2CY2A

Crystal structure of ttha1209 in complex with acetyl coenzyme a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
174
structure length
174
Chain Sequence
VRIRRAGLEDLPGVARVLVDTWRATYRGVVPEAFLEGLSYEGQAERWAQRLKTPTWPGRLFVAESESGEVVGFAAFGPDRASGFPGYTAELWAIYVLPTWQRKGLGRALFHEGARLLQAEGYGRMLVWVLKENPKGRGFYEHLGGVLLGEREIELGGAKLWEVAYGFDLGGHKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords probable acetyltransferase
publication title Crystal structure of TTHA1209 in complex with acetyl coenzyme A
rcsb
source organism Thermus thermophilus
total genus 48
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2cy2A00
2Q44A 2I00A 4DNCA 2B4DA 3T9YA 2PR1A 3FRMA 5IX3A 1MJAA 4UBRA 3LODA 2B3UA 3IWGA 4AB7A 4MJ8A 2VBQA 3R9GA 3FBUA 2OZUA 3W91A 2ZW7A 4B5PA 1Y9WA 2ZW5A 2Q04A 3KKWA 2P6FA 3TOBA 2HQYA 4KOWA 2VZZA 2R8VA 4KVME 1XE4A 2BSWA 3FIXA 2ZW6A 1QSOA 2F5IA 4H89A 2B5GB 3UY5A 3CXQA 3I9SA 3F8KA 1MJBA 4R9MA 1BO4A 5KTDA 4CAVA 3ZJ0A 2Z10A 5E96A 1N71A 3DSBA 1XMTA 2J8RA 4FD5A 5C82A 1J4JA 4PSWA 4IF5A 4QC6A 3PZJA 2BEIA 4AVBA 4JXRA 2KCWA 3PP9A 3TO6A 3F5BA 4J3GA 4II9A 3QB8A 2AJ6A 3VWEA 1YREA 2R7HA 3EXNA 3OWCA 3P2FA 4EVYA 4JJXA 2OB0A 5H86A 3SHPA 3TOAA 2GIVA 4UWIA 1S5KA 4MY0A 1QSNA 4AG9A 4PK3A 2O28A 3TO7A 3K9UA 4NF1A 4L89A 2FXFA 2J8NA 1FY7A 4HNWB 4KUAA 1M4DA 1MJ9A 2BL1A 5HMNA 5F49A 2I79A 2P6EA 3D8PA 4R87A 4M85A 1YVOA 1CM0A 1S7FA 2AE6A 5IV0A 4NEXA 4MI4A 1Y9KA 2REFA 1XF8A 5JQ4A 1I12A 4KOSA 5EBVA 3SXOA 3EO4A 4KVOE 5EC4A 1RXTA 3EC4A 2K5TA 4HNXB 2PC1A 3P2HA 1QSMA 3TCVA 4K30A 1VKCA 4QBJA 3W6XA 2CY2A 1RO5A 1Z4RA 4KVXA 1P4NA 4ORFA 3JUWA 1IYLA 3LD2A 3D3SA 4B5OA 4RS2A 4XPKA 1S60A 2OZGA 2D4OA 4KOXA 1KZFA 3CXPA 1SQHA 4XNHB 3E0KA 3GKRA 4CRYB 3R9EA 1WK4A 2P0WA 2VQYA 2B58A 1QSRA 2REEA 1IB1E 1Y7RA 4GS4A 3TTHA 4KOUA 5J8FA 3VWDA 1ON0A 1YLEA 4X5KA 4OADA 4XPLA 2VXKA 4F6AA 2B3VA 4KZTA 4AVCA 4F0YA 3G8WA 2VI7A 4PSXA 2OH1A 3EY5A 2B5GA 3DR6A 2G3TA 1GHEA 3R96A 2J8MA 4YRHA 3D2PA 3S6GA 4MBUA 2QIRA 4KOTA 5F47A 2B4BA 2A4NA 5I0CA 1L0CA 4KORA 1YR0A 5HH1A 2ZW4A 3S6FA 1Z9UA 4R57A 2FIAA 3TE4A 2ZPAA 4H6UA 4JLYA 3BJ7A 3S6HA 2DXQA 4BMHA 4E8OA 1KUVA 3FYNA 1BOBA 2IL4A 4XPDB 1M4GA 3CXSA 3BLNA 1B6BA 1Q2DA 4AVAA 2WPWA 4XPDC 2P6GA 4NSQA 4NCZA 1WWZA 2ATRA 2Q0YA 4CAXA 4I49A 4KOVA 4PK2A 4M3SA 2ARHA 4R3LA 3V8IA 3T90A 3FB3A 4AG7A 1Q2CA 3H4QA 4Y49B 4CS0B 3IGRA 2X7BA 3BJ8A 3DNSA 1UFHA 4QUSA 5H84A 3DR8A 1Q2YA 5KTCA 4LX9A 2NMTA 2FT0A 2G0BA 2Z11A 1M44A 2CNTA 1R57A 4E2AA 2R1IA 4UA3A 4FD4A 5DWMA 2Z0ZA 3W6SA 4U5YA 5J8CA 3D2MA 3N7ZA 4QB9A 3MGDA 2H5MA 2B4DB 3TFYA 5DWNA 1S7LA 4HKFA 5CNPA 3PGPA 1M1DA 4HNYB 2PRBA 2GE3A 2BUEA 2GANA 1M4IA 1S3ZA 4L8AA 1KUYA 4OLLA 2OZHA 3JVNA 4XNHC 4B5PB 1YX0A 2JEVA 2JDDA 3RYOA 2OU2A 1B87A 3GYAA 5C88A 2CNMA 4UWJA 2FIWA 2VEZA 2Q4YA 3TT2A 1TIQA 1U6MA 3EFAA 1CJWA 4U9YA 3C26A 1VHSA 5IB0A 2FCKA 1S7NA 4KLVA 2Y0MA 5F46A 1S7KA 1K4JA 4QVTA 1IYKA 5ISVA 3I3GA 2PQ8A 5FVJA 2FL4A 5F48A 5JPHA 1NMTA 3DDDA 4JD6A 1XEBA 2ZXVA 1KUXA 2QMLA 4YGOA 1IICA 1YGHA 2FSRA 4LUAA 1PUAA 3G3SA 3FNCA 4NXYA 4MY3A 3FXTA 4ONUA 1NE9A 2Q7BA 3R95A 4FD6A 2PSWA 4KOYA 2D4PA 3R9FA 4JWPA 4CRZB 1PU9A 3SXNA 4ZBGA 2FE7A 2EUIA 2EVNA 1YVKA 2PR8A 1V0CA 3TO9A 2FS5A 4OAEA 2JDCA 1Z4EA 2QECA 2VZYA 2PDOA 2R98A 3ZZIA 1MK4A 1I21A 2RC4A 1I1DA 1XIXA 4CAWA 1OZPA 1P0HA 1IIDA 2HUZA 2JLMA 4R3KA 2C27A 3S6KA 4KUBA 2Q4VA 4Y49C 5GCNA 3QAHA 2WPXA 4H6ZA 3WR7A 4FD7A 4IUSA 3R1KA 5KTAA 4U9ZA 1LRZA 3NE7A 3B8GA 1YK3A 4E0AA 4YFJA 2CNSA 2G3AA 3F0AA 1NSLA 2HV2A 3GY9A 1QSTA 4MHDA 4JXQA 4KLWA 4PV6A 4RI1A
chains in the Genus database with same CATH superfamily
