2CY2A

Crystal structure of ttha1209 in complex with acetyl coenzyme a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
174
structure length
174
Chain Sequence
b'VRIRRAGLEDLPGVARVLVDTWRATYRGVVPEAFLEGLSYEGQAERWAQRLKTPTWPGRLFVAESESGEVVGFAAFGPDRASGFPGYTAELWAIYVLPTWQRKGLGRALFHEGARLLQAEGYGRMLVWVLKENPKGRGFYEHLGGVLLGEREIELGGAKLWEVAYGFDLGGHKW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords probable acetyltransferase
publication title Crystal structure of TTHA1209 in complex with acetyl coenzyme A
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 48
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2cy2A00
4H6UA 4LX9A 3I3GA 1PUAA 1KUYA 1GHEA 1M4GA 1J4JA 4GS4A 1Z9UA 3FB3A 2CY2A 5F49A 4KUAA 3WR7A 3TO7A 4XPLA 1B6BA 3P2FA 3FXTA 5IX3A 4MHDA 2WPWA 2JDDA 3R9FA 4CAXA 2AJ6A 4IUSA 2Q4VA 4HKFA 4H6ZA 4ZBGA 3DNSA 3S6KA 4MY3A 2IL4A 1MJAA 3CXSA 2PR8A 4JWPA 4YFJA 5HMNA 3GKRA 4FD4A 5DWNA 3S6GA 1I21A 1CM0A 1KZFA 2J8MA 3S6FA 2ZXVA 2EVNA 3QAHA 4JXQA 2JDCA 3DDDA 1BO4A 3W6XA 4QC6A 2OB0A 3VWEA 4XPDB 5F48A 3D2PA 3TO9A 4J3GA 2OZGA 1Y9KA 4KZTA 4KOVA 3QB8A 4XPKA 3VWDA 1NE9A 2ZW6A 2GIVA 1S7LA 4JD6A 4KORA 1MK4A 4Y49C 1B87A 1S7NA 4YGOA 4AG9A 1RXTA 2Z10A 3GYAA 4AVCA 2BEIA 4KUBA 3FIXA 4KOXA 2VZZA 5F47A 2C27A 4XNHC 4DNCA 2H5MA 2PRBA 2Q0YA 2PR1A 4HNYB 3S6HA 1FY7A 3TFYA 4FD7A 2JLMA 2VQYA 2VZYA 4JJXA 2ZW4A 1XE4A 5EBVA 2JEVA 4F6AA 4NEXA 4CRZB 4PK2A 4RI1A 3T90A 4B5PB 1VHSA 2ZW7A 3W6SA 5IB0A 4E8OA 4EVYA 5I0CA 3FNCA 3K9UA 3DR8A 4OLLA 5FVJA 5EC4A 2P6EA 3F8KA 3LODA 2B3VA 5KTCA 3G3SA 3GY9A 5C88A 2REFA 2FSRA 1V0CA 5F46A 2QECA 4LUAA 2VEZA 2FIWA 3MGDA 4JXRA 4KVOE 4FD6A 1UFHA 3D8PA 1YVKA 1YR0A 4M85A 2PC1A 2B58A 2BSWA 2GE3A 2ATRA 3TTHA 4UBRA 2FT0A 2Q04A 4KLWA 2B3UA 3EFAA 5JQ4A 4PSXA 2VBQA 3ZZIA 5JPHA 4I49A 4NSQA 3KKWA 4QVTA 4OADA 4Y49B 4FD5A 4II9A 3IWGA 3BJ7A 1R57A 3R96A 2Z0ZA 3R9GA 3V8IA 2DXQA 2EUIA 4KOTA 3F0AA 2I79A 4E0AA 2B4DB 1YREA 4KLVA 2K5TA 2KCWA 4ORFA 2BL1A 4MY0A 5IV0A 1LRZA 1S5KA 2P6FA 5H84A 3TT2A 4CS0B 1KUVA 1NMTA 2OZUA 1P0HA 3SXNA 1I1DA 2B5GB 2BUEA 3EXNA 5ISVA 4MJ8A 4ONUA 1RO5A 1YVOA 2CNMA 4NF1A 3TOBA 5CNPA 4KOUA 1S7KA 3C26A 1SQHA 1Z4RA 3OWCA 2R1IA 4R57A 2FIAA 3JUWA 1IB1E 1YX0A 2HQYA 2G3TA 2Q44A 4QB9A 3PP9A 2PQ8A 5KTDA 2O28A 2ZPAA 3TOAA 2HUZA 1ON0A 4X5KA 2Q7BA 4CAVA 2P6GA 2VXKA 2J8NA 1XF8A 3N7ZA 1KUXA 3SXOA 2B4DA 1IICA 4QUSA 2CNSA 4KOYA 3B8GA 3R95A 4AVAA 3UY5A 1I12A 2Z11A 2R98A 2FCKA 4B5OA 3IGRA 1M4IA 2FXFA 5J8CA 1WK4A 4UWJA 4R3LA 4NXYA 5E96A 1P4NA 2RC4A 3EC4A 5GCNA 4KVXA 1S7FA 4R87A 3FYNA 4E2AA 2G0BA 3TO6A 1Y7RA 4HNWB 1MJBA 1IYKA 2GANA 4U9YA 4AVBA 1QSRA 4CAWA 3R1KA 4L8AA 1XEBA 2D4OA 3BJ8A 1M44A 1VKCA 2Q4YA 3PZJA 3FRMA 2HV2A 2VI7A 3ZJ0A 3LD2A 4KOSA 3H4QA 1IIDA 2R8VA 4XNHB 4B5PA 4BMHA 4F0YA 4HNXB 2FE7A 1MJ9A 1K4JA 1QSMA 5C82A 1XIXA 1OZPA 2ARHA 3JVNA 3F5BA 1XMTA 3E0KA 2OH1A 2X7BA 4MI4A 1Z4EA 3CXPA 4AB7A 1QSNA 4KOWA 3W91A 2CNTA 5KTAA 2PDOA 1L0CA 3P2HA 1IYLA 2P0WA 2FS5A 2NMTA 2OU2A 4R9MA 3D2MA 1Q2CA 3NE7A 1Y9WA 3CXQA 3EO4A 1M4DA 1M1DA 4UA3A 4OAEA 3TE4A 1Q2YA 5H86A 3I9SA 2WPXA 3RYOA 2G3AA 1WWZA 2F5IA 3BLNA 3D3SA 1CJWA 1YLEA 3DSBA 4CRYB 2I00A 2R7HA 2A4NA 1N71A 4YRHA 4RS2A 1S60A 2AE6A 4IF5A 4K30A 3FBUA 1Q2DA 3G8WA 4JLYA 2B4BA 1NSLA 4XPDC 2PSWA 2QIRA 1YGHA 4M3SA 4MBUA 3EY5A 4KVME 2QMLA 3DR6A 4UWIA 1S3ZA 1TIQA 2REEA 3PGPA 4PK3A 4PSWA 2OZHA 3SHPA 5DWMA 4NCZA 5HH1A 2J8RA 3R9EA 1QSOA 4U5YA 4U9ZA 4QBJA 5J8FA 4PV6A 4L89A 2D4PA 4H89A 2B5GA 1PU9A 2FL4A 3T9YA 1YK3A 1U6MA 1BOBA 2ZW5A 2Y0MA 3TCVA 4R3KA 4AG7A 1QSTA
chains in the Genus database with same CATH superfamily
