2CY2A

Crystal structure of ttha1209 in complex with acetyl coenzyme a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
174
structure length
174
Chain Sequence
VRIRRAGLEDLPGVARVLVDTWRATYRGVVPEAFLEGLSYEGQAERWAQRLKTPTWPGRLFVAESESGEVVGFAAFGPDRASGFPGYTAELWAIYVLPTWQRKGLGRALFHEGARLLQAEGYGRMLVWVLKENPKGRGFYEHLGGVLLGEREIELGGAKLWEVAYGFDLGGHKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords probable acetyltransferase
publication title Crystal structure of TTHA1209 in complex with acetyl coenzyme A
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 48
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2cy2A00
3B8GA 4LX9A 5H84A 3FNCA 3F8KA 1I21A 3FB3A 2OU2A 3CXSA 3R9EA 4AVCA 4XPKA 2CNSA 3UY5A 2B3UA 2RC4A 3D2PA 4QBJA 3QAHA 4CAWA 1IB1E 3R1KA 2OB0A 3R96A 3WR7A 4JD6A 1XEBA 4JLYA 4AVBA 3GY9A 1S7KA 3TCVA 3I9SA 1S5KA 4FD4A 4J3GA 4H89A 5HH1A 4CRZB 4AG9A 3TOAA 1PUAA 2KCWA 3ZJ0A 4MY0A 3FIXA 3I3GA 1M4GA 1YVKA 1YLEA 2AJ6A 1TIQA 1MK4A 4F6AA 2PC1A 2VQYA 1WK4A 4PK3A 3CXQA 5J8FA 5EC4A 3W91A 3EXNA 3MGDA 4PSWA 4XPLA 1Y9KA 2B3VA 1B87A 3VWDA 2HQYA 2Z10A 2CNTA 2G3AA 3FRMA 4NXYA 5E96A 1Q2DA 1S60A 2AE6A 2J8NA 1Z9UA 3V8IA 2F5IA 2PR8A 5C82A 1K4JA 2C27A 1BOBA 4E8OA 4KOWA 2B58A 2B5GB 3BJ8A 4RS2A 2OZHA 4B5PA 2P6FA 2EVNA 3H4QA 1S3ZA 4IF5A 4CS0B 1XF8A 5I0CA 4CAXA 2PSWA 2R98A 3S6GA 5CNPA 2ZW6A 2FSRA 2Z11A 5DWMA 1Q2YA 2FS5A 2HV2A 1MJAA 2VBQA 4KVXA 2FCKA 4KOSA 4ZBGA 3TT2A 3IGRA 1L0CA 3TTHA 2ZW7A 2VZYA 2Q0YA 2X7BA 4KOXA 2OZUA 4CRYB 3G3SA 2NMTA 4FD7A 1CJWA 4DNCA 4AVAA 1YREA 4KLWA 4KOVA 4R9MA 4F0YA 3P2FA 5ISVA 4UA3A 4KORA 1XE4A 3TO7A 4KLVA 2JEVA 1RXTA 2B4DA 2P0WA 2JDCA 2H5MA 1VKCA 2QIRA 4HNXB 2G0BA 2ZW4A 3R9GA 4IUSA 3DR6A 2BUEA 2FE7A 3CXPA 4KZTA 2VEZA 1SQHA 4QC6A 2VXKA 3TO9A 2K5TA 3JVNA 1QSRA 4XPDB 3F0AA 3SXNA 1IYKA 4KUBA 3W6SA 3S6KA 2O28A 2GIVA 3EO4A 4XPDC 4MJ8A 4KVOE 4E0AA 3EY5A 5DWNA 1I1DA 2ARHA 2FT0A 3C26A 3TFYA 3G8WA 2J8MA 5F48A 2BEIA 4KVME 2QECA 4R3KA 1KUVA 4UWIA 4OLLA 2JDDA 3F5BA 2ZXVA 2BL1A 3PZJA 4KUAA 1V0CA 2ZW5A 3VWEA 4NF1A 3TOBA 4Y49B 1WWZA 1Z4RA 1P0HA 4MBUA 3S6HA 3LD2A 2OH1A 5F47A 4B5PB 4CAVA 1QSMA 5FVJA 4RI1A 1OZPA 4R3LA 2Q04A 3KKWA 1MJ9A 1S7NA 1GHEA 2DXQA 2R1IA 3IWGA 3D8PA 3FBUA 2ZPAA 3W6XA 2I00A 5KTCA 2A4NA 1QSNA 1M1DA 1R57A 1RO5A 2GE3A 3FXTA 5KTDA 2FXFA 2PQ8A 1IYLA 2IL4A 2Q4YA 2GANA 4JJXA 2CY2A 4H6UA 1KUYA 4JXRA 1P4NA 4K30A 4L8AA 1YK3A 3PGPA 2EUIA 4UWJA 1M4IA 3BJ7A 4HKFA 4HNYB 3D3SA 1ON0A 4PSXA 2VZZA 4U5YA 4YRHA 3TO6A 3GYAA 2R8VA 2R7HA 2JLMA 2Y0MA 4YGOA 4YFJA 3R95A 1YX0A 4OADA 3R9FA 4NSQA 3OWCA 4MY3A 3RYOA 1KZFA 2B4DB 3SXOA 4AB7A 2FIAA 2OZGA 2QMLA 1LRZA 5C88A 4FD6A 1QSOA 1J4JA 1YGHA 1MJBA 4PV6A 1IICA 2FL4A 3EFAA 2BSWA 4GS4A 4NEXA 4OAEA 4KOTA 5HMNA 2REFA 1I12A 4H6ZA 3ZZIA 3DSBA 4NCZA 1QSTA 1VHSA 5EBVA 2Z0ZA 2PDOA 3LODA 4QVTA 3T90A 1YR0A 1YVOA 2VI7A 3DDDA 4R87A 4ONUA 5H86A 5JPHA 5GCNA 2G3TA 4ORFA 4MI4A 4E2AA 4EVYA 5F49A 1Q2CA 2ATRA 4FD5A 1NE9A 3QB8A 4B5OA 1IIDA 4L89A 4HNWB 1M44A 2Q44A 4BMHA 1U6MA 4II9A 1M4DA 2Q4VA 1NSLA 1FY7A 1Y7RA 1Z4EA 2D4PA 2FIWA 4PK2A 5F46A 2WPWA 5IX3A 5J8CA 1S7LA 4Y49C 3EC4A 1BO4A 1UFHA 1XIXA 2PRBA 2I79A 4JXQA 3E0KA 1KUXA 1N71A 3NE7A 4AG7A 4MHDA 2Q7BA 3D2MA 4X5KA 4LUAA 2J8RA 3FYNA 3N7ZA 1S7FA 4M85A 3T9YA 4U9YA 2CNMA 5IB0A 2B5GA 4M3SA 3BLNA 3P2HA 1B6BA 5JQ4A 3GKRA 3PP9A 4QUSA 3S6FA 2B4BA 3SHPA 5IV0A 1NMTA 2PR1A 1Y9WA 1XMTA 4KOYA 4QB9A 4JWPA 5KTAA 2HUZA 2WPXA 1PU9A 4I49A 4XNHB 2D4OA 4R57A 3K9UA 4KOUA 4U9ZA 4UBRA 2P6EA 4XNHC 2P6GA 3DR8A 3TE4A 2REEA 1CM0A 3DNSA 3JUWA
chains in the Genus database with same CATH superfamily
