5F47A

Crystal structure of an aminoglycoside acetyltransferase meta-aac0020 from an uncultured soil metagenomic sample in complex with trehalose
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
151
structure length
151
Chain Sequence
IDNFLKIERLAENDLPKFIQLIRLFEAVFEMKNFSIPDSEHLQKLLNQNNFYVFVALLENKIVGGLTSYVLEQYYSEKPLAYIYDLAVDTNWQRQGIGKKLITATNQFYTEKGFEEVFVQADKVDDYALDFYRSTKPTAEEQVVHFYYTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Survey of Environmental Aminoglycoside Acetyltransferases Reveals Functionality of Resistance Enzymes.
pubmed doi rcsb
source organism Uncultured bacterium
molecule tags Transferase
molecule keywords aminoglycoside acetyltransferase meta-AAC0020
total genus 36
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5f47A00
4PSWA 3TE4A 5J8CA 4KOVA 5J8FA 2NMTA 2OZGA 2CNSA 4HNXB 3LODA 3QAHA 4MI4A 4FD4A 3EY5A 5JQ4A 2OU2A 4E8OA 1BO4A 3D8PA 3G3SA 1XMTA 4FD5A 2Z0ZA 1S3ZA 1M4GA 4E2AA 1B6BA 4R57A 4B5OA 1VKCA 2JLMA 2B4DB 2VXKA 1XIXA 1S60A 4KVME 1PU9A 4H6UA 4ONUA 3VWEA 1K4JA 2Q44A 2Q4YA 2OZUA 1S5KA 4UWJA 4UBRA 3W6XA 2DXQA 4UA3A 2FIAA 3FYNA 2HUZA 2AJ6A 4IF5A 2A4NA 3KKWA 2FIWA 1QSOA 4H89A 4B5PB 1L0CA 2PQ8A 1XEBA 2CNTA 1CJWA 3BLNA 3D3SA 1S7NA 3EO4A 1RO5A 4U5YA 2QIRA 4M85A 4KVOE 4Y49B 4F0YA 3I9SA 4CRYB 2Q0YA 4XPDB 2VZYA 3VWDA 2C27A 4K30A 3TT2A 1YVKA 2FCKA 3TOBA 1MJAA 2P6GA 1S7KA 2B58A 1LRZA 2J8MA 4JWPA 1NMTA 5JPHA 1S7FA 3BJ8A 4YFJA 1QSRA 1RXTA 3FIXA 3B8GA 1KUVA 2P6EA 2BEIA 1M4IA 4X5KA 4PV6A 3WR7A 2FL4A 3F8KA 3UY5A 1CM0A 4IUSA 3TTHA 2JDDA 1IB1E 1YREA 2PR8A 1MJ9A 4R3LA 3IGRA 4QVTA 4LUAA 3R9GA 3SHPA 4PK2A 4ORFA 4ZBGA 1KUYA 2R8VA 4KOXA 2G3AA 4HKFA 4QC6A 2FS5A 4JXQA 3F5BA 2I79A 2I00A 1KUXA 4CRZB 5HMNA 3JVNA 5DWMA 3TO7A 4MJ8A 1I21A 2WPXA 4QUSA 4XPLA 2GANA 3T9YA 4JD6A 4NSQA 1M4DA 3OWCA 4KVXA 4QBJA 2PDOA 3DR8A 4MBUA 4CAWA 2GIVA 1QSNA 4BMHA 2JEVA 2R98A 2CY2A 4QB9A 4DNCA 3I3GA 4KOUA 3TCVA 5C82A 4L8AA 4NCZA 4HNYB 3R95A 1B87A 2B5GB 3H4QA 4B5PA 2REFA 1BOBA 3TFYA 5F49A 3CXPA 1VHSA 1P4NA 3GKRA 5H86A 2ZW7A 1IICA 4FD7A 4KORA 1NSLA 4R3KA 3S6KA 3P2HA 1ON0A 4JLYA 3FB3A 3EC4A 2B5GA 2FXFA 5IX3A 4XPDC 2EUIA 5KTAA 1Y9WA 4NXYA 5F46A 2RC4A 4KOSA 1WWZA 1Z4RA 3S6FA 3T90A 2VEZA 2PR1A 4KLVA 1GHEA 1FY7A 4AVAA 2Q4VA 4U9YA 4HNWB 3C26A 4M3SA 2IL4A 1YGHA 2ZW5A 3ZZIA 4II9A 3DNSA 4PSXA 4JJXA 2R1IA 5E96A 4R9MA 1Q2YA 4FD6A 2REEA 2R7HA 1Z9UA 5EBVA 3K9UA 1MK4A 4MHDA 4AVBA 4KZTA 2Z10A 4KOWA 2K5TA 3PGPA 1TIQA 4AVCA 5KTDA 4U9ZA 3TOAA 4RS2A 1S7LA 3W91A 2VBQA 2HV2A 3QB8A 3NE7A 4YRHA 3CXQA 1YX0A 3FNCA 3V8IA 1SQHA 4CS0B 1UFHA 5EC4A 3BJ7A 1Q2CA 4AB7A 1YR0A 3E0KA 3P2FA 2ZW6A 4F6AA 5F47A 1MJBA 1U6MA 2Z11A 1Q2DA 4XPKA 4H6ZA 2KCWA 2D4PA 2OH1A 5F48A 2VZZA 4OADA 2Q04A 2OB0A 3MGDA 4PK3A 4R87A 2J8NA 3W6SA 2VI7A 4LX9A 1P0HA 2ZXVA 4CAXA 4MY0A 1QSTA 2BUEA 4NEXA 4XNHC 2JDCA 3GY9A 3LD2A 5IB0A 4KLWA 5ISVA 2HQYA 1I12A 3D2MA 1XE4A 2ATRA 3D2PA 4UWIA 3FXTA 2OZHA 3R96A 4AG9A 4CAVA 1YLEA 3SXNA 1Z4EA 2B3UA 3R1KA 5I0CA 2B4DA 1QSMA 4AG7A 5HH1A 3JUWA 3CXSA 3S6GA 5H84A 2F5IA 1WK4A 3G8WA 3ZJ0A 1IYKA 3FBUA 5CNPA 2QECA 2PC1A 1R57A 2ZW4A 4J3GA 4E0AA 2P6FA 2X7BA 1Y9KA 2GE3A 2PSWA 2D4OA 3DDDA 1YK3A 2H5MA 3R9EA 1Y7RA 4OAEA 2FE7A 4MY3A 3EFAA 2WPWA 2PRBA 4YGOA 3PZJA 1YVOA 2BSWA 3SXOA 2Y0MA 4KUAA 2G3TA 2B3VA 5C88A 3PP9A 2CNMA 5DWNA 2BL1A 1XF8A 4OLLA 3GYAA 2AE6A 2B4BA 1V0CA 2FSRA 4I49A 1N71A 3EXNA 5FVJA 2ARHA 2QMLA 4KOTA 1NE9A 4EVYA 1IYLA 4Y49C 2Q7BA 4JXRA 1M44A 3TO6A 1KZFA 2FT0A 2VQYA 3N7ZA 3DSBA 4GS4A 4KUBA 1OZPA 1IIDA 5KTCA 3DR6A 3R9FA 3S6HA 1M1DA 2EVNA 5IV0A 2G0BA 3FRMA 4RI1A 3TO9A 2ZPAA 2J8RA 3F0AA 4KOYA 1J4JA 4XNHB 2P0WA 3IWGA 2O28A 1PUAA 5GCNA 3RYOA 4NF1A 1I1DA 4L89A
chains in the Genus database with same CATH superfamily
2XEJA 4PSWA 5G21A 3KR5A 1JQGA 2Q43A 3RO0A 3TE4A 3B7IA 2Z3PA 5K8OA 3IWWA 5J8CA 2DF5A 4KOVA 4JZ0A 1IY7A 4WJBA 5J8FA 2AFXA 2NMTA 3JTKA 3KASA 4MFKA 2OZGA 1ZLHA 2CNSA 1Y0YA 2V77A 3LODA 4G1PA 4HNXB 4MHPA 4A33A 4F8ZA 3QAHA 1Y7EA 2CXAA 4MI4A 3H5ZA 3D67A 2NYQA 4FD4A 1HEEA 3EY5A 5JQ4A 4FUUA 2OU2A 4E8OA 1F57A 1BO4A 2O4HA 3D8PA 2I3CA 2Z3NA 1FNOA 3G3SA 1XMTA 4FD5A 2Z0ZA 1S3ZA 1M4GA 1ARMA 2CTBA 1CPXA 1B6BA 2AFWA 4R57A 2GLJA 4OIWA 4B5OA 4E2AA 1JWQA 2IJZA 2Z3LA 1VKCA 2JLMA 2POKA 5K8NA 4TNUA 3KQXA 1A2ZA 4MFPA 2B4DB 2VXKA 1XIXA 1S60A 4UFWA 4KVME 3SI1A 4CGOA 4MFLA 4PXCA 4OIDA 4NGPA 1VGYA 3VARA 1PU9A 4H6UA 2Q51A 3K2KA 4EFDA 4ONUA 3JRUA 3KGQA 3MRUA 2NSMA 1K4JA 3VWEA 2Q44A 2ZEOA 5AG4A 2PJ0A 1TXRA 2Q4YA 2EK8A 2OZUA 3D7FA 1S5KA 5THWA 2EK9A 4UWJA 4UBRA 3W6XA 2DXQA 4UA3A 2FIAA 2PVWA 3FYNA 3PBEA 4A95A 3CPXA 3PEIA 2HUZA 3L2NA 1VHEA 4P4JA 1YMEA 2ZENA 1ZG9A 2AJ6A 3MN8A 4P4EA 4IF5A 3SI0A 2A4NA 3KKWA 2FIWA 1QSOA 4H89A 2PE3A 4B5PB 1CG2A 1L0CA 2PQ8A 2PJ5A 1XEBA 2CNTA 1CJWA 3BLNA 4NGNA 3D3SA 1S7NA 3EO4A 1RO5A 2YGWA 4ZX8A 3IU1A 4NJQA 4CAEA 4U5YA 2QIRA 4M85A 4KVOE 2OOTA 5IB9A 4Y49B 4F0YA 2DEAA 3I9SA 2WSAA 4CRYB 1Z5RA 4RN7A 2Q0YA 4XPDB 2VZYA 2Z3OA 2C27A 1LCPA 3B3CA 4K30A 4ZY2A 3VWDA 4A31A 5K8PA 3TT2A 4UCNA 1YVKA 2FCKA 3TOBA 1MJAA 4FWUA 1DTDA 2P6GA 4P4IA 1CP7A 1S7KA 2FVGA 3KQZA 2B58A 1IU8A 4O23A 2YNDA 2XEIA 1LRZA 2J8MA 4JWPA 1NMTA 2PJ4A 5JH9A 5JPHA 3GB0A 1S7FA 3IJ3A 4CAFA 3BJ8A 1BLLE 4PXEA 2JBJA 1ELLP 4CYPA 1QSRA 3LACA 4YFJA 4MFZA 3ISZA 5G22A 1RXTA 4CGNA 4UIAA 3NA6A 3FIXA 4MCQA 1TKHA 5HXDA 5CBMA 3B8GA 1KUVA 1VIXA 2P6EA 2PCUA 3S9NA 2BEIA 1M4IA 3NE8A 4PV6A 2PJ8A 4X5KA 1R43A 2FL4A 3LWUA 3TC8A 3WR7A 3F8KA 3UY5A 1CM0A 4IUSA 3TTHA 2ANPA 2JDDA 4B12A 1IB1E 1YREA 2PR8A 2YNCA 5I4MA 2YNEA 3NFZA 1MJ9A 4BD9A 4R3LA 2PJ3A 3IGRA 4LUAA 4NFRA 4QVTA 3R9GA 3SHPA 1Z8XA 4ORFA 4PK2A 5AG5A 4ZBGA 1KUYA 5CPAA 2R8VA 4KOXA 2G3AA 4HKFA 4QC6A 5LYDA 3VH9A 4C2XA 2FS5A 3NH8A 2PIYA 4JXQA 4MHYA 3F5BA 2I79A 2I00A 2XEFA 2ZEDA 2XEGA 1KUXA 1X10A 4X2TA 4CRZB 5HMNA 3H8EA 1Z8TA 4MCRA 2YNCC 4Q7AA 3JVNA 5G1ZA 3GIUA 5DWMA 5LYIA 4OC1A 4MJ8A 3RBUA 1I21A 2WPXA 4R7MA 3TO7A 1BAVA 4QUSA 4XPLA 2GANA 4B10A 1PYTB 3T9YA 4JD6A 4NSQA 4LQ6A 1M4DA 1YW4A 2BCOA 4C2ZA 3H8FA 5LRJA 4RUHA 3OWCA 2EWBA 4KVXA 2ZELA 3FEDA 4UEZA 4QBJA 8CPAA 2PDOA 2ZEEA 3FJUA 3DR8A 4MBUA 4CAWA 3LMSA 3ISXA 4X8IA 1ZG7A 5G20A 4UEFA 2GIVA 4M6HA 5HVHA 1QSNA 4BMHA 2JEVA 1LOKA 2DPSA 2CY2A 1Z8WA 2F8HA 2R98A 3PFEA 4ZY1A 5DS0A 4QB9A 2ABZA 4CPAA 4UF4A 1TF8A 2PJCA 3I3GA 4DNCA 4KOUA 1LANA 3CZXA 3PB8X 3TCVA 4L8AA 4FAIA 5C82A 4X3RA 3T8WA 3B3SA 4F9UA 1H8LA 4KSIA 4HNYB 4NCZA 4PXDA 4MHZA 3R95A 2BOAA 4A32A 1B87A 2B5GB 3IWEA 1LFWA 2EBJA 3H4QA 4NGRA 4B5PA 1LAMA 2AFUA 1BOBA 2REFA 4MCSA 3TFYA 1TKFA 2JEWA 5F49A 3CXPA 4A39A 4BBHA 1VHSA 1P4NA 4P45A 1CPSA 1IOIA 3GKRA 5H86A 2ZW7A 3PB6X 4OP4A 1IICA 4FD7A 4KORA 1NSLA 1ZO0A 4R3KA 3S6KA 4TWEA 1F2PA 4AXVA 3P2HA 1R3NA 1ON0A 4ONWA 4ZYQA 3IFEA 4JLYA 3FB3A 4NGTA 2Z3KA 4M6IA 3HLPA 3D4UA 3FH4A 2PJAA 3EC4A 2GREA 2FXFA 2B5GA 2VL1A 3SJEA 5IX3A 4XPDC 4CYNA 2EUIA 5KTAA 3B2YA 1Y9WA 1ZG8A 4NXYA 5F46A 2RC4A 4KOSA 4CYOA 3BI1A 4MXUA 1WWZA 4B14A 4B11A 4CGLA 1Z4RA 3PFOA 5ELYA 2RB7A 2V8DA 4M6GA 4OC0A 1CP6A 1DE4C 1HDUA 1XBUA 3FF3A 4Q38A 3S6FA 3T90A 2VEZA 2PR1A 4KLVA 3WC7A 1GHEA 1FY7A 4IK2A 2J9AA 4AVAA 2Q4VA 4U9YA 4HNWB 2IQ6A 4OC5A 3C26A 4H2KA 4M3SA 5LRGA 4UCPA 5LYLA 2IL4A 4PXBA 1YGHA 2ZW5A 3ZZIA 3D66A 3KZWA 4II9A 3DNSA 4PSXA 4JJXA 2R1IA 5E96A 4R9MA 3RAMA 3S9LA 1Q2YA 2Z3MA 4FD6A 3V7ZA 2REEA 3NH5A 2R7HA 1Z9UA 2WYRA 3CPAA 4YU9A 5EBVA 4F9VA 2ZEHA 3H8GA 4YWYA 2ZEPA 3K9UA 2AFOA 1MK4A 3BHXA 4MHDA 4AVBA 4B13A 4UFVA 3FX6A 4KZTA 3FECA 2V8GA 2Z10A 4KOWA 1ELMP 5D8NA 2K5TA 3IIBA 3PGPA 3QAYA 1TIQA 2ZEMA 4AVCA 4R8FA 3CT9A 5KTDA 4LQGA 2C6PA 3SJFA 5JM6A 4KSFA 4DJLA 3KI9A 4U9ZA 3TOAA 4RS2A 1S7LA 2ZEGA 3W91A 2VBQA 1TF9A 2HV2A 4KS9A 1KWMA 3KHXA 4P4DA 3QB8A 2PJ2A 3NE7A 4YRHA 3B3WA 4PPZA 3D7DA 3A9LA 1CX8A 1UWYA 3CXQA 3QNVA 1YX0A 3FNCA 1IOFA 3V8IA 1SQHA 4A37A 4GM5A 4P4FA 4CS0B 1UFHA 3B35A 4A30A 5EC4A 3BJ7A 1Q2CA 3IC1A 4ZI6A 4GXHA 3SI2A 5K8MA 3WC6A 2PJ7A 4AB7A 1YR0A 3E0KA 3DLJA 1Z8LA 1PCAA 4OKOA 1BPMA 1ZLIA 2PIZA 3P2FA 2ZW6A 4F6AA 4JYWA 5F47A 1MJBA 1U6MA 2Z11A 4HPSA 3WC5A 3WABA 4EWTA 1Q2DA 1Q7LA 4XPKA 1CBXA 4UIBA 3I1UA 4H6ZA 2KCWA 3FEEA 2D4PA 2OH1A 2RFHA 5F48A 3K9TA 3BXMA 2VZZA 5JGFA 4OADA 4WWVA 5A27A 2JBKA 2Q04A 2OB0A 3PB9X 5LRKA 3PB7X 3MGDA 4PK3A 4R87A 2J8NA 2PJ9A 3SJXA 2HC9A 2OR4A 2PVVA 1EE3P 3W6SA 4KSAA 