5F47A

Crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample in complex with trehalose
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
151
structure length
151
Chain Sequence
IDNFLKIERLAENDLPKFIQLIRLFEAVFEMKNFSIPDSEHLQKLLNQNNFYVFVALLENKIVGGLTSYVLEQYYSEKPLAYIYDLAVDTNWQRQGIGKKLITATNQFYTEKGFEEVFVQADKVDDYALDFYRSTKPTAEEQVVHFYYTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aminoglycoside acetyltransferase meta-AAC0020
publication title Structural and Functional Survey of Environmental Aminoglycoside Acetyltransferases Reveals Functionality of Resistance Enzymes.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Transferase
total genus 36
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5f47A00
2ZW7A 2J8NA 3SXOA 4PK3A 4M85A 1MJBA 4AVCA 4NXYA 3C26A 1M4GA 4R87A 2GANA 4MY0A 4AVAA 1Z4RA 5EC4A 4NF1A 1QSMA 1Q2YA 1LRZA 4H6ZA 4B5OA 2B3UA 3CXSA 1XIXA 4KOWA 4NSQA 3F5BA 3ZJ0A 2B4DB 1Z4EA 3PP9A 1IICA 1BO4A 2VXKA 2R1IA 3SHPA 4J3GA 2Q0YA 3JUWA 3TCVA 3BJ7A 3W6SA 5ISVA 5H84A 3PGPA 1I12A 3P2FA 3KKWA 4HNXB 2ZW4A 4H6UA 5E96A 3FXTA 2Q44A 5DWNA 4KOSA 2AJ6A 2R8VA 3D8PA 2OZUA 1IB1E 2JDCA 1VKCA 2F5IA 4JJXA 1VHSA 5J8FA 2REFA 2X7BA 5KTDA 5IV0A 4CS0B 4H89A 3F8KA 2IL4A 4KOYA 2I79A 2JLMA 3GYAA 4U5YA 5F47A 3FBUA 1ON0A 2OZGA 1YGHA 1WWZA 4E8OA 1MK4A 2CNSA 1OZPA 4UBRA 2Z11A 1IIDA 3SXNA 4EVYA 4PSXA 3G8WA 4R9MA 4B5PB 1QSOA 4L8AA 3G3SA 2Y0MA 3K9UA 4KLVA 3E0KA 2B5GA 2REEA 2QECA 1UFHA 1S5KA 5F49A 3EO4A 1NSLA 1S7LA 5F46A 4II9A 2Q4VA 5KTAA 1XF8A 1Y9WA 4MJ8A 4ORFA 3EXNA 3R9GA 2FCKA 2HQYA 2D4PA 4CAVA 2Q04A 3V8IA 1YVKA 3EY5A 5KTCA 1P4NA 1IYKA 4IF5A 4CRYB 2J8MA 4R57A 1QSTA 2Z0ZA 2BUEA 2FL4A 2PDOA 1Q2CA 3CXQA 2I00A 3TO9A 4E0AA 4KOVA 4MI4A 1V0CA 4U9YA 4F0YA 1IYLA 2P0WA 3DNSA 1YVOA 4R3LA 3GKRA 3T90A 2FE7A 4NEXA 3DR8A 4ONUA 5IX3A 1GHEA 1KUXA 1S60A 4AVBA 2OH1A 4AG7A 3FIXA 2PSWA 1S3ZA 4AB7A 3GY9A 4PK2A 1I21A 3N7ZA 4QVTA 4LX9A 4MBUA 1S7KA 4E2AA 3FNCA 1M1DA 3QB8A 4FD7A 2Q7BA 2C27A 2FSRA 1YX0A 4KVOE 2P6GA 1CM0A 1TIQA 4ZBGA 1M4DA 2G3TA 2FXFA 1M4IA 2PRBA 4FD6A 3W91A 4M3SA 2BEIA 2J8RA 1RO5A 4I49A 2QMLA 1P0HA 2B4BA 2B3VA 3IWGA 2G0BA 2VBQA 2PR8A 2WPWA 4RS2A 2FIAA 4UWJA 4Y49B 1Y9KA 1MJ9A 4CAXA 1RXTA 2D4OA 3QAHA 4FD4A 2GE3A 3S6HA 1J4JA 3EC4A 1YK3A 2PC1A 1XMTA 4YFJA 5C88A 4MY3A 2OZHA 4KUAA 1SQHA 4UA3A 1PUAA 2DXQA 3FB3A 1KZFA 1YR0A 1Q2DA 2KCWA 1XEBA 3DR6A 3LODA 1M44A 2ZPAA 3LD2A 1B6BA 4OADA 4JXRA 4HNWB 4JXQA 4KOXA 3ZZIA 1WK4A 4AG9A 3I9SA 5F48A 1S7NA 2GIVA 3TOBA 4XNHB 3S6GA 1XE4A 4FD5A 2RC4A 4JD6A 2OB0A 2ZW6A 2BL1A 2PQ8A 2P6FA 2NMTA 1NMTA 3UY5A 2FS5A 5HH1A 2VZYA 1S7FA 4U9ZA 2JEVA 3EFAA 5J8CA 2A4NA 4XPDC 3TOAA 2B4DA 4JWPA 2R98A 3VWEA 4QC6A 4XPKA 1QSNA 3D2PA 4KUBA 3TT2A 4QB9A 5CNPA 4MHDA 5DWMA 3DSBA 3RYOA 3TFYA 1QSRA 4UWIA 1R57A 2VQYA 4K30A 1YREA 3WR7A 2EVNA 4XPLA 4RI1A 2WPXA 5JQ4A 2ARHA 2B5GB 3R96A 1YLEA 4L89A 4Y49C 4DNCA 5JPHA 3R1KA 5H86A 1PU9A 3JVNA 4PSWA 3R9EA 3P2HA 3FRMA 1K4JA 1NE9A 4XPDB 2Z10A 3MGDA 3OWCA 2CNMA 1I1DA 2H5MA 4QBJA 5EBVA 2P6EA 2B58A 3TTHA 1KUVA 4NCZA 2FT0A 3F0AA 2CNTA 4OAEA 2VI7A 4HNYB 5C82A 3TO7A 2FIWA 3R95A 2G3AA 4KOUA 4B5PA 1FY7A 1KUYA 4KLWA 4XNHC 3TE4A 2OU2A 3BLNA 4IUSA 4KOTA 4LUAA 3VWDA 4CAWA 1Z9UA 2CY2A 3BJ8A 2EUIA 4R3KA 4F6AA 3I3GA 4HKFA 3NE7A 4PV6A 3PZJA 1BOBA 3D3SA 2BSWA 4BMHA 2VZZA 1N71A 3DDDA 2PR1A 4YGOA 2ZW5A 3B8GA 4KORA 2Q4YA 2QIRA 1MJAA 5HMNA 4CRZB 2O28A 2K5TA 2AE6A 3S6FA 2ZXVA 1U6MA 3R9FA 3H4QA 5IB0A 2HUZA 2JDDA 1L0CA 2R7HA 1B87A 3S6KA 4KVME 1CJWA 2ATRA 4X5KA 4KZTA 1Y7RA 5FVJA 5I0CA 3W6XA 3D2MA 4KVXA 4OLLA 4JLYA 5GCNA 3FYNA 4GS4A 2VEZA 3IGRA 4YRHA 3T9YA 3CXPA 2HV2A 4QUSA 3TO6A
chains in the Genus database with same CATH superfamily