1Z8XA 4H6UA 4LX9A 2YGWA 3I3GA 1PUAA 1KUYA 1GHEA 1M4GA 1J4JA 4GS4A 8CPAA 3PBEA 2PJBA 1LAMA 4M6HA 1Z9UA 3FB3A 4RUHA 4B11A 1ELMP 2CY2A 2GFQA 4NJQA 1HDQA 4KUAA 2PIYA 5F49A 5JM6A 3WR7A 3PEIA 1OBRA 3D7DA 3TO7A 2GLFA 1CP6A 4XPLA 1B6BA 3SI0A 3CPXA 3P2FA 1CBXA 4Q7AA 1Z8WA 3FXTA 5IX3A 3ISZA 4MHDA 2Z3KA 2PVVA 5CPAA 2JEWA 1X10A 4FAIA 2ZELA 2F7VA 2WPWA 1IOIA 2JDDA 3B3WA 2AFUA 3R9FA 4CAXA 1CP7A 2AJ6A 4IUSA 2Q4VA 4HKFA 4H6ZA 1Z5RA 1BPMA 1TKHA 2CTBA 3PRTA 3DNSA 4ZBGA 5K8OA 2Q7SA 1TXRA 3S6KA 5EMIA 5HXDA 1XFOA 4MY3A 2IL4A 3FMCA 3LMSA 4IHMA 1MJAA 1ZLHA 4ZX9A 3CXSA 4OC2A 4Q38A 4C68A 2PR8A 4JWPA 4YFJA 5AG4A 5HMNA 3GKRA 4FD4A 4MFQA 5DWNA 3HUVA 1I21A 1CM0A 1HDUA 4ZY2A 3S6GA 4PXDA 1KZFA 2J8MA 3S6FA 1LANA 2ZXVA 2EVNA 4LQ6A 4PXBA 3QAHA 2BO9A 4JXQA 2JDCA 3DDDA 2PCUA 1YW4A 1BO4A 5AG7A 3W6XA 4CYPA 4QC6A 2IQ6A 3KQZA 2OB0A 4UCNA 2CIJA 3VWEA 4XPDB 5F48A 1R3NA 3D2PA 3SI1A 3TO9A 1X12A 1DTDA 4J3GA 5HVGA 2OZGA 4ZY1A 1TF8A 5F09A 2Q43A 1Y9KA 4KZTA 3LWUA 4KOVA 4B6ZA 3QB8A 3NH5A 2WSAA 4XPKA 3VWDA 3GIUA 1NE9A 2AFWA 2ZW6A 2GIVA 1S7LA 2CTCA 4AXVA 4CGMA 5JGFA 2VL1A 4JD6A 3H8GA 4KORA 1MK4A 4Y49C 1B87A 1S7NA 4YGOA 4AG9A 1ELLP 2XEFA 1RXTA 2Z10A 2ZEPA 3GYAA 1JQGA 2BEIA 3BI0A 4AVCA 4IK2A 3D4UA 4ZYQA 1YSJA 4KUBA 3RNZA 4ZGYB 4OC3A 3CZXA 3FIXA 2VZZA 4KOXA 5F47A 3KR5A 1XJOA 2C27A 4XNHC 5JH9A 1AYEA 4DNCA 4P45A 4NGNA 2H5MA 2PRBA 5D29A 2Q0YA 2PR1A 4GM5A 4HNYB 1F2PA 3S6HA 4NFRA 1CPSA 3PFEA 1FY7A 4CGPA 3KGQA 5A27A 4MFZA 6CPAA 3TFYA 4C2ZA 4FD7A 2JLMA 2VQYA 2WYRA 1HEEA 3FX6A 2VZYA 2EK8A 4JJXA 4LQGA 4MCSA 4A2ZA 2ZW4A 1Y7EA 1Z8LA 4EFDA 1XE4A 5EBVA 4R8FA 2JEVA 4F6AA 4NEXA 4CRZB 2I3CA 4PK2A 3BI1A 3KHZA 1LFWA 4RI1A 3T90A 4MFPA 5THWA 4B5PB 1VHSA 2ZW7A 4MXUA 2PJAA 3W6SA 5HVHA 5IB0A 1BLLE 4E8OA 4EVYA 5K8MA 5DS0A 5I0CA 3FNCA 3K9UA 3CDXA 4DUKA 3DR8A 1ARMA 2WUUA 3PBBA 2XEIA 4OLLA 5FVJA 4R7MA 5EC4A 3ISXA 5LRGA 1Q7LA 1FNOA 2P6EA 3F8KA 5LYLA 1RTQA 2Z3PA 2ZEFA 3LODA 2B3VA 5KTCA 2QJ8A 3G3SA 3GY9A 3K9TA 4KSAA 5C88A 4B13A 2REFA 4P4FA 3H8FA 4PQAA 3VARA 1ARLA 2FSRA 1TKFA 1V0CA 5F46A 5IB9A 2V8VA 2CXAA 2QECA 4LUAA 2VEZA 2FIWA 3MGDA 4A38A 4GXHA 3A9LA 3FEDA 4JXRA 2C6CA 4KVOE 4ONWA 4MMOA 4F9UA 4MFJA 4A94A 1LCPA 4FD6A 2EK9A 1UFHA 4C7HA 4TNUA 2V8GA 3GB0A 2ZEGA 4NGSA 3D8PA 4P4IA 4A33A 4KS9A 4PXCA 2V77A 1YVKA 5G21A 1YR0A 2AFSA 4M85A 3PB9X 4UEEA 2PC1A 4UF4A 3IJ3A 4WJBA 1Y0RA 2B58A 2BSWA 2GE3A 2Q4ZA 4C2XA 2ATRA 7CPAA 2AFOA 3PB4X 1BPNA 3TTHA 2YNCA 4CGLA 3B3CA 2ZOFA 4UBRA 5LYFA 3SI2A 2C6PA 2FT0A 2Q04A 3RO0A 3B3SA 4KLWA 4EWTA 2B3UA 3EFAA 2ZEHA 5JQ4A 2PJ7A 4JZ0A 4PSXA 3B7IA 5J1QA 2VBQA 2QVPA 3ZZIA 5JPHA 4I49A 4W9YA 4NSQA 2RFHA 3KKWA 4X2TA 4NGRA 4QVTA 1XRYA 1ZLIA 2HC9A 2V8DA 4OADA 4Y49B 4OP4A 3IU2A 4FD5A 4II9A 3IWGA 1VHOA 3D66A 3KHXA 4UFXA 3BJ7A 3B35A 1R57A 2GREA 4CAFA 1XMBA 3TCVA 2V8HA 3R96A 2Z0ZA 3R9GA 3V8IA 2DXQA 3IC1A 4CPAA 5CBMA 2EUIA 4IAVA 3F0AA 4KOTA 2I79A 4E0AA 4A95A 2B4DB 1YREA 2Z3OA 5I4MA 4KLVA 1KWMA 2KCWA 2K5TA 3KR4A 4ORFA 1PCAA 2PJ2A 4P4JA 2DPSA 1F57A 2J9AA 2BL1A 4MY0A 5IV0A 1LRZA 4NJRA 4DYOA 1S5KA 2P6FA 4P44A 5H84A 3TT2A 4CS0B 1KUVA 1NMTA 2OZUA 2JBKA 3WT4A 3D68A 1P0HA 3SXNA 1I1DA 2B5GB 2BUEA 3EXNA 5ISVA 3KL9A 2WZNA 4BD9A 4MJ8A 4WWVA 1ZG7A 3IO1A 4A30A 4JYWA 4ONUA 1RO5A 2Z3MA 1YVOA 2CNMA 4NF1A 4MHPA 3TOBA 5CNPA 1Z8TA 4KOUA 1S7KA 4RN7A 1FT7A 2HB6A 2NSMA 3C26A 1SQHA 4G1PA 4FUUA 4NGMA 4C7IA 1Z4RA 2DEAA 3OWCA 4ZX8A 2R1IA 3IFEA 4R57A 2FIAA 2PVWA 3JUWA 4UFVA 4BBHA 1IB1E 1YX0A 3PB6X 4P4BA 3B2YA 2HQYA 3RBUA 4A37A 4MFKA 2G3TA 2Q44A 3TX8A 1LAPA 2RB7A 3IEHA 4QB9A 3CPAA 3KASA 2PJCA 3PFOA 2PQ8A 3PP9A 4A32A 4UIBA 4B10A 3NH4A 4YWYA 5KTDA 2O28A 2ANPA 2ZPAA 2Z3NA 3SJEA 5A28A 4OC0A 1VGYA 3TOAA 2PJ6A 4MHZA 4BINA 2HUZA 1ON0A 4MCRA 4X5KA 2C1CA 3NE8A 5G22A 1Z2LA 2Q7BA 4CAVA 2PJ8A 2P6GA 3FF3A 5AG6A 2VXKA 4OC4A 2J8NA 2NYQA 4ZI6A 2PJ5A 1XF8A 3KQXA 3BXMA 4UCMA 3N7ZA 1KUXA 1Y0YA 2EBJA 5LYIA 3SXOA 3GLJA 2B4DA 5K8PA 1IICA 3NFZA 4MRIA 4QUSA 1QQ9A 2CNSA 5AG5A 4KOYA 1NSAA 4K3NA 3B8GA 4UEZA 3WC7A 3R95A 4AVAA 3UY5A 3TC8A 1I12A 4H2KA 2C6GA 2Z11A 2R98A 4OKOA 3FECA 4PXEA 1PYTB 2FCKA 2QYVA 3QAYA 4R6TA 3IU1A 4B5OA 1ZG8A 4FBEA 3IGRA 3NH8A 1M4IA 2PJ1A 5LYDA 2FXFA 5J8CA 5ELYA 1WK4A 2YNCC 4MCPA 5LRJA 3B3TA 4A31A 4UWJA 4R3LA 4MHYA 4NXYA 1YLOA 5E96A 1P4NA 2RC4A 3EC4A 5GCNA 4B14A 2BCOA 4KVXA 2ZEMA 1S7FA 3N5FA 4R87A 3FYNA 4CYNA 4MHNA 4E2AA 2PJ9A 2G0BA 3TO6A 4R76A 1Y7RA 2G9DA 5G20A 4Z65A 4CYOA 4HNWB 1MJBA 1IYKA 1A2ZA 2GANA 4MFLA 1IY7A 3VH9A 4U9YA 4AVBA 2EO8A 1QSRA 4CAWA 3R1KA 4L8AA 3D67A 1XEBA 2GU2A 2D4OA 3BJ8A 1M44A 1VKCA 2Q4YA 4OC1A 3PZJA 3FRMA 2O4HA 2HV2A 2VI7A 3ZJ0A 3LD2A 4KOSA 2PJ3A 3K2KA 