2CY2A

Crystal structure of ttha1209 in complex with acetyl coenzyme a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
174
structure length
174
Chain Sequence
VRIRRAGLEDLPGVARVLVDTWRATYRGVVPEAFLEGLSYEGQAERWAQRLKTPTWPGRLFVAESESGEVVGFAAFGPDRASGFPGYTAELWAIYVLPTWQRKGLGRALFHEGARLLQAEGYGRMLVWVLKENPKGRGFYEHLGGVLLGEREIELGGAKLWEVAYGFDLGGHKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords probable acetyltransferase
publication title Crystal structure of TTHA1209 in complex with acetyl coenzyme A
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 48
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2cy2A00
2VZYA 2Y0MA 4XNHB 1NE9A 1K4JA 2R98A 3D3SA 5H86A 2BSWA 5IX3A 2X7BA 4K30A 4UWJA 4QUSA 3D8PA 3W6XA 3TO6A 4H89A 1KZFA 1BO4A 5DWNA 2ZW5A 2J8RA 3W91A 3TOAA 4KLWA 4QB9A 2ZW7A 4HNXB 2G0BA 2Z0ZA 2JLMA 4Y49B 1Z4RA 4MY3A 3TOBA 3PZJA 4AVBA 3H4QA 3K9UA 2P0WA 3B8GA 2OZHA 2Z10A 3GYAA 4JD6A 1QSNA 4HNYB 3I9SA 4B5PB 2KCWA 4KUBA 3TO7A 1R57A 4M3SA 4FD5A 3TT2A 4KOWA 4CRZB 2D4PA 2Q0YA 4KZTA 2P6FA 5KTAA 3R9FA 4CAWA 1VKCA 2FCKA 3R9GA 1L0CA 4R3KA 2PRBA 3EO4A 1NMTA 2CNSA 3FYNA 4JWPA 3R95A 1GHEA 2OZUA 4MHDA 5EC4A 4QBJA 4FD6A 1I1DA 2A4NA 3EY5A 4UA3A 3TFYA 1IICA 4CRYB 1YVOA 1OZPA 1S7NA 1YX0A 3W6SA 2FIWA 5E96A 5C88A 4OLLA 1QSOA 3LD2A 2GANA 4CAVA 1YLEA 1YR0A 2EUIA 1MK4A 4R3LA 2IL4A 3OWCA 1PUAA 2JEVA 4B5PA 4EVYA 4KVXA 4RS2A 4PV6A 4E8OA 4U9ZA 4NEXA 4FD4A 3N7ZA 3P2HA 4R87A 3TE4A 4X5KA 4NF1A 4MBUA 3QAHA 4ZBGA 3T9YA 2H5MA 1BOBA 2B4BA 4KOXA 2JDCA 1S5KA 2HV2A 3IGRA 5DWMA 4KUAA 2G3TA 5HH1A 2O28A 3SXNA 3JVNA 4KOSA 2VBQA 3EFAA 2D4OA 2JDDA 3GY9A 2PR1A 2CNTA 1QSTA 1KUVA 2PDOA 4ORFA 1S7FA 3F0AA 2Q7BA 5KTDA 5J8FA 2I00A 2FSRA 2G3AA 3G3SA 5F49A 2Q44A 4XPKA 3FBUA 1M4IA 1LRZA 1YREA 4HNWB 5C82A 4OAEA 2OU2A 1Y9WA 2B4DB 4H6ZA 4MY0A 1CJWA 2DXQA 2J8NA 2GIVA 5F47A 3IWGA 2QIRA 3VWDA 2HQYA 2PQ8A 2BEIA 3FIXA 3SXOA 3G8WA 1WWZA 3F8KA 4NSQA 4CAXA 3S6KA 3QB8A 3FXTA 2WPXA 2B5GB 4OADA 1S7LA 2P6EA 4R57A 3TCVA 2Z11A 4I49A 2J8MA 2B3UA 5F48A 4QC6A 4JXRA 4IF5A 5IV0A 3UY5A 4MJ8A 1Z4EA 3JUWA 1ON0A 3S6HA 3S6GA 3R1KA 3T90A 3C26A 5H84A 4LUAA 1MJBA 2QECA 4YFJA 1IIDA 2B4DA 2R1IA 5CNPA 4AVAA 1XE4A 2Q04A 2AE6A 1B6BA 5F46A 1XMTA 4KLVA 3R9EA 2PR8A 4FD7A 1Q2DA 1I21A 2FT0A 4XNHC 2FS5A 4YGOA 3BLNA 4XPDC 1RO5A 2B5GA 4KORA 4B5OA 4M85A 1VHSA 3PGPA 2ZXVA 3FRMA 1M1DA 3PP9A 2OZGA 4AB7A 4II9A 3I3GA 3V8IA 1S7KA 1U6MA 3DSBA 5JPHA 2R7HA 2VEZA 1B87A 2B3VA 4AG7A 1PU9A 2ZW4A 2WPWA 2FE7A 2FL4A 4Y49C 2CY2A 2AJ6A 5FVJA 4DNCA 3TO9A 4AG9A 4IUSA 1IYKA 4LX9A 2I79A 1XIXA 1I12A 4KOVA 2K5TA 4PK2A 3D2MA 5GCNA 3MGDA 1P0HA 1V0CA 1J4JA 4XPDB 2RC4A 1KUYA 3GKRA 2PSWA 3E0KA 2REEA 2R8VA 3EC4A 2HUZA 5IB0A 3EXNA 2Q4VA 5HMNA 4BMHA 3FNCA 2ARHA 4F6AA 4KOUA 3CXPA 2VI7A 2REFA 1Q2CA 2B58A 3F5BA 4E0AA 4E2AA 1XF8A 3ZJ0A 4HKFA 4CS0B 2Q4YA 1Y7RA 1Q2YA 4JLYA 1P4NA 4KVOE 4L8AA 5EBVA 1TIQA 4JXQA 3VWEA 1N71A 4MI4A 1M4DA 1YK3A 3BJ7A 4QVTA 1S3ZA 4PSXA 5J8CA 3CXSA 1QSRA 2BL1A 4U5YA 2VXKA 1S60A 1RXTA 4J3GA 3D2PA 1Z9UA 2NMTA 3DR8A 2VZZA 2PC1A 1IYLA 4PK3A 2EVNA 3SHPA 2P6GA 3RYOA 1YVKA 1Y9KA 4H6UA 4F0YA 3DNSA 2QMLA 4GS4A 4R9MA 2GE3A 2ZPAA 1M4GA 2OH1A 1SQHA 3FB3A 4ONUA 4KOTA 5KTCA 2FIAA 1IB1E 1NSLA 3S6FA 4KVME 3ZZIA 2FXFA 2BUEA 1XEBA 1FY7A 1WK4A 1MJAA 1YGHA 2ZW6A 3DR6A 4AVCA 4UWIA 4UBRA 3CXQA 2ATRA 4NXYA 4JJXA 2F5IA 3LODA 1CM0A 5ISVA 4L89A 4PSWA 3R96A 4NCZA 2VQYA 1QSMA 3KKWA 4RI1A 4U9YA 3P2FA 4XPLA 3WR7A 2CNMA 1MJ9A 3BJ8A 1M44A 3DDDA 5I0CA 1UFHA 1KUXA 5JQ4A 3NE7A 2C27A 3TTHA 2OB0A 4KOYA 4YRHA
chains in the Genus database with same CATH superfamily