2DF5A 1HDUA 2I00A 2Q44A 4DNCA 4X3RA 1QMUA 4OC2A 2B4DA 2G9DA 3T9YA 2AFXA 2PR1A 4A39A 3FRMA 3IIBA 5IX3A 2FVGA 4P44A 1MJAA 2GFQA 3LODA 1CP6A 2B3UA 3IWGA 3NFZA 4M6IA 4NGNA 4OP4A 4UBRA 4AB7A 4MJ8A 5CBMA 2VBQA 3R9GA 1Z8LA 4PQAA 3FBUA 5AG4A 3LACA 2PJ7A 2OZUA 3W91A 2ZW7A 4B5PA 1Y9WA 2EK9A 2ZW5A 4HPSA 2C6GA 1IOFA 2AFUA 2PJ9A 2Q04A 3KKWA 2P6FA 3TOBA 4CYQA 4UEEA 2HQYA 3KQZA 4KOWA 2VZZA 4FAIA 4EFDA 4F8ZA 2R8VA 4KVME 2NSMA 1EE3P 5DS0A 1VHOA 1XE4A 2BSWA 3FIXA 2ZW6A 3FECA 1QSOA 2F5IA 1XOVA 3CPXA 3LWUA 4H89A 3RZAA 3S9MA 4O23A 4NJQA 5ELYA 2B5GB 4LQ6A 3UY5A 3GB0A 2JEWA 3CXQA 3I9SA 5A28A 4PXCA 4CAFA 4OKOA 3SJXA 3F8KA 2Z3PA 1MJBA 2PIZA 4R9MA 1BO4A 1VGYA 5KTDA 3A9LA 1LAPA 3KQXA 3NE8A 4EWTA 5LRGA 4CAVA 5F09A 4RN7A 1LOKA 3ZJ0A 1TKHA 2Z10A 3IEHA 5CPAA 3H5ZA 4DJLA 2IQ6A 5E96A 1N71A 3DSBA 5LRJA 1XMTA 2J8RA 4FD5A 1ARLA 5C82A 1J4JA 4ZY0A 4PSWA 4IF5A 4MFPA 4QC6A 3PZJA 2BEIA 4OIWA 4AVBA 4X2TA 4ZI6A 4JXRA 4MHYA 2KCWA 4ZY1A 3PP9A 1YW4A 3TO6A 3F5BA 2O53A 1DE4C 1IU8A 4J3GA 4B6ZA 4II9A 3B3CA 3QB8A 3D7GA 5AG7A 1ZO0A 2AJ6A 3SI2A 1YREA 3VWEA 4B13A 4CGPA 2R7HA 3EXNA 1XFOA 3OWCA 3P2FA 4JJXA 2O4HA 2OB0A 5H86A 4EVYA 3SHPA 4G1PA 3TOAA 2AFSA 2GIVA 4UWIA 5LYLA 1CX8A 2IJZA 1PYTB 3CT9A 5AGEA 1YMEA 1ELLP 4R6TA 1S5KA 1HDQA 1AYEA 4MY0A 5LYFA 2PRQA 4OC0A 4A30A 1QSNA 4AG9A 4PK3A 4LQGA 4OIDA 2I3CA 2O28A 4FBEA 3NH5A 3S9NA 3TO7A 2DPSA 4OC4A 4R76A 3K9UA 4NF1A 4L89A 2PJ0A 1Y0YA 4M6HA 4MFZA 1CG2A 1X10A 2FXFA 3VH9A 2RFHA 4WWVA 4CGNA 4OC1A 2J8NA 4UF4A 4Q38A 1FY7A 4HNWB 4MHZA 4UEFA 4KUAA 1M4DA 1MJ9A 2BL1A 5HMNA 2CIJA 5F49A 4NGRA 4UCPA 2I79A 4MMOA 1OBRA 1UWYA 2ANPA 2P6EA 3D8PA 4R87A 5I4MA 4F9VA 2PVVA 4M85A 1ZG7A 3IC1A 1YVOA 1CM0A 3WC6A 3SI0A 4C2XA 1S7FA 2YNEA 2QYVA 2AE6A 3IJ3A 4A32A 4GXHA 5IV0A 4NEXA 4DYOA 3PFEA 3KHZA 4MI4A 2QVPA 1Y9KA 2REFA 1XF8A 7CPAA 1I12A 4K3NA 1R43A 4KOSA 5JQ4A 5EBVA 3SXOA 3KL9A 3EO4A 3T8WA 4KVOE 5EC4A 1RXTA 1F2OA 3EC4A 2DEAA 2PJCA 4OC5A 4IHMA 2K5TA 4HNXB 2PC1A 3P2HA 1QSMA 1TF8A 4MCRA 3B3TA 4NGSA 2PIYA 2ZEGA 3FVLA 3TCVA 4K30A 2ZEHA 4KSIA 1VKCA 4QBJA 3W6XA 2PJ8A 2CY2A 1RO5A 1Z4RA 1AMPA 1QQ9A 2PCUA 2ZEOA 4KVXA 1P4NA 4ORFA 3JUWA 1IYLA 3IO1A 3LD2A 4RI1A 3D3SA 3B7IA 3BHXA 3DLJA 2CXAA 4EMEA 4B5OA 4MFLA 4RS2A 4XPKA 1S60A 2OZGA 2ZOGA 2IMOA 2D4OA 4KOXA 4MFQA 4NFRA 5EMIA 1KZFA 3CXPA 1KWMA 1SQHA 2V8VA 3E0KA 3GKRA 4XNHB 5HVFA 4CRYB 3D68A 2YNCC 3R9EA 1WK4A 2AFWA 2JBKA 2P0WA 3VATA 2ZEPA 2VQYA 4MXUA 5A27A 2B58A 1TF9A 2F8HA 1QSRA 1CBXA 2CTCA 2REEA 4MCPA 1Z8WA 4UFVA 1ARMA 3CZXA 4TWEA 1Z8TA 1IB1E 4P10A 1Y7RA 2J9AA 4GS4A 4AXVA 4CGOA 1TKFA 3TTHA 2V8HA 4KOUA 5J8FA 3VWDA 1ON0A 3MN8A 3BI0A 1YLEA 2JBJA 3HLPA 4OADA 4X5KA 4XPLA 3H8FA 4MHPA 2VXKA 4F6AA 2C1CA 4GM5A 3JRUA 2GREA 4ZGYB 4CAEA 4C7HA 5AG6A 2GLFA 2B3VA 4KZTA 4AVCA 4F0YA 3G8WA 2VI7A 4RUHA 1LCPA 4A33A 2QJ8A 4PSXA 2HC9A 2OH1A 3EY5A 2B5GA 2HB6A 3DR6A 1LANA 2Z3OA 2G3TA 3TC8A 4P4EA 1VIXA 4C7IA 3NH8A 4PXBA 2Z3MA 1F2PA 3NA6A 3S9LA 1GHEA 3R96A 4MCQA 2DPTA 2J8MA 4PPZA 4YRHA 4ZYQA 3D2PA 3QAYA 3S6GA 2NYQA 3PBEA 1LAMA 4MBUA 2QIRA 4X8IA 5LYIA 4KOTA 5F47A 3IU2A 3PB7X 3PEIA 2B4BA 4BBHA 3IWEA 3D7FA 4KS9A 4UEZA 2V8DA 2A4NA 5I0CA 2XEGA 5K8OA 3K9TA 1L0CA 1BPNA 3H8GA 4KORA 1YR0A 2EO8A 5HH1A 2ZW4A 3D7HA 3S6FA 1Z9UA 2F7VA 4R57A 2FIAA 4UIBA 5G1ZA 3TE4A 2XEFA 2ZPAA 4H6UA 3RAMA 3BI1A 3KASA 4YWYA 4JLYA 3BJ7A 3WABA 1LFWA 4FWUA 3S6HA 1IY7A 2DXQA 4BMHA 4E8OA 1NSAA 1BPMA 1KUVA 3FYNA 4JYWA 1BOBA 2IL4A 4NGQA 1CPXA 4XPDB 3FF3A 4NGPA 1M4GA 3D7DA 3CXSA 3BLNA 2PJ4A 1B6BA 1Q2DA 4AVAA 8CPAA 5JM6A 2WPWA 1ZLIA 4XPDC 2P6GA 4MHNA 4NSQA 1YW6A 2C6PA 3FEDA 1BAVA 3K2KA 4P45A 4NCZA 1WWZA 5K8MA 1DTDA 4CYPA 1YLOA 1ZG9A 2ATRA 4CYOA 2Q0YA 2Q4ZA 4UFXA 4A37A 4CAXA 2VL1A 3FX6A 4I49A 1H8LA 3DGVA 4JZ0A 4KOVA 4PK2A 3GUXA 4M3SA 2ARHA 5THWA 4R3LA 3V8IA 1VHEA 3T90A 1AUGA 3FB3A 4MFKA 4AG7A 3D66A 1PCAA 3I1UA 1Q2CA 3H4QA 3B35A 4Y49B 4CS0B 2EK8A 2CF4A 2GU2A 3IGRA 3IU1A 5G20A 3SJFA 2C6CA 4BD9A 2X7BA 4KSAA 4Q7AA 2AFZA 3BJ8A 3WC7A 3DNSA 1UFHA 3PB6X 4QUSA 2PJAA 1YSJA 4P4JA 5H84A 3DR8A 4C68A 5J1QA 4R8FA 1Q2YA 3KZWA 5KTCA 2NMTA 1GYTA 2FT0A 2OR4A 2G0BA 1Z2LA 3B2YA 4LX9A 4UFWA 2EWBA 2Z11A 1M44A 1FNOA 2CNTA 1R57A 5LYDA 4E2AA 2R1IA 4KSFA 4M6GA 2AFOA 4P4DA 4UA3A 1CPSA 4FD4A 2Z0ZA 5DWMA 4F9UA 3MRUA 3W6SA 4U5YA 5J8CA 4DUKA 4CYNA 4YU9A 3D2MA 3N7ZA 3FMCA 4QB9A 3MGDA 1RTQA 1X12A 2H5MA 2B4DB 5IB9A 3TFYA 5DWNA 5G22A 3PRTA 1S7LA 4HKFA 5CNPA 2ZELA 3PGPA 3RO0A 4CGMA 1M1DA 2PRBA 4HNYB 2GE3A 2BUEA 2GANA 3VARA 1M4IA 1Z5RA 1S3ZA 4L8AA 1KUYA 2PVWA 4OLLA 4B11A 2OZHA 3WC5A 3JVNA 4XNHC 4TNUA 1XBUA 4B5PB 2YNCA 5BWAB 1YX0A 2JEVA 2JDDA 4P4IA 2Z3KA 3RYOA 2OU2A 1B87A 