4P4EA 4KSFA 1AMPA 5AGEA 2AFXA 3H4QA 1IIDA 4P10A 2R8VA 3JTKA 4XNHB 4UIAA 4HPSA 4B5PA 2FVGA 2YNEA 4NGPA 3I1UA 4B12A 4BMHA 2FE7A 2YNDA 1MJ9A 4HNXB 1K4JA 4F0YA 1QSMA 3B3VA 5C82A 2JBJA 1XIXA 1OZPA 2ARHA 2ZEEA 3JVNA 4O23A 3F5BA 1XMTA 2ODFA 3E0KA 4DJLA 3PB8X 4P6YA 3S9NA 2IMOA 2OH1A 2X7BA 2ZOGA 3H5ZA 4MI4A 1Z4EA 2AFZA 4UFWA 3CXPA 2XEJA 3IWWA 4AB7A 1QSNA 4KOWA 4C2YA 3W91A 2CNTA 5KTAA 4CGNA 2PDOA 4PPZA 1L0CA 1QMUA 3P2HA 1IYLA 1JWQA 2P0WA 2FS5A 2NMTA 2OU2A 3SJGA 3HLPA 4R9MA 3D2MA 1Q2CA 3NE7A 4UEFA 4KSIA 3V7ZA 3DLJA 3L2NA 2PRQA 3BHXA 1Y9WA 2Z3LA 2DPTA 3CXQA 1M4DA 1AUGA 1M1DA 2O53A 1VHEA 3EO4A 3RAMA 2PE3A 3MRUA 4F8ZA 1CPXA 4UA3A 3MN8A 3FH4A 4OAEA 1IU8A 4ZY0A 3D7FA 3KI9A 3TE4A 1Q2YA 5H86A 2GLJA 3I9SA 2WPXA 1YMEA 2POKA 1R43A 3RYOA 2G3AA 1WWZA 4OMEA 3WABA 2F5IA 3BLNA 3D3SA 1CJWA 5G1ZA 2DF5A 1IGBA 1YLEA 2AFMA 4UCPA 2PJ0A 3DSBA 2I00A 4CRYB 3D7GA 4X8IA 1VIXA 3KZWA 4Q36A 1F2OA 2OR4A 2A4NA 1N71A 2R7HA 3D7HA 4YRHA 3FVLA 4RS2A 4CYQA 1S60A 4P4DA 2AE6A 4IF5A 3FEEA 4K30A 2PJ4A 1TKJA 1GYTA 3WC6A 3FBUA 1Q2DA 3G8WA 2Q51A 2F8HA 4JLYA 2B4BA 2IJZA 1NSLA 5D8NA 4XPDC 1XBUA 2PSWA 3WC5A 1YQEA 4FWUA 2QIRA 1YGHA 2ZEDA 4M3SA 4MBUA 5LRKA 4F0XA 1BAVA 3EY5A 1LOKA 4OC5A 3T8WA 2ZEOA 4M6GA 3DGVA 4NGTA 4NGQA 4KVME 1IOFA 1DE4C 2QMLA 3LACA 3QNVA 1CX8A 3DR6A 4TWEA 4UWIA 3SJXA 1S3ZA 1TIQA 2REEA 1UWYA 3PGPA 4PK3A 2OOTA 1M4LA 4PSWA 3JRUA 2OZHA 3SHPA 3NA6A 5DWMA 1CG2A 1H8LA 3GUXA 4NCZA 5HH1A 2J8RA 3R9EA 1QSOA 2PIZA 4M6IA 3S9LA 3CT9A 3PB7X 4MCQA 3IIBA 4U5YA 4U9ZA 4QBJA 5J8FA 4PV6A 4L89A 4A39A 2D4PA 4X3RA 4CAEA 4H89A 2B5GA 3IWEA 1ZO0A 3S9MA 1PU9A 4YU9A 2CF4A 1XOVA 2ZENA 2FL4A 3FJUA 3T9YA 1YK3A 2EWBA 4OIDA 5K8NA 3SJFA 4EMEA 1YW6A 3RZAA 3H8EA 3VATA 1U6MA 5HVFA 4F9VA 2XEGA 2ABZA 1BOBA 2ZW5A 4CGOA 1TF9A 5BWAB 2BOAA 2Y0MA 4OIWA 4R3KA 1EE3P 1ZG9A 4AG7A 1QSTA 3V38A
chains in the Genus database with same CATH topology
4H6UA 4LX9A 2YGWA 3I3GA 1PUAA 1KUYA 1GHEA 1M4GA 1J4JA 4GS4A 1Z9UA 3FB3A 4B11A 2CY2A 5F49A 4KUAA 3WR7A 3TO7A 4XPLA 1B6BA 3P2FA 3FXTA 5IX3A 4MHDA 2Z3KA 2WPWA 2JDDA 3R9FA 4CAXA 2AJ6A 4IUSA 2Q4VA 4HKFA 4H6ZA 4ZBGA 3DNSA 3S6KA 4MY3A 2IL4A 1MJAA 3CXSA 4Q38A 4C68A 2PR8A 4JWPA 4YFJA 5AG4A 5HMNA 3GKRA 4FD4A 4MFQA 5DWNA 3S6GA 1I21A 1CM0A 1KZFA 2J8MA 3S6FA 2ZXVA 2EVNA 3QAHA 4JXQA 2JDCA 3DDDA 5AG7A 1BO4A 3W6XA 4CYPA 4QC6A 2OB0A 4UCNA 3VWEA 4XPDB 5F48A 3D2PA 3TO9A 4J3GA 2OZGA 1Y9KA 4KZTA 4KOVA 3QB8A 2WSAA 4XPKA 3VWDA 1NE9A 2ZW6A 2GIVA 1S7LA 4CGMA 4JD6A 4KORA 1MK4A 4Y49C 1B87A 1S7NA 4YGOA 4AG9A 1RXTA 2Z10A 3GYAA 4AVCA 2BEIA 4KUBA 4ZGYB 3FIXA 4KOXA 2VZZA 5F47A 2C27A 4XNHC 4DNCA 2H5MA 2PRBA 2Q0YA 2PR1A 4HNYB 3S6HA 4CGPA 1FY7A 5A27A 4MFZA 3TFYA 4C2ZA 4FD7A 2JLMA 2VQYA 2VZYA 4JJXA 4A2ZA 2ZW4A 1XE4A 5EBVA 2JEVA 4F6AA 4NEXA 4CRZB 4PK2A 4RI1A 3T90A 4MFPA 4B5PB 1VHSA 2ZW7A 3W6SA 5IB0A 4E8OA 4EVYA 5I0CA 3FNCA 3K9UA 3DR8A 2WUUA 4OLLA 5FVJA 5EC4A 2P6EA 3F8KA 2Z3PA 3LODA 2B3VA 5KTCA 3G3SA 3GY9A 4KSAA 5C88A 4B13A 2REFA 2FSRA 1V0CA 5F46A 2CXAA 2QECA 4LUAA 2VEZA 2FIWA 3MGDA 3A9LA 4JXRA 4KVOE 4MFJA 4FD6A 4C7HA 1UFHA 3D8PA 4A33A 4KS9A 1YVKA 5G21A 1YR0A 4M85A 2PC1A 2B58A 2BSWA 2GE3A 4C2XA 2ATRA 3TTHA 4CGLA 2YNCA 4UBRA 2FT0A 2Q04A 4KLWA 2B3UA 3EFAA 5JQ4A 4PSXA 2VBQA 3ZZIA 5JPHA 4I49A 4NSQA 3KKWA 4QVTA 4OADA 4Y49B 3IU2A 4FD5A 4II9A 3IWGA 4UFXA 3BJ7A 4CAFA 1R57A 3R96A 2Z0ZA 3R9GA 3V8IA 2DXQA 2EUIA 3F0AA 4KOTA 2I79A 4E0AA 4A95A 2B4DB 1YREA 2Z3OA 4KLVA 2K5TA 2KCWA 4ORFA 2DPSA 2BL1A 4MY0A 5IV0A 1LRZA 1S5KA 2P6FA 5H84A 3TT2A 4CS0B 1KUVA 1NMTA 2OZUA 1P0HA 3SXNA 1I1DA 2B5GB 2BUEA 3EXNA 5ISVA 4MJ8A 4A30A 4ONUA 1RO5A 2Z3MA 1YVOA 2CNMA 4NF1A 3TOBA 5CNPA 4KOUA 1S7KA 3C26A 1SQHA 4C7IA 1Z4RA 3OWCA 2R1IA 4R57A 4UFVA 2FIAA 3JUWA 4BBHA 1IB1E 1YX0A 2HQYA 4MFKA 2G3TA 2Q44A 4QB9A 3PP9A 2PQ8A 4A32A 4B10A 5KTDA 2O28A 2ZPAA 2Z3NA 5A28A 3TOAA 2HUZA 1ON0A 4X5KA 5G22A 2Q7BA 4CAVA 2P6GA 5AG6A 2VXKA 2J8NA 1XF8A 4UCMA 3N7ZA 1KUXA 3SXOA 2B4DA 1IICA 4QUSA 2CNSA 5AG5A 4KOYA 3B8GA 3R95A 4AVAA 3UY5A 1I12A 2Z11A 2R98A 2FCKA 3IU1A 4B5OA 3IGRA 1M4IA 2FXFA 5J8CA 1WK4A 2YNCC 4A31A 4UWJA 4R3LA 4NXYA 5E96A 1P4NA 