5F47A

Crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample in complex with trehalose
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
151
structure length
151
Chain Sequence
IDNFLKIERLAENDLPKFIQLIRLFEAVFEMKNFSIPDSEHLQKLLNQNNFYVFVALLENKIVGGLTSYVLEQYYSEKPLAYIYDLAVDTNWQRQGIGKKLITATNQFYTEKGFEEVFVQADKVDDYALDFYRSTKPTAEEQVVHFYYTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Survey of Environmental Aminoglycoside Acetyltransferases Reveals Functionality of Resistance Enzymes.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Transferase
molecule keywords aminoglycoside acetyltransferase meta-AAC0020
total genus 36
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5f47A00
1CJWA 3G3SA 3PP9A 2ZW5A 1YVKA 2G3TA 3BJ7A 3TO6A 4QUSA 1YK3A 2CNMA 1KUVA 2WPWA 3B8GA 2FE7A 3LODA 1ON0A 3R9EA 4NEXA 4GS4A 1MJAA 2Q04A 2A4NA 4NCZA 4XPDC 1N71A 2PSWA 1TIQA 4R87A 2FS5A 1Y9WA 2H5MA 3C26A 4E0AA 3FB3A 5C82A 4KLWA 3D2MA 4KOTA 3R9GA 1WWZA 4FD7A 4KVXA 5J8CA 5KTDA 4U9ZA 3ZJ0A 2QECA 2PC1A 1S60A 2C27A 5DWNA 3DDDA 4XNHB 4XNHC 1NSLA 2I79A 2REEA 2KCWA 4PV6A 4XPDB 4E2AA 2AJ6A 4CS0B 3DNSA 4ZBGA 4PSWA 5HMNA 4HKFA 3T90A 4FD6A 1GHEA 3PGPA 3K9UA 2P6EA 4KORA 4MJ8A 2PDOA 4KOUA 5F47A 1M4DA 1IB1E 2FSRA 4JJXA 3FXTA 1NE9A 2FIWA 2BL1A 1UFHA 2PQ8A 1Y7RA 2VQYA 3EXNA 4ONUA 2B4DB 5I0CA 3ZZIA 5KTCA 1MJ9A 1CM0A 4KVOE 2ARHA 2Q44A 4K30A 3MGDA 4JWPA 1YX0A 3W6XA 1XEBA 1R57A 1YGHA 2CNSA 1XIXA 4JD6A 4NSQA 3F8KA 4XPLA 1IYKA 1L0CA 2CY2A 3LD2A 2B4BA 5DWMA 2OH1A 4AG7A 3R95A 4KUBA 4OADA 3R96A 3SXOA 2R1IA 3TOAA 3GY9A 1S7FA 4KUAA 4YRHA 4QVTA 1KZFA 2BUEA 4U5YA 4IUSA 2R8VA 3DR8A 1IYLA 1RO5A 1SQHA 1S5KA 4RI1A 2VZZA 4MHDA 4MY3A 4UA3A 3D2PA 5JPHA 4R57A 2PR1A 3F5BA 2FXFA 2ZPAA 4M3SA 4AVAA 2ZW4A 2B4DA 4LX9A 1MJBA 4HNYB 3S6GA 2ZXVA 2QIRA 2Q0YA 5JQ4A 1QSTA 1RXTA 2ZW6A 1B87A 3E0KA 1YLEA 3S6FA 3N7ZA 4AVCA 1I21A 4ORFA 1YVOA 2OZUA 3CXSA 4E8OA 4I49A 1I12A 1Q2DA 2Z0ZA 5H84A 1WK4A 4JXQA 5IB0A 3S6HA 3FRMA 3H4QA 1PUAA 5J8FA 3FNCA 1V0CA 4NXYA 1S7LA 5EBVA 3FIXA 2EVNA 2BSWA 3I3GA 3TTHA 2PR8A 1KUXA 3TO9A 2G0BA 2JDCA 4BMHA 1PU9A 2GIVA 4QBJA 4PK2A 4U9YA 2P6GA 4JLYA 3JUWA 3DSBA 3SHPA 1BOBA 2NMTA 2HQYA 4LUAA 4H89A 4AG9A 2B3UA 1U6MA 2F5IA 4HNXB 1Z9UA 2B3VA 4KLVA 3OWCA 4FD4A 5CNPA 4EVYA 4H6ZA 2X7BA 3TCVA 1YR0A 2OB0A 1QSNA 2REFA 3GYAA 1S7KA 2OZGA 4QC6A 1Q2YA 2D4OA 4KOWA 4OAEA 2RC4A 3F0AA 1KUYA 1QSOA 2FT0A 2G3AA 4KOXA 2ATRA 5F49A 3BJ8A 4CRYB 4F0YA 2JEVA 4FD5A 2P0WA 3KKWA 1Y9KA 4KVME 4CRZB 2JLMA 1XE4A 1P0HA 1QSMA 1I1DA 4KZTA 4X5KA 1M4GA 4R9MA 1BO4A 4R3LA 4UWJA 2ZW7A 3T9YA 3P2FA 2FL4A 2Z10A 3QAHA 4L89A 5F46A 1FY7A 3RYOA 1M4IA 1QSRA 5HH1A 1IICA 5EC4A 1Q2CA 3DR6A 5IX3A 2J8MA 1IIDA 4M85A 1B6BA 2OU2A 1M44A 2WPXA 5FVJA 2B58A 2R7HA 2FIAA 4MI4A 1VKCA 4J3GA 2VXKA 4RS2A 4DNCA 4KOVA 2IL4A 2FCKA 2JDDA 2B5GB 4B5PB 1P4NA 4PK3A 3G8WA 2EUIA 4QB9A 4CAWA 2VEZA 1Z4EA 3R1KA 3I9SA 3VWDA 4CAXA 3CXQA 3FBUA 3SXNA 3NE7A 4UBRA 4YFJA 1YREA 3V8IA 3TOBA 3TT2A 4II9A 2GANA 1Z4RA 3IGRA 4CAVA 2BEIA 4PSXA 1J4JA 2VI7A 2K5TA 4KOYA 1XF8A 5E96A 3TE4A 2PRBA 4L8AA 3P2HA 2AE6A 5H86A 4F6AA 2CNTA 2HUZA 2I00A 4XPKA 3W6SA 5KTAA 1M1DA 3GKRA 1LRZA 3FYNA 3S6KA 2DXQA 2Q4VA 4Y49B 4MBUA 3TO7A 4B5OA 2Q4YA 2QMLA 3W91A 3IWGA 3EO4A 3TFYA 4MY0A 3CXPA 4R3KA 4HNWB 3EC4A 1MK4A 2OZHA 1XMTA 2VZYA 4YGOA 5C88A 2D4PA 2R98A 2Z11A 3JVNA 3WR7A 3EY5A 4B5PA 5IV0A 4NF1A 2B5GA 3UY5A 3BLNA 3QB8A 4AB7A 1VHSA 1K4JA 4KOSA 4Y49C 2J8NA 5GCNA 5F48A 2Y0MA 3D8PA 2O28A 4H6UA 4OLLA 3R9FA 2VBQA 3D3SA 1S7NA 5ISVA 3VWEA 4UWIA 3EFAA 2HV2A 4JXRA 4AVBA 2GE3A 1S3ZA 2Q7BA 3PZJA 4IF5A 2P6FA 1NMTA 1OZPA 2J8RA
chains in the Genus database with same CATH superfamily
