4UFXA

Plasmodium vivax n-myristoyltransferase in complex with a pyridyl inhibitor (compound 19)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of Pyridyl-Based Inhibitors of Plasmodium Falciparum N-Myristoyltransferase
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 116
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ufxA00
5AG7A 4UCPA 4A32A 5AG4A 5G21A 4C7IA 4UCNA 5AG5A 4A33A 4C2YA 4A30A 3IU1A 3IWEA 5AG6A 2YNEA 4CYOA 4B12A 5G1ZA 4CAEA 2WSAA 3H5ZA 3JTKA 4A95A 4CAFA 4CYNA 4CGPA 4CGNA 4CYQA 5G20A 4CGOA 4C68A 5A28A 2WUUA 4B10A 2YNCA 4CGMA 4B11A 4B13A 4A2ZA 5AGEA 4CGLA 4CYPA 4C2ZA 4UFVA 4C7HA 4B14A 4UCMA 4UFXA 5G22A 5A27A 4BBHA 2YNDA 4A31A 2YNCC 4C2XA 3IU2A 4UFWA
chains in the Genus database with same CATH superfamily
2P6FA 2POKA 2O53A 3PGPA 2V8HA 1XOVA 1XF8A 4MHNA 4OP4A 4Q38A 4NEXA 5C82A 2CIJA 3D2MA 3JUWA 2EO8A 3WR7A 2EVNA 3KR5A 3PB8X 3EC4A 4B12A 2BUEA 3B3VA 3GKRA 4M6IA 3JTKA 3BLNA 2ZOGA 2Q7SA 4OC3A 1NMTA 3FIXA 3FYNA 1YW6A 4WJBA 4C68A 1M4IA 4B10A 2PJ4A 2YNCA 4Y49B 1BO4A 4B11A 4F6AA 4OC2A 2CF4A 2BOAA 2GLFA 3CDXA 2PJ3A 3LACA 4UCMA 4MFJA 1X10A 1NSLA 2IQ6A 2FVGA 1AUGA 3A9LA 3CPXA 3I1UA 3SXOA 1BOBA 2AFXA 5IV0A 1K4JA 2PIYA 4UCNA 1V0CA 2HC9A 3T8WA 3TFYA 4R76A 4OC4A 2R1IA 5FVJA 1RXTA 5LYFA 3IWWA 2I79A 2C27A 4UEFA 1WWZA 4PPZA 4YU9A 1P0HA 5J1QA 3LWUA 1R3NA 3DGVA 3KGQA 4NGTA 5HMNA 5G20A 1M1DA 2AFOA 2Z11A 3B3CA 1CP6A 4ONUA 3FEEA 3LMSA 4FBEA 1XEBA 3DDDA 1KUYA 1XFOA 2PQ8A 3PB9X 3SI1A 4PXCA 2NSMA 4MFLA 2JBJA 4M3SA 4MBUA 3ISXA 4B5PB 1QSMA 4UFWA 3PB6X 3PP9A 3W91A 1CG2A 2D4OA 4MI4A 4RI1A 5AG7A 4DUKA 4CRYB 1YMEA 2B4BA 4NGSA 2B3UA 2WYRA 3TCVA 1EE3P 2V8VA 2WZNA 4HKFA 3EO4A 2GANA 3S9NA 5CPAA 4CYOA 4PXEA 3SJXA 2REFA 3IJ3A 2C6CA 4B6ZA 1Y0RA 1PYTB 3GY9A 4XNHC 1ARLA 4MCRA 2Q51A 2AFMA 2GFQA 4XPKA 1Q2DA 1RTQA 4FUUA 4NJRA 4ZY2A 2ZENA 3BI0A 3CZXA 5CBMA 2PRQA 4OC5A 4B13A 3KHXA 3PFOA 4CYPA 5BWAB 3BJ8A 3SJGA 4KOVA 2DPTA 4C7HA 2ZEOA 1S5KA 4ZY1A 4K3NA 1IIDA 2PJ9A 4F8ZA 5D29A 3R9GA 2QMLA 3S6KA 3KHZA 4RN7A 1YQEA 4NGMA 3SJEA 4B5OA 1MJ9A 3SI0A 4A30A 1CBXA 3B2YA 5AG6A 1IY7A 2V8DA 3V8IA 1VHSA 2CTBA 4AG7A 5DWNA 4ONWA 4MJ8A 2G0BA 4CAEA 4KSIA 1OBRA 1QSRA 4PV6A 3K9TA 4F0YA 2QJ8A 4MRIA 1QQ9A 1TF8A 3D67A 2GIVA 3PB7X 4KUBA 2B4DB 3NE7A 2K5TA 4M6GA 4AVAA 2G3AA 1LOKA 3CT9A 2J8RA 3F0AA 3KZWA 5AGEA 4CGLA 4F9VA 2ODFA 2Z3NA 4KUAA 5F46A 1ON0A 2I00A 2PJAA 3B8GA 4MHPA 2ATRA 2YNDA 2O4HA 1ZLHA 2OOTA 2ZW7A 1ARMA 4II9A 2WPWA 1YSJA 4P4EA 4GM5A 4KSAA 4A37A 4P4FA 4A33A 4CS0B 4NFRA 3S9MA 3IWEA 1J4JA 2OR4A 3BXMA 3I3GA 3IGRA 2OU2A 4UBRA 2YNEA 4HPSA 3PZJA 3HLPA 1Z8TA 2WSAA 3F5BA 3KR4A 3S9LA 4B5PA 2PCUA 1XE4A 3DSBA 4BINA 5LRGA 2AJ6A 4CYQA 4Q36A 4CAWA 2PVWA 4Q7AA 4NJQA 4CRZB 1TKJA 1ZG8A 2Y0MA 4MFKA 3FJUA 2VL1A 1HEEA 2R98A 2FT0A 2VEZA 2ZELA 3OWCA 2WPXA 2R7HA 4CGMA 4DJLA 1YLOA 5IB0A 2RB7A 7CPAA 1S7KA 2QECA 4U5YA 2EK9A 4KZTA 5THWA 2FS5A 2B5GB 1YVKA 3EY5A 5HH1A 1Z5RA 4U9ZA 3DLJA 2HUZA 1R57A 2ARHA 4OKOA 4C7IA 3R9EA 4R3LA 3D7HA 2VZZA 1NSAA 3D7GA 3PB4X 2PIZA 2Z3MA 4IAVA 4KVXA 1Q2YA 4X2TA 4FAIA 3HUVA 5K8NA 5KTDA 3FRMA 3P2FA 4R87A 1I21A 2ABZA 3D2PA 3B3SA 5HVFA 2ZEPA 1IGBA 1MJAA 4OAEA 3PBBA 1GYTA 1Q7LA 3IIBA 3RZAA 4YGOA 5DWMA 5F47A 1JWQA 1QSTA 2H5MA 3B3TA 5A28A 4R9MA 3T90A 3TOBA 2HV2A 4FD7A 4X3RA 2ZEFA 