2CY2A

Crystal structure of ttha1209 in complex with acetyl coenzyme a
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
174
structure length
174
Chain Sequence
VRIRRAGLEDLPGVARVLVDTWRATYRGVVPEAFLEGLSYEGQAERWAQRLKTPTWPGRLFVAESESGEVVGFAAFGPDRASGFPGYTAELWAIYVLPTWQRKGLGRALFHEGARLLQAEGYGRMLVWVLKENPKGRGFYEHLGGVLLGEREIELGGAKLWEVAYGFDLGGHKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TTHA1209 in complex with acetyl coenzyme A
rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
molecule keywords probable acetyltransferase
total genus 48
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2cy2A00
3R96A 1TIQA 4RS2A 4NCZA 2K5TA 4JXQA 2X7BA 4K30A 1YVOA 3JUWA 1SQHA 4II9A 1V0CA 4M3SA 2WPXA 4FD6A 2HUZA 1Z4RA 2B4BA 5KTAA 5JQ4A 2DXQA 3PP9A 4JD6A 4JWPA 3TE4A 3RYOA 1Q2CA 4KVOE 1S5KA 2FCKA 3QB8A 3DR6A 1IB1E 5IB0A 4CAWA 2REFA 2P0WA 5IV0A 4AVBA 1B6BA 2VZYA 3TO6A 2ATRA 1KUVA 3V8IA 3FIXA 2AJ6A 4KOXA 4JLYA 2Q04A 4UBRA 4IF5A 1IYLA 3T9YA 1Q2DA 4R57A 1ON0A 2OH1A 1YREA 5F48A 4KOSA 4CRYB 2VEZA 1S7FA 4XNHC 1S7KA 3TTHA 4EVYA 4Y49B 1U6MA 2PR1A 4YRHA 5J8FA 1KUYA 3EXNA 4KUAA 1PUAA 3G3SA 1CM0A 2OU2A 3SHPA 2D4PA 2B3VA 4L89A 4MI4A 4PSWA 1YGHA 5HMNA 4MY3A 2B4DB 5F49A 5DWMA 2B4DA 3R95A 2PR8A 3OWCA 4NSQA 3GY9A 3P2FA 4KOUA 2FXFA 3LODA 4F6AA 2R1IA 2OZGA 3DNSA 1WWZA 4ONUA 4JXRA 1KZFA 3NE7A 2FIWA 4KLVA 2A4NA 3ZJ0A 3E0KA 1XF8A 2F5IA 4XPDC 3S6FA 2B5GB 3K9UA 1J4JA 3TOBA 4X5KA 3SXOA 3TO7A 1IYKA 2FL4A 5DWNA 3D3SA 4YGOA 1PU9A 4CAXA 3H4QA 5CNPA 1NMTA 3EFAA 1I1DA 4E0AA 4NXYA 1R57A 3PGPA 4KVXA 4AVCA 4U9ZA 5H84A 3FBUA 3T90A 4UWIA 4FD4A 4H6ZA 4M85A 1P0HA 2FT0A 2R7HA 3EC4A 3D2PA 3FXTA 2I79A 4KLWA 5GCNA 4MBUA 2GE3A 4CRZB 2PQ8A 4UWJA 2PRBA 3BJ8A 3W6SA 4NEXA 2CNMA 1QSNA 2VXKA 2HV2A 3N7ZA 2P6GA 5KTDA 4DNCA 2Z10A 1OZPA 4KOTA 4QB9A 3F8KA 4KOYA 1WK4A 3TT2A 4H89A 4B5PB 4KOVA 3JVNA 4PSXA 3R9FA 2BUEA 1MJBA 1Q2YA 1XIXA 2WPWA 2I00A 1Y9KA 1MJ9A 3CXPA 4AG9A 2PSWA 4KOWA 1KUXA 4QUSA 2O28A 4H6UA 3DDDA 3D8PA 2FE7A 2Q0YA 1NE9A 3FB3A 3FNCA 1S7NA 2JEVA 2Z11A 2B58A 2ARHA 2VBQA 2REEA 3QAHA 1M4IA 2OZUA 4UA3A 3FYNA 4QC6A 3WR7A 4J3GA 2QMLA 3TCVA 2J8RA 5EBVA 4RI1A 4HNYB 1N71A 2J8MA 4ZBGA 4GS4A 1YR0A 1M4GA 4OAEA 1XEBA 4E8OA 2P6EA 2Q4VA 2P6FA 1VHSA 4HKFA 1S7LA 2VZZA 5F46A 1XMTA 3CXSA 4IUSA 3VWDA 1LRZA 1QSMA 2BEIA 2ZW5A 5IX3A 3BJ7A 4U5YA 4B5OA 5F47A 1QSTA 2CNSA 2GANA 1M4DA 2NMTA 3R9EA 3IWGA 2PDOA 3PZJA 2J8NA 1CJWA 4NF1A 4XPLA 2FS5A 2JDCA 3B8GA 4KUBA 3I3GA 5J8CA 1I21A 2B3UA 4AB7A 2ZW6A 1BO4A 4I49A 1IIDA 3EY5A 2OB0A 3F0AA 4CAVA 2CNTA 1S60A 2D4OA 4QVTA 2FIAA 3TFYA 1Z9UA 4B5PA 3R9GA 2Q4YA 2JLMA 1MK4A 1M1DA 2ZXVA 2C27A 4AVAA 2QECA 3F5BA 3VWEA 2ZW7A 4KVME 1M44A 3SXNA 2JDDA 4KZTA 4XPKA 4LUAA 3MGDA 2CY2A 4F0YA 5I0CA 2PC1A 4PK3A 4HNXB 5E96A 1BOBA 5FVJA 4R3KA 3ZZIA 2FSRA 3TOAA 3S6KA 2G0BA 5HH1A 3DR8A 2AE6A 4E2AA 1K4JA 3G8WA 3R1KA 3C26A 5KTCA 1Z4EA 4R3LA 3S6HA 4R9MA 3IGRA 3KKWA 5C82A 4MHDA 4L8AA 1QSOA 1S3ZA 2Q44A 2Y0MA 2BL1A 1RO5A 1MJAA 2ZW4A 1B87A 4OLLA 1YX0A 4MJ8A 4FD7A 4BMHA 4OADA 3W91A 3GKRA 3DSBA 3FRMA 4XPDB 4XNHB 5EC4A 2R98A 2VI7A 4U9YA 2VQYA 4Y49C 2QIRA 2B5GA 3BLNA 2OZHA 1XE4A 3LD2A 3S6GA 1YLEA 2G3AA 2R8VA 1YVKA 4PV6A 2RC4A 1GHEA 2Z0ZA 1UFHA 5ISVA 2ZPAA 3I9SA 1IICA 1P4NA 1YK3A 3UY5A 3EO4A 4LX9A 4MY0A 4PK2A 1RXTA 1I12A 2H5MA 3P2HA 4HNWB 2G3TA 3D2MA 2GIVA 3TO9A 1QSRA 1L0CA 2EUIA 2BSWA 4YFJA 4KORA 1FY7A 1VKCA 4FD5A 5JPHA 3CXQA 1NSLA 4JJXA 4AG7A 3GYAA 4CS0B 2HQYA 5C88A 1Y7RA 4QBJA 4ORFA 4R87A 3W6XA 2IL4A 2EVNA 5H86A 2KCWA 2Q7BA 1Y9WA
chains in the Genus database with same CATH superfamily