3V38A 1CJWA 2GREA 5BWAB 3G3SA 4ZY2A 2PJ6A 3PP9A 4PXCA 1TXRA 2ZW5A 1YVKA 2G3TA 3BJ7A 1LAMA 3TO6A 4QUSA 1ARLA 1YK3A 2CNMA 1KUVA 3FJUA 2WPWA 3B8GA 2FE7A 4X3RA 3PRTA 4OC2A 3JTKA 5G22A 3LODA 3CT9A 1ON0A 2C6CA 5LYFA 2DPSA 4MCRA 2V8VA 1ZLHA 3R9EA 4NEXA 5LYLA 4GS4A 1IGBA 1MJAA 2Z3PA 2QVPA 2Q04A 1VIXA 2A4NA 4GM5A 1CG2A 1N71A 2PJBA 2PSWA 1TIQA 2OR4A 3K9TA 4R87A 2G9DA 3NA6A 1XOVA 2PJ0A 3PB4X 2AFOA 2V77A 5LYIA 2FS5A 1Y9WA 3PB7X 2H5MA 3C26A 4E0AA 4EMEA 3FB3A 2YNCC 5C82A 4CYOA 2PJ7A 4KLWA 4CAEA 3D2MA 4MFKA 4UEZA 4KOTA 3R9GA 2QYVA 1WWZA 1JQGA 2BCOA 4FD7A 2PJ8A 5IB9A 4KVXA 4X2TA 4ZGYB 5J8CA 4K3NA 5KTDA 4OMEA 4BD9A 4U9ZA 2GFQA 4UEEA 4UIBA 3ZJ0A 4AXVA 2QECA 4JYWA 4OC3A 1F2OA 2PC1A 1S60A 3LWUA 3D7FA 2C27A 5DWNA 3DDDA 4XNHB 3B3TA 4XNHC 1NSLA 3VARA 2I79A 2REEA 2KCWA 2CF4A 4R7MA 4PV6A 2ZOGA 4XPDB 5AGEA 2EWBA 4MFLA 4E2AA 5D29A 4FUUA 2AJ6A 4CS0B 3DNSA 4ZBGA 4NGNA 4MCPA 1TKFA 1BPMA 1Y0RA 4HKFA 4PSWA 5HMNA 3KHZA 2ZEPA 4G1PA 4FD6A 1GHEA 5G21A 3T90A 2F8HA 3D67A 3LMSA 4CGOA 2AFUA 1X12A 4RN7A 3PGPA 3K9UA 2P6EA 4KORA 4MJ8A 2PDOA 3KZWA 3IEHA 4KOUA 5F47A 4ONWA 1M4DA 4B14A 4NGQA 1IB1E 1Q7LA 1LANA 4B12A 1DTDA 2FSRA 4JJXA 3FXTA 3RBUA 3WC5A 3K2KA 2ZEDA 3V7ZA 1DE4C 1NE9A 3H5ZA 3IWEA 3BI0A 2FIWA 4UFWA 1BLLE 2BL1A 4LQGA 1UFHA 2PQ8A 1ZG9A 2ZENA 1Y7RA 2VQYA 1VHEA 4YWYA 3EXNA 4ONUA 2B4DB 2V8HA 5I0CA 1HDUA 3NFZA 3ZZIA 4OP4A 4DUKA 3NH4A 5G20A 5KTCA 1MJ9A 1H8LA 4P4EA 1CM0A 2WYRA 1Z2LA 4PXEA 4KVOE 2ARHA 2F7VA 2Q44A 3A9LA 4K30A 4P10A 3MGDA 4M6HA 4JWPA 1YX0A 4ZX9A 3W6XA 2YNEA 1XEBA 3HUVA 4H2KA 3L2NA 1R57A 1YGHA 2EBJA 1R43A 2CNSA 1XIXA 4JD6A 4NSQA 3F8KA 4XPLA 3WC6A 3IFEA 1IYKA 1F2PA 1LFWA 1L0CA 1ELLP 2CIJA 1XMBA 2CY2A 3LD2A 3RAMA 2Q7SA 4CPAA 2B4BA 1AYEA 1JWQA 4MFZA 1PYTB 3D66A 5DWMA 2OH1A 3PB8X 4A32A 2NYQA 4AG7A 2AFZA 3B2YA 3R95A 3GB0A 4KUBA 4OADA 3R96A 3SXOA 5K8MA 2R1IA 3TOAA 1LCPA 3GY9A 4MXUA 3CPXA 1S7FA 1CX8A 2PVVA 3IU2A 4KUAA 1ZG8A 4P6YA 4P45A 4YRHA 4QVTA 4CGLA 4UF4A 1KZFA 2BUEA 4U5YA 2HC9A 4IUSA 2R8VA 1HDQA 2XEFA 3DR8A 1IYLA 1RO5A 1SQHA 4EFDA 1S5KA 4RI1A 1AUGA 2VZZA 4MHDA 4MY3A 1ZO0A 4UA3A 3SI2A 3D2PA 1TKJA 5JPHA 1QQ9A 4PQAA 4C2YA 3PBEA 4R57A 4OKOA 2PR1A 3F5BA 2FXFA 2ZPAA 2PJAA 2HB6A 4M3SA 4AVAA 2ZW4A 2B4DA 4LX9A 1MJBA 4HNYB 3S6GA 2ZXVA 2QIRA 2Q0YA 4B13A 2FVGA 2PJ5A 4NCZA 2ABZA 2Q43A 5JQ4A 3D68A 4FAIA 2AFWA 3PB6X 4C2XA 5AG4A 4X8IA 1QSTA 1RXTA 5HVFA 5G1ZA 2ZW6A 1B87A 4DJLA 4CGMA 3E0KA 5A27A 1YLEA 3S6FA 2JBJA 2NSMA 3N7ZA 8CPAA 4AVCA 1I21A 4ORFA 2DEAA 1YVOA 2OZUA 3CXSA 4E8OA 4I49A 4CYNA 2AFMA 1I12A 4IHMA 5THWA 4A2ZA 1Q2DA 1Z8TA 1Z8WA 4O23A 2Z0ZA 5H84A 1WK4A 1CPSA 1XFOA 4JXQA 3S9NA 2XEIA 1IU8A 3BHXA 4WWVA 5IB0A 3S6HA 3FRMA 3H4QA 1PUAA 2ZEGA 4C7IA 4P4BA 5J8FA 1EE3P 3FNCA 3WT4A 1V0CA 1CPXA 4NXYA 4A31A 1S7LA 5EBVA 3S9LA 3FIXA 2EVNA 2ZEMA 4Q36A 2JEWA 3D7DA 5JGFA 2BSWA 3PEIA 3FF3A 4MRIA 3I3GA 3TTHA 4MHZA 4B10A 3NH8A 1VGYA 1RTQA 2PR8A 4OC0A 4UEFA 1KUXA 2AFSA 2G0BA 3TO9A 6CPAA 4MHYA 4M6GA 2JDCA 4ZY0A 5K8PA 2PVWA 4BMHA 3B7IA 1PU9A 2GIVA 4F0XA 4QBJA 4PK2A 1ELMP 4U9YA 1CP6A 2P6GA 4JLYA 2Z3MA 2PJCA 3JUWA 2DPTA 5K8OA 3DSBA 4KSFA 3SHPA 2CXAA 1BOBA 1TF9A 3B3WA 2NMTA 2HQYA 2YNDA 4CYPA 4LUAA 5K8NA 1Y0YA 4FWUA 4NJRA 3BI1A 4H89A 1YQEA 4AG9A 2B3UA 2PIZA 2WUUA 4UCPA 1U6MA 2F5IA 4CGPA 4JZ0A 4HNXB 1Z9UA 1X10A 2B3VA 1NSAA 4KLVA 3OWCA 4FD4A 5CNPA 3S9MA 4EVYA 4H6ZA 5F09A 2X7BA 1Z8LA 1YR0A 2XEJA 3FX6A 4MFJA 3TCVA 5EMIA 3D7GA 3TX8A 2EK9A 2OB0A 4NGSA 4P4JA 1QSNA 4IAVA 4MCSA 2REFA 5CPAA 3GYAA 1S7KA 2O4HA 2PJ1A 2OZGA 2GU2A 1YSJA 4QC6A 4MHNA 4A33A 1Q2YA 1YW4A 4OC4A 4P4IA 4Z65A 2D4OA 3CPAA 4KOWA 4ZY1A 4F9UA 2PE3A 1GYTA 3B3SA 4OAEA 1Y7EA 2RC4A 3D7HA 1F57A 3F0AA 3SJGA 1KUYA 1QSOA 2FT0A 2G3AA 4KOXA 2ATRA 5F49A 4A95A 2IJZA 1TKHA 3BJ8A 3NH5A 2IMOA 4CRYB 4F0YA 5D8NA 2JEVA 2O53A 5JM6A 4FD5A 2CTBA 2Z3NA 2P0WA 3KKWA 1Y9KA 3KQZA 5J1QA 2ANPA 4OC5A 4KVME 4UIAA 1FT7A 1IOIA 2C6GA 3FECA 4CRZB 2AFXA 2JLMA 3TC8A 4CGNA 1XE4A 1ZG7A 3FH4A 1P0HA 1QSMA 3PFOA 1I1DA 4Q7AA 1ARMA 4A94A 2ZEFA 1R3NA 4KZTA 1LAPA 2Q51A 4M6IA 4NJQA 4X5KA 3FEEA 1AMPA 1M4GA 4R9MA 2YGWA 2PJ4A 4MHPA 4CYQA 4Q38A 4F8ZA 4KS9A 2GLJA 3SI0A 1BO4A 4R3LA 4UWJA 2ZW7A 4OC1A 3T9YA 2PCUA 3P2FA 4C2ZA 2POKA 2FL4A 4BINA 5I4MA 3FVLA 3H8GA 2Z10A 1Z8XA 3GUXA 1TF8A 3QAHA 3MRUA 4L89A 2PRQA 1UWYA 4WJBA 5F46A 1FY7A 2ZELA 3KHXA 3RYOA 3WABA 1M4IA 1QSRA 5HH1A 1IICA 4R76A 5EC4A 1Q2CA 3DR6A 3VATA 2GLFA 2BO9A 2WSAA 5IX3A 2DF5A 2J8MA 1IIDA 4M85A 1B6BA 2OU2A 4A38A 1M44A 4B6ZA 2WPXA 5FVJA 2C1CA 5HXDA 2B58A 2R7HA 2FIAA 4MI4A 1VKCA 4J3GA 4C7HA 3FEDA 3D4UA 3PFEA 2ZEHA 