2RC4A 3EC4A 5GCNA 4B14A 4KVXA 1S7FA 4R87A 3FYNA 4CYNA 4E2AA 2G0BA 3TO6A 1Y7RA 5G20A 4CYOA 4HNWB 1MJBA 1IYKA 2GANA 4MFLA 4U9YA 4AVBA 1QSRA 4CAWA 3R1KA 4L8AA 1XEBA 2D4OA 3BJ8A 1M44A 1VKCA 2Q4YA 3PZJA 3FRMA 2HV2A 2VI7A 3ZJ0A 3LD2A 4KOSA 4KSFA 5AGEA 3H4QA 1IIDA 2R8VA 3JTKA 4XNHB 4B5PA 2YNEA 4B12A 4BMHA 4HNXB 2YNDA 2FE7A 1MJ9A 1K4JA 4F0YA 1QSMA 5C82A 1XIXA 1OZPA 2ARHA 3JVNA 3F5BA 1XMTA 3E0KA 2OH1A 2X7BA 3H5ZA 4MI4A 1Z4EA 4UFWA 3CXPA 4AB7A 1QSNA 4KOWA 4C2YA 3W91A 2CNTA 5KTAA 4CGNA 2PDOA 1L0CA 3P2HA 1IYLA 2P0WA 2FS5A 2NMTA 2OU2A 4R9MA 3D2MA 1Q2CA 3NE7A 1Y9WA 2Z3LA 2DPTA 3CXQA 1M4DA 3EO4A 1M1DA 4UA3A 4OAEA 3TE4A 1Q2YA 5H86A 3I9SA 2WPXA 3RYOA 2G3AA 1WWZA 2F5IA 3BLNA 3D3SA 1CJWA 5G1ZA 1YLEA 4UCPA 3DSBA 4CRYB 2I00A 4Q36A 2R7HA 2A4NA 1N71A 4YRHA 4CYQA 4RS2A 1S60A 2AE6A 4IF5A 4K30A 3FBUA 1Q2DA 3G8WA 4JLYA 2B4BA 1NSLA 4XPDC 2PSWA 2QIRA 1YGHA 4M3SA 4MBUA 4F0XA 3EY5A 4KVME 2QMLA 3DR6A 4UWIA 1S3ZA 1TIQA 2REEA 3PGPA 4PK3A 4PSWA 2OZHA 3SHPA 5DWMA 4NCZA 5HH1A 2J8RA 3R9EA 1QSOA 4U5YA 4U9ZA 4QBJA 5J8FA 4PV6A 4L89A 2D4PA 4CAEA 4H89A 2B5GA 3IWEA 1ZO0A 1PU9A 2FL4A 3T9YA 1YK3A 1U6MA 1BOBA 2ZW5A 4CGOA 5BWAB 2Y0MA 3TCVA 4R3KA 4AG7A 1QSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H6U A;  4LX9 A;  3I3G A;  1PUA A;  1KUY A;  1GHE A;  1M4G A;  1J4J A;  4GS4 A;  1Z9U A;  3FB3 A;  2CY2 A;  5F49 A;  4KUA A;  3WR7 A;  3TO7 A;  4XPL A;  1B6B A;  3P2F A;  3FXT A;  5IX3 A;  4MHD A;  2WPW A;  2JDD A;  3R9F A;  4CAX A;  2AJ6 A;  4IUS A;  2Q4V A;  4HKF A;  4H6Z A;  4ZBG A;  3DNS A;  3S6K A;  4MY3 A;  2IL4 A;  1MJA A;  3CXS A;  2PR8 A;  4JWP A;  4YFJ A;  5HMN A;  3GKR A;  4FD4 A;  5DWN A;  3S6G A;  1I21 A;  1CM0 A;  1KZF A;  2J8M A;  3S6F A;  2ZXV A;  2EVN A;  3QAH A;  4JXQ A;  2JDC A;  3DDD A;  1BO4 A;  3W6X A;  4QC6 A;  2OB0 A;  3VWE A;  4XPD B;  5F48 A;  3D2P A;  3TO9 A;  4J3G A;  2OZG A;  1Y9K A;  4KZT A;  4KOV A;  3QB8 A;  4XPK A;  3VWD A;  1NE9 A;  2ZW6 A;  2GIV A;  1S7L A;  4JD6 A;  4KOR A;  1MK4 A;  4Y49 C;  1B87 A;  1S7N A;  4YGO A;  4AG9 A;  1RXT A;  2Z10 A;  3GYA A;  4AVC A;  2BEI A;  4KUB A;  3FIX A;  4KOX A;  2VZZ A;  5F47 A;  2C27 A;  4XNH C;  4DNC A;  2H5M A;  2PRB A;  2Q0Y A;  2PR1 A;  4HNY B;  3S6H A;  1FY7 A;  3TFY A;  4FD7 A;  2JLM A;  2VQY A;  2VZY A;  4JJX A;  2ZW4 A;  1XE4 A;  5EBV A;  2JEV A;  4F6A A;  4NEX A;  4CRZ B;  4PK2 A;  4RI1 A;  3T90 A;  4B5P B;  1VHS A;  2ZW7 A;  3W6S A;  5IB0 A;  4E8O A;  4EVY A;  5I0C A;  3FNC A;  3K9U A;  3DR8 A;  4OLL A;  5FVJ A;  5EC4 A;  2P6E A;  3F8K A;  3LOD A;  2B3V A;  5KTC A;  3G3S A;  3GY9 A;  5C88 A;  2REF A;  2FSR A;  1V0C A;  5F46 A;  2QEC A;  4LUA A;  2VEZ A;  2FIW A;  3MGD A;  4JXR A;  4KVO E;  4FD6 A;  1UFH A;  3D8P A;  1YVK A;  1YR0 A;  4M85 A;  2PC1 A;  2B58 A;  2BSW A;  2GE3 A;  2ATR A;  3TTH A;  4UBR A;  2FT0 A;  2Q04 A;  4KLW A;  2B3U A;  3EFA A;  5JQ4 A;  4PSX A;  2VBQ A;  3ZZI A;  5JPH A;  4I49 A;  4NSQ A;  3KKW A;  4QVT A;  4OAD A;  4Y49 B;  4FD5 A;  4II9 A;  3IWG A;  3BJ7 A;  1R57 A;  3R96 A;  2Z0Z A;  3R9G A;  3V8I A;  2DXQ A;  2EUI A;  4KOT A;  3F0A A;  2I79 A;  4E0A A;  2B4D B;  1YRE A;  4KLV A;  2K5T A;  2KCW A;  4ORF A;  2BL1 A;  4MY0 A;  5IV0 A;  1LRZ A;  1S5K A;  2P6F A;  5H84 A;  3TT2 A;  4CS0 B;  1KUV A;  1NMT A;  2OZU A;  1P0H A;  3SXN A;  1I1D A;  2B5G B;  2BUE A;  3EXN A;  5ISV A;  4MJ8 A;  4ONU A;  1RO5 A;  1YVO A;  2CNM A;  4NF1 A;  3TOB A;  5CNP A;  4KOU A;  1S7K A;  3C26 A;  1SQH A;  1Z4R A;  3OWC A;  2R1I A;  4R57 A;  2FIA A;  3JUW A;  1IB1 E;  1YX0 A;  2HQY A;  2G3T A;  2Q44 A;  4QB9 A;  3PP9 A;  2PQ8 A;  5KTD A;  2O28 A;  2ZPA A;  3TOA A;  2HUZ A;  1ON0 A;  4X5K A;  2Q7B A;  4CAV A;  2P6G A;  2VXK A;  2J8N A;  1XF8 A;  3N7Z A;  1KUX A;  3SXO A;  2B4D A;  1IIC A;  4QUS A;  2CNS A;  4KOY A;  3B8G A;  3R95 A;  4AVA A;  3UY5 A;  1I12 A;  2Z11 A;  2R98 A;  2FCK A;  4B5O A;  3IGR A;  1M4I A;  2FXF A;  5J8C A;  1WK4 A;  4UWJ A;  4R3L A;  4NXY A;  5E96 A;  1P4N A;  2RC4 A;  3EC4 A;  5GCN A;  4KVX A;  1S7F A;  4R87 A;  3FYN A;  4E2A A;  2G0B