2PE3A 4ZGYB 2ZW7A 2J8NA 3SXOA 5LYIA 3KR4A 4PK3A 3VARA 4M85A 4P4BA 3VATA 1XFOA 4M6IA 1MJBA 4AVCA 2YNCC 3ISXA 4NXYA 3C26A 5LRKA 1AMPA 3B3CA 1M4GA 4R87A 3V38A 4FAIA 2GANA 4MY0A 4AVAA 3RAMA 4B13A 1Z4RA 5EC4A 4X8IA 2AFXA 3NFZA 4NF1A 1QSMA 3D68A 4NGQA 4PPZA 4UIAA 1VHEA 1CBXA 1Q2YA 1LRZA 2ZEMA 4H6ZA 4B5OA 4KSIA 2PJ7A 2B3UA 3CXSA 4NGPA 1XIXA 4KOWA 2QVPA 4PXDA 4MHPA 1Y7EA 4MFKA 4NSQA 3F5BA 1IGBA 4G1PA 3ZJ0A 2B4DB 4P4EA 3LACA 3SJGA 4UEEA 5HXDA 1Z4EA 2IJZA 3PP9A 4R76A 1IICA 5K8OA 4B6ZA 1BO4A 1HDQA 2AFUA 2QJ8A 2VXKA 2EK9A 4MHNA 1CPXA 2CTBA 2DPTA 2R1IA 4IHMA 4J3GA 2Q0YA 3RO0A 3JUWA 3SHPA 1LAPA 4P6YA 3TCVA 4OIWA 3PB8X 3BJ7A 4BINA 3W6SA 5ISVA 5D29A 5H84A 3PGPA 2ZEOA 1ZLHA 1VGYA 1I12A 1RTQA 4A39A 2WSAA 3P2FA 2O4HA 4NGRA 3IWEA 3WC5A 3KKWA 4HNXB 2ZW4A 4H6UA 4FBEA 1BAVA 3BI1A 5E96A 3PB4X 3LMSA 2IMOA 2DF5A 2O53A 3FXTA 2Q44A 4UFVA 5DWNA 4YWYA 2BOAA 2Z3LA 3NA6A 2WUUA 4KOSA 4IK2A 4X2TA 3PRTA 1LCPA 3IEHA 2Q51A 3IJ3A 5IB9A 2AJ6A 4M6GA 2R8VA 3D8PA 5BWAB 2EWBA 2OZUA 2CF4A 4KS9A 1IB1E 2JDCA 1VKCA 2F5IA 4JJXA 1VHSA 2I3CA 2REFA 2X7BA 4R7MA 5J8FA 5IV0A 4CS0B 5KTDA 3QAYA 4H89A 3F8KA 2IL4A 4KOYA 4MHYA 2I79A 2JLMA 5AG4A 2XEIA 3GYAA 3D7GA 4U5YA 2Q7SA 5F47A 3FBUA 1ON0A 3HLPA 2OZGA 4ZYQA 4UEZA 1YGHA 2PJ9A 4CYOA 1WWZA 4RUHA 4E8OA 2PJ4A 1MK4A 1XMBA 2OOTA 2CNSA 5K8NA 1YW4A 1OZPA 4B12A 4CYNA 1X12A 4UBRA 2JBKA 2Z11A 1IIDA 3WC6A 2ABZA 1FNOA 3SXNA 4P44A 3SI2A 4EVYA 4PSXA 4UCMA 4FUUA 3G8WA 4R9MA 1BPMA 4B5PB 1QSOA 4L8AA 3G3SA 2Y0MA 3K9UA 4KLVA 3E0KA 3D66A 4AXVA 2B5GA 2REEA 3KI9A 3FECA 2QECA 1UFHA 4P4JA 5A28A 1S5KA 5F49A 3EO4A 4Q7AA 1NSLA 1S7LA 4MXUA 5F46A 1CX8A 2Q4VA 4II9A 5KTAA 1CG2A 1XF8A 1Y9WA 2V8HA 4ZX8A 4EFDA 6CPAA 3B7IA 2C6PA 2GLFA 4MJ8A 2FVGA 4B11A 4ORFA 3SJEA 2PJ3A 2Z3NA 3EXNA 4Q36A 4A2ZA 3R9GA 2GFQA 2FCKA 2PJAA 3D7HA 4OMEA 3PB7X 1PCAA 3LWUA 2HQYA 2D4PA 4CAVA 2Q04A 2V8VA 3K2KA 3PEIA 1YVKA 3V8IA 4CPAA 4F9UA 2J9AA 4MFPA 2Q43A 5LYFA 3CDXA 3EY5A 5KTCA 2PIYA 3TX8A 1P4NA 2YGWA 1IYKA 1Z5RA 4IF5A 4CRYB 2DEAA 2J8MA 4R57A 4ZY2A 1QSTA 2Z0ZA 3SJXA 2BUEA 3IO1A 1BPNA 2FL4A 2PDOA 2YNEA 3PB9X 4B10A 1Q2CA 2GLJA 3FX6A 4CGPA 1OBRA 3CXQA 2GREA 3TC8A 4UF4A 3L2NA 1TKHA 2I00A 4R8FA 3TO9A 4E0AA 5LYLA 4KOVA 4MI4A 4NJRA 1V0CA 3WC7A 4U9YA 4F0YA 1IYLA 2P0WA 3DNSA 2YNCA 4A37A 2BCOA 3FH4A 1YVOA 3PBBA 1YMEA 4NFRA 4LQ6A 3IC1A 4R3LA 3GKRA 4MCPA 3T90A 2PIZA 2FE7A 4CAEA 2V8GA 1Z2LA 4HPSA 3ISZA 4NEXA 3KHXA 3DR8A 4ONUA 5IX3A 1GHEA 1KUXA 1CP7A 1S60A 2PJ5A 2Z3MA 3RZAA 4AVBA 2OH1A 2QYVA 3FIXA 4AG7A 2PSWA 1S3ZA 3FEDA 3GY9A 4PK2A 4AB7A 1I21A 3N7ZA 4QVTA 4LX9A 2ZEDA 4OC3A 3H5ZA 4NGMA 3H8FA 1S7KA 4MBUA 4A30A 5CBMA 4E2AA 3FNCA 1M1DA 3QB8A 4FD7A 3D4UA 1F57A 2PJ1A 2C27A 4MFZA 4OC1A 5G21A 2Q7BA 2FSRA 1TF8A 3FVLA 4K3NA 5F09A 1AUGA 1QMUA 1YX0A 4MCRA 1ARLA 4KVOE 2P6GA 1CM0A 1TIQA 4CGNA 2ZELA 4ZBGA 1M4DA 2G3TA 2FXFA 2Z3KA 1M4IA 3IU2A 2PRBA 4CYPA 4FD6A 3W91A 5I4MA 2DPSA 4M3SA 2BEIA 2J8RA 4BBHA 1RO5A 3I1UA 2QMLA 4I49A 4MFLA 2CXAA 1Z8XA 1P0HA 1CP6A 2B4BA 2B3VA 3BXMA 3IWGA 2G0BA 2VBQA 4OC5A 4CGMA 5JGFA 4GXHA 2PR8A 2WPWA 4RS2A 4P45A 2FIAA 4C2ZA 4NGSA 3B2YA 4UWJA 3S9LA 1YSJA 4Y49B 1Y9KA 4UFWA 1MJ9A 4CAXA 1RXTA 5CPAA 3JRUA 1LFWA 2OR4A 2XEGA 2ZEFA 2D4OA 2HC9A 3QAHA 2GE3A 4FD4A 4UCPA 3S6HA 4F0XA 1J4JA 3EC4A 1YK3A 1TKFA 3B3SA 3DLJA 1ELMP 2PC1A 1JWQA 1XMTA 4YFJA 2AFOA 2C6CA 1PYTB 1TF9A 5C88A 3B35A 4MY3A 4GM5A 2OZHA 4F8ZA 3PBEA 4KUAA 5HVFA 1A2ZA 5G22A 5LRJA 1SQHA 4UA3A 1PUAA 2DXQA 4MFQA 3FB3A 1FT7A 1KWMA 3BHXA 1KZFA 1AYEA 4UIBA 2XEFA 1YW6A 1YR0A 1Q2DA 2KCWA 2AFSA 2PJ0A 1XEBA 3DR6A 2PJ6A 1ARMA 3LODA 2V77A 1M44A 2ZPAA 4RN7A 3LD2A 1B6BA 2PJ2A 1X10A 4OADA 4CGOA 1LANA 4JXRA 4HNWB 4JXQA 4KOXA 4UEFA 1YLOA 3ZZIA 1WK4A 5D8NA 4NGNA 3I9SA 4AG9A 5F48A 1F2OA 1S7NA 3SI1A 2GIVA 3N5FA 3FEEA 3TOBA 1ZG7A 4OIDA 1XE4A 4FD5A 2POKA 2RC4A 3CT9A 4JD6A 2OB0A 4P10A 5AG5A 2F7VA 2AFWA 2ZW6A 2ZEGA 4PXCA 2BL1A 1BLLE 2PQ8A 2PCUA 5JH9A 3H8GA 2P6FA 3KL9A 2NMTA 1NMTA 3UY5A 2FS5A 1M4LA 3IU1A 2PJCA 5HH1A 4C68A 3JTKA 2VZYA 1S7FA 4U9ZA 2JEVA 3EFAA 3QNVA 4X3RA 7CPAA 2C6GA 4NGTA 5J8CA 2A4NA 4XPDC 1UWYA 4IAVA 2V8DA 3TOAA 3D7FA 1TKJA 2B4DA 4JWPA 2CIJA 4F9VA 4C7IA 1GYTA 4MRIA 3FJUA 3CPAA 4CYQA 2NYQA 2R98A 2ZEEA 4ZY0A 3VWEA 4QC6A 4XPKA 1EE3P 1QSNA 3D2PA 4KUBA 2Q4ZA 3TT2A 3WT4A 4QB9A 5J1QA 1ELLP 1JQGA 3H8EA 5CNPA 4MHDA 4Q38A 5DWMA 3DSBA 3RYOA 4A31A 1QSRA 3TFYA 4UWIA 1R57A 2VQYA 1XRYA 3D7DA 3KGQA 1YREA 4K30A 3A9LA 4OC0A 2ZEHA 3WR7A 4TNUA 2EVNA 4R6TA 4XPLA 4RI1A 4C2YA 4ZY1A 2WPXA 3NH5A 5JQ4A 2NSMA 4PQAA 4XNHB 2ARHA 2C1CA 2B5GB 3R96A 1IOIA 1YLEA 3S9NA 4L89A 4Y49C 4DNCA 4O23A 3SI0A 5JPHA 4MHZA 3R1KA 5H86A 1PU9A 1ZO0A 3JVNA 4PSWA 3R9EA 3P2HA 4DUKA 1HEEA 2EBJA 3FRMA 1K4JA 3D67A 1DTDA 2RFHA 2ODFA 4JZ0A 1NE9A 2Z3OA 3MN8A 4XPDB 2Z10A 5HVHA 1CPSA 4EWTA 5AG7A 1Y0RA 1Q7LA 3T8WA 3PB6X 3MGDA 4P4FA 3OWCA 5G20A 1IOFA 3KQXA 2CNMA 3VH9A 4TWEA 3KASA 3NE8A 1I1DA 2WYRA 1IU8A 3KZWA 3S9MA 4C7HA 2H5MA 4QBJA 1Z8WA 5EBVA 2P6EA 4DJLA 1XJOA 2B58A 3V7ZA 3B3TA 4Z65A 3TTHA 1KUVA 5EMIA 3DGVA 3GUXA 4NCZA 2FT0A 3F0AA 4BD9A 1R43A 2CNTA 4OAEA 2VI7A 4HNYB 2ZEPA 3MRUA 3TO7A 3CZXA 2FIWA 3R95A 2G3AA 5C82A 2IQ6A 4KOUA 5K8MA 4B5PA 1FY7A 2WZNA 4WJBA 1KUYA 2GU2A 2PRQA 2YNDA 4KLWA 2ANPA 4XNHC 5LYDA 5G1ZA 3TE4A 4A94A 4ZX9A 2OU2A 2Z3PA 4KSFA 4A32A 3BLNA 4IUSA 4OC2A 4JYWA 3GIUA 1LAMA 4KOTA 4LUAA 3RNZA 1Z9UA 3S6GA 3VWDA 2CY2A 3BJ8A 3WABA 4CAWA 2EUIA 4R3KA 4F6AA 1Y0YA 3HUVA 3I3GA 4HKFA 3NE7A 2VL1A 3KR5A 4PV6A 5JM6A 1VIXA 2F8HA 3NH8A 4MMOA 1NSAA 3PZJA 1VHOA 1ZLIA 2PVWA 1QQ9A 1BOBA 3D3SA 2BSWA 3IFEA 4BMHA 4H2KA 4A38A 1TXRA 2VZZA 1N71A 3DDDA 4MCSA 2PR1A 4OP4A 5AG6A 4YGOA 3SJFA 2PJ8A 4YU9A 1LOKA 3B3WA 4EMEA 5ELYA 4ONWA 3KQZA 2ZW5A 3K9TA 3B8GA 4KORA 2Q4YA 2ZOGA 2EO8A 5HVGA 1IY7A 2QIRA 4NJQA 1MJAA 4A33A 4PXEA 2JEWA 2CTCA 5LRGA 4CRZB 2AFZA 1R3NA 5HMNA 4MCQA 2O28A 3B3VA 2K5TA 2AE6A 2HB6A 2ZXVA 3S6FA 2RB7A 5K8PA 3BI0A 1U6MA 3R9FA 1F2PA 3RBUA 1XBUA 3H4QA 5IB0A 2HUZA 2JDDA 1L0CA 1Z8TA 1ZG8A 2R7HA 3PFEA 4C2XA 3GLJA 1B87A 5A27A 1YQEA 3GB0A 3S6KA 3IWWA 4MFJA 4FWUA 4KVME 1CJWA 2ATRA 4B14A 2ZENA 4X5KA 4WWVA 4KSAA 4KZTA 4UCNA 1Y7RA 1DE4C 4P4IA 5FVJA 1H8LA 4UFXA 4DYOA 2ZOFA 4P4DA 5I0CA 8CPAA 4PXBA 3W6XA 3FMCA 1XOVA 4OC4A 2XEJA 3IIBA 4M6HA 3D2MA 4KVXA 4OLLA 2JBJA 4JLYA 3FYNA 4OKOA 5GCNA 3KHZA 4GS4A 4W9YA 5AGEA 2VEZA 3IGRA 1Z8LA 3CPXA 4YRHA 3NH4A 2EK8A 5DS0A 2AFMA 4LQGA 3FF3A 4CGLA 2BO9A 1HDUA 4A95A 4ZI6A 3T9YA 3PFOA 1ZG9A 2G9DA 3CXPA 4CAFA 5THWA 2PJBA 2PVVA 2HV2A 4QUSA 3TO6A
chains in the Genus database with same CATH topology
4ZGYB 2ZW7A 2J8NA 3SXOA 4PK3A 4M85A 1MJBA 4AVCA 2YNCC 4NXYA 3C26A 1M4GA 4R87A 2GANA 4MY0A 4AVAA 4B13A 1Z4RA 5EC4A 4NF1A 1QSMA 1Q2YA 1LRZA 4H6ZA 4B5OA 2B3UA 3CXSA 1XIXA 4KOWA 4MFKA 4NSQA 3F5BA 3ZJ0A 2B4DB 1Z4EA 3PP9A 1IICA 1BO4A 2VXKA 2DPTA 2R1IA 3SHPA 4J3GA 2Q0YA 3JUWA 3TCVA 3BJ7A 3W6SA 5ISVA 5H84A 3PGPA 1I12A 2WSAA 3P2FA 3IWEA 3KKWA 4HNXB 2ZW4A 4H6UA 5E96A 3FXTA 2Q44A 4UFVA 5DWNA 2Z3LA 2WUUA 4KOSA 2AJ6A 2R8VA 3D8PA 5BWAB 2OZUA 4KS9A 1IB1E 2JDCA 1VKCA 2F5IA 4JJXA 1VHSA 5J8FA 2REFA 2X7BA 5KTDA 5IV0A 4CS0B 4H89A 3F8KA 2IL4A 4KOYA 2I79A 2JLMA 5AG4A 3GYAA 4U5YA 5F47A 3FBUA 1ON0A 2OZGA 1YGHA 4CYOA 1WWZA 4E8OA 1MK4A 2CNSA 1OZPA 4B12A 4CYNA 4UBRA 2Z11A 1IIDA 3SXNA 4EVYA 4PSXA 4UCMA 3G8WA 4R9MA 4B5PB 1QSOA 4L8AA 3G3SA 2Y0MA 3K9UA 4KLVA 3E0KA 2B5GA 2REEA 2QECA 1UFHA 5A28A 1S5KA 5F49A 3EO4A 1NSLA 1S7LA 5F46A 4II9A 2Q4VA 5KTAA 1XF8A 1Y9WA 4MJ8A 4B11A 4ORFA 2Z3NA 3EXNA 4Q36A 4A2ZA 3R9GA 2FCKA 2HQYA 2D4PA 4CAVA 2Q04A 3V8IA 1YVKA 4MFPA 3EY5A 5KTCA 1P4NA 2YGWA 1IYKA 4IF5A 4CRYB 2J8MA 4R57A 1QSTA 2Z0ZA 2BUEA 2FL4A 2PDOA 2YNEA 4B10A 4CGPA 1Q2CA 3CXQA 2I00A 3TO9A 4E0AA 4KOVA 4MI4A 1V0CA 4U9YA 4F0YA 1IYLA 2P0WA 3DNSA 2YNCA 1YVOA 4R3LA 3GKRA 3T90A 2FE7A 4CAEA 4NEXA 3DR8A 4ONUA 5IX3A 1GHEA 1KUXA 1S60A 2Z3MA 4AVBA 2OH1A 4AG7A 3FIXA 2PSWA 1S3ZA 4AB7A 3GY9A 4PK2A 1I21A 3N7ZA 4QVTA 4LX9A 3H5ZA 4MBUA 1S7KA 4A30A 4E2AA 3FNCA 1M1DA 3QB8A 4FD7A 2Q7BA 2C27A 4MFZA 5G21A 2FSRA 1YX0A 4KVOE 2P6GA 1CM0A 1TIQA 4CGNA 4ZBGA 1M4DA 2G3TA 2FXFA 2Z3KA 1M4IA 3IU2A 2PRBA 4CYPA 4FD6A 3W91A 2DPSA 4M3SA 2BEIA 2J8RA 4BBHA 1RO5A 4I49A 2QMLA 4MFLA 2CXAA 1P0HA 2B4BA 2B3VA 3IWGA 2G0BA 2VBQA 4CGMA 2PR8A 2WPWA 4RS2A 2FIAA 4C2ZA 4UWJA 4Y49B 1Y9KA 4UFWA 1MJ9A 4CAXA 1RXTA 2D4OA 3QAHA 4FD4A 2GE3A 4UCPA 3S6HA 4F0XA 1J4JA 3EC4A 1YK3A 2PC1A 1XMTA 4YFJA 5C88A 4MY3A 2OZHA 4KUAA 5G22A 1SQHA 4UA3A 1PUAA 2DXQA 4MFQA 3FB3A 1KZFA 1YR0A 1Q2DA 2KCWA 1XEBA 3DR6A 3LODA 1M44A 2ZPAA 3LD2A 1B6BA 4OADA 4CGOA 4JXRA 4HNWB 4JXQA 4KOXA 3ZZIA 1WK4A 4AG9A 3I9SA 5F48A 1S7NA 2GIVA 3TOBA 4XNHB 5AG5A 1XE4A 4FD5A 2RC4A 4JD6A 3S6GA 2OB0A 2ZW6A 2BL1A 2PQ8A 2P6FA 2NMTA 