5F47A

Crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample in complex with trehalose
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
151
structure length
151
Chain Sequence
IDNFLKIERLAENDLPKFIQLIRLFEAVFEMKNFSIPDSEHLQKLLNQNNFYVFVALLENKIVGGLTSYVLEQYYSEKPLAYIYDLAVDTNWQRQGIGKKLITATNQFYTEKGFEEVFVQADKVDDYALDFYRSTKPTAEEQVVHFYYTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords aminoglycoside acetyltransferase meta-AAC0020
publication title Structural and Functional Survey of Environmental Aminoglycoside Acetyltransferases Reveals Functionality of Resistance Enzymes.
pubmed doi rcsb
source organism Uncultured bacterium
total genus 36
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5f47A00
2I00A 4B5PA 2OZHA 4CAWA 4AG9A 5CNPA 3G3SA 4GS4A 3DR8A 1YX0A 3W6XA 2B4BA 4MJ8A 2Z0ZA 3S6KA 3T90A 4U9ZA 2RC4A 3I3GA 2REFA 4QB9A 5DWMA 3IWGA 4E2AA 3G8WA 5ISVA 2PC1A 4RS2A 2JEVA 1YVKA 2CY2A 4XPDC 3VWDA 2K5TA 2R1IA 4U5YA 3IGRA 4AVBA 5KTAA 2P6EA 3SXOA 1CM0A 2I79A 4XNHC 3FYNA 3P2HA 2B3UA 3CXPA 4KUBA 2FT0A 1R57A 4KVXA 5IX3A 5F49A 1L0CA 4M85A 5DWNA 4H6UA 4IF5A 1FY7A 4PK2A 2ZW6A 3FXTA 3JUWA 4QC6A 5E96A 3S6FA 4I49A 2VI7A 3LD2A 4KLVA 4XPDB 1WK4A 4MBUA 1XE4A 1YREA 1S7FA 5FVJA 2ZW4A 3N7ZA 2R98A 2VZYA 4KOUA 1I21A 2FIWA 2J8NA 2OZGA 1YK3A 1IIDA 1QSTA 4L89A 1I1DA 5J8FA 2PR8A 1WWZA 3FB3A 3H4QA 3PZJA 4UA3A 3CXSA 1NMTA 4AVAA 2X7BA 2GIVA 3TT2A 2QIRA 4LUAA 2OB0A 3D2PA 3S6GA 3CXQA 4YRHA 4L8AA 1QSMA 3BJ8A 1BOBA 4E8OA 4JLYA 5C82A 2JDCA 1XIXA 1Y9WA 2PDOA 4RI1A 4R3LA 1KUXA 4UWJA 1S7NA 4F0YA 4NEXA 2WPWA 1MJBA 2D4PA 3RYOA 1YR0A 4PV6A 5IB0A 4YGOA 1RO5A 4FD5A 4H6ZA 4ZBGA 4CAVA 2Q44A 3WR7A 3GKRA 5J8CA 4II9A 2OZUA 1M1DA 2GE3A 1LRZA 4H89A 2Q4VA 1Z4RA 2DXQA 2FSRA 5F48A 1PU9A 1VKCA 4K30A 3S6HA 2BL1A 1M4IA 2CNTA 4J3GA 3EXNA 2EVNA 3K9UA 1Z4EA 3NE7A 4XPLA 1B87A 2H5MA 3R96A 2B5GB 1S5KA 3EY5A 2B4DB 3FRMA 2G0BA 1GHEA 1Q2CA 4EVYA 1QSOA 3ZJ0A 1MK4A 2J8RA 2J8MA 2OH1A 4KOVA 5I0CA 1S3ZA 3DNSA 2G3AA 4KVOE 1IICA 4F6AA 2ZXVA 2FIAA 2NMTA 4KOXA 2A4NA 5F46A 2B3VA 4MHDA 3F5BA 1KUVA 3VWEA 4AB7A 3R1KA 4KLWA 2OU2A 4PSXA 5IV0A 3FBUA 1MJAA 3TO6A 2P6GA 1SQHA 2IL4A 1J4JA 4OADA 3SXNA 5JPHA 5H84A 4QUSA 2Q4YA 3R95A 2B4DA 4AVCA 3KKWA 2P6FA 1XMTA 3E0KA 3C26A 3TTHA 3LODA 4UWIA 2B58A 1Z9UA 3P2FA 5GCNA 1M4GA 2EUIA 2Z10A 3SHPA 4BMHA 1Q2DA 1U6MA 1P0HA 3TOBA 2REEA 3DR6A 4NSQA 2PQ8A 3QB8A 1IB1E 1B6BA 2BSWA 2QMLA 4HNXB 2PRBA 3UY5A 4PK3A 2BUEA 1NE9A 4KOYA 1XF8A 2VZZA 3EO4A 4U9YA 4KZTA 1YVOA 1K4JA 1I12A 2AJ6A 3BLNA 2GANA 3D3SA 2FS5A 4OLLA 4R3KA 3JVNA 1N71A 1ON0A 4HKFA 4KUAA 2Q7BA 2Q04A 2Q0YA 3QAHA 1Y9KA 2JLMA 1QSRA 1QSNA 1V0CA 4Y49B 5HH1A 3ZZIA 4JXQA 4KORA 4JD6A 4X5KA 4FD6A 3W6SA 2ATRA 4R57A 4M3SA 3TCVA 2WPXA 2D4OA 1YLEA 1S7KA 1UFHA 3T9YA 1M44A 2HV2A 1KZFA 4KOTA 4DNCA 4QVTA 3TO9A 3R9EA 5EBVA 4XPKA 4IUSA 2QECA 4OAEA 1IYKA 1Q2YA 2ZW5A 3EFAA 2G3TA 2F5IA 4PSWA 4CAXA 2VBQA 2PR1A 1S7LA 4CS0B 4NF1A 2HUZA 5EC4A 1IYLA 4FD4A 4CRZB 2CNMA 1CJWA 3FIXA 3MGDA 1XEBA 4NCZA 2B5GA 3D8PA 3OWCA 2VXKA 3TFYA 5HMNA 1S60A 3F8KA 4JXRA 1PUAA 2FL4A 3D2MA 4R87A 3DSBA 4MY3A 2R7HA 4KVME 4XNHB 3R9FA 2Z11A 2ZPAA 4MI4A 2HQYA 1YGHA 1VHSA 2VQYA 4KOSA 4KOWA 2Y0MA 3W91A 4ONUA 4FD7A 4NXYA 2VEZA 3EC4A 4QBJA 4CRYB 2O28A 1KUYA 3B8GA 2BEIA 3FNCA 4UBRA 4B5PB 3PGPA 5KTDA 2FE7A 3TO7A 2PSWA 4B5OA 4E0AA 4JWPA 1P4NA 2C27A 2R8VA 4R9MA 5C88A 3TOAA 4HNYB 5F47A 2KCWA 4LX9A 1BO4A 3F0AA 2JDDA 3I9SA 4Y49C 5JQ4A 3GY9A 4MY0A 1M4DA 3R9GA 1RXTA 2CNSA 4HNWB 3V8IA 1OZPA 2FXFA 1Y7RA 4YFJA 5KTCA 5H86A 2ZW7A 4JJXA 4ORFA 2ARHA 1TIQA 2P0WA 2FCKA 3BJ7A 3TE4A 2AE6A 1MJ9A 1NSLA 3GYAA 4AG7A 3PP9A 3DDDA
chains in the Genus database with same CATH superfamily