1Y7RA 2PJ8A 4G1PA 4QC6A 1F57A 2DF5A 4B14A 4NSQA 5EC4A 2O28A 3C26A 4E0AA 5LRKA 5HVGA 1NE9A 4KOWA 4UWJA 2YNCC 1CX8A 1RO5A 1Z8LA 4DYOA 2B3VA 4A32A 2B4DA 2IL4A 1BPNA 2KCWA 3W6SA 3PBEA 4NF1A 3FECA 1VIXA 4M85A 2D4PA 1XMTA 2JEWA 4CAXA 1VGYA 4ZGYB 1OZPA 4XPLA 2YGWA 2BO9A 3QB8A 4MFQA 3D68A 4CGPA 2Z10A 3FXTA 1SQHA 3GYAA 1VKCA 4QB9A 4MMOA 2HB6A 2OZGA 2CNTA 2CNMA 3CXPA 2CNSA 1M4DA 3MRUA 3S6GA 1UWYA 5JGFA 1AYEA 3WC7A 2J8MA 3H8EA 1YR0A 2VZYA 5I0CA 3RBUA 4BBHA 4E2AA 3R9FA 1S3ZA 1PUAA 3BI1A 4KVOE 4ZY0A 4UF4A 3IC1A 4IHMA 4JXQA 4ORFA 2ZEGA 5J8CA 3R96A 2Z3KA 1PU9A 1BLLE 3IU1A 4UWIA 2Q44A 4PK3A 2PVVA 4WWVA 2B5GA 3GLJA 4P45A 5G1ZA 3H8GA 4NGPA 5LRJA 1S7LA 4CYNA 4FD4A 4XPDB 1QMUA 1QSNA 4H6ZA 4IK2A 3N5FA 5K8MA 3V7ZA 2CY2A 1HDQA 1U6MA 1KUXA 1KZFA 2B58A 2PJ6A 4NGRA 3D66A 4EMEA 1ELLP 1KUVA 3EXNA 3MGDA 3N7ZA 3BJ7A 3QAHA 2RC4A 3TX8A 5H86A 2PDOA 1XIXA 3FX6A 4H2KA 8CPAA 1XJOA 4K30A 5JPHA 2Q43A 1BPMA 2PJ5A 2PC1A 2OZUA 4C2YA 2ZEMA 3TO9A 3D8PA 1I12A 4DNCA 3KI9A 4A94A 4OLLA 2Z3PA 2C6GA 3ZJ0A 2FL4A 4ZX9A 4Y49C 4L8AA 4YWYA 4KOSA 4CGOA 2PJBA 3SJFA 3D3SA 3I9SA 2ZEEA 4OC0A 1ZG9A 2EBJA 4MFZA 1GHEA 1YREA 2GU2A 4MHDA 4MCSA 4QUSA 2FCKA 4UFXA 4AG9A 3QAYA 5D8NA 1YK3A 1BAVA 2GREA 1F2PA 1IU8A 3MN8A 4GXHA 3UY5A 3H8FA 3VWEA 4OIWA 2RFHA 2JDDA 2Z3OA 4F0XA 1M44A 2ZEHA 4QBJA 1R43A 1DTDA 2F8HA 1ZLIA 4NXYA 3SXNA 4HNXB 2ZXVA 2G9DA 3D4UA 3KQXA 4NCZA 4R6TA 3PRTA 4IF5A 3ZZIA 2GE3A 2XEGA 4R7MA 3FVLA 3RAMA 3TC8A 2NYQA 4ZX8A 1S7NA 4HNYB 3EFAA 5I4MA 2G3TA 1PCAA 2Q4YA 1M4LA 2FXFA 1IYKA 1IICA 5C88A 6CPAA 1Y7EA 2DXQA 5HXDA 3IWGA 1Y9KA 1QSOA 3WABA 4JXRA 2FIAA 3WT4A 3IEHA 1IOFA 2FE7A 2PJ2A 2PSWA 3NH5A 4AXVA 1TXRA 3G8WA 4P4DA 5H84A 5F09A 4RUHA 2OZHA 2QIRA 3CXSA 2EWBA 3D7FA 5EBVA 2Q04A 2J8NA 5F49A 2NMTA 3ISZA 2AFUA 1VHEA 3FB3A 1Z2LA 1XMBA 3L2NA 1TIQA 3FMCA 4PSXA 2CTCA 4NGQA 2P6EA 2QYVA 3FF3A 1LAMA 1LCPA 4R8FA 4PK2A 3RNZA 1ZG7A 3KQZA 4UEZA 4XNHB 4MY0A 4PSWA 3SHPA 2HQYA 4PXDA 4KLWA 4CPAA 4H6UA 1MJBA 3CXQA 1XBUA 3KASA 3TE4A 1IYLA 2Q4ZA 3B7IA 2BSWA 4KLVA 4MCPA 4OC1A 5JQ4A 2C6PA 4A31A 1Y0YA 2P0WA 2P6GA 3IU2A 5AG5A 1H8LA 3VH9A 4MFPA 5LYLA 3GUXA 2PJ1A 3FBUA 3DR8A 4P6YA 4CAVA 5AG4A 3FEDA 1JQGA 4MXUA 3B3WA 2PJ0A 4KOUA 3QNVA 2Z0ZA 4LQ6A 1CPXA 4TWEA 3P2HA 1B87A 5DS0A 2PE3A 2DEAA 4KOXA 4BD9A 4CGNA 1S7FA 2QVPA 5K8PA 2Q4VA 4YRHA 5IX3A 1HDUA 3DR6A 2F5IA 4W9YA 3TT2A 4ZBGA 5ISVA 1FY7A 3NA6A 5CNPA 4P44A 1Z4EA 1IOIA 5G22A 5A27A 2Q0YA 1UFHA 3LD2A 2EUIA 3JVNA 4R57A 4YFJA 5LYDA 1YW4A 2EK8A 2VI7A 3K9UA 4UIBA 5K8OA 4ZI6A 2BCOA 4H89A 4IUSA 1LFWA 3SI2A 3TO7A 4ZYQA 5KTCA 4TNUA 4A95A 4UIAA 2AFZA 1CPSA 1L0CA 4L89A 2AFSA 3GB0A 2REEA 3E0KA 2ZPAA 5J8FA 2C1CA 2WUUA 5HVHA 1ELMP 4PXBA 4P10A 2F7VA 2VQYA 4HNWB 5E96A 1TF9A 4GS4A 4A2ZA 4BMHA 1A2ZA 4J3GA 4C2ZA 4UFVA 2VBQA 3TOAA 1LANA 2X7BA 3D7DA 4UEEA 2Q7BA 3PFEA 1I1DA 1Z8XA 4LUAA 2ZW6A 1S60A 3F8KA 4UCPA 4JZ0A 5G21A 2ZOFA 1MK4A 4Z65A 4KVME 2V77A 4X8IA 2FSRA 2ANPA 5KTAA 1M4GA 3NE8A 4MY3A 3TO6A 1Q2CA 2A4NA 4KSFA 3H5ZA 3VWDA 2AFWA 3IO1A 2IMOA 2OH1A 4LQGA 4MCQA 4R3KA 5LYIA 4F9UA 1F2OA 4U9YA 5GCNA 1CM0A 1P4NA 2JEVA 2PR8A 2AE6A 4KS9A 3IFEA 3NH4A 3WC6A 3BHXA 3FH4A 2VXKA 3R1KA 2JDCA 4A39A 3VATA 3JRUA 4FD5A 3CPAA 1AMPA 4E8OA 2PR1A 3NFZA 3H4QA 4QVTA 4JWPA 2I3CA 3K2KA 1YVOA 2XEFA 4KOTA 4MHYA 4AVBA 1TKHA 