1NMTA 3UY5A 2FS5A 3IU1A 5HH1A 4C68A 3JTKA 2VZYA 1S7FA 4U9ZA 2JEVA 3EFAA 5J8CA 2A4NA 4XPDC 3TOAA 2B4DA 4JWPA 4C7IA 4CYQA 2R98A 3VWEA 4QC6A 4XPKA 1QSNA 3D2PA 4KUBA 3TT2A 4QB9A 5CNPA 4MHDA 4Q38A 5DWMA 3DSBA 3RYOA 4A31A 1QSRA 3TFYA 4UWIA 1R57A 2VQYA 4K30A 1YREA 3A9LA 3WR7A 2EVNA 4XPLA 4RI1A 4C2YA 2WPXA 5JQ4A 2ARHA 2B5GB 3R96A 1YLEA 4L89A 4Y49C 4DNCA 5JPHA 3R1KA 5H86A 1PU9A 1ZO0A 3JVNA 4PSWA 3R9EA 3P2HA 3FRMA 1K4JA 1NE9A 2Z3OA 4XPDB 2Z10A 5AG7A 3MGDA 3OWCA 5G20A 2CNMA 1I1DA 4C7HA 2H5MA 4QBJA 5EBVA 2P6EA 2B58A 3TTHA 1KUVA 4NCZA 2FT0A 3F0AA 2CNTA 4OAEA 2VI7A 4HNYB 5C82A 3TO7A 2FIWA 3R95A 2G3AA 4KOUA 4B5PA 1FY7A 1KUYA 2YNDA 4KLWA 4XNHC 5G1ZA 3TE4A 2OU2A 2Z3PA 4KSFA 4A32A 3BLNA 4IUSA 4KOTA 4LUAA 3VWDA 4CAWA 1Z9UA 2CY2A 3BJ8A 2EUIA 4R3KA 4F6AA 3I3GA 4HKFA 3NE7A 4PV6A 3PZJA 1BOBA 3D3SA 2BSWA 4BMHA 2VZZA 1N71A 3DDDA 2PR1A 5AG6A 4YGOA 2ZW5A 3B8GA 4KORA 2Q4YA 2QIRA 1MJAA 4A33A 5HMNA 4CRZB 2O28A 2K5TA 2AE6A 3S6FA 2ZXVA 1U6MA 3R9FA 3H4QA 5IB0A 2HUZA 2JDDA 1L0CA 2R7HA 4C2XA 5A27A 1B87A 3S6KA 4MFJA 4KVME 1CJWA 2ATRA 4B14A 4X5KA 4KSAA 4KZTA 4UCNA 1Y7RA 5FVJA 4UFXA 5I0CA 3W6XA 3D2MA 4KVXA 4OLLA 4JLYA 5GCNA 3FYNA 4GS4A 5AGEA 2VEZA 3IGRA 4YRHA 4CGLA 4A95A 3T9YA 3CXPA 4CAFA 2HV2A 4QUSA 3TO6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZW7 A;  2J8N A;  3SXO A;  4PK3 A;  4M85 A;  1MJB A;  4AVC A;  4NXY A;  3C26 A;  1M4G A;  4R87 A;  2GAN A;  4MY0 A;  4AVA A;  1Z4R A;  5EC4 A;  4NF1 A;  1QSM A;  1Q2Y A;  1LRZ A;  4H6Z A;  4B5O A;  2B3U A;  3CXS A;  1XIX A;  4KOW A;  4NSQ A;  3F5B A;  3ZJ0 A;  2B4D B;  1Z4E A;  3PP9 A;  1IIC A;  1BO4 A;  2VXK A;  2R1I A;  3SHP A;  4J3G A;  2Q0Y A;  3JUW A;  3TCV A;  3BJ7 A;  3W6S A;  5ISV A;  5H84 A;  3PGP A;  1I12 A;  3P2F A;  3KKW A;  4HNX B;  2ZW4 A;  4H6U A;  5E96 A;  3FXT A;  2Q44 A;  5DWN A;  4KOS A;  2AJ6 A;  2R8V A;  3D8P A;  2OZU A;  1IB1 E;  2JDC A;  1VKC A;  2F5I A;  4JJX A;  1VHS A;  5J8F A;  2REF A;  2X7B A;  5KTD A;  5IV0 A;  4CS0 B;  4H89 A;  3F8K A;  2IL4 A;  4KOY A;  2I79 A;  2JLM A;  3GYA A;  4U5Y A;  5F47 A;  3FBU A;  1ON0 A;  2OZG A;  1YGH A;  1WWZ A;  4E8O A;  1MK4 A;  2CNS A;  1OZP A;  4UBR A;  2Z11 A;  1IID A;  3SXN A;  4EVY A;  4PSX A;  3G8W A;  4R9M A;  4B5P B;  1QSO A;  4L8A A;  3G3S A;  2Y0M A;  3K9U A;  4KLV A;  3E0K A;  2B5G A;  2REE A;  2QEC A;  1UFH A;  1S5K A;  5F49 A;  3EO4 A;  1NSL A;  1S7L A;  5F46 A;  4II9 A;  2Q4V A;  5KTA A;  1XF8 A;  1Y9W A;  4MJ8 A;  4ORF A;  3EXN A;  3R9G A;  2FCK A;  2HQY A;  2D4P A;  4CAV A;  2Q04 A;  3V8I A;  1YVK A;  3EY5 A;  5KTC A;  1P4N A;  1IYK A;  4IF5 A;  4CRY B;  2J8M A;  4R57 A;  1QST A;  2Z0Z A;  2BUE A;  2FL4 A;  2PDO A;  1Q2C A;  3CXQ A;  2I00 A;  3TO9 A;  4E0A A;  4KOV A;  4MI4 A;  1V0C A;  4U9Y A;  4F0Y A;  1IYL A;  2P0W A;  3DNS A;  1YVO A;  4R3L A;  3GKR A;  3T90 A;  2FE7 A;  4NEX A;  3DR8 A;  4ONU A;  5IX3 A;  1GHE A;  1KUX A;  1S60 A;  4AVB A;  2OH1 A;  4AG7 A;  3FIX A;  2PSW A;  1S3Z A;  4AB7 A;  3GY9 A;  4PK2 A;  1I21 A;  3N7Z A;  4QVT A;  4LX9 A;  4MBU A;  1S7K A;  4E2A A;  3FNC A;  1M1D A;  3QB8 A;  4FD7 A;  2Q7B A;  2C27 A;  2FSR A;  1YX0 A;  4KVO E;  2P6G A;  1CM0 A;  1TIQ A;  4ZBG A;  1M4D A;  2G3T A;  2FXF A;  1M4I A;  2PRB A;  4FD6 A;  3W91 A;  4M3S A;  2BEI A;  2J8R A;  1RO5 A;  4I49 A;  2QML A;  1P0H A;  2B4B A;  2B3V A;  3IWG A;  2G0B A;  2VBQ A;  2PR8 A;  2WPW A;  4RS2 A;  2FIA A;  4UWJ A;  4Y49 B;  1Y9K A;  1MJ9 A;  4CAX A;  1RXT A;  2D4O A;  3QAH A;  4FD4 A;  2GE3 A;  3S6H A;  1J4J A;  3EC4 A;  1YK3 A;  2PC1 A;  1XMT A;  4YFJ A;  5C88 A;  4MY3 A;  2OZH A;  4KUA A;  1SQH A;  4UA3 A;  1PUA A;  2DXQ A;  3FB3 A;  1KZF A;  1YR0 A;  1Q2D A;  2KCW A;  1XEB A;  3DR6 A;  3LOD A;  1M44 A;  2ZPA A;  3LD2 A;  1B6B A;  4OAD A;  4JXR A;  4HNW B;  4JXQ A;  4KOX A;  3ZZI A;  1WK4 A;  4AG9 A;  3I9S A;  5F48 A;  1S7N A;  2GIV A;  3TOB A;  4XNH B;  3S6G A;  1XE4 A;  4FD5 A;  2RC4 A;  4JD6 A;  2OB0 A;  2ZW6 A;  2BL1 A;  2PQ8 A;  2P6F A;  2NMT A;  1NMT A;  3UY5 A;  2FS5 A;  5HH1 A;  2VZY A;  1S7F A;  4U9Z A;  2JEV A;  