4UFXA

Plasmodium vivax n-myristoyltransferase in complex with a pyridyl inhibitor (compound 19)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Pyridyl-Based Inhibitors of Plasmodium Falciparum N-Myristoyltransferase
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 116
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ufxA00
3JTKA 4C2XA 5AGEA 4B13A 4UCMA 3IU2A 4UFXA 4CGPA 3H5ZA 4UCNA 4CGLA 4CYQA 4CGOA 3IWEA 4UCPA 5A27A 4B11A 4B12A 4CAFA 4A33A 4UFWA 5AG5A 2WUUA 4A32A 4A2ZA 4CYNA 4C7IA 4CYOA 4C2ZA 2YNCC 4C68A 4A31A 4CYPA 5AG6A 4B14A 5G22A 5A28A 2YNDA 4CGMA 5AG4A 4C7HA 5G21A 5AG7A 2YNEA 5G1ZA 4CGNA 4BBHA 5G20A 4C2YA 4B10A 4A30A 4A95A 2WSAA 2YNCA 3IU1A 4UFVA 4CAEA
chains in the Genus database with same CATH superfamily
3SJFA 3KGQA 1NSAA 2ZEHA 4OIDA 2IMOA 4P4DA 4XPDC 3E0KA 5LYFA 1LAPA 4R57A 4UFXA 1LANA 2ABZA 4ZX9A 4M3SA 4CGOA 4W9YA 4H89A 1BLLE 1K4JA 3LMSA 4RN7A 3S6FA 3S6KA 1Y9KA 3D2MA 3WC6A 2Q43A 1WWZA 2C1CA 2FXFA 2B5GB 2EO8A 5JQ4A 2O28A 2O53A 4BMHA 3KQXA 4UIAA 5AG6A 1LCPA 6CPAA 4B5PB 2C6GA 5K8NA 4KS9A 1XRYA 4DUKA 4R8FA 1M1DA 2PE3A 1IU8A 3C26A 4HNYB 2PDOA 3IGRA 3VH9A 2AFZA 4NCZA 5E96A 2XEFA 3SJEA 5BWAB 3KHXA 4IAVA 1Z8XA 1BO4A 1S3ZA 4Q7AA 3TT2A 2J8NA 4P10A 3D4UA 4P4IA 1YK3A 3IC1A 2VI7A 4MI4A 3EXNA 1XE4A 4FWUA 3WC5A 2PCUA 3LD2A 4MBUA 1XFOA 3D8PA 3QAYA 4PK2A 5LRJA 4AB7A 5K8MA 1R3NA 4MFJA 2YNEA 3BJ8A 4JD6A 4C2YA 1PCAA 1Z5RA 3CXSA 4OC0A 4NGPA 3TO6A 3TO7A 4DNCA 4F9VA 2C27A 3MRUA 3B3SA 1ARLA 4R3LA 3PB9X 4P44A 3JRUA 3RO0A 4AG9A 3F0AA 4IK2A 4CPAA 2DPSA 4MFQA 4MY3A 4X3RA 2Z3NA 3KL9A 4OC5A 4Y49B 1M44A 1RO5A 2GFQA 2ODFA 1B87A 1CP6A 1IYKA 2BOAA 2PJCA 3G3SA 3PB8X 2Z3LA 2IQ6A 1DTDA 4Q38A 4B6ZA 3NH5A 2GLFA 2WZNA 2GE3A 2PRQA 2ZPAA 2PJAA 4FD7A 4JXRA 5D29A 3GY9A 3R1KA 3VARA 2DF5A 1YMEA 2YGWA 1CJWA 4NGTA 