A;  3TO6 A;  1Y7R A;  4HNW B;  1MJB A;  1IYK A;  2GAN A;  4U9Y A;  4AVB A;  1QSR A;  4CAW A;  3R1K A;  4L8A A;  1XEB A;  2D4O A;  3BJ8 A;  1M44 A;  1VKC A;  2Q4Y A;  3PZJ A;  3FRM A;  2HV2 A;  2VI7 A;  3ZJ0 A;  3LD2 A;  4KOS A;  3H4Q A;  1IID A;  2R8V A;  4XNH B;  4B5P A;  4BMH A;  4F0Y A;  4HNX B;  2FE7 A;  1MJ9 A;  1K4J A;  1QSM A;  5C82 A;  1XIX A;  1OZP A;  2ARH A;  3JVN A;  3F5B A;  1XMT A;  3E0K A;  2OH1 A;  2X7B A;  4MI4 A;  1Z4E A;  3CXP A;  4AB7 A;  1QSN A;  4KOW A;  3W91 A;  2CNT A;  5KTA A;  2PDO A;  1L0C A;  3P2H A;  1IYL A;  2P0W A;  2FS5 A;  2NMT A;  2OU2 A;  4R9M A;  3D2M A;  1Q2C A;  3NE7 A;  1Y9W A;  3CXQ A;  3EO4 A;  1M4D A;  1M1D A;  4UA3 A;  4OAE A;  3TE4 A;  1Q2Y A;  5H86 A;  3I9S A;  2WPX A;  3RYO A;  2G3A A;  1WWZ A;  2F5I A;  3BLN A;  3D3S A;  1CJW A;  1YLE A;  3DSB A;  4CRY B;  2I00 A;  2R7H A;  2A4N A;  1N71 A;  4YRH A;  4RS2 A;  1S60 A;  2AE6 A;  4IF5 A;  4K30 A;  3FBU A;  1Q2D A;  3G8W A;  4JLY A;  2B4B A;  1NSL A;  4XPD C;  2PSW A;  2QIR A;  1YGH A;  4M3S A;  4MBU A;  3EY5 A;  4KVM E;  2QML A;  3DR6 A;  4UWI A;  1S3Z A;  1TIQ A;  2REE A;  3PGP A;  4PK3 A;  4PSW A;  2OZH A;  3SHP A;  5DWM A;  4NCZ A;  5HH1 A;  2J8R A;  3R9E A;  1QSO A;  4U5Y A;  4U9Z A;  4QBJ A;  5J8F A;  4PV6 A;  4L89 A;  2D4P A;  4H89 A;  2B5G A;  1PU9 A;  2FL4 A;  3T9Y A;  1YK3 A;  1U6M A;  1BOB A;  2ZW5 A;  2Y0M A;  3TCV A;  4R3K A;  4AG7 A;  1QST A; 
#chains in the Genus database with same CATH topology
 1Z8X A;  4H6U A;  4LX9 A;  2YGW A;  3I3G A;  1PUA A;  1KUY A;  1GHE A;  1M4G A;  1J4J A;  4GS4 A;  8CPA A;  3PBE A;  2PJB A;  1LAM A;  4M6H A;  1Z9U A;  3FB3 A;  4RUH A;  4B11 A;  1ELM P;  2CY2 A;  2GFQ A;  4NJQ A;  1HDQ A;  4KUA A;  2PIY A;  5F49 A;  5JM6 A;  3WR7 A;  3PEI A;  1OBR A;  3D7D A;  3TO7 A;  2GLF A;  1CP6 A;  4XPL A;  1B6B A;  3SI0 A;  3CPX A;  3P2F A;  1CBX A;  4Q7A A;  1Z8W A;  3FXT A;  5IX3 A;  3ISZ A;  4MHD A;  2Z3K A;  2PVV A;  5CPA A;  2JEW A;  1X10 A;  4FAI A;  2ZEL A;  2F7V A;  2WPW A;  1IOI A;  2JDD A;  3B3W A;  2AFU A;  3R9F A;  4CAX A;  1CP7 A;  2AJ6 A;  4IUS A;  2Q4V A;  4HKF A;  4H6Z A;  1Z5R A;  1BPM A;  1TKH A;  2CTB A;  3PRT A;  3DNS A;  4ZBG A;  5K8O A;  2Q7S A;  1TXR A;  3S6K A;  5EMI A;  5HXD A;  1XFO A;  4MY3 A;  2IL4 A;  3FMC A;  3LMS A;  4IHM A;  1MJA A;  1ZLH A;  4ZX9 A;  3CXS A;  4OC2 A;  4Q38 A;  4C68 A;  2PR8 A;  4JWP A;  4YFJ A;  5AG4 A;  5HMN A;  3GKR A;  4FD4 A;  4MFQ A;  5DWN A;  3HUV A;  1I21 A;  1CM0 A;  1HDU A;  4ZY2 A;  3S6G A;  4PXD A;  1KZF A;  2J8M A;  3S6F A;  1LAN A;  2ZXV A;  2EVN A;  4LQ6 A;  4PXB A;  3QAH A;  2BO9 A;  4JXQ A;  2JDC A;  3DDD A;  2PCU A;  1YW4 A;  1BO4 A;  5AG7 A;  3W6X A;  4CYP A;  4QC6 A;  2IQ6 A;  3KQZ A;  2OB0 A;  4UCN A;  2CIJ A;  3VWE A;  4XPD B;  5F48 A;  1R3N A;  3D2P A;  3SI1 A;  3TO9 A;  1X12 A;  1DTD A;  4J3G A;  5HVG A;  2OZG A;  4ZY1 A;  1TF8 A;  5F09 A;  2Q43 A;  1Y9K A;  4KZT A;  3LWU A;  4KOV A;  4B6Z A;  3QB8 A;  3NH5 A;  2WSA A;  4XPK A;  3VWD A;  3GIU A;  1NE9 A;  2AFW A;  2ZW6 A;  2GIV A;  1S7L A;  2CTC A;  4AXV A;  4CGM A;  5JGF A;  2VL1 A;  4JD6 A;  3H8G A;  4KOR A;  1MK4 A;  4Y49 C;  1B87 A;  1S7N A;  4YGO A;  4AG9 A;  1ELL P;  2XEF A;  1RXT A;  2Z10 A;  2ZEP A;  3GYA A;  1JQG A;  2BEI A;  3BI0 A;  4AVC A;  4IK2 A;  3D4U A;  4ZYQ A;  1YSJ A;  4KUB A;  3RNZ A;  4ZGY B;  4OC3 A;  3CZX A;  3FIX A;  2VZZ A;  4KOX A;  5F47 A;  3KR5 A;  1XJO A;  2C27 A;  4XNH C;  5JH9 A;  1AYE A;  4DNC A;  4P45 A;  4NGN A;  2H5M A;  2PRB A;  5D29 A;  2Q0Y A;  2PR1 A;  4GM5 A;  4HNY B;  1F2P A;  3S6H A;  4NFR A;  1CPS A;  3PFE A;  1FY7 A;  4CGP A;  3KGQ A;  5A27 A;  4MFZ A;  6CPA A;  3TFY A;  4C2Z A;  4FD7 A;  2JLM A;  2VQY A;  2WYR A;  1HEE A;  3FX6 A;  2VZY A;  2EK8 A;  4JJX A;  4LQG A;  4MCS A;  4A2Z A;  2ZW4 A;  1Y7E A;  1Z8L A;  4EFD A;  1XE4 A;  5EBV A;  4R8F A;  2JEV A;  4F6A A;  4NEX A;  4CRZ B;  2I3C A;  4PK2 A;  3BI1 A;  3KHZ A;  1LFW A;  4RI1 A;  3T90 A;  4MFP A;  5THW A;  4B5P B;  1VHS A;  2ZW7 A;  4MXU A;  2PJA