4DYOA 3KQXA 3PBBA 1BPNA 2VXKA 3WC7A 1CBXA 4RS2A 3H8EA 1Z5RA 3I1UA 2JBKA 4DNCA 1OBRA 4KOVA 2IL4A 3B3VA 3RO0A 3CZXA 4W9YA 2FCKA 2XEGA 4OIDA 4R6TA 3HLPA 2JDDA 2B5GB 2QJ8A 3T8WA 4B5PB 1P4NA 4PK3A 2PJ9A 3G8WA 4NGTA 2Z3OA 2EUIA 4QB9A 4CAWA 2EK8A 3B3CA 4OIWA 4FBEA 4ZX8A 4P4FA 1CP7A 1IOFA 4NGPA 2VEZA 1Z4EA 4RUHA 3R1KA 4IK2A 3I9SA 3IC1A 3KGQA 3SJXA 3VWDA 3KASA 4CAXA 3CXQA 5A28A 4LQ6A 2IQ6A 3FBUA 4UFXA 3SXNA 4PXDA 1PCAA 3NE7A 4UBRA 4ZYQA 4YFJA 3VH9A 1YREA 3GLJA 2RB7A 4UCNA 3V8IA 2WZNA 3FMCA 3TOBA 3TT2A 4NGMA 4II9A 3N5FA 4P44A 2GANA 1Z4RA 3IGRA 4CAVA 2BEIA 4MFQA 3PB9X 4PSXA 2C6PA 3IU1A 1J4JA 2VI7A 5DS0A 2K5TA 2RFHA 4MCQA 4HPSA 4KOYA 2Q4ZA 2ODFA 1XF8A 3KR4A 4YU9A 5JH9A 3GIUA 4PXBA 5LRKA 5E96A 3TE4A 1HEEA 2PRBA 2ZEEA 4L8AA 3P2HA 4PPZA 2AE6A 5LYDA 5H86A 1YLOA 4F6AA 2CNTA 1IY7A 2HUZA 2I00A 4XPKA 3W6SA 5KTAA 1M1DA 1M4LA 1LRZA 2Z3KA 3FYNA 3GKRA 3S6KA 4MMOA 2DXQA 5ELYA 4UFVA 4A30A 2Q4VA 1XRYA 4Y49B 4MBUA 3TO7A 4B5OA 2Q4YA 5HVGA 2QMLA 2VL1A 3W91A 3IWGA 3EO4A 2EO8A 3IJ3A 4MY0A 3TFYA 3SJEA 3CXPA 4ZI6A 4R3KA 4HNWB 7CPAA 2PIYA 3EC4A 5LRGA 4B11A 2OOTA 4C68A 1KWMA 1VHOA 1MK4A 2OZHA 1XMTA 2VZYA 3ISZA 3LACA 4YGOA 4F9VA 5C88A 2D4PA 4CAFA 4KSIA 3SJFA 2R98A 4XPDC 3B35A 3IIBA 2YNCA 2Z11A 5AG5A 1LOKA 3JVNA 4BBHA 3IO1A 3WR7A 2J9AA 2V8GA 3EY5A 4TNUA 4A39A 1XBUA 2PJ2A 4R8FA 3RNZA 4B5PA 4NF1A 5IV0A 2B5GA 3NE8A 3UY5A 3BLNA 2ZEOA 3QB8A 1YW6A 4NGRA 2Z3LA 3JRUA 4AB7A 3MN8A 1VHSA 1K4JA 4UCMA 1FNOA 2BOAA 4KOSA 1XJOA 2CTCA 3DGVA 4Y49C 5LRJA 3QAYA 5AG7A 3CDXA 1ZLIA 2V8DA 2J8NA 3KR5A 3ISXA 5GCNA 4GXHA 4MFPA 5F48A 2Y0MA 3D8PA 2O28A 4H6UA 3RZAA 3H8FA 1BAVA 2PJ3A 3KL9A 4OLLA 3R9FA 2VBQA 3D3SA 1S7NA 5ISVA 4A37A 3QNVA 3VWEA 4UWIA 3EFAA 2HV2A 3IWWA 4NFRA 4JXRA 4AVBA 2GE3A 5HVHA 1S3ZA 3KI9A 2Q7BA 3DLJA 4KSAA 5AG6A 2ZOFA 3PZJA 4EWTA 3BXMA 4IF5A 4P4DA 3SI1A 4TWEA 1QMUA 1YMEA 1OZPA 1A2ZA 1NMTA 2P6FA 2I3CA 2J8RA 5CBMA
chains in the Genus database with same CATH topology
1CJWA 5BWAB 3G3SA 3PP9A 2ZW5A 1YVKA 2G3TA 3BJ7A 3TO6A 4QUSA 1YK3A 2CNMA 1KUVA 2WPWA 3B8GA 2FE7A 5G22A 3JTKA 3LODA 1ON0A 2DPSA 3R9EA 4NEXA 4GS4A 1MJAA 2Z3PA 2Q04A 2A4NA 4NCZA 4XPDC 1N71A 2PSWA 1TIQA 4R87A 2FS5A 1Y9WA 2H5MA 3C26A 4E0AA 3FB3A 2YNCC 5C82A 4CYOA 4KLWA 4CAEA 3D2MA 4MFKA 4KOTA 3R9GA 1WWZA 4FD7A 4KVXA 4ZGYB 5J8CA 5KTDA 4U9ZA 3ZJ0A 2QECA 2PC1A 1S60A 2C27A 5DWNA 3DDDA 4XNHB 4XNHC 1NSLA 2I79A 2REEA 2KCWA 4PV6A 4XPDB 5AGEA 4MFLA 4E2AA 2AJ6A 4CS0B 3DNSA 4ZBGA 4PSWA 5HMNA 4HKFA 3T90A 5G21A 4FD6A 1GHEA 4CGOA 3PGPA 3K9UA 2P6EA 4KORA 4MJ8A 2PDOA 4KOUA 5F47A 1M4DA 4B14A 1IB1E 4B12A 2FSRA 4JJXA 3FXTA 1NE9A 3H5ZA 3IWEA 2FIWA 4UFWA 2BL1A 1UFHA 2PQ8A 1Y7RA 2VQYA 3EXNA 4ONUA 2B4DB 5I0CA 3ZZIA 5G20A 5KTCA 1MJ9A 1CM0A 4KVOE 2ARHA 3A9LA 2Q44A 4K30A 3MGDA 4JWPA 1YX0A 3W6XA 2YNEA 1XEBA 1R57A 1YGHA 2CNSA 1XIXA 4JD6A 4NSQA 3F8KA 4XPLA 1IYKA 1L0CA 2CY2A 3LD2A 2B4BA 4MFZA 5DWMA 2OH1A 4A32A 4AG7A 3R95A 4KUBA 4OADA 3R96A 3SXOA 2R1IA 3TOAA 3GY9A 1S7FA 4KUAA 3IU2A 4YRHA 4CGLA 4QVTA 1KZFA 2BUEA 4U5YA 4IUSA 2R8VA 3DR8A 1IYLA 1RO5A 1SQHA 1S5KA 4RI1A 2VZZA 4MHDA 4MY3A 1ZO0A 4UA3A 3D2PA 5JPHA 4C2YA 4R57A 2PR1A 3F5BA 2FXFA 2ZPAA 4M3SA 4AVAA 2ZW4A 2B4DA 4LX9A 1MJBA 4HNYB 3S6GA 2ZXVA 2QIRA 2Q0YA 4B13A 5JQ4A 4C2XA 5AG4A 1QSTA 1RXTA 5G1ZA 2ZW6A 1B87A 4CGMA 3E0KA 5A27A 1YLEA 3S6FA 3N7ZA 4AVCA 1I21A 4ORFA 1YVOA 2OZUA 3CXSA 4E8OA 4I49A 4CYNA 1I12A 4A2ZA 1Q2DA 2Z0ZA 5H84A 1WK4A 4JXQA 5IB0A 3S6HA 3FRMA 3H4QA 1PUAA 4C7IA 5J8FA 3FNCA 1V0CA 4NXYA 4A31A 1S7LA 5EBVA 3FIXA 2EVNA 4Q36A 2BSWA 3I3GA 3TTHA 4B10A 2PR8A 1KUXA 3TO9A 2G0BA 2JDCA 4BMHA 1PU9A 2GIVA 4F0XA 4QBJA 4PK2A 4U9YA 2P6GA 4JLYA 2Z3MA 3JUWA 2DPTA 3DSBA 4KSFA 3SHPA 2CXAA 1BOBA 2NMTA 2HQYA 2YNDA 4CYPA 4LUAA 4H89A 4AG9A 2B3UA 2WUUA 4UCPA 1U6MA 2F5IA 4CGPA 4HNXB 1Z9UA 2B3VA 4KLVA 3OWCA 4FD4A 5CNPA 4EVYA 4H6ZA 2X7BA 3TCVA 1YR0A 4MFJA 2OB0A 1QSNA 2REFA 3GYAA 1S7KA 2OZGA 4QC6A 4A33A 1Q2YA 2D4OA 4KOWA 4OAEA 2RC4A 3F0AA 1KUYA 1QSOA 2FT0A 2G3AA 4KOXA 2ATRA 5F49A 4A95A 3BJ8A 4CRYB 4F0YA 2JEVA 4FD5A 2Z3NA 2P0WA 3KKWA 1Y9KA 4KVME 4CRZB 2JLMA 4CGNA 1XE4A 1P0HA 1QSMA 1I1DA 4KZTA 4X5KA 