5F47A

Crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample in complex with trehalose
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
151
structure length
151
Chain Sequence
IDNFLKIERLAENDLPKFIQLIRLFEAVFEMKNFSIPDSEHLQKLLNQNNFYVFVALLENKIVGGLTSYVLEQYYSEKPLAYIYDLAVDTNWQRQGIGKKLITATNQFYTEKGFEEVFVQADKVDDYALDFYRSTKPTAEEQVVHFYYTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aminoglycoside acetyltransferase meta-AAC0020
publication title Structural and Functional Survey of Environmental Aminoglycoside Acetyltransferases Reveals Functionality of Resistance Enzymes.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Transferase
total genus 36
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5f47A00
2NMTA 2ARHA 2VXKA 4OAEA 2VI7A 4X5KA 2PR1A 5KTCA 1ON0A 4NEXA 4IF5A 3PGPA 2PDOA 1Y9WA 4JJXA 4HNWB 1NE9A 1GHEA 3C26A 1BOBA 1I1DA 1KUVA 2B3UA 3DDDA 3I3GA 2Z10A 2FXFA 2CNSA 3TFYA 1M4DA 4KLWA 1RXTA 1IYKA 4LX9A 2P6EA 4KZTA 3MGDA 4RI1A 1Q2DA 3FBUA 2ZW4A 3R1KA 3BJ7A 4ZBGA 4CRZB 4EVYA 4R87A 4XPLA 1QSMA 2OZGA 2ZXVA 3DR6A 3FNCA 5HH1A 4KUAA 2B4DB 4HNYB 2OZUA 3DNSA 2OB0A 4M85A 5C82A 4J3GA 2REEA 1M4IA 3LODA 1WK4A 2BUEA 3F8KA 2BSWA 4KOYA 3H4QA 1XEBA 2REFA 4AVBA 4JD6A 3ZZIA 3BJ8A 3I9SA 3GKRA 2G3TA 4YGOA 2P6FA 1YR0A 1QSRA 4F6AA 3T9YA 4MHDA 2B4DA 3TOBA 4QC6A 1QSTA 4DNCA 4U5YA 4HNXB 5F48A 2FS5A 4JXRA 4KVME 5GCNA 4R3KA 4KOWA 3K9UA 5ISVA 3EY5A 1IIDA 4R9MA 4MI4A 3S6GA 4AG7A 3FIXA 4R3LA 5JQ4A 3EFAA 4L8AA 2IL4A 5KTAA 2B58A 4FD4A 4ORFA 1B6BA 2C27A 2FIWA 2G0BA 2CY2A 1XIXA 2J8MA 3FYNA 2FCKA 4R57A 4OADA 2B5GB 2Q04A 4E2AA 4KOTA 2VEZA 1S5KA 1VKCA 5EBVA 2Q4VA 1PU9A 2QIRA 1L0CA 4CAXA 2JEVA 3D3SA 4NF1A 4UBRA 1Q2CA 3S6HA 3P2FA 1KZFA 4KVOE 1XMTA 2PRBA 1K4JA 3TO7A 5FVJA 3V8IA 4MBUA 2QECA 4LUAA 2AE6A 4OLLA 5KTDA 4NCZA 3N7ZA 3T90A 2B5GA 3QB8A 3R9GA 3TCVA 2A4NA 5H86A 2RC4A 1P0HA 2VQYA 4GS4A 3R9FA 1I12A 4L89A 3G8WA 4PSXA 1YX0A 3IGRA 4PK3A 5J8FA 2BEIA 2FL4A 4KOUA 1CM0A 4AB7A 4U9YA 2VZYA 5H84A 2Q4YA 4CAVA 2ATRA 2F5IA 1S3ZA 1S7NA 3PZJA 1LRZA 2Q0YA 4XPDC 1BO4A 2JDCA 2D4PA 3CXSA 2EVNA 3KKWA 1Z4RA 3B8GA 1YLEA 5JPHA 4XPDB 4MY0A 1MJAA 2OZHA 2B4BA 1Y7RA 1KUXA 1J4JA 1XE4A 3RYOA 1YGHA 4PV6A 1UFHA 2OU2A 3W6XA 3SXOA 2JLMA 4KOSA 2R8VA 1SQHA 1YK3A 1RO5A 5F49A 3EC4A 3GY9A 2FIAA 4H89A 3FB3A 4U9ZA 3VWDA 2Q7BA 1P4NA 3EXNA 5DWNA 3VWEA 4B5PB 2R1IA 3ZJ0A 4KVXA 2BL1A 4MJ8A 2HUZA 3SXNA 4BMHA 3S6KA 3G3SA 2VZZA 1M1DA 2I79A 4AVAA 4UA3A 5IX3A 2HV2A 2P0WA 1Z9UA 3LD2A 3SHPA 3WR7A 1V0CA 4K30A 1IYLA 1NSLA 4FD5A 2Y0MA 2FE7A 2KCWA 3IWGA 5I0CA 3D8PA 2B3VA 1YVOA 1VHSA 2CNMA 3W91A 2CNTA 4B5PA 1S7LA 3R96A 3DSBA 3S6FA 3FRMA 2Z0ZA 3CXPA 3OWCA 3EO4A 4HKFA 3UY5A 4F0YA 1PUAA 4B5OA 2J8NA 5DWMA 4YFJA 1S7KA 4YRHA 1YVKA 3GYAA 1MK4A 5IB0A 2G3AA 4JXQA 3D2MA 4NSQA 4UWJA 4FD7A 2PC1A 2VBQA 4KOXA 3CXQA 1KUYA 1R57A 3QAHA 4KUBA 4AG9A 3TOAA 2ZPAA 3DR8A 2JDDA 2HQYA 3JUWA 5F47A 1QSNA 4II9A 1Z4EA 3TO6A 4CRYB 4E8OA 2GIVA 2ZW7A 3F5BA 4PK2A 5E96A 2FT0A 4FD6A 4H6UA 1S60A 2FSRA 1IICA 2AJ6A 2PQ8A 2I00A 1FY7A 4MY3A 5HMNA 2GE3A 4I49A 1M4GA 1S7FA 2J8RA 3FXTA 1M44A 2PSWA 1QSOA 1TIQA 4XPKA 2WPWA 5F46A 4PSWA 3PP9A 2X7BA 2QMLA 2ZW6A 4H6ZA 4JWPA 5C88A 1IB1E 4QB9A 1Q2YA 4KORA 4UWIA 4NXYA 4Y49C 2Q44A 1I21A 2GANA 3W6SA 4CAWA 3NE7A 3D2PA 2K5TA 2ZW5A 1N71A 4JLYA 1NMTA 4QUSA 2Z11A 1MJBA 4Y49B 1Y9KA 1WWZA 4RS2A 4E0AA 2WPXA 4IUSA 4M3SA 1MJ9A 2EUIA 3P2HA 4QVTA 4KLVA 2DXQA 1CJWA 5J8CA 5CNPA 3JVNA 1OZPA 3R95A 2O28A 2R98A 3E0KA 3F0AA 5EC4A 1B87A 1YREA 4XNHC 1U6MA 3TO9A 4KOVA 2H5MA 5IV0A 4AVCA 3R9EA 4QBJA 4XNHB 2PR8A 3TT2A 4CS0B 1XF8A 2OH1A 2R7HA 4ONUA 2P6GA 3BLNA 3TTHA 2D4OA 3TE4A
chains in the Genus database with same CATH superfamily