3R96A 4C2YA 3PB6X 3LMSA 1YSJA 5LYIA 4K3NA 1TIQA 4MXUA 3DGVA 3PB8X 4RS2A 4NCZA 2K5TA 4JXQA 2X7BA 1IOFA 3D4UA 4K30A 3H8FA 1YVOA 4OMEA 3JUWA 4EFDA 2Q4ZA 4P10A 1TF8A 1SQHA 3A9LA 4II9A 3KI9A 4A37A 1V0CA 2C6CA 2GFQA 4C7IA 3BXMA 4A38A 3LWUA 4M3SA 4UCNA 2PJ6A 2PVVA 2WPXA 5K8NA 4FD6A 3IWEA 1Y0RA 2HUZA 1IY7A 1Z4RA 5G20A 3T8WA 4M6HA 2B4BA 1XOVA 4MFZA 5KTAA 5JQ4A 2DXQA 3PP9A 1KWMA 1DTDA 4JD6A 4JWPA 1Q2CA 4KVOE 4KSAA 3RYOA 2DPTA 3QAYA 1Z8LA 3LACA 1S5KA 2FCKA 2EK8A 3QNVA 2GREA 3QB8A 4UFWA 3DR6A 4P44A 1IB1E 6CPAA 5IB0A 4CAWA 2F7VA 3GB0A 2REFA 2QVPA 3FJUA 4IAVA 2P0WA 4KS9A 3SI1A 5IV0A 4AVBA 3SI0A 1B6BA 2VZYA 3PFEA 3TO6A 2ATRA 1KUVA 4ZX8A 3FIXA 3V8IA 2AJ6A 3B3TA 3BHXA 4JLYA 2Q04A 4KOXA 4UBRA 4H2KA 2OOTA 3VARA 2GU2A 4CGOA 4FWUA 4IF5A 1JWQA 1IYLA 3T9YA 1AUGA 3L2NA 3SJXA 1Q2DA 2F8HA 1ON0A 2AFMA 2OH1A 1YREA 4R57A 5CBMA 5F48A 4BD9A 3S9MA 2CIJA 2J9AA 4KOSA 4CRYB 2VEZA 3KR5A 1S7FA 4A39A 1Z2LA 4XNHC 1JQGA 3I1UA 1S7KA 3TTHA 5THWA 3FEDA 3V7ZA 4ZY1A 4EVYA 4CYPA 4MHPA 4Y49B 1VIXA 3NA6A 4RN7A 5D29A 1U6MA 2PR1A 4YRHA 2PJBA 1LAPA 4UEEA 4TNUA 1KUYA 3WT4A 1BPNA 2ZEEA 3EXNA 5J8FA 3G3SA 1PUAA 4KUAA 5HXDA 1XFOA 1ZLHA 4NGSA 2XEGA 1CM0A 4IK2A 4R76A 2OU2A 3D68A 3TX8A 3JRUA 3SHPA 2D4PA 4X2TA 2B3VA 4L89A 4P4EA 2XEIA 4MI4A 4PSWA 1ZO0A 1YGHA 5HMNA 3FVLA 5LYFA 4MY3A 2B4DB 5F49A 5DWMA 2B4DA 3R95A 4DUKA 4OC5A 2EK9A 3FEEA 2IMOA 5BWAB 2YNCC 2PR8A 8CPAA 3OWCA 3PB4X 4NSQA 3RAMA 4GXHA 1ZG8A 3GY9A 3P2FA 2CTCA 4OKOA 1TKHA 2V8VA 2CTBA 4KOUA 1LANA 2PVWA 4A31A 1EE3P 4UCPA 2FXFA 3SJFA 3LODA 4A30A 1CPSA 4F6AA 2YGWA 2R1IA 1CPXA 3CPXA 4P4FA 1Z8TA 1H8LA 3D67A 4MFPA 2OZGA 2WYRA 4KSFA 4P4BA 4FBEA 2IQ6A 3CDXA 2QJ8A 4MCSA 3DNSA 4B6ZA 1WWZA 2BCOA 2NYQA 3IWWA 4ONUA 5D8NA 4JXRA 1KZFA 3B7IA 3NE7A 4NFRA 3FX6A 3WABA 2FIWA 2AFOA 3IU1A 4KLVA 1UWYA 2A4NA 3D7HA 3ZJ0A 2AFWA 3DLJA 3FH4A 4P45A 3E0KA 2PJ8A 1XF8A 4A2ZA 2GLJA 1ELMP 2F5IA 2AFZA 2JBJA 2YNEA 4XPDC 5AG6A 3S6FA 2Z3KA 2B5GB 2PJ5A 2ZENA 3K9UA 1J4JA 4CGLA 3TOBA 1ZG9A 2ZOGA 5G22A 2AFSA 2EO8A 4UEFA 3D66A 4OIDA 4X5KA 3D7GA 3SXOA 4CPAA 4Q36A 1Y0YA 4R7MA 4UIBA 3TO7A 1IYKA 2FL4A 2PRQA 5DWNA 2QYVA 3D3SA 3GIUA 2DF5A 4YGOA 1PU9A 4CAXA 4ZGYB 3H4QA 5CNPA 1F2PA 1NMTA 5ELYA 2HC9A 3EFAA 1I1DA 3RZAA 4LQ6A 4E0AA 4NXYA 1R57A 4B10A 3PGPA 4KVXA 3B3VA 4AVCA 1CX8A 3B3WA 4U9ZA 5H84A 3FBUA 3T90A 1HDQA 4UWIA 1R43A 1CG2A 4FD4A 4NGNA 4H6ZA 2RB7A 4M85A 2AFUA 2PJAA 1P0HA 2C6GA 2WZNA 2FT0A 3H5ZA 4NGRA 2R7HA 2ZEHA 3JTKA 4R8FA 3EC4A 2YNCA 3D2PA 5LYDA 5J1QA 3FXTA 3IU2A 2I79A 4KLWA 2ZEOA 5GCNA 4BBHA 4MBUA 2GE3A 4UFXA 3IFEA 3KQZA 4CRZB 2ODFA 3FECA 1LCPA 2PQ8A 5LRGA 4CGNA 2Q43A 4BINA 4M6GA 1DE4C 5AG4A 4UWJA 3B3SA 3NE8A 4CAFA 2C6PA 2PRBA 1F2OA 3BJ8A 3W6SA 4NEXA 2CNMA 2I3CA 4MFKA 2ABZA 1QSNA 2VXKA 4O23A 5K8MA 2ZEDA 2HV2A 5LYLA 3KGQA 3N7ZA 4CGMA 5LRJA 1Y7EA 2P6GA 2ZEGA 5KTDA 4DNCA 2Z10A 2DEAA 1OZPA 1VHOA 4P4DA 4KOTA 5K8OA 4QB9A 2PJCA 1RTQA 3F8KA 1WK4A 2PE3A 4KOYA 3TT2A 4H89A 4B5PB 3KQXA 4MHZA 5AG7A 4KOVA 3JVNA 2ZELA 4C2ZA 4PSXA 4C7HA 3R9FA 2BUEA 1Z5RA 1MJBA 1Q2YA 1XIXA 4PXEA 2WPWA 4DJLA 2I00A 4PQAA 1TXRA 4PXBA 2XEFA 1Y9KA 5EMIA 1FT7A 1MJ9A 4A33A 1OBRA 2PIZA 3CXPA 1ZLIA 4AG9A 2PSWA 1BPMA 4P6YA 4A94A 4KOWA 1KUXA 5JM6A 4QUSA 3D7FA 2O28A 4F9VA 1TF9A 1HDUA 4UF4A 4H6UA 4EWTA 5JGFA 1LAMA 2O4HA 4M6IA 5CPAA 3DDDA 4G1PA 3D8PA 3NH8A 2PJ0A 1X10A 5K8PA 4OIWA 4NGMA 2FE7A 1XRYA 2Q0YA 4Q38A 1NE9A 3FB3A 3FNCA 3IEHA 3KASA 1S7NA 2JEVA 4WWVA 1XMBA 2Z11A 4OC3A 3SJGA 3D7DA 4C2XA 4UCMA 2B58A 2ARHA 2VBQA 2REEA 2PJ2A 1M4IA 2V77A 3PEIA 3QAHA 3VATA 2JEWA 2OZUA 4UA3A 3FYNA 2PJ4A 2PJ3A 4QC6A 3WR7A 4NGQA 4J3GA 2QMLA 3GLJA 3PBBA 3TCVA 2J8RA 5EBVA 3KZWA 2EWBA 4B12A 4RI1A 3IIBA 3RNZA 4TWEA 4HNYB 5HVGA 1FNOA 1BLLE 1N71A 2J8MA 2WUUA 4ZBGA 3WC7A 4WJBA 4GS4A 1A2ZA 1YR0A 1M4GA 4OAEA 1XEBA 4PXDA 4E8OA 2P6EA 2Q4VA 3ISXA 3PBEA 1XBUA 2P6FA 1VHSA 4FUUA 4HKFA 1S7LA 2VZZA 5F46A 1XMTA 1Z8XA 1ELLP 3CXSA 4LQGA 4IUSA 4ZY2A 4PXCA 3VWDA 2V8DA 1LRZA 1QSMA 2BEIA 2ZW5A 3TC8A 2POKA 3BJ7A 2C1CA 7CPAA 5IX3A 5F09A 4U5YA 4B5OA 5F47A 1QSTA 2CNSA 4OP4A 4CGPA 2GANA 2VL1A 1M4DA 2NMTA 3R9EA 1M4LA 3IWGA 3MRUA 2PDOA 3RO0A 3FF3A 4Q7AA 4F8ZA 1Z8WA 2JBKA 2J8NA 1CJWA 2PJ1A 3PZJA 4X8IA 4A32A 4NF1A 2CF4A 4XPLA 2FS5A 3NH5A 2JDCA 4MMOA 3B8GA 4KUBA 4ZX9A 3I3GA 5J8CA 4CYOA 2Z3LA 1I21A 2B3UA 1CBXA 4NGPA 4AB7A 2ZW6A 1BO4A 1VGYA 1IU8A 3BI0A 3IC1A 1GYTA 1IIDA 3EY5A 3FMCA 4I49A 2OB0A 1AMPA 4OC0A 3F0AA 2V8GA 3HLPA 4MFJA 2PJ7A 4B14A 4CAVA 2CNTA 5G1ZA 1S60A 2D4OA 2Q7SA 2FIAA 4NJRA 1AYEA 4OC2A 4QVTA 4FAIA 3TE4A 2ZOFA 1ZG7A 1Z9UA 4KSIA 3TFYA 1TKJA 1YQEA 4F9UA 3CT9A 1PCAA 4B5PA 4ZYQA 3R9GA 4NJQA 2Q4YA 2JLMA 4JYWA 