3EFA A;  5J8C A;  2A4N A;  4XPD C;  3TOA A;  2B4D A;  4JWP A;  2R98 A;  3VWE A;  4QC6 A;  4XPK A;  1QSN A;  3D2P A;  4KUB A;  3TT2 A;  4QB9 A;  5CNP A;  4MHD A;  5DWM A;  3DSB A;  3RYO A;  3TFY A;  1QSR A;  4UWI A;  1R57 A;  2VQY A;  4K30 A;  1YRE A;  3WR7 A;  2EVN A;  4XPL A;  4RI1 A;  2WPX A;  5JQ4 A;  2ARH A;  2B5G B;  3R96 A;  1YLE A;  4L89 A;  4Y49 C;  4DNC A;  5JPH A;  3R1K A;  5H86 A;  1PU9 A;  3JVN A;  4PSW A;  3R9E A;  3P2H A;  3FRM A;  1K4J A;  1NE9 A;  4XPD B;  2Z10 A;  3MGD A;  3OWC A;  2CNM A;  1I1D A;  2H5M A;  4QBJ A;  5EBV A;  2P6E A;  2B58 A;  3TTH A;  1KUV A;  4NCZ A;  2FT0 A;  3F0A A;  2CNT A;  4OAE A;  2VI7 A;  4HNY B;  5C82 A;  3TO7 A;  2FIW A;  3R95 A;  2G3A A;  4KOU A;  4B5P A;  1FY7 A;  1KUY A;  4KLW A;  4XNH C;  3TE4 A;  2OU2 A;  3BLN A;  4IUS A;  4KOT A;  4LUA A;  3VWD A;  4CAW A;  1Z9U A;  2CY2 A;  3BJ8 A;  2EUI A;  4R3K A;  4F6A A;  3I3G A;  4HKF A;  3NE7 A;  4PV6 A;  3PZJ A;  1BOB A;  3D3S A;  2BSW A;  4BMH A;  2VZZ A;  1N71 A;  3DDD A;  2PR1 A;  4YGO A;  2ZW5 A;  3B8G A;  4KOR A;  2Q4Y A;  2QIR A;  1MJA A;  5HMN A;  4CRZ B;  2O28 A;  2K5T A;  2AE6 A;  3S6F A;  2ZXV A;  1U6M A;  3R9F A;  3H4Q A;  5IB0 A;  2HUZ A;  2JDD A;  1L0C A;  2R7H A;  1B87 A;  3S6K A;  4KVM E;  1CJW A;  2ATR A;  4X5K A;  4KZT A;  1Y7R A;  5FVJ A;  5I0C A;  3W6X A;  3D2M A;  4KVX A;  4OLL A;  4JLY A;  5GCN A;  3FYN A;  4GS4 A;  2VEZ A;  3IGR A;  4YRH A;  3T9Y A;  3CXP A;  2HV2 A;  4QUS A;  3TO6 A; 
#chains in the Genus database with same CATH topology
 2PE3 A;  4ZGY B;  2ZW7 A;  2J8N A;  3SXO A;  5LYI A;  3KR4 A;  4PK3 A;  3VAR A;  4M85 A;  4P4B A;  3VAT A;  1XFO A;  4M6I A;  1MJB A;  4AVC A;  2YNC C;  3ISX A;  4NXY A;  3C26 A;  5LRK A;  1AMP A;  3B3C A;  1M4G A;  4R87 A;  3V38 A;  4FAI A;  2GAN A;  4MY0 A;  4AVA A;  3RAM A;  4B13 A;  1Z4R A;  5EC4 A;  4X8I A;  2AFX A;  3NFZ A;  4NF1 A;  1QSM A;  3D68 A;  4NGQ A;  4PPZ A;  4UIA A;  1VHE A;  1CBX A;  1Q2Y A;  1LRZ A;  2ZEM A;  4H6Z A;  4B5O A;  4KSI A;  2PJ7 A;  2B3U A;  3CXS A;  4NGP A;  1XIX A;  4KOW A;  2QVP A;  4PXD A;  4MHP A;  1Y7E A;  4MFK A;  4NSQ A;  3F5B A;  1IGB A;  4G1P A;  3ZJ0 A;  2B4D B;  4P4E A;  3LAC A;  3SJG A;  4UEE A;  5HXD A;  1Z4E A;  2IJZ A;  3PP9 A;  4R76 A;  1IIC A;  5K8O A;  4B6Z A;  1BO4 A;  1HDQ A;  2AFU A;  2QJ8 A;  2VXK A;  2EK9 A;  4MHN A;  1CPX A;  2CTB A;  2DPT A;  2R1I A;  4IHM A;  4J3G A;  2Q0Y A;  3RO0 A;  3JUW A;  3SHP A;  1LAP A;  4P6Y A;  3TCV A;  4OIW A;  3PB8 X;  3BJ7 A;  4BIN A;  3W6S A;  5ISV A;  5D29 A;  5H84 A;  3PGP A;  2ZEO A;  1ZLH A;  1VGY A;  1I12 A;  1RTQ A;  4A39 A;  2WSA A;  3P2F A;  2O4H A;  4NGR A;  3IWE A;  3WC5 A;  3KKW A;  4HNX B;  2ZW4 A;  4H6U A;  4FBE A;  1BAV A;  3BI1 A;  5E96 A;  3PB4 X;  3LMS A;  2IMO A;  2DF5 A;  2O53 A;  3FXT A;  2Q44 A;  4UFV A;  5DWN A;  4YWY A;  2BOA A;  2Z3L A;  3NA6 A;  2WUU A;  4KOS A;  4IK2 A;  4X2T A;  3PRT A;  1LCP A;  3IEH A;  2Q51 A;  3IJ3 A;  5IB9 A;  2AJ6 A;  4M6G A;  2R8V A;  3D8P A;  5BWA B;  2EWB A;  2OZU A;  2CF4 A;  4KS9 A;  1IB1 E;  2JDC A;  1VKC A;  2F5I A;  4JJX A;  1VHS A;  2I3C A;  2REF A;  2X7B A;  4R7M A;  5J8F A;  5IV0 A;  4CS0 B;  5KTD A;  3QAY A;  4H89 A;  3F8K A;  2IL4 A;  4KOY A;  4MHY A;  2I79 A;  2JLM A;  5AG4 A;  2XEI A;  3GYA A;  3D7G A;  4U5Y A;  2Q7S A;  5F47 A;  3FBU A;  1ON0 A;  3HLP A;  2OZG A;  4ZYQ A;  4UEZ A;  1YGH A;  2PJ9 A;  4CYO A;  1WWZ A;  4RUH A;  4E8O A;  2PJ4 A;  1MK4 A;  1XMB A;  2OOT A;  2CNS A;  5K8N A;  1YW4 A;  1OZP A;  4B12 A;  4CYN A;  1X12 A;  4UBR A;  2JBK A;  2Z11 A;  1IID A;  3WC6 A;  2ABZ A;  1FNO A;  3SXN A;  4P44 A;  3SI2 A;  4EVY A;  4PSX A;  4UCM A;  4FUU A;  3G8W A;  4R9M A;  1BPM A;  4B5P B;  1QSO A;  4L8A A;  3G3S A;  2Y0M A;  3K9U A;  4KLV A;  3E0K A;  3D66 A;  4AXV A;  2B5G A;  2REE A;  3KI9 A;  3FEC A;  2QEC A;  1UFH A;  4P4J A;  5A28 A;  1S5K A;  5F49 A;  3EO4 A;  4Q7A A;  1NSL A;  1S7L A;  4MXU A;  5F46 A;  1CX8 A;  2Q4V A;  4II9 A;  5KTA A;  1CG2 A;  1XF8 A;  1Y9W A;  2V8H A;  4ZX8 A;  4EFD A;  6CPA