5DS0A 2AE6A 4F9UA 2REFA 2PRBA 2F5IA 1I12A 5HMNA 3NE7A 1VHEA 3BI0A 4M6HA 3PEIA 3IU1A 4ZX8A 3RAMA 1LOKA 3D2PA 3PZJA 3IIBA 4YWYA 4JJXA 2EUIA 2FCKA 4NJQA 3PP9A 4MXUA 2ZW5A 4PXDA 5H86A 1Z8TA 4MFKA 4XNHB 3SI0A 2PQ8A 2DPTA 4OMEA 5CNPA 4EMEA 1ZLHA 3N7ZA 4UEEA 3RZAA 2QECA 4C2ZA 1F2PA 1CP7A 5G22A 5AG7A 2QVPA 3ZZIA 4KOSA 2PSWA 2C6CA 3QB8A 2VZZA 4BBHA 3H8FA 5C82A 3A9LA 1ZG9A 2J9AA 2Z3KA 4OP4A 4X2TA 1X12A 5DWNA 3D67A 4MCQA 3CDXA 3TTHA 2F8HA 4JYWA 2FVGA 4KLWA 4KSAA 2RFHA 2RC4A 1Y0RA 5F48A 2B58A 3JUWA 3PBBA 3D7DA 1M4GA 3TFYA 4QUSA 4ZI6A 4KOWA 4AVAA 3FJUA 2PVVA 4KVME 4DJLA 4LX9A 1A2ZA 4XPLA 4A32A 4A2ZA 4X8IA 3W6XA 1PU9A 4C7IA 1YR0A 3FBUA 4RUHA 1ON0A 5CPAA 1Z8LA 3V8IA 4F8ZA 2G3TA 2QMLA 1QQ9A 5LRKA 1LAMA 4A38A 4NGSA 4B5PA 1QSNA 2VEZA 4NSQA 1R43A 2P6FA 5KTDA 5G20A 5C88A 1YW4A 2VZYA 3H8EA 2Z3OA 2DEAA 3H8GA 4OC1A 2I3CA 4UWIA 4MHDA 5JH9A 4A95A 2CTBA 3PRTA 5IB9A 3HUVA 2XEJA 1F2OA 1ARMA 2PJ7A 4CAEA 3KR5A 1HDUA 1XIXA 2HUZA 4YGOA 4CGPA 1ZG8A 1U6MA 4ZY0A 3FX6A 1S7KA 1QSMA 2PC1A 2B3VA 3DLJA 3IWEA 3PB6X 4NF1A 4M6GA 2ARHA 5LYIA 3SXOA 4B11A 3KR4A 5HVFA 1VKCA 3IJ3A 2VBQA 1ZG7A 1NSLA 2FSRA 1V0CA 3QAHA 2CF4A 3NA6A 2ZOFA 2KCWA 4NXYA 1M4IA 3F5BA 3VWDA 1OBRA 4MHZA 4ORFA 1S7FA 3IWGA 2CY2A 3PB4X 5IX3A 3TC8A 4C7HA 1BAVA 2GANA 1LFWA 4CGNA 3CZXA 1UFHA 3MGDA 1B6BA 2VL1A 4TWEA 3TOAA 4JWPA 1TKFA 4PXEA 4OC4A 4MMOA 4C2XA 2D4OA 5AGEA 1VGYA 2PR1A 4OADA 4B13A 4KVXA 4GM5A 4A39A 4YU9A 5F47A 3P2FA 1RTQA 1BPNA 2FS5A 2H5MA 2V8HA 2WPXA 5IV0A 1AMPA 4FD4A 4KOVA 1Z4EA 2ZW7A 3QNVA 4JLYA 3RNZA 2PJ3A 4R7MA 3I3GA 2Q4YA 4FD5A 1CX8A 2I79A 2OZGA 2V8GA 3NE8A 4HNWB 4EWTA 3D66A 3DR6A 2EBJA 3SI2A 4E2AA 1BOBA 1IIDA 4B14A 2BL1A 2O4HA 1NE9A 4L8AA 4B5OA 2AFWA 5GCNA 3R9FA 5IB0A 3FYNA 4E0AA 4NJRA 4CAVA 1XMTA 1FT7A 2BCOA 2FIAA 3K9UA 3GUXA 4Y49C 2BUEA 2ZEMA 4BINA 2WSAA 