4P4DA 1X12A 2I00A 3BI1A 4B5PA 3FMCA 1CP6A 4OIWA 2PJ9A 2OZHA 3B3TA 4P44A 4CAWA 3KHZA 5CNPA 4AG9A 4B12A 3D7FA 3G3SA 3FJUA 4GS4A 3DR8A 1YX0A 3W6XA 4PXCA 2B4BA 4MJ8A 2Z0ZA 3S6KA 4A30A 3PB8X 4UFWA 5A27A 4CAEA 1ARLA 3T90A 2NSMA 4U9ZA 2RC4A 3I3GA 5THWA 4A95A 4CGPA 2REFA 4QB9A 5DWMA 3IWGA 4E2AA 3B3VA 3G8WA 4WWVA 4ZI6A 5ISVA 2PC1A 2ZOGA 2PVWA 5LYDA 4ZY2A 1XFOA 4RS2A 2JEVA 1YVKA 2CY2A 3BI0A 4XPDC 4ZX9A 3BXMA 2C6CA 2K5TA 3H8GA 2R1IA 3VWDA 4U5YA 3H5ZA 2HC9A 3IGRA 4AVBA 5KTAA 2P6EA 2F7VA 4GXHA 3SXOA 1CM0A 2I79A 4XNHC 3FYNA 3IFEA 4R8FA 3GB0A 3P2HA 2B3UA 4P4BA 3CXPA 3FECA 2IJZA 1R57A 2DPTA 2FT0A 4KUBA 4KVXA 2PJ3A 4PQAA 5F49A 4A32A 5IX3A 3ISXA 3RO0A 3RAMA 5JGFA 3VARA 1L0CA 4KS9A 4AXVA 3NFZA 3PFEA 2FVGA 2ZEHA 4M85A 1DE4C 1ZG7A 3JRUA 2IQ6A 5DWNA 4H6UA 4IF5A 2CTBA 1FY7A 4PK2A 2ZW6A 2AFUA 2JBKA 3FXTA 3JUWA 4NGQA 4I49A 1YMEA 2VI7A 4QC6A 5E96A 3LD2A 4WJBA 4KLVA 1YSJA 3B7IA 4XPDB 1WK4A 4G1PA 4MBUA 2DF5A 1XE4A 2CF4A 1YREA 1S7FA 2CXAA 3IIBA 5FVJA 2ZW4A 2OOTA 3N7ZA 2R98A 4NGMA 2VZYA 2Z3PA 4P4JA 1CBXA 4KOUA 4MHPA 3IU2A 2CTCA 2F8HA 1I21A 2FIWA 2J8NA 2GU2A 2OZGA 4LQ6A 1YK3A 2PJ1A 1IIDA 1QSTA 2ZEMA 4L89A 4DUKA 4UEZA 3D4UA 4GM5A 1I1DA 2DEAA 5J8FA 3RZAA 1YW4A 1WWZA 1Z8WA 2PJ6A 2PR8A 3FB3A 3H4QA 3PZJA 4IAVA 4NGNA 4UA3A 2GREA 3CXSA 1LCPA 5AG4A 1NMTA 4AVAA 2V77A 4F9VA 1Z8LA 3IJ3A 5EMIA 4P6YA 4PPZA 1IOFA 2X7BA 2GIVA 3TT2A 5K8MA 2QIRA 4LUAA 2OB0A 1BPMA 4M6GA 4CYPA 3D2PA 2EK9A 4MCRA 4YWYA 1FT7A 3S6GA 3CXQA 4JYWA 4YRHA 5K8PA 1Z8TA 4L8AA 1QSMA 2Z3KA 1BOBA 3BJ8A 4E8OA 4JLYA 5C82A 2JDCA 1XIXA 1Y9WA 2PJCA 2WUUA 2ZEGA 3PB4X 5ELYA 2PDOA 4OMEA 3SJXA 4RI1A 2GLJA 4R3LA 1KUXA 4UWJA 1S7NA 2YNCC 4F0YA 2PIZA 4NEXA 1Y0RA 2WPWA 2HB6A 1MJBA 1KWMA 2D4PA 2IMOA 3B3WA 3RYOA 1YR0A 4PV6A 5IB0A 4UFVA 4YGOA 3PBBA 1JQGA 1RO5A 3D7GA 4P4EA 4F9UA 4FD5A 4H6ZA 4ZBGA 4CAVA 2Q44A 3WR7A 3GKRA 5G20A 4RUHA 1XMBA 5J8CA 4II9A 1BPNA 2OZUA 1M1DA 2GE3A 3KASA 4UF4A 1LRZA 4C2XA 4H89A 2Q4VA 1Z4RA 4X3RA 4NGSA 2C6GA 2DXQA 2FSRA 3B2YA 1YW6A 5I4MA 5F48A 5LYLA 1BAVA 1PU9A 4HPSA 1VKCA 3CZXA 4K30A 3S6HA 2BL1A 1A2ZA 1M4IA 2CNTA 1HDQA 4J3GA 1XJOA 2BCOA 1CP7A 3EXNA 3I1UA 2EVNA 3B3CA 4Z65A 3K9UA 4CGNA 1Z4EA 3NE7A 4XPLA 1B87A 4OC0A 4ZX8A 2H5MA 2BO9A 3R96A 3FVLA 2B5GB 3K2KA 7CPAA 1S5KA 1IU8A 3EY5A 2ZEDA 2AFXA 1LOKA 2B4DB 3FRMA 1VIXA 3PFOA 2G0BA 1GHEA 3WC7A 2ABZA 1Q2CA 1TF9A 5LYIA 5K8NA 4EVYA 2WZNA 1QSOA 3N5FA 3ZJ0A 4ONWA 4CGOA 1PYTB 2WYRA 1MK4A 2J8RA 4B13A 4IK2A 4BINA 2J8MA 2OH1A 3SJFA 2QVPA 4KOVA 5I0CA 1S3ZA 2RFHA 2G3AA 1XBUA 2AFSA 3DNSA 4KVOE 1IICA 3FEEA 4F6AA 5K8OA 2ZXVA 2FIAA 1ELLP 2NMTA 4KOXA 4PXEA 2A4NA 5F46A 4CGLA 1Q7LA 1RTQA 3VH9A 2B3VA 4MHDA 3F5BA 5CPAA 3SJEA 1F57A 4P45A 2QYVA 4UCMA 1KUVA 4R76A 1XOVA 3KZWA 3VWEA 4AB7A 3LMSA 2J9AA 3R1KA 4KLWA 4MHYA 4CYNA 2OU2A 4PSXA 5IV0A 3FBUA 1TKFA 3K9TA 1LAPA 4MFPA 1MJAA 2YNCA 3TO6A 2P6GA 1HEEA 1SQHA 2PJBA 4BBHA 2IL4A 5HVGA 4X8IA 4C68A 5BWAB 2ZEFA 4ZY0A 1J4JA 1AMPA 4OADA 3SXNA 5F09A 5JPHA 2EBJA 5H84A 4QUSA 2AFOA 2Q4YA 3R95A 2AFWA 2B4DA 4TWEA 4MHNA 1UWYA 4AVCA 3KKWA 2P6FA 5CBMA 1IOIA 1XMTA 3D7HA 2PE3A 3CDXA 1CG2A 3E0KA 4FAIA 4OC2A 2Q51A 3C26A 4EMEA 3D7DA 3LACA 3LODA 4UWIA 3TTHA 4A39A 2B58A 3PEIA 2AFZA 4MCSA 4KSIA 1Z9UA 4A33A 4Q36A 1R43A 4NGTA 5A28A 5HVFA 3P2FA 5GCNA 4P4FA 3NH8A 1M4GA 2EUIA 5AG5A 3S9MA 2C6PA 2CIJA 2Z10A 3SHPA 4BMHA 2V8VA 3CPAA 2PIYA 1Q2DA 3FF3A 3CPXA 1U6MA 1P0HA 3NE8A 3TOBA 2REEA 3DR6A 4NSQA 4PXDA 1CX8A 1NSAA 2PQ8A 3KQXA 3JTKA 2Q4ZA 3QB8A 2EK8A 2XEFA 1IB1E 1B6BA 4UCPA 2BSWA 2QMLA 2NYQA 4HNXB 2O4HA 2ZELA 4FBEA 1LANA 1TKJA 4B10A 5JM6A 2PRBA 1ZG9A 1XRYA 4Q7AA 3SI1A 3UY5A 2PJ2A 1CPSA 2XEIA 2ZEOA 1QQ9A 4PK3A 3MRUA 3DDDA 3D68A 2BUEA 1NE9A 4ZYQA 4C2YA 3DLJA 3B3SA 4KOYA 2JEWA 2Z3OA 3L2NA 1LFWA 1XF8A 2VZZA 3EO4A 2Q43A 3GLJA 4U9YA 2ODFA 1YVOA 4KZTA 4UIAA 4FWUA 1K4JA 4P10A 1I12A 8CPAA 2AJ6A 2PRQA 3BLNA 2GANA 3PB6X 3D3SA 4F8ZA 5IB9A 2FS5A 4MHZA 4OLLA 2ZOFA 2POKA 1F2OA 4JZ0A 4NGPA 4R3KA 5LRJA 2PJ7A 2Z3MA 3JVNA 1N71A 4DJLA 4B11A 2OR4A 2Z3NA 1ON0A 4PXBA 5AG6A 4HKFA 4KUAA 2Q7BA 3H8EA 3IEHA 3KQZA 2Q7SA 2Q04A 6CPAA 5G22A 4CGMA 3IWWA 2Q0YA 1TXRA 3S9NA 3TX8A 3QAHA 1Y9KA 2JLMA 4NFRA 4C7HA 1QSRA 4CYOA 2I3CA 1QSNA 1V0CA 3HUVA 4Q38A 4B14A 4Y49B 5HH1A 1DTDA 3ZZIA 2VL1A 4JXQA 4KORA 4JD6A 4X5KA 3SI2A 4MCQA 4BD9A 3S9LA 3T8WA 1VHOA 4FD6A 3W6SA 3FH4A 2RB7A 2ATRA 4R57A 3IO1A 3S6FA 4DYOA 3IC1A 1VHEA 4M3SA 3TCVA 2PJ5A 2WPXA 2D4OA 3D66A 3KHXA 4OC5A 4A94A 5D29A 4MCPA 4C2ZA 5G1ZA 4R7MA 3WT4A 1YLEA 5AG7A 2C1CA 4M6IA 3WC6A 1S7KA 4MFZA 1UFHA 5LRKA 3T9YA 1M44A 2HV2A 