A;  3B7I A;  2C6P A;  2GLF A;  4MJ8 A;  2FVG A;  4B11 A;  4ORF A;  3SJE A;  2PJ3 A;  2Z3N A;  3EXN A;  4Q36 A;  4A2Z A;  3R9G A;  2GFQ A;  2FCK A;  2PJA A;  3D7H A;  4OME A;  3PB7 X;  1PCA A;  3LWU A;  2HQY A;  2D4P A;  4CAV A;  2Q04 A;  2V8V A;  3K2K A;  3PEI A;  1YVK A;  3V8I A;  4CPA A;  4F9U A;  2J9A A;  4MFP A;  2Q43 A;  5LYF A;  3CDX A;  3EY5 A;  5KTC A;  2PIY A;  3TX8 A;  1P4N A;  2YGW A;  1IYK A;  1Z5R A;  4IF5 A;  4CRY B;  2DEA A;  2J8M A;  4R57 A;  4ZY2 A;  1QST A;  2Z0Z A;  3SJX A;  2BUE A;  3IO1 A;  1BPN A;  2FL4 A;  2PDO A;  2YNE A;  3PB9 X;  4B10 A;  1Q2C A;  2GLJ A;  3FX6 A;  4CGP A;  1OBR A;  3CXQ A;  2GRE A;  3TC8 A;  4UF4 A;  3L2N A;  1TKH A;  2I00 A;  4R8F A;  3TO9 A;  4E0A A;  5LYL A;  4KOV A;  4MI4 A;  4NJR A;  1V0C A;  3WC7 A;  4U9Y A;  4F0Y A;  1IYL A;  2P0W A;  3DNS A;  2YNC A;  4A37 A;  2BCO A;  3FH4 A;  1YVO A;  3PBB A;  1YME A;  4NFR A;  4LQ6 A;  3IC1 A;  4R3L A;  3GKR A;  4MCP A;  3T90 A;  2PIZ A;  2FE7 A;  4CAE A;  2V8G A;  1Z2L A;  4HPS A;  3ISZ A;  4NEX A;  3KHX A;  3DR8 A;  4ONU A;  5IX3 A;  1GHE A;  1KUX A;  1CP7 A;  1S60 A;  2PJ5 A;  2Z3M A;  3RZA A;  4AVB A;  2OH1 A;  2QYV A;  3FIX A;  4AG7 A;  2PSW A;  1S3Z A;  3FED A;  3GY9 A;  4PK2 A;  4AB7 A;  1I21 A;  3N7Z A;  4QVT A;  4LX9 A;  2ZED A;  4OC3 A;  3H5Z A;  4NGM A;  3H8F A;  1S7K A;  4MBU A;  4A30 A;  5CBM A;  4E2A A;  3FNC A;  1M1D A;  3QB8 A;  4FD7 A;  3D4U A;  1F57 A;  2PJ1 A;  2C27 A;  4MFZ A;  4OC1 A;  5G21 A;  2Q7B A;  2FSR A;  1TF8 A;  3FVL A;  4K3N A;  5F09 A;  1AUG A;  1QMU A;  1YX0 A;  4MCR A;  1ARL A;  4KVO E;  2P6G A;  1CM0 A;  1TIQ A;  4CGN A;  2ZEL A;  4ZBG A;  1M4D A;  2G3T A;  2FXF A;  2Z3K A;  1M4I A;  3IU2 A;  2PRB A;  4CYP A;  4FD6 A;  3W91 A;  5I4M A;  2DPS A;  4M3S A;  2BEI A;  2J8R A;  4BBH A;  1RO5 A;  3I1U A;  2QML A;  4I49 A;  4MFL A;  2CXA A;  1Z8X A;  1P0H A;  1CP6 A;  2B4B A;  2B3V A;  3BXM A;  3IWG A;  2G0B A;  2VBQ A;  4OC5 A;  4CGM A;  5JGF A;  4GXH A;  2PR8 A;  2WPW A;  4RS2 A;  4P45 A;  2FIA A;  4C2Z A;  4NGS A;  3B2Y A;  4UWJ A;  3S9L A;  1YSJ A;  4Y49 B;  1Y9K A;  4UFW A;  1MJ9 A;  4CAX A;  1RXT A;  5CPA A;  3JRU A;  1LFW A;  2OR4 A;  2XEG A;  2ZEF A;  2D4O A;  2HC9 A;  3QAH A;  2GE3 A;  4FD4 A;  4UCP A;  3S6H A;  4F0X A;  1J4J A;  3EC4 A;  1YK3 A;  1TKF A;  3B3S A;  3DLJ A;  1ELM P;  2PC1 A;  1JWQ A;  1XMT A;  4YFJ A;  2AFO A;  2C6C A;  1PYT B;  1TF9 A;  5C88 A;  3B35 A;  4MY3 A;  4GM5 A;  2OZH A;  4F8Z A;  3PBE A;  4KUA A;  5HVF A;  1A2Z A;  5G22 A;  5LRJ A;  1SQH A;  4UA3 A;  1PUA A;  2DXQ A;  4MFQ A;  3FB3 A;  1FT7 A;  1KWM A;  3BHX A;  1KZF A;  1AYE A;  4UIB A;  2XEF A;  1YW6 A;  1YR0 A;  1Q2D A;  2KCW A;  2AFS A;  2PJ0 A;  1XEB A;  3DR6 A;  2PJ6 A;  1ARM A;  3LOD A;  2V77 A;  1M44 A;  2ZPA A;  4RN7 A;  3LD2 A;  1B6B A;  2PJ2 A;  1X10 A;  4OAD A;  4CGO A;  1LAN A;  4JXR A;  4HNW B;  4JXQ A;  4KOX A;  4UEF A;  1YLO A;  3ZZI A;  1WK4 A;  5D8N A;  4NGN A;  3I9S A;  4AG9 A;  5F48 A;  1F2O A;  1S7N A;  3SI1 A;  2GIV A;  3N5F A;  3FEE A;  3TOB A;  1ZG7 A;  4OID A;  1XE4 A;  4FD5 A;  2POK A;  2RC4 A;  3CT9 A;  4JD6 A;  2OB0 A;  4P10 A;  5AG5 A;  2F7V A;  2AFW A;  2ZW6 A;  2ZEG A;  4PXC A;  2BL1 A;  1BLL E;  2PQ8 A;  2PCU A;  5JH9 A;  3H8G A;  2P6F A;  3KL9 A;  2NMT A;  1NMT A;  3UY5 A;  2FS5 A;  1M4L A;  3IU1 A;  2PJC A;  5HH1 A;  4C68 A;  3JTK A;  2VZY A;  1S7F A;  4U9Z A;  2JEV A;  3EFA A;  3QNV A;  4X3R A;  7CPA A;  2C6G A;  4NGT A;  5J8C A;  2A4N A;  4XPD C;  1UWY A;  4IAV A;  2V8D A;  3TOA A;  3D7F A;  1TKJ A;  2B4D A;  4JWP A;  2CIJ A;  4F9V A;  4C7I A;  1GYT A;  4MRI A;  3FJU A;  3CPA A;  4CYQ A;  2NYQ A;  2R98 A;  2ZEE A;  4ZY0 A;  3VWE A;  4QC6 A;  4XPK A;  1EE3 P;  1QSN A;  3D2P A;  4KUB A;  2Q4Z A;  3TT2 A;  3WT4 A;  4QB9 A;  5J1Q A;  1ELL P;  1JQG A;  3H8E A;  5CNP A;  4MHD A;  4Q38 A;  5DWM A;  3DSB A;  3RYO A;  4A31 A;  1QSR A;  3TFY A;  4UWI A;  1R57 A;  2VQY A;  1XRY A;  3D7D A;  3KGQ A;  1YRE A;  4K30 A;  3A9L A;  4OC0 A;  2ZEH A;  3WR7 A;  4TNU A;  2EVN A;  4R6T A;  4XPL