1CP7A 1X12A 2R8VA 3DNSA 4NGNA 3S6FA 2DPSA 1KWMA 3T9YA 3WC5A 1CJWA 1N71A 2BL1A 4EFDA 5IB9A 4MHZA 3KKWA 2OB0A 1Z4RA 4M6HA 3S6HA 3G3SA 1YX0A 4O23A 5ELYA 4OMEA 2PJ7A 1Y9WA 2ZW4A 4AVCA 4KORA 4JLYA 2CXAA 4FD6A 2ZW5A 1TKFA 2V8GA 3GIUA 3NH8A 4P4BA 1FNOA 4KOYA 1DE4C 4OIDA 4C2XA 2Z3LA 5JM6A 1LAPA 2FIWA 3LODA 1ZO0A 2ZEDA 1FT7A 4X5KA 4JYWA 3VARA 4XPDC 1IB1E 2GLJA 5JH9A 3V38A 4A38A 1LRZA 3W6XA 4CAFA 3FNCA 1VHOA 4OADA 4EWTA 3RYOA 4JD6A 4FWUA 1Z8WA 3KL9A 1B6BA 4EVYA 2PJCA 4LX9A 4P4JA 2PRBA 3PEIA 4UA3A 1WK4A 1XRYA 1YGHA 2J9AA 2XEIA 3B35A 4P4IA 3RO0A 2BEIA 2XEJA 4PQAA 5F48A 3TTHA 4AB7A 4I49A 1Z9UA 5EMIA 2JLMA 2IJZA 1YLEA 2JBKA 4RS2A 4JJXA 3R95A
chains in the Genus database with same CATH topology
2P6FA 3PGPA 4Q38A 1XF8A 4NEXA 5C82A 3D2MA 3JUWA 3WR7A 2EVNA 3EC4A 4B12A 2BUEA 3GKRA 3JTKA 3BLNA 1NMTA 3FIXA 3FYNA 4C68A 1M4IA 4B10A 2YNCA 4Y49B 1BO4A 4B11A 4F6AA 4UCMA 4MFJA 1NSLA 3A9LA 3SXOA 1BOBA 5IV0A 1K4JA 4UCNA 1V0CA 3TFYA 2R1IA 5FVJA 1RXTA 2I79A 2C27A 1WWZA 1P0HA 5HMNA 5G20A 1M1DA 2Z11A 4ONUA 1XEBA 3DDDA 1KUYA 2PQ8A 4MFLA 4M3SA 4MBUA 4B5PB 1QSMA 4UFWA 3PP9A 3W91A 2D4OA 4MI4A 4RI1A 5AG7A 4CRYB 2B4BA 2B3UA 3TCVA 4HKFA 3EO4A 2GANA 4CYOA 2REFA 3GY9A 4XNHC 4XPKA 1Q2DA 4B13A 4CYPA 5BWAB 3BJ8A 4KOVA 2DPTA 4C7HA 1S5KA 1IIDA 3R9GA 2QMLA 3S6KA 4B5OA 1MJ9A 4A30A 5AG6A 3V8IA 1VHSA 4AG7A 5DWNA 4MJ8A 2G0BA 4CAEA 1QSRA 4PV6A 4F0YA 2GIVA 4KUBA 2B4DB 3NE7A 2K5TA 4AVAA 2G3AA 3F0AA 2J8RA 4CGLA 5AGEA 2Z3NA 4KUAA 5F46A 1ON0A 2I00A 3B8GA 2ATRA 2YNDA 2ZW7A 4II9A 2WPWA 4KSAA 4A33A 4CS0B 3IWEA 1J4JA 3I3GA 3IGRA 2OU2A 4UBRA 2YNEA 3PZJA 2WSAA 3F5BA 4B5PA 1XE4A 3DSBA 2AJ6A 4CYQA 4Q36A 4CAWA 4CRZB 2Y0MA 4MFKA 2R98A 2FT0A 2VEZA 3OWCA 4CGMA 2WPXA 2R7HA 5IB0A 1S7KA 2QECA 4U5YA 4KZTA 2FS5A 2B5GB 1YVKA 3EY5A 5HH1A 4U9ZA 2HUZA 1R57A 2ARHA 4C7IA 3R9EA 4R3LA 4KVXA 2VZZA 2Z3MA 5KTDA 1Q2YA 3FRMA 3P2FA 4R87A 1I21A 3D2PA 1MJAA 4OAEA 4YGOA 5DWMA 5F47A 1QSTA 2H5MA 5A28A 4R9MA 3T90A 3TOBA 2HV2A 4FD7A 1Y7RA 4QC6A 4B14A 4NSQA 5EC4A 2O28A 3C26A 4E0AA 1NE9A 4KOWA 4UWJA 2YNCC 1RO5A 2B3VA 4A32A 2B4DA 2IL4A 2KCWA 3W6SA 4NF1A 4M85A 2D4PA 1XMTA 4CAXA 4ZGYB 1OZPA 4XPLA 2YGWA 3QB8A 4MFQA 4CGPA 2Z10A 3FXTA 1SQHA 3GYAA 1VKCA 4QB9A 2OZGA 2CNTA 2CNMA 3CXPA 2CNSA 1M4DA 3S6GA 2J8MA 1YR0A 2VZYA 5I0CA 4BBHA 4E2AA 3R9FA 1S3ZA 1PUAA 4KVOE 4JXQA 4ORFA 5J8CA 3R96A 2Z3KA 1PU9A 3IU1A 4UWIA 2Q44A 4PK3A 2B5GA 5G1ZA 1S7LA 4CYNA 4FD4A 4XPDB 1QSNA 4H6ZA 2CY2A 1U6MA 1KUXA 1KZFA 2B58A 1KUVA 3EXNA 3MGDA 3N7ZA 3BJ7A 3QAHA 2RC4A 5H86A 2PDOA 1XIXA 4K30A 5JPHA 2PC1A 2OZUA 4C2YA 3TO9A 3D8PA 1I12A 4DNCA 4OLLA 2Z3PA 3ZJ0A 2FL4A 4Y49C 4L8AA 4KOSA 4CGOA 3D3SA 3I9SA 4MFZA 1GHEA 1YREA 4MHDA 4QUSA 2FCKA 4UFXA 4AG9A 1YK3A 3UY5A 3VWEA 4F0XA 2JDDA 2Z3OA 4QBJA 1M44A 3SXNA 4NXYA 4HNXB 2ZXVA 4NCZA 3ZZIA 4IF5A 2GE3A 1S7NA 4HNYB 3EFAA 2G3TA 2Q4YA 2FXFA 1IYKA 1IICA 5C88A 2DXQA 3IWGA 1Y9KA 1QSOA 4JXRA 2FIAA 2FE7A 2PSWA 3G8WA 5H84A 2OZHA 2QIRA 3CXSA 5EBVA 2Q04A 2J8NA 5F49A 2NMTA 3FB3A 1TIQA 4PSXA 2P6EA 4PK2A 4XNHB 4MY0A 4PSWA 3SHPA 2HQYA 4KLWA 4H6UA 1MJBA 3CXQA 3TE4A 1IYLA 4KLVA 5JQ4A 2BSWA 4A31A 2P0WA 2P6GA 3IU2A 5AG5A 4MFPA 3FBUA 5AG4A 3DR8A 4CAVA 4KOUA 2Z0ZA 3P2HA 1B87A 4KOXA 4CGNA 1S7FA 2Q4VA 4YRHA 5IX3A 3DR6A 2F5IA 3TT2A 4ZBGA 5ISVA 1FY7A 5CNPA 