3H8EA 3NA6A 3B8GA 4P6YA 2ZEPA 4UF4A 5F09A 4LX9A 5H84A 1YLOA 3F8KA 3FNCA 1I21A 2V8GA 4P4EA 3FB3A 2OU2A 3CXSA 3SI0A 3IEHA 3R9EA 3IWEA 3FX6A 4AVCA 3D7HA 2V8DA 4P4DA 4A37A 2ZEDA 4XPKA 2CNSA 4ZYQA 3UY5A 3PB6X 3JTKA 2B3UA 1Y0RA 1KWMA 2RC4A 4KSAA 5AG7A 2F8HA 4JZ0A 2DPSA 3D2PA 4QBJA 3QAHA 4M6IA 4CAWA 2RB7A 1IB1E 3R1KA 2OB0A 3R96A 1TF9A 3HLPA 3WR7A 4NGQA 2WYRA 4TWEA 4JD6A 2EO8A 1XEBA 2PJ5A 4JLYA 4IAVA 1Z8XA 3GY9A 4OC2A 4AVBA 4C2XA 1S7KA 1PCAA 1TXRA 3TCVA 1HEEA 5D29A 4MFPA 3B3VA 4B10A 3I9SA 1S5KA 3KHZA 3B35A 4FD4A 4J3GA 4FAIA 4UCPA 1CG2A 7CPAA 4MHNA 3FH4A 5HVHA 1OBRA 4P4BA 3KZWA 4H89A 5HH1A 4CRZB 4AG9A 3TOAA 1PUAA 2ZENA 2KCWA 3ZJ0A 4KSIA 5LRKA 4C7HA 4TNUA 2PJCA 2PJ6A 3KQXA 4MY0A 3FIXA 3I3GA 1M4GA 2Z3LA 1YVKA 4C2ZA 2YGWA 3DGVA 4G1PA 1YLEA 3JRUA 5LRGA 2AJ6A 3PBEA 1TIQA 2CTCA 4C7IA 1MK4A 4F6AA 2PC1A 3SI1A 2VQYA 3I1UA 2J9AA 3B3SA 2CTBA 2GU2A 4DUKA 4KS9A 2O4HA 5A27A 1WK4A 4PK3A 4NGNA 3CPAA 2V77A 3CXQA 5G1ZA 5J8FA 4C68A 5EC4A 3W91A 2C6GA 3EXNA 3MGDA 4PSWA 1R43A 4PXCA 2Z3MA 4XPLA 4P10A 1Y9KA 2DPTA 4KSFA 2B3VA 1B87A 4PPZA 5AG6A 3HUVA 2HQYA 3VWDA 2Z10A 2CNTA 4ZX9A 2Q51A 1H8LA 2G3AA 3FRMA 2VL1A 1FNOA 4NXYA 5E96A 3SJFA 3TX8A 4OKOA 3KHXA 2PCUA 1Q2DA 4X8IA 4ZI6A 4Q36A 1S60A 2QVPA 3PB8X 2AE6A 2J8NA 1Z9UA 4CGLA 3V8IA 2F5IA 2GLFA 2PR8A 1UWYA 1YW6A 3KGQA 5AG4A 5C82A 1ZG7A 1K4JA 2C27A 1BOBA 4RN7A 4CGOA 4E8OA 4KOWA 2F7VA 4CPAA 2Q4ZA 2EK9A 2B58A 3GUXA 4UCMA 3WABA 2B5GB 3BJ8A 4CYNA 4JYWA 4RS2A 2OZHA 4B5PA 2GFQA 4B14A 2I3CA 1CBXA 2P6FA 2XEGA 3MRUA 2PIZA 2EVNA 3PB4X 3H4QA 4UIAA 1S3ZA 4IF5A 4CS0B 1XF8A 1DE4C 5I0CA 4MCPA 3NH8A 4CYQA 2AFXA 4GXHA 4CAXA 2PSWA 2R98A 3DLJA 3RBUA 3S6GA 2XEFA 5CNPA 2ZW6A 4MMOA 2FSRA 2NYQA 2Z11A 4MRIA 5DWMA 1VIXA 5K8NA 1Q2YA 2FS5A 2HV2A 1MJAA 3KR4A 2VBQA 4KVXA 4LQ6A 1HDQA 1Z8WA 3FF3A 2FCKA 3L2NA 4Q38A 1TKJA 4KOSA 4PQAA 1VHEA 4F9UA 4OIDA 4ZBGA 4YU9A 3PFOA 1IY7A 4ZY2A 4NGTA 8CPAA 4F9VA 2Z3KA 3TT2A 3IGRA 1L0CA 1QQ9A 3B3CA 3TTHA 5IB9A 2ZW7A 2VZYA 3B7IA 4MFJA 2Q0YA 2Z3PA 2X7BA 5G21A 1XFOA 1CP6A 4KOXA 4UIBA 1Q7LA 2OZUA 4CRYB 3G3SA 4OC4A 2NMTA 2ZOGA 4FD7A 1TKFA 1CJWA 4DNCA 4AVAA 3ISZA 1YREA 1EE3P 4ONWA 4BD9A 4KLWA 4KOVA 4R9MA 1IOIA 4F0YA 3LACA 1F57A 3P2FA 5AG5A 5ISVA 4UA3A 1CX8A 2CF4A 4KORA 4OP4A 1XE4A 3TO7A 1ZG8A 4RUHA 4A2ZA 2NSMA 4KLVA 2JEVA 2ABZA 2GREA 1RXTA 4UFWA 4IK2A 2B4DA 2P0WA 1XJOA 2PJ3A 1QMUA 2JDCA 4PXDA 4UFVA 3RO0A 2PIYA 1IOFA 2H5MA 1VKCA 2ZOFA 3WC5A 2QIRA 4HNXB 4R7MA 2WSAA 2PRQA 2G0BA 3PEIA 2ZW4A 3IO1A 3S9MA 3R9GA 4AXVA 4IUSA 3DR6A 3SI2A 2QJ8A 3QNVA 1LCPA 4UEZA 1XBUA 2BUEA 2FE7A 3CXPA 4KZTA 4OC5A 2VEZA 1SQHA 1ZO0A 4QC6A 5DS0A 2VXKA 3VARA 3MN8A 3TO9A 2K5TA 3JVNA 2QYVA 5K8OA 1QSRA 1AMPA 4A94A 1M4LA 4XPDB 2PJAA 3F0AA 1ARLA 3SXNA 3IWWA 2Q7SA 1IYKA 4KUBA 3T8WA 3W6SA 4X3RA 3S6KA 1RTQA 1X10A 2O28A 2GIVA 3NE8A 4K3NA 3EO4A 3S9LA 4XPDC 1R3NA 2C1CA 4UEFA 1LANA 1ZLHA 4P44A 4B11A 3B3WA 4KVOE 4MJ8A 4E0AA 1VGYA 3EY5A 2YNCA 5HVGA 3PB9X 5DWNA 1CPXA 3NH4A 1I1DA 2ARHA 2FT0A 3IIBA 3C26A 4ZGYB 3TFYA 3G8WA 2J8MA 1NSAA 3N5FA 4R76A 5F48A 2BEIA 4H2KA 2JBJA 2QECA 4KVME 4R3KA 5ELYA 1KUVA 3FJUA 3GIUA 4UWIA 4OLLA 2JDDA 3D66A 3F5BA 2ZXVA 3PFEA 4WJBA 3NFZA 1AYEA 4CYPA 2BL1A 3PZJA 1BLLE 5I4MA 4KUAA 3TC8A 4A30A 1V0CA 2ZW5A 3VWEA 4NF1A 3TOBA 2POKA 4Y49B 1WWZA 2Q43A 1Z4RA 3K2KA 4MCQA 1P0HA 4MBUA 3S6HA 3LD2A 1ZG9A 2BCOA 2HC9A 2HB6A 2OH1A 1ARMA 5F47A 2JEWA 4B5PB 4CAVA 1QSMA 5FVJA 3D7DA 4RI1A 2BOAA 1OZPA 2AFOA 4R3LA 5LYDA 4A32A 2ANPA 2V8HA 2Q04A 3KKWA 2ZEFA 3IC1A 1MJ9A 4MHZA 1S7NA 4MXUA 1GHEA 2DXQA 2R1IA 3H8GA 3IWGA 3D8PA 3FBUA 2ZPAA 4PXEA 3W6XA 2YNEA 2I00A 1FT7A 2A4NA 5KTCA 1QSNA 1M1DA 1R57A 1RO5A 3H5ZA 2YNDA 2GE3A 1Y0YA 3D68A 3FXTA 5HXDA 5KTDA 2FXFA 2PQ8A 1IYLA 1Y7EA 2IL4A 2Q4YA 2GANA 4B12A 4JJXA 2ZELA 2CY2A 4ZY0A 4H6UA 4CGMA 1KUYA 2WUUA 4CGPA 4JXRA 4NGRA 3RZAA 1P4NA 4K30A 4F0XA 4L8AA 4O23A 5THWA 3BI0A 1A2ZA 2Z3OA 3BXMA 4NGMA 1XOVA 4MCSA 1YK3A 3PGPA 2EUIA 4UWJA 4CAFA 1M4IA 1TF8A 3BJ7A 2ZEMA 2Z3NA 4HKFA 4HNYB 4A31A 3KR5A 3KASA 3D3SA 2EWBA 1ON0A 2EBJA 3PBBA 3NH5A 4PSXA 5LYFA 3D67A 2VZZA 2CIJA 4U5YA 2PJ2A 4YRHA 3TO6A 1LOKA 3GYAA 4P45A 3BHXA 2R8VA 2R7HA 3D4UA 4HPSA 2JLMA 4P4FA 2Y0MA 4YWYA 2ODFA 4YGOA 4C2YA 1IU8A 1JWQA 1LAPA 2XEJA 2AFMA 4DYOA 1TKHA 4BINA 4A39A 5CPAA 5G20A 2XEIA 3R95A 3GLJA 4BBHA 1VHOA 4YFJA 1YX0A 2G9DA 4OADA 3R9FA 1ELMP 4MFLA 3VATA 4NSQA 3OWCA 3V7ZA 2V8VA 4MY3A 2IQ6A 3RYOA 1ELLP 3CT9A 1KZFA 2B4DB 1GYTA 3SXOA 4AB7A 3D7GA 2RFHA 3RAMA 2FIAA 2OZGA 2QMLA 1HDUA 3KQZA 4FWUA 5LYIA 4Z65A 1LRZA 4MFZA 5C88A 4FD6A 1QSOA 5LRJA 1J4JA 1YGHA 1MJBA 4PV6A 1IICA 4GM5A 2FL4A 2BO9A 2PE3A 2BSWA 3EFAA 4GS4A 4NEXA 