;  5LYI A;  2A4N A;  4NGR A;  1P0H A;  4MBU A;  3KKW A;  4EWT A;  1TKF A;  3NH4 A;  1YW4 A;  4L8A A;  4X8I A;  2O28 A;  3T90 A;  4B14 A;  1NMT A;  4OID A;  2I00 A;  1X12 A;  2G9D A;  2PIY A;  2J8N A;  5JQ4 A;  3TOA A;  4MMO A;  4BD9 A;  4FBE A;  4KOX A;  2AFM A;  4UEF A;  4KSI A;  3A9L A;  2XEF A;  4A38 A;  3R9G A;  1HDQ A;  5AG4 A;  4CAX A;  3RBU A;  1NE9 A;  4A32 A;  4NFR A;  3PB6 X;  3D7H A;  4OKO A;  1ZG7 A;  2HV2 A;  4PQA A;  2G3A A;  1LFW A;  2Q51 A;  2F7V A;  3VH9 A;  4CAV A;  2FL4 A;  1LAM A;  1KWM A;  4CRZ B;  2AFU A;  2FIW A;  2OH1 A;  2DPS A;  2PRQ A;  4H6U A;  3EO4 A;  4Q36 A;  1M4L A;  1YR0 A;  2ZED A;  2HQY A;  3ZZI A;  2PJA A;  2EO8 A;  3FED A;  1QQ9 A;  3UY5 A;  2R98 A;  1XF8 A;  3IO1 A;  2BCO A;  3WT4 A;  1B87 A;  3K9U A;  4X2T A;  2Z3N A;  3LOD A;  3RYO A;  3OWC A;  1R3N A;  4B12 A;  4NGT A;  5A27 A;  3FBU A;  3VWD A;  2P0W A;  4XNH B;  1ARL A;  1YK3 A;  2JBJ A;  3PP9 A;  2AFS A;  4P45 A;  3B3T A;  4E8O A;  3N7Z A;  2Z3M A;  4TNU A;  4R6T A;  1YSJ A;  4M3S A;  2CY2 A;  4FWU A;  5BWA B;  3CXQ A;  4UCM A;  1ARM A;  2Y0M A;  2VBQ A;  2CIJ A;  4AB7 A;  1VGY A;  1I1D A;  1YVO A;  5K8M A;  2CNM A;  2HC9 A;  3NFZ A;  1QSM A;  4Z65 A;  5JM6 A;  3B35 A;  2REE A;  4ONU A;  3QAY A;  2FCK A;  1TF8 A;  1MJA A;  4C68 A;  1KUY A;  1RO5 A;  5H86 A;  2HB6 A;  4MFK A;  2NYQ A;  5I0C A;  2FS5 A;  3KR4 A;  1I12 A;  2B3V A;  3FEC A;  3GKR A;  4I49 A;  5HH1 A;  3HLP A;  5D8N A;  5HVF A;  2ZW5 A;  1P4N A;  5JPH A;  1M1D A;  2ZW7 A;  4PSX A;  4NXY A;  2WPX A;  1Q7L A;  1QST A;  1VHE A;  1S7L A;  4W9Y A;  4B10 A;  2VEZ A;  4MY0 A;  5EMI A;  1F2O A;  4XPK A;  4WJB A;  4P4D A;  5F49 A;  1CPS A;  2OR4 A;  1J4J A;  4G1P A;  4MJ8 A;  4ZY2 A;  4DNC A;  4CGP A;  3PFE A;  1YGH A;  1EE3 P;  1IOF A;  3IFE A;  2Q0Y A;  4ZX8 A;  4ZI6 A;  1IGB A;  1Y9W A;  3GB0 A;  1DTD A;  1XE4 A;  2PE3 A;  1F2P A;  1XBU A;  5THW A;  2B4D A;  3W6S A;  4NGM A;  1TKJ A;  2B4D B;  4UF4 A;  2PIZ A;  5LYF A;  1BPM A;  3BLN A;  2HUZ A;  2GLJ A;  3PBB A;  4KLW A;  4KOR A;  4KOW A;  1BO4 A;  5K8N A;  1CBX A;  2BOA A;  2VQY A;  4PXB