A;  3W6S A;  5HVH A;  5IB0 A;  1BLL E;  4E8O A;  4EVY A;  5K8M A;  5DS0 A;  5I0C A;  3FNC A;  3K9U A;  3CDX A;  4DUK A;  3DR8 A;  1ARM A;  2WUU A;  3PBB A;  2XEI A;  4OLL A;  5FVJ A;  4R7M A;  5EC4 A;  3ISX A;  5LRG A;  1Q7L A;  1FNO A;  2P6E A;  3F8K A;  5LYL A;  1RTQ A;  2Z3P A;  2ZEF A;  3LOD A;  2B3V A;  5KTC A;  2QJ8 A;  3G3S A;  3GY9 A;  3K9T A;  4KSA A;  5C88 A;  4B13 A;  2REF A;  4P4F A;  3H8F A;  4PQA A;  3VAR A;  1ARL A;  2FSR A;  1TKF A;  1V0C A;  5F46 A;  5IB9 A;  2V8V A;  2CXA A;  2QEC A;  4LUA A;  2VEZ A;  2FIW A;  3MGD A;  4A38 A;  4GXH A;  3A9L A;  3FED A;  4JXR A;  2C6C A;  4KVO E;  4ONW A;  4MMO A;  4F9U A;  4MFJ A;  4A94 A;  1LCP A;  4FD6 A;  2EK9 A;  1UFH A;  4C7H A;  4TNU A;  2V8G A;  3GB0 A;  2ZEG A;  4NGS A;  3D8P A;  4P4I A;  4A33 A;  4KS9 A;  4PXC A;  2V77 A;  1YVK A;  5G21 A;  1YR0 A;  2AFS A;  4M85 A;  3PB9 X;  4UEE A;  2PC1 A;  4UF4 A;  3IJ3 A;  4WJB A;  1Y0R A;  2B58 A;  2BSW A;  2GE3 A;  2Q4Z A;  4C2X A;  2ATR A;  7CPA A;  2AFO A;  3PB4 X;  1BPN A;  3TTH A;  2YNC A;  4CGL A;  3B3C A;  2ZOF A;  4UBR A;  5LYF A;  3SI2 A;  2C6P A;  2FT0 A;  2Q04 A;  3RO0 A;  3B3S A;  4KLW A;  4EWT A;  2B3U A;  3EFA A;  2ZEH A;  5JQ4 A;  2PJ7 A;  4JZ0 A;  4PSX A;  3B7I A;  5J1Q A;  2VBQ A;  2QVP A;  3ZZI A;  5JPH A;  4I49 A;  4W9Y A;  4NSQ A;  2RFH A;  3KKW A;  4X2T A;  4NGR A;  4QVT A;  1XRY A;  1ZLI A;  2HC9 A;  2V8D A;  4OAD A;  4Y49 B;  4OP4 A;  3IU2 A;  4FD5 A;  4II9 A;  3IWG A;  1VHO A;  3D66 A;  3KHX A;  4UFX A;  3BJ7 A;  3B35 A;  1R57 A;  2GRE A;  4CAF A;  1XMB A;  3TCV A;  2V8H A;  3R96 A;  2Z0Z A;  3R9G A;  3V8I A;  2DXQ A;  3IC1 A;  4CPA A;  5CBM A;  2EUI A;  4IAV A;  3F0A A;  4KOT A;  2I79 A;  4E0A A;  4A95 A;  2B4D B;  1YRE A;  2Z3O A;  5I4M A;  4KLV A;  1KWM A;  2KCW A;  2K5T A;  3KR4 A;  4ORF A;  1PCA A;  2PJ2 A;  4P4J A;  2DPS A;  1F57 A;  2J9A A;  2BL1 A;  4MY0 A;  5IV0 A;  1LRZ A;  4NJR A;  4DYO A;  1S5K A;  2P6F A;  4P44 A;  5H84 A;  3TT2 A;  4CS0 B;  1KUV A;  1NMT A;  2OZU A;  2JBK A;  3WT4 A;  3D68 A;  1P0H A;  3SXN A;  1I1D A;  2B5G B;  2BUE A;  3EXN A;  5ISV A;  3KL9 A;  2WZN A;  4BD9 A;  4MJ8 A;  4WWV A;  1ZG7 A;  3IO1 A;  4A30 A;  4JYW A;  4ONU A;  1RO5 A;  2Z3M A;  1YVO A;  2CNM A;  4NF1 A;  4MHP A;  3TOB A;  5CNP A;  1Z8T A;  4KOU A;  1S7K A;  4RN7 A;  1FT7 A;  2HB6 A;  2NSM A;  3C26 A;  1SQH A;  4G1P A;  4FUU A;  4NGM A;  4C7I A;  1Z4R A;  2DEA A;  3OWC A;  4ZX8 A;  2R1I A;  3IFE A;  4R57 A;  2FIA A;  2PVW A;  3JUW A;  4UFV A;  4BBH A;  1IB1 E;  1YX0 A;  3PB6 X;  4P4B A;  3B2Y A;  2HQY A;  3RBU A;  4A37 A;  4MFK A;  2G3T A;  2Q44 A;  3TX8 A;  1LAP A;  2RB7 A;  3IEH A;  4QB9 A;  3CPA A;  3KAS A;  2PJC A;  3PFO A;  2PQ8 A;  3PP9 A;  4A32 A;  4UIB A;  4B10 A;  3NH4 A;  4YWY A;  5KTD A;  2O28 A;  2ANP A;  2ZPA A;  2Z3N A;  3SJE A;  5A28 A;  4OC0 A;  1VGY A;  3TOA A;  2PJ6 A;  4MHZ A;  4BIN A;  2HUZ A;  1ON0 A;  4MCR A;  4X5K A;  2C1C A;  3NE8 A;  5G22 A;  1Z2L A;  2Q7B A;  4CAV A;  2PJ8 A;  2P6G A;  3FF3 A;  5AG6 A;  2VXK A;  4OC4 A;  2J8N A;  2NYQ A;  4ZI6 A;  2PJ5 A;  1XF8 A;  3KQX A;  3BXM A;  4UCM A;  3N7Z A;  1KUX A;  1Y0Y A;  2EBJ A;  5LYI A;  3SXO A;  3GLJ A;  2B4D A;  5K8P A;  1IIC A;  3NFZ A;  4MRI A;  4QUS A;  1QQ9 A;  2CNS A;  5AG5 A;  4KOY A;  1NSA A;  4K3N A;  3B8G A;  4UEZ A;  3WC7 A;  3R95 A;  4AVA A;  3UY5 A;  3TC8 A;  1I12 A;  4H2K A;  2C6G A;  2Z11 A;  2R98 A;  4OKO A;  3FEC A;  4PXE A;  1PYT B;  2FCK A;  2QYV A;  3QAY A;  4R6T A;  3IU1 A;  4B5O A;  1ZG8 A;  4FBE A;  3IGR A;  3NH8 A;  1M4I A;  2PJ1 A;  5LYD A;  2FXF A;  5J8C A;  5ELY A;  1WK4 A;  2YNC C;  4MCP A;  5LRJ A;  3B3T A;  4A31 A;  4UWJ A;  4R3L A;  4MHY A;  4NXY A;  1YLO A;  5E96 A;  1P4N A;  2RC4 A;  3EC4 A;  5GCN A;  4B14 A;  2BCO A;  4KVX A;  2ZEM A;  1S7F A;  3N5F A;  4R87 A;  3FYN A;  4CYN A;  4MHN A;  4E2A A;  2PJ9 A;  2G0B A;  3TO6 A;  4R76 A;  1Y7R A;  2G9D A;  5G20 A;  4Z65 A;  4CYO A;  4HNW B;  1MJB A;  1IYK A;  1A2Z A;  2GAN A;  4MFL A;  1IY7 A;  3VH9 A;  4U9Y A;  4AVB A;  