5H86A 2VZYA 2Y0MA 1ZG7A 4OKOA 4XNHB 1NE9A 1Z8TA 4JZ0A 3SJEA 1K4JA 2R98A 3D3SA 3IFEA 2BSWA 3K9TA 2X7BA 3PFEA 2Z3KA 4K30A 4OC5A 5G22A 4UWJA 1TF9A 4QUSA 3D8PA 4NGRA 3W6XA 1QMUA 3TO6A 4H89A 4FBEA 1KZFA 1BO4A 4P10A 4M6HA 5DWNA 1LAMA 5AGEA 2ZW5A 2J8RA 1RTQA 3W91A 4GM5A 3TOAA 5THWA 4KLWA 4QB9A 2ZW7A 5JGFA 3WT4A 4HNXB 2BO9A 3PBBA 4UCMA 2G0BA 2Z0ZA 2Q51A 3S9NA 5K8PA 2JLMA 4Y49B 2HB6A 1HDUA 1Z4RA 2GFQA 4MY3A 4C68A 3TOBA 3PZJA 2FVGA 2O53A 3B3WA 3CPAA 3H4QA 1F57A 3K9UA 2P0WA 3L2NA 4ZX8A 2C6PA 3B8GA 1Y0RA 2OZHA 3IJ3A 2Z10A 3GYAA 4F0XA 2ZEOA 4JD6A 1QSNA 3WC6A 4A94A 4HNYB 3BXMA 3I9SA 4X2TA 3B3VA 2XEIA 5LYIA 2KCWA 2PJAA 4KUBA 4OIDA 3TO7A 3WABA 4B5PB 2EBJA 1R57A 4FD5A 3GUXA 4M3SA 3TT2A 1LAPA 2DPSA 2D4PA 4KOWA 4A2ZA 4CGLA 4CRZB 2Z3NA 4ZY1A 2YGWA 4W9YA 1IOFA 1R3NA 1YW6A 2Z3LA 3IO1A 3KGQA 2Q0YA 4KZTA 2P6FA 2ZOGA 3FECA 5KTAA 5LYLA 3R9FA 3KHXA 4CAWA 1VKCA 2FCKA 2ODFA 3R9GA 1L0CA 5BWAB 4R3KA 2PRBA 3EO4A 1NMTA 2CNSA 1IGBA 3NH5A 1AYEA 3FYNA 4JWPA 1ELLP 3R95A 4P45A 2JBKA 4MHYA 4OC2A 3S9LA 1CG2A 1GHEA 4MXUA 4NGTA 2OZUA 2AFWA 2PJ8A 2V8GA 3FEDA 3B7IA 4FAIA 4MFQA 4MHDA 5EC4A 4AVBA 4QBJA 4FD6A 1TKFA 1I1DA 2A4NA 3EY5A 2I3CA 4UA3A 3TFYA 2GU2A 2PIYA 1IICA 1ZLIA 2EWBA 4CRYB 1YVOA 1OZPA 4CGNA 5A28A 1S7NA 1YX0A 4A31A 1AUGA 3W6SA 5HVHA 2FIWA 3KASA 5E96A 4MCSA 5C88A 1R43A 1UWYA 4OLLA 3NH8A 1QSOA 2F7VA 4P6YA 3LD2A 4Q38A 1XBUA 3HLPA 3N5FA 5I4MA 4HPSA 2GANA 2XEGA 1ZG8A 4ZX9A 4CAVA 2AFXA 3D7HA 3IEHA 4A95A 1YLEA 1YQEA 3H8EA 4YU9A 1YR0A 2EUIA 5AG6A 1MK4A 2PJ1A 3BHXA 4R3LA 2IL4A 3DLJA 3TX8A 4A37A 2PJ2A 1KWMA 2CTBA 4M6IA 4PXBA 3OWCA 4B11A 3KZWA 1PUAA 2JEVA 4B5PA 4MFJA 4R6TA 4EVYA 4KVXA 1CPXA 4RS2A 5HVFA 3RBUA 4WJBA 3KL9A 4NJRA 4PV6A 4E8OA 4U9ZA 3FH4A 3QNVA 1F2PA 4FD4A 3N7ZA 3P2HA 4NEXA 2QYVA 4R87A 5AG4A 4X5KA 3TE4A 4X3RA 2AFZA 4NGQA 4NF1A 4MBUA 3QAHA 4ZBGA 3T9YA 1VIXA 2H5MA 1BOBA 2B4BA 3PB8X 4KOXA 4NGSA 2JDCA 1S5KA 2HV2A 3JRUA 4YWYA 3IGRA 2CTCA 4MFZA 1YLOA 4KUAA 5DWMA 1YW4A 4K3NA 2G3TA 5HH1A 1YSJA 2V8HA 3D7GA 3H5ZA 4UFXA 2O28A 3SXNA 4A33A 3RZAA 3B3SA 3JVNA 4MCRA 4CAEA 4KOSA 2VBQA 4A32A 5JM6A 5G1ZA 4KSFA 5K8NA 3EFAA 4PQAA 4CYQA 4MFPA 1LCPA 4BINA 2D4OA 2JDDA 3GY9A 4PPZA 4Q7AA 2PR1A 2ZEMA 2J9AA 1XOVA 2ZEHA 4MHZA 2CNTA 1QSTA 2VL1A 1KUVA 4JYWA 2PDOA 4ORFA 3ISZA 1CPSA 1DTDA 1XJOA 1Z2LA 3KQXA 4PXCA 3GB0A 1S7FA 3F0AA 3JTKA 2Q7BA 5KTDA 1FNOA 3SJGA 5J8FA 2I00A 3IC1A 2FSRA 4CPAA 2G3AA 3G3SA 3LMSA 5F49A 1IOIA 3RAMA 1XMBA 2Q44A 2XEJA 2GREA 2PJCA 4XPKA 3FBUA 1A2ZA 4P44A 1M4IA 3PB6X 1LRZA 8CPAA 1YREA 4CGMA 4HNWB 5C82A 2V8VA 4OAEA 1ELMP 3PB4X 1HEEA 2OU2A 1XRYA 2AFMA 5ELYA 4UIAA 1VGYA 1Y9WA 2B4DB 4H6ZA 4MY0A 3KI9A 4ZY2A 4B13A 1CJWA 2DXQA 2JBJA 2PJ0A 2J8NA 2YNEA 2GIVA 2IMOA 2C6CA 5F47A 4ZI6A 3IWGA 2QIRA 3FMCA 3CT9A 1GYTA 4X8IA 7CPAA 4UFVA 5LYFA 3VWDA 2HQYA 2PQ8A 1Q7LA 2BEIA 3FIXA 1HDQA 3SXOA 4MFLA 4P4BA 4UCNA 1XFOA 2AFSA 3G8WA 1WWZA 3F8KA 4NSQA 4FWUA 2GLFA 4CAXA 3S6KA 4NGMA 3QB8A 3FXTA 4P4DA 2WPXA 2PJ4A 5LRKA 3T8WA 2B5GB 2QVPA 2ZOFA 4OADA 5HXDA 1TKJA 1S7LA 2P6EA 2PJ6A 4UF4A 2CF4A 2XEFA 3B2YA 4R57A 3TCVA 5F09A 2Z11A 3MRUA 4IAVA 4MCQA 1TXRA 4I49A 1JQGA 2EO8A 2PVVA 2J8MA 1BPNA 2B3UA 2EK9A 3B3CA 4UIBA 4QC6A 5F48A 4JXRA 3SI1A 4R7MA 4DJLA 4B6ZA 4IF5A 5IV0A 3UY5A 4MJ8A 1Z4EA 3JUWA 2Q7SA 2ZELA 4NJQA 1ON0A 2PJ5A 3D4UA 3V38A 2V77A 3FF3A 4AXVA 2BOAA 3S6HA 3S6GA 1Y7EA 3R1KA 3T90A 3KR5A 3WC5A 1LANA 2PCUA 3B35A 2PJBA 2EK8A 2Z3OA 3RO0A 3VH9A 3C26A 5H84A 3CDXA 3D68A 4LUAA 4A39A 1MJBA 2QECA 4YFJA 1Z8WA 3PB7X 1IIDA 2B4DA 4ONWA 4C7IA 2DPTA 6CPAA 3PBEA 2R1IA 3PEIA 3VARA 3A9LA 5CNPA 1VHEA 4AVAA 1CP6A 1LOKA 1XE4A 2Q04A 3KQZA 4MMOA 4CAFA 2WYRA 3MN8A 2AE6A 1Z8XA 1B6BA 5F46A 3LACA 4UEFA 1XMTA 4RN7A 4KLVA 3R9EA 4Z65A 3KHZA 2PR8A 4FD7A 1Q2DA 2PVWA 1I21A 5LRGA 1NSAA 2FT0A 4F9UA 4XNHC 5LYDA 2FS5A 1F2OA 1JWQA 2GLJA 3BLNA 4IHMA 4YGOA 5IX3A 4XPDC 1TKHA 1RO5A 2B5GA 3HUVA 4KORA 4B5OA 4OC4A 4ZGYB 4M85A 5K8MA 1VHSA 1X12A 1BAVA 3SJFA 5IB9A 3PGPA 1H8LA 2IJZA 3FEEA 3QAYA 5J1QA 2PIZA 4MFKA 2ZXVA 3FRMA 4F9VA 1M1DA 4RUHA 3PP9A 2OZGA 4UFWA 4AB7A 4II9A 3I3GA 3V8IA 3IU2A 1S7KA 4OC0A 1U6MA 2ZEGA 2ANPA 2C6GA 4UEZA 2WSAA 3DSBA 4EMEA 1ARLA 2CIJA 3WC7A 5JPHA 2R7HA 3D7DA 3KR4A 3PB9X 4B14A 2DF5A 2PJ9A 2VEZA 2ZENA 3SI2A 4EWTA 1CX8A 1B87A 5AG5A 2B3VA 4H2KA 4AG7A 4R76A 1PU9A 2C1CA 2ZW4A 1BPMA 2FE7A 2WPWA 2FL4A 3SI0A 4Y49C 2CY2A 4R8FA 2AJ6A 4MHNA 5FVJA 2BCOA 3PRTA 4DNCA 3TO9A 4AG9A 4IUSA 3IU1A 1IYKA 3D66A 4NGPA 1OBRA 4LX9A 2I79A 1XIXA 1I12A 4OC3A 4P4FA 4CGPA 4KOVA 2K5TA 4A30A 3NH4A 4PK2A 4KSAA 3D2MA 5GCNA 3NA6A 3MGDA 4NGNA 4BBHA 1P0HA 1V0CA 1ARMA 1J4JA 2NYQA 4XPDB 2RC4A 1IY7A 1KUYA 