1KZFA 1TF8A 2JBJA 1IY7A 4KOTA 4DNCA 2O53A 4QVTA 3TO9A 3R9EA 2XEJA 5EBVA 1R3NA 4A38A 1F2PA 4IUSA 4OP4A 4XPKA 3DGVA 2QECA 4OAEA 3KR4A 1EE3P 1IYKA 1JWQA 1Q2YA 2ZW5A 4MFKA 4UIBA 1YQEA 2V8DA 3TC8A 4OC1A 4MMOA 5LRGA 3IWEA 2G3TA 3EFAA 2F5IA 4RN7A 3LWUA 3PB9X 1Z5RA 4W9YA 1AUGA 4OIDA 4PSWA 2DPSA 4CAXA 2VBQA 3VATA 2PR1A 1S7LA 4CPAA 4CS0B 2Z3LA 3B35A 3V38A 3NA6A 4NF1A 4OKOA 2HUZA 3RBUA 5EC4A 4K3NA 1IYLA 4FD4A 4CRZB 2CNMA 3FEDA 1CJWA 1CPXA 3FIXA 3WC5A 3H8FA 3MGDA 4A2ZA 1XEBA 4NCZA 2B5GA 2GFQA 1ZO0A 3D8PA 3OWCA 2VXKA 3TFYA 5HMNA 1S60A 4C7IA 3HLPA 3F8KA 4A37A 3SI0A 5HVHA 4JXRA 3FX6A 1PUAA 1FNOA 3V7ZA 4IHMA 3PBEA 2FL4A 4M6HA 3CT9A 3D2MA 4NJQA 4R87A 3DSBA 1VGYA 4MY3A 2R7HA 4KVME 4X2TA 4XNHB 3R9FA 2Z11A 4CAFA 2GLFA 2ZPAA 2V8GA 4MI4A 4KSAA 4TNUA 2HQYA 4A31A 1YGHA 3ISZA 1VHSA 1TKHA 2VQYA 4MFJA 4KOSA 2BOAA 2XEGA 4KOWA 2Y0MA 4MRIA 1ARMA 4F0XA 5AGEA 4FUUA 3QNVA 4LQGA 3W91A 3WABA 4ONUA 1BLLE 4KSFA 4FD7A 1Z2LA 3KR5A 3SJGA 4NXYA 4MFQA 2PJ0A 2VEZA 1ZLIA 3EC4A 4EWTA 4ZY1A 1HDUA 2PVVA 3KL9A 3PB7X 4QBJA 1ZG8A 3KGQA 4CRYB 5HXDA 2O28A 3RNZA 1KUYA 3B8GA 2BEIA 3FNCA 4UBRA 3QAYA 4YU9A 3PGPA 1NSLA 4B5PB 5KTDA 2FE7A 2V8HA 3TO7A 2PSWA 2ZENA 4B5OA 4E0AA 4NJRA 1X10A 4JWPA 1P4NA 2C27A 2R8VA 4R9MA 4UFXA 1M4LA 1GYTA 1Y0YA 4OC3A 3TOAA 5C88A 5LYFA 4HNYB 2WSAA 2KCWA 5F47A 4H2KA 1OBRA 4O23A 4LX9A 4UEFA 1ELMP 4B6ZA 1BO4A 2QJ8A 1PCAA 2JDDA 2G9DA 2EO8A 2YNDA 3F0AA 3I9SA 4UEEA 4Y49C 5JQ4A 3GY9A 1Y7EA 2PJ8A 1LAMA 4MY0A 1M4DA 3R9GA 4CYQA 1AYEA 1RXTA 2CNSA 4UCNA 2PCUA 5J1QA 4HNWB 3V8IA 2YNEA 1OZPA 4EFDA 2FXFA 2EWBA 3KI9A 1Y7RA 5DS0A 5G21A 4YFJA 2YGWA 5KTCA 5H86A 2ZW7A 4JJXA 3NH4A 4ORFA 1IGBA 2ARHA 1YLOA 1Z8XA 2AFMA 3GIUA 1TIQA 4ZGYB 2P0WA 2ZEEA 3PRTA 2FCKA 4R6TA 1H8LA 4MFLA 4NGRA 3BJ7A 3TE4A 2ANPA 4P4IA 4MXUA 5D8NA 5JH9A 2AE6A 2PJ4A 4OC4A 1MJ9A 1ZLHA 3D67A 2ZEPA 2PJAA 3MN8A 3GYAA 3BHXA 3IU1A 3NH5A 1QMUA 3PP9A 4AG7A 3GUXA 3A9LA
chains in the Genus database with same CATH topology
2I00A 4B5PA 2OZHA 4CAWA 4AG9A 5CNPA 4B12A 3G3SA 4GS4A 3DR8A 1YX0A 3W6XA 2B4BA 4MJ8A 2Z0ZA 3S6KA 4A30A 4UFWA 5A27A 4CAEA 3T90A 4U9ZA 2RC4A 3I3GA 4A95A 4CGPA 2REFA 4QB9A 5DWMA 3IWGA 4E2AA 3G8WA 5ISVA 2PC1A 4RS2A 2JEVA 1YVKA 2CY2A 4XPDC 3VWDA 2K5TA 2R1IA 4U5YA 3H5ZA 3IGRA 4AVBA 5KTAA 2P6EA 3SXOA 1CM0A 2I79A 4XNHC 3FYNA 3P2HA 2B3UA 3CXPA 4KUBA 2DPTA 1R57A 2FT0A 4KVXA 4A32A 5IX3A 5F49A 1L0CA 4KS9A 4M85A 5DWNA 4H6UA 4IF5A 1FY7A 4PK2A 2ZW6A 3FXTA 3JUWA 4QC6A 5E96A 3S6FA 4I49A 2VI7A 3LD2A 4KLVA 4XPDB 1WK4A 4MBUA 1XE4A 1YREA 1S7FA 2CXAA 5FVJA 2ZW4A 3N7ZA 2R98A 2VZYA 2Z3PA 4KOUA 3IU2A 1I21A 2FIWA 2J8NA 2OZGA 1YK3A 1IIDA 1QSTA 4L89A 1I1DA 5J8FA 2PR8A 1WWZA 3FB3A 3H4QA 3PZJA 4UA3A 3CXSA 5AG4A 1NMTA 4AVAA 2X7BA 2GIVA 3TT2A 2QIRA 4LUAA 2OB0A 4CYPA 3D2PA 3S6GA 3CXQA 4YRHA 4L8AA 2Z3KA 1QSMA 3BJ8A 1BOBA 4E8OA 4JLYA 5C82A 2JDCA 1XIXA 1Y9WA 2WUUA 2PDOA 4RI1A 4R3LA 1KUXA 4UWJA 1S7NA 2YNCC 4F0YA 4NEXA 2WPWA 1MJBA 2D4PA 3RYOA 1YR0A 4PV6A 5IB0A 4UFVA 4YGOA 1RO5A 4FD5A 4H6ZA 4ZBGA 4CAVA 2Q44A 3WR7A 3GKRA 5G20A 5J8CA 4II9A 2OZUA 1M1DA 2GE3A 1LRZA 4C2XA 4H89A 2Q4VA 1Z4RA 2DXQA 2FSRA 5F48A 1PU9A 1VKCA 4K30A 3S6HA 2BL1A 1M4IA 2CNTA 4J3GA 3EXNA 2EVNA 3K9UA 4CGNA 1Z4EA 3NE7A 4XPLA 1B87A 2H5MA 3R96A 2B5GB 1S5KA 3EY5A 2B4DB 3FRMA 2G0BA 1GHEA 1Q2CA 4EVYA 1QSOA 3ZJ0A 4CGOA 1MK4A 2J8RA 4B13A 2J8MA 2OH1A 4KOVA 5I0CA 1S3ZA 3DNSA 2G3AA 4KVOE 1IICA 4F6AA 2ZXVA 2FIAA 2NMTA 4KOXA 2A4NA 5F46A 4CGLA 2B3VA 4MHDA 3F5BA 3A9LA 4UCMA 1KUVA 3VWEA 4AB7A 4CYNA 3R1KA 4KLWA 2OU2A 4PSXA 5IV0A 3FBUA 4MFPA 1MJAA 2YNCA 3TO6A 2P6GA 1SQHA 4BBHA 2IL4A 4C68A 5BWAB 1J4JA 4OADA 3SXNA 5JPHA 5H84A 4QUSA 2Q4YA 3R95A 2B4DA 4AVCA 3KKWA 2P6FA 1XMTA 3E0KA 3C26A 3TTHA 3LODA 4UWIA 2B58A 1Z9UA 4A33A 4Q36A 5A28A 3P2FA 5GCNA 1M4GA 2EUIA 5AG5A 2Z10A 3SHPA 4BMHA 1Q2DA 1U6MA 1P0HA 3TOBA 2REEA 3DR6A 4NSQA 2PQ8A 3JTKA 3QB8A 1IB1E 1B6BA 4UCPA 2BSWA 2QMLA 4HNXB 4B10A 2PRBA 3UY5A 4PK3A 2BUEA 1NE9A 4C2YA 4KOYA 2Z3OA 1XF8A 2VZZA 3EO4A 4U9YA 4KZTA 1YVOA 1K4JA 1I12A 2AJ6A 3BLNA 2GANA 3D3SA 2FS5A 4OLLA 4R3KA 2Z3MA 3JVNA 1N71A 4B11A 2Z3NA 1ON0A 5AG6A 4HKFA 4KUAA 2Q7BA 