4BINA 2XEIA 3GYAA 2V8GA 5C88A 2CNMA 2PJBA 3QNVA 1TKJA 4Z65A 4UWJA 4C2YA 1CP7A 2FIWA 2PJ1A 2VEZA 2Q4YA 3TT2A 1IGBA 4IK2A 3KR4A 1TIQA 4W9YA 1U6MA 3EFAA 2ZEFA 4UIAA 2Z3NA 4P4BA 1CJWA 4U9YA 3D4UA 2EBJA 3CPAA 3C26A 3CDXA 1VHSA 4MCSA 4ZX9A 5IB0A 2FCKA 1S7NA 4KLVA 2Y0MA 5F46A 3GIUA 1S7KA 4A2ZA 5HVGA 4P6YA 1BLLE 1R3NA 3SI1A 1IOIA 1K4JA 1IYKA 4QVTA 5ISVA 4R7MA 5AG5A 3I3GA 2PQ8A 1HEEA 5FVJA 2WSAA 4MFJA 4NJRA 2PJ2A 2PJ3A 2FL4A 5F48A 4A38A 5JPHA 1NMTA 4CPAA 3DDDA 4JD6A 1XEBA 5D29A 1YQEA 1KUXA 2QMLA 2ZXVA 4YGOA 3D67A 4B12A 1IICA 1YGHA 2FSRA 3B3SA 4LUAA 2Q43A 1PUAA 1F57A 2WUUA 3G3SA 5K8PA 4WJBA 4H2KA 4OMEA 3ISXA 3FNCA 4NXYA 4MY3A 4OC3A 3FXTA 3FH4A 3HUVA 4ONUA 1NE9A 2Q7BA 4A94A 3R95A 4ZY2A 1JQGA 4FD6A 4B14A 4PXDA 2PSWA 2YNDA 4CGLA 4NGTA 4KOYA 3TX8A 2D4PA 2YGWA 3R9FA 3GLJA 3N5FA 4JWPA 2ZEDA 4CRZB 1PU9A 3SXNA 5JGFA 1A2ZA 6CPAA 3FEEA 3KR5A 4ZBGA 3WT4A 2POKA 1ELMP 5JH9A 2ZOFA 2V77A 1ZG8A 3H8EA 4ONWA 2OOTA 2FE7A 2EUIA 2EVNA 1FT7A 4UCNA 1Y7EA 1YVKA 3PB4X 2PR8A 3RBUA 1V0CA 3TO9A 2FS5A 4IAVA 3BXMA 4OAEA 4F0XA 2JDCA 3SJGA 1Z4EA 3KHXA 2QECA 2ZEEA 4B10A 3PB9X 2BOAA 1JWQA 3PB8X 1XRYA 2VZYA 2PDOA 3FJUA 4Q36A 2R98A 3ZZIA 1MK4A 3IFEA 1I21A 3IWWA 3PFOA 2RC4A 1I1DA 1XIXA 5D8NA 3LMSA 4CAWA 1OZPA 2GLJA 3SJEA 2WYRA 4UCMA 2BCOA 5G21A 5HVHA 1P0HA 1IIDA 5HXDA 3L2NA 3ISZA 4FUUA 2HUZA 2JLMA 4R3KA 2C27A 3S6KA 4A95A 4KUBA 1XMBA 2Q4VA 4Y49C 4C2ZA 5GCNA 2ZEMA 3JTKA 2XEJA 3QAHA 2WPXA 4A31A 4H6ZA 1M4LA 3WR7A 4FD7A 3V38A 4IUSA 1Y0RA 3R1KA 5KTAA 4U9ZA 3B3VA 1LRZA 4MRIA 3PBBA 1XJOA 2Z3LA 3NE7A 3B8GA 4P4FA 4PXEA 2RB7A 1YK3A 2ZENA 2PJ6A 3V7ZA 3B3WA 4E0AA 4YFJA 2CNSA 2Q7SA 1Z8XA 2PE3A 5K8NA 3KI9A 3RNZA 2G3AA 2ABZA 2Q51A 4ZX8A 3F0AA 2ODFA 2PJ5A 4NGMA 2HV2A 1NSLA 3GY9A 1QSTA 2WZNA 3KGQA 4MHDA 4JXQA 5LRKA 4KLWA 2CTBA 1Q7LA 2BO9A 3NH4A 4PV6A 1TXRA 2AFMA 1ZLHA
chains in the Genus database with same CATH topology
2Q44A 2I00A 4DNCA 2B4DA 3T9YA 2PR1A 3FRMA 5IX3A 1MJAA 4UBRA 3LODA 2B3UA 3IWGA 4AB7A 4MJ8A 2VBQA 3R9GA 3FBUA 5AG4A 2OZUA 3W91A 2ZW7A 4B5PA 1Y9WA 2ZW5A 2Q04A 3KKWA 2P6FA 3TOBA 4CYQA 2HQYA 4KOWA 2VZZA 2R8VA 4KVME 1XE4A 2BSWA 3FIXA 2ZW6A 1QSOA 2F5IA 4H89A 2B5GB 3UY5A 3CXQA 3I9SA 5A28A 4CAFA 3F8KA 2Z3PA 1MJBA 4R9MA 1BO4A 5KTDA 3A9LA 4CAVA 3ZJ0A 2Z10A 3H5ZA 5E96A 1N71A 3DSBA 1XMTA 2J8RA 4FD5A 5C82A 1J4JA 4PSWA 4IF5A 4MFPA 4QC6A 3PZJA 2BEIA 4AVBA 4JXRA 2KCWA 3PP9A 3TO6A 3F5BA 4J3GA 4II9A 3QB8A 5AG7A 1ZO0A 2AJ6A 3VWEA 1YREA 4B13A 4CGPA 2R7HA 3EXNA 3OWCA 3P2FA 4EVYA 4JJXA 2OB0A 5H86A 3SHPA 3TOAA 2GIVA 4UWIA 5AGEA 1S5KA 4MY0A 4A30A 1QSNA 4AG9A 4PK3A 2O28A 3TO7A 2DPSA 3K9UA 4NF1A 4L89A 4MFZA 4CGNA 2FXFA 2J8NA 4Q38A 1FY7A 4HNWB 4KUAA 1M4DA 1MJ9A 2BL1A 5HMNA 5F49A 4UCPA 2I79A 2P6EA 3D8PA 4R87A 4M85A 1YVOA 1CM0A 4C2XA 1S7FA 2YNEA 2AE6A 4A32A 5IV0A 4NEXA 4MI4A 1Y9KA 2REFA 1XF8A 5JQ4A 1I12A 4KOSA 5EBVA 3SXOA 3EO4A 4KVOE 5EC4A 1RXTA 3EC4A 2K5TA 4HNXB 2PC1A 3P2HA 1QSMA 3TCVA 4K30A 1VKCA 4QBJA 3W6XA 2CY2A 1RO5A 1Z4RA 4KVXA 1P4NA 4ORFA 3JUWA 1IYLA 3LD2A 3D3SA 2CXAA 4B5OA 4MFLA 4RS2A 4XPKA 1S60A 2OZGA 2D4OA 4KOXA 4MFQA 1KZFA 3CXPA 1SQHA 4XNHB 3E0KA 3GKRA 4CRYB 2YNCC 3R9EA 1WK4A 2P0WA 2VQYA 5A27A 2B58A 1QSRA 2REEA 4UFVA 1IB1E 1Y7RA 4GS4A 4CGOA 3TTHA 4KOUA 5J8FA 3VWDA 1ON0A 1YLEA 4X5KA 4OADA 4XPLA 2VXKA 4F6AA 4ZGYB 4CAEA 4C7HA 5AG6A 2B3VA 4KZTA 4AVCA 4F0YA 3G8WA 2VI7A 4A33A 4PSXA 2OH1A 3EY5A 2B5GA 3DR6A 2Z3OA 2G3TA 4C7IA 2Z3MA 1GHEA 3R96A 2DPTA 2J8MA 4YRHA 3D2PA 3S6GA 4MBUA 2QIRA 4KOTA 5F47A 3IU2A 2B4BA 4BBHA 3IWEA 4KS9A 2A4NA 5I0CA 1L0CA 4KORA 1YR0A 5HH1A 2ZW4A 3S6FA 1Z9UA 4R57A 2FIAA 5G1ZA 3TE4A 2ZPAA 4H6UA 4JLYA 3BJ7A 3S6HA 2DXQA 4BMHA 4E8OA 1KUVA 3FYNA 1BOBA 2IL4A 4XPDB 1M4GA 3CXSA 3BLNA 1B6BA 1Q2DA 4AVAA 2WPWA 4XPDC 2P6GA 4NSQA 4NCZA 1WWZA 4CYPA 4CYOA 2ATRA 2Q0YA 4UFXA 4CAXA 4I49A 4KOVA 4PK2A 4M3SA 2ARHA 4R3LA 3V8IA 3T90A 3FB3A 4MFKA 4AG7A 1Q2CA 3H4QA 4Y49B 4CS0B 3IGRA 5G20A 3IU1A 2X7BA 4KSAA 3BJ8A 3DNSA 1UFHA 4QUSA 5H84A 4C68A 3DR8A 1Q2YA 5KTCA 2NMTA 4LX9A 2FT0A 4UFWA 2G0BA 2Z11A 1M44A 2CNTA 1R57A 4E2AA 2R1IA 4KSFA 4UA3A 4FD4A 5DWMA 2Z0ZA 3W6SA 4U5YA 5J8CA 