3GKRA 2PSWA 3E0KA 2ZEPA 3I1UA 5CPAA 4UEEA 1CP7A 2REEA 3IWEA 3ISXA 4DYOA 1EE3P 3D67A 4WWVA 2YNCC 2R8VA 3EC4A 2HUZA 4KS9A 4ZY0A 2CXAA 3CZXA 3GLJA 5IB0A 3EXNA 2Q4VA 4MHPA 4P4EA 5HMNA 4BMHA 1YMEA 3FNCA 2ARHA 5D8NA 4F6AA 4KOUA 3CXPA 2VI7A 2REFA 5K8OA 3D7FA 1Q2CA 2B58A 3IWWA 3F5BA 4E0AA 4DUKA 4E2AA 4CGOA 1XF8A 1FT7A 2PJ7A 3ZJ0A 4HKFA 4NFRA 4CS0B 2Q4YA 2V8DA 5G20A 1Y7RA 1Q2YA 4JLYA 4OC1A 1Z8LA 2WUUA 2PE3A 1P4NA 3SJXA 1AMPA 4FUUA 4IK2A 4KVOE 4L8AA 5EBVA 1DE4C 4B10A 3FVLA 1TIQA 3IIBA 4JXQA 5HVGA 4CYPA 3VWEA 1N71A 4MI4A 1M4DA 1YK3A 4Q36A 1BLLE 4UCPA 3BJ7A 3CPXA 2ABZA 2NSMA 4QVTA 2PJ3A 1S3ZA 4PSXA 5J8CA 1Y0YA 3CXSA 1QSRA 2BL1A 4U5YA 2VXKA 1S60A 1RXTA 2PRQA 3B3TA 4J3GA 3D2PA 1Z9UA 1CBXA 2NMTA 3DR8A 4O23A 2OOTA 2VZZA 1ZLHA 2IQ6A 2PC1A 4C7HA 5CBMA 1IYLA 2Z3MA 1ZG9A 3DGVA 4LQ6A 3NFZA 4PK3A 5JH9A 2EVNA 3RNZA 3SHPA 4TNUA 1TF8A 2P6GA 1PCAA 3RYOA 4GXHA 1YVKA 1Y9KA 2RB7A 4H6UA 4F8ZA 1M4LA 4F0YA 1QQ9A 4G1PA 1X10A 4PXDA 5AG7A 3DNSA 3V7ZA 2QMLA 4GS4A 5A27A 3FJUA 4R9MA 4ZYQA 2GE3A 2ZPAA 1M4GA 2HC9A 2OH1A 4MCPA 5G21A 1SQHA 3FB3A 4BD9A 4CYNA 4CYOA 3H8GA 4ONUA 1IU8A 4KOTA 1PYTB 5KTCA 2FIAA 2ZEDA 4TWEA 5DS0A 4M6GA 2G9DA 4KSIA 1IB1E 2DEAA 1NSLA 3S6FA 2Q43A 4KVME 3ZZIA 4B12A 2FXFA 2ZEFA 3TC8A 2BUEA 3H8FA 1XEBA 1Z5RA 1FY7A 3NE8A 1WK4A 2WZNA 1MJAA 1YGHA 2OR4A 4OP4A 2ZW6A 3DR6A 4AVCA 4C2YA 5LRJA 1LFWA 3FX6A 4PXEA 4UWIA 2QJ8A 4C2XA 4UBRA 3CXQA 2ATRA 2POKA 4NXYA 4JJXA 2F5IA 1VHOA 3LODA 1CM0A 2F8HA 3VATA 4MRIA 4P4IA 5ISVA 3LWUA 4L89A 4C2ZA 2JEWA 4PSWA 3R96A 2ZEEA 3BI0A 2VQYA 2Q4ZA 4NCZA 1QSMA 2Z3PA 3KKWA 5D29A 4RI1A 4U9YA 2YNDA 3P2FA 4XPLA 3WR7A 2CNMA 1MJ9A 3BJ8A 3BI1A 1M44A 2O4HA 3DDDA 1UFHA 2YNCA 3PFOA 4A38A 5I0CA 1KUXA 5JQ4A 4OMEA 1ZO0A 2AFOA 2AFUA 4LQGA 3NE7A 4EFDA 2C27A 2RFHA 3K2KA 4OIWA 3S9MA 3TTHA 4P4JA 2OB0A 4KOYA 5EMIA 3GIUA 4YRHA
chains in the Genus database with same CATH topology
2VZYA 2Y0MA 4XNHB 1NE9A 1K4JA 2R98A 3D3SA 5H86A 2BSWA 5IX3A 2X7BA 2Z3KA 4K30A 5G22A 4UWJA 4QUSA 3D8PA 3W6XA 3TO6A 4H89A 1KZFA 1BO4A 5DWNA 5AGEA 2ZW5A 2J8RA 3W91A 3TOAA 4KLWA 4QB9A 2ZW7A 4HNXB 4UCMA 2G0BA 2Z0ZA 2JLMA 4Y49B 1Z4RA 4MY3A 4C68A 3TOBA 3PZJA 4AVBA 3H4QA 3K9UA 2P0WA 3B8GA 2OZHA 2Z10A 3GYAA 4F0XA 4JD6A 1QSNA 4HNYB 3I9SA 4B5PB 2KCWA 4KUBA 3TO7A 1R57A 4FD5A 4M3SA 3TT2A 2DPSA 4KOWA 2D4PA 4A2ZA 4CRZB 4CGLA 2Z3NA 2YGWA 2Z3LA 2Q0YA 4KZTA 2P6FA 5KTAA 3R9FA 4CAWA 1VKCA 2FCKA 3R9GA 5BWAB 1L0CA 4R3KA 2PRBA 3EO4A 1NMTA 2CNSA 3FYNA 4JWPA 3R95A 1GHEA 2OZUA 4MFQA 4MHDA 5EC4A 4QBJA 4FD6A 1I1DA 2A4NA 3EY5A 4UA3A 3TFYA 1IICA 4CRYB 1YVOA 1OZPA 4CGNA 5A28A 1S7NA 1YX0A 4A31A 3W6SA 2FIWA 5E96A 5C88A 4OLLA 1QSOA 3LD2A 4Q38A 2GANA 4CAVA 4A95A 1YLEA 1YR0A 2EUIA 5AG6A 1MK4A 4R3LA 2IL4A 4B11A 3OWCA 4ZGYB 1PUAA 2JEVA 4B5PA 4MFJA 4EVYA 4KVXA 4RS2A 4PV6A 4E8OA 4U9ZA 4NEXA 4FD4A 3N7ZA 3P2HA 4R87A 5AG4A 3TE4A 4X5KA 4NF1A 4MBUA 3QAHA 4ZBGA 3T9YA 2H5MA 1BOBA 2B4BA 4KOXA 2JDCA 1S5KA 2HV2A 3IGRA 4MFZA 5DWMA 4KUAA 2G3TA 5HH1A 3H5ZA 4UFXA 2O28A 3SXNA 4A33A 3JVNA 4CAEA 4KOSA 2VBQA 4A32A 5G1ZA 4KSFA 3EFAA 4CYQA 4MFPA 2D4OA 2JDDA 3GY9A 2PR1A 2CNTA 1QSTA 1KUVA 2PDOA 4ORFA 1S7FA 3F0AA 3JTKA 2Q7BA 5KTDA 5J8FA 2I00A 2FSRA 2G3AA 3G3SA 5F49A 2Q44A 4XPKA 3FBUA 1M4IA 1LRZA 1YREA 4CGMA 4HNWB 5C82A 4OAEA 2OU2A 1Y9WA 2B4DB 4H6ZA 4MY0A 4B13A 1CJWA 2DXQA 2J8NA 2YNEA 2GIVA 5F47A 3IWGA 2QIRA 4UFVA 3VWDA 2HQYA 2PQ8A 2BEIA 3FIXA 3SXOA 4MFLA 4UCNA 3G8WA 1WWZA 3F8KA 4NSQA 4CAXA 3S6KA 3QB8A 3FXTA 2WPXA 2B5GB 4OADA 1S7LA 2P6EA 4R57A 3TCVA 2Z11A 4I49A 2J8MA 2B3UA 5F48A 4QC6A 4JXRA 4IF5A 5IV0A 3UY5A 4MJ8A 1Z4EA 3JUWA 1ON0A 3S6HA 3S6GA 3R1KA 3T90A 2Z3OA 3C26A 5H84A 4LUAA 1MJBA 2QECA 4YFJA 1IIDA 2B4DA 4C7IA 2DPTA 2R1IA 3A9LA 5CNPA 4AVAA 1XE4A 2Q04A 4CAFA 2AE6A 1B6BA 5F46A 1XMTA 4KLVA 3R9EA 2PR8A 4FD7A 1Q2DA 1I21A 2FT0A 4XNHC 2FS5A 4YGOA 3BLNA 4XPDC 1RO5A 2B5GA 4KORA 4B5OA 4M85A 1VHSA 3PGPA 4MFKA 2ZXVA 3FRMA 1M1DA 3PP9A 2OZGA 4UFWA 4AB7A 4II9A 3I3GA 3V8IA 3IU2A 1S7KA 1U6MA 2WSAA 3DSBA 5JPHA 2R7HA 4B14A 2VEZA 1B87A 5AG5A 2B3VA 4AG7A 1PU9A 2ZW4A 2WPWA 2FE7A 2FL4A 4Y49C 2CY2A 2AJ6A 5FVJA 4DNCA 3TO9A 