1Z4EA 5G22A 5A27A 2Q0YA 1UFHA 3LD2A 3JVNA 2EUIA 4R57A 4YFJA 2VI7A 3K9UA 4H89A 4IUSA 3TO7A 5KTCA 4A95A 1L0CA 4L89A 2REEA 3E0KA 2ZPAA 5J8FA 2WUUA 2VQYA 4HNWB 5E96A 4A2ZA 4GS4A 4BMHA 4J3GA 4C2ZA 4UFVA 2VBQA 3TOAA 2X7BA 2Q7BA 1I1DA 4LUAA 2ZW6A 1S60A 3F8KA 4UCPA 5G21A 1MK4A 4KVME 2FSRA 5KTAA 1M4GA 4MY3A 3TO6A 1Q2CA 2A4NA 4KSFA 3H5ZA 3VWDA 2OH1A 4R3KA 4U9YA 5GCNA 1CM0A 1P4NA 2JEVA 2PR8A 2AE6A 4KS9A 2VXKA 3R1KA 2JDCA 4FD5A 4E8OA 2PR1A 3H4QA 4QVTA 4JWPA 1YVOA 4KOTA 4AVBA 2R8VA 3DNSA 3S6FA 2DPSA 3T9YA 1CJWA 1N71A 2BL1A 3KKWA 2OB0A 1Z4RA 3S6HA 3G3SA 1YX0A 1Y9WA 2ZW4A 4AVCA 4KORA 4JLYA 2CXAA 4FD6A 2ZW5A 4KOYA 4C2XA 2Z3LA 3LODA 2FIWA 1ZO0A 4X5KA 4XPDC 1IB1E 4CAFA 1LRZA 3W6XA 3FNCA 4OADA 3RYOA 4JD6A 1B6BA 4EVYA 4LX9A 2PRBA 4UA3A 1WK4A 1YGHA 2BEIA 3TTHA 5F48A 4AB7A 4I49A 1Z9UA 2JLMA 4RS2A 1YLEA 4JJXA 3R95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AG7 A;  4UCP A;  4A32 A;  5AG4 A;  5G21 A;  4C7I A;  4UCN A;  5AG5 A;  4A33 A;  4C2Y A;  4A30 A;  3IU1 A;  3IWE A;  5AG6 A;  2YNE A;  4CYO A;  4B12 A;  5G1Z A;  4CAE A;  2WSA A;  3H5Z A;  3JTK A;  4A95 A;  4CAF A;  4CYN A;  4CGP A;  4CGN A;  4CYQ A;  5G20 A;  4CGO A;  4C68 A;  5A28 A;  2WUU A;  4B10 A;  2YNC A;  4CGM A;  4B11 A;  4B13 A;  4A2Z A;  5AGE A;  4CGL A;  4CYP A;  4C2Z A;  4UFV A;  4C7H A;  4B14 A;  4UCM A;  4UFX A;  5G22 A;  5A27 A;  4BBH A;  2YND A;  4A31 A;  2YNC C;  4C2X A;  3IU2 A;  4UFW A; 
#chains in the Genus database with same CATH topology
 2P6F A;  2POK A;  2O53 A;  3PGP A;  2V8H A;  1XOV A;  1XF8 A;  4MHN A;  4OP4 A;  4Q38 A;  4NEX A;  5C82 A;  2CIJ A;  3D2M A;  3JUW A;  2EO8 A;  3WR7 A;  2EVN A;  3KR5 A;  3PB8 X;  3EC4 A;  4B12 A;  2BUE A;  3B3V A;  3GKR A;  4M6I A;  3JTK A;  3BLN A;  2ZOG A;  2Q7S A;  4OC3 A;  1NMT A;  3FIX A;  3FYN A;  1YW6 A;  4WJB A;  4C68 A;  1M4I A;  4B10 A;  2PJ4 A;  2YNC A;  4Y49 B;  1BO4 A;  4B11 A;  4F6A A;  4OC2 A;  2CF4 A;  2BOA A;  2GLF A;  3CDX A;  2PJ3 A;  3LAC A;  4UCM A;  4MFJ A;  1X10 A;  1NSL A;  2IQ6 A;  2FVG A;  1AUG A;  3A9L A;  3CPX A;  3I1U A;  3SXO A;  1BOB A;  2AFX A;  5IV0 A;  1K4J A;  2PIY A;  4UCN A;  1V0C A;  2HC9 A;  3T8W A;  3TFY A;  4R76 A;  4OC4 A;  2R1I A;  5FVJ A;  1RXT A;  5LYF A;  3IWW A;  2I79 A;  2C27 A;  4UEF A;  1WWZ A;  4PPZ A;  4YU9 A;  1P0H A;  5J1Q A;  3LWU A;  1R3N A;  3DGV A;  3KGQ A;  4NGT A;  5HMN A;  5G20 A;  1M1D A;  2AFO A;  2Z11 A;  3B3C A;  1CP6 A;  4ONU A;  3FEE A;  3LMS A;  4FBE A;  1XEB A;  3DDD A;  1KUY A;  1XFO A;  2PQ8 A;  3PB9 X;  3SI1 A;  4PXC A;  2NSM A;  4MFL A;  2JBJ A;  4M3S A;  4MBU A;  3ISX A;  4B5P B;  1QSM A;  4UFW A;  3PB6 X;  3PP9 A;  3W91 A;  1CG2 A;  2D4O A;  4MI4 A;  4RI1 A;  5AG7 A;  4DUK A;  4CRY B;  1YME A;  2B4B A;  4NGS A;  2B3U A;  2WYR A;  3TCV A;  1EE3 P;  2V8V A;  2WZN A;  4HKF A;  3EO4 A;  2GAN A;  3S9N A;  5CPA A;  4CYO A;  4PXE A;  3SJX A;  2REF A;  3IJ3 A;  2C6C A;  4B6Z A;  1Y0R A;  1PYT B;  3GY9 A;  4XNH C;  1ARL A;  4MCR A;  2Q51 A;  2AFM A;  2GFQ A;  4XPK A;  1Q2D A;  1RTQ A;  4FUU A;  4NJR A;  4ZY2 A;  2ZEN A;  3BI0 A;  3CZX A;  5CBM A;  2PRQ A;  4OC5 A;  4B13 A;  3KHX A;  3PFO A;  4CYP A;  5BWA B;  3BJ8 A;  3SJG A;  4KOV A;  2DPT A;  4C7H A;  2ZEO A;  1S5K A;  