2Q04A 5G22A 4CGMA 2Q0YA 3QAHA 1Y9KA 2JLMA 4C7HA 1QSRA 4CYOA 4B14A 1QSNA 1V0CA 4Q38A 4Y49B 5HH1A 3ZZIA 4JXQA 4KORA 4JD6A 4X5KA 4FD6A 3W6SA 2ATRA 4R57A 4M3SA 3TCVA 2WPXA 2D4OA 4C2ZA 5G1ZA 1YLEA 5AG7A 1S7KA 4MFZA 1UFHA 3T9YA 1M44A 2HV2A 1KZFA 4KOTA 4DNCA 4QVTA 3TO9A 3R9EA 5EBVA 4XPKA 4IUSA 2QECA 4OAEA 1IYKA 1Q2YA 2ZW5A 4MFKA 3IWEA 3EFAA 2G3TA 2F5IA 4PSWA 2DPSA 4CAXA 2VBQA 2PR1A 1S7LA 4CS0B 2Z3LA 4NF1A 2HUZA 5EC4A 1IYLA 4FD4A 4CRZB 2CNMA 1CJWA 3FIXA 3MGDA 4A2ZA 1XEBA 4NCZA 2B5GA 1ZO0A 3D8PA 3OWCA 2VXKA 3TFYA 5HMNA 1S60A 4C7IA 3F8KA 4JXRA 1PUAA 2FL4A 3D2MA 4R87A 3DSBA 4MY3A 2R7HA 4KVME 4XNHB 3R9FA 2Z11A 4CAFA 2ZPAA 4MI4A 4KSAA 4A31A 2HQYA 1YGHA 1VHSA 2VQYA 4MFJA 4KOSA 4KOWA 2Y0MA 4F0XA 5AGEA 3W91A 4ONUA 4KSFA 4FD7A 4NXYA 4MFQA 2VEZA 3EC4A 4QBJA 4CRYB 2O28A 1KUYA 3B8GA 2BEIA 3FNCA 4UBRA 4B5PB 3PGPA 5KTDA 2FE7A 3TO7A 2PSWA 4B5OA 4E0AA 4JWPA 1P4NA 2C27A 2R8VA 4R9MA 4UFXA 5C88A 3TOAA 4HNYB 2WSAA 2KCWA 5F47A 4LX9A 1BO4A 2YNDA 3F0AA 2JDDA 3I9SA 4Y49C 5JQ4A 3GY9A 4MY0A 1M4DA 3R9GA 4CYQA 1RXTA 4UCNA 2CNSA 4HNWB 3V8IA 2YNEA 1OZPA 2FXFA 5G21A 1Y7RA 4YFJA 2YGWA 5KTCA 5H86A 2ZW7A 4JJXA 4ORFA 2ARHA 4ZGYB 1TIQA 2P0WA 2FCKA 4MFLA 3BJ7A 3TE4A 2AE6A 1MJ9A 1NSLA 3GYAA 3IU1A 3PP9A 4AG7A 3DDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I00 A;  4B5P A;  2OZH A;  4CAW A;  4AG9 A;  5CNP A;  3G3S A;  4GS4 A;  3DR8 A;  1YX0 A;  3W6X A;  2B4B A;  4MJ8 A;  2Z0Z A;  3S6K A;  3T90 A;  4U9Z A;  2RC4 A;  3I3G A;  2REF A;  4QB9 A;  5DWM A;  3IWG A;  4E2A A;  3G8W A;  5ISV A;  2PC1 A;  4RS2 A;  2JEV A;  1YVK A;  2CY2 A;  4XPD C;  3VWD A;  2K5T A;  2R1I A;  4U5Y A;  3IGR A;  4AVB A;  5KTA A;  2P6E A;  3SXO A;  1CM0 A;  2I79 A;  4XNH C;  3FYN A;  3P2H A;  2B3U A;  3CXP A;  4KUB A;  2FT0 A;  1R57 A;  4KVX A;  5IX3 A;  5F49 A;  1L0C A;  4M85 A;  5DWN A;  4H6U A;  4IF5 A;  1FY7 A;  4PK2 A;  2ZW6 A;  3FXT A;  3JUW A;  4QC6 A;  5E96 A;  3S6F A;  4I49 A;  2VI7 A;  3LD2 A;  4KLV A;  4XPD B;  1WK4 A;  4MBU A;  1XE4 A;  1YRE A;  1S7F A;  5FVJ A;  2ZW4 A;  3N7Z A;  2R98 A;  2VZY A;  4KOU A;  1I21 A;  2FIW A;  2J8N A;  2OZG A;  1YK3 A;  1IID A;  1QST A;  4L89 A;  1I1D A;  5J8F A;  2PR8 A;  1WWZ A;  3FB3 A;  3H4Q A;  3PZJ A;  4UA3 A;  3CXS A;  1NMT A;  4AVA A;  2X7B A;  2GIV A;  3TT2 A;  2QIR A;  4LUA A;  2OB0 A;  3D2P A;  3S6G A;  3CXQ A;  4YRH A;  4L8A A;  1QSM A;  3BJ8 A;  1BOB A;  4E8O A;  4JLY A;  5C82 A;  2JDC A;  1XIX A;  1Y9W A;  2PDO A;  4RI1 A;  4R3L A;  1KUX A;  4UWJ A;  1S7N A;  4F0Y A;  4NEX A;  2WPW A;  1MJB A;  2D4P A;  3RYO A;  1YR0 A;  4PV6 A;  5IB0 A;  4YGO A;  1RO5 A;  4FD5 A;  4H6Z A;  4ZBG A;  4CAV A;  2Q44 A;  3WR7 A;  3GKR A;  5J8C A;  4II9 A;  2OZU A;  1M1D A;  2GE3 A;  1LRZ A;  4H89 A;  2Q4V A;  1Z4R A;  2DXQ A;  2FSR A;  5F48 A;  1PU9 A;  1VKC A;  4K30 A;  3S6H A;  2BL1 A;  1M4I A;  2CNT A;  4J3G A;  3EXN A;  2EVN A;  3K9U A;  1Z4E A;  3NE7 A;  4XPL A;  1B87 A;  2H5M A;  3R96 A;  2B5G B;  1S5K A;  3EY5 A;  2B4D B;  3FRM A;  2G0B A;  1GHE A;  1Q2C A;  4EVY A;  1QSO A;  3ZJ0 A;  1MK4 A;  2J8R A;  2J8M A;  2OH1 A;  4KOV A;  5I0C A;  1S3Z A;  3DNS A;  2G3A A;  4KVO E;  1IIC A;  4F6A A;  2ZXV A;  2FIA A;  2NMT A;  4KOX A;  2A4N A;  5F46 A;  2B3V A;  4MHD A;  3F5B A;  1KUV A;  3VWE A;  4AB7 A;  3R1K A;  4KLW A;  2OU2 A;  4PSX A;  5IV0 A;  3FBU A;  1MJA A;  3TO6 A;  2P6G A;  1SQH A;  2IL4 A;  1J4J A;  4OAD A;  3SXN A;  5JPH A;  5H84 A;  4QUS A;  2Q4Y A;  3R95 A;  2B4D A;  4AVC A;  3KKW A;  2P6F A;  1XMT A;  3E0K A;  3C26 A;  3TTH A;  3LOD A;  4UWI A;  2B58 A;  1Z9U A;  3P2F A;  5GCN A;  1M4G A;  2EUI A;  2Z10 A;  3SHP A;  4BMH A;  1Q2D A;  1U6M A;  1P0H A;  3TOB A;  2REE A;  3DR6 A;  4NSQ A;  2PQ8 A;  3QB8 A;  1IB1 E;  1B6B A;  2BSW A;  2QML A;  4HNX B;  2PRB A;  3UY5 A;  4PK3 A;  2BUE A;  1NE9 A;  4KOY A;  1XF8 A;  2VZZ A;  3EO4 A;  4U9Y A;  4KZT A;  1YVO A;  1K4J A;  1I12 A;  2AJ6 A;  3BLN A;  2GAN A;  3D3S A;  2FS5 A;  4OLL A;  4R3K A;  3JVN A;  1N71 A;  1ON0 A;  4HKF A;  4KUA A;  2Q7B A;  2Q04 A;  2Q0Y A;  3QAH A;  1Y9K A;  