4P4JA 1MK4A 4MHNA 1M1DA 2ZEMA 4MCRA 2ZXVA 2C27A 4AVAA 4AXVA 1XJOA 2BOAA 4IHMA 4PPZA 2QECA 3F5BA 3PFOA 3VWEA 2ZW7A 3K9TA 4KVME 1M44A 3SXNA 2JDDA 1YW6A 3N5FA 4KZTA 4XPKA 5AGEA 3MGDA 1BAVA 4LUAA 2CY2A 5A27A 4F0YA 5I0CA 2PC1A 4YU9A 4PK3A 1IOIA 4HNXB 5E96A 1BOBA 3KHXA 5FVJA 4R3KA 2PJ9A 2CXAA 1Q7LA 1LOKA 2FSRA 3ZZIA 3KHZA 3TOAA 3S6KA 2G0BA 5HH1A 3DR8A 3CZXA 2AE6A 1X12A 5HVFA 4E2AA 1K4JA 1ARMA 3IJ3A 3B3CA 3G8WA 3R1KA 3C26A 2RFHA 4F0XA 3VH9A 2DPSA 3GUXA 3KR4A 4UIAA 1Z4EA 5KTCA 4R3LA 5DS0A 3S6HA 2Z3OA 4R9MA 4YWYA 1CP6A 3IGRA 5IB9A 3KKWA 1F57A 2ANPA 1QQ9A 5C82A 4MHDA 4L8AA 1QSOA 1S3ZA 2Q44A 2XEJA 2Y0MA 3WC6A 2BL1A 1RO5A 2Z3PA 1QMUA 5JH9A 4X3RA 2NSMA 1MJAA 3PB7X 1PYTB 2BO9A 2PIYA 2ZW4A 5G21A 1B87A 4OLLA 1YX0A 4MJ8A 3MN8A 4CAEA 4MHYA 4FD7A 4C68A 2AFXA 4BMHA 1IGBA 2GLFA 3H8EA 3B2YA 2V8HA 4MRIA 1R3NA 4OADA 3W91A 1YW4A 4DYOA 3BI1A 3GKRA 3DSBA 1ARLA 1LFWA 4GM5A 3FRMA 3H8GA 4XPDB 1YMEA 3S9NA 4NGTA 4XNHB 3KL9A 5EC4A 4A95A 4CYQA 2R98A 5A28A 2OR4A 2VI7A 4U9YA 3SI2A 2VQYA 4Y49C 2QIRA 2O53A 2B5GA 4UFVA 3BLNA 2OZHA 2IJZA 4B11A 5LRKA 1XE4A 3LD2A 3S9LA 4RUHA 4HPSA 4EMEA 4MFLA 3S6GA 4JZ0A 1YLEA 2G3AA 2R8VA 5HVHA 1YVKA 2FVGA 3ISZA 4PV6A 2RC4A 1GHEA 2Z0ZA 4MCQA 4OC4A 1UFHA 4R6TA 5ISVA 2ZPAA 3I9SA 1IICA 5I4MA 4W9YA 1P4NA 1YK3A 2Z3MA 2Q51A 2ZEPA 3EO4A 4LX9A 1YLOA 4MY0A 3UY5A 4PK2A 1RXTA 2HB6A 1I12A 1TKFA 2H5MA 3P2HA 4HNWB 2G3TA 3D2MA 3WC5A 2GIVA 3B35A 1QSRA 1L0CA 3TO9A 4ZI6A 2EUIA 4P4IA 4OC1A 4UEZA 2BSWA 4YFJA 4KORA 4ZY0A 1FY7A 1VKCA 1HEEA 4FD5A 5JPHA 1NSAA 3PB9X 5AG5A 3RBUA 2EBJA 3CPAA 3CXQA 2YNDA 3HUVA 4MCPA 1NSLA 3NH4A 4JJXA 1CP7A 2ZEFA 4ONWA 4B13A 4AG7A 3GYAA 4CS0B 2WSAA 2HQYA 2G9DA 3IO1A 3K2KA 3NFZA 4CYNA 2Z3NA 1VHEA 1Y7RA 3PRTA 5C88A 4QBJA 4ORFA 4R87A 3W6XA 4MFQA 2IL4A 2EVNA 3SJEA 5H86A 3V38A 4Z65A 2KCWA 2Q7BA 1Y9WA 2PCUA
chains in the Genus database with same CATH topology
3R96A 4C2YA 1TIQA 4RS2A 4NCZA 2K5TA 4JXQA 2X7BA 4K30A 1YVOA 3JUWA 1SQHA 3A9LA 4II9A 1V0CA 4C7IA 4M3SA 4UCNA 2WPXA 4FD6A 3IWEA 5G20A 2HUZA 1Z4RA 2B4BA 4MFZA 5KTAA 5JQ4A 2DXQA 3PP9A 4JD6A 4JWPA 3TE4A 3RYOA 1Q2CA 4KVOE 4KSAA 2DPTA 1S5KA 2FCKA 3QB8A 4UFWA 3DR6A 1IB1E 5IB0A 4CAWA 2REFA 2P0WA 4KS9A 5IV0A 4AVBA 1B6BA 2VZYA 3TO6A 2ATRA 1KUVA 3V8IA 3FIXA 2AJ6A 4KOXA 4JLYA 2Q04A 4UBRA 4CGOA 4IF5A 1IYLA 3T9YA 1Q2DA 1ON0A 2OH1A 4R57A 1YREA 5F48A 4KOSA 4CRYB 2VEZA 1S7FA 4XNHC 1S7KA 3TTHA 4EVYA 4CYPA 4Y49B 1U6MA 2PR1A 4YRHA 5J8FA 1KUYA 3EXNA 3G3SA 4KUAA 1PUAA 1CM0A 2OU2A 3SHPA 2D4PA 2B3VA 4L89A 4MI4A 4PSWA 1ZO0A 1YGHA 5HMNA 4MY3A 2B4DB 5F49A 5DWMA 2B4DA 3R95A 5BWAB 2YNCC 2PR8A 3OWCA 4NSQA 3GY9A 3P2FA 4KOUA 4A31A 4UCPA 2FXFA 3LODA 4A30A 4F6AA 2YGWA 2R1IA 4MFPA 2OZGA 4KSFA 3DNSA 1WWZA 4ONUA 4JXRA 1KZFA 3NE7A 2FIWA 3IU1A 4KLVA 2A4NA 3ZJ0A 4A2ZA 3E0KA 1XF8A 2F5IA 2YNEA 4XPDC 5AG6A 3S6FA 2Z3KA 2B5GB 3K9UA 1J4JA 4CGLA 3TOBA 5G22A 4X5KA 3SXOA 4Q36A 3TO7A 1IYKA 2FL4A 5DWNA 3D3SA 4YGOA 1PU9A 4CAXA 4ZGYB 3H4QA 5CNPA 1NMTA 3EFAA 1I1DA 4E0AA 4NXYA 1R57A 4B10A 3PGPA 4KVXA 4AVCA 4U9ZA 5H84A 3FBUA 3T90A 4UWIA 4FD4A 4H6ZA 4M85A 1P0HA 2FT0A 3H5ZA 2R7HA 3JTKA 3EC4A 2YNCA 3D2PA 3FXTA 3IU2A 2I79A 4KLWA 5GCNA 4BBHA 4MBUA 2GE3A 4UFXA 4CRZB 2PQ8A 4CGNA 5AG4A 4UWJA 4CAFA 2PRBA 3BJ8A 3W6SA 4NEXA 2CNMA 4MFKA 1QSNA 2VXKA 2HV2A 3N7ZA 4CGMA 2P6GA 5KTDA 4DNCA 2Z10A 1OZPA 4KOTA 4QB9A 3F8KA 4KOYA 1WK4A 3TT2A 4H89A 4B5PB 5AG7A 4KOVA 3JVNA 4C2ZA 4PSXA 4C7HA 3R9FA 2BUEA 1MJBA 1Q2YA 1XIXA 2WPWA 2I00A 1Y9KA 1MJ9A 4A33A 3CXPA 4AG9A 2PSWA 4KOWA 1KUXA 4QUSA 2O28A 4H6UA 3DDDA 3D8PA 2FE7A 2Q0YA 4Q38A 1NE9A 3FB3A 3FNCA 1S7NA 2JEVA 2Z11A 4C2XA 4UCMA 2B58A 2ARHA 2VBQA 2REEA 3QAHA 1M4IA 2OZUA 4UA3A 3FYNA 4QC6A 3WR7A 4J3GA 2QMLA 3TCVA 2J8RA 5EBVA 4B12A 4RI1A 4HNYB 1N71A 2J8MA 2WUUA 4ZBGA 4GS4A 1YR0A 1M4GA 4OAEA 1XEBA 4E8OA 2P6EA 2Q4VA 2P6FA 1VHSA 4HKFA 1S7LA 2VZZA 5F46A 1XMTA 3CXSA 4IUSA 3VWDA 1LRZA 1QSMA 2BEIA 2ZW5A 5IX3A 3BJ7A 4U5YA 4B5OA 5F47A 1QSTA 2CNSA 4CGPA 2GANA 1M4DA 2NMTA 3R9EA 3IWGA 2PDOA 3PZJA 2J8NA 1CJWA 4A32A 4NF1A 4XPLA 2FS5A 2JDCA 3B8GA 4KUBA 3I3GA 5J8CA 4CYOA 2Z3LA 1I21A 2B3UA 4AB7A 2ZW6A 