4CYNA 3D2MA 3N7ZA 4QB9A 3MGDA 2H5MA 2B4DB 3TFYA 5DWNA 5G22A 1S7LA 4HKFA 5CNPA 3PGPA 4CGMA 1M1DA 4HNYB 2PRBA 2GE3A 2BUEA 2GANA 1M4IA 1S3ZA 4L8AA 1KUYA 4OLLA 4B11A 2OZHA 3JVNA 4XNHC 4B5PB 2YNCA 5BWAB 1YX0A 2JEVA 2JDDA 2Z3KA 3RYOA 2OU2A 1B87A 3GYAA 5C88A 2CNMA 4UWJA 4C2YA 2FIWA 2VEZA 2Q4YA 3TT2A 1TIQA 1U6MA 3EFAA 2Z3NA 1CJWA 4U9YA 3C26A 1VHSA 5IB0A 2FCKA 1S7NA 4KLVA 2Y0MA 5F46A 1S7KA 4A2ZA 1K4JA 4QVTA 1IYKA 5ISVA 5AG5A 3I3GA 2PQ8A 5FVJA 2WSAA 4MFJA 2FL4A 5F48A 5JPHA 1NMTA 3DDDA 4JD6A 1XEBA 2ZXVA 1KUXA 2QMLA 4YGOA 4B12A 1IICA 1YGHA 2FSRA 4LUAA 1PUAA 2WUUA 3G3SA 3FNCA 4NXYA 4MY3A 3FXTA 4ONUA 1NE9A 2Q7BA 3R95A 4FD6A 4B14A 2PSWA 2YNDA 4CGLA 4KOYA 2D4PA 2YGWA 3R9FA 4JWPA 4CRZB 1PU9A 3SXNA 4ZBGA 2FE7A 2EUIA 2EVNA 4UCNA 1YVKA 2PR8A 1V0CA 3TO9A 2FS5A 4OAEA 4F0XA 2JDCA 1Z4EA 2QECA 4B10A 2VZYA 2PDOA 4Q36A 2R98A 3ZZIA 1MK4A 1I21A 2RC4A 1I1DA 1XIXA 4CAWA 1OZPA 4UCMA 5G21A 1P0HA 1IIDA 2HUZA 2JLMA 4R3KA 2C27A 3S6KA 4A95A 4KUBA 2Q4VA 4Y49C 4C2ZA 5GCNA 3JTKA 3QAHA 2WPXA 4A31A 4H6ZA 3WR7A 4FD7A 4IUSA 3R1KA 5KTAA 4U9ZA 1LRZA 3NE7A 2Z3LA 3B8GA 1YK3A 4E0AA 4YFJA 2CNSA 2G3AA 3F0AA 1NSLA 2HV2A 3GY9A 1QSTA 4MHDA 4JXQA 4KLWA 4PV6A 4RI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q44 A;  2I00 A;  4DNC A;  2B4D A;  3T9Y A;  2PR1 A;  3FRM A;  5IX3 A;  1MJA A;  4UBR A;  3LOD A;  2B3U A;  3IWG A;  4AB7 A;  4MJ8 A;  2VBQ A;  3R9G A;  3FBU A;  2OZU A;  3W91 A;  2ZW7 A;  4B5P A;  1Y9W A;  2ZW5 A;  2Q04 A;  3KKW A;  2P6F A;  3TOB A;  2HQY A;  4KOW A;  2VZZ A;  2R8V A;  4KVM E;  1XE4 A;  2BSW A;  3FIX A;  2ZW6 A;  1QSO A;  2F5I A;  4H89 A;  2B5G B;  3UY5 A;  3CXQ A;  3I9S A;  3F8K A;  1MJB A;  4R9M A;  1BO4 A;  5KTD A;  4CAV A;  3ZJ0 A;  2Z10 A;  5E96 A;  1N71 A;  3DSB A;  1XMT A;  2J8R A;  4FD5 A;  5C82 A;  1J4J A;  4PSW A;  4IF5 A;  4QC6 A;  3PZJ A;  2BEI A;  4AVB A;  4JXR A;  2KCW A;  3PP9 A;  3TO6 A;  3F5B A;  4J3G A;  4II9 A;  3QB8 A;  2AJ6 A;  3VWE A;  1YRE A;  2R7H A;  3EXN A;  3OWC A;  3P2F A;  4EVY A;  4JJX A;  2OB0 A;  5H86 A;  3SHP A;  3TOA A;  2GIV A;  4UWI A;  1S5K A;  4MY0 A;  1QSN A;  4AG9 A;  4PK3 A;  2O28 A;  3TO7 A;  3K9U A;  4NF1 A;  4L89 A;  2FXF A;  2J8N A;  1FY7 A;  4HNW B;  4KUA A;  1M4D A;  1MJ9 A;  2BL1 A;  5HMN A;  5F49 A;  2I79 A;  2P6E A;  3D8P A;  4R87 A;  4M85 A;  1YVO A;  1CM0 A;  1S7F A;  2AE6 A;  5IV0 A;  4NEX A;  4MI4 A;  1Y9K A;  2REF A;  1XF8 A;  5JQ4 A;  1I12 A;  4KOS A;  5EBV A;  3SXO A;  3EO4 A;  4KVO E;  5EC4 A;  1RXT A;  3EC4 A;  2K5T A;  4HNX B;  2PC1 A;  3P2H A;  1QSM A;  3TCV A;  4K30 A;  1VKC A;  4QBJ A;  3W6X A;  2CY2 A;  1RO5 A;  1Z4R A;  4KVX A;  1P4N A;  4ORF A;  3JUW A;  1IYL A;  3LD2 A;  3D3S A;  4B5O A;  4RS2 A;  4XPK A;  1S60 A;  2OZG A;  2D4O A;  4KOX A;  1KZF A;  3CXP A;  1SQH A;  4XNH B;  3E0K A;  3GKR A;  4CRY B;  3R9E A;  1WK4 A;  2P0W A;  2VQY A;  2B58 A;  1QSR A;  2REE A;  1IB1 E;  1Y7R A;  4GS4 A;  3TTH A;  4KOU A;  5J8F A;  3VWD A;  1ON0 A;  1YLE A;  4X5K A;  4OAD A;  4XPL A;  2VXK A;  4F6A A;  2B3V A;  4KZT A;  4AVC A;  4F0Y A;  3G8W A;  2VI7 A;  4PSX A;  2OH1 A;  3EY5 A;  2B5G A;  3DR6 A;  2G3T A;  1GHE A;  3R96 A;  2J8M A;  4YRH A;  3D2P A;  3S6G A;  4MBU A;  2QIR A;  4KOT A;  5F47 A;  2B4B A;  2A4N A;  5I0C A;  1L0C A;  4KOR A;  1YR0 A;  5HH1 A;  2ZW4 A;  3S6F A;  1Z9U A;  4R57 A;  2FIA A;  3TE4 A;  2ZPA A;  4H6U A;  4JLY A;  3BJ7 A;  3S6H A;  2DXQ A;  4BMH A;  4E8O A;  1KUV A;  3FYN A;  1BOB A;  2IL4 A;  4XPD B;  1M4G A;  3CXS A;  3BLN A;  1B6B A;  1Q2D A;  4AVA A;  2WPW A;  4XPD C;  2P6G A;  4NSQ A;  4NCZ A;  1WWZ A;  2ATR A;  2Q0Y A;  4CAX A;  4I49 A;  4KOV A;  4PK2 A;  4M3S A;  2ARH A;  4R3L A;  3V8I A;  3T90 A;  3FB3 A;  4AG7 A;  1Q2C A;  3H4Q A;  4Y49 B;  4CS0 B;  3IGR A;  2X7B A;  3BJ8 A;  3DNS A;  1UFH A;  4QUS A;  5H84 A;  3DR8 A;  1Q2Y A;  5KTC A;  4LX9 A;  2NMT A;  2FT0 A;  2G0B A;  2Z11 A;  1M44 A;  2CNT A;  1R57 A;  4E2A A;  2R1I A;  4UA3 A;  4FD4 A;  5DWM A;  2Z0Z A;  3W6S A;  4U5Y A;  5J8C A;  3D2M A;  3N7Z A;  4QB9 A;  3MGD A;  2H5M A;  2B4D