2CXAA 2JBJA 2AFMA 2PJ8A 2J8RA 2OR4A 4A37A 5THWA 5I4MA 2ZEFA 4X5KA 3FRMA 2P6EA 2ZEPA 1YREA 4QC6A 3WABA 2XEGA 5JGFA 2DXQA 1CPSA 2Z11A 3K2KA 4CYQA 4MHNA 4B12A 8CPAA 4ZY1A 2EWBA 1CG2A 1ELMP 4KLVA 2C6PA 1S7LA 2OU2A 2HC9A 3NH8A 5JM6A 4ZBGA 1KUXA 1F57A 4MHYA 3KHZA 4OC2A 1AUGA 2ZENA 1KUVA 4ONUA 1YGHA 3ISZA 4LQGA 3S9MA 3B7IA 5FVJA 1S7NA 4ZY2A 2AFXA 2Z3MA 3KI9A 2GIVA 1Y7RA 4KSIA 2ZXVA 3R96A 1QSRA 3JTKA 2R7HA 4JZ0A 4I49A 4FAIA 4R87A 4GXHA 2PR8A 3G8WA 5J8CA 3P2HA 4KSFA 3WR7A 3FEDA 3R95A 5K8OA 3RBUA 2QYVA 3B3CA 1XF8A 2K5TA 2NMTA 5HXDA 2IL4A 5AG5A 1JQGA 4OKOA 4F0YA 3PGPA 3V38A 1TKJA 4IUSA 1IY7A 4KOTA 1GYTA 4MHPA 2Q0YA 2PIYA 4PPZA 3R9EA 4CGMA 3B35A 4OC3A 4WJBA 5ELYA 4CRZB 3CPXA 2QJ8A 4IHMA 4R6TA 4HPSA 2QIRA 4P45A 3NFZA 4E8OA 5F49A 3TO9A 3PB7X 2YNCA 2R1IA 4UBRA 3FH4A 4AG7A 3S9NA 3TCVA 2HQYA 4UCMA 5KTAA 1ZLIA 3D7FA 4ZGYB 5HVHA 1IYLA 4PSXA 4UCPA 3CT9A 4OLLA 2VQYA 2RB7A 4R76A 2WUUA 2JEVA 1ZO0A 3FECA 3CXQA 4FUUA 5J1QA 1AYEA 1HDQA 3FXTA 4NFRA 4CYOA 2PJ1A 4NEXA 4HNXB 2PVWA 3UY5A 4QB9A 2CTCA 3SHPA 2PJ5A 5A28A 2G9DA 2YNDA 1MJ9A 3CXPA 3K9TA 4FD6A 4PV6A 2Y0MA 1WK4A 3IEHA 2PJ9A 4YRHA 5DWMA 2PJ0A 3DSBA 4B10A 1VIXA 4KUAA 3T9YA 3EO4A 4A30A 2JDDA 4LUAA 2CIJA 2AFUA 2R98A 2F7VA 4K3NA 5HVGA 3IWWA 2PIZA 4O23A 1VHSA 4KOUA 4Z65A 3KKWA 5EC4A 5JPHA 1P0HA 4NGRA 1TIQA 2BEIA 2FIWA 2ZEEA 4UFWA 4DYOA 1XOVA 2JDCA 2Q51A 2Q7SA 2R8VA 1BPMA 5ISVA 3W91A 4R9MA 2B4BA 1Q2CA 4CYPA 1VHOA 2IJZA 4IF5A 1FY7A 2ZEDA 1Z4RA 2V8VA 4MFZA 3FEEA 3OWCA 3CPAA 1XEBA 3GLJA 4A94A 2Q4VA 1QSTA 4UEFA 1JWQA 1GHEA 3FNCA 3S6GA 4H6UA 1QSOA 5I0CA 4CAWA 3MN8A 4BD9A 1S60A 3PBEA 4UIBA 2Z0ZA 1R57A 1YQEA 3GIUA 5F09A 4MFLA 2ANPA 1Z2LA 2OZUA 4WWVA 4KOYA 3WT4A 4RI1A 3DDDA 4A33A 1N71A 3B3VA 4M6IA 4MCSA 3N5FA 2BO9A 5EMIA 2HB6A 4KZTA 3I1UA 2I00A 1RXTA 2PJ6A 4UEZA 4A31A 2ZEOA 2ATRA 2JEWA 