1BO4A 4I49A 1IIDA 3EY5A 2OB0A 3F0AA 4MFJA 4B14A 4CAVA 2CNTA 5G1ZA 1S60A 2D4OA 4QVTA 2FIAA 3TFYA 1Z9UA 4B5PA 3R9GA 2Q4YA 2JLMA 1MK4A 1M1DA 2ZXVA 2C27A 4AVAA 2QECA 3F5BA 3VWEA 2ZW7A 4KVME 1M44A 3SXNA 2JDDA 4KZTA 4XPKA 5AGEA 4LUAA 3MGDA 5A27A 2CY2A 4F0YA 5I0CA 2PC1A 4PK3A 4HNXB 5E96A 1BOBA 5FVJA 4R3KA 2CXAA 3ZZIA 2FSRA 3TOAA 3S6KA 2G0BA 5HH1A 3DR8A 2AE6A 4E2AA 1K4JA 3G8WA 3R1KA 3C26A 4F0XA 2DPSA 5KTCA 1Z4EA 4R3LA 3S6HA 2Z3OA 4R9MA 3IGRA 3KKWA 5C82A 4MHDA 4L8AA 1QSOA 1S3ZA 2Q44A 2Y0MA 2BL1A 1RO5A 2Z3PA 1MJAA 5G21A 2ZW4A 1B87A 4OLLA 1YX0A 4MJ8A 4CAEA 4FD7A 4C68A 4BMHA 4OADA 3W91A 3GKRA 3DSBA 3FRMA 4XPDB 4XNHB 5EC4A 4A95A 4CYQA 2R98A 5A28A 2VI7A 4U9YA 2VQYA 4Y49C 2QIRA 2B5GA 4UFVA 3BLNA 2OZHA 4B11A 1XE4A 3LD2A 4MFLA 3S6GA 1YLEA 2G3AA 2R8VA 1YVKA 4PV6A 2RC4A 1GHEA 2Z0ZA 1UFHA 5ISVA 2ZPAA 3I9SA 1IICA 1P4NA 1YK3A 2Z3MA 3EO4A 4LX9A 3UY5A 4MY0A 4PK2A 1RXTA 1I12A 2H5MA 3P2HA 4HNWB 2G3TA 3D2MA 2GIVA 3TO9A 1QSRA 1L0CA 2EUIA 2BSWA 4YFJA 4KORA 1FY7A 1VKCA 4FD5A 5JPHA 5AG5A 3CXQA 2YNDA 1NSLA 4JJXA 4B13A 4AG7A 3GYAA 4CS0B 2WSAA 2HQYA 4CYNA 2Z3NA 5C88A 1Y7RA 4QBJA 4ORFA 4R87A 3W6XA 4MFQA 2IL4A 2EVNA 5H86A 2KCWA 2Q7BA 1Y9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R96 A;  1TIQ A;  4RS2 A;  4NCZ A;  2K5T A;  4JXQ A;  2X7B A;  4K30 A;  1YVO A;  3JUW A;  1SQH A;  4II9 A;  1V0C A;  4M3S A;  2WPX A;  4FD6 A;  2HUZ A;  1Z4R A;  2B4B A;  5KTA A;  5JQ4 A;  2DXQ A;  3PP9 A;  4JD6 A;  4JWP A;  3TE4 A;  3RYO A;  1Q2C A;  4KVO E;  1S5K A;  2FCK A;  3QB8 A;  3DR6 A;  1IB1 E;  5IB0 A;  4CAW A;  2REF A;  2P0W A;  5IV0 A;  4AVB A;  1B6B A;  2VZY A;  3TO6 A;  2ATR A;  1KUV A;  3V8I A;  3FIX A;  2AJ6 A;  4KOX A;  4JLY A;  2Q04 A;  4UBR A;  4IF5 A;  1IYL A;  3T9Y A;  1Q2D A;  4R57 A;  1ON0 A;  2OH1 A;  1YRE A;  5F48 A;  4KOS A;  4CRY B;  2VEZ A;  1S7F A;  4XNH C;  1S7K A;  3TTH A;  4EVY A;  4Y49 B;  1U6M A;  2PR1 A;  4YRH A;  5J8F A;  1KUY A;  3EXN A;  4KUA A;  1PUA A;  3G3S A;  1CM0 A;  2OU2 A;  3SHP A;  2D4P A;  2B3V A;  4L89 A;  4MI4 A;  4PSW A;  1YGH A;  5HMN A;  4MY3 A;  2B4D B;  5F49 A;  5DWM A;  2B4D A;  3R95 A;  2PR8 A;  3OWC A;  4NSQ A;  3GY9 A;  3P2F A;  4KOU A;  2FXF A;  3LOD A;  4F6A A;  2R1I A;  2OZG A;  3DNS A;  1WWZ A;  4ONU A;  4JXR A;  1KZF A;  3NE7 A;  2FIW A;  4KLV A;  2A4N A;  3ZJ0 A;  3E0K A;  1XF8 A;  2F5I A;  4XPD C;  3S6F A;  2B5G B;  3K9U A;  1J4J A;  3TOB A;  4X5K A;  3SXO A;  3TO7 A;  1IYK A;  2FL4 A;  5DWN A;  3D3S A;  4YGO A;  1PU9 A;  4CAX A;  3H4Q A;  5CNP A;  1NMT A;  3EFA A;  1I1D A;  4E0A A;  4NXY A;  1R57 A;  3PGP A;  4KVX A;  4AVC A;  4U9Z A;  5H84 A;  3FBU A;  3T90 A;  4UWI A;  4FD4 A;  4H6Z A;  4M85 A;  1P0H A;  2FT0 A;  2R7H A;  3EC4 A;  3D2P A;  3FXT A;  2I79 A;  4KLW A;  5GCN A;  4MBU A;  2GE3 A;  4CRZ B;  2PQ8 A;  4UWJ A;  2PRB A;  3BJ8 A;  3W6S A;  4NEX A;  2CNM A;  1QSN A;  2VXK A;  2HV2 A;  3N7Z A;  2P6G A;  5KTD A;  4DNC A;  2Z10 A;  1OZP A;  4KOT A;  4QB9 A;  3F8K A;  4KOY A;  1WK4 A;  3TT2 A;  4H89 A;  4B5P B;  4KOV A;  3JVN A;  4PSX A;  3R9F A;  2BUE A;  1MJB A;  1Q2Y A;  1XIX A;  2WPW A;  2I00 A;  1Y9K A;  1MJ9 A;  3CXP A;  4AG9 A;  2PSW A;  4KOW A;  1KUX A;  4QUS A;  2O28 A;  4H6U A;  3DDD A;  3D8P A;  2FE7 A;  2Q0Y A;  1NE9 A;  3FB3 A;  3FNC A;  1S7N A;  2JEV A;  2Z11 A;  2B58 A;  2ARH A;  2VBQ A;  2REE A;  3QAH A;  1M4I A;  2OZU A;  4UA3 A;  3FYN A;  4QC6 A;  3WR7 A;  4J3G A;  2QML A;  3TCV A;  2J8R A;  5EBV A;  4RI1 A;  4HNY B;  1N71 A;  2J8M A;  4ZBG A;  4GS4 A;  1YR0 A;  1M4G A;  4OAE A;  1XEB A;  4E8O A;  2P6E A;  2Q4V A;  2P6F A;  1VHS A;  4HKF A;  1S7L A;  2VZZ A;  5F46 A;  1XMT A;  3CXS A;  4IUS A;  3VWD A;  1LRZ A;  1QSM A;  2BEI A;  2ZW5 A;  5IX3 A;  3BJ7 A;  4U5Y A;  4B5O A;  5F47 A;  1QST A;  2CNS A;  2GAN A;  1M4D A;  2NMT A;  3R9E A;  3IWG A;  2PDO A;  3PZJ A;  2J8N A;  1CJW A;  4NF1 A;  4XPL A;  2FS5 A;  2JDC A;  3B8G A;  4KUB A;  3I3G A;  5J8C A;  1I21 A;  2B3U A;  4AB7 A;  2ZW6 A;  1BO4 A;  4I49 A;  1IID A;  3EY5 A;  2OB0 A;  3F0A A;  4CAV A;  2CNT A;  