A;  2PC1 A;  4M6G A;  1R43 A;  5J8C A;  1TXR A;  4MCQ A;  2WYR A;  2QJ8 A;  4KUA A;  4ZY1 A;  1PYT B;  1IYL A;  1VHO A;  2CNS A;  1YX0 A;  2ZXV A;  1V0C A;  1X10 A;  2ZEM A;  3E0K A;  3FXT A;  4CAW A;  4CS0 B;  4JYW A;  2PJ9 A;  4OC0 A;  2VZY A;  2JBK A;  3BI1 A;  3SJG A;  2Q7S A;  4RUH A;  5LYL A;  3FMC A;  3P2H A;  3FEE A;  2PJB A;  3PB4 X;  5C82 A;  5KTA A;  3PBE A;  2PVW A;  2C1C A;  4JD6 A;  4QB9 A;  4B13 A;  4KVO E;  5GCN A;  4CAF A;  3R96 A;  3QAH A;  2OOT A;  4NF1 A;  4UIB A;  4RN7 A;  2AFZ A;  2EWB A;  2Z3O A;  4HNW B;  4UWI A;  1JQG A;  2B5G A;  2YNE A;  1RXT A;  2B5G B;  4XPL A;  3BJ7 A;  2PJ6 A;  3ISX A;  4JWP A;  4YWY A;  2FSR A;  3NH5 A;  5AG7 A;  4F0X A;  4UCP A;  4MHD A;  4PSW A;  1XIX A;  4ZY0 A;  1HDU A;  3D66 A;  4II9 A;  1ZLI A;  2ZEP A;  4A31 A;  2GFQ A;  4CGM A;  4H2K A;  3G8W A;  2FXF A;  4EFD A;  5LRK A;  2O4H A;  4XPD B;  4RI1 A;  1K4J A;  1ON0 A;  2EK9 A;  5I4M A;  5EC4 A;  2BO9 A;  2JDC A;  3FNC A;  4LQG A;  1I21 A;  4CYQ A;  4YU9 A;  4OC2 A;  4YRH A;  5IB0 A;  2Q43 A;  4XNH C;  2EK8 A;  2G0B A;  5J8F A;  4AVB A;  3DLJ A;  1ELM P;  2GU2 A;  4X3R A;  2R7H A;  3KQX A;  5FVJ A;  3NE7 A;  1WK4 A;  1MK4 A;  2KCW A;  4P4E A; 
#chains in the Genus database with same CATH homology
 1YVK A;  3FYN A;  4KVM E;  4Y49 B;  4IUS A;  4PV6 A;  4KZT A;  4KSA A;  2FT0 A;  3S6K A;  4HNY B;  3TCV A;  3S6G A;  1M4D A;  4CGO A;  2FE7 A;  2ATR A;  4FD5 A;  4AVA A;  3EFA A;  4ZGY B;  4CYP A;  1IIC A;  4AG7 A;  4U5Y A;  1B6B A;  3TE4 A;  2J8R A;  2YNC C;  2J8M A;  2B3U A;  1XMT A;  1IYK A;  2BSW A;  3EXN A;  4EVY A;  5G1Z A;  3JTK A;  4QBJ A;  3IGR A;  3D8P A;  3SHP A;  5IX3 A;  3PGP A;  2EVN A;  2B58 A;  4F6A A;  4PK2 A;  2Q04 A;  5ISV A;  4H89 A;  4R57 A;  2ARH A;  4NCZ A;  4AG9 A;  2OB0 A;  4PK3 A;  2G3T A;  4CGN A;  5E96 A;  1N71 A;  2D4P A;  4MFL A;  4KUB A;  1Z4E A;  4R3L A;  1PU9 A;  5A28 A;  4OAD A;  1KUV A;  5G22 A;  3S6H A;  1CM0 A;  3R95 A;  3W6X A;  2Q4V A;  3D2M A;  2DPT A;  2GIV A;  5AGE A;  5DWN A;  1XEB A;  3QB8 A;  2OU2 A;  2GAN A;  2Z10 A;  2JDD A;  4E2A A;  1Q2D A;  4C7I