3KZWA 2Q7BA 2G0BA 4MY0A 4P4FA 1CBXA 2BSWA 4TNUA 1IGBA 3KASA 2B4DA 1TF9A 5D8NA 2B5GA 1NMTA 2AFSA 3FB3A 4J3GA 2ZW4A 4K30A 4OIWA 4AVBA 1YW6A 1DE4C 4NGMA 5H84A 1FNOA 3TX8A 1H8LA 1YLOA 3W6SA 2GLJA 1OZPA 1I21A 4NGQA 5LYLA 4UCNA 3SXNA 7CPAA 3BJ7A 1TKHA 3LODA 4KOXA 2D4PA 3LACA 2GREA 4HKFA 2A4NA 2WPWA 4P4BA 3BXMA 4AVCA 1YLEA 4OAEA 1YX0A 4PXBA 3NH4A 2P0WA 3BHXA 1L0CA 4PSWA 4UWJA 2VXKA 5CBMA 3IFEA 3TOBA 4EVYA 3H4QA 1UWYA 2EK9A 4UF4A 3S6HA 1QMUA 4P4EA 3D3SA 2EVNA 3IO1A 3L2NA 4MFPA 4RS2A 1PUAA 2Q44A 2V8DA 4ZYQA 4KVOE 2ZELA 4FBEA 3LWUA 1YVKA 3FF3A 2POKA 1X10A 2JBKA 3DR8A 3FVLA 1CM0A 4UFVA 2WYRA 1TXRA 4PQAA 1YVOA 2CNMA 2EK8A 4XNHC 5HH1A 3ISXA 2PJ4A 1IOIA 2AFOA 4P4JA 4MRIA 4CGLA 2OH1A 1M4DA 4QVTA 2CNSA 4PK3A 1SQHA 2J8MA 3B3TA 3EY5A 4CAFA 4CYNA 4MJ8A 1I1DA 2XEIA 4U5YA 2JLMA 2CNTA 2YNCC 3B3WA 1HEEA 3EFAA 2OOTA 5LRGA 5J8FA 5AG4A 1ELLP 5G21A 2FT0A 2Q04A 2OZHA 4L89A 2ZOGA 4KORA 2B3UA 3DGVA 4MCPA 3V7ZA 4LQ6A 4P6YA 3B8GA 2V77A 3BI1A 3S9LA 1Y7EA 2X7BA 3TE4A 1XJOA 4CS0B 1MJBA 1MJAA 1Y9WA 3FIXA 1XBUA 3PFOA 2P6GA 1LRZA 4MCRA 3HLPA 3ZJ0A 4CAXA 4F0XA 1YSJA 1P4NA 1KZFA 3FMCA 3SI1A 3F8KA 3GB0A 3SJXA 4EFDA 1KWMA 3EC4A 4M85A 4AXVA 1Q2YA 3RYOA 2ZW6A 3D7HA 1CPXA 2Z10A 3JVNA 4YFJA 2AJ6A 1M4LA 1Y0YA 2Z3PA 2GU2A 4UA3A 3D7GA 3GKRA 1Q7LA 5G1ZA 3GYAA 3R9GA 3B2YA 1MK4A 3SJGA 2NSMA 3T8WA 5KTCA 1EE3P 4QBJA 3DNSA 4G1PA 3PFEA 1KUYA 3KQZA 5F46A 1S5KA 1J4JA 2HV2A 1IICA 4F6AA 1IOFA 4R3KA 4H6ZA 3IU2A 4H2KA 4KUBA 4NGNA 4PXCA 3BLNA 4XPKA 2FL4A 1Z9UA 5LYDA 4U9YA 5A27A 2PJBA 4Q36A 2FE7A 3VATA 2REEA 1IB1E 4U9ZA 2NYQA 4GS4A 5EBVA 1Z8WA 2G3AA 4C68A 3WC7A 2Q4ZA 1XMBA 3VWEA 4JXQA 1TF8A 3T90A 1Q2DA 4ONWA 4CRYB 3I9SA 2B4DB 2PJ2A 2ZEGA 4XPDB 3D68A 2OB0A 3H5ZA 5K8PA 4II9A 1PYTB
chains in the Genus database with same CATH topology