2GFQA 3KL9A 3NH4A 4UEEA 2VI7A 5F09A 3IO1A 4LX9A 4CYQA 3BI0A 1P0HA 2ODFA 1Z2LA 3FMCA 4ZGYB 2ZXVA 4CAXA 2G9DA 4MY0A 1QSTA 2BUEA 4NEXA 4XNHC 2JDCA 3GY9A 3LD2A 3RZAA 4KLWA 5IB0A 5ISVA 4ZX9A 2HQYA 3D68A 1I12A 3FVLA 3VATA 4R76A 3V38A 4UFXA 2Q4ZA 3D2MA 1BPNA 1XE4A 3GUXA 2ATRA 1IGBA 2CTCA 3D2PA 4NGSA 4L89A 4P4BA 3FXTA 2OZHA 4OC4A 4UWIA 3R96A 4AG9A 4CAVA 4C7IA 1YLEA 3SXNA 1Z4EA 2B3UA 4EMEA 3R1KA 4NGMA 3GLJA 5HVGA 1XFOA 2B4DA 5I0CA 1QSMA 4AG7A 5A28A 5HH1A 3JUWA 3CXSA 3S6GA 1Y0RA 5H84A 2F5IA 1WK4A 1YQEA 4MFJA 5LYFA 1X12A 3G8WA 1RTQA 3SJGA 3ZJ0A 3IU2A 1IYKA 3FBUA 5CNPA 2QECA 3PB4X 4B6ZA 2PC1A 5AGEA 2AFZA 3IEHA 1R57A 5AG6A 2V8VA 2ZOGA 2ZW4A 4J3GA 3PBBA 4E0AA 7CPAA 2P6FA 3B3TA 2ZEFA 2Q7SA 2X7BA 3KHZA 1Y9KA 4DYOA 2F7VA 4CGMA 2GE3A 1OBRA 2PSWA 2D4OA 2GU2A 1YK3A 2H5MA 3DDDA 3R9EA 4P44A 2AFSA 4NJRA 1QMUA 1Y7RA 3TX8A 4OAEA 2FE7A 4MY3A 4OC3A 3EFAA 1XJOA 2WPWA 4IAVA 2PRBA 3RNZA 4YGOA 3PZJA 1TKJA 1YVOA 2BSWA 3SXOA 2Y0MA 4R6TA 4KUAA 2PJ6A 3DGVA 3N5FA 2G3TA 5AG7A 3HUVA 2B3VA 5C88A 3PP9A 2CNMA 1YSJA 5DWNA 2BL1A 2QVPA 4F0XA 3CDXA 2PJBA 1XF8A 2CF4A 2DPTA 3GYAA 4IHMA 4OLLA 2AE6A 4P10A 4C68A 4C2YA 2B4BA 4A2ZA 1V0CA 1HDQA 3D7GA 2FSRA 4I49A 1N71A 1GYTA 3D7HA 2C6CA 2C6GA 2QYVA 3EXNA 5FVJA 2ARHA 4K3NA 2QMLA 2IMOA 4KOTA 1NE9A 4EVYA 2PJ1A 2V8HA 1IYLA 4Y49C 1AUGA 1VHOA 1AMPA 1QQ9A 4NGQA 2HB6A 2EO8A 2Q7BA 3S9MA 4JXRA 1M44A 3TO6A 1KZFA 4Z65A 4UCMA 2FT0A 2VQYA 3N7ZA 3DSBA 1XMBA 6CPAA 4CGPA 4FBEA 4GS4A 4KUBA 1M4LA 1AYEA 1OZPA 1IIDA 3KR4A 5KTCA 4A38A 4C7HA 4BINA 2CIJA 5J1QA 3DR6A 4DUKA 3R9FA 4P6YA 3S6HA 1M1DA 1F2OA 1LAPA 2EVNA 1FT7A 2O53A 2G0BA 5IV0A 4MHNA 4MMOA 4OC2A 5HVFA 1ARLA 3FRMA 4RI1A 3TO9A 5D29A 2ZPAA 2J8RA 3F0AA 3B3VA 2C1CA 4W9YA 4A94A 4KOYA 1J4JA 1YW6A 2WZNA 2BO9A 4XNHB 1YLOA 1XRYA 2P0WA 4Q36A 4OMEA 2ZOFA 4MCPA 2WUUA 4ZY0A 5BWAB 4PQAA 3PRTA 1NSAA 3IWGA 2O28A 2PRQA 3WT4A 1XOVA 1PUAA 2GLFA 2AFMA 4MFQA 5GCNA 4NF1A 3RYOA 1I1DA 2QJ8A 5EMIA 4MRIA
chains in the Genus database with same CATH topology
4PSWA 5G21A 3TE4A 2Z3PA 5J8CA 4KOVA 5J8FA 2NMTA 3JTKA 4MFKA 2OZGA 2CNSA 4HNXB 3LODA 4A33A 3QAHA 2CXAA 4MI4A 3H5ZA 4FD4A 3EY5A 5JQ4A 2OU2A 4E8OA 1BO4A 3D8PA 2Z3NA 3G3SA 1XMTA 4FD5A 2Z0ZA 1S3ZA 1M4GA 4E2AA 1B6BA 4R57A 4B5OA 2Z3LA 1VKCA 2JLMA 4MFPA 2B4DB 2VXKA 1XIXA 1S60A 4UFWA 4KVME 4CGOA 4MFLA 1PU9A 4H6UA 4ONUA 3VWEA 1K4JA 2Q44A 5AG4A 2Q4YA 2OZUA 1S5KA 4UWJA 4UBRA 3W6XA 2DXQA 4UA3A 2FIAA 3FYNA 4A95A 2HUZA 2AJ6A 4IF5A 2A4NA 3KKWA 2FIWA 1QSOA 4H89A 4B5PB 1L0CA 2PQ8A 1XEBA 2CNTA 1CJWA 3BLNA 3D3SA 1S7NA 3EO4A 1RO5A 2YGWA 3IU1A 4CAEA 4U5YA 2QIRA 4M85A 4KVOE 4Y49B 4F0YA 3I9SA 4CRYB 2WSAA 2Q0YA 4XPDB 2VZYA 2Z3OA 2C27A 3VWDA 4A31A 4K30A 3TT2A 4UCNA 1YVKA 2FCKA 3TOBA 1MJAA 2P6GA 1S7KA 2B58A 2YNDA 1LRZA 2J8MA 4JWPA 1NMTA 5JPHA 1S7FA 4CAFA 3BJ8A 4CYPA 4YFJA 1QSRA 4MFZA 5G22A 1RXTA 4CGNA 3FIXA 3B8GA 1KUVA 2P6EA 2BEIA 1M4IA 4X5KA 4PV6A 3WR7A 2FL4A 3F8KA 3UY5A 1CM0A 4IUSA 3TTHA 2JDDA 4B12A 1IB1E 1YREA 2PR8A 2YNCA 2YNEA 1MJ9A 4R3LA 3IGRA 4QVTA 4LUAA 3R9GA 3SHPA 4PK2A 4ORFA 5AG5A 4ZBGA 1KUYA 2R8VA 4KOXA 2G3AA 4HKFA 4QC6A 4C2XA 2FS5A 4JXQA 3F5BA 2I79A 2I00A 1KUXA 4CRZB 5HMNA 2YNCC 3JVNA 5G1ZA 5DWMA 3TO7A 4MJ8A 1I21A 2WPXA 4QUSA 4XPLA 2GANA 4B10A 3T9YA 4JD6A 4NSQA 1M4DA 4C2ZA 3OWCA 4KVXA 4QBJA 2PDOA 3DR8A 4MBUA 4CAWA 5G20A 2GIVA 1QSNA 4BMHA 2DPSA 2JEVA 2R98A 2CY2A 4QB9A 4DNCA 3I3GA 4KOUA 3TCVA 5C82A 4L8AA 4NCZA 4HNYB 3R95A 4A32A 1B87A 2B5GB 3IWEA 3H4QA 4B5PA 2REFA 1BOBA 3TFYA 5F49A 3CXPA 4BBHA 1VHSA 1P4NA 3GKRA 5H86A 2ZW7A 4KORA 1IICA 4FD7A 1NSLA 1ZO0A 4R3KA 3S6KA 3P2HA 1ON0A 4JLYA 3FB3A 2Z3KA 3EC4A 2B5GA 2FXFA 5IX3A 4XPDC 4CYNA 2EUIA 5KTAA 1Y9WA 4NXYA 5F46A 2RC4A 4KOSA 4CYOA 4B14A 1WWZA 4B11A 4CGLA 1Z4RA 4Q38A 3S6FA 3T90A 2VEZA 2PR1A 4KLVA 1GHEA 1FY7A 4AVAA 2Q4VA 4U9YA 4HNWB 3C26A 4M3SA 4UCPA 2IL4A 1YGHA 2ZW5A 3ZZIA 4II9A 3DNSA 4PSXA 4JJXA 2R1IA 5E96A 4R9MA 1Q2YA 2Z3MA 4FD6A 2REEA 2R7HA 1Z9UA 5EBVA 3K9UA 1MK4A 4MHDA 4B13A 4AVBA 4UFVA 4KZTA 2Z10A 4KOWA 2K5TA 3PGPA 1TIQA 4AVCA 5KTDA 4KSFA 4U9ZA 3TOAA 4RS2A 1S7LA 3W91A 2VBQA 2HV2A 4KS9A 3QB8A 3NE7A 4YRHA 3A9LA 3CXQA 1YX0A 