4OAEA 4ZY1A 2AFZA 4KOTA 5HMNA 2REFA 1Z2LA 1I12A 4H6ZA 1ZLIA 4B13A 1LAMA 3ZZIA 2IMOA 3FVLA 2PJBA 1Z8LA 3DSBA 4A33A 2PJ0A 1BPNA 4MFKA 4NCZA 3FEDA 2C6PA 1QSTA 1VHSA 1DTDA 5EBVA 3FEEA 1F2OA 2Z0ZA 2ZEHA 4MFQA 2PDOA 3LODA 4QVTA 1Z8TA 4OC3A 3T90A 1YR0A 5HVFA 3S9NA 4OC0A 4FBEA 1YVOA 2VI7A 2JBKA 4OIWA 3B3TA 4M6HA 3RNZA 5D8NA 3SJXA 3DDDA 4R87A 4ONUA 5H86A 4EFDA 2AFUA 6CPAA 1X12A 3KI9A 4NFRA 5GCNA 5JPHA 2G3TA 4NGPA 3CZXA 4ORFA 1CPSA 4MI4A 4MHYA 4X2TA 1XMBA 4E2AA 5CBMA 2YNCC 4EVYA 5F49A 2ZEGA 3B2YA 1Q2CA 2ATRA 2WZNA 4ZX8A 5G22A 1YQEA 3LMSA 4B6ZA 3CDXA 2IJZA 2PJ4A 2FVGA 4FD5A 1NE9A 3QB8A 4PXBA 4B5OA 3ISXA 1IIDA 4L89A 4EWTA 5K8MA 4HNWB 5AGEA 2EK8A 2O53A 1M44A 2Q44A 4BMHA 3BI1A 1U6MA 5LYLA 4II9A 4Q7AA 2PJ8A 3SJEA 1M4DA 2Q4VA 1LFWA 1NSLA 1FY7A 3PB7X 4DJLA 1JQGA 1Y7RA 3A9LA 4NJRA 4EMEA 4W9YA 1Z4EA 3D7FA 2D4PA 4M6GA 2FIWA 4PK2A 5F46A 2WPWA 5IX3A 5J8CA 2PVWA 3WC6A 1S7LA 4Y49C 3CPXA 4NGSA 3EC4A 1BO4A 1Z5RA 4P4IA 1UFHA 5A28A 1XIXA 3LWUA 2PJ1A 3SJGA 4F8ZA 5JH9A 1PYTB 2PRBA 3IFEA 1YW4A 2I79A 4JXQA 4P4JA 3E0KA 3V38A 1KUXA 1N71A 2AFSA 3KL9A 3NE7A 4MHDA 2ZEEA 4AG7A 4UCNA 3FECA 2OOTA 5EMIA 4A38A 1YMEA 5J1QA 4R8FA 4OC1A 2Q7BA 1AUGA 3GB0A 3D2MA 4X5KA 2ZEOA 4LUAA 2J8RA 5K8PA 1F2PA 2DF5A 4MHPA 3FYNA 2DEAA 4WWVA 1CP7A 3N7ZA 1S7FA 3IU1A 1BAVA 3IJ3A 4UFXA 4LQGA 4M85A 3T9YA 2PJ7A 3H8FA 4U9YA 2CXAA 2CNMA 3VH9A 4CYOA 2B5GA 3QAYA 4M3SA 5IB0A 3BLNA 3P2HA 4A95A 1B6BA 2AFWA 2PJ9A 1BPMA 3GKRA 5BWAB 5JQ4A 5JM6A 4CGNA 3PP9A 4QUSA 3S6FA 2B4BA 3WT4A 5JGFA 3SHPA 3FMCA 1XRYA 3IU2A 5IV0A 1NMTA 3K9TA 2PVVA 1YSJA 2PR1A 1Y9WA 3PRTA 1XMTA 4KOYA 4MCRA 4QB9A 3WC7A 4JWPA 5KTAA 2HUZA 2WPXA 1PU9A 4I49A 4FUUA 4UEEA 4XNHB 4CAEA 2OR4A 2D4OA 4R57A 2C6CA 3K9UA 4NJQA 4KOUA 4U9ZA 4UBRA 4IHMA 2P6EA 4R6TA 1IGBA 4XNHC 2P6GA 3DR8A 4OMEA 3TE4A 2REEA 2GLJA 1CM0A 3DNSA 3JUWA
chains in the Genus database with same CATH topology
3B8GA 4LX9A 5H84A 3FNCA 3F8KA 1I21A 3FB3A 2OU2A 3CXSA 3R9EA 3IWEA 4AVCA 4XPKA 2CNSA 3UY5A 3JTKA 2B3UA 2RC4A 4KSAA 5AG7A 2DPSA 3D2PA 4QBJA 3QAHA 4CAWA 1IB1E 3R1KA 2OB0A 3R96A 3WR7A 4JD6A 1XEBA 4JLYA 4AVBA 3GY9A 4C2XA 1S7KA 3TCVA 4MFPA 4B10A 3I9SA 1S5KA 4FD4A 4J3GA 4UCPA 4H89A 5HH1A 4CRZB 4AG9A 3TOAA 1PUAA 2KCWA 3ZJ0A 4C7HA 4MY0A 3FIXA 3I3GA 1M4GA 2Z3LA 1YVKA 4C2ZA 2YGWA 1YLEA 2AJ6A 1TIQA 4C7IA 1MK4A 4F6AA 2PC1A 2VQYA 4KS9A 5A27A 1WK4A 4PK3A 3CXQA 5G1ZA 5J8FA 4C68A 5EC4A 3W91A 3EXNA 3MGDA 4PSWA 4XPLA 2Z3MA 1Y9KA 2DPTA 4KSFA 2B3VA 1B87A 5AG6A 3VWDA 2HQYA 2Z10A 2CNTA 2G3AA 3FRMA 4NXYA 5E96A 1Q2DA 4Q36A 1S60A 2AE6A 2J8NA 1Z9UA 4CGLA 3V8IA 2F5IA 2PR8A 5AG4A 5C82A 1K4JA 2C27A 1BOBA 4CGOA 4E8OA 4KOWA 2B58A 4UCMA 2B5GB 3BJ8A 4CYNA 4RS2A 2OZHA 4B5PA 4B14A 2P6FA 2EVNA 3H4QA 1S3ZA 4IF5A 4CS0B 1XF8A 5I0CA 4CYQA 4CAXA 2PSWA 2R98A 3S6GA 5CNPA 2ZW6A 2FSRA 2Z11A 5DWMA 1Q2YA 2FS5A 2HV2A 1MJAA 2VBQA 4KVXA 2FCKA 4Q38A 4KOSA 4ZBGA 2Z3KA 3TT2A 3IGRA 1L0CA 3TTHA 2ZW7A 2VZYA 4MFJA 2Q0YA 2Z3PA 2X7BA 5G21A 4KOXA 2OZUA 4CRYB 3G3SA 2NMTA 4FD7A 1CJWA 4DNCA 4AVAA 1YREA 4KLWA 4KOVA 4R9MA 4F0YA 3P2FA 5AG5A 5ISVA 4UA3A 4KORA 1XE4A 3TO7A 4A2ZA 4KLVA 2JEVA 1RXTA 4UFWA 2B4DA 2P0WA 2JDCA 4UFVA 2H5MA 1VKCA 2QIRA 4HNXB 2WSAA 2G0BA 2ZW4A 3R9GA 4IUSA 3DR6A 2BUEA 2FE7A 3CXPA 4KZTA 2VEZA 1SQHA 1ZO0A 4QC6A 2VXKA 3TO9A 2K5TA 3JVNA 1QSRA 4XPDB 3F0AA 3SXNA 1IYKA 4KUBA 3W6SA 3S6KA 2O28A 2GIVA 3EO4A 4XPDC 4B11A 4MJ8A 4KVOE 4E0AA 3EY5A 2YNCA 5DWNA 1I1DA 2ARHA 2FT0A 3C26A 4ZGYB 3TFYA 3G8WA 2J8MA 5F48A 2BEIA 4KVME 2QECA 4R3KA 1KUVA 4UWIA 4OLLA 2JDDA 3F5BA 2ZXVA 4CYPA 2BL1A 3PZJA 4KUAA 4A30A 1V0CA 2ZW5A 3VWEA 4NF1A 3TOBA 4Y49B 1WWZA 1Z4RA 1P0HA 4MBUA 3S6HA 3LD2A 2OH1A 5F47A 4B5PB 4CAVA 1QSMA 5FVJA 4RI1A 1OZPA 4R3LA 4A32A 2Q04A 3KKWA 1MJ9A 1S7NA 1GHEA 2DXQA 2R1IA 3IWGA 3D8PA 3FBUA 2ZPAA 3W6XA 2YNEA 2I00A 5KTCA 2A4NA 1QSNA 1M1DA 1R57A 1RO5A 3H5ZA 2YNDA 2GE3A 3FXTA 5KTDA 2FXFA 2PQ8A 1IYLA 2IL4A 2Q4YA 2GANA 4B12A 4JJXA 2CY2A 4H6UA 4CGMA 1KUYA 2WUUA 4CGPA 4JXRA 4F0XA 1P4NA 4K30A 4L8AA 2Z3OA 1YK3A 3PGPA 2EUIA 4UWJA 4CAFA 1M4IA 3BJ7A 4A31A 4HKFA 2Z3NA 4HNYB 3D3SA 1ON0A 4PSXA 2VZZA 4U5YA 4YRHA 3TO6A 