1M4GA 4R9MA 2YGWA 4CYQA 4Q38A 4KS9A 1BO4A 4R3LA 4UWJA 2ZW7A 3T9YA 3P2FA 4C2ZA 2FL4A 2Z10A 3QAHA 4L89A 5F46A 1FY7A 3RYOA 1M4IA 1QSRA 5HH1A 1IICA 5EC4A 1Q2CA 3DR6A 2WSAA 5IX3A 2J8MA 1IIDA 4M85A 1B6BA 2OU2A 1M44A 2WPXA 5FVJA 2B58A 2R7HA 2FIAA 4MI4A 1VKCA 4J3GA 4C7HA 2VXKA 4RS2A 4DNCA 4KOVA 2IL4A 2FCKA 2JDDA 2B5GB 4B5PB 1P4NA 4PK3A 3G8WA 2Z3OA 2EUIA 4QB9A 4CAWA 2VEZA 1Z4EA 3R1KA 3I9SA 3VWDA 4CAXA 3CXQA 5A28A 3FBUA 4UFXA 3SXNA 3NE7A 4UBRA 4YFJA 1YREA 4UCNA 3V8IA 3TOBA 3TT2A 4II9A 2GANA 1Z4RA 3IGRA 4CAVA 2BEIA 4MFQA 4PSXA 3IU1A 1J4JA 2VI7A 2K5TA 4KOYA 1XF8A 5E96A 3TE4A 2PRBA 4L8AA 3P2HA 2AE6A 5H86A 4F6AA 2CNTA 2HUZA 2I00A 4XPKA 3W6SA 5KTAA 3GKRA 1M1DA 1LRZA 2Z3KA 3FYNA 3S6KA 2DXQA 4UFVA 4A30A 2Q4VA 4Y49B 4MBUA 3TO7A 4B5OA 2Q4YA 2QMLA 3W91A 3IWGA 3EO4A 3TFYA 4MY0A 3CXPA 4R3KA 4HNWB 3EC4A 4B11A 4C68A 1MK4A 2OZHA 1XMTA 2VZYA 4YGOA 5C88A 2D4PA 4CAFA 2R98A 2YNCA 2Z11A 5AG5A 3JVNA 4BBHA 3WR7A 3EY5A 4B5PA 5IV0A 4NF1A 2B5GA 3UY5A 3BLNA 3QB8A 2Z3LA 4AB7A 1VHSA 1K4JA 4UCMA 4KOSA 4Y49C 5AG7A 2J8NA 5GCNA 4MFPA 5F48A 2Y0MA 3D8PA 2O28A 4H6UA 4OLLA 3R9FA 2VBQA 3D3SA 1S7NA 5ISVA 3VWEA 4UWIA 3EFAA 2HV2A 4JXRA 4AVBA 2GE3A 1S3ZA 2Q7BA 4KSAA 5AG6A 3PZJA 4IF5A 2P6FA 1NMTA 1OZPA 2J8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJW A;  3G3S A;  3PP9 A;  2ZW5 A;  1YVK A;  2G3T A;  3BJ7 A;  3TO6 A;  4QUS A;  1YK3 A;  2CNM A;  1KUV A;  2WPW A;  3B8G A;  2FE7 A;  3LOD A;  1ON0 A;  3R9E A;  4NEX A;  4GS4 A;  1MJA A;  2Q04 A;  2A4N A;  4NCZ A;  4XPD C;  1N71 A;  2PSW A;  1TIQ A;  4R87 A;  2FS5 A;  1Y9W A;  2H5M A;  3C26 A;  4E0A A;  3FB3 A;  5C82 A;  4KLW A;  3D2M A;  4KOT A;  3R9G A;  1WWZ A;  4FD7 A;  4KVX A;  5J8C A;  5KTD A;  4U9Z A;  3ZJ0 A;  2QEC A;  2PC1 A;  1S60 A;  2C27 A;  5DWN A;  3DDD A;  4XNH B;  4XNH C;  1NSL A;  2I79 A;  2REE A;  2KCW A;  4PV6 A;  4XPD B;  4E2A A;  2AJ6 A;  4CS0 B;  3DNS A;  4ZBG A;  4PSW A;  5HMN A;  4HKF A;  3T90 A;  4FD6 A;  1GHE A;  3PGP A;  3K9U A;  2P6E A;  4KOR A;  4MJ8 A;  2PDO A;  4KOU A;  5F47 A;  1M4D A;  1IB1 E;  2FSR A;  4JJX A;  3FXT A;  1NE9 A;  2FIW A;  2BL1 A;  1UFH A;  2PQ8 A;  1Y7R A;  2VQY A;  3EXN A;  4ONU A;  2B4D B;  5I0C A;  3ZZI A;  5KTC A;  1MJ9 A;  1CM0 A;  4KVO E;  2ARH A;  2Q44 A;  4K30 A;  3MGD A;  4JWP A;  1YX0 A;  3W6X A;  1XEB A;  1R57 A;  1YGH A;  2CNS A;  1XIX A;  4JD6 A;  4NSQ A;  3F8K A;  4XPL A;  1IYK A;  1L0C A;  2CY2 A;  3LD2 A;  2B4B A;  5DWM A;  2OH1 A;  4AG7 A;  3R95 A;  4KUB A;  4OAD A;  3R96 A;  3SXO A;  2R1I A;  3TOA A;  3GY9 A;  1S7F A;  4KUA A;  4YRH A;  4QVT A;  1KZF A;  2BUE A;  4U5Y A;  4IUS A;  2R8V A;  3DR8 A;  1IYL A;  1RO5 A;  1SQH A;  1S5K A;  4RI1 A;  2VZZ A;  4MHD A;  4MY3 A;  4UA3 A;  3D2P A;  5JPH A;  4R57 A;  2PR1 A;  3F5B A;  2FXF A;  2ZPA A;  4M3S A;  4AVA A;  2ZW4 A;  2B4D A;  4LX9 A;  1MJB A;  4HNY B;  3S6G A;  2ZXV A;  2QIR A;  2Q0Y A;  5JQ4 A;  1QST A;  1RXT A;  2ZW6 A;  1B87 A;  3E0K A;  1YLE A;  3S6F A;  3N7Z A;  4AVC A;  1I21 A;  4ORF A;  1YVO A;  2OZU A;  3CXS A;  4E8O A;  4I49 A;  1I12 A;  1Q2D A;  2Z0Z A;  5H84 A;  1WK4 A;  4JXQ A;  5IB0 A;  3S6H A;  3FRM A;  3H4Q A;  1PUA A;  5J8F A;  3FNC A;  1V0C A;  4NXY A;  1S7L A;  5EBV A;  3FIX A;  2EVN A;  2BSW A;  3I3G A;  3TTH A;  2PR8 A;  1KUX A;  3TO9 A;  2G0B A;  2JDC A;  4BMH A;  1PU9 A;  2GIV A;  4QBJ A;  4PK2 A;  4U9Y A;  2P6G A;  4JLY A;  3JUW A;  3DSB A;  3SHP A;  1BOB A;  2NMT A;  2HQY A;  4LUA A;  4H89 A;  4AG9 A;  2B3U A;  1U6M A;  2F5I A;  4HNX B;  1Z9U A;  2B3V A;  4KLV A;  3OWC A;  4FD4 A;  5CNP A;  4EVY A;  4H6Z A;  2X7B A;  3TCV A;  1YR0 A;  2OB0 A;  1QSN A;  2REF A;  3GYA A;  1S7K A;  2OZG A;  4QC6 A;  1Q2Y A;  2D4O A;  4KOW A;  4OAE A;  2RC4 A;  3F0A A;  1KUY A;  1QSO A;  2FT0 A;  2G3A A;  4KOX A;  2ATR A;  5F49 A;  3BJ8 A;  4CRY B;  4F0Y A;  2JEV A;  4FD5 A;  2P0W A;  3KKW A;  1Y9K A;  4KVM E;  4CRZ B;  2JLM A;  1XE4 A;  1P0H A;  1QSM A;  1I1D A;  4KZT A;  4X5K A;  1M4G A;  4R9M A;  1BO4 A;  4R3L A;  4UWJ A;  2ZW7 A;  3T9Y A;  3P2F A;  2FL4 A;  2Z10 A;  3QAH A;  4L89 