4AG9A 4IUSA 3IU1A 1IYKA 4LX9A 4CGPA 2I79A 1XIXA 1I12A 4KOVA 2K5TA 4A30A 4PK2A 4KSAA 3D2MA 5GCNA 3MGDA 4BBHA 1P0HA 1V0CA 1J4JA 4XPDB 2RC4A 1KUYA 3GKRA 2PSWA 3E0KA 2REEA 3IWEA 2YNCC 2R8VA 3EC4A 2HUZA 4KS9A 2CXAA 5IB0A 3EXNA 2Q4VA 5HMNA 4BMHA 3FNCA 2ARHA 4F6AA 4KOUA 3CXPA 2VI7A 2REFA 1Q2CA 2B58A 3F5BA 4E0AA 4E2AA 4CGOA 1XF8A 3ZJ0A 4HKFA 4CS0B 2Q4YA 5G20A 1Y7RA 1Q2YA 4JLYA 2WUUA 1P4NA 4KVOE 4L8AA 5EBVA 4B10A 1TIQA 4JXQA 4CYPA 3VWEA 1N71A 4MI4A 1M4DA 1YK3A 4Q36A 4UCPA 3BJ7A 4QVTA 1S3ZA 4PSXA 5J8CA 3CXSA 1QSRA 2BL1A 4U5YA 2VXKA 1S60A 1RXTA 4J3GA 3D2PA 1Z9UA 2NMTA 3DR8A 2VZZA 4C7HA 2PC1A 1IYLA 2Z3MA 4PK3A 2EVNA 3SHPA 2P6GA 3RYOA 1YVKA 1Y9KA 4H6UA 4F0YA 5AG7A 3DNSA 2QMLA 4GS4A 5A27A 4R9MA 2GE3A 2ZPAA 1M4GA 2OH1A 5G21A 1SQHA 3FB3A 4CYNA 4CYOA 4ONUA 4KOTA 5KTCA 2FIAA 1IB1E 1NSLA 3S6FA 4KVME 3ZZIA 4B12A 2FXFA 2BUEA 1XEBA 1FY7A 1WK4A 1MJAA 1YGHA 2ZW6A 3DR6A 4AVCA 4C2YA 4UWIA 4C2XA 4UBRA 3CXQA 2ATRA 4NXYA 4JJXA 2F5IA 3LODA 1CM0A 5ISVA 4L89A 4C2ZA 4PSWA 3R96A 4NCZA 2VQYA 1QSMA 2Z3PA 3KKWA 4RI1A 4U9YA 2YNDA 3P2FA 4XPLA 3WR7A 2CNMA 1MJ9A 3BJ8A 1M44A 3DDDA 5I0CA 1UFHA 2YNCA 1KUXA 5JQ4A 1ZO0A 3NE7A 2C27A 3TTHA 2OB0A 4KOYA 4YRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZY A;  2Y0M A;  4XNH B;  1NE9 A;  1K4J A;  2R98 A;  3D3S A;  5H86 A;  2BSW A;  5IX3 A;  2X7B A;  4K30 A;  4UWJ A;  4QUS A;  3D8P A;  3W6X A;  3TO6 A;  4H89 A;  1KZF A;  1BO4 A;  5DWN A;  2ZW5 A;  2J8R A;  3W91 A;  3TOA A;  4KLW A;  4QB9 A;  2ZW7 A;  4HNX B;  2G0B A;  2Z0Z A;  2JLM A;  4Y49 B;  1Z4R A;  4MY3 A;  3TOB A;  3PZJ A;  4AVB A;  3H4Q A;  3K9U A;  2P0W A;  3B8G A;  2OZH A;  2Z10 A;  3GYA A;  4JD6 A;  1QSN A;  4HNY B;  3I9S A;  4B5P B;  2KCW A;  4KUB A;  3TO7 A;  1R57 A;  4M3S A;  4FD5 A;  3TT2 A;  4KOW A;  4CRZ B;  2D4P A;  2Q0Y A;  4KZT A;  2P6F A;  5KTA A;  3R9F A;  4CAW A;  1VKC A;  2FCK A;  3R9G A;  1L0C A;  4R3K A;  2PRB A;  3EO4 A;  1NMT A;  2CNS A;  3FYN A;  4JWP A;  3R95 A;  1GHE A;  2OZU A;  4MHD A;  5EC4 A;  4QBJ A;  4FD6 A;  1I1D A;  2A4N A;  3EY5 A;  4UA3 A;  3TFY A;  1IIC A;  4CRY B;  1YVO A;  1OZP A;  1S7N A;  1YX0 A;  3W6S A;  2FIW A;  5E96 A;  5C88 A;  4OLL A;  1QSO A;  3LD2 A;  2GAN A;  4CAV A;  1YLE A;  1YR0 A;  2EUI A;  1MK4 A;  4R3L A;  2IL4 A;  3OWC A;  1PUA A;  2JEV A;  4B5P A;  4EVY A;  4KVX A;  4RS2 A;  4PV6 A;  4E8O A;  4U9Z A;  4NEX A;  4FD4 A;  3N7Z A;  3P2H A;  4R87 A;  3TE4 A;  4X5K A;  4NF1 A;  4MBU A;  3QAH A;  4ZBG A;  3T9Y A;  2H5M A;  1BOB A;  2B4B A;  4KOX A;  2JDC A;  1S5K A;  2HV2 A;  3IGR A;  5DWM A;  4KUA A;  2G3T A;  5HH1 A;  2O28 A;  3SXN A;  3JVN A;  4KOS A;  2VBQ A;  3EFA A;  2D4O A;  2JDD A;  3GY9 A;  2PR1 A;  2CNT A;  1QST A;  1KUV A;  2PDO A;  4ORF A;  1S7F A;  3F0A A;  2Q7B A;  5KTD A;  5J8F A;  2I00 A;  2FSR A;  2G3A A;  3G3S A;  5F49 A;  2Q44 A;  4XPK A;  3FBU A;  1M4I A;  1LRZ A;  1YRE A;  4HNW B;  5C82 A;  4OAE A;  2OU2 A;  1Y9W A;  2B4D B;  4H6Z A;  4MY0 A;  1CJW A;  2DXQ A;  2J8N A;  2GIV A;  5F47 A;  3IWG A;  2QIR A;  3VWD A;  2HQY A;  2PQ8 A;  2BEI A;  3FIX A;  3SXO A;  3G8W A;  1WWZ A;  3F8K A;  4NSQ A;  4CAX A;  3S6K A;  3QB8 A;  3FXT A;  2WPX A;  2B5G B;  4OAD A;  1S7L A;  2P6E A;  4R57 A;  3TCV A;  2Z11 A;  4I49 A;  2J8M A;  2B3U A;  5F48 A;  4QC6 A;  4JXR A;  4IF5 A;  5IV0 A;  3UY5 A;  4MJ8 A;  1Z4E A;  3JUW A;  1ON0 A;  3S6H A;  3S6G A;  3R1K A;  3T90 A;  3C26 A;  5H84 A;  4LUA A;  1MJB A;  2QEC A;  4YFJ A;  1IID A;  2B4D A;  2R1I A;  5CNP A;  4AVA A;  1XE4 A;  2Q04 A;  2AE6 A;  1B6B A;  5F46 A;  1XMT A;  4KLV A;  3R9E A;  2PR8 A;  4FD7 A;  1Q2D A;  1I21 A;  2FT0 A;  4XNH C;  2FS5 A;  4YGO A;  3BLN A;  4XPD C;  1RO5 A;  2B5G A;  4KOR A;  4B5O A;  4M85 A;  1VHS A;  3PGP A;  2ZXV A;  3FRM A;  1M1D A;  3PP9 A;  2OZG A;  4AB7 A;  4II9 A;  3I3G A;  3V8I A;  1S7K A;  1U6M A;  3DSB A;  5JPH A;  2R7H A;  2VEZ A;  1B87 A;  2B3V A;  4AG7 A;  1PU9 A;  2ZW4 A;  2WPW A;  2FE7 A;  2FL4 A;  4Y49 C;  2CY2 A;  2AJ6 A;  5FVJ A;  4DNC A;  3TO9 A;  4AG9 A;  4IUS A;  1IYK A;  4LX9 A;  2I79 