2NMTA 2ARHA 1TKHA 2GLJA 2VXKA 4MXUA 1ZLIA 2C6CA 2VI7A 3BHXA 4MHYA 4OAEA 2O4HA 4OMEA 4OC4A 4X5KA 4B14A 4OIWA 2PVVA 2PR1A 5KTCA 4F9UA 4IHMA 3TX8A 3IIBA 2G9DA 1ON0A 2O53A 2Z3MA 2DEAA 4NEXA 4IF5A 3PGPA 2PDOA 2AFSA 1XBUA 1YW4A 2C6PA 2Z3LA 1Y9WA 4X8IA 4JJXA 4Z65A 2F8HA 4UCPA 3S9NA 4OKOA 1ARMA 4HNWB 1NE9A 4W9YA 1GHEA 2PJ1A 5IB9A 3C26A 1BOBA 3NFZA 4C7IA 3LWUA 3IWWA 4OC2A 1I1DA 4P4FA 2YGWA 2V8GA 4ZI6A 1HDUA 1KUVA 2B3UA 4A94A 3DDDA 3I3GA 2XEGA 2I3CA 2Z10A 2FXFA 2PJ2A 4JYWA 1VGYA 2Z3PA 2C6GA 3FEDA 4P4IA 2CNSA 3TFYA 1M4DA 4KLWA 4P4JA 1RXTA 1IYKA 3B3SA 4LX9A 5LYFA 2P6EA 4KZTA 3IO1A 2V8VA 4CGOA 4KSFA 4CGNA 2XEJA 1CBXA 1TKFA 3VATA 1CX8A 3MGDA 1Q2DA 4RI1A 3KQXA 4ONWA 3MRUA 1Y7EA 3FBUA 3TC8A 2ZW4A 3RZAA 4NGSA 3GUXA 4H2KA 1CP6A 3D7DA 4NJRA 4NGNA 4DJLA 3R1KA 3BJ7A 2RFHA 3B7IA 4CAEA 1YSJA 2Q4ZA 4Q36A 4ZBGA 2VL1A 3QAYA 4CRZB 4EVYA 4R87A 4X3RA 3FVLA 5K8NA 3FH4A 3K2KA 4XPLA 1QSMA 1KWMA 4YU9A 2NSMA 1X12A 2OZGA 2ZXVA 3DR6A 3FNCA 5HH1A 2PJ8A 3SJXA 4FWUA 4KUAA 2B4DB 2JBJA 2ZEOA 4HNYB 4B10A 2OZUA 3DNSA 2OB0A 4M85A 4UIBA 5C82A 1LFWA 4J3GA 2REEA 4CYQA 1LAPA 1M4IA 2Z3OA 3IU1A 3LODA 5HXDA 2ABZA 2PJ4A 1WK4A 1M4LA 5LYDA 2BUEA 3F8KA 3CPAA 2BSWA 4ZX9A 2AFMA 1ELMP 3NH8A 4KOYA 4JZ0A 3H4QA 4WWVA 1XEBA 2REFA 4AVBA 4JD6A 3ZZIA 1JQGA 3BJ8A 4MRIA 3RO0A 3I9SA 3GKRA 2G3TA 1H8LA 1R43A 4YGOA 2P6FA 3D68A 1YR0A 2DPTA 3K9TA 1AUGA 1QSRA 2FVGA 4P44A 4F6AA 3T9YA 4A31A 4MHDA 2B4DA 3TOBA 4QC6A 4A2ZA 1QSTA 4EWTA 5K8MA 3IJ3A 3PB7X 4MHPA 1DE4C 4C68A 4U5YA 4DNCA 1EE3P 4HNXB 5F48A 2FS5A 2J9AA 3GIUA 4JXRA 4KVME 3CT9A 4UFXA 3SJGA 4MMOA 2PJAA 5GCNA 4R3KA 4KOWA 1X10A 3K9UA 3KZWA 5ISVA 4UF4A 3EY5A 2QJ8A 1IIDA 2AFZA 3LMSA 4R9MA 5I4MA 5ELYA 4MI4A 3S6GA 4AG7A 3T8WA 4PXDA 3SI2A 4A37A 3FIXA 1VHEA 1UWYA 4R3LA 2BO9A 1Y0RA 5JQ4A 2C1CA 1CPSA 2V8DA 3WABA 1NSAA 2ODFA 5J1QA 3EFAA 3CDXA 3CZXA 4L8AA 2ZENA 2IL4A 4UEZA 2ZELA 4KSIA 2CF4A 5KTAA 2B58A 3B35A 2IMOA 3FX6A 2ZEGA 4FD4A 4NFRA 4ORFA 1HDQA 3IFEA 1B6BA 4B12A 2C27A 1AMPA 2FIWA 1ZO0A 2G0BA 3V7ZA 2CTCA 1PCAA 2CY2A 2Z3NA 1R3NA 1XIXA 2J8MA 3FYNA 4UCMA 3D66A 3NH4A 4NGPA 5G20A 2FCKA 4MCSA 2OR4A 4P45A 4OADA 4R57A 2B5GB 2Q04A 4ZYQA 4E2AA 5CBMA 3S9LA 4M6HA 4NJQA 4KOTA 1QMUA 4MHNA 2VEZA 2CXAA 2ANPA 4K3NA 1S5KA 1VKCA 5EBVA 3WC6A 4CYNA 2Q4VA 1PU9A 2IJZA 1L0CA 2QIRA 2PJ0A 4CAXA 1CP7A 2JEVA 4NGRA 3D3SA 4NF1A 4UBRA 1A2ZA 1Q2CA 3S6HA 3ISZA 3P2FA 4A32A 1KZFA 1Z2LA 4P4EA 2ZOFA 4KVOE 1XMTA 4O23A 3BI0A 2EK9A 1K4JA 2PRBA 3D4UA 3H8GA 3TO7A 4C2XA 1Z8LA 5FVJA 4ZY2A 3V8IA 3IC1A 4MBUA 5LRKA 3VH9A 2PJ9A 2QECA 4LUAA 2WUUA 2AE6A 2ZEFA 4OLLA 4NCZA 5KTDA 3N7ZA 3BXMA 3T90A 2B5GA 4BD9A 5JH9A 3QB8A 3R9GA 3TCVA 3FEEA 3HLPA 2A4NA 5LYIA 5H86A 1IOIA 1BPNA 2RC4A 1P0HA 4B13A 3CPXA 5THWA 2VQYA 4GS4A 4LQ6A 3R9FA 3BI1A 4DUKA 3A9LA 1I12A 4UFVA 4L89A 3G8WA 3LACA 1YX0A 4PSXA 1Z8WA 4F0XA 2GU2A 4P4BA 2DPSA 2WYRA 3IGRA 3SJFA 4PK3A 5J8FA 2BEIA 2ZEEA 1LCPA 4ZGYB 3TE4A 2FL4A 4Q38A 2DF5A 4KOUA 1CM0A 4AB7A 1OBRA 3IEHA 2PCUA 1LAMA 4U9YA 3DLJA 5K8PA 2VZYA 5H84A 2Q4YA 4CAVA 3B3TA 2ATRA 4PXEA 2F5IA 4GXHA 5F09A 3PBEA 1S3ZA 1S7NA 2XEIA 2HC9A 3PZJA 4NGTA 1LRZA 2Q0YA 4XPDC 4ZY1A 3MN8A 1BO4A 2JDCA 2D4PA 2ZEPA 3CXSA 2EVNA 1YW6A 3KKWA 5EMIA 4OC3A 1Z4RA 1ZLHA 4OIDA 3RAMA 7CPAA 3PB8X 3RBUA 4RUHA 3B8GA 4A33A 1YLEA 3FECA 2PRQA 5JPHA 4XPDB 4MY0A 8CPAA 1VHOA 3V38A 1MJAA 2OZHA 2B4BA 1Y7RA 1KUXA 1J4JA 2AFWA 1XE4A 3RYOA 5CPAA 3QNVA 2EK8A 1YGHA 4ZY0A 4PV6A 1UFHA 2CTBA 2WSAA 2OU2A 3W6XA 1BAVA 4F8ZA 4MFPA 3SXOA 1HEEA 2JLMA 4KOSA 4MFQA 4UFWA 4C2ZA 2Z3KA 2R8VA 1SQHA 2HB6A 1YK3A 3JTKA 3WC7A 4MCQA 2YNEA 1RO5A 5F49A 3EC4A 3GY9A 4NGQA 2FIAA 4H89A 2GLFA 3FB3A 1XMBA 2Q43A 4U9ZA 1Z8XA 3VWDA 4CAFA 4IAVA 1TF8A 2Q7BA 3H8FA 1F57A 1P4NA 3S9MA 4C2YA 4CGMA 4NGMA 3EXNA 5DWNA 3VWEA 4B5PB 3WC5A 2R1IA 5G1ZA 3ZJ0A 1TXRA 4KVXA 2BL1A 4MJ8A 2HUZA 3SXNA 4BMHA 3S6KA 3I1UA 3D7HA 3G3SA 2VZZA 5DS0A 1M1DA 2I79A 4AVAA 4UA3A 5AG5A 1FNOA 5IX3A 2HV2A 1XRYA 2P0WA 2V8HA 2YNCC 3B3WA 1Z9UA 3GB0A 1Y0YA 3LD2A 2Q51A 3KR4A 3SHPA 1V0CA 4K30A 3WR7A 1IYLA 2QYVA 4EMEA 4GM5A 4UEFA 1NSLA 3PB9X 2Y0MA 2FE7A 4FD5A 2KCWA 4PXCA 3IWGA 4EFDA 5I0CA 1ZG8A 3D8PA 4CGLA 1AYEA 4PQAA 4F9VA 4CYOA 2B3VA 3IU2A 1YVOA 2CIJA 2PJ7A 1VHSA 2CNMA 3PEIA 4UIAA 5HVFA 3W91A 2CNTA 4B5PA 3KQZA 1IU8A 3PFEA 4CPAA 1LOKA 1S7LA 4R7MA 3NH5A 3R96A 3DSBA 1YQEA 3S6FA 3KR5A 3PBBA 3KGQA 1XJOA 2PJ3A 3FRMA 2PJ6A 2Z0ZA 4C7HA 1CPXA 3CXPA 5D8NA 3OWCA 3EO4A 4OC5A 4M6GA 2EO8A 4HKFA 3UY5A 4F0YA 1PUAA 2EBJA 4P10A 1FT7A 2BOAA 4B5OA 3D7GA 2J8NA 2YNCA 4OP4A 5DWMA 4HPSA 4YFJA 1S7KA 1DTDA 