A;  5F46 A;  1FY7 A;  3RYO A;  1M4I A;  1QSR A;  5HH1 A;  1IIC A;  5EC4 A;  1Q2C A;  3DR6 A;  5IX3 A;  2J8M A;  1IID A;  4M85 A;  1B6B A;  2OU2 A;  1M44 A;  2WPX A;  5FVJ A;  2B58 A;  2R7H A;  2FIA A;  4MI4 A;  1VKC A;  4J3G A;  2VXK A;  4RS2 A;  4DNC A;  4KOV A;  2IL4 A;  2FCK A;  2JDD A;  2B5G B;  4B5P B;  1P4N A;  4PK3 A;  3G8W A;  2EUI A;  4QB9 A;  4CAW A;  2VEZ A;  1Z4E A;  3R1K A;  3I9S A;  3VWD A;  4CAX A;  3CXQ A;  3FBU A;  3SXN A;  3NE7 A;  4UBR A;  4YFJ A;  1YRE A;  3V8I A;  3TOB A;  3TT2 A;  4II9 A;  2GAN A;  1Z4R A;  3IGR A;  4CAV A;  2BEI A;  4PSX A;  1J4J A;  2VI7 A;  2K5T A;  4KOY A;  1XF8 A;  5E96 A;  3TE4 A;  2PRB A;  4L8A A;  3P2H A;  2AE6 A;  5H86 A;  4F6A A;  2CNT A;  2HUZ A;  2I00 A;  4XPK A;  3W6S A;  5KTA A;  1M1D A;  3GKR A;  1LRZ A;  3FYN A;  3S6K A;  2DXQ A;  2Q4V A;  4Y49 B;  4MBU A;  3TO7 A;  4B5O A;  2Q4Y A;  2QML A;  3W91 A;  3IWG A;  3EO4 A;  3TFY A;  4MY0 A;  3CXP A;  4R3K A;  4HNW B;  3EC4 A;  1MK4 A;  2OZH A;  1XMT A;  2VZY A;  4YGO A;  5C88 A;  2D4P A;  2R98 A;  2Z11 A;  3JVN A;  3WR7 A;  3EY5 A;  4B5P A;  5IV0 A;  4NF1 A;  2B5G A;  3UY5 A;  3BLN A;  3QB8 A;  4AB7 A;  1VHS A;  1K4J A;  4KOS A;  4Y49 C;  2J8N A;  5GCN A;  5F48 A;  2Y0M A;  3D8P A;  2O28 A;  4H6U A;  4OLL A;  3R9F A;  2VBQ A;  3D3S A;  1S7N A;  5ISV A;  3VWE A;  4UWI A;  3EFA A;  2HV2 A;  4JXR A;  4AVB A;  2GE3 A;  1S3Z A;  2Q7B A;  3PZJ A;  4IF5 A;  2P6F A;  1NMT A;  1OZP A;  2J8R A; 
#chains in the Genus database with same CATH topology
 3V38 A;  1CJW A;  2GRE A;  5BWA B;  3G3S A;  4ZY2 A;  2PJ6 A;  3PP9 A;  4PXC A;  1TXR A;  2ZW5 A;  1YVK A;  2G3T A;  3BJ7 A;  1LAM A;  3TO6 A;  4QUS A;  1ARL A;  1YK3 A;  2CNM A;  1KUV A;  3FJU A;  2WPW A;  3B8G A;  2FE7 A;  4X3R A;  3PRT A;  4OC2 A;  3JTK A;  5G22 A;  3LOD A;  3CT9 A;  1ON0 A;  2C6C A;  5LYF A;  2DPS A;  4MCR A;  2V8V A;  1ZLH A;  3R9E A;  4NEX A;  5LYL A;  4GS4 A;  1IGB A;  1MJA A;  2Z3P A;  2QVP A;  2Q04 A;  1VIX A;  2A4N A;  4GM5 A;  1CG2 A;  1N71 A;  2PJB A;  2PSW A;  1TIQ A;  2OR4 A;  3K9T A;  4R87 A;  2G9D A;  3NA6 A;  1XOV A;  2PJ0 A;  3PB4 X;  2AFO A;  2V77 A;  5LYI A;  2FS5 A;  1Y9W A;  3PB7 X;  2H5M A;  3C26 A;  4E0A A;  4EME A;  3FB3 A;  2YNC C;  5C82 A;  4CYO A;  2PJ7 A;  4KLW A;  4CAE A;  3D2M A;  4MFK A;  4UEZ A;  4KOT A;  3R9G A;  2QYV A;  1WWZ A;  1JQG A;  2BCO A;  4FD7 A;  2PJ8 A;  5IB9 A;  4KVX A;  4X2T A;  4ZGY B;  5J8C A;  4K3N A;  5KTD A;  4OME A;  4BD9 A;  4U9Z A;  2GFQ A;  4UEE A;  4UIB A;  3ZJ0 A;  4AXV A;  2QEC A;  4JYW A;  4OC3 A;  1F2O A;  2PC1 A;  1S60 A;  3LWU A;  3D7F A;  2C27 A;  5DWN A;  3DDD A;  4XNH B;  3B3T A;  4XNH C;  1NSL A;  3VAR A;  2I79 A;  2REE A;  2KCW A;  2CF4 A;  4R7M A;  4PV6 A;  2ZOG A;  4XPD B;  5AGE A;  2EWB A;  4MFL A;  4E2A A;  5D29 A;  4FUU A;  2AJ6 A;  4CS0 B;  3DNS A;  4ZBG A;  4NGN A;  4MCP A;  1TKF A;  1BPM A;  1Y0R A;  4HKF A;  4PSW A;  5HMN A;  3KHZ A;  2ZEP A;  4G1P A;  4FD6 A;  1GHE A;  5G21 A;  3T90 A;  2F8H A;  3D67 A;  3LMS A;  4CGO A;  2AFU A;  1X12 A;  4RN7 A;  3PGP A;  3K9U A;  2P6E A;  4KOR A;  4MJ8 A;  2PDO A;  3KZW A;  3IEH A;  4KOU A;  5F47 A;  4ONW A;  1M4D A;  4B14 A;  4NGQ A;  1IB1 E;  1Q7L A;  1LAN A;  4B12 A;  1DTD A;  2FSR A;  4JJX A;  3FXT A;  3RBU A;  3WC5 A;  3K2K A;  2ZED A;  3V7Z A;  1DE4 C;  1NE9 A;  3H5Z A;  3IWE A;  3BI0 A;  2FIW A;  4UFW A;  1BLL E;  2BL1 A;  4LQG A;  1UFH A;  2PQ8 A;  1ZG9 A;  2ZEN A;  1Y7R A;  2VQY A;  1VHE A;  4YWY A;  3EXN A;  4ONU A;  2B4D B;  2V8H A;  5I0C A;  1HDU A;  3NFZ A;  3ZZI A;  4OP4 A;  4DUK A;  3NH4 A;  5G20 A;  5KTC A;  1MJ9 A;  1H8L A;  4P4E A;  1CM0 A;  2WYR A;  1Z2L A;  4PXE A;  4KVO E;  2ARH A;  2F7V A;  2Q44 A;  3A9L A;  4K30 A;  4P10 A;  3MGD A;  4M6H A;  4JWP A;  1YX0 A;  4ZX9 A;  3W6X A;  2YNE A;  1XEB A;  3HUV A;  4H2K A;  3L2N A;  1R57 A;  1YGH A;  2EBJ A;  1R43 A;  2CNS A;  1XIX A;  4JD6 A;  4NSQ A;  3F8K A;  4XPL A;  3WC6 A;  3IFE A;  1IYK A;  1F2P A;  1LFW A;  1L0C A;  1ELL P;  2CIJ A;  1XMB A;  2CY2 A;  3LD2 A;  3RAM A;  2Q7S A;  4CPA A;  2B4B A;  1AYE A;  1JWQ A;  4MFZ A;  1PYT B;  3D66 A;  5DWM A;  2OH1 A;  3PB8 X;  4A32 A;  2NYQ A;  4AG7 A;  2AFZ A;  3B2Y A;  3R95 A;  3GB0 A;  4KUB A;  4OAD A;  3R96 A;  3SXO A;  5K8M A;  2R1I A;  3TOA A;  1LCP A;  3GY9 A;  4MXU A;  3CPX A;  1S7F A;  1CX8 A;  2PVV A;  3IU2 A;  4KUA A;  1ZG8 A;  4P6Y A;  4P45 A;  4YRH A;  4QVT A;  4CGL A;  4UF4 A;  1KZF A;  2BUE A;  4U5Y A;  2HC9 A;  4IUS A;  2R8V A;  1HDQ A;  2XEF A;  3DR8 A;  1IYL A;  1RO5 A;  1SQH A;  4EFD A;  1S5K A;  4RI1 A;  1AUG A;  2VZZ A;  4MHD A;  4MY3 A;  1ZO0 A;  4UA3 A;  3SI2 A;  3D2P A;  1TKJ A;  5JPH A;  1QQ9 A;  4PQA A;  4C2Y A;  3PBE A;  4R57 A;  4OKO A;  2PR1 A;  3F5B A;  2FXF A;  2ZPA A;  2PJA A;  2HB6 A;  4M3S A;  4AVA A;  2ZW4 A;  2B4D A;  4LX9 A;  1MJB A;  4HNY B;  3S6G A;  2ZXV A;  2QIR A;  2Q0Y A;  4B13 A;  2FVG A;  2PJ5 A;  4NCZ A;  2ABZ A;  2Q43 A;  5JQ4 A;  3D68 A;  4FAI A;  2AFW A;  3PB6 X;  4C2X A;  5AG4 A;  4X8I A;  1QST A;  1RXT A;  5HVF A;  5G1Z A;  2ZW6 A;  1B87 A;  4DJL A;  4CGM A;  3E0K A;  5A27 A;  1YLE A;  3S6F A;  2JBJ A;  2NSM A;  3N7Z A;  8CPA A;  4AVC A;  1I21 A;  4ORF A;  2DEA A;  1YVO A;  2OZU A;  3CXS A;  4E8O A;  4I49 A;  4CYN A;  2AFM A;  1I12 A;  4IHM A;  5THW A;  4A2Z A;  1Q2D A;  1Z8T A;  1Z8W A;  4O23 A;  2Z0Z A;  5H84 A;  1WK4 A;  1CPS A;  1XFO A;  4JXQ A;  3S9N A;  2XEI A;  1IU8 A;  3BHX A;  4WWV A;  5IB0 A;  3S6H A;  3FRM A;  3H4Q A;  1PUA A;  2ZEG A;  4C7I A;  4P4B A;  5J8F A;  1EE3 P;  3FNC A;  3WT4 A;  1V0C A;  1CPX A;  4NXY A;  4A31 A;  1S7L A;  5EBV A;  3S9L A;  3FIX A;  2EVN A;  2ZEM A;  4Q36 A;  2JEW A;  3D7D A;  5JGF A;  2BSW A;  3PEI A;  3FF3 A;  4MRI A;  3I3G A;  3TTH A;  4MHZ A;  4B10 A;  3NH8 A;  1VGY A;  1RTQ A;  2PR8 A;  4OC0 A;  4UEF A;  1KUX A;  2AFS A;  2G0B A;  3TO9 A;  6CPA A;  4MHY A;  4M6G A;  2JDC A;  4ZY0 A;  5K8P A;  2PVW A;  4BMH A;  3B7I A;  1PU9 A;  2GIV A;  4F0X A;  4QBJ A;  4PK2 A;  1ELM P;  4U9Y A;  1CP6 A;  2P6G A;  4JLY A;  2Z3M A;  2PJC A;  3JUW A;  2DPT A;  5K8O A;  3DSB A;  4KSF A;  3SHP A;  2CXA A;  1BOB A;  1TF9 A;  3B3W A;  2NMT A;  2HQY A;  2YND A;  4CYP A;  4LUA A;  5K8N A;  1Y0Y A;  4FWU A;  4NJR A;  3BI1 A;  4H89 A;  1YQE A;  4AG9 A;  2B3U A;  2PIZ A;  2WUU A;  4UCP A;  1U6M A;  2F5I A;  4CGP A;  4JZ0 A;  4HNX B;  1Z9U A;  1X10 A;  2B3V A;  1NSA A;  4KLV A;  3OWC A;  4FD4 A;  5CNP A;  3S9M A;  4EVY A;  4H6Z A;  5F09 A;  2X7B A;  1Z8L A;  1YR0 A;  2XEJ A;  3FX6 A;  4MFJ A;  3TCV A;  5EMI A;  3D7G A;  3TX8 A;  2EK9 A;  2OB0 A;  4NGS A;  4P4J A;  1QSN A;  4IAV A;  4MCS A;  2REF A;  5CPA A;  3GYA A;  1S7K A;  2O4H A;  2PJ1 A;  2OZG A;  2GU2 A;  1YSJ A;  4QC6 A;  4MHN A;  4A33 A;  1Q2Y A;  1YW4 A;  4OC4 A;  4P4I A;  4Z65 A;  2D4O A;  3CPA A;  4KOW A;  4ZY1 A;  4F9U A;  2PE3 A;  1GYT A;  3B3S A;  4OAE A;  1Y7E A;  2RC4 A;  3D7H A;  1F57 A;  3F0A A;  3SJG A;  1KUY A;  1QSO A;  2FT0 A;  2G3A A;  4KOX A;  2ATR A;  5F49 A;  4A95 A;  2IJZ A;  1TKH A;  3BJ8 A;  3NH5 A;  2IMO A;  4CRY B;  4F0Y A;  5D8N A;  2JEV A;  2O53 A;  5JM6 A;  4FD5 A;  2CTB A;  2Z3N A;  2P0W A;  3KKW A;  1Y9K A;  3KQZ A;  5J1Q A;  2ANP A;  4OC5 A;  4KVM E;  4UIA A;  1FT7 A;  1IOI A;  2C6G A;  3FEC A;  4CRZ B;  2AFX A;  2JLM A;  3TC8 A;  4CGN A;  1XE4 A;  1ZG7 A;  3FH4 A;  1P0H A;  1QSM A;  3PFO A;  1I1D A;  4Q7A A;  1ARM A;  4A94 A;  2ZEF A;  1R3N A;  4KZT A;  1LAP A;  2Q51 A;  4M6I A;  4NJQ A;  4X5K A;  3FEE A;  1AMP A;  1M4G A;  4R9M A;  2YGW A;  2PJ4 A;  4MHP A;  4CYQ A;  4Q38 A;  4F8Z A;  4KS9 A;  2GLJ A;  3SI0 A;  1BO4 A;  4R3L A;  4UWJ A;  2ZW7 A;  4OC1 A;  3T9Y A;  2PCU A;  3P2F A;  4C2Z A;  2POK A;  2FL4 A;  4BIN A;  5I4M A;  3FVL A;  3H8G A;  2Z10 A;  1Z8X A;  3GUX A;  1TF8 A;  3QAH A;  3MRU A;  4L89 A;  2PRQ A;  1UWY A;  4WJB A;  5F46 A;  1FY7 A;  2ZEL A;  3KHX A;  3RYO A;  3WAB A;  1M4I A;  1QSR A;  5HH1 A;  1IIC A;  4R76 A;  5EC4 A;  1Q2C A;  3DR6 A;  3VAT A;  2GLF A;  2BO9 A;  2WSA A;  5IX3 A;  2DF5 A;  2J8M A;  1IID A;  4M85 A;  1B6B A;  2OU2 A;  4A38 A;  1M44 A;  