3GYAA 2R8VA 2R7HA 2JLMA 2Y0MA 4YGOA 4C2YA 4YFJA 5G20A 3R95A 4BBHA 1YX0A 4OADA 3R9FA 4MFLA 4NSQA 3OWCA 4MY3A 3RYOA 1KZFA 2B4DB 3SXOA 4AB7A 2FIAA 2OZGA 2QMLA 1LRZA 4MFZA 5C88A 4FD6A 1QSOA 1J4JA 1YGHA 1MJBA 4PV6A 1IICA 2FL4A 3EFAA 2BSWA 4GS4A 4NEXA 4OAEA 4KOTA 5HMNA 2REFA 1I12A 4H6ZA 4B13A 3ZZIA 3DSBA 4A33A 4MFKA 4NCZA 1QSTA 1VHSA 5EBVA 2Z0ZA 4MFQA 2PDOA 3LODA 4QVTA 3T90A 1YR0A 1YVOA 2VI7A 3DDDA 4R87A 4ONUA 5H86A 5JPHA 5GCNA 2G3TA 4ORFA 4MI4A 4E2AA 2YNCC 4EVYA 5F49A 1Q2CA 2ATRA 5G22A 4FD5A 1NE9A 3QB8A 4B5OA 1IIDA 4L89A 4HNWB 5AGEA 1M44A 2Q44A 4BMHA 1U6MA 4II9A 1M4DA 2Q4VA 1NSLA 1FY7A 1Y7RA 3A9LA 1Z4EA 2D4PA 2FIWA 4PK2A 5F46A 2WPWA 5IX3A 5J8CA 1S7LA 4Y49C 3EC4A 1BO4A 1UFHA 5A28A 1XIXA 2PRBA 2I79A 4JXQA 3E0KA 1KUXA 1N71A 3NE7A 4AG7A 4MHDA 4UCNA 2Q7BA 3D2MA 4X5KA 4LUAA 2J8RA 3FYNA 3N7ZA 1S7FA 3IU1A 4UFXA 4M85A 3T9YA 4U9YA 2CXAA 2CNMA 4CYOA 5IB0A 2B5GA 4M3SA 3BLNA 3P2HA 4A95A 1B6BA 5BWAB 3GKRA 5JQ4A 4CGNA 3PP9A 4QUSA 3S6FA 2B4BA 3SHPA 3IU2A 5IV0A 1NMTA 2PR1A 1Y9WA 1XMTA 4KOYA 4QB9A 4JWPA 5KTAA 2HUZA 2WPXA 1PU9A 4I49A 4XNHB 4CAEA 2D4OA 4R57A 3K9UA 4KOUA 4U9ZA 4UBRA 2P6EA 4XNHC 2P6GA 3DR8A 3TE4A 2REEA 1CM0A 3DNSA 3JUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8G A;  4LX9 A;  5H84 A;  3FNC A;  3F8K A;  1I21 A;  3FB3 A;  2OU2 A;  3CXS A;  3R9E A;  4AVC A;  4XPK A;  2CNS A;  3UY5 A;  2B3U A;  2RC4 A;  3D2P A;  4QBJ A;  3QAH A;  4CAW A;  1IB1 E;  3R1K A;  2OB0 A;  3R96 A;  3WR7 A;  4JD6 A;  1XEB A;  4JLY A;  4AVB A;  3GY9 A;  1S7K A;  3TCV A;  3I9S A;  1S5K A;  4FD4 A;  4J3G A;  4H89 A;  5HH1 A;  4CRZ B;  4AG9 A;  3TOA A;  1PUA A;  2KCW A;  3ZJ0 A;  4MY0 A;  3FIX A;  3I3G A;  1M4G A;  1YVK A;  1YLE A;  2AJ6 A;  1TIQ A;  1MK4 A;  4F6A A;  2PC1 A;  2VQY A;  1WK4 A;  4PK3 A;  3CXQ A;  5J8F A;  5EC4 A;  3W91 A;  3EXN A;  3MGD A;  4PSW A;  4XPL A;  1Y9K A;  2B3V A;  1B87 A;  3VWD A;  2HQY A;  2Z10 A;  2CNT A;  2G3A A;  3FRM A;  4NXY A;  5E96 A;  1Q2D A;  1S60 A;  2AE6 A;  2J8N A;  1Z9U A;  3V8I A;  2F5I A;  2PR8 A;  5C82 A;  1K4J A;  2C27 A;  1BOB A;  4E8O A;  4KOW A;  2B58 A;  2B5G B;  3BJ8 A;  4RS2 A;  2OZH A;  4B5P A;  2P6F A;  2EVN A;  3H4Q A;  1S3Z A;  4IF5 A;  4CS0 B;  1XF8 A;  5I0C A;  4CAX A;  2PSW A;  2R98 A;  3S6G A;  5CNP A;  2ZW6 A;  2FSR A;  2Z11 A;  5DWM A;  1Q2Y A;  2FS5 A;  2HV2 A;  1MJA A;  2VBQ A;  4KVX A;  2FCK A;  4KOS A;  4ZBG A;  3TT2 A;  3IGR A;  1L0C A;  3TTH A;  2ZW7 A;  2VZY A;  2Q0Y A;  2X7B A;  4KOX A;  2OZU A;  4CRY B;  3G3S A;  2NMT A;  4FD7 A;  1CJW A;  4DNC A;  4AVA A;  1YRE A;  4KLW A;  4KOV A;  4R9M A;  4F0Y A;  3P2F A;  5ISV A;  4UA3 A;  4KOR A;  1XE4 A;  3TO7 A;  4KLV A;  2JEV A;  1RXT A;  2B4D A;  2P0W A;  2JDC A;  2H5M A;  1VKC A;  2QIR A;  4HNX B;  2G0B A;  2ZW4 A;  3R9G A;  4IUS A;  3DR6 A;  2BUE A;  2FE7 A;  3CXP A;  4KZT A;  2VEZ A;  1SQH A;  4QC6 A;  2VXK A;  3TO9 A;  2K5T A;  3JVN A;  1QSR A;  4XPD B;  3F0A A;  3SXN A;  1IYK A;  4KUB A;  3W6S A;  3S6K A;  2O28 A;  2GIV A;  3EO4 A;  4XPD C;  4MJ8 A;  4KVO E;  4E0A A;  3EY5 A;  5DWN A;  1I1D A;  2ARH A;  2FT0 A;  3C26 A;  3TFY A;  3G8W A;  2J8M A;  5F48 A;  2BEI A;  4KVM E;  2QEC A;  4R3K A;  1KUV A;  4UWI A;  4OLL A;  2JDD A;  3F5B A;  2ZXV A;  2BL1 A;  3PZJ A;  4KUA A;  1V0C A;  2ZW5 A;  3VWE A;  4NF1 A;  3TOB A;  4Y49 B;  1WWZ A;  1Z4R A;  1P0H A;  4MBU A;  3S6H A;  3LD2 A;  2OH1 A;  5F47 A;  4B5P B;  4CAV A;  1QSM A;  5FVJ A;  4RI1 A;  1OZP A;  4R3L A;  2Q04 A;  3KKW A;  1MJ9 A;  1S7N A;  1GHE A;  2DXQ A;  2R1I A;  3IWG A;  3D8P A;  3FBU A;  2ZPA A;  3W6X A;  2I00 A;  5KTC A;  2A4N A;  1QSN A;  1M1D A;  1R57 A;  1RO5 A;  2GE3 A;  3FXT A;  5KTD A;  2FXF A;  2PQ8 A;  1IYL A;  2IL4 A;  2Q4Y A;  2GAN A;  4JJX A;  2CY2 A;  4H6U A;  1KUY A;  4JXR A;  1P4N A;  4K30 A;  4L8A A;  1YK3 A;  3PGP A;  2EUI A;  4UWJ A;  1M4I A;  3BJ7 A;  4HKF A;  4HNY B;  3D3S A;  1ON0 A;  4PSX A;  2VZZ A;  4U5Y A;  4YRH A;  3TO6 A;  3GYA A;  2R8V A;  2R7H A;  2JLM A;  2Y0M A;  4YGO A;  4YFJ A;  3R95 A;  1YX0 A;  4OAD A;  3R9F A;  4NSQ A;  3OWC A;  4MY3 A;  3RYO A;  1KZF A;  2B4D B;  3SXO A;  4AB7 A;  2FIA A;  2OZG A;  2QML A;  1LRZ A;  5C88 A;  4FD6 A;  1QSO A;  1J4J A;  1YGH A;  1MJB A;  4PV6 A;  1IIC A;  2FL4 A;  3EFA A;  2BSW A;  4GS4 A;  4NEX A;  4OAE A;  4KOT A;  5HMN A;  2REF A;  1I12 A;  4H6Z A;  3ZZI A;  3DSB A;  4NCZ A;  1QST A;  1VHS A;  5EBV A;  2Z0Z A;  2PDO A;  3LOD A;  4QVT A;  3T90 A;  1YR0 A;  1YVO A;  2VI7 A;  3DDD A;  4R87 A;  4ONU A;  5H86 A;  5JPH A;  5GCN A;  2G3T A;  4ORF A;  4MI4 A;  4E2A A;  4EVY A;  5F49 A;  1Q2C A;  2ATR A;  4FD5 A;  1NE9 A;  3QB8 A;  4B5O A;  1IID A;  4L89 A;  4HNW B;  1M44 A;  2Q44 A;  4BMH A;  1U6M A;  4II9 A;  1M4D A;  2Q4V A;  1NSL A;  1FY7 A;  1Y7R A;  1Z4E A;  2D4P A;  2FIW A;  4PK2 A;  5F46 A;  2WPW A;  5IX3 A;  5J8C A;  1S7L A;  4Y49 C;  3EC4 A;  1BO4 A;  1UFH A;  1XIX A;  2PRB A;  2I79 A;  4JXQ A;  3E0K A;  1KUX A;  1N71 A;  3NE7 A;  4AG7 A;  4MHD A;  2Q7B A;  3D2M A;  4X5K A;  4LUA A;  2J8R A;  3FYN A;  3N7Z A;  1S7F A;  4M85 A;  3T9Y A;  4U9Y A;  2CNM A;  5IB0 A;  2B5G A;  4M3S A;  3BLN A;  3P2H A;  1B6B A;  5JQ4 A;  3GKR A;  3PP9 A;  4QUS A;  3S6F A;  2B4B A;  3SHP A;  5IV0 A;  1NMT A;  2PR1 A;  1Y9W A;  1XMT A;  4KOY A;  4QB9 A;  4JWP A;  5KTA A;  2HUZ A;  2WPX A;  1PU9 A;  4I49 A;  4XNH B;  2D4O A;  4R57 A;  3K9U A;  4KOU A;  4U9Z A;  4UBR A;  2P6E A;  4XNH C;  2P6G A;  3DR8 A;  3TE4 A;  2REE A;  1CM0 A;  3DNS A;  3JUW A; 
#chains in the Genus database with same CATH topology
 3H8E A;  3NA6 A;  3B8G A;  4P6Y A;  2ZEP A;  4UF4 A;  5F09 A;  4LX9 A;  5H84 A;  1YLO A;  3F8K A;  3FNC A;  1I21 A;  2V8G A;  4P4E A;  3FB3 A;  2OU2 A;  3CXS A;  3SI0 A;  3IEH A;  3R9E A;  3IWE A;  3FX6 A;  4AVC A;  3D7H A;  2V8D A;  4P4D A;  4A37 A;  2ZED A;  4XPK A;  2CNS A;  4ZYQ A;  3UY5 A;  3PB6 X;  3JTK A;  2B3U A;  1Y0R A;  1KWM A;  2RC4 A;  4KSA A;  5AG7 A;  2F8H A;  4JZ0 A;  2DPS A;  3D2P A;  4QBJ A;  3QAH A;  4M6I A;  4CAW A;  2RB7 A;  1IB1 E;  3R1K A;  2OB0 A;  3R96 A;  1TF9 A;  3HLP A;  3WR7 A;  4NGQ A;  2WYR A;  4TWE A;  4JD6 A;  2EO8 A;  1XEB A;  2PJ5 A;  4JLY A;  4IAV A;  1Z8X A;  3GY9 A;  4OC2 A;  4AVB A;  4C2X A;  1S7K A;  1PCA A;  1TXR A;  3TCV A;  1HEE A;  5D29 A;  4MFP A;  3B3V A;  4B10 A;  3I9S A;  1S5K A;  3KHZ A;  3B35 A;  4FD4 A;  4J3G A;  4FAI A;  4UCP A;  1CG2 A;  7CPA A;  4MHN A;  3FH4 A;  5HVH A;  1OBR A;  4P4B A;  3KZW A;  4H89 A;  5HH1 A;  4CRZ B;  4AG9 A;  3TOA A;  1PUA A;  2ZEN A;  2KCW A;  3ZJ0 A;  4KSI A;  5LRK A;  4C7H A;  4TNU A;  2PJC A;  2PJ6 A;  3KQX A;  4MY0 A;  3FIX A;  3I3G A;  1M4G A;  2Z3L A;  1YVK A;  4C2Z A;  2YGW A;  3DGV A;  4G1P A;  1YLE A;  3JRU A;  5LRG A;  2AJ6 A;  3PBE A;  1TIQ A;  2CTC A;  4C7I A;  1MK4 A;  4F6A A;  2PC1 A;  3SI1 A;  2VQY A;  3I1U A;  2J9A A;  3B3S A;  2CTB A;  2GU2 A;  4DUK A;  4KS9 A;  2O4H A;  5A27 A;  1WK4 A;  4PK3 A;  4NGN A;  3CPA A;  2V77 A;  3CXQ A;  5G1Z A;  5J8F A;  4C68 A;  5EC4 A;  3W91 A;  2C6G A;  3EXN A;  3MGD A;  4PSW A;  1R43 A;  4PXC A;  2Z3M A;  4XPL A;  4P10 A;  1Y9K A;  2DPT A;  4KSF A;  2B3V A;  1B87 A;  4PPZ A;  5AG6 A;  3HUV A;  2HQY A;  3VWD A;  2Z10 A;  2CNT A;  4ZX9 A;  2Q51 A;  1H8L A;  2G3A A;  3FRM A;  2VL1 A;  1FNO A;  4NXY A;  5E96 A;  3SJF A;  3TX8 A;  4OKO A;  3KHX A;  2PCU A;  1Q2D A;  4X8I A;  4ZI6 A;  4Q36 A;  1S60 A;  2QVP A;  3PB8 X;  2AE6 A;  2J8N A;  1Z9U A;  4CGL A;  3V8I A;  2F5I A;  2GLF A;  2PR8 A;  1UWY A;  1YW6 A;  3KGQ A;  5AG4 A;  5C82 A;  1ZG7 A;  1K4J A;  2C27 A;  1BOB A;  4RN7 A;  4CGO A;  4E8O A;  4KOW A;  2F7V A;  4CPA A;  2Q4Z A;  2EK9 A;  2B58 A;  3GUX A;  4UCM A;  3WAB A;  2B5G B;  3BJ8 A;  4CYN A;  4JYW A;  4RS2 A;  2OZH A;  4B5P A;  2GFQ A;  4B14 A;  2I3C A;  1CBX A;  2P6F A;  2XEG A;  3MRU A;  2PIZ A;  2EVN A;  3PB4 X;  3H4Q A;  4UIA A;  1S3Z A;  4IF5 A;  4CS0 B;  1XF8 A;  1DE4 C;  5I0C A;  4MCP A;  3NH8 A;  4CYQ A;  2AFX A;  4GXH A;  4CAX A;  2PSW A;  2R98 A;  3DLJ A;  3RBU A;  3S6G A;  2XEF A;  5CNP A;  2ZW6 A;  4MMO A;  2FSR A;  2NYQ A;  2Z11 A;  4MRI A;  5DWM A;  