2JLM A;  1QSR A;  1QSN A;  1V0C A;  4Y49 B;  5HH1 A;  3ZZI A;  4JXQ A;  4KOR A;  4JD6 A;  4X5K A;  4FD6 A;  3W6S A;  2ATR A;  4R57 A;  4M3S A;  3TCV A;  2WPX A;  2D4O A;  1YLE A;  1S7K A;  1UFH A;  3T9Y A;  1M44 A;  2HV2 A;  1KZF A;  4KOT A;  4DNC A;  4QVT A;  3TO9 A;  3R9E A;  5EBV A;  4XPK A;  4IUS A;  2QEC A;  4OAE A;  1IYK A;  1Q2Y A;  2ZW5 A;  3EFA A;  2G3T A;  2F5I A;  4PSW A;  4CAX A;  2VBQ A;  2PR1 A;  1S7L A;  4CS0 B;  4NF1 A;  2HUZ A;  5EC4 A;  1IYL A;  4FD4 A;  4CRZ B;  2CNM A;  1CJW A;  3FIX A;  3MGD A;  1XEB A;  4NCZ A;  2B5G A;  3D8P A;  3OWC A;  2VXK A;  3TFY A;  5HMN A;  1S60 A;  3F8K A;  4JXR A;  1PUA A;  2FL4 A;  3D2M A;  4R87 A;  3DSB A;  4MY3 A;  2R7H A;  4KVM E;  4XNH B;  3R9F A;  2Z11 A;  2ZPA A;  4MI4 A;  2HQY A;  1YGH A;  1VHS A;  2VQY A;  4KOS A;  4KOW A;  2Y0M A;  3W91 A;  4ONU A;  4FD7 A;  4NXY A;  2VEZ A;  3EC4 A;  4QBJ A;  4CRY B;  2O28 A;  1KUY A;  3B8G A;  2BEI A;  3FNC A;  4UBR A;  4B5P B;  3PGP A;  5KTD A;  2FE7 A;  3TO7 A;  2PSW A;  4B5O A;  4E0A A;  4JWP A;  1P4N A;  2C27 A;  2R8V A;  4R9M A;  5C88 A;  3TOA A;  4HNY B;  5F47 A;  2KCW A;  4LX9 A;  1BO4 A;  3F0A A;  2JDD A;  3I9S A;  4Y49 C;  5JQ4 A;  3GY9 A;  4MY0 A;  1M4D A;  3R9G A;  1RXT A;  2CNS A;  4HNW B;  3V8I A;  1OZP A;  2FXF A;  1Y7R A;  4YFJ A;  5KTC A;  5H86 A;  2ZW7 A;  4JJX A;  4ORF A;  2ARH A;  1TIQ A;  2P0W A;  2FCK A;  3BJ7 A;  3TE4 A;  2AE6 A;  1MJ9 A;  1NSL A;  3GYA A;  4AG7 A;  3PP9 A;  3DDD A; 
#chains in the Genus database with same CATH topology
 4P4D A;  1X12 A;  2I00 A;  3BI1 A;  4B5P A;  3FMC A;  1CP6 A;  4OIW A;  2PJ9 A;  2OZH A;  3B3T A;  4P44 A;  4CAW A;  3KHZ A;  5CNP A;  4AG9 A;  4B12 A;  3D7F A;  3G3S A;  3FJU A;  4GS4 A;  3DR8 A;  1YX0 A;  3W6X A;  4PXC A;  2B4B A;  4MJ8 A;  2Z0Z A;  3S6K A;  4A30 A;  3PB8 X;  4UFW A;  5A27 A;  4CAE A;  1ARL A;  3T90 A;  2NSM A;  4U9Z A;  2RC4 A;  3I3G A;  5THW A;  4A95 A;  4CGP A;  2REF A;  4QB9 A;  5DWM A;  3IWG A;  4E2A A;  3B3V A;  3G8W A;  4WWV A;  4ZI6 A;  5ISV A;  2PC1 A;  2ZOG A;  2PVW A;  5LYD A;  4ZY2 A;  1XFO A;  4RS2 A;  2JEV A;  1YVK A;  2CY2 A;  3BI0 A;  4XPD C;  4ZX9 A;  3BXM A;  2C6C A;  2K5T A;  3H8G A;  2R1I A;  3VWD A;  4U5Y A;  3H5Z A;  2HC9 A;  3IGR A;  4AVB A;  5KTA A;  2P6E A;  2F7V A;  4GXH A;  3SXO A;  1CM0 A;  2I79 A;  4XNH C;  3FYN A;  3IFE A;  4R8F A;  3GB0 A;  3P2H A;  2B3U A;  4P4B A;  3CXP A;  3FEC A;  2IJZ A;  1R57 A;  2DPT A;  2FT0 A;  4KUB A;  4KVX A;  2PJ3 A;  4PQA A;  5F49 A;  4A32 A;  5IX3 A;  3ISX A;  3RO0 A;  3RAM A;  5JGF A;  3VAR A;  1L0C A;  4KS9 A;  4AXV A;  3NFZ A;  3PFE A;  2FVG A;  2ZEH A;  4M85 A;  1DE4 C;  1ZG7 A;  3JRU A;  2IQ6 A;  5DWN A;  4H6U A;  4IF5 A;  2CTB A;  1FY7 A;  4PK2 A;  2ZW6 A;  2AFU A;  2JBK A;  3FXT A;  3JUW A;  4NGQ A;  4I49 A;  1YME A;  2VI7 A;  4QC6 A;  5E96 A;  3LD2 A;  4WJB A;  4KLV A;  1YSJ A;  3B7I A;  4XPD B;  1WK4 A;  4G1P A;  4MBU A;  2DF5 A;  1XE4 A;  2CF4 A;  1YRE A;  1S7F A;  2CXA A;  3IIB A;  5FVJ A;  2ZW4 A;  2OOT A;  3N7Z A;  2R98 A;  4NGM A;  2VZY A;  2Z3P A;  4P4J A;  1CBX A;  4KOU A;  4MHP A;  3IU2 A;  2CTC A;  2F8H A;  1I21 A;  2FIW A;  2J8N A;  2GU2 A;  2OZG A;  4LQ6 A;  1YK3 A;  2PJ1 A;  1IID A;  1QST A;  2ZEM A;  4L89 A;  4DUK A;  4UEZ A;  3D4U A;  4GM5 A;  1I1D A;  2DEA A;  5J8F A;  3RZA A;  1YW4 A;  1WWZ A;  1Z8W A;  2PJ6 A;  2PR8 A;  3FB3 A;  3H4Q A;  3PZJ A;  4IAV A;  4NGN A;  4UA3 A;  2GRE A;  3CXS A;  1LCP A;  5AG4 A;  1NMT A;  4AVA A;  2V77 A;  4F9V A;  1Z8L A;  3IJ3 A;  5EMI A;  4P6Y A;  4PPZ A;  1IOF A;  2X7B A;  2GIV A;  3TT2 A;  5K8M A;  2QIR A;  4LUA A;  2OB0 A;  1BPM A;  4M6G A;  4CYP A;  3D2P A;  2EK9 A;  4MCR A;  4YWY A;  1FT7 A;  3S6G A;  3CXQ A;  4JYW A;  4YRH A;  5K8P A;  1Z8T A;  4L8A A;  1QSM A;  2Z3K A;  1BOB A;  3BJ8 A;  4E8O A;  4JLY A;  5C82 A;  2JDC A;  1XIX A;  1Y9W A;  2PJC A;  2WUU A;  2ZEG A;  3PB4 X;  5ELY A;  2PDO A;  4OME A;  3SJX A;  4RI1 A;  2GLJ A;  4R3L A;  1KUX A;  4UWJ A;  1S7N A;  2YNC C;  4F0Y A;  2PIZ A;  4NEX A;  1Y0R A;  2WPW A;  