4YRHA 4ZX8A 1YVKA 4R6TA 3GYAA 1MK4A 5BWAB 2XEFA 5IB0A 2G3AA 4JXQA 1PYTB 4BBHA 4KSAA 5JGFA 3D2MA 4NSQA 4UWJA 5AG7A 2PJBA 4FD7A 3B3VA 5LRGA 2PC1A 1VIXA 4WJBA 2VBQA 4KOXA 3CXQA 1QQ9A 1KUYA 3JRUA 1R57A 3QAHA 4KUBA 4MFLA 4R8FA 4TWEA 4AG9A 3TOAA 4MCPA 2ZPAA 4LQGA 5AGEA 2RB7A 2AFXA 3DR8A 3SI1A 2JDDA 2HQYA 4OC1A 1IOFA 1TKJA 1TF9A 2PVWA 2WZNA 3JUWA 4G1PA 5F47A 1QSNA 5A28A 2V77A 4II9A 1Z4EA 3TO6A 4CRYB 4E8OA 2AFUA 2GIVA 5LYLA 2AFOA 2ZW7A 3F5BA 3RNZA 2EWBA 2JBKA 4PPZA 4PK2A 4FUUA 4UEEA 5E96A 2QVPA 3FF3A 3KI9A 2FT0A 4FD6A 4H6UA 4FBEA 1S60A 2FSRA 1IICA 2IQ6A 3ISXA 4MCRA 2AJ6A 4OC0A 3H8EA 2PQ8A 2I00A 1FY7A 4MY3A 4P6YA 5HMNA 2GE3A 4I49A 1M4GA 1Q7LA 5A27A 1S7FA 4PXBA 2J8RA 3VARA 4FAIA 3PRTA 4BINA 3FXTA 1M44A 3KL9A 2PSWA 1XFOA 2F7VA 5HVHA 1XOVA 1QSOA 1TIQA 4IK2A 1JWQA 2BCOA 4XPKA 2OOTA 4B11A 5AG6A 3N5FA 1ZG9A 2PJ5A 2WPWA 5F46A 4PSWA 2PIYA 3D67A 4MFJA 3B2YA 3PP9A 2X7BA 2QMLA 4MFKA 2NYQA 2ZW6A 3NE8A 4H6ZA 3HUVA 4KS9A 3KHZA 4JWPA 3GLJA 5C88A 1IB1E 1YLOA 4QB9A 4RN7A 2ZEDA 1Q2YA 4KORA 4UWIA 4NXYA 1ELLP 4Y49C 2Q44A 1I21A 2GANA 3W6SA 4CAWA 5G21A 1RTQA 2GREA 2POKA 3D2PA 3NE7A 2K5TA 2ZW5A 3H5ZA 1N71A 4JLYA 1NMTA 4B6ZA 4QUSA 2Z11A 4AXVA 1BLLE 4Q7AA 1BPMA 3SJEA 1MJBA 4Y49B 1Y9KA 1WWZA 4CYPA 1Z8TA 4RS2A 4A30A 4E0AA 2WPXA 3PFOA 4IUSA 4M3SA 1MJ9A 2EUIA 4CGPA 3P2HA 4QVTA 4KLVA 4MFZA 2DXQA 1CJWA 6CPAA 3KHXA 5J8CA 4A95A 4YWYA 2ZEHA 3KASA 5AG4A 5CNPA 3JVNA 1OZPA 3NA6A 4UCNA 2PIZA 3R95A 2O28A 2Q7SA 1F2PA 1ARLA 4X2TA 5JM6A 2R98A 1IGBA 3E0KA 4A39A 3F0AA 5EC4A 1B87A 3PB6X 3DGVA 4A38A 5HVGA 1YREA 4XNHC 1U6MA 3TO9A 3D7FA 4KOVA 4DYOA 3WT4A 2H5MA 3B3CA 5IV0A 2PE3A 3PB4X 4M6IA 4TNUA 5LRJA 4AVCA 4R76A 3R9EA 5K8OA 1YMEA 4XNHB 4QBJA 1Z5RA 3SI0A 1F2OA 2YNDA 2PR8A 2PJCA 5D29A 4P4DA 3TT2A 4CS0B 1GYTA 1LANA 1XF8A 2OH1A 2ZOGA 2GFQA 2JEWA 1ZG7A 4MHZA 1CG2A 2R7HA 3FMCA 3IWEA 2P6GA 3BLNA 1IY7A 2D4OA 3L2NA 4ONUA 3FJUA 3TTHA 2ZEMA 5G22A
chains in the Genus database with same CATH topology
2NMTA 2ARHA 2VXKA 4OAEA 4B14A 2VI7A 4X5KA 2PR1A 5KTCA 1ON0A 2Z3MA 4NEXA 4IF5A 3PGPA 2PDOA 2Z3LA 1Y9WA 4JJXA 4UCPA 4HNWB 1NE9A 1GHEA 3C26A 1BOBA 4C7IA 1I1DA 2YGWA 1KUVA 2B3UA 3DDDA 3I3GA 2Z10A 2FXFA 2Z3PA 2CNSA 3TFYA 1M4DA 4KLWA 1RXTA 1IYKA 4LX9A 2P6EA 4KZTA 4CGOA 4KSFA 4CGNA 3MGDA 4RI1A 1Q2DA 3FBUA 2ZW4A 3R1KA 3BJ7A 4CAEA 4Q36A 4ZBGA 4CRZB 4EVYA 4R87A 4XPLA 1QSMA 2OZGA 2ZXVA 3DR6A 3FNCA 5HH1A 4KUAA 2B4DB 4HNYB 4B10A 2OZUA 3DNSA 2OB0A 4M85A 5C82A 4J3GA 2REEA 4CYQA 1M4IA 2Z3OA 3IU1A 3LODA 1WK4A 2BUEA 3F8KA 2BSWA 4KOYA 3H4QA 1XEBA 2REFA 4AVBA 4JD6A 3ZZIA 3BJ8A 3I9SA 3GKRA 2G3TA 4YGOA 2P6FA 1YR0A 2DPTA 1QSRA 4F6AA 3T9YA 4A31A 4MHDA 2B4DA 3TOBA 4QC6A 4A2ZA 1QSTA 4DNCA 4C68A 4U5YA 4HNXB 5F48A 2FS5A 4JXRA 4KVME 4UFXA 5GCNA 4R3KA 4KOWA 3K9UA 5ISVA 3EY5A 1IIDA 4R9MA 4MI4A 3S6GA 4AG7A 3FIXA 4R3LA 5JQ4A 3EFAA 4L8AA 2IL4A 5KTAA 2B58A 4FD4A 4ORFA 4B12A 1B6BA 2C27A 2FIWA 1ZO0A 2G0BA 2CY2A 2Z3NA 4UCMA 1XIXA 2J8MA 3FYNA 5G20A 2FCKA 4R57A 4OADA 2B5GB 2Q04A 4E2AA 4KOTA 2VEZA 2CXAA 1S5KA 1VKCA 5EBVA 4CYNA 2Q4VA 1PU9A 2QIRA 1L0CA 4CAXA 2JEVA 3D3SA 4NF1A 4UBRA 1Q2CA 3S6HA 3P2FA 4A32A 1KZFA 4KVOE 1XMTA 2PRBA 1K4JA 4C2XA 3TO7A 5FVJA 3V8IA 4MBUA 2QECA 4LUAA 2WUUA 2AE6A 4OLLA 5KTDA 4NCZA 3N7ZA 3T90A 2B5GA 3QB8A 3R9GA 3TCVA 2A4NA 5H86A 2RC4A 1P0HA 4B13A 2VQYA 4GS4A 3R9FA 3A9LA 1I12A 4UFVA 4L89A 3G8WA 4PSXA 1YX0A 4F0XA 2DPSA 3IGRA 4PK3A 5J8FA 2BEIA 4ZGYB 2FL4A 4Q38A 4KOUA 1CM0A 4AB7A 4U9YA 2VZYA 5H84A 2Q4YA 4CAVA 2ATRA 2F5IA 1S3ZA 1S7NA 3PZJA 1LRZA 2Q0YA 4XPDC 1BO4A 2JDCA 2D4PA 3CXSA 2EVNA 3KKWA 1Z4RA 3B8GA 4A33A 1YLEA 5JPHA 4XPDB 4MY0A 1MJAA 2OZHA 2B4BA 1Y7RA 1KUXA 1J4JA 1XE4A 3RYOA 1YGHA 4PV6A 1UFHA 2WSAA 2OU2A 3W6XA 4MFPA 3SXOA 2JLMA 4KOSA 4MFQA 4UFWA 4C2ZA 2Z3KA 2R8VA 1SQHA 1YK3A 3JTKA 2YNEA 1RO5A 5F49A 3EC4A 3GY9A 2FIAA 4H89A 3FB3A 4U9ZA 3VWDA 4CAFA 2Q7BA 1P4NA 4C2YA 4CGMA 3EXNA 5DWNA 3VWEA 4B5PB 2R1IA 5G1ZA 3ZJ0A 4KVXA 2BL1A 4MJ8A 2HUZA 3SXNA 4BMHA 3S6KA 3G3SA 2VZZA 1M1DA 2I79A 4AVAA 4UA3A 5AG5A 5IX3A 2HV2A 2P0WA 2YNCC 1Z9UA 3LD2A 3SHPA 3WR7A 1V0CA 4K30A 1IYLA 1NSLA 4FD5A 2Y0MA 2FE7A 2KCWA 3IWGA 5I0CA 