4ZY1 A;  4K3N A;  1IID A;  2PJ9 A;  4F8Z A;  5D29 A;  3R9G A;  2QML A;  3S6K A;  3KHZ A;  4RN7 A;  1YQE A;  4NGM A;  3SJE A;  4B5O A;  1MJ9 A;  3SI0 A;  4A30 A;  1CBX A;  3B2Y A;  5AG6 A;  1IY7 A;  2V8D A;  3V8I A;  1VHS A;  2CTB A;  4AG7 A;  5DWN A;  4ONW A;  4MJ8 A;  2G0B A;  4CAE A;  4KSI A;  1OBR A;  1QSR A;  4PV6 A;  3K9T A;  4F0Y A;  2QJ8 A;  4MRI A;  1QQ9 A;  1TF8 A;  3D67 A;  2GIV A;  3PB7 X;  4KUB A;  2B4D B;  3NE7 A;  2K5T A;  4M6G A;  4AVA A;  2G3A A;  1LOK A;  3CT9 A;  2J8R A;  3F0A A;  3KZW A;  5AGE A;  4CGL A;  4F9V A;  2ODF A;  2Z3N A;  4KUA A;  5F46 A;  1ON0 A;  2I00 A;  2PJA A;  3B8G A;  4MHP A;  2ATR A;  2YND A;  2O4H A;  1ZLH A;  2OOT A;  2ZW7 A;  1ARM A;  4II9 A;  2WPW A;  1YSJ A;  4P4E A;  4GM5 A;  4KSA A;  4A37 A;  4P4F A;  4A33 A;  4CS0 B;  4NFR A;  3S9M A;  3IWE A;  1J4J A;  2OR4 A;  3BXM A;  3I3G A;  3IGR A;  2OU2 A;  4UBR A;  2YNE A;  4HPS A;  3PZJ A;  3HLP A;  1Z8T A;  2WSA A;  3F5B A;  3KR4 A;  3S9L A;  4B5P A;  2PCU A;  1XE4 A;  3DSB A;  4BIN A;  5LRG A;  2AJ6 A;  4CYQ A;  4Q36 A;  4CAW A;  2PVW A;  4Q7A A;  4NJQ A;  4CRZ B;  1TKJ A;  1ZG8 A;  2Y0M A;  4MFK A;  3FJU A;  2VL1 A;  1HEE A;  2R98 A;  2FT0 A;  2VEZ A;  2ZEL A;  3OWC A;  2WPX A;  2R7H A;  4CGM A;  4DJL A;  1YLO A;  5IB0 A;  2RB7 A;  7CPA A;  1S7K A;  2QEC A;  4U5Y A;  2EK9 A;  4KZT A;  5THW A;  2FS5 A;  2B5G B;  1YVK A;  3EY5 A;  5HH1 A;  1Z5R A;  4U9Z A;  3DLJ A;  2HUZ A;  1R57 A;  2ARH A;  4OKO A;  4C7I A;  3R9E A;  4R3L A;  3D7H A;  2VZZ A;  1NSA A;  3D7G A;  3PB4 X;  2PIZ A;  2Z3M A;  4IAV A;  4KVX A;  1Q2Y A;  4X2T A;  4FAI A;  3HUV A;  5K8N A;  5KTD A;  3FRM A;  3P2F A;  4R87 A;  1I21 A;  2ABZ A;  3D2P A;  3B3S A;  5HVF A;  2ZEP A;  1IGB A;  1MJA A;  4OAE A;  3PBB A;  1GYT A;  1Q7L A;  3IIB A;  3RZA A;  4YGO A;  5DWM A;  5F47 A;  1JWQ A;  1QST A;  2H5M A;  3B3T A;  5A28 A;  4R9M A;  3T90 A;  3TOB A;  2HV2 A;  4FD7 A;  4X3R A;  2ZEF A;  1Y7R A;  2PJ8 A;  4G1P A;  4QC6 A;  1F57 A;  2DF5 A;  4B14 A;  4NSQ A;  5EC4 A;  2O28 A;  3C26 A;  4E0A A;  5LRK A;  5HVG A;  1NE9 A;  4KOW A;  4UWJ A;  2YNC C;  1CX8 A;  1RO5 A;  1Z8L A;  4DYO A;  2B3V A;  4A32 A;  2B4D A;  2IL4 A;  1BPN A;  2KCW A;  3W6S A;  3PBE A;  4NF1 A;  3FEC A;  1VIX A;  4M85 A;  2D4P A;  1XMT A;  2JEW A;  4CAX A;  1VGY A;  4ZGY B;  1OZP A;  4XPL A;  2YGW A;  2BO9 A;  3QB8 A;  4MFQ A;  3D68 A;  4CGP A;  2Z10 A;  3FXT A;  1SQH A;  3GYA A;  1VKC A;  4QB9 A;  4MMO A;  2HB6 A;  2OZG A;  2CNT A;  2CNM A;  3CXP A;  2CNS A;  1M4D A;  3MRU A;  3S6G A;  1UWY A;  5JGF A;  1AYE A;  3WC7 A;  2J8M A;  3H8E A;  1YR0 A;  2VZY A;  5I0C A;  3RBU A;  4BBH A;  4E2A A;  3R9F A;  1S3Z A;  1PUA A;  3BI1 A;  4KVO E;  4ZY0 A;  4UF4 A;  3IC1 A;  4IHM A;  4JXQ A;  4ORF A;  2ZEG A;  5J8C A;  3R96 A;  2Z3K A;  1PU9 A;  1BLL E;  3IU1 A;  4UWI A;  2Q44 A;  4PK3 A;  2PVV A;  4WWV A;  2B5G A;  3GLJ A;  4P45 A;  5G1Z A;  3H8G A;  4NGP A;  5LRJ A;  1S7L A;  4CYN A;  4FD4 A;  4XPD B;  1QMU A;  1QSN A;  4H6Z A;  4IK2 A;  3N5F A;  5K8M A;  3V7Z A;  2CY2 A;  1HDQ A;  1U6M A;  1KUX A;  1KZF A;  2B58 A;  2PJ6 A;  4NGR A;  3D66 A;  4EME A;  1ELL P;  1KUV A;  3EXN A;  3MGD A;  3N7Z A;  3BJ7 A;  3QAH A;  2RC4 A;  3TX8 A;  5H86 