1S60 A;  2D4O A;  4QVT A;  2FIA A;  3TFY A;  1Z9U A;  4B5P A;  3R9G A;  2Q4Y A;  2JLM A;  1MK4 A;  1M1D A;  2ZXV A;  2C27 A;  4AVA A;  2QEC A;  3F5B A;  3VWE A;  2ZW7 A;  4KVM E;  1M44 A;  3SXN A;  2JDD A;  4KZT A;  4XPK A;  4LUA A;  3MGD A;  2CY2 A;  4F0Y A;  5I0C A;  2PC1 A;  4PK3 A;  4HNX B;  5E96 A;  1BOB A;  5FVJ A;  4R3K A;  3ZZI A;  2FSR A;  3TOA A;  3S6K A;  2G0B A;  5HH1 A;  3DR8 A;  2AE6 A;  4E2A A;  1K4J A;  3G8W A;  3R1K A;  3C26 A;  5KTC A;  1Z4E A;  4R3L A;  3S6H A;  4R9M A;  3IGR A;  3KKW A;  5C82 A;  4MHD A;  4L8A A;  1QSO A;  1S3Z A;  2Q44 A;  2Y0M A;  2BL1 A;  1RO5 A;  1MJA A;  2ZW4 A;  1B87 A;  4OLL A;  1YX0 A;  4MJ8 A;  4FD7 A;  4BMH A;  4OAD A;  3W91 A;  3GKR A;  3DSB A;  3FRM A;  4XPD B;  4XNH B;  5EC4 A;  2R98 A;  2VI7 A;  4U9Y A;  2VQY A;  4Y49 C;  2QIR A;  2B5G A;  3BLN A;  2OZH A;  1XE4 A;  3LD2 A;  3S6G A;  1YLE A;  2G3A A;  2R8V A;  1YVK A;  4PV6 A;  2RC4 A;  1GHE A;  2Z0Z A;  1UFH A;  5ISV A;  2ZPA A;  3I9S A;  1IIC A;  1P4N A;  1YK3 A;  3UY5 A;  3EO4 A;  4LX9 A;  4MY0 A;  4PK2 A;  1RXT A;  1I12 A;  2H5M A;  3P2H A;  4HNW B;  2G3T A;  3D2M A;  2GIV A;  3TO9 A;  1QSR A;  1L0C A;  2EUI A;  2BSW A;  4YFJ A;  4KOR A;  1FY7 A;  1VKC A;  4FD5 A;  5JPH A;  3CXQ A;  1NSL A;  4JJX A;  4AG7 A;  3GYA A;  4CS0 B;  2HQY A;  5C88 A;  1Y7R A;  4QBJ A;  4ORF A;  4R87 A;  3W6X A;  2IL4 A;  2EVN A;  5H86 A;  2KCW A;  2Q7B A;  1Y9W A; 
#chains in the Genus database with same CATH topology
 3R96 A;  4C2Y A;  3PB6 X;  3LMS A;  1YSJ A;  5LYI A;  4K3N A;  1TIQ A;  4MXU A;  3DGV A;  3PB8 X;  4RS2 A;  4NCZ A;  2K5T A;  4JXQ A;  2X7B A;  1IOF A;  3D4U A;  4K30 A;  3H8F A;  1YVO A;  4OME A;  3JUW A;  4EFD A;  2Q4Z A;  4P10 A;  1TF8 A;  1SQH A;  3A9L A;  4II9 A;  3KI9 A;  4A37 A;  1V0C A;  2C6C A;  2GFQ A;  4C7I A;  3BXM A;  4A38 A;  3LWU A;  4M3S A;  4UCN A;  2PJ6 A;  2PVV A;  2WPX A;  5K8N A;  4FD6 A;  3IWE A;  1Y0R A;  2HUZ A;  1IY7 A;  1Z4R A;  5G20 A;  3T8W A;  4M6H A;  2B4B A;  1XOV A;  4MFZ A;  5KTA A;  5JQ4 A;  2DXQ A;  3PP9 A;  1KWM A;  1DTD A;  4JD6 A;  4JWP A;  1Q2C A;  4KVO E;  4KSA A;  3RYO A;  2DPT A;  3QAY A;  1Z8L A;  3LAC A;  1S5K A;  2FCK A;  2EK8 A;  3QNV A;  2GRE A;  3QB8 A;  4UFW A;  3DR6 A;  4P44 A;  1IB1 E;  6CPA A;  5IB0 A;  4CAW A;  2F7V A;  3GB0 A;  2REF A;  2QVP A;  3FJU A;  4IAV A;  2P0W A;  4KS9 A;  3SI1 A;  5IV0 A;  4AVB A;  3SI0 A;  1B6B A;  2VZY A;  3PFE A;  3TO6 A;  2ATR A;  1KUV A;  4ZX8 A;  3FIX A;  3V8I A;  2AJ6 A;  3B3T A;  3BHX A;  4JLY A;  2Q04 A;  4KOX A;  4UBR A;  4H2K A;  2OOT A;  3VAR A;  2GU2 A;  4CGO A;  4FWU A;  4IF5 A;  1JWQ A;  1IYL A;  3T9Y A;  1AUG A;  3L2N A;  3SJX A;  1Q2D A;  2F8H A;  1ON0 A;  2AFM A;  2OH1 A;  1YRE A;  4R57 A;  5CBM A;  5F48 A;  4BD9 A;  3S9M A;  2CIJ A;  2J9A A;  4KOS A;  4CRY B;  2VEZ A;  3KR5 A;  1S7F A;  4A39 A;  1Z2L A;  4XNH C;  1JQG A;  3I1U A;  1S7K A;  3TTH A;  5THW A;  3FED A;  3V7Z A;  4ZY1 A;  4EVY A;  4CYP A;  4MHP A;  4Y49 B;  1VIX A;  3NA6 A;  4RN7 A;  5D29 A;  1U6M A;  2PR1 A;  4YRH A;  2PJB A;  1LAP A;  4UEE A;  4TNU A;  1KUY A;  3WT4 A;  1BPN A;  2ZEE A;  3EXN A;  5J8F A;  3G3S A;  1PUA A;  4KUA A;  5HXD A;  1XFO A;  1ZLH A;  4NGS A;  2XEG A;  1CM0 A;  4IK2 A;  4R76 A;  2OU2 A;  3D68 A;  3TX8 A;  3JRU A;  3SHP A;  2D4P A;  4X2T A;  2B3V A;  4L89 A;  4P4E A;  2XEI A;  4MI4 A;  4PSW A;  1ZO0 A;  1YGH A;  5HMN A;  3FVL A;  5LYF A;  4MY3 A;  2B4D B;  5F49 A;  5DWM A;  2B4D A;  3R95 A;  4DUK A;  4OC5 A;  2EK9 A;  3FEE A;  2IMO A;  5BWA B;  2YNC C;  2PR8 A;  8CPA A;  3OWC A;  3PB4 X;  4NSQ A;  3RAM A;  4GXH A;  1ZG8 A;  3GY9 A;  3P2F A;  2CTC A;  4OKO A;  1TKH A;  2V8V A;  2CTB A;  4KOU A;  1LAN A;  2PVW A;  4A31 A;  1EE3 P;  4UCP A;  2FXF A;  3SJF A;  3LOD A;  4A30 A;  1CPS A;  4F6A A;  2YGW A;  2R1I A;  1CPX A;  3CPX A;  4P4F A;  1Z8T A;  1H8L A;  3D67 A;  4MFP A;  2OZG A;  2WYR A;  4KSF A;  4P4B A;  4FBE A;  2IQ6 A;  3CDX A;  2QJ8 A;  4MCS A;  3DNS A;  4B6Z A;  1WWZ A;  2BCO A;  2NYQ A;  3IWW A;  4ONU A;  