3D8PA 4CGLA 4CYOA 2B3VA 3IU2A 1YVOA 1VHSA 2CNMA 3W91A 2CNTA 4B5PA 1S7LA 3R96A 3DSBA 3S6FA 3FRMA 2Z0ZA 4C7HA 3CXPA 3OWCA 3EO4A 4HKFA 3UY5A 4F0YA 1PUAA 4B5OA 2J8NA 2YNCA 5DWMA 4YFJA 1S7KA 4YRHA 1YVKA 3GYAA 1MK4A 5BWAB 5IB0A 2G3AA 4JXQA 4BBHA 4KSAA 3D2MA 4NSQA 4UWJA 5AG7A 4FD7A 2PC1A 2VBQA 4KOXA 3CXQA 1KUYA 1R57A 3QAHA 4KUBA 4MFLA 4AG9A 3TOAA 2ZPAA 5AGEA 3DR8A 2JDDA 2HQYA 5A28A 3JUWA 5F47A 1QSNA 4II9A 1Z4EA 3TO6A 4CRYB 4E8OA 2GIVA 2ZW7A 3F5BA 4PK2A 5E96A 2FT0A 4FD6A 4H6UA 1S60A 2FSRA 1IICA 2AJ6A 2PQ8A 2I00A 1FY7A 4MY3A 5HMNA 2GE3A 4I49A 1M4GA 5A27A 1S7FA 2J8RA 3FXTA 1M44A 2PSWA 1QSOA 1TIQA 4XPKA 4B11A 5AG6A 2WPWA 5F46A 4PSWA 4MFJA 3PP9A 2X7BA 2QMLA 4MFKA 2ZW6A 4H6ZA 4KS9A 4JWPA 5C88A 1IB1E 4QB9A 1Q2YA 4KORA 4UWIA 4NXYA 4Y49C 2Q44A 1I21A 2GANA 3W6SA 4CAWA 5G21A 3NE7A 3D2PA 3H5ZA 2ZW5A 2K5TA 1N71A 4JLYA 1NMTA 4QUSA 2Z11A 1MJBA 4Y49B 1Y9KA 1WWZA 4CYPA 4RS2A 4A30A 4E0AA 2WPXA 4IUSA 4M3SA 1MJ9A 2EUIA 4CGPA 3P2HA 4QVTA 4KLVA 4MFZA 2DXQA 1CJWA 5J8CA 4A95A 5AG4A 5CNPA 3JVNA 1OZPA 4UCNA 3R95A 2O28A 2R98A 3E0KA 3F0AA 5EC4A 1B87A 1YREA 4XNHC 1U6MA 3TO9A 4KOVA 2H5MA 5IV0A 4AVCA 3R9EA 4QBJA 4XNHB 2YNDA 2PR8A 3TT2A 4CS0B 1XF8A 2OH1A 3IWEA 2R7HA 4ONUA 2P6GA 3BLNA 3TTHA 2D4OA 3TE4A 5G22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NMT A;  2ARH A;  2VXK A;  4OAE A;  2VI7 A;  4X5K A;  2PR1 A;  5KTC A;  1ON0 A;  4NEX A;  4IF5 A;  3PGP A;  2PDO A;  1Y9W A;  4JJX A;  4HNW B;  1NE9 A;  1GHE A;  3C26 A;  1BOB A;  1I1D A;  1KUV A;  2B3U A;  3DDD A;  3I3G A;  2Z10 A;  2FXF A;  2CNS A;  3TFY A;  1M4D A;  4KLW A;  1RXT A;  1IYK A;  4LX9 A;  2P6E A;  4KZT A;  3MGD A;  4RI1 A;  1Q2D A;  3FBU A;  2ZW4 A;  3R1K A;  3BJ7 A;  4ZBG A;  4CRZ B;  4EVY A;  4R87 A;  4XPL A;  1QSM A;  2OZG A;  2ZXV A;  3DR6 A;  3FNC A;  5HH1 A;  4KUA A;  2B4D B;  4HNY B;  2OZU A;  3DNS A;  2OB0 A;  4M85 A;  5C82 A;  4J3G A;  2REE A;  1M4I A;  3LOD A;  1WK4 A;  2BUE A;  3F8K A;  2BSW A;  4KOY A;  3H4Q A;  1XEB A;  2REF A;  4AVB A;  4JD6 A;  3ZZI A;  3BJ8 A;  3I9S A;  3GKR A;  2G3T A;  4YGO A;  2P6F A;  1YR0 A;  1QSR A;  4F6A A;  3T9Y A;  4MHD A;  2B4D A;  3TOB A;  4QC6 A;  1QST A;  4DNC A;  4U5Y A;  4HNX B;  5F48 A;  2FS5 A;  4JXR A;  4KVM E;  5GCN A;  4R3K A;  4KOW A;  3K9U A;  5ISV A;  3EY5 A;  1IID A;  4R9M A;  4MI4 A;  3S6G A;  4AG7 A;  3FIX A;  4R3L A;  5JQ4 A;  3EFA A;  4L8A A;  2IL4 A;  5KTA A;  2B58 A;  4FD4 A;  4ORF A;  1B6B A;  2C27 A;  2FIW A;  2G0B A;  2CY2 A;  1XIX A;  2J8M A;  3FYN A;  2FCK A;  4R57 A;  4OAD A;  2B5G B;  2Q04 A;  4E2A A;  4KOT A;  2VEZ A;  1S5K A;  1VKC A;  5EBV A;  2Q4V A;  1PU9 A;  2QIR A;  1L0C A;  4CAX A;  2JEV A;  3D3S A;  4NF1 A;  4UBR A;  1Q2C A;  3S6H A;  3P2F A;  1KZF A;  4KVO E;  1XMT A;  2PRB A;  1K4J A;  3TO7 A;  5FVJ A;  3V8I A;  4MBU A;  2QEC A;  4LUA A;  2AE6 A;  4OLL A;  5KTD A;  4NCZ A;  3N7Z A;  3T90 A;  2B5G A;  3QB8 A;  3R9G A;  3TCV A;  2A4N A;  5H86 A;  2RC4 A;  1P0H A;  2VQY A;  4GS4 A;  3R9F A;  1I12 A;  4L89 A;  3G8W A;  4PSX A;  1YX0 A;  3IGR A;  4PK3 A;  5J8F A;  2BEI A;  2FL4 A;  4KOU A;  1CM0 A;  4AB7 A;  4U9Y A;  2VZY A;  5H84 A;  2Q4Y A;  4CAV A;  2ATR A;  2F5I A;  1S3Z A;  1S7N A;  3PZJ A;  1LRZ A;  2Q0Y A;  4XPD C;  1BO4 A;  2JDC A;  2D4P A;  3CXS A;  2EVN A;  3KKW A;  1Z4R A;  3B8G A;  1YLE A;  5JPH A;  4XPD B;  4MY0 A;  1MJA A;  2OZH A;  2B4B A;  1Y7R A;  1KUX A;  1J4J A;  1XE4 A;  3RYO A;  1YGH A;  4PV6 A;  1UFH A;  2OU2 A;  3W6X A;  3SXO A;  2JLM A;  4KOS A;  2R8V A;  1SQH A;  1YK3 A;  1RO5 A;  5F49 A;  3EC4 A;  3GY9 A;  2FIA A;  4H89 A;  3FB3 A;  4U9Z A;  3VWD A;  2Q7B A;  1P4N A;  3EXN A;  5DWN A;  3VWE A;  4B5P B;  2R1I A;  3ZJ0 A;  4KVX A;  2BL1 A;  4MJ8 A;  2HUZ A;  3SXN A;  4BMH A;  3S6K A;  3G3S A;  2VZZ A;  1M1D A;  2I79 A;  4AVA A;  4UA3 A;  5IX3 A;  2HV2 A;  2P0W A;  1Z9U A;  3LD2 A;  3SHP A;  3WR7 A;  1V0C A;  4K30 A;  1IYL A;  1NSL A;  4FD5 A;  2Y0M A;  2FE7 A;  2KCW A;  3IWG A;  5I0C A;  3D8P A;  2B3V A;  1YVO A;  1VHS A;  2CNM A;  3W91 A;  2CNT A;  4B5P A;  1S7L A;  3R96 A;  