1VIX A;  5K8N A;  1Q2Y A;  2FS5 A;  2HV2 A;  1MJA A;  3KR4 A;  2VBQ A;  4KVX A;  4LQ6 A;  1HDQ A;  1Z8W A;  3FF3 A;  2FCK A;  3L2N A;  4Q38 A;  1TKJ A;  4KOS A;  4PQA A;  1VHE A;  4F9U A;  4OID A;  4ZBG A;  4YU9 A;  3PFO A;  1IY7 A;  4ZY2 A;  4NGT A;  8CPA A;  4F9V A;  2Z3K A;  3TT2 A;  3IGR A;  1L0C A;  1QQ9 A;  3B3C A;  3TTH A;  5IB9 A;  2ZW7 A;  2VZY A;  3B7I A;  4MFJ A;  2Q0Y A;  2Z3P A;  2X7B A;  5G21 A;  1XFO A;  1CP6 A;  4KOX A;  4UIB A;  1Q7L A;  2OZU A;  4CRY B;  3G3S A;  4OC4 A;  2NMT A;  2ZOG A;  4FD7 A;  1TKF A;  1CJW A;  4DNC A;  4AVA A;  3ISZ A;  1YRE A;  1EE3 P;  4ONW A;  4BD9 A;  4KLW A;  4KOV A;  4R9M A;  1IOI A;  4F0Y A;  3LAC A;  1F57 A;  3P2F A;  5AG5 A;  5ISV A;  4UA3 A;  1CX8 A;  2CF4 A;  4KOR A;  4OP4 A;  1XE4 A;  3TO7 A;  1ZG8 A;  4RUH A;  4A2Z A;  2NSM A;  4KLV A;  2JEV A;  2ABZ A;  2GRE A;  1RXT A;  4UFW A;  4IK2 A;  2B4D A;  2P0W A;  1XJO A;  2PJ3 A;  1QMU A;  2JDC A;  4PXD A;  4UFV A;  3RO0 A;  2PIY A;  1IOF A;  2H5M A;  1VKC A;  2ZOF A;  3WC5 A;  2QIR A;  4HNX B;  4R7M A;  2WSA A;  2PRQ A;  2G0B A;  3PEI A;  2ZW4 A;  3IO1 A;  3S9M A;  3R9G A;  4AXV A;  4IUS A;  3DR6 A;  3SI2 A;  2QJ8 A;  3QNV A;  1LCP A;  4UEZ A;  1XBU A;  2BUE A;  2FE7 A;  3CXP A;  4KZT A;  4OC5 A;  2VEZ A;  1SQH A;  1ZO0 A;  4QC6 A;  5DS0 A;  2VXK A;  3VAR A;  3MN8 A;  3TO9 A;  2K5T A;  3JVN A;  2QYV A;  5K8O A;  1QSR A;  1AMP A;  4A94 A;  1M4L A;  4XPD B;  2PJA A;  3F0A A;  1ARL A;  3SXN A;  3IWW A;  2Q7S A;  1IYK A;  4KUB A;  3T8W A;  3W6S A;  4X3R A;  3S6K A;  1RTQ A;  1X10 A;  2O28 A;  2GIV A;  3NE8 A;  4K3N A;  3EO4 A;  3S9L A;  4XPD C;  1R3N A;  2C1C A;  4UEF A;  1LAN A;  1ZLH A;  4P44 A;  4B11 A;  3B3W A;  4KVO E;  4MJ8 A;  4E0A A;  1VGY A;  3EY5 A;  2YNC A;  5HVG A;  3PB9 X;  5DWN A;  1CPX A;  3NH4 A;  1I1D A;  2ARH A;  2FT0 A;  3IIB A;  3C26 A;  4ZGY B;  3TFY A;  3G8W A;  2J8M A;  1NSA A;  3N5F A;  4R76 A;  5F48 A;  2BEI A;  4H2K A;  2JBJ A;  2QEC A;  4KVM E;  4R3K A;  5ELY A;  1KUV A;  3FJU A;  3GIU A;  4UWI A;  4OLL A;  2JDD A;  3D66 A;  3F5B A;  2ZXV A;  3PFE A;  4WJB A;  3NFZ A;  1AYE A;  4CYP A;  2BL1 A;  3PZJ A;  1BLL E;  5I4M A;  4KUA A;  3TC8 A;  4A30 A;  1V0C A;  2ZW5 A;  3VWE A;  4NF1 A;  3TOB A;  2POK A;  4Y49 B;  1WWZ A;  2Q43 A;  1Z4R A;  3K2K A;  4MCQ A;  1P0H A;  4MBU A;  3S6H A;  3LD2 A;  1ZG9 A;  2BCO A;  2HC9 A;  2HB6 A;  2OH1 A;  1ARM A;  5F47 A;  2JEW A;  4B5P B;  4CAV A;  1QSM A;  5FVJ A;  3D7D A;  4RI1 A;  2BOA A;  1OZP A;  2AFO A;  4R3L A;  5LYD A;  4A32 A;  2ANP A;  2V8H A;  2Q04 A;  3KKW A;  2ZEF A;  3IC1 A;  1MJ9 A;  4MHZ A;  1S7N A;  4MXU A;  1GHE A;  2DXQ A;  2R1I A;  3H8G A;  3IWG A;  3D8P A;  3FBU A;  2ZPA A;  4PXE A;  3W6X A;  2YNE A;  2I00 A;  1FT7 A;  2A4N A;  5KTC A;  1QSN A;  1M1D A;  1R57 A;  1RO5 A;  3H5Z A;  2YND A;  2GE3 A;  1Y0Y A;  3D68 A;  3FXT A;  5HXD A;  5KTD A;  2FXF A;  2PQ8 A;  1IYL A;  1Y7E A;  2IL4 A;  2Q4Y A;  2GAN A;  4B12 A;  4JJX A;  2ZEL A;  2CY2 A;  4ZY0 A;  4H6U A;  4CGM A;  1KUY A;  2WUU A;  4CGP A;  4JXR A;  4NGR A;  3RZA A;  1P4N A;  4K30 A;  4F0X A;  4L8A A;  4O23 A;  5THW A;  3BI0 A;  1A2Z A;  2Z3O A;  3BXM A;  4NGM A;  1XOV A;  4MCS A;  1YK3 A;  3PGP A;  2EUI A;  4UWJ A;  4CAF A;  1M4I A;  1TF8 A;  3BJ7 A;  2ZEM A;  2Z3N A;  4HKF A;  4HNY B;  4A31 A;  3KR5 A;  3KAS A;  3D3S A;  2EWB A;  1ON0 A;  2EBJ A;  3PBB A;  3NH5 A;  4PSX A;  5LYF A;  3D67 A;  2VZZ A;  2CIJ A;  4U5Y A;  2PJ2 A;  4YRH A;  3TO6 A;  1LOK A;  3GYA A;  4P45 A;  3BHX A;  2R8V A;  2R7H A;  3D4U A;  4HPS A;  2JLM A;  4P4F A;  2Y0M A;  4YWY A;  2ODF A;  4YGO A;  4C2Y A;  1IU8 A;  1JWQ A;  1LAP A;  2XEJ A;  2AFM A;  4DYO A;  1TKH A;  4BIN A;  4A39 A;  5CPA A;  5G20 A;  2XEI A;  3R95 A;  3GLJ A;  4BBH A;  1VHO A;  4YFJ A;  1YX0 A;  2G9D A;  4OAD A;  3R9F A;  1ELM P;  4MFL A;  3VAT A;  4NSQ A;  3OWC A;  3V7Z A;  2V8V A;  4MY3 A;  2IQ6 A;  3RYO A;  1ELL P;  3CT9 A;  1KZF A;  2B4D B;  1GYT A;  3SXO A;  4AB7 A;  3D7G A;  2RFH A;  3RAM A;  2FIA A;  2OZG A;  2QML A;  