5D8N A;  4JXR A;  1KZF A;  3B7I A;  3NE7 A;  4NFR A;  3FX6 A;  3WAB A;  2FIW A;  2AFO A;  3IU1 A;  4KLV A;  1UWY A;  2A4N A;  3D7H A;  3ZJ0 A;  2AFW A;  3DLJ A;  3FH4 A;  4P45 A;  3E0K A;  2PJ8 A;  1XF8 A;  4A2Z A;  2GLJ A;  1ELM P;  2F5I A;  2AFZ A;  2JBJ A;  2YNE A;  4XPD C;  5AG6 A;  3S6F A;  2Z3K A;  2B5G B;  2PJ5 A;  2ZEN A;  3K9U A;  1J4J A;  4CGL A;  3TOB A;  1ZG9 A;  2ZOG A;  5G22 A;  2AFS A;  2EO8 A;  4UEF A;  3D66 A;  4OID A;  4X5K A;  3D7G A;  3SXO A;  4CPA A;  4Q36 A;  1Y0Y A;  4R7M A;  4UIB A;  3TO7 A;  1IYK A;  2FL4 A;  2PRQ A;  5DWN A;  2QYV A;  3D3S A;  3GIU A;  2DF5 A;  4YGO A;  1PU9 A;  4CAX A;  4ZGY B;  3H4Q A;  5CNP A;  1F2P A;  1NMT A;  5ELY A;  2HC9 A;  3EFA A;  1I1D A;  3RZA A;  4LQ6 A;  4E0A A;  4NXY A;  1R57 A;  4B10 A;  3PGP A;  4KVX A;  3B3V A;  4AVC A;  1CX8 A;  3B3W A;  4U9Z A;  5H84 A;  3FBU A;  3T90 A;  1HDQ A;  4UWI A;  1R43 A;  1CG2 A;  4FD4 A;  4NGN A;  4H6Z A;  2RB7 A;  4M85 A;  2AFU A;  2PJA A;  1P0H A;  2C6G A;  2WZN A;  2FT0 A;  3H5Z A;  4NGR A;  2R7H A;  2ZEH A;  3JTK A;  4R8F A;  3EC4 A;  2YNC A;  3D2P A;  5LYD A;  5J1Q A;  3FXT A;  3IU2 A;  2I79 A;  4KLW A;  2ZEO A;  5GCN A;  4BBH A;  4MBU A;  2GE3 A;  4UFX A;  3IFE A;  3KQZ A;  4CRZ B;  2ODF A;  3FEC A;  1LCP A;  2PQ8 A;  5LRG A;  4CGN A;  2Q43 A;  4BIN A;  4M6G A;  1DE4 C;  5AG4 A;  4UWJ A;  3B3S A;  3NE8 A;  4CAF A;  2C6P A;  2PRB A;  1F2O A;  3BJ8 A;  3W6S A;  4NEX A;  2CNM A;  2I3C A;  4MFK A;  2ABZ A;  1QSN A;  2VXK A;  4O23 A;  5K8M A;  2ZED A;  2HV2 A;  5LYL A;  3KGQ A;  3N7Z A;  4CGM A;  5LRJ A;  1Y7E A;  2P6G A;  2ZEG A;  5KTD A;  4DNC A;  2Z10 A;  2DEA A;  1OZP A;  1VHO A;  4P4D A;  4KOT A;  5K8O A;  4QB9 A;  2PJC A;  1RTQ A;  3F8K A;  1WK4 A;  2PE3 A;  4KOY A;  3TT2 A;  4H89 A;  4B5P B;  3KQX A;  4MHZ A;  5AG7 A;  4KOV A;  3JVN A;  2ZEL A;  4C2Z A;  4PSX A;  4C7H A;  3R9F A;  2BUE A;  1Z5R A;  1MJB A;  1Q2Y A;  1XIX A;  4PXE A;  2WPW A;  4DJL A;  2I00 A;  4PQA A;  1TXR A;  4PXB A;  2XEF A;  1Y9K A;  5EMI A;  1FT7 A;  1MJ9 A;  4A33 A;  1OBR A;  2PIZ A;  3CXP A;  1ZLI A;  4AG9 A;  2PSW A;  1BPM A;  4P6Y A;  4A94 A;  4KOW A;  1KUX A;  5JM6 A;  4QUS A;  3D7F A;  2O28 A;  4F9V A;  1TF9 A;  1HDU A;  4UF4 A;  4H6U A;  4EWT A;  5JGF A;  1LAM A;  2O4H A;  4M6I A;  5CPA A;  3DDD A;  4G1P A;  3D8P A;  3NH8 A;  2PJ0 A;  1X10 A;  5K8P A;  4OIW A;  4NGM A;  2FE7 A;  1XRY A;  2Q0Y A;  4Q38 A;  1NE9 A;  3FB3 A;  3FNC A;  3IEH A;  3KAS A;  1S7N A;  2JEV A;  4WWV A;  1XMB A;  2Z11 A;  4OC3 A;  3SJG A;  3D7D A;  4C2X A;  4UCM A;  2B58 A;  2ARH A;  2VBQ A;  2REE A;  2PJ2 A;  1M4I A;  2V77 A;  3PEI A;  3QAH A;  3VAT A;  2JEW A;  2OZU A;  4UA3 A;  3FYN A;  2PJ4 A;  2PJ3 A;  4QC6 A;  3WR7 A;  4NGQ A;  4J3G A;  2QML A;  3GLJ A;  3PBB A;  3TCV A;  2J8R A;  5EBV A;  3KZW A;  2EWB A;  4B12 A;  4RI1 A;  3IIB A;  3RNZ A;  4TWE A;  4HNY B;  5HVG A;  1FNO A;  1BLL E;  1N71 A;  2J8M A;  2WUU A;  4ZBG A;  3WC7 A;  4WJB A;  4GS4 A;  1A2Z A;  1YR0 A;  1M4G A;  4OAE A;  1XEB A;  4PXD A;  4E8O A;  2P6E A;  2Q4V A;  3ISX A;  3PBE A;  1XBU A;  2P6F A;  1VHS A;  4FUU A;  4HKF A;  1S7L A;  2VZZ A;  5F46 A;  1XMT A;  1Z8X A;  1ELL P;  3CXS A;  4LQG A;  4IUS A;  4ZY2 A;  4PXC A;  3VWD A;  2V8D A;  1LRZ A;  1QSM A;  2BEI A;  2ZW5 A;  3TC8 A;  2POK A;  3BJ7 A;  2C1C A;  7CPA A;  5IX3 A;  5F09 A;  4U5Y A;  4B5O A;  5F47 A;  1QST A;  2CNS A;  4OP4 A;  4CGP A;  2GAN A;  2VL1 A;  1M4D A;  2NMT A;  3R9E A;  1M4L A;  3IWG A;  3MRU A;  2PDO A;  3RO0 A;  3FF3 A;  4Q7A A;  4F8Z A;  1Z8W A;  2JBK A;  2J8N A;  1CJW A;  2PJ1 A;  3PZJ A;  4X8I A;  4A32 A;  4NF1 A;  2CF4 A;  4XPL A;  2FS5 A;  3NH5 A;  2JDC A;  4MMO A;  3B8G A;  4KUB A;  4ZX9 A;  3I3G A;  5J8C A;  4CYO A;  2Z3L A;  1I21 A;  2B3U A;  1CBX A;  4NGP A;  4AB7 A;  2ZW6 A;  1BO4 A;  1VGY A;  1IU8 A;  3BI0 A;  3IC1 A;  1GYT A;  1IID A;  3EY5 A;  3FMC A;  4I49 A;  2OB0 A;  1AMP A;  4OC0 A;  3F0A A;  2V8G A;  3HLP A;  4MFJ A;  2PJ7 A;  4B14 A;  4CAV A;  2CNT A;  5G1Z A;  1S60 A;  2D4O A;  2Q7S