4B6Z A;  2WPX A;  5FVJ A;  2C1C A;  5HXD A;  2B58 A;  2R7H A;  2FIA A;  4MI4 A;  1VKC A;  4J3G A;  4C7H A;  3FED A;  3D4U A;  3PFE A;  2ZEH A;  4DYO A;  3KQX A;  3PBB A;  1BPN A;  2VXK A;  3WC7 A;  1CBX A;  4RS2 A;  3H8E A;  1Z5R A;  3I1U A;  2JBK A;  4DNC A;  1OBR A;  4KOV A;  2IL4 A;  3B3V A;  3RO0 A;  3CZX A;  4W9Y A;  2FCK A;  2XEG A;  4OID A;  4R6T A;  3HLP A;  2JDD A;  2B5G B;  2QJ8 A;  3T8W A;  4B5P B;  1P4N A;  4PK3 A;  2PJ9 A;  3G8W A;  4NGT A;  2Z3O A;  2EUI A;  4QB9 A;  4CAW A;  2EK8 A;  3B3C A;  4OIW A;  4FBE A;  4ZX8 A;  4P4F A;  1CP7 A;  1IOF A;  4NGP A;  2VEZ A;  1Z4E A;  4RUH A;  3R1K A;  4IK2 A;  3I9S A;  3IC1 A;  3KGQ A;  3SJX A;  3VWD A;  3KAS A;  4CAX A;  3CXQ A;  5A28 A;  4LQ6 A;  2IQ6 A;  3FBU A;  4UFX A;  3SXN A;  4PXD A;  1PCA A;  3NE7 A;  4UBR A;  4ZYQ A;  4YFJ A;  3VH9 A;  1YRE A;  3GLJ A;  2RB7 A;  4UCN A;  3V8I A;  2WZN A;  3FMC A;  3TOB A;  3TT2 A;  4NGM A;  4II9 A;  3N5F A;  4P44 A;  2GAN A;  1Z4R A;  3IGR A;  4CAV A;  2BEI A;  4MFQ A;  3PB9 X;  4PSX A;  2C6P A;  3IU1 A;  1J4J A;  2VI7 A;  5DS0 A;  2K5T A;  2RFH A;  4MCQ A;  4HPS A;  4KOY A;  2Q4Z A;  2ODF A;  1XF8 A;  3KR4 A;  4YU9 A;  5JH9 A;  3GIU A;  4PXB A;  5LRK A;  5E96 A;  3TE4 A;  1HEE A;  2PRB A;  2ZEE A;  4L8A A;  3P2H A;  4PPZ A;  2AE6 A;  5LYD A;  5H86 A;  1YLO A;  4F6A A;  2CNT A;  1IY7 A;  2HUZ A;  2I00 A;  4XPK A;  3W6S A;  5KTA A;  1M1D A;  1M4L A;  1LRZ A;  2Z3K A;  3FYN A;  3GKR A;  3S6K A;  4MMO A;  2DXQ A;  5ELY A;  4UFV A;  4A30 A;  2Q4V A;  1XRY A;  4Y49 B;  4MBU A;  3TO7 A;  4B5O A;  2Q4Y A;  5HVG A;  2QML A;  2VL1 A;  3W91 A;  3IWG A;  3EO4 A;  2EO8 A;  3IJ3 A;  4MY0 A;  3TFY A;  3SJE A;  3CXP A;  4ZI6 A;  4R3K A;  4HNW B;  7CPA A;  2PIY A;  3EC4 A;  5LRG A;  4B11 A;  2OOT A;  4C68 A;  1KWM A;  1VHO A;  1MK4 A;  2OZH A;  1XMT A;  2VZY A;  3ISZ A;  3LAC A;  4YGO A;  4F9V A;  5C88 A;  2D4P A;  4CAF A;  4KSI A;  3SJF A;  2R98 A;  4XPD C;  3B35 A;  3IIB A;  2YNC A;  2Z11 A;  5AG5 A;  1LOK A;  3JVN A;  4BBH A;  3IO1 A;  3WR7 A;  2J9A A;  2V8G A;  3EY5 A;  4TNU A;  4A39 A;  1XBU A;  2PJ2 A;  4R8F A;  3RNZ A;  4B5P A;  4NF1 A;  5IV0 A;  2B5G A;  3NE8 A;  3UY5 A;  3BLN A;  2ZEO A;  3QB8 A;  1YW6 A;  4NGR A;  2Z3L A;  3JRU A;  4AB7 A;  3MN8 A;  1VHS A;  1K4J A;  4UCM A;  1FNO A;  2BOA A;  4KOS A;  1XJO A;  2CTC A;  3DGV A;  4Y49 C;  5LRJ A;  3QAY A;  5AG7 A;  3CDX A;  1ZLI A;  2V8D A;  2J8N A;  3KR5 A;  3ISX A;  5GCN A;  4GXH A;  4MFP A;  5F48 A;  2Y0M A;  3D8P A;  2O28 A;  4H6U A;  3RZA A;  3H8F A;  1BAV A;  2PJ3 A;  3KL9 A;  4OLL A;  3R9F A;  2VBQ A;  3D3S A;  1S7N A;  5ISV A;  4A37 A;  3QNV A;  3VWE A;  4UWI A;  3EFA A;  2HV2 A;  3IWW A;  4NFR A;  4JXR A;  4AVB A;  2GE3 A;  5HVH A;  1S3Z A;  3KI9 A;  2Q7B A;  3DLJ A;  4KSA A;  5AG6 A;  2ZOF A;  3PZJ A;  4EWT A;  3BXM A;  4IF5 A;  4P4D A;  3SI1 A;  4TWE A;  1QMU A;  1YME A;  1OZP A;  1A2Z A;  1NMT A;  2P6F A;  2I3C A;  2J8R A;  5CBM A; 
#chains in the Genus database with same CATH homology
 1CJW A;  5BWA B;  3G3S A;  3PP9 A;  2ZW5 A;  1YVK A;  2G3T A;  3BJ7 A;  3TO6 A;  4QUS A;  1YK3 A;  2CNM A;  1KUV A;  2WPW A;  3B8G A;  2FE7 A;  5G22 A;  3JTK A;  3LOD A;  1ON0 A;  2DPS A;  3R9E A;  4NEX A;  4GS4 A;  1MJA A;  2Z3P A;  2Q04 A;  2A4N A;  4NCZ A;  4XPD C;  1N71 A;  2PSW A;  1TIQ A;  4R87 A;  2FS5 A;  1Y9W A;  2H5M A;  3C26 A;  4E0A A;  3FB3 A;  2YNC C;  5C82 A;  4CYO A;  4KLW A;  4CAE A;  3D2M A;  4MFK A;  4KOT A;  3R9G A;  1WWZ A;  4FD7 A;  4KVX A;  4ZGY B;  5J8C A;  5KTD A;  4U9Z A;  3ZJ0 A;  2QEC A;  2PC1 A;  1S60 A;  2C27 A;  5DWN A;  3DDD A;  4XNH B;  4XNH C;  1NSL A;  2I79 A;  2REE A;  2KCW A;  4PV6 A;  4XPD B;  5AGE A;  4MFL A;  4E2A A;  2AJ6 A;  4CS0 B;  3DNS A;  4ZBG A;  4PSW A;  5HMN A;  4HKF A;  3T90 A;  5G21 A;  4FD6 A;  1GHE A;  4CGO A;  3PGP A;  3K9U A;  2P6E A;  4KOR A;  4MJ8 A;  2PDO A;  4KOU A;  5F47 A;  1M4D A;  4B14 A;  1IB1 E;  4B12 A;  2FSR A;  4JJX A;  3FXT A;  1NE9 A;  3H5Z A;  3IWE A;  2FIW A;  4UFW A;  2BL1 A;  1UFH A;  2PQ8 A;  