3DSB A;  3S6F A;  3FRM A;  2Z0Z A;  3CXP A;  3OWC A;  3EO4 A;  4HKF A;  3UY5 A;  4F0Y A;  1PUA A;  4B5O A;  2J8N A;  5DWM A;  4YFJ A;  1S7K A;  4YRH A;  1YVK A;  3GYA A;  1MK4 A;  5IB0 A;  2G3A A;  4JXQ A;  3D2M A;  4NSQ A;  4UWJ A;  4FD7 A;  2PC1 A;  2VBQ A;  4KOX A;  3CXQ A;  1KUY A;  1R57 A;  3QAH A;  4KUB A;  4AG9 A;  3TOA A;  2ZPA A;  3DR8 A;  2JDD A;  2HQY A;  3JUW A;  5F47 A;  1QSN A;  4II9 A;  1Z4E A;  3TO6 A;  4CRY B;  4E8O A;  2GIV A;  2ZW7 A;  3F5B A;  4PK2 A;  5E96 A;  2FT0 A;  4FD6 A;  4H6U A;  1S60 A;  2FSR A;  1IIC A;  2AJ6 A;  2PQ8 A;  2I00 A;  1FY7 A;  4MY3 A;  5HMN A;  2GE3 A;  4I49 A;  1M4G A;  1S7F A;  2J8R A;  3FXT A;  1M44 A;  2PSW A;  1QSO A;  1TIQ A;  4XPK A;  2WPW A;  5F46 A;  4PSW A;  3PP9 A;  2X7B A;  2QML A;  2ZW6 A;  4H6Z A;  4JWP A;  5C88 A;  1IB1 E;  4QB9 A;  1Q2Y A;  4KOR A;  4UWI A;  4NXY A;  4Y49 C;  2Q44 A;  1I21 A;  2GAN A;  3W6S A;  4CAW A;  3NE7 A;  3D2P A;  2K5T A;  2ZW5 A;  1N71 A;  4JLY A;  1NMT A;  4QUS A;  2Z11 A;  1MJB A;  4Y49 B;  1Y9K A;  1WWZ A;  4RS2 A;  4E0A A;  2WPX A;  4IUS A;  4M3S A;  1MJ9 A;  2EUI A;  3P2H A;  4QVT A;  4KLV A;  2DXQ A;  1CJW A;  5J8C A;  5CNP A;  3JVN A;  1OZP A;  3R95 A;  2O28 A;  2R98 A;  3E0K A;  3F0A A;  5EC4 A;  1B87 A;  1YRE A;  4XNH C;  1U6M A;  3TO9 A;  4KOV A;  2H5M A;  5IV0 A;  4AVC A;  3R9E A;  4QBJ A;  4XNH B;  2PR8 A;  3TT2 A;  4CS0 B;  1XF8 A;  2OH1 A;  2R7H A;  4ONU A;  2P6G A;  3BLN A;  3TTH A;  2D4O A;  3TE4 A; 
#chains in the Genus database with same CATH topology
 2NMT A;  2ARH A;  1TKH A;  2GLJ A;  2VXK A;  4MXU A;  1ZLI A;  2C6C A;  2VI7 A;  3BHX A;  4MHY A;  4OAE A;  2O4H A;  4OME A;  4OC4 A;  4X5K A;  4B14 A;  4OIW A;  2PVV A;  2PR1 A;  5KTC A;  4F9U A;  4IHM A;  3TX8 A;  3IIB A;  2G9D A;  1ON0 A;  2O53 A;  2Z3M A;  2DEA A;  4NEX A;  4IF5 A;  3PGP A;  2PDO A;  2AFS A;  1XBU A;  1YW4 A;  2C6P A;  2Z3L A;  1Y9W A;  4X8I A;  4JJX A;  4Z65 A;  2F8H A;  4UCP A;  3S9N A;  4OKO A;  1ARM A;  4HNW B;  1NE9 A;  4W9Y A;  1GHE A;  2PJ1 A;  5IB9 A;  3C26 A;  1BOB A;  3NFZ A;  4C7I A;  3LWU A;  3IWW A;  4OC2 A;  1I1D A;  4P4F A;  2YGW A;  2V8G A;  4ZI6 A;  1HDU A;  1KUV A;  2B3U A;  4A94 A;  3DDD A;  3I3G A;  2XEG A;  2I3C A;  2Z10 A;  2FXF A;  2PJ2 A;  4JYW A;  1VGY A;  2Z3P A;  2C6G A;  3FED A;  4P4I A;  2CNS A;  3TFY A;  1M4D A;  4KLW A;  4P4J A;  1RXT A;  1IYK A;  3B3S A;  4LX9 A;  5LYF A;  2P6E A;  4KZT A;  3IO1 A;  2V8V A;  4CGO A;  4KSF A;  4CGN A;  2XEJ A;  1CBX A;  1TKF A;  3VAT A;  1CX8 A;  3MGD A;  1Q2D A;  4RI1 A;  3KQX A;  4ONW A;  3MRU A;  1Y7E A;  3FBU A;  3TC8 A;  2ZW4 A;  3RZA A;  4NGS A;  3GUX A;  4H2K A;  1CP6 A;  3D7D A;  4NJR A;  4NGN A;  4DJL A;  3R1K A;  3BJ7 A;  2RFH A;  3B7I A;  4CAE A;  1YSJ A;  2Q4Z A;  4Q36 A;  4ZBG A;  2VL1 A;  3QAY A;  4CRZ B;  4EVY A;  4R87 A;  4X3R A;  3FVL A;  5K8N A;  3FH4 A;  3K2K A;  4XPL A;  1QSM A;  1KWM A;  4YU9 A;  2NSM A;  1X12 A;  2OZG A;  2ZXV A;  3DR6 A;  3FNC A;  5HH1 A;  2PJ8 A;  3SJX A;  4FWU A;  4KUA A;  2B4D B;  2JBJ A;  2ZEO A;  4HNY B;  4B10 A;  2OZU A;  3DNS A;  2OB0 A;  4M85 A;  4UIB A;  5C82 A;  1LFW A;  4J3G A;  2REE A;  4CYQ A;  1LAP A;  1M4I A;  2Z3O A;  3IU1 A;  3LOD A;  5HXD A;  2ABZ A;  2PJ4 A;  1WK4 A;  1M4L A;  5LYD A;  2BUE A;  3F8K A;  3CPA A;  2BSW A;  4ZX9 A;  2AFM A;  1ELM P;  3NH8 A;  4KOY A;  4JZ0 A;  3H4Q A;  4WWV A;  1XEB A;  2REF A;  4AVB A;  4JD6 A;  3ZZI A;  1JQG A;  3BJ8 A;  4MRI A;  3RO0 A;  3I9S A;  3GKR A;  2G3T A;  1H8L A;  1R43 A;  4YGO A;  2P6F A;  3D68 A;  1YR0 A;  2DPT A;  3K9T A;  1AUG A;  1QSR A;  2FVG A;  4P44 A;  4F6A A;  3T9Y A;  4A31 A;  4MHD A;  2B4D A;  3TOB A;  4QC6 A;  4A2Z A;  1QST A;  4EWT A;  5K8M A;  3IJ3 A;  3PB7 X;  4MHP A;  1DE4 C;  4C68 A;  4U5Y A;  4DNC A;  1EE3 P;  4HNX B;  5F48 A;  2FS5 A;  2J9A A;  3GIU A;  4JXR A;  4KVM E;  3CT9 A;  4UFX A;  3SJG A;  4MMO A;  2PJA A;  5GCN A;  4R3K A;  4KOW A;  1X10 A;  3K9U A;  3KZW A;  5ISV A;  4UF4 A;  3EY5 A;  2QJ8 A;  1IID A;  2AFZ A;  3LMS A;  4R9M A;  5I4M A;  5ELY