A;  4RI1 A;  4C2Y A;  4ZY1 A;  2WPX A;  3NH5 A;  5JQ4 A;  2NSM A;  4PQA A;  4XNH B;  2ARH A;  2C1C A;  2B5G B;  3R96 A;  1IOI A;  1YLE A;  3S9N A;  4L89 A;  4Y49 C;  4DNC A;  4O23 A;  3SI0 A;  5JPH A;  4MHZ A;  3R1K A;  5H86 A;  1PU9 A;  1ZO0 A;  3JVN A;  4PSW A;  3R9E A;  3P2H A;  4DUK A;  1HEE A;  2EBJ A;  3FRM A;  1K4J A;  3D67 A;  1DTD A;  2RFH A;  2ODF A;  4JZ0 A;  1NE9 A;  2Z3O A;  3MN8 A;  4XPD B;  2Z10 A;  5HVH A;  1CPS A;  4EWT A;  5AG7 A;  1Y0R A;  1Q7L A;  3T8W A;  3PB6 X;  3MGD A;  4P4F A;  3OWC A;  5G20 A;  1IOF A;  3KQX A;  2CNM A;  3VH9 A;  4TWE A;  3KAS A;  3NE8 A;  1I1D A;  2WYR A;  1IU8 A;  3KZW A;  3S9M A;  4C7H A;  2H5M A;  4QBJ A;  1Z8W A;  5EBV A;  2P6E A;  4DJL A;  1XJO A;  2B58 A;  3V7Z A;  3B3T A;  4Z65 A;  3TTH A;  1KUV A;  5EMI A;  3DGV A;  3GUX A;  4NCZ A;  2FT0 A;  3F0A A;  4BD9 A;  1R43 A;  2CNT A;  4OAE A;  2VI7 A;  4HNY B;  2ZEP A;  3MRU A;  3TO7 A;  3CZX A;  2FIW A;  3R95 A;  2G3A A;  5C82 A;  2IQ6 A;  4KOU A;  5K8M A;  4B5P A;  1FY7 A;  2WZN A;  4WJB A;  1KUY A;  2GU2 A;  2PRQ A;  2YND A;  4KLW A;  2ANP A;  4XNH C;  5LYD A;  5G1Z A;  3TE4 A;  4A94 A;  4ZX9 A;  2OU2 A;  2Z3P A;  4KSF A;  4A32 A;  3BLN A;  4IUS A;  4OC2 A;  4JYW A;  3GIU A;  1LAM A;  4KOT A;  4LUA A;  3RNZ A;  1Z9U A;  3S6G A;  3VWD A;  2CY2 A;  3BJ8 A;  3WAB A;  4CAW A;  2EUI A;  4R3K A;  4F6A A;  1Y0Y A;  3HUV A;  3I3G A;  4HKF A;  3NE7 A;  2VL1 A;  3KR5 A;  4PV6 A;  5JM6 A;  1VIX A;  2F8H A;  3NH8 A;  4MMO A;  1NSA A;  3PZJ A;  1VHO A;  1ZLI A;  2PVW A;  1QQ9 A;  1BOB A;  3D3S A;  2BSW A;  3IFE A;  4BMH A;  4H2K A;  4A38 A;  1TXR A;  2VZZ A;  1N71 A;  3DDD A;  4MCS A;  2PR1 A;  4OP4 A;  5AG6 A;  4YGO A;  3SJF A;  2PJ8 A;  4YU9 A;  1LOK A;  3B3W A;  4EME A;  5ELY A;  4ONW A;  3KQZ A;  2ZW5 A;  3K9T A;  3B8G A;  4KOR A;  2Q4Y A;  2ZOG A;  2EO8 A;  5HVG A;  1IY7 A;  2QIR A;  4NJQ A;  1MJA A;  4A33 A;  4PXE A;  2JEW A;  2CTC A;  5LRG A;  4CRZ B;  2AFZ A;  1R3N A;  5HMN A;  4MCQ A;  2O28 A;  3B3V A;  2K5T A;  2AE6 A;  2HB6 A;  2ZXV A;  3S6F A;  2RB7 A;  5K8P A;  3BI0 A;  1U6M A;  3R9F A;  1F2P A;  3RBU A;  1XBU A;  3H4Q A;  5IB0 A;  2HUZ A;  2JDD A;  1L0C A;  1Z8T A;  1ZG8 A;  2R7H A;  3PFE A;  4C2X A;  3GLJ A;  1B87 A;  5A27 A;  1YQE A;  3GB0 A;  3S6K A;  3IWW A;  4MFJ A;  4FWU A;  4KVM E;  1CJW A;  2ATR A;  4B14 A;  2ZEN A;  4X5K A;  4WWV A;  4KSA A;  4KZT A;  4UCN A;  1Y7R A;  1DE4 C;  4P4I A;  5FVJ A;  1H8L A;  4UFX A;  4DYO A;  2ZOF A;  4P4D A;  5I0C A;  8CPA A;  4PXB A;  3W6X A;  3FMC A;  1XOV A;  4OC4 A;  2XEJ A;  3IIB A;  4M6H A;  3D2M A;  4KVX A;  4OLL A;  2JBJ A;  4JLY A;  3FYN A;  4OKO A;  5GCN A;  3KHZ A;  4GS4 A;  4W9Y A;  5AGE A;  2VEZ A;  3IGR A;  1Z8L A;  3CPX A;  4YRH A;  3NH4 A;  2EK8 A;  5DS0 A;  2AFM A;  4LQG A;  3FF3 A;  4CGL A;  2BO9 A;  1HDU A;  4A95 A;  4ZI6 A;  3T9Y A;  3PFO A;  1ZG9 A;  2G9D A;  3CXP A;  4CAF A;  5THW A;  2PJB A;  2PVV A;  2HV2 A;  4QUS A;  3TO6 A; 
#chains in the Genus database with same CATH homology
 4ZGY B;  2ZW7 A;  2J8N A;  3SXO A;  4PK3 A;  4M85 A;  1MJB A;  4AVC A;  2YNC C;  4NXY A;  3C26 A;  1M4G A;  4R87 A;  2GAN A;  4MY0 A;  4AVA A;  4B13 A;  1Z4R A;  5EC4 A;  4NF1 A;  1QSM A;  1Q2Y A;  1LRZ A;  4H6Z A;  4B5O A;  2B3U A;  3CXS A;  1XIX A;  4KOW A;  4MFK A;  4NSQ A;  3F5B A;  3ZJ0 A;  2B4D B;  1Z4E A;  3PP9 A;  1IIC A;  1BO4 A;  2VXK A;  2DPT A;  2R1I A;  3SHP A;  4J3G A;  2Q0Y A;  3JUW A;  3TCV A;  3BJ7 A;  3W6S A;  5ISV A;  5H84 A;  3PGP A;  1I12 A;  2WSA A;  3P2F A;  3IWE A;  3KKW A;  4HNX B;  2ZW4 A;  4H6U A;  5E96 A;  3FXT A;  2Q44 A;  4UFV A;  5DWN A;  2Z3L A;  2WUU A;  4KOS A;  2AJ6 A;  2R8V A;  3D8P A;  5BWA B;  2OZU A;  4KS9 A;  1IB1 E;  2JDC A;  1VKC A;  2F5I A;  4JJX A;  1VHS A;  5J8F A;  2REF A;  2X7B A;  5KTD A;  5IV0 A;  4CS0 B;  4H89 A;  3F8K A;  2IL4 A;  4KOY A;  2I79 A;  2JLM A;  5AG4 A;  3GYA A;  4U5Y A;  5F47 A;  3FBU A;  1ON0 A;  2OZG A;  1YGH A;  4CYO A;  1WWZ A;  4E8O A;  1MK4 A;  2CNS A;  1OZP A;  4B12 A;  4CYN A;  4UBR A;  2Z11 A;  