B;  3TFY A;  5DWN A;  1S7L A;  4HKF A;  5CNP A;  3PGP A;  1M1D A;  4HNY B;  2PRB A;  2GE3 A;  2BUE A;  2GAN A;  1M4I A;  1S3Z A;  4L8A A;  1KUY A;  4OLL A;  2OZH A;  3JVN A;  4XNH C;  4B5P B;  1YX0 A;  2JEV A;  2JDD A;  3RYO A;  2OU2 A;  1B87 A;  3GYA A;  5C88 A;  2CNM A;  4UWJ A;  2FIW A;  2VEZ A;  2Q4Y A;  3TT2 A;  1TIQ A;  1U6M A;  3EFA A;  1CJW A;  4U9Y A;  3C26 A;  1VHS A;  5IB0 A;  2FCK A;  1S7N A;  4KLV A;  2Y0M A;  5F46 A;  1S7K A;  1K4J A;  4QVT A;  1IYK A;  5ISV A;  3I3G A;  2PQ8 A;  5FVJ A;  2FL4 A;  5F48 A;  5JPH A;  1NMT A;  3DDD A;  4JD6 A;  1XEB A;  2ZXV A;  1KUX A;  2QML A;  4YGO A;  1IIC A;  1YGH A;  2FSR A;  4LUA A;  1PUA A;  3G3S A;  3FNC A;  4NXY A;  4MY3 A;  3FXT A;  4ONU A;  1NE9 A;  2Q7B A;  3R95 A;  4FD6 A;  2PSW A;  4KOY A;  2D4P A;  3R9F A;  4JWP A;  4CRZ B;  1PU9 A;  3SXN A;  4ZBG A;  2FE7 A;  2EUI A;  2EVN A;  1YVK A;  2PR8 A;  1V0C A;  3TO9 A;  2FS5 A;  4OAE A;  2JDC A;  1Z4E A;  2QEC A;  2VZY A;  2PDO A;  2R98 A;  3ZZI A;  1MK4 A;  1I21 A;  2RC4 A;  1I1D A;  1XIX A;  4CAW A;  1OZP A;  1P0H A;  1IID A;  2HUZ A;  2JLM A;  4R3K A;  2C27 A;  3S6K A;  4KUB A;  2Q4V A;  4Y49 C;  5GCN A;  3QAH A;  2WPX A;  4H6Z A;  3WR7 A;  4FD7 A;  4IUS A;  3R1K A;  5KTA A;  4U9Z A;  1LRZ A;  3NE7 A;  3B8G A;  1YK3 A;  4E0A A;  4YFJ A;  2CNS A;  2G3A A;  3F0A A;  1NSL A;  2HV2 A;  3GY9 A;  1QST A;  4MHD A;  4JXQ A;  4KLW A;  4PV6 A;  4RI1 A; 
#chains in the Genus database with same CATH topology
 2DF5 A;  1HDU A;  2I00 A;  2Q44 A;  4DNC A;  4X3R A;  1QMU A;  4OC2 A;  2B4D A;  2G9D A;  3T9Y A;  2AFX A;  2PR1 A;  4A39 A;  3FRM A;  3IIB A;  5IX3 A;  2FVG A;  4P44 A;  1MJA A;  2GFQ A;  3LOD A;  1CP6 A;  2B3U A;  3IWG A;  3NFZ A;  4M6I A;  4NGN A;  4OP4 A;  4UBR A;  4AB7 A;  4MJ8 A;  5CBM A;  2VBQ A;  3R9G A;  1Z8L A;  4PQA A;  3FBU A;  5AG4 A;  3LAC A;  2PJ7 A;  2OZU A;  3W91 A;  2ZW7 A;  4B5P A;  1Y9W A;  2EK9 A;  2ZW5 A;  4HPS A;  2C6G A;  1IOF A;  2AFU A;  2PJ9 A;  2Q04 A;  3KKW A;  2P6F A;  3TOB A;  4CYQ A;  4UEE A;  2HQY A;  3KQZ A;  4KOW A;  2VZZ A;  4FAI A;  4EFD A;  4F8Z A;  2R8V A;  4KVM E;  2NSM A;  1EE3 P;  5DS0 A;  1VHO A;  1XE4 A;  2BSW A;  3FIX A;  2ZW6 A;  3FEC A;  1QSO A;  2F5I A;  1XOV A;  3CPX A;  3LWU A;  4H89 A;  3RZA A;  3S9M A;  4O23 A;  4NJQ A;  5ELY A;  2B5G B;  4LQ6 A;  3UY5 A;  3GB0 A;  2JEW A;  3CXQ A;  3I9S A;  5A28 A;  4PXC A;  4CAF A;  4OKO A;  3SJX A;  3F8K A;  2Z3P A;  1MJB A;  2PIZ A;  4R9M A;  1BO4 A;  1VGY A;  5KTD A;  3A9L A;  1LAP A;  3KQX A;  3NE8 A;  4EWT A;  5LRG A;  4CAV A;  5F09 A;  4RN7 A;  1LOK A;  3ZJ0 A;  1TKH A;  2Z10 A;  3IEH A;  5CPA A;  3H5Z A;  4DJL A;  2IQ6 A;  5E96 A;  1N71 A;  3DSB A;  5LRJ A;  1XMT A;  2J8R A;  4FD5 A;  1ARL A;  5C82 A;  1J4J A;  4ZY0 A;  4PSW A;  4IF5 A;  4MFP A;  4QC6 A;  3PZJ A;  2BEI A;  4OIW A;  4AVB A;  4X2T A;  4ZI6 A;  4JXR A;  4MHY A;  2KCW A;  4ZY1 A;  3PP9 A;  1YW4 A;  3TO6 A;  3F5B A;  2O53 A;  1DE4 C;  1IU8 A;  4J3G A;  4B6Z A;  4II9 A;  3B3C A;  3QB8 A;  3D7G A;  5AG7 A;  1ZO0 A;  2AJ6 A;  3SI2 A;  1YRE A;  3VWE A;  4B13 A;  4CGP A;  2R7H A;  3EXN A;  1XFO A;  3OWC A;  3P2F A;  4JJX A;  2O4H A;  2OB0 A;  5H86 A;  4EVY A;  3SHP A;  4G1P A;  3TOA A;  2AFS A;  2GIV A;  4UWI A;  5LYL A;  1CX8 A;  2IJZ A;  1PYT B;  3CT9 A;  5AGE A;  1YME A;  1ELL P;  4R6T A;  1S5K A;  1HDQ A;  1AYE A;  4MY0 A;  5LYF A;  2PRQ A;  4OC0 A;  4A30 A;  1QSN A;  4AG9 A;  4PK3 A;  4LQG A;  4OID A;  2I3C A;  2O28 A;  4FBE A;  3NH5 A;  3S9N A;  3TO7 A;  2DPS A;  4OC4 A;  4R76 A;  3K9U A;  4NF1 A;  4L89 A;  2PJ0 A;  1Y0Y A;  4M6H A;  4MFZ A;  1CG2 A;  1X10 A;  2FXF A;  3VH9 A;  2RFH A;  4WWV A;  4CGN A;  4OC1 A;  2J8N A;  4UF4 A;  4Q38 A;  1FY7 A;  4HNW B;  4MHZ A;  4UEF A;  4KUA A;  1M4D A;  1MJ9 A;  2BL1 A;  5HMN A;  2CIJ A;  5F49 A;  4NGR A;  4UCP A;  2I79 A;  4MMO A;  1OBR A;  1UWY A;  2ANP A;  2P6E A;  3D8P A;  4R87 A;  5I4M A;  4F9V A;  2PVV A;  4M85 A;  1ZG7 A;  3IC1 A;  1YVO A;  1CM0 A;  3WC6 A;  3SI0 A;  4C2X A;  1S7F A;  2YNE