2EO8 A;  1QSR A;  4CAW A;  3R1K A;  4L8A A;  3D67 A;  1XEB A;  2GU2 A;  2D4O A;  3BJ8 A;  1M44 A;  1VKC A;  2Q4Y A;  4OC1 A;  3PZJ A;  3FRM A;  2O4H A;  2HV2 A;  2VI7 A;  3ZJ0 A;  3LD2 A;  4KOS A;  2PJ3 A;  3K2K A;  4P4E A;  4KSF A;  1AMP A;  5AGE A;  2AFX A;  3H4Q A;  1IID A;  4P10 A;  2R8V A;  3JTK A;  4XNH B;  4UIA A;  4HPS A;  4B5P A;  2FVG A;  2YNE A;  4NGP A;  3I1U A;  4B12 A;  4BMH A;  2FE7 A;  2YND A;  1MJ9 A;  4HNX B;  1K4J A;  4F0Y A;  1QSM A;  3B3V A;  5C82 A;  2JBJ A;  1XIX A;  1OZP A;  2ARH A;  2ZEE A;  3JVN A;  4O23 A;  3F5B A;  1XMT A;  2ODF A;  3E0K A;  4DJL A;  3PB8 X;  4P6Y A;  3S9N A;  2IMO A;  2OH1 A;  2X7B A;  2ZOG A;  3H5Z A;  4MI4 A;  1Z4E A;  2AFZ A;  4UFW A;  3CXP A;  2XEJ A;  3IWW A;  4AB7 A;  1QSN A;  4KOW A;  4C2Y A;  3W91 A;  2CNT A;  5KTA A;  4CGN A;  2PDO A;  4PPZ A;  1L0C A;  1QMU A;  3P2H A;  1IYL A;  1JWQ A;  2P0W A;  2FS5 A;  2NMT A;  2OU2 A;  3SJG A;  3HLP A;  4R9M A;  3D2M A;  1Q2C A;  3NE7 A;  4UEF A;  4KSI A;  3V7Z A;  3DLJ A;  3L2N A;  2PRQ A;  3BHX A;  1Y9W A;  2Z3L A;  2DPT A;  3CXQ A;  1M4D A;  1AUG A;  1M1D A;  2O53 A;  1VHE A;  3EO4 A;  3RAM A;  2PE3 A;  3MRU A;  4F8Z A;  1CPX A;  4UA3 A;  3MN8 A;  3FH4 A;  4OAE A;  1IU8 A;  4ZY0 A;  3D7F A;  3KI9 A;  3TE4 A;  1Q2Y A;  5H86 A;  2GLJ A;  3I9S A;  2WPX A;  1YME A;  2POK A;  1R43 A;  3RYO A;  2G3A A;  1WWZ A;  4OME A;  3WAB A;  2F5I A;  3BLN A;  3D3S A;  1CJW A;  5G1Z A;  2DF5 A;  1IGB A;  1YLE A;  2AFM A;  4UCP A;  2PJ0 A;  3DSB A;  2I00 A;  4CRY B;  3D7G A;  4X8I A;  1VIX A;  3KZW A;  4Q36 A;  1F2O A;  2OR4 A;  2A4N A;  1N71 A;  2R7H A;  3D7H A;  4YRH A;  3FVL A;  4RS2 A;  4CYQ A;  1S60 A;  4P4D A;  2AE6 A;  4IF5 A;  3FEE A;  4K30 A;  2PJ4 A;  1TKJ A;  1GYT A;  3WC6 A;  3FBU A;  1Q2D A;  3G8W A;  2Q51 A;  2F8H A;  4JLY A;  2B4B A;  2IJZ A;  1NSL A;  5D8N A;  4XPD C;  1XBU A;  2PSW A;  3WC5 A;  1YQE A;  4FWU A;  2QIR A;  1YGH A;  2ZED A;  4M3S A;  4MBU A;  5LRK A;  4F0X A;  1BAV A;  3EY5 A;  1LOK A;  4OC5 A;  3T8W A;  2ZEO A;  4M6G A;  3DGV A;  4NGT A;  4NGQ A;  4KVM E;  1IOF A;  1DE4 C;  2QML A;  3LAC A;  3QNV A;  1CX8 A;  3DR6 A;  4TWE A;  4UWI A;  3SJX A;  1S3Z A;  1TIQ A;  2REE A;  1UWY A;  3PGP A;  4PK3 A;  2OOT A;  1M4L A;  4PSW A;  3JRU A;  2OZH A;  3SHP A;  3NA6 A;  5DWM A;  1CG2 A;  1H8L A;  3GUX A;  4NCZ A;  5HH1 A;  2J8R A;  3R9E A;  1QSO A;  2PIZ A;  4M6I A;  3S9L A;  3CT9 A;  3PB7 X;  4MCQ A;  3IIB A;  4U5Y A;  4U9Z A;  4QBJ A;  5J8F A;  4PV6 A;  4L89 A;  4A39 A;  2D4P A;  4X3R A;  4CAE A;  4H89 A;  2B5G A;  3IWE A;  1ZO0 A;  3S9M A;  1PU9 A;  4YU9 A;  2CF4 A;  1XOV A;  2ZEN A;  2FL4 A;  3FJU A;  3T9Y A;  1YK3 A;  2EWB A;  4OID A;  5K8N A;  3SJF A;  4EME A;  1YW6 A;  3RZA A;  3H8E A;  3VAT A;  1U6M A;  5HVF A;  4F9V A;  2XEG A;  2ABZ A;  1BOB A;  2ZW5 A;  4CGO A;  1TF9 A;  5BWA B;  2BOA A;  2Y0M A;  4OIW A;  4R3K A;  1EE3 P;  1ZG9 A;  4AG7 A;  1QST A;  3V38 A; 
#chains in the Genus database with same CATH homology
 4H6U A;  4LX9 A;  2YGW A;  3I3G A;  1PUA A;  1KUY A;  1GHE A;  1M4G A;  1J4J A;  4GS4 A;  1Z9U A;  3FB3 A;  4B11 A;  2CY2 A;  5F49 A;  4KUA A;  3WR7 A;  3TO7 A;  4XPL A;  1B6B A;  3P2F A;  3FXT A;  5IX3 A;  4MHD A;  2Z3K A;  2WPW A;  2JDD A;  3R9F A;  4CAX A;  2AJ6 A;  4IUS A;  2Q4V A;  4HKF A;  4H6Z A;  4ZBG A;  3DNS A;  3S6K A;  4MY3 A;  2IL4 A;  1MJA A;  3CXS A;  4Q38 A;  4C68 A;  2PR8 A;  4JWP A;  4YFJ A;  5AG4 A;  5HMN A;  3GKR A;  4FD4 A;  4MFQ A;  5DWN A;  3S6G A;  1I21 A;  1CM0 A;  1KZF A;  2J8M A;  3S6F A;  2ZXV A;  2EVN A;  3QAH A;  4JXQ A;  2JDC A;  3DDD A;  5AG7 A;  1BO4 A;  3W6X A;  4CYP A;  4QC6 A;  2OB0 A;  4UCN A;  3VWE A;  4XPD B;  5F48 A;  3D2P A;  3TO9 A;  4J3G A;  2OZG A;  1Y9K A;  4KZT A;  4KOV A;  3QB8 A;  2WSA A;  4XPK A;  3VWD A;  1NE9 A;  2ZW6 A;  2GIV A;  1S7L A;  4CGM A;  4JD6 A;  4KOR A;  1MK4 A;  4Y49 C;  1B87 A;  1S7N A;  4YGO A;  4AG9 A;  1RXT A;  2Z10 A;  3GYA A;  4AVC A;  2BEI A;  4KUB A;  4ZGY B;  3FIX A;  4KOX A;  2VZZ A;  5F47 A;  2C27 A;  4XNH