A;  1XIX A;  1I12 A;  4KOV A;  2K5T A;  4PK2 A;  3D2M A;  5GCN A;  3MGD A;  1P0H A;  1V0C A;  1J4J A;  4XPD B;  2RC4 A;  1KUY A;  3GKR A;  2PSW A;  3E0K A;  2REE A;  2R8V A;  3EC4 A;  2HUZ A;  5IB0 A;  3EXN A;  2Q4V A;  5HMN A;  4BMH A;  3FNC A;  2ARH A;  4F6A A;  4KOU A;  3CXP A;  2VI7 A;  2REF A;  1Q2C A;  2B58 A;  3F5B A;  4E0A A;  4E2A A;  1XF8 A;  3ZJ0 A;  4HKF A;  4CS0 B;  2Q4Y A;  1Y7R A;  1Q2Y A;  4JLY A;  1P4N A;  4KVO E;  4L8A A;  5EBV A;  1TIQ A;  4JXQ A;  3VWE A;  1N71 A;  4MI4 A;  1M4D A;  1YK3 A;  3BJ7 A;  4QVT A;  1S3Z A;  4PSX A;  5J8C A;  3CXS A;  1QSR A;  2BL1 A;  4U5Y A;  2VXK A;  1S60 A;  1RXT A;  4J3G A;  3D2P A;  1Z9U A;  2NMT A;  3DR8 A;  2VZZ A;  2PC1 A;  1IYL A;  4PK3 A;  2EVN A;  3SHP A;  2P6G A;  3RYO A;  1YVK A;  1Y9K A;  4H6U A;  4F0Y A;  3DNS A;  2QML A;  4GS4 A;  4R9M A;  2GE3 A;  2ZPA A;  1M4G A;  2OH1 A;  1SQH A;  3FB3 A;  4ONU A;  4KOT A;  5KTC A;  2FIA A;  1IB1 E;  1NSL A;  3S6F A;  4KVM E;  3ZZI A;  2FXF A;  2BUE A;  1XEB A;  1FY7 A;  1WK4 A;  1MJA A;  1YGH A;  2ZW6 A;  3DR6 A;  4AVC A;  4UWI A;  4UBR A;  3CXQ A;  2ATR A;  4NXY A;  4JJX A;  2F5I A;  3LOD A;  1CM0 A;  5ISV A;  4L89 A;  4PSW A;  3R96 A;  4NCZ A;  2VQY A;  1QSM A;  3KKW A;  4RI1 A;  4U9Y A;  3P2F A;  4XPL A;  3WR7 A;  2CNM A;  1MJ9 A;  3BJ8 A;  1M44 A;  3DDD A;  5I0C A;  1UFH A;  1KUX A;  5JQ4 A;  3NE7 A;  2C27 A;  3TTH A;  2OB0 A;  4KOY A;  4YRH A; 
#chains in the Genus database with same CATH topology
 5H86 A;  2VZY A;  2Y0M A;  1ZG7 A;  4OKO A;  4XNH B;  1NE9 A;  1Z8T A;  4JZ0 A;  3SJE A;  1K4J A;  2R98 A;  3D3S A;  3IFE A;  2BSW A;  3K9T A;  2X7B A;  3PFE A;  2Z3K A;  4K30 A;  4OC5 A;  5G22 A;  4UWJ A;  1TF9 A;  4QUS A;  3D8P A;  4NGR A;  3W6X A;  1QMU A;  3TO6 A;  4H89 A;  4FBE A;  1KZF A;  1BO4 A;  4P10 A;  4M6H A;  5DWN A;  1LAM A;  5AGE A;  2ZW5 A;  2J8R A;  1RTQ A;  3W91 A;  4GM5 A;  3TOA A;  5THW A;  4KLW A;  4QB9 A;  2ZW7 A;  5JGF A;  3WT4 A;  4HNX B;  2BO9 A;  3PBB A;  4UCM A;  2G0B A;  2Z0Z A;  2Q51 A;  3S9N A;  5K8P A;  2JLM A;  4Y49 B;  2HB6 A;  1HDU A;  1Z4R A;  2GFQ A;  4MY3 A;  4C68 A;  3TOB A;  3PZJ A;  2FVG A;  2O53 A;  3B3W A;  3CPA A;  3H4Q A;  1F57 A;  3K9U A;  2P0W A;  3L2N A;  4ZX8 A;  2C6P A;  3B8G A;  1Y0R A;  2OZH A;  3IJ3 A;  2Z10 A;  3GYA A;  4F0X A;  2ZEO A;  4JD6 A;  1QSN A;  3WC6 A;  4A94 A;  4HNY B;  3BXM A;  3I9S A;  4X2T A;  3B3V A;  2XEI A;  5LYI A;  2KCW A;  2PJA A;  4KUB A;  4OID A;  3TO7 A;  3WAB A;  4B5P B;  2EBJ A;  1R57 A;  4FD5 A;  3GUX A;  4M3S A;  3TT2 A;  1LAP A;  2DPS A;  2D4P A;  4KOW A;  4A2Z A;  4CGL A;  4CRZ B;  2Z3N A;  4ZY1 A;  2YGW A;  4W9Y A;  1IOF A;  1R3N A;  1YW6 A;  2Z3L A;  3IO1 A;  3KGQ A;  2Q0Y A;  4KZT A;  2P6F A;  2ZOG A;  3FEC A;  5KTA A;  5LYL A;  3R9F A;  3KHX A;  4CAW A;  1VKC A;  2FCK A;  2ODF A;  3R9G A;  1L0C A;  5BWA B;  4R3K A;  2PRB A;  3EO4 A;  1NMT A;  2CNS A;  1IGB A;  3NH5 A;  1AYE A;  3FYN A;  4JWP A;  1ELL P;  3R95 A;  4P45 A;  2JBK A;  4MHY A;  4OC2 A;  3S9L A;  1CG2 A;  1GHE A;  4MXU A;  4NGT A;  2OZU A;  2AFW A;  2PJ8 A;  2V8G A;  3FED A;  3B7I A;  4FAI A;  4MFQ A;  4MHD A;  5EC4 A;  4AVB A;  4QBJ A;  4FD6 A;  1TKF A;  1I1D A;  2A4N A;  3EY5 A;  2I3C A;  4UA3 A;  3TFY A;  2GU2 A;  2PIY A;  1IIC A;  1ZLI A;  2EWB A;  4CRY B;  1YVO A;  1OZP A;  4CGN A;  5A28 A;  1S7N A;  1YX0 A;  4A31 A;  1AUG A;  3W6S A;  5HVH A;  2FIW A;  3KAS A;  5E96 A;  4MCS A;  5C88 A;  1R43 A;  1UWY A;  4OLL A;  3NH8 A;  1QSO A;  2F7V A;  4P6Y A;  3LD2 A;  4Q38 A;  1XBU A;  3HLP A;  3N5F A;  5I4M A;  4HPS A;  2GAN A;  2XEG A;  1ZG8 A;  4ZX9 A;  4CAV A;  2AFX A;  3D7H A;  3IEH A;  4A95 A;  1YLE A;  1YQE A;  3H8E A;  4YU9 A;  1YR0 A;  2EUI A;  5AG6 A;  1MK4 A;  2PJ1 A;  3BHX A;  4R3L A;  2IL4 A;  3DLJ A;  3TX8 A;  4A37 A;  2PJ2 A;  1KWM A;  2CTB A;  4M6I A;  4PXB A;  3OWC A;  4B11 A;  3KZW A;  1PUA A;  2JEV A;  4B5P A;  4MFJ A;  4R6T A;  4EVY A;  4KVX A;  1CPX A;  4RS2 A;  5HVF A;  3RBU A;  4WJB A;  3KL9 A;  4NJR A;  4PV6 A;  4E8O A;  4U9Z A;  