3FNCA 3V8IA 1SQHA 4CS0B 1UFHA 4A30A 5EC4A 3BJ7A 1Q2CA 4AB7A 1YR0A 3E0KA 3P2FA 2ZW6A 4F6AA 5F47A 1MJBA 1U6MA 2Z11A 1Q2DA 4XPKA 4H6ZA 2KCWA 2D4PA 2OH1A 5F48A 2VZZA 4OADA 5A27A 2Q04A 2OB0A 3MGDA 4PK3A 4R87A 2J8NA 3W6SA 4KSAA 2VI7A 4LX9A 4CYQA 1P0HA 4ZGYB 2ZXVA 4CAXA 4MY0A 1QSTA 2BUEA 4NEXA 4XNHC 2JDCA 3GY9A 3LD2A 5IB0A 4KLWA 5ISVA 2HQYA 1I12A 4UFXA 3D2MA 1XE4A 2ATRA 3D2PA 4UWIA 3FXTA 2OZHA 3R96A 4AG9A 4CAVA 4C7IA 1YLEA 3SXNA 1Z4EA 2B3UA 3R1KA 5I0CA 2B4DA 1QSMA 4AG7A 5A28A 5HH1A 3JUWA 3CXSA 3S6GA 5H84A 2F5IA 1WK4A 4MFJA 3G8WA 3ZJ0A 3IU2A 1IYKA 3FBUA 5CNPA 2QECA 2PC1A 5AGEA 1R57A 5AG6A 2ZW4A 4J3GA 4E0AA 2P6FA 2X7BA 1Y9KA 4CGMA 2GE3A 2PSWA 2D4OA 3DDDA 1YK3A 2H5MA 3R9EA 1Y7RA 4OAEA 2FE7A 4MY3A 3EFAA 2WPWA 2PRBA 4YGOA 3PZJA 1YVOA 2BSWA 3SXOA 2Y0MA 4KUAA 2G3TA 5AG7A 2B3VA 5C88A 3PP9A 2CNMA 5DWNA 2BL1A 4F0XA 1XF8A 2DPTA 3GYAA 4OLLA 2AE6A 4C68A 4C2YA 2B4BA 4A2ZA 1V0CA 2FSRA 4I49A 1N71A 3EXNA 5FVJA 2ARHA 2QMLA 4KOTA 1NE9A 4EVYA 1IYLA 4Y49C 2Q7BA 4JXRA 1M44A 3TO6A 1KZFA 4UCMA 2FT0A 2VQYA 3N7ZA 3DSBA 4CGPA 4GS4A 4KUBA 1OZPA 1IIDA 5KTCA 4C7HA 3DR6A 3R9FA 3S6HA 1M1DA 2EVNA 5IV0A 2G0BA 3FRMA 4RI1A 3TO9A 2ZPAA 2J8RA 3F0AA 4KOYA 1J4JA 4XNHB 2P0WA 4Q36A 2WUUA 5BWAB 3IWGA 2O28A 1PUAA 4MFQA 5GCNA 4NF1A 3RYOA 1I1DA 4L89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PSW A;  3TE4 A;  5J8C A;  4KOV A;  5J8F A;  2NMT A;  2OZG A;  2CNS A;  4HNX B;  3LOD A;  3QAH A;  4MI4 A;  4FD4 A;  3EY5 A;  5JQ4 A;  2OU2 A;  4E8O A;  1BO4 A;  3D8P A;  3G3S A;  1XMT A;  4FD5 A;  2Z0Z A;  1S3Z A;  1M4G A;  4E2A A;  1B6B A;  4R57 A;  4B5O A;  1VKC A;  2JLM A;  2B4D B;  2VXK A;  1XIX A;  1S60 A;  4KVM E;  1PU9 A;  4H6U A;  4ONU A;  3VWE A;  1K4J A;  2Q44 A;  2Q4Y A;  2OZU A;  1S5K A;  4UWJ A;  4UBR A;  3W6X A;  2DXQ A;  4UA3 A;  2FIA A;  3FYN A;  2HUZ A;  2AJ6 A;  4IF5 A;  2A4N A;  3KKW A;  2FIW A;  1QSO A;  4H89 A;  4B5P B;  1L0C A;  2PQ8 A;  1XEB A;  2CNT A;  1CJW A;  3BLN A;  3D3S A;  1S7N A;  3EO4 A;  1RO5 A;  4U5Y A;  2QIR A;  4M85 A;  4KVO E;  4Y49 B;  4F0Y A;  3I9S A;  4CRY B;  2Q0Y A;  4XPD B;  2VZY A;  3VWD A;  2C27 A;  4K30 A;  3TT2 A;  1YVK A;  2FCK A;  3TOB A;  1MJA A;  2P6G A;  1S7K A;  2B58 A;  1LRZ A;  2J8M A;  4JWP A;  1NMT A;  5JPH A;  1S7F A;  3BJ8 A;  4YFJ A;  1QSR A;  1RXT A;  3FIX A;  3B8G A;  1KUV A;  2P6E A;  2BEI A;  1M4I A;  4X5K A;  4PV6 A;  3WR7 A;  2FL4 A;  3F8K A;  3UY5 A;  1CM0 A;  4IUS A;  3TTH A;  2JDD A;  1IB1 E;  1YRE A;  2PR8 A;  1MJ9 A;  4R3L A;  3IGR A;  4QVT A;  4LUA A;  3R9G A;  3SHP A;  4PK2 A;  4ORF A;  4ZBG A;  1KUY A;  2R8V A;  4KOX A;  2G3A A;  4HKF A;  4QC6 A;  2FS5 A;  4JXQ A;  3F5B A;  2I79 A;  2I00 A;  1KUX A;  4CRZ B;  5HMN A;  3JVN A;  5DWM A;  3TO7 A;  4MJ8 A;  1I21 A;  2WPX A;  4QUS A;  4XPL A;  2GAN A;  3T9Y A;  4JD6 A;  4NSQ A;  1M4D A;  3OWC A;  4KVX A;  4QBJ A;  2PDO A;  3DR8 A;  4MBU A;  4CAW A;  2GIV A;  1QSN A;  4BMH A;  2JEV A;  2R98 A;  2CY2 A;  4QB9 A;  4DNC A;  3I3G A;  4KOU A;  3TCV A;  5C82 A;  4L8A A;  4NCZ A;  4HNY B;  3R95 A;  1B87 A;  2B5G B;  3H4Q A;  4B5P A;  2REF A;  1BOB A;  3TFY A;  5F49 A;  3CXP A;  1VHS A;  1P4N A;  3GKR A;  5H86 A;  2ZW7 A;  1IIC A;  4FD7 A;  4KOR A;  1NSL A;  4R3K A;  3S6K A;  3P2H A;  1ON0 A;  4JLY A;  3FB3 A;  3EC4 A;  2B5G A;  2FXF A;  5IX3 A;  4XPD C;  2EUI A;  5KTA A;  1Y9W A;  4NXY A;  5F46 A;  2RC4 A;  4KOS A;  1WWZ A;  1Z4R A;  3S6F A;  3T90 A;  2VEZ A;  2PR1 A;  4KLV A;  1GHE A;  1FY7 A;  4AVA A;  2Q4V A;  4U9Y A;  4HNW B;  3C26 A;  4M3S A;  2IL4 A;  1YGH A;  2ZW5 A;  3ZZI A;  4II9 A;  3DNS A;  4PSX A;  4JJX A;  2R1I A;  5E96 A;  4R9M A;  1Q2Y A;  4FD6 A;  2REE A;  2R7H A;  1Z9U A;  5EBV A;  3K9U A;  1MK4 A;  4MHD A;  4AVB A;  4KZT A;  2Z10 A;  4KOW A;  2K5T A;  3PGP A;  1TIQ A;  4AVC A;  5KTD A;  4U9Z A;  3TOA A;  4RS2 A;  1S7L A;  3W91 A;  2VBQ A;  2HV2 A;  3QB8 A;  3NE7 A;  4YRH A;  3CXQ A;  1YX0 A;  3FNC A;  3V8I A;  1SQH A;  4CS0 B;  1UFH A;  5EC4 A;  3BJ7 A;  1Q2C A;  4AB7 A;  1YR0 A;  3E0K A;  3P2F A;  2ZW6 A;  4F6A A;  5F47 A;  1MJB A;  1U6M