A;  4MI4 A;  3S6G A;  4AG7 A;  3T8W A;  4PXD A;  3SI2 A;  4A37 A;  3FIX A;  1VHE A;  1UWY A;  4R3L A;  2BO9 A;  1Y0R A;  5JQ4 A;  2C1C A;  1CPS A;  2V8D A;  3WAB A;  1NSA A;  2ODF A;  5J1Q A;  3EFA A;  3CDX A;  3CZX A;  4L8A A;  2ZEN A;  2IL4 A;  4UEZ A;  2ZEL A;  4KSI A;  2CF4 A;  5KTA A;  2B58 A;  3B35 A;  2IMO A;  3FX6 A;  2ZEG A;  4FD4 A;  4NFR A;  4ORF A;  1HDQ A;  3IFE A;  1B6B A;  4B12 A;  2C27 A;  1AMP A;  2FIW A;  1ZO0 A;  2G0B A;  3V7Z A;  2CTC A;  1PCA A;  2CY2 A;  2Z3N A;  1R3N A;  1XIX A;  2J8M A;  3FYN A;  4UCM A;  3D66 A;  3NH4 A;  4NGP A;  5G20 A;  2FCK A;  4MCS A;  2OR4 A;  4P45 A;  4OAD A;  4R57 A;  2B5G B;  2Q04 A;  4ZYQ A;  4E2A A;  5CBM A;  3S9L A;  4M6H A;  4NJQ A;  4KOT A;  1QMU A;  4MHN A;  2VEZ A;  2CXA A;  2ANP A;  4K3N A;  1S5K A;  1VKC A;  5EBV A;  3WC6 A;  4CYN A;  2Q4V A;  1PU9 A;  2IJZ A;  1L0C A;  2QIR A;  2PJ0 A;  4CAX A;  1CP7 A;  2JEV A;  4NGR A;  3D3S A;  4NF1 A;  4UBR A;  1A2Z A;  1Q2C A;  3S6H A;  3ISZ A;  3P2F A;  4A32 A;  1KZF A;  1Z2L A;  4P4E A;  2ZOF A;  4KVO E;  1XMT A;  4O23 A;  3BI0 A;  2EK9 A;  1K4J A;  2PRB A;  3D4U A;  3H8G A;  3TO7 A;  4C2X A;  1Z8L A;  5FVJ A;  4ZY2 A;  3V8I A;  3IC1 A;  4MBU A;  5LRK A;  3VH9 A;  2PJ9 A;  2QEC A;  4LUA A;  2WUU A;  2AE6 A;  2ZEF A;  4OLL A;  4NCZ A;  5KTD A;  3N7Z A;  3BXM A;  3T90 A;  2B5G A;  4BD9 A;  5JH9 A;  3QB8 A;  3R9G A;  3TCV A;  3FEE A;  3HLP A;  2A4N A;  5LYI A;  5H86 A;  1IOI A;  1BPN A;  2RC4 A;  1P0H A;  4B13 A;  3CPX A;  5THW A;  2VQY A;  4GS4 A;  4LQ6 A;  3R9F A;  3BI1 A;  4DUK A;  3A9L A;  1I12 A;  4UFV A;  4L89 A;  3G8W A;  3LAC A;  1YX0 A;  4PSX A;  1Z8W A;  4F0X A;  2GU2 A;  4P4B A;  2DPS A;  2WYR A;  3IGR A;  3SJF A;  4PK3 A;  5J8F A;  2BEI A;  2ZEE A;  1LCP A;  4ZGY B;  3TE4 A;  2FL4 A;  4Q38 A;  2DF5 A;  4KOU A;  1CM0 A;  4AB7 A;  1OBR A;  3IEH A;  2PCU A;  1LAM A;  4U9Y A;  3DLJ A;  5K8P A;  2VZY A;  5H84 A;  2Q4Y A;  4CAV A;  3B3T A;  2ATR A;  4PXE A;  2F5I A;  4GXH A;  5F09 A;  3PBE A;  1S3Z A;  1S7N A;  2XEI A;  2HC9 A;  3PZJ A;  4NGT A;  1LRZ A;  2Q0Y A;  4XPD C;  4ZY1 A;  3MN8 A;  1BO4 A;  2JDC A;  2D4P A;  2ZEP A;  3CXS A;  2EVN A;  1YW6 A;  3KKW A;  5EMI A;  4OC3 A;  1Z4R A;  1ZLH A;  4OID A;  3RAM A;  7CPA A;  3PB8 X;  3RBU A;  4RUH A;  3B8G A;  4A33 A;  1YLE A;  3FEC A;  2PRQ A;  5JPH A;  4XPD B;  4MY0 A;  8CPA A;  1VHO A;  3V38 A;  1MJA A;  2OZH A;  2B4B A;  1Y7R A;  1KUX A;  1J4J A;  2AFW A;  1XE4 A;  3RYO A;  5CPA A;  3QNV A;  2EK8 A;  1YGH A;  4ZY0 A;  4PV6 A;  1UFH A;  2CTB A;  2WSA A;  2OU2 A;  3W6X A;  1BAV A;  4F8Z A;  4MFP A;  3SXO A;  1HEE A;  2JLM A;  4KOS A;  4MFQ A;  4UFW A;  4C2Z A;  2Z3K A;  2R8V A;  1SQH A;  2HB6 A;  1YK3 A;  3JTK A;  3WC7 A;  4MCQ A;  2YNE A;  1RO5 A;  5F49 A;  3EC4 A;  3GY9 A;  4NGQ A;  2FIA A;  4H89 A;  2GLF A;  3FB3 A;  1XMB A;  2Q43 A;  4U9Z A;  1Z8X A;  3VWD A;  4CAF A;  4IAV A;  1TF8 A;  2Q7B A;  3H8F A;  1F57 A;  1P4N A;  3S9M A;  4C2Y A;  4CGM A;  4NGM A;  3EXN A;  5DWN A;  3VWE A;  4B5P B;  3WC5 A;  2R1I A;  5G1Z A;  3ZJ0 A;  1TXR A;  4KVX A;  2BL1 A;  4MJ8 A;  2HUZ A;  3SXN A;  4BMH A;  3S6K A;  3I1U A;  3D7H A;  3G3S A;  2VZZ A;  5DS0 A;  1M1D A;  2I79 A;  4AVA A;  4UA3 A;  5AG5 A;  1FNO A;  5IX3 A;  2HV2 A;  1XRY A;  2P0W A;  2V8H A;  2YNC C;  3B3W A;  1Z9U A;  3GB0 A;  1Y0Y A;  3LD2 A;  2Q51 A;  3KR4 A;  3SHP A;  1V0C A;  4K30 A;  3WR7 A;  1IYL A;  2QYV A;  4EME A;  4GM5 A;  4UEF A;  1NSL A;  3PB9 X;  2Y0M A;  2FE7 A;  4FD5 A;  2KCW A;  4PXC A;  3IWG A;  4EFD A;  5I0C A;  1ZG8 A;  3D8P A;  4CGL A;  1AYE A;  4PQA A;  4F9V A;  4CYO A;  2B3V A;  3IU2 A;  1YVO A;  2CIJ A;  2PJ7 A;  1VHS A;  2CNM A;  3PEI A;  4UIA A;  5HVF A;  3W91 A;  2CNT A;  4B5P A;  3KQZ A;  1IU8 A;  3PFE A;  4CPA A;  1LOK A;  1S7L A;  4R7M A;  3NH5 A;  3R96 A;  3DSB A;  1YQE A;  3S6F A;  3KR5 A;  3PBB A;  3KGQ A;  1XJO A;  2PJ3 A;  3FRM A;  2PJ6 A;  2Z0Z A;  4C7H A;  1CPX A;  3CXP A;  5D8N A;  3OWC A;  3EO4 A;  4OC5 A;  4M6G A;  2EO8 A;  4HKF A;  3UY5 A;  4F0Y A;  1PUA A;  2EBJ A;  4P10 A;  1FT7 A;  2BOA A;  4B5O A;  3D7G A;  2J8N A;  2YNC A;  4OP4 A;  5DWM A;  4HPS A;  4YFJ A;  1S7K A;  1DTD A;  4YRH A;  4ZX8 A;  1YVK A;  4R6T A;  3GYA A;  1MK4 A;  5BWA B;  2XEF A;  5IB0 A;  2G3A A;  4JXQ A;  1PYT B;  4BBH A;  4KSA A;  5JGF A;  3D2M A;  4NSQ A;  4UWJ A;  5AG7 A;  2PJB A;  4FD7 A;  3B3V A;  5LRG A;  2PC1 A;  1VIX A;  4WJB A;  2VBQ A;  4KOX A;  3CXQ A;  1QQ9 A;  1KUY A;  3JRU A;  1R57 A;  3QAH A;  4KUB A;  4MFL A;  4R8F A;  4TWE A;  4AG9 A;  3TOA A;  4MCP A;  2ZPA A;  4LQG A;  5AGE A;  2RB7 A;  2AFX A;  3DR8 A;  3SI1 A;  2JDD A;  2HQY A;  4OC1 A;  1IOF A;  1TKJ A;  1TF9 A;  2PVW A;  2WZN A;  3JUW A;  4G1P A;  5F47 A;  1QSN A;  5A28 A;  2V77 A;  4II9 A;  1Z4E A;  3TO6 A;  4CRY B;  4E8O A;  2AFU A;  2GIV A;  5LYL A;  2AFO A;  2ZW7 A;  3F5B A;  3RNZ A;  2EWB A;  2JBK A;  4PPZ A;  4PK2 A;  4FUU A;  4UEE A;  5E96 A;  2QVP A;  3FF3 A;  3KI9 A;  2FT0 A;  4FD6 A;  4H6U A;  4FBE A;  1S60 A;  2FSR A;  1IIC A;  2IQ6 A;  3ISX A;  4MCR A;  2AJ6 A;  4OC0 A;  3H8E A;  2PQ8 A;  2I00 A;  1FY7 A;  4MY3 A;  4P6Y A;  5HMN A;  2GE3 A;  4I49 A;  1M4G A;  1Q7L A;  5A27 A;  1S7F A;  4PXB A;  2J8R A;  3VAR A;  4FAI A;  3PRT A;  4BIN A;  3FXT A;  1M44 A;  3KL9 A;  2PSW A;  1XFO A;  2F7V A;  5HVH A;  1XOV A;  1QSO A;  1TIQ A;  4IK2 A;  1JWQ A;  2BCO A;  4XPK A;  2OOT A;  4B11 A;  5AG6 A;  3N5F A;  1ZG9 A;  2PJ5 A;  2WPW A;  5F46 A;  4PSW A;  2PIY A;  3D67 A;  4MFJ A;  3B2Y A;  3PP9 A;  2X7B A;  2QML A;  4MFK A;  2NYQ A;  2ZW6 A;  3NE8 A;  4H6Z A;  3HUV A;  4KS9 A;  3KHZ A;  4JWP A;  3GLJ A;  5C88 A;  1IB1 E;  1YLO A;  4QB9 A;  4RN7 A;  2ZED A;  1Q2Y A;  4KOR A;  4UWI A;  4NXY A;  1ELL P;  4Y49 C;  2Q44 A;  1I21 A;  2GAN A;  3W6S A;  4CAW A;  5G21 A;  1RTQ A;  2GRE A;  2POK A;  3D2P A;  3NE7 A;  2K5T A;  2ZW5 A;  3H5Z A;  1N71 A;  4JLY A;  1NMT A;  4B6Z A;  4QUS A;  2Z11 A;  4AXV A;  1BLL E;  4Q7A A;  1BPM A;  3SJE A;  1MJB A;  4Y49 B;  1Y9K A;  1WWZ A;  4CYP A;  1Z8T A;  4RS2 A;  4A30 A;  4E0A A;  2WPX A;  3PFO A;  4IUS A;  4M3S A;  1MJ9 A;  2EUI A;  4CGP A;  3P2H A;  4QVT A;  4KLV A;  4MFZ A;  2DXQ A;  1CJW A;  6CPA A;  3KHX A;  5J8C A;  4A95 A;  4YWY A;  2ZEH A;  3KAS A;  5AG4 A;  5CNP A;  3JVN A;  1OZP A;  3NA6 A;  4UCN A;  2PIZ A;  3R95 A;  2O28 A;  2Q7S A;  1F2P A;  1ARL A;  4X2T A;  5JM6 A;  2R98 A;  1IGB A;  3E0K A;  4A39 A;  3F0A A;  5EC4 A;  1B87 A;  3PB6 X;  3DGV A;  4A38 A;  5HVG A;  1YRE A;  4XNH C;  1U6M A;  3TO9 A;  3D7F A;  4KOV A;  4DYO A;  3WT4 A;  2H5M A;  3B3C A;  5IV0 A;  2PE3 A;  3PB4 X;  4M6I A;  4TNU A;  5LRJ A;  4AVC A;  4R76 A;  3R9E A;  5K8O A;  1YME A;  4XNH B;  4QBJ A;  1Z5R A;  3SI0 A;  1F2O A;  2YND A;  2PR8 A;  2PJC A;  5D29 A;  4P4D A;  3TT2 A;  4CS0 B;  1GYT A;  1LAN A;  1XF8 A;  2OH1 A;  2ZOG A;  2GFQ A;  2JEW A;  1ZG7 A;  4MHZ A;  1CG2 A;  2R7H A;  3FMC A;  3IWE A;  2P6G A;  3BLN A;  1IY7 A;  2D4O A;  3L2N A;  4ONU A;  3FJU A;  3TTH A;  2ZEM A;  5G22 A; 
#chains in the Genus database with same CATH homology
 2NMT A;  2ARH A;  2VXK A;  4OAE A;  4B14 A;  2VI7 A;  4X5K A;  2PR1 A;  5KTC A;  1ON0 A;  2Z3M A;  4NEX A;  4IF5 A;  3PGP A;  2PDO A;  2Z3L A;  1Y9W A;  4JJX A;  4UCP A;  4HNW B;  1NE9 A;  1GHE A;  3C26 A;  1BOB A;  4C7I A;  1I1D A;  2YGW A;  1KUV A;  2B3U A;  3DDD A;  3I3G A;  2Z10 A;  2FXF A;  2Z3P A;  2CNS A;  3TFY A;  1M4D A;  4KLW A;  1RXT A;  1IYK A;  4LX9 A;  2P6E A;  4KZT A;  4CGO A;  4KSF A;  4CGN A;  3MGD A;  4RI1 A;  1Q2D A;  3FBU A;  2ZW4 A;  3R1K A;  3BJ7 A;  4CAE A;  4Q36 A;  4ZBG A;  4CRZ B;  4EVY A;  4R87 A;  4XPL A;  1QSM A;  2OZG A;  2ZXV A;  3DR6 A;  3FNC A;  5HH1 A;  4KUA A;  2B4D B;  4HNY B;  4B10 A;  2OZU A;  3DNS A;  2OB0 A;  4M85 A;  5C82 A;  4J3G A;  2REE A;  4CYQ A;  1M4I A;  2Z3O A;  3IU1 A;  3LOD A;  1WK4 A;  2BUE A;  3F8K A;  2BSW A;  4KOY A;  3H4Q A;  1XEB A;  2REF A;  4AVB A;  4JD6 A;  3ZZI A;  3BJ8 A;  3I9S A;  3GKR A;  2G3T A;  4YGO A;  2P6F A;  1YR0 A;  2DPT A;  1QSR A;  4F6A A;  3T9Y A;  4A31 A;  4MHD A;  2B4D A;  3TOB A;  4QC6 A;  