3FH4 A;  3QNV A;  1F2P A;  4FD4 A;  3N7Z A;  3P2H A;  4NEX A;  2QYV A;  4R87 A;  5AG4 A;  4X5K A;  3TE4 A;  4X3R A;  2AFZ A;  4NGQ A;  4NF1 A;  4MBU A;  3QAH A;  4ZBG A;  3T9Y A;  1VIX A;  2H5M A;  1BOB A;  2B4B A;  3PB8 X;  4KOX A;  4NGS A;  2JDC A;  1S5K A;  2HV2 A;  3JRU A;  4YWY A;  3IGR A;  2CTC A;  4MFZ A;  1YLO A;  4KUA A;  5DWM A;  1YW4 A;  4K3N A;  2G3T A;  5HH1 A;  1YSJ A;  2V8H A;  3D7G A;  3H5Z A;  4UFX A;  2O28 A;  3SXN A;  4A33 A;  3RZA A;  3B3S A;  3JVN A;  4MCR A;  4CAE A;  4KOS A;  2VBQ A;  4A32 A;  5JM6 A;  5G1Z A;  4KSF A;  5K8N A;  3EFA A;  4PQA A;  4CYQ A;  4MFP A;  1LCP A;  4BIN A;  2D4O A;  2JDD A;  3GY9 A;  4PPZ A;  4Q7A A;  2PR1 A;  2ZEM A;  2J9A A;  1XOV A;  2ZEH A;  4MHZ A;  2CNT A;  1QST A;  2VL1 A;  1KUV A;  4JYW A;  2PDO A;  4ORF A;  3ISZ A;  1CPS A;  1DTD A;  1XJO A;  1Z2L A;  3KQX A;  4PXC A;  3GB0 A;  1S7F A;  3F0A A;  3JTK A;  2Q7B A;  5KTD A;  1FNO A;  3SJG A;  5J8F A;  2I00 A;  3IC1 A;  2FSR A;  4CPA A;  2G3A A;  3G3S A;  3LMS A;  5F49 A;  1IOI A;  3RAM A;  1XMB A;  2Q44 A;  2XEJ A;  2GRE A;  2PJC A;  4XPK A;  3FBU A;  1A2Z A;  4P44 A;  1M4I A;  3PB6 X;  1LRZ A;  8CPA A;  1YRE A;  4CGM A;  4HNW B;  5C82 A;  2V8V A;  4OAE A;  1ELM P;  3PB4 X;  1HEE A;  2OU2 A;  1XRY A;  2AFM A;  5ELY A;  4UIA A;  1VGY A;  1Y9W A;  2B4D B;  4H6Z A;  4MY0 A;  3KI9 A;  4ZY2 A;  4B13 A;  1CJW A;  2DXQ A;  2JBJ A;  2PJ0 A;  2J8N A;  2YNE A;  2GIV A;  2IMO A;  2C6C A;  5F47 A;  4ZI6 A;  3IWG A;  2QIR A;  3FMC A;  3CT9 A;  1GYT A;  4X8I A;  7CPA A;  4UFV A;  5LYF A;  3VWD A;  2HQY A;  2PQ8 A;  1Q7L A;  2BEI A;  3FIX A;  1HDQ A;  3SXO A;  4MFL A;  4P4B A;  4UCN A;  1XFO A;  2AFS A;  3G8W A;  1WWZ A;  3F8K A;  4NSQ A;  4FWU A;  2GLF A;  4CAX A;  3S6K A;  4NGM A;  3QB8 A;  3FXT A;  4P4D A;  2WPX A;  2PJ4 A;  5LRK A;  3T8W A;  2B5G B;  2QVP A;  2ZOF A;  4OAD A;  5HXD A;  1TKJ A;  1S7L A;  2P6E A;  2PJ6 A;  4UF4 A;  2CF4 A;  2XEF A;  3B2Y A;  4R57 A;  3TCV A;  5F09 A;  2Z11 A;  3MRU A;  4IAV A;  4MCQ A;  1TXR A;  4I49 A;  1JQG A;  2EO8 A;  2PVV A;  2J8M A;  1BPN A;  2B3U A;  2EK9 A;  3B3C A;  4UIB A;  4QC6 A;  5F48 A;  4JXR A;  3SI1 A;  4R7M A;  4DJL A;  4B6Z A;  4IF5 A;  5IV0 A;  3UY5 A;  4MJ8 A;  1Z4E A;  3JUW A;  2Q7S A;  2ZEL A;  4NJQ A;  1ON0 A;  2PJ5 A;  3D4U A;  3V38 A;  2V77 A;  3FF3 A;  4AXV A;  2BOA A;  3S6H A;  3S6G A;  1Y7E A;  3R1K A;  3T90 A;  3KR5 A;  3WC5 A;  1LAN A;  2PCU A;  3B35 A;  2PJB A;  2EK8 A;  2Z3O A;  3RO0 A;  3VH9 A;  3C26 A;  5H84 A;  3CDX A;  3D68 A;  4LUA A;  4A39 A;  1MJB A;  2QEC A;  4YFJ A;  1Z8W A;  3PB7 X;  1IID A;  2B4D A;  4ONW A;  4C7I A;  2DPT A;  6CPA A;  3PBE A;  2R1I A;  3PEI A;  3VAR A;  3A9L A;  5CNP A;  1VHE A;  4AVA A;  1CP6 A;  1LOK A;  1XE4 A;  2Q04 A;  3KQZ A;  4MMO A;  4CAF A;  2WYR A;  3MN8 A;  2AE6 A;  1Z8X A;  1B6B A;  5F46 A;  3LAC A;  4UEF A;  1XMT A;  4RN7 A;  4KLV A;  3R9E A;  4Z65 A;  3KHZ A;  2PR8 A;  4FD7 A;  1Q2D A;  2PVW A;  1I21 A;  5LRG A;  1NSA A;  2FT0 A;  4F9U A;  4XNH C;  5LYD A;  2FS5 A;  1F2O A;  1JWQ A;  2GLJ A;  3BLN A;  4IHM A;  4YGO A;  5IX3 A;  4XPD C;  1TKH A;  1RO5 A;  2B5G A;  3HUV A;  4KOR A;  4B5O A;  4OC4 A;  4ZGY B;  4M85 A;  5K8M A;  1VHS A;  1X12 A;  1BAV A;  3SJF A;  5IB9 A;  3PGP A;  1H8L A;  2IJZ A;  3FEE A;  3QAY A;  5J1Q A;  2PIZ A;  4MFK A;  2ZXV A;  3FRM A;  4F9V A;  1M1D A;  4RUH A;  3PP9 A;  2OZG A;  4UFW A;  4AB7 A;  4II9 A;  3I3G A;  3V8I A;  3IU2 A;  1S7K A;  4OC0 A;  1U6M A;  2ZEG A;  2ANP A;  2C6G A;  4UEZ A;  2WSA A;  3DSB A;  4EME A;  1ARL A;  2CIJ A;  3WC7 A;  5JPH A;  2R7H A;  3D7D A;  3KR4 A;  3PB9 X;  4B14 A;  2DF5 A;  2PJ9 A;  2VEZ A;  2ZEN A;  3SI2 A;  4EWT A;  1CX8 A;  1B87 A;  5AG5 A;  2B3V A;  4H2K A;  4AG7 A;  4R76 A;  1PU9 A;  2C1C A;  2ZW4 A;  1BPM A;  2FE7 A;  2WPW A;  2FL4 A;  3SI0 A;  4Y49 C;  2CY2 A;  4R8F A;  2AJ6 A;  4MHN A;  5FVJ A;  2BCO A;  3PRT A;  4DNC A;  3TO9 A;  4AG9 A;  4IUS A;  3IU1 A;  1IYK A;  3D66 A;  4NGP A;  1OBR A;  4LX9 A;  2I79 A;  1XIX A;  1I12 A;  