A;  2QYV A;  2AE6 A;  3IJ3 A;  4A32 A;  4GXH A;  5IV0 A;  4NEX A;  4DYO A;  3PFE A;  3KHZ A;  4MI4 A;  2QVP A;  1Y9K A;  2REF A;  1XF8 A;  7CPA A;  1I12 A;  4K3N A;  1R43 A;  4KOS A;  5JQ4 A;  5EBV A;  3SXO A;  3KL9 A;  3EO4 A;  3T8W A;  4KVO E;  5EC4 A;  1RXT A;  1F2O A;  3EC4 A;  2DEA A;  2PJC A;  4OC5 A;  4IHM A;  2K5T A;  4HNX B;  2PC1 A;  3P2H A;  1QSM A;  1TF8 A;  4MCR A;  3B3T A;  4NGS A;  2PIY A;  2ZEG A;  3FVL A;  3TCV A;  4K30 A;  2ZEH A;  4KSI A;  1VKC A;  4QBJ A;  3W6X A;  2PJ8 A;  2CY2 A;  1RO5 A;  1Z4R A;  1AMP A;  1QQ9 A;  2PCU A;  2ZEO A;  4KVX A;  1P4N A;  4ORF A;  3JUW A;  1IYL A;  3IO1 A;  3LD2 A;  4RI1 A;  3D3S A;  3B7I A;  3BHX A;  3DLJ A;  2CXA A;  4EME A;  4B5O A;  4MFL A;  4RS2 A;  4XPK A;  1S60 A;  2OZG A;  2ZOG A;  2IMO A;  2D4O A;  4KOX A;  4MFQ A;  4NFR A;  5EMI A;  1KZF A;  3CXP A;  1KWM A;  1SQH A;  2V8V A;  3E0K A;  3GKR A;  4XNH B;  5HVF A;  4CRY B;  3D68 A;  2YNC C;  3R9E A;  1WK4 A;  2AFW A;  2JBK A;  2P0W A;  3VAT A;  2ZEP A;  2VQY A;  4MXU A;  5A27 A;  2B58 A;  1TF9 A;  2F8H A;  1QSR A;  1CBX A;  2CTC A;  2REE A;  4MCP A;  1Z8W A;  4UFV A;  1ARM A;  3CZX A;  4TWE A;  1Z8T A;  1IB1 E;  4P10 A;  1Y7R A;  2J9A A;  4GS4 A;  4AXV A;  4CGO A;  1TKF A;  3TTH A;  2V8H A;  4KOU A;  5J8F A;  3VWD A;  1ON0 A;  3MN8 A;  3BI0 A;  1YLE A;  2JBJ A;  3HLP A;  4OAD A;  4X5K A;  4XPL A;  3H8F A;  4MHP A;  2VXK A;  4F6A A;  2C1C A;  4GM5 A;  3JRU A;  2GRE A;  4ZGY B;  4CAE A;  4C7H A;  5AG6 A;  2GLF A;  2B3V A;  4KZT A;  4AVC A;  4F0Y A;  3G8W A;  2VI7 A;  4RUH A;  1LCP A;  4A33 A;  2QJ8 A;  4PSX A;  2HC9 A;  2OH1 A;  3EY5 A;  2B5G A;  2HB6 A;  3DR6 A;  1LAN A;  2Z3O A;  2G3T A;  3TC8 A;  4P4E A;  1VIX A;  4C7I A;  3NH8 A;  4PXB A;  2Z3M A;  1F2P A;  3NA6 A;  3S9L A;  1GHE A;  3R96 A;  4MCQ A;  2DPT A;  2J8M A;  4PPZ A;  4YRH A;  4ZYQ A;  3D2P A;  3QAY A;  3S6G A;  2NYQ A;  3PBE A;  1LAM A;  4MBU A;  2QIR A;  4X8I A;  5LYI A;  4KOT A;  5F47 A;  3IU2 A;  3PB7 X;  3PEI A;  2B4B A;  4BBH A;  3IWE A;  3D7F A;  4KS9 A;  4UEZ A;  2V8D A;  2A4N A;  5I0C A;  2XEG A;  5K8O A;  3K9T A;  1L0C A;  1BPN A;  3H8G A;  4KOR A;  1YR0 A;  2EO8 A;  5HH1 A;  2ZW4 A;  3D7H A;  3S6F A;  1Z9U A;  2F7V A;  4R57 A;  2FIA A;  4UIB A;  5G1Z A;  3TE4 A;  2XEF A;  2ZPA A;  4H6U A;  3RAM A;  3BI1 A;  3KAS A;  4YWY A;  4JLY A;  3BJ7 A;  3WAB A;  1LFW A;  4FWU A;  3S6H A;  1IY7 A;  2DXQ A;  4BMH A;  4E8O A;  1NSA A;  1BPM A;  1KUV A;  3FYN A;  4JYW A;  1BOB A;  2IL4 A;  4NGQ A;  1CPX A;  4XPD B;  3FF3 A;  4NGP A;  1M4G A;  3D7D A;  3CXS A;  3BLN A;  2PJ4 A;  1B6B A;  1Q2D A;  4AVA A;  8CPA A;  5JM6 A;  2WPW A;  1ZLI A;  4XPD C;  2P6G A;  4MHN A;  4NSQ A;  1YW6 A;  2C6P A;  3FED A;  1BAV A;  3K2K A;  4P45 A;  4NCZ A;  1WWZ A;  5K8M A;  1DTD A;  4CYP A;  1YLO A;  1ZG9 A;  2ATR A;  4CYO A;  2Q0Y A;  2Q4Z A;  4UFX A;  4A37 A;  4CAX A;  2VL1 A;  3FX6 A;  4I49 A;  1H8L A;  3DGV A;  4JZ0 A;  4KOV A;  4PK2 A;  3GUX A;  4M3S A;  2ARH A;  5THW A;  4R3L A;  3V8I A;  1VHE A;  3T90 A;  1AUG A;  3FB3 A;  4MFK A;  4AG7 A;  3D66 A;  1PCA A;  3I1U A;  1Q2C A;  3H4Q A;  3B35 A;  4Y49 B;  4CS0 B;  2EK8 A;  2CF4 A;  2GU2 A;  3IGR A;  3IU1 A;  5G20 A;  3SJF A;  2C6C A;  4BD9 A;  2X7B A;  4KSA A;  4Q7A A;  2AFZ A;  3BJ8 A;  3WC7 A;  3DNS A;  1UFH A;  3PB6 X;  4QUS A;  2PJA A;  1YSJ A;  4P4J A;  5H84 A;  3DR8 A;  4C68 A;  5J1Q A;  4R8F A;  1Q2Y A;  3KZW A;  5KTC A;  2NMT A;  1GYT A;  2FT0 A;  2OR4 A;  2G0B A;  1Z2L A;  3B2Y A;  4LX9 A;  4UFW A;  2EWB A;  2Z11 A;  1M44 A;  1FNO A;  2CNT A;  1R57 A;  5LYD A;  4E2A A;  2R1I A;  4KSF A;  4M6G A;  2AFO A;  4P4D A;  4UA3 A;  1CPS A;  4FD4 A;  2Z0Z A;  5DWM A;  4F9U A;  3MRU A;  3W6S A;  4U5Y A;  5J8C A;  4DUK A;  4CYN A;  4YU9 A;  3D2M A;  3N7Z A;  3FMC A;  4QB9 A;  3MGD A;  1RTQ A;  1X12 A;  2H5M A;  2B4D B;  5IB9 A;  3TFY A;  5DWN A;  5G22 A;  3PRT A;  1S7L A;  4HKF A;  5CNP A;  2ZEL A;  3PGP A;  3RO0 A;  4CGM A;  1M1D A;  2PRB A;  4HNY B;  2GE3 A;  2BUE A;  2GAN A;  3VAR A;  1M4I A;  