A;  2Z11 A;  1Q2D A;  4XPK A;  4H6Z A;  2KCW A;  2D4P A;  2OH1 A;  5F48 A;  2VZZ A;  4OAD A;  2Q04 A;  2OB0 A;  3MGD A;  4PK3 A;  4R87 A;  2J8N A;  3W6S A;  2VI7 A;  4LX9 A;  1P0H A;  2ZXV A;  4CAX A;  4MY0 A;  1QST A;  2BUE A;  4NEX A;  4XNH C;  2JDC A;  3GY9 A;  3LD2 A;  5IB0 A;  4KLW A;  5ISV A;  2HQY A;  1I12 A;  3D2M A;  1XE4 A;  2ATR A;  3D2P A;  4UWI A;  3FXT A;  2OZH A;  3R96 A;  4AG9 A;  4CAV A;  1YLE A;  3SXN A;  1Z4E A;  2B3U A;  3R1K A;  5I0C A;  2B4D A;  1QSM A;  4AG7 A;  5HH1 A;  3JUW A;  3CXS A;  3S6G A;  5H84 A;  2F5I A;  1WK4 A;  3G8W A;  3ZJ0 A;  1IYK A;  3FBU A;  5CNP A;  2QEC A;  2PC1 A;  1R57 A;  2ZW4 A;  4J3G A;  4E0A A;  2P6F A;  2X7B A;  1Y9K A;  2GE3 A;  2PSW A;  2D4O A;  3DDD A;  1YK3 A;  2H5M A;  3R9E A;  1Y7R A;  4OAE A;  2FE7 A;  4MY3 A;  3EFA A;  2WPW A;  2PRB A;  4YGO A;  3PZJ A;  1YVO A;  2BSW A;  3SXO A;  2Y0M A;  4KUA A;  2G3T A;  2B3V A;  5C88 A;  3PP9 A;  2CNM A;  5DWN A;  2BL1 A;  1XF8 A;  4OLL A;  3GYA A;  2AE6 A;  2B4B A;  1V0C A;  2FSR A;  4I49 A;  1N71 A;  3EXN A;  5FVJ A;  2ARH A;  2QML A;  4KOT A;  1NE9 A;  4EVY A;  1IYL A;  4Y49 C;  2Q7B A;  4JXR A;  1M44 A;  3TO6 A;  1KZF A;  2FT0 A;  2VQY A;  3N7Z A;  3DSB A;  4GS4 A;  4KUB A;  1OZP A;  1IID A;  5KTC A;  3DR6 A;  3R9F A;  3S6H A;  1M1D A;  2EVN A;  5IV0 A;  2G0B A;  3FRM A;  4RI1 A;  3TO9 A;  2ZPA A;  2J8R A;  3F0A A;  4KOY A;  1J4J A;  4XNH B;  2P0W A;  3IWG A;  2O28 A;  1PUA A;  5GCN A;  3RYO A;  4NF1 A;  1I1D A;  4L89 A; 
#chains in the Genus database with same CATH topology
 2XEJ A;  4PSW A;  5G21 A;  3KR5 A;  1JQG A;  2Q43 A;  3RO0 A;  3TE4 A;  3B7I A;  2Z3P A;  5K8O A;  3IWW A;  5J8C A;  2DF5 A;  4KOV A;  4JZ0 A;  1IY7 A;  4WJB A;  5J8F A;  2AFX A;  2NMT A;  3JTK A;  3KAS A;  4MFK A;  2OZG A;  1ZLH A;  2CNS A;  1Y0Y A;  2V77 A;  3LOD A;  4G1P A;  4HNX B;  4MHP A;  4A33 A;  4F8Z A;  3QAH A;  1Y7E A;  2CXA A;  4MI4 A;  3H5Z A;  3D67 A;  2NYQ A;  4FD4 A;  1HEE A;  3EY5 A;  5JQ4 A;  4FUU A;  2OU2 A;  4E8O A;  1F57 A;  1BO4 A;  2O4H A;  3D8P A;  2I3C A;  2Z3N A;  1FNO A;  3G3S A;  1XMT A;  4FD5 A;  2Z0Z A;  1S3Z A;  1M4G A;  1ARM A;  2CTB A;  1CPX A;  1B6B A;  2AFW A;  4R57 A;  2GLJ A;  4OIW A;  4B5O A;  4E2A A;  1JWQ A;  2IJZ A;  2Z3L A;  1VKC A;  2JLM A;  2POK A;  5K8N A;  4TNU A;  3KQX A;  1A2Z A;  4MFP A;  2B4D B;  2VXK A;  1XIX A;  1S60 A;  4UFW A;  4KVM E;  3SI1 A;  4CGO A;  4MFL A;  4PXC A;  4OID A;  4NGP A;  1VGY A;  3VAR A;  1PU9 A;  4H6U A;  2Q51 A;  3K2K A;  4EFD A;  4ONU A;  3JRU A;  3KGQ A;  3MRU A;  2NSM A;  1K4J A;  3VWE A;  2Q44 A;  2ZEO A;  5AG4 A;  2PJ0 A;  1TXR A;  2Q4Y A;  2EK8 A;  2OZU A;  3D7F A;  1S5K A;  5THW A;  2EK9 A;  4UWJ A;  4UBR A;  3W6X A;  2DXQ A;  4UA3 A;  2FIA A;  2PVW A;  3FYN A;  3PBE A;  4A95 A;  3CPX A;  3PEI A;  2HUZ A;  3L2N A;  1VHE A;  4P4J A;  1YME A;  2ZEN A;  1ZG9 A;  2AJ6 A;  3MN8 A;  4P4E A;  4IF5 A;  3SI0 A;  2A4N A;  3KKW A;  2FIW A;  1QSO A;  4H89 A;  2PE3 A;  4B5P B;  1CG2 A;  1L0C A;  2PQ8 A;  2PJ5 A;  1XEB A;  2CNT A;  1CJW A;  3BLN A;  4NGN A;  3D3S A;  1S7N A;  3EO4 A;  1RO5 A;  2YGW A;  4ZX8 A;  3IU1 A;  4NJQ A;  4CAE A;  4U5Y A;  2QIR A;  4M85 A;  4KVO E;  2OOT A;  5IB9 A;  4Y49 B;  4F0Y A;  2DEA A;  3I9S A;  2WSA A;  4CRY B;  1Z5R A;  4RN7 A;  2Q0Y A;  4XPD B;  2VZY A;  2Z3O A;  2C27 A;  1LCP A;  3B3C A;  4K30 A;  4ZY2 A;  3VWD A;  4A31 A;  5K8P A;  3TT2 A;  4UCN A;  1YVK A;  2FCK A;  3TOB A;  1MJA A;  4FWU A;  1DTD A;  2P6G A;  4P4I A;  1CP7 A;  1S7K A;  2FVG A;  3KQZ A;  2B58 A;  1IU8 A;  4O23 A;  2YND A;  2XEI A;  1LRZ A;  2J8M A;  4JWP A;  1NMT A;  2PJ4 A;  5JH9 A;  5JPH A;  3GB0 A;  1S7F A;  3IJ3 A;  4CAF A;  3BJ8 A;  1BLL E;  4PXE A;  2JBJ A;  1ELL P;  4CYP A;  1QSR A;  3LAC A;  4YFJ A;  4MFZ A;  3ISZ A;  5G22 A;  1RXT A;  4CGN A;  4UIA A;  3NA6 A;  3FIX A;  4MCQ A;  1TKH A;  5HXD A;  5CBM A;  3B8G A;  1KUV A;  1VIX A;  2P6E A;  2PCU A;  3S9N A;  2BEI A;  1M4I A;  3NE8 A;  4PV6 A;  2PJ8 A;  4X5K A;  1R43 A;  2FL4 A;  3LWU A;  3TC8 A;  3WR7 A;  3F8K A;  