1IID A;  3SXN A;  4EVY A;  4PSX A;  4UCM A;  3G8W A;  4R9M A;  4B5P B;  1QSO A;  4L8A A;  3G3S A;  2Y0M A;  3K9U A;  4KLV A;  3E0K A;  2B5G A;  2REE A;  2QEC A;  1UFH A;  5A28 A;  1S5K A;  5F49 A;  3EO4 A;  1NSL A;  1S7L A;  5F46 A;  4II9 A;  2Q4V A;  5KTA A;  1XF8 A;  1Y9W A;  4MJ8 A;  4B11 A;  4ORF A;  2Z3N A;  3EXN A;  4Q36 A;  4A2Z A;  3R9G A;  2FCK A;  2HQY A;  2D4P A;  4CAV A;  2Q04 A;  3V8I A;  1YVK A;  4MFP A;  3EY5 A;  5KTC A;  1P4N A;  2YGW A;  1IYK A;  4IF5 A;  4CRY B;  2J8M A;  4R57 A;  1QST A;  2Z0Z A;  2BUE A;  2FL4 A;  2PDO A;  2YNE A;  4B10 A;  4CGP A;  1Q2C A;  3CXQ A;  2I00 A;  3TO9 A;  4E0A A;  4KOV A;  4MI4 A;  1V0C A;  4U9Y A;  4F0Y A;  1IYL A;  2P0W A;  3DNS A;  2YNC A;  1YVO A;  4R3L A;  3GKR A;  3T90 A;  2FE7 A;  4CAE A;  4NEX A;  3DR8 A;  4ONU A;  5IX3 A;  1GHE A;  1KUX A;  1S60 A;  2Z3M A;  4AVB A;  2OH1 A;  4AG7 A;  3FIX A;  2PSW A;  1S3Z A;  4AB7 A;  3GY9 A;  4PK2 A;  1I21 A;  3N7Z A;  4QVT A;  4LX9 A;  3H5Z A;  4MBU A;  1S7K A;  4A30 A;  4E2A A;  3FNC A;  1M1D A;  3QB8 A;  4FD7 A;  2Q7B A;  2C27 A;  4MFZ A;  5G21 A;  2FSR A;  1YX0 A;  4KVO E;  2P6G A;  1CM0 A;  1TIQ A;  4CGN A;  4ZBG A;  1M4D A;  2G3T A;  2FXF A;  2Z3K A;  1M4I A;  3IU2 A;  2PRB A;  4CYP A;  4FD6 A;  3W91 A;  2DPS A;  4M3S A;  2BEI A;  2J8R A;  4BBH A;  1RO5 A;  4I49 A;  2QML A;  4MFL A;  2CXA A;  1P0H A;  2B4B A;  2B3V A;  3IWG A;  2G0B A;  2VBQ A;  4CGM A;  2PR8 A;  2WPW A;  4RS2 A;  2FIA A;  4C2Z A;  4UWJ A;  4Y49 B;  1Y9K A;  4UFW A;  1MJ9 A;  4CAX A;  1RXT A;  2D4O A;  3QAH A;  4FD4 A;  2GE3 A;  4UCP A;  3S6H A;  4F0X A;  1J4J A;  3EC4 A;  1YK3 A;  2PC1 A;  1XMT A;  4YFJ A;  5C88 A;  4MY3 A;  2OZH A;  4KUA A;  5G22 A;  1SQH A;  4UA3 A;  1PUA A;  2DXQ A;  4MFQ A;  3FB3 A;  1KZF A;  1YR0 A;  1Q2D A;  2KCW A;  1XEB A;  3DR6 A;  3LOD A;  1M44 A;  2ZPA A;  3LD2 A;  1B6B A;  4OAD A;  4CGO A;  4JXR A;  4HNW B;  4JXQ A;  4KOX A;  3ZZI A;  1WK4 A;  4AG9 A;  3I9S A;  5F48 A;  1S7N A;  2GIV A;  3TOB A;  4XNH B;  5AG5 A;  1XE4 A;  4FD5 A;  2RC4 A;  4JD6 A;  3S6G A;  2OB0 A;  2ZW6 A;  2BL1 A;  2PQ8 A;  2P6F A;  2NMT A;  1NMT A;  3UY5 A;  2FS5 A;  3IU1 A;  5HH1 A;  4C68 A;  3JTK A;  2VZY A;  1S7F A;  4U9Z A;  2JEV A;  3EFA A;  5J8C A;  2A4N A;  4XPD C;  3TOA A;  2B4D A;  4JWP A;  4C7I A;  4CYQ A;  2R98 A;  3VWE A;  4QC6 A;  4XPK A;  1QSN A;  3D2P A;  4KUB A;  3TT2 A;  4QB9 A;  5CNP A;  4MHD A;  4Q38 A;  5DWM A;  3DSB A;  3RYO A;  4A31 A;  1QSR A;  3TFY A;  4UWI A;  1R57 A;  2VQY A;  4K30 A;  1YRE A;  3A9L A;  3WR7 A;  2EVN A;  4XPL A;  4RI1 A;  4C2Y A;  2WPX A;  5JQ4 A;  2ARH A;  2B5G B;  3R96 A;  1YLE A;  4L89 A;  4Y49 C;  4DNC A;  5JPH A;  3R1K A;  5H86 A;  1PU9 A;  1ZO0 A;  3JVN A;  4PSW A;  3R9E A;  3P2H A;  3FRM A;  1K4J A;  1NE9 A;  2Z3O A;  4XPD B;  2Z10 A;  5AG7 A;  3MGD A;  3OWC A;  5G20 A;  2CNM A;  1I1D A;  4C7H A;  2H5M A;  4QBJ A;  5EBV A;  2P6E A;  2B58 A;  3TTH A;  1KUV A;  4NCZ A;  2FT0 A;  3F0A A;  2CNT A;  4OAE A;  2VI7 A;  4HNY B;  5C82 A;  3TO7 A;  2FIW A;  3R95 A;  2G3A A;  4KOU A;  4B5P A;  1FY7 A;  1KUY A;  2YND A;  4KLW A;  4XNH C;  5G1Z A;  3TE4 A;  2OU2 A;  2Z3P A;  4KSF A;  4A32 A;  3BLN A;  4IUS A;  4KOT A;  4LUA A;  3VWD A;  4CAW A;  1Z9U A;  2CY2 A;  3BJ8 A;  2EUI A;  4R3K A;  4F6A A;  3I3G A;  4HKF A;  3NE7 A;  4PV6 A;  3PZJ A;  1BOB A;  3D3S A;  2BSW A;  4BMH A;  2VZZ A;  1N71 A;  3DDD A;  2PR1 A;  5AG6 A;  4YGO A;  2ZW5 A;  3B8G A;  4KOR A;  2Q4Y A;  2QIR A;  1MJA A;  4A33 A;  5HMN A;  4CRZ B;  2O28 A;  2K5T A;  2AE6 A;  3S6F A;  2ZXV A;  1U6M A;  3R9F A;  3H4Q A;  5IB0 A;  2HUZ A;  2JDD A;  1L0C A;  2R7H A;  4C2X A;  5A27 A;  1B87 A;  3S6K A;  4MFJ A;  4KVM E;  1CJW A;  2ATR A;  4B14 A;  4X5K A;  4KSA A;  4KZT A;  4UCN A;  1Y7R A;  5FVJ A;  4UFX A;  5I0C A;  3W6X A;  3D2M A;  4KVX A;  4OLL A;  4JLY A;  5GCN A;  3FYN A;  4GS4 A;  5AGE A;  2VEZ A;  3IGR A;  4YRH A;  4CGL A;  4A95 A;  3T9Y A;  3CXP A;  4CAF A;  2HV2 A;  4QUS A;  3TO6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...