2HB6 A;  1MJB A;  1KWM A;  2D4P A;  2IMO A;  3B3W A;  3RYO A;  1YR0 A;  4PV6 A;  5IB0 A;  4UFV A;  4YGO A;  3PBB A;  1JQG A;  1RO5 A;  3D7G A;  4P4E A;  4F9U A;  4FD5 A;  4H6Z A;  4ZBG A;  4CAV A;  2Q44 A;  3WR7 A;  3GKR A;  5G20 A;  4RUH A;  1XMB A;  5J8C A;  4II9 A;  1BPN A;  2OZU A;  1M1D A;  2GE3 A;  3KAS A;  4UF4 A;  1LRZ A;  4C2X A;  4H89 A;  2Q4V A;  1Z4R A;  4X3R A;  4NGS A;  2C6G A;  2DXQ A;  2FSR A;  3B2Y A;  1YW6 A;  5I4M A;  5F48 A;  5LYL A;  1BAV A;  1PU9 A;  4HPS A;  1VKC A;  3CZX A;  4K30 A;  3S6H A;  2BL1 A;  1A2Z A;  1M4I A;  2CNT A;  1HDQ A;  4J3G A;  1XJO A;  2BCO A;  1CP7 A;  3EXN A;  3I1U A;  2EVN A;  3B3C A;  4Z65 A;  3K9U A;  4CGN A;  1Z4E A;  3NE7 A;  4XPL A;  1B87 A;  4OC0 A;  4ZX8 A;  2H5M A;  2BO9 A;  3R96 A;  3FVL A;  2B5G B;  3K2K A;  7CPA A;  1S5K A;  1IU8 A;  3EY5 A;  2ZED A;  2AFX A;  1LOK A;  2B4D B;  3FRM A;  1VIX A;  3PFO A;  2G0B A;  1GHE A;  3WC7 A;  2ABZ A;  1Q2C A;  1TF9 A;  5LYI A;  5K8N A;  4EVY A;  2WZN A;  1QSO A;  3N5F A;  3ZJ0 A;  4ONW A;  4CGO A;  1PYT B;  2WYR A;  1MK4 A;  2J8R A;  4B13 A;  4IK2 A;  4BIN A;  2J8M A;  2OH1 A;  3SJF A;  2QVP A;  4KOV A;  5I0C A;  1S3Z A;  2RFH A;  2G3A A;  1XBU A;  2AFS A;  3DNS A;  4KVO E;  1IIC A;  3FEE A;  4F6A A;  5K8O A;  2ZXV A;  2FIA A;  1ELL P;  2NMT A;  4KOX A;  4PXE A;  2A4N A;  5F46 A;  4CGL A;  1Q7L A;  1RTQ A;  3VH9 A;  2B3V A;  4MHD A;  3F5B A;  5CPA A;  3SJE A;  1F57 A;  4P45 A;  2QYV A;  4UCM A;  1KUV A;  4R76 A;  1XOV A;  3KZW A;  3VWE A;  4AB7 A;  3LMS A;  2J9A A;  3R1K A;  4KLW A;  4MHY A;  4CYN A;  2OU2 A;  4PSX A;  5IV0 A;  3FBU A;  1TKF A;  3K9T A;  1LAP A;  4MFP A;  1MJA A;  2YNC A;  3TO6 A;  2P6G A;  1HEE A;  1SQH A;  2PJB A;  4BBH A;  2IL4 A;  5HVG A;  4X8I A;  4C68 A;  5BWA B;  2ZEF A;  4ZY0 A;  1J4J A;  1AMP A;  4OAD A;  3SXN A;  5F09 A;  5JPH A;  2EBJ A;  5H84 A;  4QUS A;  2AFO A;  2Q4Y A;  3R95 A;  2AFW A;  2B4D A;  4TWE A;  4MHN A;  1UWY A;  4AVC A;  3KKW A;  2P6F A;  5CBM A;  1IOI A;  1XMT A;  3D7H A;  2PE3 A;  3CDX A;  1CG2 A;  3E0K A;  4FAI A;  4OC2 A;  2Q51 A;  3C26 A;  4EME A;  3D7D A;  3LAC A;  3LOD A;  4UWI A;  3TTH A;  4A39 A;  2B58 A;  3PEI A;  2AFZ A;  4MCS A;  4KSI A;  1Z9U A;  4A33 A;  4Q36 A;  1R43 A;  4NGT A;  5A28 A;  5HVF A;  3P2F A;  5GCN A;  4P4F A;  3NH8 A;  1M4G A;  2EUI A;  5AG5 A;  3S9M A;  2C6P A;  2CIJ A;  2Z10 A;  3SHP A;  4BMH A;  2V8V A;  3CPA A;  2PIY A;  1Q2D A;  3FF3 A;  3CPX A;  1U6M A;  1P0H A;  3NE8 A;  3TOB A;  2REE A;  3DR6 A;  4NSQ A;  4PXD A;  1CX8 A;  1NSA A;  2PQ8 A;  3KQX A;  3JTK A;  2Q4Z A;  3QB8 A;  2EK8 A;  2XEF A;  1IB1 E;  1B6B A;  4UCP A;  2BSW A;  2QML A;  2NYQ A;  4HNX B;  2O4H A;  2ZEL A;  4FBE A;  1LAN A;  1TKJ A;  4B10 A;  5JM6 A;  2PRB A;  1ZG9 A;  1XRY A;  4Q7A A;  3SI1 A;  3UY5 A;  2PJ2 A;  1CPS A;  2XEI A;  2ZEO A;  1QQ9 A;  4PK3 A;  3MRU A;  3DDD A;  3D68 A;  2BUE A;  1NE9 A;  4ZYQ A;  4C2Y A;  3DLJ A;  3B3S A;  4KOY A;  2JEW A;  2Z3O A;  3L2N A;  1LFW A;  1XF8 A;  2VZZ A;  3EO4 A;  2Q43 A;  3GLJ A;  4U9Y A;  2ODF A;  1YVO A;  4KZT A;  4UIA A;  4FWU A;  1K4J A;  4P10 A;  1I12 A;  8CPA A;  2AJ6 A;  2PRQ A;  3BLN A;  2GAN A;  3PB6 X;  3D3S A;  4F8Z A;  5IB9 A;  2FS5 A;  4MHZ A;  4OLL A;  2ZOF A;  2POK A;  1F2O A;  4JZ0 A;  4NGP A;  4R3K A;  5LRJ A;  2PJ7 A;  2Z3M A;  3JVN A;  1N71 A;  4DJL A;  4B11 A;  2OR4 A;  2Z3N A;  1ON0 A;  4PXB A;  5AG6 A;  4HKF A;  4KUA A;  2Q7B A;  3H8E A;  3IEH A;  3KQZ A;  2Q7S A;  2Q04 A;  6CPA A;  5G22 A;  4CGM A;  3IWW A;  2Q0Y A;  1TXR A;  3S9N A;  3TX8 A;  3QAH A;  1Y9K A;  2JLM A;  4NFR A;  4C7H A;  1QSR A;  4CYO A;  2I3C A;  1QSN A;  1V0C A;  3HUV A;  4Q38 A;  4B14 A;  4Y49 B;  5HH1 A;  1DTD A;  3ZZI A;  2VL1 A;  4JXQ A;  4KOR A;  4JD6 A;  4X5K A;  3SI2 A;  4MCQ A;  4BD9 A;  3S9L A;  3T8W A;  1VHO A;  4FD6 A;  3W6S A;  3FH4 A;  2RB7 A;  2ATR A;  4R57 A;  3IO1 A;  3S6F A;  4DYO A;  3IC1 A;  1VHE A;  4M3S A;  3TCV A;  2PJ5 A;  2WPX A;  2D4O A;  3D66 A;  3KHX A;  4OC5 A;  4A94 A;  5D29 A;  4MCP A;  4C2Z A;  5G1Z