3UY5 A;  1CM0 A;  4IUS A;  3TTH A;  2ANP A;  2JDD A;  4B12 A;  1IB1 E;  1YRE A;  2PR8 A;  2YNC A;  5I4M A;  2YNE A;  3NFZ A;  1MJ9 A;  4BD9 A;  4R3L A;  2PJ3 A;  3IGR A;  4LUA A;  4NFR A;  4QVT A;  3R9G A;  3SHP A;  1Z8X A;  4ORF A;  4PK2 A;  5AG5 A;  4ZBG A;  1KUY A;  5CPA A;  2R8V A;  4KOX A;  2G3A A;  4HKF A;  4QC6 A;  5LYD A;  3VH9 A;  4C2X A;  2FS5 A;  3NH8 A;  2PIY A;  4JXQ A;  4MHY A;  3F5B A;  2I79 A;  2I00 A;  2XEF A;  2ZED A;  2XEG A;  1KUX A;  1X10 A;  4X2T A;  4CRZ B;  5HMN A;  3H8E A;  1Z8T A;  4MCR A;  2YNC C;  4Q7A A;  3JVN A;  5G1Z A;  3GIU A;  5DWM A;  5LYI A;  4OC1 A;  4MJ8 A;  3RBU A;  1I21 A;  2WPX A;  4R7M A;  3TO7 A;  1BAV A;  4QUS A;  4XPL A;  2GAN A;  4B10 A;  1PYT B;  3T9Y A;  4JD6 A;  4NSQ A;  4LQ6 A;  1M4D A;  1YW4 A;  2BCO A;  4C2Z A;  3H8F A;  5LRJ A;  4RUH A;  3OWC A;  2EWB A;  4KVX A;  2ZEL A;  3FED A;  4UEZ A;  4QBJ A;  8CPA A;  2PDO A;  2ZEE A;  3FJU A;  3DR8 A;  4MBU A;  4CAW A;  3LMS A;  3ISX A;  4X8I A;  1ZG7 A;  5G20 A;  4UEF A;  2GIV A;  4M6H A;  5HVH A;  1QSN A;  4BMH A;  2JEV A;  1LOK A;  2DPS A;  2CY2 A;  1Z8W A;  2F8H A;  2R98 A;  3PFE A;  4ZY1 A;  5DS0 A;  4QB9 A;  2ABZ A;  4CPA A;  4UF4 A;  1TF8 A;  2PJC A;  3I3G A;  4DNC A;  4KOU A;  1LAN A;  3CZX A;  3PB8 X;  3TCV A;  4L8A A;  4FAI A;  5C82 A;  4X3R A;  3T8W A;  3B3S A;  4F9U A;  1H8L A;  4KSI A;  4HNY B;  4NCZ A;  4PXD A;  4MHZ A;  3R95 A;  2BOA A;  4A32 A;  1B87 A;  2B5G B;  3IWE A;  1LFW A;  2EBJ A;  3H4Q A;  4NGR A;  4B5P A;  1LAM A;  2AFU A;  1BOB A;  2REF A;  4MCS A;  3TFY A;  1TKF A;  2JEW A;  5F49 A;  3CXP A;  4A39 A;  4BBH A;  1VHS A;  1P4N A;  4P45 A;  1CPS A;  1IOI A;  3GKR A;  5H86 A;  2ZW7 A;  3PB6 X;  4OP4 A;  1IIC A;  4FD7 A;  4KOR A;  1NSL A;  1ZO0 A;  4R3K A;  3S6K A;  4TWE A;  1F2P A;  4AXV A;  3P2H A;  1R3N A;  1ON0 A;  4ONW A;  4ZYQ A;  3IFE A;  4JLY A;  3FB3 A;  4NGT A;  2Z3K A;  4M6I A;  3HLP A;  3D4U A;  3FH4 A;  2PJA A;  3EC4 A;  2GRE A;  2FXF A;  2B5G A;  2VL1 A;  3SJE A;  5IX3 A;  4XPD C;  4CYN A;  2EUI A;  5KTA A;  3B2Y A;  1Y9W A;  1ZG8 A;  4NXY A;  5F46 A;  2RC4 A;  4KOS A;  4CYO A;  3BI1 A;  4MXU A;  1WWZ A;  4B14 A;  4B11 A;  4CGL A;  1Z4R A;  3PFO A;  5ELY A;  2RB7 A;  2V8D A;  4M6G A;  4OC0 A;  1CP6 A;  1DE4 C;  1HDU A;  1XBU A;  3FF3 A;  4Q38 A;  3S6F A;  3T90 A;  2VEZ A;  2PR1 A;  4KLV A;  3WC7 A;  1GHE A;  1FY7 A;  4IK2 A;  2J9A A;  4AVA A;  2Q4V A;  4U9Y A;  4HNW B;  2IQ6 A;  4OC5 A;  3C26 A;  4H2K A;  4M3S A;  5LRG A;  4UCP A;  5LYL A;  2IL4 A;  4PXB A;  1YGH A;  2ZW5 A;  3ZZI A;  3D66 A;  3KZW A;  4II9 A;  3DNS A;  4PSX A;  4JJX A;  2R1I A;  5E96 A;  4R9M A;  3RAM A;  3S9L A;  1Q2Y A;  2Z3M A;  4FD6 A;  3V7Z A;  2REE A;  3NH5 A;  2R7H A;  1Z9U A;  2WYR A;  3CPA A;  4YU9 A;  5EBV A;  4F9V A;  2ZEH A;  3H8G A;  4YWY A;  2ZEP A;  3K9U A;  2AFO A;  1MK4 A;  3BHX A;  4MHD A;  4AVB A;  4B13 A;  4UFV A;  3FX6 A;  4KZT A;  3FEC A;  2V8G A;  2Z10 A;  4KOW A;  1ELM P;  5D8N A;  2K5T A;  3IIB A;  3PGP A;  3QAY A;  1TIQ A;  2ZEM A;  4AVC A;  4R8F A;  3CT9 A;  5KTD A;  4LQG A;  2C6P A;  3SJF A;  5JM6 A;  4KSF A;  4DJL A;  3KI9 A;  4U9Z A;  3TOA A;  4RS2 A;  1S7L A;  2ZEG A;  3W91 A;  2VBQ A;  1TF9 A;  2HV2 A;  4KS9 A;  1KWM A;  3KHX A;  4P4D A;  3QB8 A;  2PJ2 A;  3NE7 A;  4YRH A;  3B3W A;  4PPZ A;  3D7D A;  3A9L A;  1CX8 A;  1UWY A;  3CXQ A;  3QNV A;  1YX0 A;  3FNC A;  1IOF A;  3V8I A;  1SQH A;  4A37 A;  4GM5 A;  4P4F A;  4CS0 B;  1UFH A;  3B35 A;  4A30 A;  5EC4 A;  3BJ7 A;  1Q2C A;  3IC1 A;  4ZI6 A;  4GXH A;  3SI2 A;  5K8M A;  3WC6 A;  2PJ7 A;  4AB7 A;  1YR0 A;  3E0K A;  3DLJ A;  1Z8L A;  1PCA A;  4OKO A;  1BPM A;  1ZLI A;  2PIZ A;  3P2F A;  2ZW6 A;  4F6A A;  4JYW A;  5F47 A;  1MJB A;  1U6M A;  2Z11 A;  4HPS A;  3WC5 A;  3WAB A;  4EWT A;  1Q2D A;  1Q7L A;  4XPK A;  1CBX A;  4UIB A;  3I1U A;  4H6Z A;  2KCW A;  3FEE A;  2D4P A;  2OH1 A;  2RFH A;  5F48 A;  3K9T A;  3BXM A;  2VZZ A;  5JGF A;  4OAD A;  4WWV A;  5A27 A;  2JBK A;  2Q04 A;  2OB0 A;  3PB9 X;  5LRK A;  3PB7 X;  3MGD A;  4PK3 A;  