A;  2FIA A;  4NJR A;  1AYE A;  4OC2 A;  4QVT A;  4FAI A;  3TE4 A;  2ZOF A;  1ZG7 A;  1Z9U A;  4KSI A;  3TFY A;  1TKJ A;  1YQE A;  4F9U A;  3CT9 A;  1PCA A;  4B5P A;  4ZYQ A;  3R9G A;  4NJQ A;  2Q4Y A;  2JLM A;  4JYW A;  4P4J A;  1MK4 A;  4MHN A;  1M1D A;  2ZEM A;  4MCR A;  2ZXV A;  2C27 A;  4AVA A;  4AXV A;  1XJO A;  2BOA A;  4IHM A;  4PPZ A;  2QEC A;  3F5B A;  3PFO A;  3VWE A;  2ZW7 A;  3K9T A;  4KVM E;  1M44 A;  3SXN A;  2JDD A;  1YW6 A;  3N5F A;  4KZT A;  4XPK A;  5AGE A;  3MGD A;  1BAV A;  4LUA A;  2CY2 A;  5A27 A;  4F0Y A;  5I0C A;  2PC1 A;  4YU9 A;  4PK3 A;  1IOI A;  4HNX B;  5E96 A;  1BOB A;  3KHX A;  5FVJ A;  4R3K A;  2PJ9 A;  2CXA A;  1Q7L A;  1LOK A;  2FSR A;  3ZZI A;  3KHZ A;  3TOA A;  3S6K A;  2G0B A;  5HH1 A;  3DR8 A;  3CZX A;  2AE6 A;  1X12 A;  5HVF A;  4E2A A;  1K4J A;  1ARM A;  3IJ3 A;  3B3C A;  3G8W A;  3R1K A;  3C26 A;  2RFH A;  4F0X A;  3VH9 A;  2DPS A;  3GUX A;  3KR4 A;  4UIA A;  1Z4E A;  5KTC A;  4R3L A;  5DS0 A;  3S6H A;  2Z3O A;  4R9M A;  4YWY A;  1CP6 A;  3IGR A;  5IB9 A;  3KKW A;  1F57 A;  2ANP A;  1QQ9 A;  5C82 A;  4MHD A;  4L8A A;  1QSO A;  1S3Z A;  2Q44 A;  2XEJ A;  2Y0M A;  3WC6 A;  2BL1 A;  1RO5 A;  2Z3P A;  1QMU A;  5JH9 A;  4X3R A;  2NSM A;  1MJA A;  3PB7 X;  1PYT B;  2BO9 A;  2PIY A;  2ZW4 A;  5G21 A;  1B87 A;  4OLL A;  1YX0 A;  4MJ8 A;  3MN8 A;  4CAE A;  4MHY A;  4FD7 A;  4C68 A;  2AFX A;  4BMH A;  1IGB A;  2GLF A;  3H8E A;  3B2Y A;  2V8H A;  4MRI A;  1R3N A;  4OAD A;  3W91 A;  1YW4 A;  4DYO A;  3BI1 A;  3GKR A;  3DSB A;  1ARL A;  1LFW A;  4GM5 A;  3FRM A;  3H8G A;  4XPD B;  1YME A;  3S9N A;  4NGT A;  4XNH B;  3KL9 A;  5EC4 A;  4A95 A;  4CYQ A;  2R98 A;  5A28 A;  2OR4 A;  2VI7 A;  4U9Y A;  3SI2 A;  2VQY A;  4Y49 C;  2QIR A;  2O53 A;  2B5G A;  4UFV A;  3BLN A;  2OZH A;  2IJZ A;  4B11 A;  5LRK A;  1XE4 A;  3LD2 A;  3S9L A;  4RUH A;  4HPS A;  4EME A;  4MFL A;  3S6G A;  4JZ0 A;  1YLE A;  2G3A A;  2R8V A;  5HVH A;  1YVK A;  2FVG A;  3ISZ A;  4PV6 A;  2RC4 A;  1GHE A;  2Z0Z A;  4MCQ A;  4OC4 A;  1UFH A;  4R6T A;  5ISV A;  2ZPA A;  3I9S A;  1IIC A;  5I4M A;  4W9Y A;  1P4N A;  1YK3 A;  2Z3M A;  2Q51 A;  2ZEP A;  3EO4 A;  4LX9 A;  1YLO A;  4MY0 A;  3UY5 A;  4PK2 A;  1RXT A;  2HB6 A;  1I12 A;  1TKF A;  2H5M A;  3P2H A;  4HNW B;  2G3T A;  3D2M A;  3WC5 A;  2GIV A;  3B35 A;  1QSR A;  1L0C A;  3TO9 A;  4ZI6 A;  2EUI A;  4P4I A;  4OC1 A;  4UEZ A;  2BSW A;  4YFJ A;  4KOR A;  4ZY0 A;  1FY7 A;  1VKC A;  1HEE A;  4FD5 A;  5JPH A;  1NSA A;  3PB9 X;  5AG5 A;  3RBU A;  2EBJ A;  3CPA A;  3CXQ A;  2YND A;  3HUV A;  4MCP A;  1NSL A;  3NH4 A;  4JJX A;  1CP7 A;  2ZEF A;  4ONW A;  4B13 A;  4AG7 A;  3GYA A;  4CS0 B;  2WSA A;  2HQY A;  2G9D A;  3IO1 A;  3K2K A;  3NFZ A;  4CYN A;  2Z3N A;  1VHE A;  1Y7R A;  3PRT A;  5C88 A;  4QBJ A;  4ORF A;  4R87 A;  3W6X A;  4MFQ A;  2IL4 A;  2EVN A;  3SJE A;  5H86 A;  3V38 A;  4Z65 A;  2KCW A;  2Q7B A;  1Y9W A;  2PCU A; 
#chains in the Genus database with same CATH homology
 3R96 A;  4C2Y A;  1TIQ A;  4RS2 A;  4NCZ A;  2K5T A;  4JXQ A;  2X7B A;  4K30 A;  1YVO A;  3JUW A;  1SQH A;  3A9L A;  4II9 A;  1V0C A;  4C7I A;  4M3S A;  4UCN A;  2WPX A;  4FD6 A;  3IWE A;  5G20 A;  2HUZ A;  1Z4R A;  2B4B A;  4MFZ A;  5KTA A;  5JQ4 A;  2DXQ A;  3PP9 A;  4JD6 A;  4JWP A;  3TE4 A;  3RYO A;  1Q2C A;  4KVO E;  4KSA A;  2DPT A;  1S5K A;  2FCK A;  3QB8 A;  4UFW A;  3DR6 A;  1IB1 E;  5IB0 A;  4CAW A;  2REF A;  2P0W A;  4KS9 A;  5IV0 A;  4AVB A;  1B6B A;  2VZY A;  3TO6 A;  2ATR A;  1KUV A;  3V8I A;  3FIX A;  2AJ6 A;  4KOX A;  4JLY A;  2Q04 A;  4UBR A;  4CGO A;  4IF5 A;  1IYL A;  3T9Y A;  1Q2D A;  1ON0 A;  2OH1 A;  4R57 A;  1YRE A;  5F48 A;  4KOS A;  4CRY B;  2VEZ A;  1S7F A;  4XNH C;  1S7K A;  3TTH A;  4EVY A;  4CYP A;  4Y49 B;  1U6M A;  2PR1 A;  4YRH A;  5J8F A;  1KUY A;  3EXN A;  3G3S A;  4KUA A;  1PUA A;  1CM0 A;  2OU2 A;  3SHP A;  2D4P A;  2B3V A;  4L89 A;  4MI4 A;  4PSW A;  1ZO0 A;  1YGH A;  5HMN A;  4MY3 A;  2B4D B;  5F49 A;  5DWM A;  2B4D A;  3R95 A;  5BWA B;  2YNC