A;  2PDO A;  1XIX A;  3FX6 A;  4H2K A;  8CPA A;  1XJO A;  4K30 A;  5JPH A;  2Q43 A;  1BPM A;  2PJ5 A;  2PC1 A;  2OZU A;  4C2Y A;  2ZEM A;  3TO9 A;  3D8P A;  1I12 A;  4DNC A;  3KI9 A;  4A94 A;  4OLL A;  2Z3P A;  2C6G A;  3ZJ0 A;  2FL4 A;  4ZX9 A;  4Y49 C;  4L8A A;  4YWY A;  4KOS A;  4CGO A;  2PJB A;  3SJF A;  3D3S A;  3I9S A;  2ZEE A;  4OC0 A;  1ZG9 A;  2EBJ A;  4MFZ A;  1GHE A;  1YRE A;  2GU2 A;  4MHD A;  4MCS A;  4QUS A;  2FCK A;  4UFX A;  4AG9 A;  3QAY A;  5D8N A;  1YK3 A;  1BAV A;  2GRE A;  1F2P A;  1IU8 A;  3MN8 A;  4GXH A;  3UY5 A;  3H8F A;  3VWE A;  4OIW A;  2RFH A;  2JDD A;  2Z3O A;  4F0X A;  1M44 A;  2ZEH A;  4QBJ A;  1R43 A;  1DTD A;  2F8H A;  1ZLI A;  4NXY A;  3SXN A;  4HNX B;  2ZXV A;  2G9D A;  3D4U A;  3KQX A;  4NCZ A;  4R6T A;  3PRT A;  4IF5 A;  3ZZI A;  2GE3 A;  2XEG A;  4R7M A;  3FVL A;  3RAM A;  3TC8 A;  2NYQ A;  4ZX8 A;  1S7N A;  4HNY B;  3EFA A;  5I4M A;  2G3T A;  1PCA A;  2Q4Y A;  1M4L A;  2FXF A;  1IYK A;  1IIC A;  5C88 A;  6CPA A;  1Y7E A;  2DXQ A;  5HXD A;  3IWG A;  1Y9K A;  1QSO A;  3WAB A;  4JXR A;  2FIA A;  3WT4 A;  3IEH A;  1IOF A;  2FE7 A;  2PJ2 A;  2PSW A;  3NH5 A;  4AXV A;  1TXR A;  3G8W A;  4P4D A;  5H84 A;  5F09 A;  4RUH A;  2OZH A;  2QIR A;  3CXS A;  2EWB A;  3D7F A;  5EBV A;  2Q04 A;  2J8N A;  5F49 A;  2NMT A;  3ISZ A;  2AFU A;  1VHE A;  3FB3 A;  1Z2L A;  1XMB A;  3L2N A;  1TIQ A;  3FMC A;  4PSX A;  2CTC A;  4NGQ A;  2P6E A;  2QYV A;  3FF3 A;  1LAM A;  1LCP A;  4R8F A;  4PK2 A;  3RNZ A;  1ZG7 A;  3KQZ A;  4UEZ A;  4XNH B;  4MY0 A;  4PSW A;  3SHP A;  2HQY A;  4PXD A;  4KLW A;  4CPA A;  4H6U A;  1MJB A;  3CXQ A;  1XBU A;  3KAS A;  3TE4 A;  1IYL A;  2Q4Z A;  3B7I A;  2BSW A;  4KLV A;  4MCP A;  4OC1 A;  5JQ4 A;  2C6P A;  4A31 A;  1Y0Y A;  2P0W A;  2P6G A;  3IU2 A;  5AG5 A;  1H8L A;  3VH9 A;  4MFP A;  5LYL A;  3GUX A;  2PJ1 A;  3FBU A;  3DR8 A;  4P6Y A;  4CAV A;  5AG4 A;  3FED A;  1JQG A;  4MXU A;  3B3W A;  2PJ0 A;  4KOU A;  3QNV A;  2Z0Z A;  4LQ6 A;  1CPX A;  4TWE A;  3P2H A;  1B87 A;  5DS0 A;  2PE3 A;  2DEA A;  4KOX A;  4BD9 A;  4CGN A;  1S7F A;  2QVP A;  5K8P A;  2Q4V A;  4YRH A;  5IX3 A;  1HDU A;  3DR6 A;  2F5I A;  4W9Y A;  3TT2 A;  4ZBG A;  5ISV A;  1FY7 A;  3NA6 A;  5CNP A;  4P44 A;  1Z4E A;  1IOI A;  5G22 A;  5A27 A;  2Q0Y A;  1UFH A;  3LD2 A;  2EUI A;  3JVN A;  4R57 A;  4YFJ A;  5LYD A;  1YW4 A;  2EK8 A;  2VI7 A;  3K9U A;  4UIB A;  5K8O A;  4ZI6 A;  2BCO A;  4H89 A;  4IUS A;  1LFW A;  3SI2 A;  3TO7 A;  4ZYQ A;  5KTC A;  4TNU A;  4A95 A;  4UIA A;  2AFZ A;  1CPS A;  1L0C A;  4L89 A;  2AFS A;  3GB0 A;  2REE A;  3E0K A;  2ZPA A;  5J8F A;  2C1C A;  2WUU A;  5HVH A;  1ELM P;  4PXB A;  4P10 A;  2F7V A;  2VQY A;  4HNW B;  5E96 A;  1TF9 A;  4GS4 A;  4A2Z A;  4BMH A;  1A2Z A;  4J3G A;  4C2Z A;  4UFV A;  2VBQ A;  3TOA A;  1LAN A;  2X7B A;  3D7D A;  4UEE A;  2Q7B A;  3PFE A;  1I1D A;  1Z8X A;  4LUA A;  2ZW6 A;  1S60 A;  3F8K A;  4UCP A;  4JZ0 A;  5G21 A;  2ZOF A;  1MK4 A;  4Z65 A;  4KVM E;  2V77 A;  4X8I A;  2FSR A;  2ANP A;  5KTA A;  1M4G A;  3NE8 A;  4MY3 A;  3TO6 A;  1Q2C A;  2A4N A;  4KSF A;  3H5Z A;  3VWD A;  2AFW A;  3IO1 A;  2IMO A;  2OH1 A;  4LQG A;  4MCQ A;  4R3K A;  5LYI A;  4F9U A;  1F2O A;  4U9Y A;  