4R87 A;  2J8N A;  2PJ9 A;  3SJX A;  2HC9 A;  2OR4 A;  2PVV A;  1EE3 P;  3W6S A;  4KSA A;  2GFQ A;  3KL9 A;  3NH4 A;  4UEE A;  2VI7 A;  5F09 A;  3IO1 A;  4LX9 A;  4CYQ A;  3BI0 A;  1P0H A;  2ODF A;  1Z2L A;  3FMC A;  4ZGY B;  2ZXV A;  4CAX A;  2G9D A;  4MY0 A;  1QST A;  2BUE A;  4NEX A;  4XNH C;  2JDC A;  3GY9 A;  3LD2 A;  3RZA A;  4KLW A;  5IB0 A;  5ISV A;  4ZX9 A;  2HQY A;  3D68 A;  1I12 A;  3FVL A;  3VAT A;  4R76 A;  3V38 A;  4UFX A;  2Q4Z A;  3D2M A;  1BPN A;  1XE4 A;  3GUX A;  2ATR A;  1IGB A;  2CTC A;  3D2P A;  4NGS A;  4L89 A;  4P4B A;  3FXT A;  2OZH A;  4OC4 A;  4UWI A;  3R96 A;  4AG9 A;  4CAV A;  4C7I A;  1YLE A;  3SXN A;  1Z4E A;  2B3U A;  4EME A;  3R1K A;  4NGM A;  3GLJ A;  5HVG A;  1XFO A;  2B4D A;  5I0C A;  1QSM A;  4AG7 A;  5A28 A;  5HH1 A;  3JUW A;  3CXS A;  3S6G A;  1Y0R A;  5H84 A;  2F5I A;  1WK4 A;  1YQE A;  4MFJ A;  5LYF A;  1X12 A;  3G8W A;  1RTQ A;  3SJG A;  3ZJ0 A;  3IU2 A;  1IYK A;  3FBU A;  5CNP A;  2QEC A;  3PB4 X;  4B6Z A;  2PC1 A;  5AGE A;  2AFZ A;  3IEH A;  1R57 A;  5AG6 A;  2V8V A;  2ZOG A;  2ZW4 A;  4J3G A;  3PBB A;  4E0A A;  7CPA A;  2P6F A;  3B3T A;  2ZEF A;  2Q7S A;  2X7B A;  3KHZ A;  1Y9K A;  4DYO A;  2F7V A;  4CGM A;  2GE3 A;  1OBR A;  2PSW A;  2D4O A;  2GU2 A;  1YK3 A;  2H5M A;  3DDD A;  3R9E A;  4P44 A;  2AFS A;  4NJR A;  1QMU A;  1Y7R A;  3TX8 A;  4OAE A;  2FE7 A;  4MY3 A;  4OC3 A;  3EFA A;  1XJO A;  2WPW A;  4IAV A;  2PRB A;  3RNZ A;  4YGO A;  3PZJ A;  1TKJ A;  1YVO A;  2BSW A;  3SXO A;  2Y0M A;  4R6T A;  4KUA A;  2PJ6 A;  3DGV A;  3N5F A;  2G3T A;  5AG7 A;  3HUV A;  2B3V A;  5C88 A;  3PP9 A;  2CNM A;  1YSJ A;  5DWN A;  2BL1 A;  2QVP A;  4F0X A;  3CDX A;  2PJB A;  1XF8 A;  2CF4 A;  2DPT A;  3GYA A;  4IHM A;  4OLL A;  2AE6 A;  4P10 A;  4C68 A;  4C2Y A;  2B4B A;  4A2Z A;  1V0C A;  1HDQ A;  3D7G A;  2FSR A;  4I49 A;  1N71 A;  1GYT A;  3D7H A;  2C6C A;  2C6G A;  2QYV A;  3EXN A;  5FVJ A;  2ARH A;  4K3N A;  2QML A;  2IMO A;  4KOT A;  1NE9 A;  4EVY A;  2PJ1 A;  2V8H A;  1IYL A;  4Y49 C;  1AUG A;  1VHO A;  1AMP A;  1QQ9 A;  4NGQ A;  2HB6 A;  2EO8 A;  2Q7B A;  3S9M A;  4JXR A;  1M44 A;  3TO6 A;  1KZF A;  4Z65 A;  4UCM A;  2FT0 A;  2VQY A;  3N7Z A;  3DSB A;  1XMB A;  6CPA A;  4CGP A;  4FBE A;  4GS4 A;  4KUB A;  1M4L A;  1AYE A;  1OZP A;  1IID A;  3KR4 A;  5KTC A;  4A38 A;  4C7H A;  4BIN A;  2CIJ A;  5J1Q A;  3DR6 A;  4DUK A;  3R9F A;  4P6Y A;  3S6H A;  1M1D A;  1F2O A;  1LAP A;  2EVN A;  1FT7 A;  2O53 A;  2G0B A;  5IV0 A;  4MHN A;  4MMO A;  4OC2 A;  5HVF A;  1ARL A;  3FRM A;  4RI1 A;  3TO9 A;  5D29 A;  2ZPA A;  2J8R A;  3F0A A;  3B3V A;  2C1C A;  4W9Y A;  4A94 A;  4KOY A;  1J4J A;  1YW6 A;  2WZN A;  2BO9 A;  4XNH B;  1YLO A;  1XRY A;  2P0W A;  4Q36 A;  4OME A;  2ZOF A;  4MCP A;  2WUU A;  4ZY0 A;  5BWA B;  4PQA A;  3PRT A;  1NSA A;  3IWG A;  2O28 A;  2PRQ A;  3WT4 A;  1XOV A;  1PUA A;  2GLF A;  2AFM A;  4MFQ A;  5GCN A;  4NF1 A;  3RYO A;  1I1D A;  2QJ8 A;  5EMI A;  4MRI A; 
#chains in the Genus database with same CATH homology
 4PSW A;  5G21 A;  3TE4 A;  2Z3P A;  5J8C A;  4KOV A;  5J8F A;  2NMT A;  3JTK A;  4MFK A;  2OZG A;  2CNS A;  4HNX B;  3LOD A;  4A33 A;  3QAH A;  2CXA A;  4MI4 A;  3H5Z A;  4FD4 A;  3EY5 A;  5JQ4 A;  2OU2 A;  4E8O A;  1BO4 A;  3D8P A;  2Z3N A;  3G3S A;  1XMT A;  4FD5 A;  2Z0Z A;  1S3Z A;  1M4G A;  4E2A A;  1B6B A;  4R57 A;  4B5O A;  2Z3L A;  1VKC A;  2JLM A;  4MFP A;  2B4D B;  2VXK A;  1XIX A;  1S60 A;  4UFW A;  4KVM E;  4CGO A;  4MFL A;  1PU9 A;  4H6U A;  4ONU A;  3VWE A;  1K4J A;  2Q44 A;  5AG4 A;  2Q4Y A;  2OZU A;  1S5K A;  4UWJ A;  4UBR A;  3W6X A;  2DXQ A;  4UA3 A;  2FIA A;  3FYN A;  4A95 A;  2HUZ A;  2AJ6 A;  4IF5 A;  2A4N A;  3KKW A;  2FIW A;  1QSO A;  4H89 A;  4B5P B;  1L0C A;  2PQ8 A;  1XEB A;  2CNT A;  1CJW A;  3BLN A;  3D3S A;  1S7N A;  3EO4 A;  1RO5 A;  2YGW A;  3IU1 A;  4CAE A;  4U5Y A;  2QIR A;  4M85 A;  4KVO E;  4Y49 B;  4F0Y A;  3I9S A;  4CRY B;  2WSA A;  2Q0Y A;  4XPD B;  2VZY A;  2Z3O A;  2C27 A;  3VWD A;  4A31 A;  4K30 A;  3TT2 A;  4UCN A;  1YVK