A;  4R7M A;  3WT4 A;  1YLE A;  5AG7 A;  2C1C A;  4M6I A;  3WC6 A;  1S7K A;  4MFZ A;  1UFH A;  5LRK A;  3T9Y A;  1M44 A;  2HV2 A;  1KZF A;  1TF8 A;  2JBJ A;  1IY7 A;  4KOT A;  4DNC A;  2O53 A;  4QVT A;  3TO9 A;  3R9E A;  2XEJ A;  5EBV A;  1R3N A;  4A38 A;  1F2P A;  4IUS A;  4OP4 A;  4XPK A;  3DGV A;  2QEC A;  4OAE A;  3KR4 A;  1EE3 P;  1IYK A;  1JWQ A;  1Q2Y A;  2ZW5 A;  4MFK A;  4UIB A;  1YQE A;  2V8D A;  3TC8 A;  4OC1 A;  4MMO A;  5LRG A;  3IWE A;  2G3T A;  3EFA A;  2F5I A;  4RN7 A;  3LWU A;  3PB9 X;  1Z5R A;  4W9Y A;  1AUG A;  4OID A;  4PSW A;  2DPS A;  4CAX A;  2VBQ A;  3VAT A;  2PR1 A;  1S7L A;  4CPA A;  4CS0 B;  2Z3L A;  3B35 A;  3V38 A;  3NA6 A;  4NF1 A;  4OKO A;  2HUZ A;  3RBU A;  5EC4 A;  4K3N A;  1IYL A;  4FD4 A;  4CRZ B;  2CNM A;  3FED A;  1CJW A;  1CPX A;  3FIX A;  3WC5 A;  3H8F A;  3MGD A;  4A2Z A;  1XEB A;  4NCZ A;  2B5G A;  2GFQ A;  1ZO0 A;  3D8P A;  3OWC A;  2VXK A;  3TFY A;  5HMN A;  1S60 A;  4C7I A;  3HLP A;  3F8K A;  4A37 A;  3SI0 A;  5HVH A;  4JXR A;  3FX6 A;  1PUA A;  1FNO A;  3V7Z A;  4IHM A;  3PBE A;  2FL4 A;  4M6H A;  3CT9 A;  3D2M A;  4NJQ A;  4R87 A;  3DSB A;  1VGY A;  4MY3 A;  2R7H A;  4KVM E;  4X2T A;  4XNH B;  3R9F A;  2Z11 A;  4CAF A;  2GLF A;  2ZPA A;  2V8G A;  4MI4 A;  4KSA A;  4TNU A;  2HQY A;  4A31 A;  1YGH A;  3ISZ A;  1VHS A;  1TKH A;  2VQY A;  4MFJ A;  4KOS A;  2BOA A;  2XEG A;  4KOW A;  2Y0M A;  4MRI A;  1ARM A;  4F0X A;  5AGE A;  4FUU A;  3QNV A;  4LQG A;  3W91 A;  3WAB A;  4ONU A;  1BLL E;  4KSF A;  4FD7 A;  1Z2L A;  3KR5 A;  3SJG A;  4NXY A;  4MFQ A;  2PJ0 A;  2VEZ A;  1ZLI A;  3EC4 A;  4EWT A;  4ZY1 A;  1HDU A;  2PVV A;  3KL9 A;  3PB7 X;  4QBJ A;  1ZG8 A;  3KGQ A;  4CRY B;  5HXD A;  2O28 A;  3RNZ A;  1KUY A;  3B8G A;  2BEI A;  3FNC A;  4UBR A;  3QAY A;  4YU9 A;  3PGP A;  1NSL A;  4B5P B;  5KTD A;  2FE7 A;  2V8H A;  3TO7 A;  2PSW A;  2ZEN A;  4B5O A;  4E0A A;  4NJR A;  1X10 A;  4JWP A;  1P4N A;  2C27 A;  2R8V A;  4R9M A;  4UFX A;  1M4L A;  1GYT A;  1Y0Y A;  4OC3 A;  3TOA A;  5C88 A;  5LYF A;  4HNY B;  2WSA A;  2KCW A;  5F47 A;  4H2K A;  1OBR A;  4O23 A;  4LX9 A;  4UEF A;  1ELM P;  4B6Z A;  1BO4 A;  2QJ8 A;  1PCA A;  2JDD A;  2G9D A;  2EO8 A;  2YND A;  3F0A A;  3I9S A;  4UEE A;  4Y49 C;  5JQ4 A;  3GY9 A;  1Y7E A;  2PJ8 A;  1LAM A;  4MY0 A;  1M4D A;  3R9G A;  4CYQ A;  1AYE A;  1RXT A;  2CNS A;  4UCN A;  2PCU A;  5J1Q A;  4HNW B;  3V8I A;  2YNE A;  1OZP A;  4EFD A;  2FXF A;  2EWB A;  3KI9 A;  1Y7R A;  5DS0 A;  5G21 A;  4YFJ A;  2YGW A;  5KTC A;  5H86 A;  2ZW7 A;  4JJX A;  3NH4 A;  4ORF A;  1IGB A;  2ARH A;  1YLO A;  1Z8X A;  2AFM A;  3GIU A;  1TIQ A;  4ZGY B;  2P0W A;  2ZEE A;  3PRT A;  2FCK A;  4R6T A;  1H8L A;  4MFL A;  4NGR A;  3BJ7 A;  3TE4 A;  2ANP A;  4P4I A;  4MXU A;  5D8N A;  5JH9 A;  2AE6 A;  2PJ4 A;  4OC4 A;  1MJ9 A;  1ZLH A;  3D67 A;  2ZEP A;  2PJA A;  3MN8 A;  3GYA A;  3BHX A;  3IU1 A;  3NH5 A;  1QMU A;  3PP9 A;  4AG7 A;  3GUX A;  3A9L A; 
#chains in the Genus database with same CATH homology
 2I00 A;  4B5P A;  2OZH A;  4CAW A;  4AG9 A;  5CNP A;  4B12 A;  3G3S A;  4GS4 A;  3DR8 A;  1YX0 A;  3W6X A;  2B4B A;  4MJ8 A;  2Z0Z A;  3S6K A;  4A30 A;  4UFW A;  5A27 A;  4CAE A;  3T90 A;  4U9Z A;  2RC4 A;  3I3G A;  4A95 A;  4CGP A;  2REF A;  4QB9 A;  5DWM A;  3IWG A;  4E2A A;  3G8W A;  5ISV A;  2PC1 A;  4RS2 A;  2JEV A;  1YVK A;  2CY2 A;  4XPD C;  3VWD A;  2K5T A;  2R1I A;  4U5Y A;  3H5Z A;  3IGR A;  4AVB A;  5KTA A;  2P6E A;  3SXO A;  1CM0 A;  2I79 A;  4XNH C;  3FYN A;  3P2H A;  2B3U A;  3CXP A;  4KUB A;  2DPT A;  1R57 A;  2FT0 A;  4KVX A;  4A32 A;  5IX3 A;  5F49 A;  1L0C A;  4KS9 A;  4M85 A;  5DWN A;  4H6U A;  4IF5 A;  1FY7 A;  4PK2 A;  2ZW6 A;  3FXT A;  3JUW A;  4QC6 A;  5E96 A;  3S6F A;  4I49 A;  2VI7 A;  3LD2 A;  4KLV A;  4XPD B;  1WK4 A;  4MBU A;  1XE4 A;  1YRE A;  1S7F A;  2CXA A;  5FVJ A;  2ZW4 A;  3N7Z A;  2R98 A;  2VZY A;  2Z3P A;  4KOU A;  3IU2 A;  1I21 A;  2FIW A;  2J8N A;  2OZG A;  1YK3 A;  1IID A;  1QST A;  4L89 A;  1I1D A;  5J8F A;  2PR8 A;  1WWZ A;  