1HDU A;  3KQZ A;  4FWU A;  5LYI A;  4Z65 A;  1LRZ A;  4MFZ A;  5C88 A;  4FD6 A;  1QSO A;  5LRJ A;  1J4J A;  1YGH A;  1MJB A;  4PV6 A;  1IIC A;  4GM5 A;  2FL4 A;  2BO9 A;  2PE3 A;  2BSW A;  3EFA A;  4GS4 A;  4NEX A;  4OAE A;  4ZY1 A;  2AFZ A;  4KOT A;  5HMN A;  2REF A;  1Z2L A;  1I12 A;  4H6Z A;  1ZLI A;  4B13 A;  1LAM A;  3ZZI A;  2IMO A;  3FVL A;  2PJB A;  1Z8L A;  3DSB A;  4A33 A;  2PJ0 A;  1BPN A;  4MFK A;  4NCZ A;  3FED A;  2C6P A;  1QST A;  1VHS A;  1DTD A;  5EBV A;  3FEE A;  1F2O A;  2Z0Z A;  2ZEH A;  4MFQ A;  2PDO A;  3LOD A;  4QVT A;  1Z8T A;  4OC3 A;  3T90 A;  1YR0 A;  5HVF A;  3S9N A;  4OC0 A;  4FBE A;  1YVO A;  2VI7 A;  2JBK A;  4OIW A;  3B3T A;  4M6H A;  3RNZ A;  5D8N A;  3SJX A;  3DDD A;  4R87 A;  4ONU A;  5H86 A;  4EFD A;  2AFU A;  6CPA A;  1X12 A;  3KI9 A;  4NFR A;  5GCN A;  5JPH A;  2G3T A;  4NGP A;  3CZX A;  4ORF A;  1CPS A;  4MI4 A;  4MHY A;  4X2T A;  1XMB A;  4E2A A;  5CBM A;  2YNC C;  4EVY A;  5F49 A;  2ZEG A;  3B2Y A;  1Q2C A;  2ATR A;  2WZN A;  4ZX8 A;  5G22 A;  1YQE A;  3LMS A;  4B6Z A;  3CDX A;  2IJZ A;  2PJ4 A;  2FVG A;  4FD5 A;  1NE9 A;  3QB8 A;  4PXB A;  4B5O A;  3ISX A;  1IID A;  4L89 A;  4EWT A;  5K8M A;  4HNW B;  5AGE A;  2EK8 A;  2O53 A;  1M44 A;  2Q44 A;  4BMH A;  3BI1 A;  1U6M A;  5LYL A;  4II9 A;  4Q7A A;  2PJ8 A;  3SJE A;  1M4D A;  2Q4V A;  1LFW A;  1NSL A;  1FY7 A;  3PB7 X;  4DJL A;  1JQG A;  1Y7R A;  3A9L A;  4NJR A;  4EME A;  4W9Y A;  1Z4E A;  3D7F A;  2D4P A;  4M6G A;  2FIW A;  4PK2 A;  5F46 A;  2WPW A;  5IX3 A;  5J8C A;  2PVW A;  3WC6 A;  1S7L A;  4Y49 C;  3CPX A;  4NGS A;  3EC4 A;  1BO4 A;  1Z5R A;  4P4I A;  1UFH A;  5A28 A;  1XIX A;  3LWU A;  2PJ1 A;  3SJG A;  4F8Z A;  5JH9 A;  1PYT B;  2PRB A;  3IFE A;  1YW4 A;  2I79 A;  4JXQ A;  4P4J A;  3E0K A;  3V38 A;  1KUX A;  1N71 A;  2AFS A;  3KL9 A;  3NE7 A;  4MHD A;  2ZEE A;  4AG7 A;  4UCN A;  3FEC A;  2OOT A;  5EMI A;  4A38 A;  1YME A;  5J1Q A;  4R8F A;  4OC1 A;  2Q7B A;  1AUG A;  3GB0 A;  3D2M A;  4X5K A;  2ZEO A;  4LUA A;  2J8R A;  5K8P A;  1F2P A;  2DF5 A;  4MHP A;  3FYN A;  2DEA A;  4WWV A;  1CP7 A;  3N7Z A;  1S7F A;  3IU1 A;  1BAV A;  3IJ3 A;  4UFX A;  4LQG A;  4M85 A;  3T9Y A;  2PJ7 A;  3H8F A;  4U9Y A;  2CXA A;  2CNM A;  3VH9 A;  4CYO A;  2B5G A;  3QAY A;  4M3S A;  5IB0 A;  3BLN A;  3P2H A;  4A95 A;  1B6B A;  2AFW A;  2PJ9 A;  1BPM A;  3GKR A;  5BWA B;  5JQ4 A;  5JM6 A;  4CGN A;  3PP9 A;  4QUS A;  3S6F A;  2B4B A;  3WT4 A;  5JGF A;  3SHP A;  3FMC A;  1XRY A;  3IU2 A;  5IV0 A;  1NMT A;  3K9T A;  2PVV A;  1YSJ A;  2PR1 A;  1Y9W A;  3PRT A;  1XMT A;  4KOY A;  4MCR A;  4QB9 A;  3WC7 A;  4JWP A;  5KTA A;  2HUZ A;  2WPX A;  1PU9 A;  4I49 A;  4FUU A;  4UEE A;  4XNH B;  4CAE A;  2OR4 A;  2D4O A;  4R57 A;  2C6C A;  3K9U A;  4NJQ A;  4KOU A;  4U9Z A;  4UBR A;  4IHM A;  2P6E A;  4R6T A;  1IGB A;  4XNH C;  2P6G A;  3DR8 A;  4OME A;  3TE4 A;  2REE A;  2GLJ A;  1CM0 A;  3DNS A;  3JUW A; 
#chains in the Genus database with same CATH homology
 3B8G A;  4LX9 A;  5H84 A;  3FNC A;  3F8K A;  1I21 A;  3FB3 A;  2OU2 A;  3CXS A;  3R9E A;  3IWE A;  4AVC A;  4XPK A;  2CNS A;  3UY5 A;  3JTK A;  2B3U A;  2RC4 A;  4KSA A;  5AG7 A;  2DPS A;  3D2P A;  4QBJ A;  3QAH A;  4CAW A;  1IB1 E;  3R1K A;  2OB0 A;  3R96 A;  3WR7 A;  4JD6 A;  1XEB A;  4JLY A;  4AVB A;  3GY9 A;  4C2X A;  1S7K A;  3TCV A;  4MFP A;  4B10 A;  3I9S A;  1S5K A;  4FD4 A;  4J3G A;  4UCP A;  4H89 A;  5HH1 A;  4CRZ B;  4AG9 A;  3TOA A;  1PUA A;  2KCW A;  3ZJ0 A;  4C7H A;  4MY0 A;  3FIX A;  3I3G A;  1M4G A;  2Z3L A;  1YVK A;  4C2Z A;  2YGW A;  1YLE A;  2AJ6 A;  1TIQ A;  4C7I A;  1MK4 A;  4F6A A;  2PC1 A;  2VQY A;  4KS9 A;  5A27 A;  1WK4 A;  4PK3 A;  3CXQ A;  5G1Z A;  5J8F A;  4C68 A;  5EC4 A;  3W91 A;  3EXN A;  3MGD A;  4PSW A;  4XPL A;  2Z3M A;  1Y9K A;  2DPT A;  4KSF A;  2B3V A;  1B87 A;  5AG6 A;  3VWD A;  2HQY A;  2Z10 A;  2CNT A;  2G3A A;  3FRM A;  4NXY A;  5E96 A;  1Q2D A;  4Q36 A;  1S60 A;  2AE6 A;  2J8N A;  1Z9U A;  4CGL A;  3V8I A;  2F5I A;  2PR8 A;  5AG4 A;  