A;  2FCK A;  3TOB A;  1MJA A;  2P6G A;  1S7K A;  2B58 A;  2YND A;  1LRZ A;  2J8M A;  4JWP A;  1NMT A;  5JPH A;  1S7F A;  4CAF A;  3BJ8 A;  4CYP A;  4YFJ A;  1QSR A;  4MFZ A;  5G22 A;  1RXT A;  4CGN A;  3FIX A;  3B8G A;  1KUV A;  2P6E A;  2BEI A;  1M4I A;  4X5K A;  4PV6 A;  3WR7 A;  2FL4 A;  3F8K A;  3UY5 A;  1CM0 A;  4IUS A;  3TTH A;  2JDD A;  4B12 A;  1IB1 E;  1YRE A;  2PR8 A;  2YNC A;  2YNE A;  1MJ9 A;  4R3L A;  3IGR A;  4QVT A;  4LUA A;  3R9G A;  3SHP A;  4PK2 A;  4ORF A;  5AG5 A;  4ZBG A;  1KUY A;  2R8V A;  4KOX A;  2G3A A;  4HKF A;  4QC6 A;  4C2X A;  2FS5 A;  4JXQ A;  3F5B A;  2I79 A;  2I00 A;  1KUX A;  4CRZ B;  5HMN A;  2YNC C;  3JVN A;  5G1Z A;  5DWM A;  3TO7 A;  4MJ8 A;  1I21 A;  2WPX A;  4QUS A;  4XPL A;  2GAN A;  4B10 A;  3T9Y A;  4JD6 A;  4NSQ A;  1M4D A;  4C2Z A;  3OWC A;  4KVX A;  4QBJ A;  2PDO A;  3DR8 A;  4MBU A;  4CAW A;  5G20 A;  2GIV A;  1QSN A;  4BMH A;  2DPS A;  2JEV A;  2R98 A;  2CY2 A;  4QB9 A;  4DNC A;  3I3G A;  4KOU A;  3TCV A;  5C82 A;  4L8A A;  4NCZ A;  4HNY B;  3R95 A;  4A32 A;  1B87 A;  2B5G B;  3IWE A;  3H4Q A;  4B5P A;  2REF A;  1BOB A;  3TFY A;  5F49 A;  3CXP A;  4BBH A;  1VHS A;  1P4N A;  3GKR A;  5H86 A;  2ZW7 A;  4KOR A;  1IIC A;  4FD7 A;  1NSL A;  1ZO0 A;  4R3K A;  3S6K A;  3P2H A;  1ON0 A;  4JLY A;  3FB3 A;  2Z3K A;  3EC4 A;  2B5G A;  2FXF A;  5IX3 A;  4XPD C;  4CYN A;  2EUI A;  5KTA A;  1Y9W A;  4NXY A;  5F46 A;  2RC4 A;  4KOS A;  4CYO A;  4B14 A;  1WWZ A;  4B11 A;  4CGL A;  1Z4R A;  4Q38 A;  3S6F A;  3T90 A;  2VEZ A;  2PR1 A;  4KLV A;  1GHE A;  1FY7 A;  4AVA A;  2Q4V A;  4U9Y A;  4HNW B;  3C26 A;  4M3S A;  4UCP A;  2IL4 A;  1YGH A;  2ZW5 A;  3ZZI A;  4II9 A;  3DNS A;  4PSX A;  4JJX A;  2R1I A;  5E96 A;  4R9M A;  1Q2Y A;  2Z3M A;  4FD6 A;  2REE A;  2R7H A;  1Z9U A;  5EBV A;  3K9U A;  1MK4 A;  4MHD A;  4B13 A;  4AVB A;  4UFV A;  4KZT A;  2Z10 A;  4KOW A;  2K5T A;  3PGP A;  1TIQ A;  4AVC A;  5KTD A;  4KSF A;  4U9Z A;  3TOA A;  4RS2 A;  1S7L A;  3W91 A;  2VBQ A;  2HV2 A;  4KS9 A;  3QB8 A;  3NE7 A;  4YRH A;  3A9L A;  3CXQ A;  1YX0 A;  3FNC A;  3V8I A;  1SQH A;  4CS0 B;  1UFH A;  4A30 A;  5EC4 A;  3BJ7 A;  1Q2C A;  4AB7 A;  1YR0 A;  3E0K A;  3P2F A;  2ZW6 A;  4F6A A;  5F47 A;  1MJB A;  1U6M A;  2Z11 A;  1Q2D A;  4XPK A;  4H6Z A;  2KCW A;  2D4P A;  2OH1 A;  5F48 A;  2VZZ A;  4OAD A;  5A27 A;  2Q04 A;  2OB0 A;  3MGD A;  4PK3 A;  4R87 A;  2J8N A;  3W6S A;  4KSA A;  2VI7 A;  4LX9 A;  4CYQ A;  1P0H A;  4ZGY B;  2ZXV A;  4CAX A;  4MY0 A;  1QST A;  2BUE A;  4NEX A;  4XNH C;  2JDC A;  3GY9 A;  3LD2 A;  5IB0 A;  4KLW A;  5ISV A;  2HQY A;  1I12 A;  4UFX A;  3D2M A;  1XE4 A;  2ATR A;  3D2P A;  4UWI A;  3FXT A;  2OZH A;  3R96 A;  4AG9 A;  4CAV A;  4C7I A;  1YLE A;  3SXN A;  1Z4E A;  2B3U A;  3R1K A;  5I0C A;  2B4D A;  1QSM A;  4AG7 A;  5A28 A;  5HH1 A;  3JUW A;  3CXS A;  3S6G A;  5H84 A;  2F5I A;  1WK4 A;  4MFJ A;  3G8W A;  3ZJ0 A;  3IU2 A;  1IYK A;  3FBU A;  5CNP A;  2QEC A;  2PC1 A;  5AGE A;  1R57 A;  5AG6 A;  2ZW4 A;  4J3G A;  4E0A A;  2P6F A;  2X7B A;  1Y9K A;  4CGM A;  2GE3 A;  2PSW A;  2D4O A;  3DDD A;  1YK3 A;  2H5M A;  3R9E A;  1Y7R A;  4OAE A;  2FE7 A;  4MY3 A;  3EFA A;  2WPW A;  2PRB A;  4YGO A;  3PZJ A;  1YVO A;  2BSW A;  3SXO A;  2Y0M A;  4KUA A;  2G3T A;  5AG7 A;  2B3V A;  5C88 A;  3PP9 A;  2CNM A;  5DWN A;  2BL1 A;  4F0X A;  1XF8 A;  2DPT A;  3GYA A;  4OLL A;  2AE6 A;  4C68 A;  4C2Y A;  2B4B A;  4A2Z A;  1V0C A;  2FSR A;  4I49 A;  1N71 A;  3EXN A;  5FVJ A;  2ARH A;  2QML A;  4KOT A;  1NE9 A;  4EVY A;  1IYL A;  4Y49 C;  2Q7B A;  4JXR A;  1M44 A;  3TO6 A;  1KZF A;  4UCM A;  2FT0 A;  2VQY A;  3N7Z A;  3DSB A;  4CGP A;  4GS4 A;  4KUB A;  1OZP A;  1IID A;  5KTC A;  4C7H A;  3DR6 A;  3R9F A;  3S6H A;  1M1D A;  2EVN A;  5IV0 A;  2G0B A;  3FRM A;  4RI1 A;  3TO9 A;  2ZPA A;  2J8R A;  3F0A A;  4KOY A;  1J4J A;  4XNH B;  2P0W A;  4Q36 A;  2WUU A;  5BWA B;  3IWG A;  2O28 A;  1PUA A;  4MFQ A;  5GCN A;  4NF1 A;  3RYO A;  1I1D A;  4L89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...