1Z5R A;  1S3Z A;  4L8A A;  1KUY A;  2PVW A;  4OLL A;  4B11 A;  2OZH A;  3WC5 A;  3JVN A;  4XNH C;  4TNU A;  1XBU A;  4B5P B;  2YNC A;  5BWA B;  1YX0 A;  2JEV A;  2JDD A;  4P4I A;  2Z3K A;  3RYO A;  2OU2 A;  1B87 A;  4BIN A;  2XEI A;  3GYA A;  2V8G A;  5C88 A;  2CNM A;  2PJB A;  3QNV A;  1TKJ A;  4Z65 A;  4UWJ A;  4C2Y A;  1CP7 A;  2FIW A;  2PJ1 A;  2VEZ A;  2Q4Y A;  3TT2 A;  1IGB A;  4IK2 A;  3KR4 A;  1TIQ A;  4W9Y A;  1U6M A;  3EFA A;  2ZEF A;  4UIA A;  2Z3N A;  4P4B A;  1CJW A;  4U9Y A;  3D4U A;  2EBJ A;  3CPA A;  3C26 A;  3CDX A;  1VHS A;  4MCS A;  4ZX9 A;  5IB0 A;  2FCK A;  1S7N A;  4KLV A;  2Y0M A;  5F46 A;  3GIU A;  1S7K A;  4A2Z A;  5HVG A;  4P6Y A;  1BLL E;  1R3N A;  3SI1 A;  1IOI A;  1K4J A;  1IYK A;  4QVT A;  5ISV A;  4R7M A;  5AG5 A;  3I3G A;  2PQ8 A;  1HEE A;  5FVJ A;  2WSA A;  4MFJ A;  4NJR A;  2PJ2 A;  2PJ3 A;  2FL4 A;  5F48 A;  4A38 A;  5JPH A;  1NMT A;  4CPA A;  3DDD A;  4JD6 A;  1XEB A;  5D29 A;  1YQE A;  1KUX A;  2QML A;  2ZXV A;  4YGO A;  3D67 A;  4B12 A;  1IIC A;  1YGH A;  2FSR A;  3B3S A;  4LUA A;  2Q43 A;  1PUA A;  1F57 A;  2WUU A;  3G3S A;  5K8P A;  4WJB A;  4H2K A;  4OME A;  3ISX A;  3FNC A;  4NXY A;  4MY3 A;  4OC3 A;  3FXT A;  3FH4 A;  3HUV A;  4ONU A;  1NE9 A;  2Q7B A;  4A94 A;  3R95 A;  4ZY2 A;  1JQG A;  4FD6 A;  4B14 A;  4PXD A;  2PSW A;  2YND A;  4CGL A;  4NGT A;  4KOY A;  3TX8 A;  2D4P A;  2YGW A;  3R9F A;  3GLJ A;  3N5F A;  4JWP A;  2ZED A;  4CRZ B;  1PU9 A;  3SXN A;  5JGF A;  1A2Z A;  6CPA A;  3FEE A;  3KR5 A;  4ZBG A;  3WT4 A;  2POK A;  1ELM P;  5JH9 A;  2ZOF A;  2V77 A;  1ZG8 A;  3H8E A;  4ONW A;  2OOT A;  2FE7 A;  2EUI A;  2EVN A;  1FT7 A;  4UCN A;  1Y7E A;  1YVK A;  3PB4 X;  2PR8 A;  3RBU A;  1V0C A;  3TO9 A;  2FS5 A;  4IAV A;  3BXM A;  4OAE A;  4F0X A;  2JDC A;  3SJG A;  1Z4E A;  3KHX A;  2QEC A;  2ZEE A;  4B10 A;  3PB9 X;  2BOA A;  1JWQ A;  3PB8 X;  1XRY A;  2VZY A;  2PDO A;  3FJU A;  4Q36 A;  2R98 A;  3ZZI A;  1MK4 A;  3IFE A;  1I21 A;  3IWW A;  3PFO A;  2RC4 A;  1I1D A;  1XIX A;  5D8N A;  3LMS A;  4CAW A;  1OZP A;  2GLJ A;  3SJE A;  2WYR A;  4UCM A;  2BCO A;  5G21 A;  5HVH A;  1P0H A;  1IID A;  5HXD A;  3L2N A;  3ISZ A;  4FUU A;  2HUZ A;  2JLM A;  4R3K A;  2C27 A;  3S6K A;  4A95 A;  4KUB A;  1XMB A;  2Q4V A;  4Y49 C;  4C2Z A;  5GCN A;  2ZEM A;  3JTK A;  2XEJ A;  3QAH A;  2WPX A;  4A31 A;  4H6Z A;  1M4L A;  3WR7 A;  4FD7 A;  3V38 A;  4IUS A;  1Y0R A;  3R1K A;  5KTA A;  4U9Z A;  3B3V A;  1LRZ A;  4MRI A;  3PBB A;  1XJO A;  2Z3L A;  3NE7 A;  3B8G A;  4P4F A;  4PXE A;  2RB7 A;  1YK3 A;  2ZEN A;  2PJ6 A;  3V7Z A;  3B3W A;  4E0A A;  4YFJ A;  2CNS A;  2Q7S A;  1Z8X A;  2PE3 A;  5K8N A;  3KI9 A;  3RNZ A;  2G3A A;  2ABZ A;  2Q51 A;  4ZX8 A;  3F0A A;  2ODF A;  2PJ5 A;  4NGM A;  2HV2 A;  1NSL A;  3GY9 A;  1QST A;  2WZN A;  3KGQ A;  4MHD A;  4JXQ A;  5LRK A;  4KLW A;  2CTB A;  1Q7L A;  2BO9 A;  3NH4 A;  4PV6 A;  1TXR A;  2AFM A;  1ZLH A; 
#chains in the Genus database with same CATH homology
 2Q44 A;  2I00 A;  4DNC A;  2B4D A;  3T9Y A;  2PR1 A;  3FRM A;  5IX3 A;  1MJA A;  4UBR A;  3LOD A;  2B3U A;  3IWG A;  4AB7 A;  4MJ8 A;  2VBQ A;  3R9G A;  3FBU A;  5AG4 A;  2OZU A;  3W91 A;  2ZW7 A;  4B5P A;  1Y9W A;  2ZW5 A;  2Q04 A;  3KKW A;  2P6F A;  3TOB A;  4CYQ A;  2HQY A;  4KOW A;  2VZZ A;  2R8V A;  4KVM E;  1XE4 A;  2BSW A;  3FIX A;  2ZW6 A;  1QSO A;  2F5I A;  4H89 A;  2B5G B;  3UY5 A;  3CXQ A;  3I9S A;  5A28 A;  4CAF A;  3F8K A;  2Z3P A;  1MJB A;  4R9M A;  1BO4 A;  5KTD A;  3A9L A;  4CAV A;  3ZJ0 A;  2Z10 A;  3H5Z A;  5E96 A;  1N71 A;  3DSB A;  1XMT A;  2J8R A;  4FD5 A;  5C82 A;  1J4J A;  4PSW A;  4IF5 A;  4MFP A;  4QC6 A;  3PZJ A;  2BEI A;  4AVB A;  4JXR A;  2KCW A;  3PP9 A;  3TO6 A;  3F5B A;  4J3G A;  4II9 A;  3QB8 A;  5AG7 A;  1ZO0 A;  2AJ6 A;  3VWE A;  1YRE A;  4B13 A;  4CGP A;  2R7H A;  3EXN A;  3OWC A;  3P2F A;  4EVY A;  4JJX A;  2OB0 A;  5H86 A;  3SHP A;  3TOA A;  2GIV A;  4UWI A;  5AGE A;  1S5K A;  4MY0 A;  4A30 A;  1QSN A;  4AG9 A;  4PK3 A;  2O28 A;  3TO7 A;  