4OC3 A;  4P4F A;  4CGP A;  4KOV A;  2K5T A;  4A30 A;  3NH4 A;  4PK2 A;  4KSA A;  3D2M A;  5GCN A;  3NA6 A;  3MGD A;  4NGN A;  4BBH A;  1P0H A;  1V0C A;  1ARM A;  1J4J A;  2NYQ A;  4XPD B;  2RC4 A;  1IY7 A;  1KUY A;  3GKR A;  2PSW A;  3E0K A;  2ZEP A;  3I1U A;  5CPA A;  4UEE A;  1CP7 A;  2REE A;  3IWE A;  3ISX A;  4DYO A;  1EE3 P;  3D67 A;  4WWV A;  2YNC C;  2R8V A;  3EC4 A;  2HUZ A;  4KS9 A;  4ZY0 A;  2CXA A;  3CZX A;  3GLJ A;  5IB0 A;  3EXN A;  2Q4V A;  4MHP A;  4P4E A;  5HMN A;  4BMH A;  1YME A;  3FNC A;  2ARH A;  5D8N A;  4F6A A;  4KOU A;  3CXP A;  2VI7 A;  2REF A;  5K8O A;  3D7F A;  1Q2C A;  2B58 A;  3IWW A;  3F5B A;  4E0A A;  4DUK A;  4E2A A;  4CGO A;  1XF8 A;  1FT7 A;  2PJ7 A;  3ZJ0 A;  4HKF A;  4NFR A;  4CS0 B;  2Q4Y A;  2V8D A;  5G20 A;  1Y7R A;  1Q2Y A;  4JLY A;  4OC1 A;  1Z8L A;  2WUU A;  2PE3 A;  1P4N A;  3SJX A;  1AMP A;  4FUU A;  4IK2 A;  4KVO E;  4L8A A;  5EBV A;  1DE4 C;  4B10 A;  3FVL A;  1TIQ A;  3IIB A;  4JXQ A;  5HVG A;  4CYP A;  3VWE A;  1N71 A;  4MI4 A;  1M4D A;  1YK3 A;  4Q36 A;  1BLL E;  4UCP A;  3BJ7 A;  3CPX A;  2ABZ A;  2NSM A;  4QVT A;  2PJ3 A;  1S3Z A;  4PSX A;  5J8C A;  1Y0Y A;  3CXS A;  1QSR A;  2BL1 A;  4U5Y A;  2VXK A;  1S60 A;  1RXT A;  2PRQ A;  3B3T A;  4J3G A;  3D2P A;  1Z9U A;  1CBX A;  2NMT A;  3DR8 A;  4O23 A;  2OOT A;  2VZZ A;  1ZLH A;  2IQ6 A;  2PC1 A;  4C7H A;  5CBM A;  1IYL A;  2Z3M A;  1ZG9 A;  3DGV A;  4LQ6 A;  3NFZ A;  4PK3 A;  5JH9 A;  2EVN A;  3RNZ A;  3SHP A;  4TNU A;  1TF8 A;  2P6G A;  1PCA A;  3RYO A;  4GXH A;  1YVK A;  1Y9K A;  2RB7 A;  4H6U A;  4F8Z A;  1M4L A;  4F0Y A;  1QQ9 A;  4G1P A;  1X10 A;  4PXD A;  5AG7 A;  3DNS A;  3V7Z A;  2QML A;  4GS4 A;  5A27 A;  3FJU A;  4R9M A;  4ZYQ A;  2GE3 A;  2ZPA A;  1M4G A;  2HC9 A;  2OH1 A;  4MCP A;  5G21 A;  1SQH A;  3FB3 A;  4BD9 A;  4CYN A;  4CYO A;  3H8G A;  4ONU A;  1IU8 A;  4KOT A;  1PYT B;  5KTC A;  2FIA A;  2ZED A;  4TWE A;  5DS0 A;  4M6G A;  2G9D A;  4KSI A;  1IB1 E;  2DEA A;  1NSL A;  3S6F A;  2Q43 A;  4KVM E;  3ZZI A;  4B12 A;  2FXF A;  2ZEF A;  3TC8 A;  2BUE A;  3H8F A;  1XEB A;  1Z5R A;  1FY7 A;  3NE8 A;  1WK4 A;  2WZN A;  1MJA A;  1YGH A;  2OR4 A;  4OP4 A;  2ZW6 A;  3DR6 A;  4AVC A;  4C2Y A;  5LRJ A;  1LFW A;  3FX6 A;  4PXE A;  4UWI A;  2QJ8 A;  4C2X A;  4UBR A;  3CXQ A;  2ATR A;  2POK A;  4NXY A;  4JJX A;  2F5I A;  1VHO A;  3LOD A;  1CM0 A;  2F8H A;  3VAT A;  4MRI A;  4P4I A;  5ISV A;  3LWU A;  4L89 A;  4C2Z A;  2JEW A;  4PSW A;  3R96 A;  2ZEE A;  3BI0 A;  2VQY A;  2Q4Z A;  4NCZ A;  1QSM A;  2Z3P A;  3KKW A;  5D29 A;  4RI1 A;  4U9Y A;  2YND A;  3P2F A;  4XPL A;  3WR7 A;  2CNM A;  1MJ9 A;  3BJ8 A;  3BI1 A;  1M44 A;  2O4H A;  3DDD A;  1UFH A;  2YNC A;  3PFO A;  4A38 A;  5I0C A;  1KUX A;  5JQ4 A;  4OME A;  1ZO0 A;  2AFO A;  2AFU A;  4LQG A;  3NE7 A;  4EFD A;  2C27 A;  2RFH A;  3K2K A;  4OIW A;  3S9M A;  3TTH A;  4P4J A;  2OB0 A;  4KOY A;  5EMI A;  3GIU A;  4YRH A; 
#chains in the Genus database with same CATH homology
 2VZY A;  2Y0M A;  4XNH B;  1NE9 A;  1K4J A;  2R98 A;  3D3S A;  5H86 A;  2BSW A;  5IX3 A;  2X7B A;  2Z3K A;  4K30 A;  5G22 A;  4UWJ A;  4QUS A;  3D8P A;  3W6X A;  3TO6 A;  4H89 A;  1KZF A;  1BO4 A;  5DWN A;  5AGE A;  2ZW5 A;  2J8R A;  3W91 A;  3TOA A;  4KLW A;  4QB9 A;  2ZW7 A;  4HNX B;  4UCM A;  2G0B A;  2Z0Z A;  2JLM A;  4Y49 B;  1Z4R A;  4MY3 A;  4C68 A;  3TOB A;  3PZJ A;  4AVB A;  3H4Q A;  3K9U A;  2P0W A;  3B8G A;  2OZH A;  2Z10 A;  3GYA A;  4F0X A;  4JD6 A;  1QSN A;  4HNY B;  3I9S A;  4B5P B;  2KCW A;  4KUB A;  3TO7 A;  1R57 A;  4FD5 A;  4M3S A;  3TT2 A;  2DPS A;  4KOW A;  2D4P A;  4A2Z A;  4CRZ B;  4CGL A;  2Z3N A;  2YGW A;  2Z3L A;  2Q0Y A;  4KZT A;  2P6F A;  5KTA A;  3R9F A;  4CAW A;  1VKC A;  2FCK A;  3R9G A;  5BWA B;  1L0C A;  4R3K A;  2PRB A;  3EO4 A;  1NMT A;  2CNS A;  3FYN A;  4JWP A;  3R95 A;  1GHE A;  2OZU A;  4MFQ A;  4MHD A;  5EC4 A;  4QBJ A;  4FD6 A;  1I1D A;  2A4N A;  3EY5 A;  4UA3 A;  3TFY A;  1IIC A;  4CRY B;  1YVO A;  1OZP A;  4CGN A;  5A28 A;  1S7N A;  