4XPDC 3E0KA 4R57A 4UFXA 4M3SA 4CGOA 4H89A 1K4JA 3S6FA 3S6KA 1Y9KA 3D2MA 1WWZA 2FXFA 2B5GB 5JQ4A 2O28A 4BMHA 5AG6A 4B5PB 4KS9A 1M1DA 3C26A 4HNYB 2PDOA 3IGRA 4NCZA 5E96A 5BWAB 1BO4A 1S3ZA 3TT2A 2J8NA 1YK3A 2VI7A 4MI4A 3EXNA 1XE4A 3LD2A 4MBUA 3D8PA 4PK2A 4AB7A 4MFJA 2YNEA 4JD6A 3BJ8A 4C2YA 3CXSA 3TO6A 3TO7A 4DNCA 2C27A 4R3LA 4AG9A 3F0AA 2DPSA 4MFQA 4MY3A 2Z3NA 4Y49B 1M44A 1RO5A 1B87A 1IYKA 3G3SA 4Q38A 2Z3LA 2ZPAA 2GE3A 4FD7A 4JXRA 3GY9A 3R1KA 2YGWA 1CJWA 2AE6A 2REFA 2PRBA 2F5IA 1I12A 5HMNA 3NE7A 3IU1A 3D2PA 3PZJA 4JJXA 2EUIA 2FCKA 3PP9A 2ZW5A 5H86A 4MFKA 4XNHB 2PQ8A 2DPTA 5CNPA 3N7ZA 4C2ZA 2QECA 5G22A 5AG7A 3ZZIA 4KOSA 3QB8A 2PSWA 5C82A 2VZZA 4BBHA 3A9LA 2Z3KA 5DWNA 3TTHA 4KLWA 4KSAA 2RC4A 5F48A 2B58A 3JUWA 3TFYA 1M4GA 4QUSA 4KOWA 4AVAA 4KVME 4LX9A 4XPLA 4A32A 4A2ZA 3W6XA 1PU9A 4C7IA 1YR0A 3FBUA 1ON0A 3V8IA 2G3TA 2QMLA 4B5PA 1QSNA 2VEZA 4NSQA 2P6FA 5KTDA 5G20A 5C88A 2VZYA 2Z3OA 4UWIA 4MHDA 4A95A 4CAEA 1XIXA 2HUZA 4YGOA 4CGPA 1U6MA 1S7KA 1QSMA 2PC1A 2B3VA 3IWEA 4NF1A 3SXOA 2ARHA 4B11A 1VKCA 1NSLA 2VBQA 2FSRA 1V0CA 3QAHA 4NXYA 2KCWA 3VWDA 1M4IA 3F5BA 4ORFA 1S7FA 3IWGA 2CY2A 5IX3A 4C7HA 2GANA 4CGNA 1UFHA 3MGDA 1B6BA 3TOAA 4JWPA 4C2XA 2D4OA 5AGEA 4OADA 2PR1A 4B13A 4KVXA 5F47A 3P2FA 2FS5A 2H5MA 2WPXA 5IV0A 4KOVA 4FD4A 1Z4EA 2ZW7A 4JLYA 3I3GA 2Q4YA 4FD5A 2I79A 2OZGA 4HNWB 3DR6A 4E2AA 1BOBA 1IIDA 4B14A 2BL1A 1NE9A 4L8AA 4B5OA 5GCNA 3R9FA 5IB0A 3FYNA 4E0AA 4CAVA 1XMTA 2FIAA 3K9UA 4Y49C 2BUEA 2WSAA 2CXAA 2J8RA 4X5KA 3FRMA 2P6EA 1YREA 4QC6A 2DXQA 2Z11A 4CYQA 4B12A 4KLVA 1S7LA 2OU2A 4ZBGA 1KUXA 1KUVA 4ONUA 1YGHA 5FVJA 1S7NA 2Z3MA 2GIVA 1Y7RA 2ZXVA 3R96A 1QSRA 3JTKA 2R7HA 4I49A 4R87A 2PR8A 3G8WA 5J8CA 3P2HA 4KSFA 3WR7A 3R95A 1XF8A 2K5TA 2NMTA 2IL4A 5AG5A 4F0YA 3PGPA 4IUSA 4KOTA 2Q0YA 3R9EA 4CGMA 4CRZB 2QIRA 4E8OA 5F49A 3TO9A 2YNCA 