5GCN A;  1CM0 A;  1P4N A;  2JEV A;  2PR8 A;  2AE6 A;  4KS9 A;  3IFE A;  3NH4 A;  3WC6 A;  3BHX A;  3FH4 A;  2VXK A;  3R1K A;  2JDC A;  4A39 A;  3VAT A;  3JRU A;  4FD5 A;  3CPA A;  1AMP A;  4E8O A;  2PR1 A;  3NFZ A;  3H4Q A;  4QVT A;  4JWP A;  2I3C A;  3K2K A;  1YVO A;  2XEF A;  4KOT A;  4MHY A;  4AVB A;  1TKH A;  1CP7 A;  1X12 A;  2R8V A;  3DNS A;  4NGN A;  3S6F A;  2DPS A;  1KWM A;  3T9Y A;  3WC5 A;  1CJW A;  1N71 A;  2BL1 A;  4EFD A;  5IB9 A;  4MHZ A;  3KKW A;  2OB0 A;  1Z4R A;  4M6H A;  3S6H A;  3G3S A;  1YX0 A;  4O23 A;  5ELY A;  4OME A;  2PJ7 A;  1Y9W A;  2ZW4 A;  4AVC A;  4KOR A;  4JLY A;  2CXA A;  4FD6 A;  2ZW5 A;  1TKF A;  2V8G A;  3GIU A;  3NH8 A;  4P4B A;  1FNO A;  4KOY A;  1DE4 C;  4OID A;  4C2X A;  2Z3L A;  5JM6 A;  1LAP A;  2FIW A;  3LOD A;  1ZO0 A;  2ZED A;  1FT7 A;  4X5K A;  4JYW A;  3VAR A;  4XPD C;  1IB1 E;  2GLJ A;  5JH9 A;  3V38 A;  4A38 A;  1LRZ A;  3W6X A;  4CAF A;  3FNC A;  1VHO A;  4OAD A;  4EWT A;  3RYO A;  4JD6 A;  4FWU A;  1Z8W A;  3KL9 A;  1B6B A;  4EVY A;  2PJC A;  4LX9 A;  4P4J A;  2PRB A;  3PEI A;  4UA3 A;  1WK4 A;  1XRY A;  1YGH A;  2J9A A;  2XEI A;  3B35 A;  4P4I A;  3RO0 A;  2BEI A;  2XEJ A;  4PQA A;  5F48 A;  3TTH A;  4AB7 A;  4I49 A;  1Z9U A;  5EMI A;  2JLM A;  2IJZ A;  1YLE A;  2JBK A;  4RS2 A;  4JJX A;  3R95 A; 
#chains in the Genus database with same CATH homology
 2P6F A;  3PGP A;  4Q38 A;  1XF8 A;  4NEX A;  5C82 A;  3D2M A;  3JUW A;  3WR7 A;  2EVN A;  3EC4 A;  4B12 A;  2BUE A;  3GKR A;  3JTK A;  3BLN A;  1NMT A;  3FIX A;  3FYN A;  4C68 A;  1M4I A;  4B10 A;  2YNC A;  4Y49 B;  1BO4 A;  4B11 A;  4F6A A;  4UCM A;  4MFJ A;  1NSL A;  3A9L A;  3SXO A;  1BOB A;  5IV0 A;  1K4J A;  4UCN A;  1V0C A;  3TFY A;  2R1I A;  5FVJ A;  1RXT A;  2I79 A;  2C27 A;  1WWZ A;  1P0H A;  5HMN A;  5G20 A;  1M1D A;  2Z11 A;  4ONU A;  1XEB A;  3DDD A;  1KUY A;  2PQ8 A;  4MFL A;  4M3S A;  4MBU A;  4B5P B;  1QSM A;  4UFW A;  3PP9 A;  3W91 A;  2D4O A;  4MI4 A;  4RI1 A;  5AG7 A;  4CRY B;  2B4B A;  2B3U A;  3TCV A;  4HKF A;  3EO4 A;  2GAN A;  4CYO A;  2REF A;  3GY9 A;  4XNH C;  4XPK A;  1Q2D A;  4B13 A;  4CYP A;  5BWA B;  3BJ8 A;  4KOV A;  2DPT A;  4C7H A;  1S5K A;  1IID A;  3R9G A;  2QML A;  3S6K A;  4B5O A;  1MJ9 A;  4A30 A;  5AG6 A;  3V8I A;  1VHS A;  4AG7 A;  5DWN A;  4MJ8 A;  2G0B A;  4CAE A;  1QSR A;  4PV6 A;  4F0Y A;  2GIV A;  4KUB A;  2B4D B;  3NE7 A;  2K5T A;  4AVA A;  2G3A A;  3F0A A;  2J8R A;  4CGL A;  5AGE A;  2Z3N A;  4KUA A;  5F46 A;  1ON0 A;  2I00 A;  3B8G A;  2ATR A;  2YND A;  2ZW7 A;  4II9 A;  2WPW A;  4KSA A;  4A33 A;  4CS0 B;  3IWE A;  1J4J A;  3I3G A;  3IGR A;  2OU2 A;  4UBR A;  2YNE A;  3PZJ A;  2WSA A;  3F5B A;  4B5P A;  1XE4 A;  3DSB A;  2AJ6 A;  4CYQ A;  4Q36 A;  4CAW A;  4CRZ B;  2Y0M A;  4MFK A;  2R98 A;  2FT0 A;  2VEZ A;  3OWC A;  4CGM A;  2WPX A;  2R7H A;  5IB0 A;  1S7K A;  2QEC A;  4U5Y A;  4KZT A;  2FS5 A;  2B5G B;  1YVK A;  3EY5 A;  5HH1 A;  4U9Z A;  2HUZ A;  1R57 A;  2ARH A;  4C7I A;  3R9E A;  4R3L A;  4KVX A;  2VZZ A;  2Z3M A;  5KTD A;  1Q2Y A;  3FRM A;  3P2F A;  4R87 A;  1I21 A;  3D2P A;  1MJA A;  4OAE A;  4YGO A;  5DWM A;  5F47 A;  1QST A;  2H5M A;  5A28 A;  4R9M A;  3T90 A;  3TOB A;  2HV2 A;  4FD7 