1YX0 A;  4A31 A;  3W6S A;  2FIW A;  5E96 A;  5C88 A;  4OLL A;  1QSO A;  3LD2 A;  4Q38 A;  2GAN A;  4CAV A;  4A95 A;  1YLE A;  1YR0 A;  2EUI A;  5AG6 A;  1MK4 A;  4R3L A;  2IL4 A;  4B11 A;  3OWC A;  4ZGY B;  1PUA A;  2JEV A;  4B5P A;  4MFJ A;  4EVY A;  4KVX A;  4RS2 A;  4PV6 A;  4E8O A;  4U9Z A;  4NEX A;  4FD4 A;  3N7Z A;  3P2H A;  4R87 A;  5AG4 A;  3TE4 A;  4X5K A;  4NF1 A;  4MBU A;  3QAH A;  4ZBG A;  3T9Y A;  2H5M A;  1BOB A;  2B4B A;  4KOX A;  2JDC A;  1S5K A;  2HV2 A;  3IGR A;  4MFZ A;  5DWM A;  4KUA A;  2G3T A;  5HH1 A;  3H5Z A;  4UFX A;  2O28 A;  3SXN A;  4A33 A;  3JVN A;  4CAE A;  4KOS A;  2VBQ A;  4A32 A;  5G1Z A;  4KSF A;  3EFA A;  4CYQ A;  4MFP A;  2D4O A;  2JDD A;  3GY9 A;  2PR1 A;  2CNT A;  1QST A;  1KUV A;  2PDO A;  4ORF A;  1S7F A;  3F0A A;  3JTK A;  2Q7B A;  5KTD A;  5J8F A;  2I00 A;  2FSR A;  2G3A A;  3G3S A;  5F49 A;  2Q44 A;  4XPK A;  3FBU A;  1M4I A;  1LRZ A;  1YRE A;  4CGM A;  4HNW B;  5C82 A;  4OAE A;  2OU2 A;  1Y9W A;  2B4D B;  4H6Z A;  4MY0 A;  4B13 A;  1CJW A;  2DXQ A;  2J8N A;  2YNE A;  2GIV A;  5F47 A;  3IWG A;  2QIR A;  4UFV A;  3VWD A;  2HQY A;  2PQ8 A;  2BEI A;  3FIX A;  3SXO A;  4MFL A;  4UCN A;  3G8W A;  1WWZ A;  3F8K A;  4NSQ A;  4CAX A;  3S6K A;  3QB8 A;  3FXT A;  2WPX A;  2B5G B;  4OAD A;  1S7L A;  2P6E A;  4R57 A;  3TCV A;  2Z11 A;  4I49 A;  2J8M A;  2B3U A;  5F48 A;  4QC6 A;  4JXR A;  4IF5 A;  5IV0 A;  3UY5 A;  4MJ8 A;  1Z4E A;  3JUW A;  1ON0 A;  3S6H A;  3S6G A;  3R1K A;  3T90 A;  2Z3O A;  3C26 A;  5H84 A;  4LUA A;  1MJB A;  2QEC A;  4YFJ A;  1IID A;  2B4D A;  4C7I A;  2DPT A;  2R1I A;  3A9L A;  5CNP A;  4AVA A;  1XE4 A;  2Q04 A;  4CAF A;  2AE6 A;  1B6B A;  5F46 A;  1XMT A;  4KLV A;  3R9E A;  2PR8 A;  4FD7 A;  1Q2D A;  1I21 A;  2FT0 A;  4XNH C;  2FS5 A;  4YGO A;  3BLN A;  4XPD C;  1RO5 A;  2B5G A;  4KOR A;  4B5O A;  4M85 A;  1VHS A;  3PGP A;  4MFK A;  2ZXV A;  3FRM A;  1M1D A;  3PP9 A;  2OZG A;  4UFW A;  4AB7 A;  4II9 A;  3I3G A;  3V8I A;  3IU2 A;  1S7K A;  1U6M A;  2WSA A;  3DSB A;  5JPH A;  2R7H A;  4B14 A;  2VEZ A;  1B87 A;  5AG5 A;  2B3V A;  4AG7 A;  1PU9 A;  2ZW4 A;  2WPW A;  2FE7 A;  2FL4 A;  4Y49 C;  2CY2 A;  2AJ6 A;  5FVJ A;  4DNC A;  3TO9 A;  4AG9 A;  4IUS A;  3IU1 A;  1IYK A;  4LX9 A;  4CGP A;  2I79 A;  1XIX A;  1I12 A;  4KOV A;  2K5T A;  4A30 A;  4PK2 A;  4KSA A;  3D2M A;  5GCN A;  3MGD A;  4BBH A;  1P0H A;  1V0C A;  1J4J A;  4XPD B;  2RC4 A;  1KUY A;  3GKR A;  2PSW A;  3E0K A;  2REE A;  3IWE A;  2YNC C;  2R8V A;  3EC4 A;  2HUZ A;  4KS9 A;  2CXA A;  5IB0 A;  3EXN A;  2Q4V A;  5HMN A;  4BMH A;  3FNC A;  2ARH A;  4F6A A;  4KOU A;  3CXP A;  2VI7 A;  2REF A;  1Q2C A;  2B58 A;  3F5B A;  4E0A A;  4E2A A;  4CGO A;  1XF8 A;  3ZJ0 A;  4HKF A;  4CS0 B;  2Q4Y A;  5G20 A;  1Y7R A;  1Q2Y A;  4JLY A;  2WUU A;  1P4N A;  4KVO E;  4L8A A;  5EBV A;  4B10 A;  1TIQ A;  4JXQ A;  4CYP A;  3VWE A;  1N71 A;  4MI4 A;  1M4D A;  1YK3 A;  4Q36 A;  4UCP A;  3BJ7 A;  4QVT A;  1S3Z A;  4PSX A;  5J8C A;  3CXS A;  1QSR A;  2BL1 A;  4U5Y A;  2VXK A;  1S60 A;  1RXT A;  4J3G A;  3D2P A;  1Z9U A;  2NMT A;  3DR8 A;  2VZZ A;  4C7H A;  2PC1 A;  1IYL A;  2Z3M A;  4PK3 A;  2EVN A;  3SHP A;  2P6G A;  3RYO A;  1YVK A;  1Y9K A;  4H6U A;  4F0Y A;  5AG7 A;  3DNS A;  2QML A;  4GS4 A;  5A27 A;  4R9M A;  2GE3 A;  2ZPA A;  1M4G A;  2OH1 A;  5G21 A;  1SQH A;  3FB3 A;  4CYN A;  4CYO A;  4ONU A;  4KOT A;  5KTC A;  2FIA A;  1IB1 E;  1NSL A;  3S6F A;  4KVM E;  3ZZI A;  4B12 A;  2FXF A;  2BUE A;  1XEB A;  1FY7 A;  1WK4 A;  1MJA A;  1YGH A;  2ZW6 A;  3DR6 A;  4AVC A;  4C2Y A;  4UWI A;  4C2X A;  4UBR A;  3CXQ A;  2ATR A;  4NXY A;  4JJX A;  2F5I A;  3LOD A;  1CM0 A;  5ISV A;  4L89 A;  4C2Z A;  4PSW A;  3R96 A;  4NCZ A;  2VQY A;  1QSM A;  2Z3P A;  3KKW A;  4RI1 A;  4U9Y A;  2YND A;  3P2F A;  4XPL A;  3WR7 A;  2CNM A;  1MJ9 A;  3BJ8 A;  1M44 A;  3DDD A;  5I0C A;  1UFH A;  2YNC A;  1KUX A;  5JQ4 A;  1ZO0 A;  3NE7 A;  2C27 A;  3TTH A;  2OB0 A;  4KOY A;  4YRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...