3FB3 A;  3H4Q A;  3PZJ A;  4UA3 A;  3CXS A;  5AG4 A;  1NMT A;  4AVA A;  2X7B A;  2GIV A;  3TT2 A;  2QIR A;  4LUA A;  2OB0 A;  4CYP A;  3D2P A;  3S6G A;  3CXQ A;  4YRH A;  4L8A A;  2Z3K A;  1QSM A;  3BJ8 A;  1BOB A;  4E8O A;  4JLY A;  5C82 A;  2JDC A;  1XIX A;  1Y9W A;  2WUU A;  2PDO A;  4RI1 A;  4R3L A;  1KUX A;  4UWJ A;  1S7N A;  2YNC C;  4F0Y A;  4NEX A;  2WPW A;  1MJB A;  2D4P A;  3RYO A;  1YR0 A;  4PV6 A;  5IB0 A;  4UFV A;  4YGO A;  1RO5 A;  4FD5 A;  4H6Z A;  4ZBG A;  4CAV A;  2Q44 A;  3WR7 A;  3GKR A;  5G20 A;  5J8C A;  4II9 A;  2OZU A;  1M1D A;  2GE3 A;  1LRZ A;  4C2X A;  4H89 A;  2Q4V A;  1Z4R A;  2DXQ A;  2FSR A;  5F48 A;  1PU9 A;  1VKC A;  4K30 A;  3S6H A;  2BL1 A;  1M4I A;  2CNT A;  4J3G A;  3EXN A;  2EVN A;  3K9U A;  4CGN A;  1Z4E A;  3NE7 A;  4XPL A;  1B87 A;  2H5M A;  3R96 A;  2B5G B;  1S5K A;  3EY5 A;  2B4D B;  3FRM A;  2G0B A;  1GHE A;  1Q2C A;  4EVY A;  1QSO A;  3ZJ0 A;  4CGO A;  1MK4 A;  2J8R A;  4B13 A;  2J8M A;  2OH1 A;  4KOV A;  5I0C A;  1S3Z A;  3DNS A;  2G3A A;  4KVO E;  1IIC A;  4F6A A;  2ZXV A;  2FIA A;  2NMT A;  4KOX A;  2A4N A;  5F46 A;  4CGL A;  2B3V A;  4MHD A;  3F5B A;  3A9L A;  4UCM A;  1KUV A;  3VWE A;  4AB7 A;  4CYN A;  3R1K A;  4KLW A;  2OU2 A;  4PSX A;  5IV0 A;  3FBU A;  4MFP A;  1MJA A;  2YNC A;  3TO6 A;  2P6G A;  1SQH A;  4BBH A;  2IL4 A;  4C68 A;  5BWA B;  1J4J A;  4OAD A;  3SXN A;  5JPH A;  5H84 A;  4QUS A;  2Q4Y A;  3R95 A;  2B4D A;  4AVC A;  3KKW A;  2P6F A;  1XMT A;  3E0K A;  3C26 A;  3TTH A;  3LOD A;  4UWI A;  2B58 A;  1Z9U A;  4A33 A;  4Q36 A;  5A28 A;  3P2F A;  5GCN A;  1M4G A;  2EUI A;  5AG5 A;  2Z10 A;  3SHP A;  4BMH A;  1Q2D A;  1U6M A;  1P0H A;  3TOB A;  2REE A;  3DR6 A;  4NSQ A;  2PQ8 A;  3JTK A;  3QB8 A;  1IB1 E;  1B6B A;  4UCP A;  2BSW A;  2QML A;  4HNX B;  4B10 A;  2PRB A;  3UY5 A;  4PK3 A;  2BUE A;  1NE9 A;  4C2Y A;  4KOY A;  2Z3O A;  1XF8 A;  2VZZ A;  3EO4 A;  4U9Y A;  4KZT A;  1YVO A;  1K4J A;  1I12 A;  2AJ6 A;  3BLN A;  2GAN A;  3D3S A;  2FS5 A;  4OLL A;  4R3K A;  2Z3M A;  3JVN A;  1N71 A;  4B11 A;  2Z3N A;  1ON0 A;  5AG6 A;  4HKF A;  4KUA A;  2Q7B A;  2Q04 A;  5G22 A;  4CGM A;  2Q0Y A;  3QAH A;  1Y9K A;  2JLM A;  4C7H A;  1QSR A;  4CYO A;  4B14 A;  1QSN A;  1V0C A;  4Q38 A;  4Y49 B;  5HH1 A;  3ZZI A;  4JXQ A;  4KOR A;  4JD6 A;  4X5K A;  4FD6 A;  3W6S A;  2ATR A;  4R57 A;  4M3S A;  3TCV A;  2WPX A;  2D4O A;  4C2Z A;  5G1Z A;  1YLE A;  5AG7 A;  1S7K A;  4MFZ A;  1UFH A;  3T9Y A;  1M44 A;  2HV2 A;  1KZF A;  4KOT A;  4DNC A;  4QVT A;  3TO9 A;  3R9E A;  5EBV A;  4XPK A;  4IUS A;  2QEC A;  4OAE A;  1IYK A;  1Q2Y A;  2ZW5 A;  4MFK A;  3IWE A;  3EFA A;  2G3T A;  2F5I A;  4PSW A;  2DPS A;  4CAX A;  2VBQ A;  2PR1 A;  1S7L A;  4CS0 B;  2Z3L A;  4NF1 A;  2HUZ A;  5EC4 A;  1IYL A;  4FD4 A;  4CRZ B;  2CNM A;  1CJW A;  3FIX A;  3MGD A;  4A2Z A;  1XEB A;  4NCZ A;  2B5G A;  1ZO0 A;  3D8P A;  3OWC A;  2VXK A;  3TFY A;  5HMN A;  1S60 A;  4C7I A;  3F8K A;  4JXR A;  1PUA A;  2FL4 A;  3D2M A;  4R87 A;  3DSB A;  4MY3 A;  2R7H A;  4KVM E;  4XNH B;  3R9F A;  2Z11 A;  4CAF A;  2ZPA A;  4MI4 A;  4KSA A;  4A31 A;  2HQY A;  1YGH A;  1VHS A;  2VQY A;  4MFJ A;  4KOS A;  4KOW A;  2Y0M A;  4F0X A;  5AGE A;  3W91 A;  4ONU A;  4KSF A;  4FD7 A;  4NXY A;  4MFQ A;  2VEZ A;  3EC4 A;  4QBJ A;  4CRY B;  2O28 A;  1KUY A;  3B8G A;  2BEI A;  3FNC A;  4UBR A;  4B5P B;  3PGP A;  5KTD A;  2FE7 A;  3TO7 A;  2PSW A;  4B5O A;  4E0A A;  4JWP A;  1P4N A;  2C27 A;  2R8V A;  4R9M A;  4UFX A;  5C88 A;  3TOA A;  4HNY B;  2WSA A;  2KCW A;  5F47 A;  4LX9 A;  1BO4 A;  2YND A;  3F0A A;  2JDD A;  3I9S A;  4Y49 C;  5JQ4 A;  3GY9 A;  4MY0 A;  1M4D A;  3R9G A;  4CYQ A;  1RXT A;  4UCN A;  2CNS A;  4HNW B;  3V8I A;  2YNE A;  1OZP A;  2FXF A;  5G21 A;  1Y7R A;  4YFJ A;  2YGW A;  5KTC A;  5H86 A;  2ZW7 A;  4JJX A;  4ORF A;  2ARH A;  4ZGY B;  1TIQ A;  2P0W A;  2FCK A;  4MFL A;  3BJ7 A;  3TE4 A;  2AE6 A;  1MJ9 A;  1NSL A;  3GYA A;  3IU1 A;  3PP9 A;  4AG7 A;  3DDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...