C;  2PR8 A;  3OWC A;  4NSQ A;  3GY9 A;  3P2F A;  4KOU A;  4A31 A;  4UCP A;  2FXF A;  3LOD A;  4A30 A;  4F6A A;  2YGW A;  2R1I A;  4MFP A;  2OZG A;  4KSF A;  3DNS A;  1WWZ A;  4ONU A;  4JXR A;  1KZF A;  3NE7 A;  2FIW A;  3IU1 A;  4KLV A;  2A4N A;  3ZJ0 A;  4A2Z A;  3E0K A;  1XF8 A;  2F5I A;  2YNE A;  4XPD C;  5AG6 A;  3S6F A;  2Z3K A;  2B5G B;  3K9U A;  1J4J A;  4CGL A;  3TOB A;  5G22 A;  4X5K A;  3SXO A;  4Q36 A;  3TO7 A;  1IYK A;  2FL4 A;  5DWN A;  3D3S A;  4YGO A;  1PU9 A;  4CAX A;  4ZGY B;  3H4Q A;  5CNP A;  1NMT A;  3EFA A;  1I1D A;  4E0A A;  4NXY A;  1R57 A;  4B10 A;  3PGP A;  4KVX A;  4AVC A;  4U9Z A;  5H84 A;  3FBU A;  3T90 A;  4UWI A;  4FD4 A;  4H6Z A;  4M85 A;  1P0H A;  2FT0 A;  3H5Z A;  2R7H A;  3JTK A;  3EC4 A;  2YNC A;  3D2P A;  3FXT A;  3IU2 A;  2I79 A;  4KLW A;  5GCN A;  4BBH A;  4MBU A;  2GE3 A;  4UFX A;  4CRZ B;  2PQ8 A;  4CGN A;  5AG4 A;  4UWJ A;  4CAF A;  2PRB A;  3BJ8 A;  3W6S A;  4NEX A;  2CNM A;  4MFK A;  1QSN A;  2VXK A;  2HV2 A;  3N7Z A;  4CGM A;  2P6G A;  5KTD A;  4DNC A;  2Z10 A;  1OZP A;  4KOT A;  4QB9 A;  3F8K A;  4KOY A;  1WK4 A;  3TT2 A;  4H89 A;  4B5P B;  5AG7 A;  4KOV A;  3JVN A;  4C2Z A;  4PSX A;  4C7H A;  3R9F A;  2BUE A;  1MJB A;  1Q2Y A;  1XIX A;  2WPW A;  2I00 A;  1Y9K A;  1MJ9 A;  4A33 A;  3CXP A;  4AG9 A;  2PSW A;  4KOW A;  1KUX A;  4QUS A;  2O28 A;  4H6U A;  3DDD A;  3D8P A;  2FE7 A;  2Q0Y A;  4Q38 A;  1NE9 A;  3FB3 A;  3FNC A;  1S7N A;  2JEV A;  2Z11 A;  4C2X A;  4UCM A;  2B58 A;  2ARH A;  2VBQ A;  2REE A;  3QAH A;  1M4I A;  2OZU A;  4UA3 A;  3FYN A;  4QC6 A;  3WR7 A;  4J3G A;  2QML A;  3TCV A;  2J8R A;  5EBV A;  4B12 A;  4RI1 A;  4HNY B;  1N71 A;  2J8M A;  2WUU A;  4ZBG A;  4GS4 A;  1YR0 A;  1M4G A;  4OAE A;  1XEB A;  4E8O A;  2P6E A;  2Q4V A;  2P6F A;  1VHS A;  4HKF A;  1S7L A;  2VZZ A;  5F46 A;  1XMT A;  3CXS A;  4IUS A;  3VWD A;  1LRZ A;  1QSM A;  2BEI A;  2ZW5 A;  5IX3 A;  3BJ7 A;  4U5Y A;  4B5O A;  5F47 A;  1QST A;  2CNS A;  4CGP A;  2GAN A;  1M4D A;  2NMT A;  3R9E A;  3IWG A;  2PDO A;  3PZJ A;  2J8N A;  1CJW A;  4A32 A;  4NF1 A;  4XPL A;  2FS5 A;  2JDC A;  3B8G A;  4KUB A;  3I3G A;  5J8C A;  4CYO A;  2Z3L A;  1I21 A;  2B3U A;  4AB7 A;  2ZW6 A;  1BO4 A;  4I49 A;  1IID A;  3EY5 A;  2OB0 A;  3F0A A;  4MFJ A;  4B14 A;  4CAV A;  2CNT A;  5G1Z A;  1S60 A;  2D4O A;  4QVT A;  2FIA A;  3TFY A;  1Z9U A;  4B5P A;  3R9G A;  2Q4Y A;  2JLM A;  1MK4 A;  1M1D A;  2ZXV A;  2C27 A;  4AVA A;  2QEC A;  3F5B A;  3VWE A;  2ZW7 A;  4KVM E;  1M44 A;  3SXN A;  2JDD A;  4KZT A;  4XPK A;  5AGE A;  4LUA A;  3MGD A;  5A27 A;  2CY2 A;  4F0Y A;  5I0C A;  2PC1 A;  4PK3 A;  4HNX B;  5E96 A;  1BOB A;  5FVJ A;  4R3K A;  2CXA A;  3ZZI A;  2FSR A;  3TOA A;  3S6K A;  2G0B A;  5HH1 A;  3DR8 A;  2AE6 A;  4E2A A;  1K4J A;  3G8W A;  3R1K A;  3C26 A;  4F0X A;  2DPS A;  5KTC A;  1Z4E A;  4R3L A;  3S6H A;  2Z3O A;  4R9M A;  3IGR A;  3KKW A;  5C82 A;  4MHD A;  4L8A A;  1QSO A;  1S3Z A;  2Q44 A;  2Y0M A;  2BL1 A;  1RO5 A;  2Z3P A;  1MJA A;  5G21 A;  2ZW4 A;  1B87 A;  4OLL A;  1YX0 A;  4MJ8 A;  4CAE A;  4FD7 A;  4C68 A;  4BMH A;  4OAD A;  3W91 A;  3GKR A;  3DSB A;  3FRM A;  4XPD B;  4XNH B;  5EC4 A;  4A95 A;  4CYQ A;  2R98 A;  5A28 A;  2VI7 A;  4U9Y A;  2VQY A;  4Y49 C;  2QIR A;  2B5G A;  4UFV A;  3BLN A;  2OZH A;  4B11 A;  1XE4 A;  3LD2 A;  4MFL A;  3S6G A;  1YLE A;  2G3A A;  2R8V A;  1YVK A;  4PV6 A;  2RC4 A;  1GHE A;  2Z0Z A;  1UFH A;  5ISV A;  2ZPA A;  3I9S A;  1IIC A;  1P4N A;  1YK3 A;  2Z3M A;  3EO4 A;  4LX9 A;  3UY5 A;  4MY0 A;  4PK2 A;  1RXT A;  1I12 A;  2H5M A;  3P2H A;  4HNW B;  2G3T A;  3D2M A;  2GIV A;  3TO9 A;  1QSR A;  1L0C A;  2EUI A;  2BSW A;  4YFJ A;  4KOR A;  1FY7 A;  1VKC A;  4FD5 A;  5JPH A;  5AG5 A;  3CXQ A;  2YND A;  1NSL A;  4JJX A;  4B13 A;  4AG7 A;  3GYA A;  4CS0 B;  2WSA A;  2HQY A;  4CYN A;  2Z3N A;  5C88 A;  1Y7R A;  4QBJ A;  4ORF A;  4R87 A;  3W6X A;  4MFQ A;  2IL4 A;  2EVN A;  5H86 A;  2KCW A;  2Q7B A;  1Y9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...