2DPS A;  3K9U A;  4NF1 A;  4L89 A;  4MFZ A;  4CGN A;  2FXF A;  2J8N A;  4Q38 A;  1FY7 A;  4HNW B;  4KUA A;  1M4D A;  1MJ9 A;  2BL1 A;  5HMN A;  5F49 A;  4UCP A;  2I79 A;  2P6E A;  3D8P A;  4R87 A;  4M85 A;  1YVO A;  1CM0 A;  4C2X A;  1S7F A;  2YNE A;  2AE6 A;  4A32 A;  5IV0 A;  4NEX A;  4MI4 A;  1Y9K A;  2REF A;  1XF8 A;  5JQ4 A;  1I12 A;  4KOS A;  5EBV A;  3SXO A;  3EO4 A;  4KVO E;  5EC4 A;  1RXT A;  3EC4 A;  2K5T A;  4HNX B;  2PC1 A;  3P2H A;  1QSM A;  3TCV A;  4K30 A;  1VKC A;  4QBJ A;  3W6X A;  2CY2 A;  1RO5 A;  1Z4R A;  4KVX A;  1P4N A;  4ORF A;  3JUW A;  1IYL A;  3LD2 A;  3D3S A;  2CXA A;  4B5O A;  4MFL A;  4RS2 A;  4XPK A;  1S60 A;  2OZG A;  2D4O A;  4KOX A;  4MFQ A;  1KZF A;  3CXP A;  1SQH A;  4XNH B;  3E0K A;  3GKR A;  4CRY B;  2YNC C;  3R9E A;  1WK4 A;  2P0W A;  2VQY A;  5A27 A;  2B58 A;  1QSR A;  2REE A;  4UFV A;  1IB1 E;  1Y7R A;  4GS4 A;  4CGO A;  3TTH A;  4KOU A;  5J8F A;  3VWD A;  1ON0 A;  1YLE A;  4X5K A;  4OAD A;  4XPL A;  2VXK A;  4F6A A;  4ZGY B;  4CAE A;  4C7H A;  5AG6 A;  2B3V A;  4KZT A;  4AVC A;  4F0Y A;  3G8W A;  2VI7 A;  4A33 A;  4PSX A;  2OH1 A;  3EY5 A;  2B5G A;  3DR6 A;  2Z3O A;  2G3T A;  4C7I A;  2Z3M A;  1GHE A;  3R96 A;  2DPT A;  2J8M A;  4YRH A;  3D2P A;  3S6G A;  4MBU A;  2QIR A;  4KOT A;  5F47 A;  3IU2 A;  2B4B A;  4BBH A;  3IWE A;  4KS9 A;  2A4N A;  5I0C A;  1L0C A;  4KOR A;  1YR0 A;  5HH1 A;  2ZW4 A;  3S6F A;  1Z9U A;  4R57 A;  2FIA A;  5G1Z A;  3TE4 A;  2ZPA A;  4H6U A;  4JLY A;  3BJ7 A;  3S6H A;  2DXQ A;  4BMH A;  4E8O A;  1KUV A;  3FYN A;  1BOB A;  2IL4 A;  4XPD B;  1M4G A;  3CXS A;  3BLN A;  1B6B A;  1Q2D A;  4AVA A;  2WPW A;  4XPD C;  2P6G A;  4NSQ A;  4NCZ A;  1WWZ A;  4CYP A;  4CYO A;  2ATR A;  2Q0Y A;  4UFX A;  4CAX A;  4I49 A;  4KOV A;  4PK2 A;  4M3S A;  2ARH A;  4R3L A;  3V8I A;  3T90 A;  3FB3 A;  4MFK A;  4AG7 A;  1Q2C A;  3H4Q A;  4Y49 B;  4CS0 B;  3IGR A;  5G20 A;  3IU1 A;  2X7B A;  4KSA A;  3BJ8 A;  3DNS A;  1UFH A;  4QUS A;  5H84 A;  4C68 A;  3DR8 A;  1Q2Y A;  5KTC A;  2NMT A;  4LX9 A;  2FT0 A;  4UFW A;  2G0B A;  2Z11 A;  1M44 A;  2CNT A;  1R57 A;  4E2A A;  2R1I A;  4KSF A;  4UA3 A;  4FD4 A;  5DWM A;  2Z0Z A;  3W6S A;  4U5Y A;  5J8C A;  4CYN A;  3D2M A;  3N7Z A;  4QB9 A;  3MGD A;  2H5M A;  2B4D B;  3TFY A;  5DWN A;  5G22 A;  1S7L A;  4HKF A;  5CNP A;  3PGP A;  4CGM A;  1M1D A;  4HNY B;  2PRB A;  2GE3 A;  2BUE A;  2GAN A;  1M4I A;  1S3Z A;  4L8A A;  1KUY A;  4OLL A;  4B11 A;  2OZH A;  3JVN A;  4XNH C;  4B5P B;  2YNC A;  5BWA B;  1YX0 A;  2JEV A;  2JDD A;  2Z3K A;  3RYO A;  2OU2 A;  1B87 A;  3GYA A;  5C88 A;  2CNM A;  4UWJ A;  4C2Y A;  2FIW A;  2VEZ A;  2Q4Y A;  3TT2 A;  1TIQ A;  1U6M A;  3EFA A;  2Z3N A;  1CJW A;  4U9Y A;  3C26 A;  1VHS A;  5IB0 A;  2FCK A;  1S7N A;  4KLV A;  2Y0M A;  5F46 A;  1S7K A;  4A2Z A;  1K4J A;  4QVT A;  1IYK A;  5ISV A;  5AG5 A;  3I3G A;  2PQ8 A;  5FVJ A;  2WSA A;  4MFJ A;  2FL4 A;  5F48 A;  5JPH A;  1NMT A;  3DDD A;  4JD6 A;  1XEB A;  2ZXV A;  1KUX A;  2QML A;  4YGO A;  4B12 A;  1IIC A;  1YGH A;  2FSR A;  4LUA A;  1PUA A;  2WUU A;  3G3S A;  3FNC A;  4NXY A;  4MY3 A;  3FXT A;  4ONU A;  1NE9 A;  2Q7B A;  3R95 A;  4FD6 A;  4B14 A;  2PSW A;  2YND A;  4CGL A;  4KOY A;  2D4P A;  2YGW A;  3R9F A;  4JWP A;  4CRZ B;  1PU9 A;  3SXN A;  4ZBG A;  2FE7 A;  2EUI A;  2EVN A;  4UCN A;  1YVK A;  2PR8 A;  1V0C A;  3TO9 A;  2FS5 A;  4OAE A;  4F0X A;  2JDC A;  1Z4E A;  2QEC A;  4B10 A;  2VZY A;  2PDO A;  4Q36 A;  2R98 A;  3ZZI A;  1MK4 A;  1I21 A;  2RC4 A;  1I1D A;  1XIX A;  4CAW A;  1OZP A;  4UCM A;  5G21 A;  1P0H A;  1IID A;  2HUZ A;  2JLM A;  4R3K A;  2C27 A;  3S6K A;  4A95 A;  4KUB A;  2Q4V A;  4Y49 C;  4C2Z A;  5GCN A;  3JTK A;  3QAH A;  2WPX A;  4A31 A;  4H6Z A;  3WR7 A;  4FD7 A;  4IUS A;  3R1K A;  5KTA A;  4U9Z A;  1LRZ A;  3NE7 A;  2Z3L A;  3B8G A;  1YK3 A;  4E0A A;  4YFJ A;  2CNS A;  2G3A A;  3F0A A;  1NSL A;  2HV2 A;  3GY9 A;  1QST A;  4MHD A;  4JXQ A;  4KLW A;  4PV6 A;  4RI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...