1Y7R A;  2VQY A;  3EXN A;  4ONU A;  2B4D B;  5I0C A;  3ZZI A;  5G20 A;  5KTC A;  1MJ9 A;  1CM0 A;  4KVO E;  2ARH A;  3A9L A;  2Q44 A;  4K30 A;  3MGD A;  4JWP A;  1YX0 A;  3W6X A;  2YNE A;  1XEB A;  1R57 A;  1YGH A;  2CNS A;  1XIX A;  4JD6 A;  4NSQ A;  3F8K A;  4XPL A;  1IYK A;  1L0C A;  2CY2 A;  3LD2 A;  2B4B A;  4MFZ A;  5DWM A;  2OH1 A;  4A32 A;  4AG7 A;  3R95 A;  4KUB A;  4OAD A;  3R96 A;  3SXO A;  2R1I A;  3TOA A;  3GY9 A;  1S7F A;  4KUA A;  3IU2 A;  4YRH A;  4CGL A;  4QVT A;  1KZF A;  2BUE A;  4U5Y A;  4IUS A;  2R8V A;  3DR8 A;  1IYL A;  1RO5 A;  1SQH A;  1S5K A;  4RI1 A;  2VZZ A;  4MHD A;  4MY3 A;  1ZO0 A;  4UA3 A;  3D2P A;  5JPH A;  4C2Y A;  4R57 A;  2PR1 A;  3F5B A;  2FXF A;  2ZPA A;  4M3S A;  4AVA A;  2ZW4 A;  2B4D A;  4LX9 A;  1MJB A;  4HNY B;  3S6G A;  2ZXV A;  2QIR A;  2Q0Y A;  4B13 A;  5JQ4 A;  4C2X A;  5AG4 A;  1QST A;  1RXT A;  5G1Z A;  2ZW6 A;  1B87 A;  4CGM A;  3E0K A;  5A27 A;  1YLE A;  3S6F A;  3N7Z A;  4AVC A;  1I21 A;  4ORF A;  1YVO A;  2OZU A;  3CXS A;  4E8O A;  4I49 A;  4CYN A;  1I12 A;  4A2Z A;  1Q2D A;  2Z0Z A;  5H84 A;  1WK4 A;  4JXQ A;  5IB0 A;  3S6H A;  3FRM A;  3H4Q A;  1PUA A;  4C7I A;  5J8F A;  3FNC A;  1V0C A;  4NXY A;  4A31 A;  1S7L A;  5EBV A;  3FIX A;  2EVN A;  4Q36 A;  2BSW A;  3I3G A;  3TTH A;  4B10 A;  2PR8 A;  1KUX A;  3TO9 A;  2G0B A;  2JDC A;  4BMH A;  1PU9 A;  2GIV A;  4F0X A;  4QBJ A;  4PK2 A;  4U9Y A;  2P6G A;  4JLY A;  2Z3M A;  3JUW A;  2DPT A;  3DSB A;  4KSF A;  3SHP A;  2CXA A;  1BOB A;  2NMT A;  2HQY A;  2YND A;  4CYP A;  4LUA A;  4H89 A;  4AG9 A;  2B3U A;  2WUU A;  4UCP A;  1U6M A;  2F5I A;  4CGP A;  4HNX B;  1Z9U A;  2B3V A;  4KLV A;  3OWC A;  4FD4 A;  5CNP A;  4EVY A;  4H6Z A;  2X7B A;  3TCV A;  1YR0 A;  4MFJ A;  2OB0 A;  1QSN A;  2REF A;  3GYA A;  1S7K A;  2OZG A;  4QC6 A;  4A33 A;  1Q2Y A;  2D4O A;  4KOW A;  4OAE A;  2RC4 A;  3F0A A;  1KUY A;  1QSO A;  2FT0 A;  2G3A A;  4KOX A;  2ATR A;  5F49 A;  4A95 A;  3BJ8 A;  4CRY B;  4F0Y A;  2JEV A;  4FD5 A;  2Z3N A;  2P0W A;  3KKW A;  1Y9K A;  4KVM E;  4CRZ B;  2JLM A;  4CGN A;  1XE4 A;  1P0H A;  1QSM A;  1I1D A;  4KZT A;  4X5K A;  1M4G A;  4R9M A;  2YGW A;  4CYQ A;  4Q38 A;  4KS9 A;  1BO4 A;  4R3L A;  4UWJ A;  2ZW7 A;  3T9Y A;  3P2F A;  4C2Z A;  2FL4 A;  2Z10 A;  3QAH A;  4L89 A;  5F46 A;  1FY7 A;  3RYO A;  1M4I A;  1QSR A;  5HH1 A;  1IIC A;  5EC4 A;  1Q2C A;  3DR6 A;  2WSA A;  5IX3 A;  2J8M A;  1IID A;  4M85 A;  1B6B A;  2OU2 A;  1M44 A;  2WPX A;  5FVJ A;  2B58 A;  2R7H A;  2FIA A;  4MI4 A;  1VKC A;  4J3G A;  4C7H A;  2VXK A;  4RS2 A;  4DNC A;  4KOV A;  2IL4 A;  2FCK A;  2JDD A;  2B5G B;  4B5P B;  1P4N A;  4PK3 A;  3G8W A;  2Z3O A;  2EUI A;  4QB9 A;  4CAW A;  2VEZ A;  1Z4E A;  3R1K A;  3I9S A;  3VWD A;  4CAX A;  3CXQ A;  5A28 A;  3FBU A;  4UFX A;  3SXN A;  3NE7 A;  4UBR A;  4YFJ A;  1YRE A;  4UCN A;  3V8I A;  3TOB A;  3TT2 A;  4II9 A;  2GAN A;  1Z4R A;  3IGR A;  4CAV A;  2BEI A;  4MFQ A;  4PSX A;  3IU1 A;  1J4J A;  2VI7 A;  2K5T A;  4KOY A;  1XF8 A;  5E96 A;  3TE4 A;  2PRB A;  4L8A A;  3P2H A;  2AE6 A;  5H86 A;  4F6A A;  2CNT A;  2HUZ A;  2I00 A;  4XPK A;  3W6S A;  5KTA A;  3GKR A;  1M1D A;  1LRZ A;  2Z3K A;  3FYN A;  3S6K A;  2DXQ A;  4UFV A;  4A30 A;  2Q4V A;  4Y49 B;  4MBU A;  3TO7 A;  4B5O A;  2Q4Y A;  2QML A;  3W91 A;  3IWG A;  3EO4 A;  3TFY A;  4MY0 A;  3CXP A;  4R3K A;  4HNW B;  3EC4 A;  4B11 A;  4C68 A;  1MK4 A;  2OZH A;  1XMT A;  2VZY A;  4YGO A;  5C88 A;  2D4P A;  4CAF A;  2R98 A;  2YNC A;  2Z11 A;  5AG5 A;  3JVN A;  4BBH A;  3WR7 A;  3EY5 A;  4B5P A;  5IV0 A;  4NF1 A;  2B5G A;  3UY5 A;  3BLN A;  3QB8 A;  2Z3L A;  4AB7 A;  1VHS A;  1K4J A;  4UCM A;  4KOS A;  4Y49 C;  5AG7 A;  2J8N A;  5GCN A;  4MFP A;  5F48 A;  2Y0M A;  3D8P A;  2O28 A;  4H6U A;  4OLL A;  3R9F A;  2VBQ A;  3D3S A;  1S7N A;  5ISV A;  3VWE A;  4UWI A;  3EFA A;  2HV2 A;  4JXR A;  4AVB A;  2GE3 A;  1S3Z A;  2Q7B A;  4KSA A;  5AG6 A;  3PZJ A;  4IF5 A;  2P6F A;  1NMT A;  1OZP A;  2J8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...