C;  4DNC A;  2H5M A;  2PRB A;  2Q0Y A;  2PR1 A;  4HNY B;  3S6H A;  4CGP A;  1FY7 A;  5A27 A;  4MFZ A;  3TFY A;  4C2Z A;  4FD7 A;  2JLM A;  2VQY A;  2VZY A;  4JJX A;  4A2Z A;  2ZW4 A;  1XE4 A;  5EBV A;  2JEV A;  4F6A A;  4NEX A;  4CRZ B;  4PK2 A;  4RI1 A;  3T90 A;  4MFP A;  4B5P B;  1VHS A;  2ZW7 A;  3W6S A;  5IB0 A;  4E8O A;  4EVY A;  5I0C A;  3FNC A;  3K9U A;  3DR8 A;  2WUU A;  4OLL A;  5FVJ A;  5EC4 A;  2P6E A;  3F8K A;  2Z3P A;  3LOD A;  2B3V A;  5KTC A;  3G3S A;  3GY9 A;  4KSA A;  5C88 A;  4B13 A;  2REF A;  2FSR A;  1V0C A;  5F46 A;  2CXA A;  2QEC A;  4LUA A;  2VEZ A;  2FIW A;  3MGD A;  3A9L A;  4JXR A;  4KVO E;  4MFJ A;  4FD6 A;  4C7H A;  1UFH A;  3D8P A;  4A33 A;  4KS9 A;  1YVK A;  5G21 A;  1YR0 A;  4M85 A;  2PC1 A;  2B58 A;  2BSW A;  2GE3 A;  4C2X A;  2ATR A;  3TTH A;  4CGL A;  2YNC A;  4UBR A;  2FT0 A;  2Q04 A;  4KLW A;  2B3U A;  3EFA A;  5JQ4 A;  4PSX A;  2VBQ A;  3ZZI A;  5JPH A;  4I49 A;  4NSQ A;  3KKW A;  4QVT A;  4OAD A;  4Y49 B;  3IU2 A;  4FD5 A;  4II9 A;  3IWG A;  4UFX A;  3BJ7 A;  4CAF A;  1R57 A;  3R96 A;  2Z0Z A;  3R9G A;  3V8I A;  2DXQ A;  2EUI A;  3F0A A;  4KOT A;  2I79 A;  4E0A A;  4A95 A;  2B4D B;  1YRE A;  2Z3O A;  4KLV A;  2K5T A;  2KCW A;  4ORF A;  2DPS A;  2BL1 A;  4MY0 A;  5IV0 A;  1LRZ A;  1S5K A;  2P6F A;  5H84 A;  3TT2 A;  4CS0 B;  1KUV A;  1NMT A;  2OZU A;  1P0H A;  3SXN A;  1I1D A;  2B5G B;  2BUE A;  3EXN A;  5ISV A;  4MJ8 A;  4A30 A;  4ONU A;  1RO5 A;  2Z3M A;  1YVO A;  2CNM A;  4NF1 A;  3TOB A;  5CNP A;  4KOU A;  1S7K A;  3C26 A;  1SQH A;  4C7I A;  1Z4R A;  3OWC A;  2R1I A;  4R57 A;  4UFV A;  2FIA A;  3JUW A;  4BBH A;  1IB1 E;  1YX0 A;  2HQY A;  4MFK A;  2G3T A;  2Q44 A;  4QB9 A;  3PP9 A;  2PQ8 A;  4A32 A;  4B10 A;  5KTD A;  2O28 A;  2ZPA A;  2Z3N A;  5A28 A;  3TOA A;  2HUZ A;  1ON0 A;  4X5K A;  5G22 A;  2Q7B A;  4CAV A;  2P6G A;  5AG6 A;  2VXK A;  2J8N A;  1XF8 A;  4UCM A;  3N7Z A;  1KUX A;  3SXO A;  2B4D A;  1IIC A;  4QUS A;  2CNS A;  5AG5 A;  4KOY A;  3B8G A;  3R95 A;  4AVA A;  3UY5 A;  1I12 A;  2Z11 A;  2R98 A;  2FCK A;  3IU1 A;  4B5O A;  3IGR A;  1M4I A;  2FXF A;  5J8C A;  1WK4 A;  2YNC C;  4A31 A;  4UWJ A;  4R3L A;  4NXY A;  5E96 A;  1P4N A;  2RC4 A;  3EC4 A;  5GCN A;  4B14 A;  4KVX A;  1S7F A;  4R87 A;  3FYN A;  4CYN A;  4E2A A;  2G0B A;  3TO6 A;  1Y7R A;  5G20 A;  4CYO A;  4HNW B;  1MJB A;  1IYK A;  2GAN A;  4MFL A;  4U9Y A;  4AVB A;  1QSR A;  4CAW A;  3R1K A;  4L8A A;  1XEB A;  2D4O A;  3BJ8 A;  1M44 A;  1VKC A;  2Q4Y A;  3PZJ A;  3FRM A;  2HV2 A;  2VI7 A;  3ZJ0 A;  3LD2 A;  4KOS A;  4KSF A;  5AGE A;  3H4Q A;  1IID A;  2R8V A;  3JTK A;  4XNH B;  4B5P A;  2YNE A;  4B12 A;  4BMH A;  4HNX B;  2YND A;  2FE7 A;  1MJ9 A;  1K4J A;  4F0Y A;  1QSM A;  5C82 A;  1XIX A;  1OZP A;  2ARH A;  3JVN A;  3F5B A;  1XMT A;  3E0K A;  2OH1 A;  2X7B A;  3H5Z A;  4MI4 A;  1Z4E A;  4UFW A;  3CXP A;  4AB7 A;  1QSN A;  4KOW A;  4C2Y A;  3W91 A;  2CNT A;  5KTA A;  4CGN A;  2PDO A;  1L0C A;  3P2H A;  1IYL A;  2P0W A;  2FS5 A;  2NMT A;  2OU2 A;  4R9M A;  3D2M A;  1Q2C A;  3NE7 A;  1Y9W A;  2Z3L A;  2DPT A;  3CXQ A;  1M4D A;  3EO4 A;  1M1D A;  4UA3 A;  4OAE A;  3TE4 A;  1Q2Y A;  5H86 A;  3I9S A;  2WPX A;  3RYO A;  2G3A A;  1WWZ A;  2F5I A;  3BLN A;  3D3S A;  1CJW A;  5G1Z A;  1YLE A;  4UCP A;  3DSB A;  4CRY B;  2I00 A;  4Q36 A;  2R7H A;  2A4N A;  1N71 A;  4YRH A;  4CYQ A;  4RS2 A;  1S60 A;  2AE6 A;  4IF5 A;  4K30 A;  3FBU A;  1Q2D A;  3G8W A;  4JLY A;  2B4B A;  1NSL A;  4XPD C;  2PSW A;  2QIR A;  1YGH A;  4M3S A;  4MBU A;  4F0X A;  3EY5 A;  4KVM E;  2QML A;  3DR6 A;  4UWI A;  1S3Z A;  1TIQ A;  2REE A;  3PGP A;  4PK3 A;  4PSW A;  2OZH A;  3SHP A;  5DWM A;  4NCZ A;  5HH1 A;  2J8R A;  3R9E A;  1QSO A;  4U5Y A;  4U9Z A;  4QBJ A;  5J8F A;  4PV6 A;  4L89 A;  2D4P A;  4CAE A;  4H89 A;  2B5G A;  3IWE A;  1ZO0 A;  1PU9 A;  2FL4 A;  3T9Y A;  1YK3 A;  1U6M A;  1BOB A;  2ZW5 A;  4CGO A;  5BWA B;  2Y0M A;  3TCV A;  4R3K A;  4AG7 A;  1QST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...