5C82 A;  1K4J A;  2C27 A;  1BOB A;  4CGO A;  4E8O A;  4KOW A;  2B58 A;  4UCM A;  2B5G B;  3BJ8 A;  4CYN A;  4RS2 A;  2OZH A;  4B5P A;  4B14 A;  2P6F A;  2EVN A;  3H4Q A;  1S3Z A;  4IF5 A;  4CS0 B;  1XF8 A;  5I0C A;  4CYQ A;  4CAX A;  2PSW A;  2R98 A;  3S6G A;  5CNP A;  2ZW6 A;  2FSR A;  2Z11 A;  5DWM A;  1Q2Y A;  2FS5 A;  2HV2 A;  1MJA A;  2VBQ A;  4KVX A;  2FCK A;  4Q38 A;  4KOS A;  4ZBG A;  2Z3K A;  3TT2 A;  3IGR A;  1L0C A;  3TTH A;  2ZW7 A;  2VZY A;  4MFJ A;  2Q0Y A;  2Z3P A;  2X7B A;  5G21 A;  4KOX A;  2OZU A;  4CRY B;  3G3S A;  2NMT A;  4FD7 A;  1CJW A;  4DNC A;  4AVA A;  1YRE A;  4KLW A;  4KOV A;  4R9M A;  4F0Y A;  3P2F A;  5AG5 A;  5ISV A;  4UA3 A;  4KOR A;  1XE4 A;  3TO7 A;  4A2Z A;  4KLV A;  2JEV A;  1RXT A;  4UFW A;  2B4D A;  2P0W A;  2JDC A;  4UFV A;  2H5M A;  1VKC A;  2QIR A;  4HNX B;  2WSA A;  2G0B A;  2ZW4 A;  3R9G A;  4IUS A;  3DR6 A;  2BUE A;  2FE7 A;  3CXP A;  4KZT A;  2VEZ A;  1SQH A;  1ZO0 A;  4QC6 A;  2VXK A;  3TO9 A;  2K5T A;  3JVN A;  1QSR A;  4XPD B;  3F0A A;  3SXN A;  1IYK A;  4KUB A;  3W6S A;  3S6K A;  2O28 A;  2GIV A;  3EO4 A;  4XPD C;  4B11 A;  4MJ8 A;  4KVO E;  4E0A A;  3EY5 A;  2YNC A;  5DWN A;  1I1D A;  2ARH A;  2FT0 A;  3C26 A;  4ZGY B;  3TFY A;  3G8W A;  2J8M A;  5F48 A;  2BEI A;  4KVM E;  2QEC A;  4R3K A;  1KUV A;  4UWI A;  4OLL A;  2JDD A;  3F5B A;  2ZXV A;  4CYP A;  2BL1 A;  3PZJ A;  4KUA A;  4A30 A;  1V0C A;  2ZW5 A;  3VWE A;  4NF1 A;  3TOB A;  4Y49 B;  1WWZ A;  1Z4R A;  1P0H A;  4MBU A;  3S6H A;  3LD2 A;  2OH1 A;  5F47 A;  4B5P B;  4CAV A;  1QSM A;  5FVJ A;  4RI1 A;  1OZP A;  4R3L A;  4A32 A;  2Q04 A;  3KKW A;  1MJ9 A;  1S7N A;  1GHE A;  2DXQ A;  2R1I A;  3IWG A;  3D8P A;  3FBU A;  2ZPA A;  3W6X A;  2YNE A;  2I00 A;  5KTC A;  2A4N A;  1QSN A;  1M1D A;  1R57 A;  1RO5 A;  3H5Z A;  2YND A;  2GE3 A;  3FXT A;  5KTD A;  2FXF A;  2PQ8 A;  1IYL A;  2IL4 A;  2Q4Y A;  2GAN A;  4B12 A;  4JJX A;  2CY2 A;  4H6U A;  4CGM A;  1KUY A;  2WUU A;  4CGP A;  4JXR A;  4F0X A;  1P4N A;  4K30 A;  4L8A A;  2Z3O A;  1YK3 A;  3PGP A;  2EUI A;  4UWJ A;  4CAF A;  1M4I A;  3BJ7 A;  4A31 A;  4HKF A;  2Z3N A;  4HNY B;  3D3S A;  1ON0 A;  4PSX A;  2VZZ A;  4U5Y A;  4YRH A;  3TO6 A;  3GYA A;  2R8V A;  2R7H A;  2JLM A;  2Y0M A;  4YGO A;  4C2Y A;  4YFJ A;  5G20 A;  3R95 A;  4BBH A;  1YX0 A;  4OAD A;  3R9F A;  4MFL A;  4NSQ A;  3OWC A;  4MY3 A;  3RYO A;  1KZF A;  2B4D B;  3SXO A;  4AB7 A;  2FIA A;  2OZG A;  2QML A;  1LRZ A;  4MFZ A;  5C88 A;  4FD6 A;  1QSO A;  1J4J A;  1YGH A;  1MJB A;  4PV6 A;  1IIC A;  2FL4 A;  3EFA A;  2BSW A;  4GS4 A;  4NEX A;  4OAE A;  4KOT A;  5HMN A;  2REF A;  1I12 A;  4H6Z A;  4B13 A;  3ZZI A;  3DSB A;  4A33 A;  4MFK A;  4NCZ A;  1QST A;  1VHS A;  5EBV A;  2Z0Z A;  4MFQ A;  2PDO A;  3LOD A;  4QVT A;  3T90 A;  1YR0 A;  1YVO A;  2VI7 A;  3DDD A;  4R87 A;  4ONU A;  5H86 A;  5JPH A;  5GCN A;  2G3T A;  4ORF A;  4MI4 A;  4E2A A;  2YNC C;  4EVY A;  5F49 A;  1Q2C A;  2ATR A;  5G22 A;  4FD5 A;  1NE9 A;  3QB8 A;  4B5O A;  1IID A;  4L89 A;  4HNW B;  5AGE A;  1M44 A;  2Q44 A;  4BMH A;  1U6M A;  4II9 A;  1M4D A;  2Q4V A;  1NSL A;  1FY7 A;  1Y7R A;  3A9L A;  1Z4E A;  2D4P A;  2FIW A;  4PK2 A;  5F46 A;  2WPW A;  5IX3 A;  5J8C A;  1S7L A;  4Y49 C;  3EC4 A;  1BO4 A;  1UFH A;  5A28 A;  1XIX A;  2PRB A;  2I79 A;  4JXQ A;  3E0K A;  1KUX A;  1N71 A;  3NE7 A;  4AG7 A;  4MHD A;  4UCN A;  2Q7B A;  3D2M A;  4X5K A;  4LUA A;  2J8R A;  3FYN A;  3N7Z A;  1S7F A;  3IU1 A;  4UFX A;  4M85 A;  3T9Y A;  4U9Y A;  2CXA A;  2CNM A;  4CYO A;  5IB0 A;  2B5G A;  4M3S A;  3BLN A;  3P2H A;  4A95 A;  1B6B A;  5BWA B;  3GKR A;  5JQ4 A;  4CGN A;  3PP9 A;  4QUS A;  3S6F A;  2B4B A;  3SHP A;  3IU2 A;  5IV0 A;  1NMT A;  2PR1 A;  1Y9W A;  1XMT A;  4KOY A;  4QB9 A;  4JWP A;  5KTA A;  2HUZ A;  2WPX A;  1PU9 A;  4I49 A;  4XNH B;  4CAE A;  2D4O A;  4R57 A;  3K9U A;  4KOU A;  4U9Z A;  4UBR A;  2P6E A;  4XNH C;  2P6G A;  3DR8 A;  3TE4 A;  2REE A;  1CM0 A;  3DNS A;  3JUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...