A;  2B4B A;  4C2Z A;  1UFH A;  2QEC A;  2P6F A;  4XPD C;  5CNP A;  2ZW4 A;  2YND A;  4KOV A;  1SQH A;  1LRZ A;  2P6E A;  1TIQ A;  4A30 A;  1VHS A;  1MJB A;  2QML A;  3S6F A;  3SXN A;  2VZZ A;  1WWZ A;  4LUA A;  3IWE A;  4FD6 A;  2Z3L A;  3F8K A;  1L0C A;  4KOT A;  4UWJ A;  3D2P A;  3DR8 A;  2R8V A;  5G21 A;  1CJW A;  4E0A A;  4C2Y A;  3FIX A;  3MGD A;  4R9M A;  5EBV A;  2EUI A;  1S5K A;  4C7H A;  2BL1 A;  4J3G A;  4Q38 A;  3GYA A;  3C26 A;  1GHE A;  4QC6 A;  4CRY B;  3I9S A;  4UBR A;  3DDD A;  4M85 A;  3DNS A;  3GY9 A;  2OZG A;  3SXO A;  3R1K A;  5H84 A;  2AE6 A;  4YGO A;  4H6Z A;  1ZO0 A;  2JEV A;  2BEI A;  2I79 A;  4CAE A;  1S7K A;  2Z11 A;  2Z0Z A;  2ZW6 A;  1R57 A;  4GS4 A;  2PR1 A;  2BUE A;  4MFQ A;  2PR8 A;  2R1I A;  4F0Y A;  1NSL A;  4QUS A;  4A95 A;  2VI7 A;  5C88 A;  4KOS A;  2K5T A;  1PUA A;  4MFJ A;  2WSA A;  5HMN A;  3TOB A;  4HNX B;  2WPW A;  4KS9 A;  2P6G A;  4BBH A;  4UFX A;  4QVT A;  4R3K A;  2CXA A;  2C27 A;  1Q2Y A;  3VWE A;  1S7N A;  4KLV A;  4MFZ A;  4UA3 A;  1QSN A;  3I3G A;  3V8I A;  3CXP A;  2VXK A;  4YFJ A;  4U9Z A;  3TTH A;  5DWM A;  2H5M A;  5KTC A;  1KUX A;  3CXS A;  3TO6 A;  4UFV A;  2D4O A;  5AG5 A;  3LD2 A;  4CYO A;  1YLE A;  5IV0 A;  3EC4 A;  1M4G A;  3TT2 A;  4A33 A;  2QIR A;  3JUW A;  4UFW A;  1Y7R A;  1S60 A;  3F0A A;  3R9F A;  4AVC A;  4KOY A;  4CGL A;  4LX9 A;  4MI4 A;  4OAE A;  5G20 A;  1M4I A;  2NMT A;  4KVX A;  2ZPA A;  2Z3P A;  4BMH A;  3TFY A;  3IU2 A;  4JXQ A;  2OZH A;  2JLM A;  1KZF A;  2Z3K A;  3FB3 A;  2FIA A;  1Z9U A;  3P2F A;  2Q44 A;  4FD4 A;  4KSF A;  1OZP A;  3G3S A;  4CYN A;  2REF A;  2YNC A;  4X5K A;  3TO9 A;  4NEX A;  1IB1 E;  2IL4 A;  2WUU A;  3PZJ A;  2X7B A;  5KTD A;  1Y9K A;  2Q7B A;  2PQ8 A;  4UCN A;  2PSW A;  4JLY A;  4B5P A;  1M44 A;  2OZU A;  4B5P B;  4K30 A;  3WR7 A;  4OLL A;  3DR6 A;  3T9Y A;  1FY7 A;  2RC4 A;  4KOU A;  5F48 A;  1Z4R A;  4JJX A;  4MY3 A;  4RS2 A;  1S7F A;  3DSB A;  1U6M A;  4U9Y A;  3H4Q A;  1Q2C A;  4IF5 A;  5F46 A;  3BJ8 A;  1IID A;  4Y49 C;  4MFP A;  1BOB A;  2YGW A;  4R87 A;  2GE3 A;  2PDO A;  1YRE A;  4NSQ A;  3ZJ0 A;  5F47 A;  3IU1 A;  4JXR A;  3JVN A;  1S3Z A;  4C2X A;  2DXQ A;  3EY5 A;  3FRM A;  4HKF A;  1VKC A;  5AG6 A;  2AJ6 A;  1QSO A;  4B5O A;  4B11 A;  1MJ9 A;  2Q4Y A;  3W91 A;  2PRB A;  3H5Z A;  3IWG A;  4ORF A;  3TO7 A;  1QSR A;  4L89 A;  4FD7 A;  4A2Z A;  4ZBG A;  3F5B A;  3B8G A;  3D3S A;  3R9E A;  2CNT A;  2F5I A;  2A4N A;  1P0H A;  4MBU A;  3KKW A;  4L8A A;  2O28 A;  3T90 A;  4B14 A;  1NMT A;  2I00 A;  2J8N A;  5JQ4 A;  3TOA A;  4KOX A;  3A9L A;  3R9G A;  5AG4 A;  4CAX A;  1NE9 A;  4A32 A;  2HV2 A;  2G3A A;  4CAV A;  2FL4 A;  4CRZ B;  2OH1 A;  2FIW A;  4H6U A;  2DPS A;  3EO4 A;  4Q36 A;  1YR0 A;  2HQY A;  3ZZI A;  3UY5 A;  2R98 A;  1XF8 A;  1B87 A;  3K9U A;  2Z3N A;  3LOD A;  3RYO A;  3OWC A;  4B12 A;  5A27 A;  3FBU A;  3VWD A;  2P0W A;  4XNH B;  1YK3 A;  3PP9 A;  4E8O A;  3N7Z A;  2Z3M A;  4M3S A;  2CY2 A;  5BWA B;  3CXQ A;  4UCM A;  2Y0M A;  2VBQ A;  4AB7 A;  1I1D A;  1YVO A;  2CNM A;  1QSM A;  2REE A;  4ONU A;  2FCK A;  4C68 A;  1MJA A;  1KUY A;  1RO5 A;  5H86 A;  4MFK A;  5I0C A;  2FS5 A;  1I12 A;  2B3V A;  3GKR A;  4I49 A;  5HH1 A;  2ZW5 A;  1P4N A;  5JPH A;  1M1D A;  2ZW7 A;  4PSX A;  4NXY A;  2WPX A;  1QST A;  1S7L A;  4B10 A;  2VEZ A;  4MY0 A;  4XPK A;  5F49 A;  4MJ8 A;  1J4J A;  4DNC A;  4CGP A;  1YGH A;  2Q0Y A;  1Y9W A;  1XE4 A;  2B4D A;  3W6S A;  2B4D B;  3BLN A;  2HUZ A;  4KLW A;  4KOR A;  4KOW A;  1BO4 A;  2VQY A;  2PC1 A;  5J8C A;  4KUA A;  1IYL A;  3E0K A;  2CNS A;  1YX0 A;  2ZXV A;  1V0C A;  3FXT A;  4CAW A;  4CS0 B;  2VZY A;  3P2H A;  5KTA A;  5C82 A;  4JD6 A;  4CAF A;  4QB9 A;  4B13 A;  4KVO E;  5GCN A;  3R96 A;  3QAH A;  4NF1 A;  2Z3O A;  4UWI A;  4HNW B;  2B5G A;  2YNE A;  1RXT A;  2B5G B;  4XPL A;  3BJ7 A;  4JWP A;  2FSR A;  5AG7 A;  4F0X A;  4UCP A;  4MHD A;  4PSW A;  1XIX A;  4II9 A;  4A31 A;  4CGM A;  3G8W A;  2FXF A;  4XPD B;  4RI1 A;  1K4J A;  1ON0 A;  5EC4 A;  2JDC A;  3FNC A;  1I21 A;  4CYQ A;  5IB0 A;  4YRH A;  4XNH C;  2G0B A;  5J8F A;  4AVB A;  2R7H A;  5FVJ A;  3NE7 A;  1WK4 A;  1MK4 A;  2KCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...