A;  1Y7R A;  4QC6 A;  4B14 A;  4NSQ A;  5EC4 A;  2O28 A;  3C26 A;  4E0A A;  1NE9 A;  4KOW A;  4UWJ A;  2YNC C;  1RO5 A;  2B3V A;  4A32 A;  2B4D A;  2IL4 A;  2KCW A;  3W6S A;  4NF1 A;  4M85 A;  2D4P A;  1XMT A;  4CAX A;  4ZGY B;  1OZP A;  4XPL A;  2YGW A;  3QB8 A;  4MFQ A;  4CGP A;  2Z10 A;  3FXT A;  1SQH A;  3GYA A;  1VKC A;  4QB9 A;  2OZG A;  2CNT A;  2CNM A;  3CXP A;  2CNS A;  1M4D A;  3S6G A;  2J8M A;  1YR0 A;  2VZY A;  5I0C A;  4BBH A;  4E2A A;  3R9F A;  1S3Z A;  1PUA A;  4KVO E;  4JXQ A;  4ORF A;  5J8C A;  3R96 A;  2Z3K A;  1PU9 A;  3IU1 A;  4UWI A;  2Q44 A;  4PK3 A;  2B5G A;  5G1Z A;  1S7L A;  4CYN A;  4FD4 A;  4XPD B;  1QSN A;  4H6Z A;  2CY2 A;  1U6M A;  1KUX A;  1KZF A;  2B58 A;  1KUV A;  3EXN A;  3MGD A;  3N7Z A;  3BJ7 A;  3QAH A;  2RC4 A;  5H86 A;  2PDO A;  1XIX A;  4K30 A;  5JPH A;  2PC1 A;  2OZU A;  4C2Y A;  3TO9 A;  3D8P A;  1I12 A;  4DNC A;  4OLL A;  2Z3P A;  3ZJ0 A;  2FL4 A;  4Y49 C;  4L8A A;  4KOS A;  4CGO A;  3D3S A;  3I9S A;  4MFZ A;  1GHE A;  1YRE A;  4MHD A;  4QUS A;  2FCK A;  4UFX A;  4AG9 A;  1YK3 A;  3UY5 A;  3VWE A;  4F0X A;  2JDD A;  2Z3O A;  4QBJ A;  1M44 A;  3SXN A;  4NXY A;  4HNX B;  2ZXV A;  4NCZ A;  3ZZI A;  4IF5 A;  2GE3 A;  1S7N A;  4HNY B;  3EFA A;  2G3T A;  2Q4Y A;  2FXF A;  1IYK A;  1IIC A;  5C88 A;  2DXQ A;  3IWG A;  1Y9K A;  1QSO A;  4JXR A;  2FIA A;  2FE7 A;  2PSW A;  3G8W A;  5H84 A;  2OZH A;  2QIR A;  3CXS A;  5EBV A;  2Q04 A;  2J8N A;  5F49 A;  2NMT A;  3FB3 A;  1TIQ A;  4PSX A;  2P6E A;  4PK2 A;  4XNH B;  4MY0 A;  4PSW A;  3SHP A;  2HQY A;  4KLW A;  4H6U A;  1MJB A;  3CXQ A;  3TE4 A;  1IYL A;  4KLV A;  5JQ4 A;  2BSW A;  4A31 A;  2P0W A;  2P6G A;  3IU2 A;  5AG5 A;  4MFP A;  3FBU A;  5AG4 A;  3DR8 A;  4CAV A;  4KOU A;  2Z0Z A;  3P2H A;  1B87 A;  4KOX A;  4CGN A;  1S7F A;  2Q4V A;  4YRH A;  5IX3 A;  3DR6 A;  2F5I A;  3TT2 A;  4ZBG A;  5ISV A;  1FY7 A;  5CNP A;  1Z4E A;  5G22 A;  5A27 A;  2Q0Y A;  1UFH A;  3LD2 A;  3JVN A;  2EUI A;  4R57 A;  4YFJ A;  2VI7 A;  3K9U A;  4H89 A;  4IUS A;  3TO7 A;  5KTC A;  4A95 A;  1L0C A;  4L89 A;  2REE A;  3E0K A;  2ZPA A;  5J8F A;  2WUU A;  2VQY A;  4HNW B;  5E96 A;  4A2Z A;  4GS4 A;  4BMH A;  4J3G A;  4C2Z A;  4UFV A;  2VBQ A;  3TOA A;  2X7B A;  2Q7B A;  1I1D A;  4LUA A;  2ZW6 A;  1S60 A;  3F8K A;  4UCP A;  5G21 A;  1MK4 A;  4KVM E;  2FSR A;  5KTA A;  1M4G A;  4MY3 A;  3TO6 A;  1Q2C A;  2A4N A;  4KSF A;  3H5Z A;  3VWD A;  2OH1 A;  4R3K A;  4U9Y A;  5GCN A;  1CM0 A;  1P4N A;  2JEV A;  2PR8 A;  2AE6 A;  4KS9 A;  2VXK A;  3R1K A;  2JDC A;  4FD5 A;  4E8O A;  2PR1 A;  3H4Q A;  4QVT A;  4JWP A;  1YVO A;  4KOT A;  4AVB A;  2R8V A;  3DNS A;  3S6F A;  2DPS A;  3T9Y A;  1CJW A;  1N71 A;  2BL1 A;  3KKW A;  2OB0 A;  1Z4R A;  3S6H A;  3G3S A;  1YX0 A;  1Y9W A;  2ZW4 A;  4AVC A;  4KOR A;  4JLY A;  2CXA A;  4FD6 A;  2ZW5 A;  4KOY A;  4C2X A;  2Z3L A;  3LOD A;  2FIW A;  1ZO0 A;  4X5K A;  4XPD C;  1IB1 E;  4CAF A;  1LRZ A;  3W6X A;  3FNC A;  4OAD A;  3RYO A;  4JD6 A;  1B6B A;  4EVY A;  4LX9 A;  2PRB A;  4UA3 A;  1WK4 A;  1YGH A;  2BEI A;  3TTH A;  5F48 A;  4AB7 A;  4I49 A;  1Z9U A;  2JLM A;  4RS2 A;  1YLE A;  4JJX A;  3R95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...