4A2Z A;  1QST A;  4DNC A;  4C68 A;  4U5Y A;  4HNX B;  5F48 A;  2FS5 A;  4JXR A;  4KVM E;  4UFX A;  5GCN A;  4R3K A;  4KOW A;  3K9U A;  5ISV A;  3EY5 A;  1IID A;  4R9M A;  4MI4 A;  3S6G A;  4AG7 A;  3FIX A;  4R3L A;  5JQ4 A;  3EFA A;  4L8A A;  2IL4 A;  5KTA A;  2B58 A;  4FD4 A;  4ORF A;  4B12 A;  1B6B A;  2C27 A;  2FIW A;  1ZO0 A;  2G0B A;  2CY2 A;  2Z3N A;  4UCM A;  1XIX A;  2J8M A;  3FYN A;  5G20 A;  2FCK A;  4R57 A;  4OAD A;  2B5G B;  2Q04 A;  4E2A A;  4KOT A;  2VEZ A;  2CXA A;  1S5K A;  1VKC A;  5EBV A;  4CYN A;  2Q4V A;  1PU9 A;  2QIR A;  1L0C A;  4CAX A;  2JEV A;  3D3S A;  4NF1 A;  4UBR A;  1Q2C A;  3S6H A;  3P2F A;  4A32 A;  1KZF A;  4KVO E;  1XMT A;  2PRB A;  1K4J A;  4C2X A;  3TO7 A;  5FVJ A;  3V8I A;  4MBU A;  2QEC A;  4LUA A;  2WUU A;  2AE6 A;  4OLL A;  5KTD A;  4NCZ A;  3N7Z A;  3T90 A;  2B5G A;  3QB8 A;  3R9G A;  3TCV A;  2A4N A;  5H86 A;  2RC4 A;  1P0H A;  4B13 A;  2VQY A;  4GS4 A;  3R9F A;  3A9L A;  1I12 A;  4UFV A;  4L89 A;  3G8W A;  4PSX A;  1YX0 A;  4F0X A;  2DPS A;  3IGR A;  4PK3 A;  5J8F A;  2BEI A;  4ZGY B;  2FL4 A;  4Q38 A;  4KOU A;  1CM0 A;  4AB7 A;  4U9Y A;  2VZY A;  5H84 A;  2Q4Y A;  4CAV A;  2ATR A;  2F5I A;  1S3Z A;  1S7N A;  3PZJ A;  1LRZ A;  2Q0Y A;  4XPD C;  1BO4 A;  2JDC A;  2D4P A;  3CXS A;  2EVN A;  3KKW A;  1Z4R A;  3B8G A;  4A33 A;  1YLE A;  5JPH A;  4XPD B;  4MY0 A;  1MJA A;  2OZH A;  2B4B A;  1Y7R A;  1KUX A;  1J4J A;  1XE4 A;  3RYO A;  1YGH A;  4PV6 A;  1UFH A;  2WSA A;  2OU2 A;  3W6X A;  4MFP A;  3SXO A;  2JLM A;  4KOS A;  4MFQ A;  4UFW A;  4C2Z A;  2Z3K A;  2R8V A;  1SQH A;  1YK3 A;  3JTK A;  2YNE A;  1RO5 A;  5F49 A;  3EC4 A;  3GY9 A;  2FIA A;  4H89 A;  3FB3 A;  4U9Z A;  3VWD A;  4CAF A;  2Q7B A;  1P4N A;  4C2Y A;  4CGM A;  3EXN A;  5DWN A;  3VWE A;  4B5P B;  2R1I A;  5G1Z A;  3ZJ0 A;  4KVX A;  2BL1 A;  4MJ8 A;  2HUZ A;  3SXN A;  4BMH A;  3S6K A;  3G3S A;  2VZZ A;  1M1D A;  2I79 A;  4AVA A;  4UA3 A;  5AG5 A;  5IX3 A;  2HV2 A;  2P0W A;  2YNC C;  1Z9U A;  3LD2 A;  3SHP A;  3WR7 A;  1V0C A;  4K30 A;  1IYL A;  1NSL A;  4FD5 A;  2Y0M A;  2FE7 A;  2KCW A;  3IWG A;  5I0C A;  3D8P A;  4CGL A;  4CYO A;  2B3V A;  3IU2 A;  1YVO A;  1VHS A;  2CNM A;  3W91 A;  2CNT A;  4B5P A;  1S7L A;  3R96 A;  3DSB A;  3S6F A;  3FRM A;  2Z0Z A;  4C7H A;  3CXP A;  3OWC A;  3EO4 A;  4HKF A;  3UY5 A;  4F0Y A;  1PUA A;  4B5O A;  2J8N A;  2YNC A;  5DWM A;  4YFJ A;  1S7K A;  4YRH A;  1YVK A;  3GYA A;  1MK4 A;  5BWA B;  5IB0 A;  2G3A A;  4JXQ A;  4BBH A;  4KSA A;  3D2M A;  4NSQ A;  4UWJ A;  5AG7 A;  4FD7 A;  2PC1 A;  2VBQ A;  4KOX A;  3CXQ A;  1KUY A;  1R57 A;  3QAH A;  4KUB A;  4MFL A;  4AG9 A;  3TOA A;  2ZPA A;  5AGE A;  3DR8 A;  2JDD A;  2HQY A;  5A28 A;  3JUW A;  5F47 A;  1QSN A;  4II9 A;  1Z4E A;  3TO6 A;  4CRY B;  4E8O A;  2GIV A;  2ZW7 A;  3F5B A;  4PK2 A;  5E96 A;  2FT0 A;  4FD6 A;  4H6U A;  1S60 A;  2FSR A;  1IIC A;  2AJ6 A;  2PQ8 A;  2I00 A;  1FY7 A;  4MY3 A;  5HMN A;  2GE3 A;  4I49 A;  1M4G A;  5A27 A;  1S7F A;  2J8R A;  3FXT A;  1M44 A;  2PSW A;  1QSO A;  1TIQ A;  4XPK A;  4B11 A;  5AG6 A;  2WPW A;  5F46 A;  4PSW A;  4MFJ A;  3PP9 A;  2X7B A;  2QML A;  4MFK A;  2ZW6 A;  4H6Z A;  4KS9 A;  4JWP A;  5C88 A;  1IB1 E;  4QB9 A;  1Q2Y A;  4KOR A;  4UWI A;  4NXY A;  4Y49 C;  2Q44 A;  1I21 A;  2GAN A;  3W6S A;  4CAW A;  5G21 A;  3NE7 A;  3D2P A;  3H5Z A;  2ZW5 A;  2K5T A;  1N71 A;  4JLY A;  1NMT A;  4QUS A;  2Z11 A;  1MJB A;  4Y49 B;  1Y9K A;  1WWZ A;  4CYP A;  4RS2 A;  4A30 A;  4E0A A;  2WPX A;  4IUS A;  4M3S A;  1MJ9 A;  2EUI A;  4CGP A;  3P2H A;  4QVT A;  4KLV A;  4MFZ A;  2DXQ A;  1CJW A;  5J8C A;  4A95 A;  5AG4 A;  5CNP A;  3JVN A;  1OZP A;  4UCN A;  3R95 A;  2O28 A;  2R98 A;  3E0K A;  3F0A A;  5EC4 A;  1B87 A;  1YRE A;  4XNH C;  1U6M A;  3TO9 A;  4KOV A;  2H5M A;  5IV0 A;  4AVC A;  3R9E A;  4QBJ A;  4XNH B;  2YND A;  2PR8 A;  3TT2 A;  4CS0 B;  1XF8 A;  2OH1 A;  3IWE A;  2R7H A;  4ONU A;  2P6G A;  3BLN A;  3TTH A;  2D4O A;  3TE4 A;  5G22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...