2R1IA 4UBRA 4AG7A 3TCVA 2HQYA 4UCMA 5KTAA 4ZGYB 1IYLA 4PSXA 4UCPA 4OLLA 2VQYA 2WUUA 2JEVA 1ZO0A 3CXQA 3FXTA 4CYOA 4NEXA 4HNXB 3UY5A 4QB9A 3SHPA 5A28A 2YNDA 4FD6A 1MJ9A 3CXPA 4PV6A 2Y0MA 1WK4A 4YRHA 5DWMA 3DSBA 4B10A 4KUAA 3T9YA 3EO4A 4A30A 2JDDA 4LUAA 2R98A 1VHSA 4KOUA 3KKWA 5EC4A 5JPHA 1P0HA 1TIQA 2BEIA 2FIWA 4UFWA 2JDCA 2R8VA 5ISVA 3W91A 4R9MA 2B4BA 1Q2CA 4CYPA 4IF5A 1FY7A 1Z4RA 4MFZA 3OWCA 1XEBA 2Q4VA 1QSTA 1GHEA 3FNCA 3S6GA 4H6UA 1QSOA 5I0CA 4CAWA 1S60A 2Z0ZA 1R57A 4MFLA 2OZUA 4KOYA 4RI1A 3DDDA 4A33A 1N71A 4KZTA 2I00A 1RXTA 4A31A 2ATRA 2Q7BA 2G0BA 4MY0A 2BSWA 2B4DA 2B5GA 1NMTA 4J3GA 3FB3A 4K30A 2ZW4A 4AVBA 5H84A 3W6SA 1OZPA 1I21A 4UCNA 3SXNA 3BJ7A 3LODA 4KOXA 2D4PA 4HKFA 2A4NA 2WPWA 4AVCA 1YLEA 4OAEA 1YX0A 2P0WA 4PSWA 1L0CA 4UWJA 2VXKA 3TOBA 4EVYA 3H4QA 3S6HA 3D3SA 2EVNA 4MFPA 4RS2A 1PUAA 2Q44A 4KVOE 1YVKA 3DR8A 1CM0A 4UFVA 1YVOA 2CNMA 4XNHC 5HH1A 4CGLA 2OH1A 1M4DA 4QVTA 2CNSA 4PK3A 1SQHA 2J8MA 3EY5A 4CAFA 4CYNA 4MJ8A 1I1DA 4U5YA 2JLMA 2CNTA 2YNCC 3EFAA 5J8FA 5AG4A 5G21A 2FT0A 2Q04A 4L89A 2OZHA 4KORA 2B3UA 3B8GA 2X7BA 3TE4A 4CS0B 1MJBA 1MJAA 1Y9WA 3FIXA 2P6GA 1LRZA 3ZJ0A 4CAXA 4F0XA 1P4NA 1KZFA 3F8KA 3EC4A 4M85A 1Q2YA 3RYOA 2ZW6A 2Z10A 3JVNA 4YFJA 2AJ6A 2Z3PA 4UA3A 3GKRA 3R9GA 5G1ZA 3GYAA 1MK4A 5KTCA 4QBJA 3DNSA 5F46A 1KUYA 1S5KA 1J4JA 2HV2A 1IICA 4F6AA 4R3KA 4H6ZA 3IU2A 4KUBA 3BLNA 4XPKA 2FL4A 1Z9UA 4U9YA 5A27A 4Q36A 2FE7A 2REEA 1IB1E 4U9ZA 4GS4A 5EBVA 2G3AA 4C68A 3VWEA 4JXQA 3T90A 1Q2DA 4CRYB 3I9SA 2B4DB 4XPDB 2OB0A 3H5ZA 4II9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JTK A;  4C2X A;  5AGE A;  4B13 A;  4UCM A;  3IU2 A;  4UFX A;  4CGP A;  3H5Z A;  4UCN A;  4CGL A;  4CYQ A;  4CGO A;  3IWE A;  4UCP A;  5A27 A;  4B11 A;  4B12 A;  4CAF A;  4A33 A;  4UFW A;  5AG5 A;  2WUU A;  4A32 A;  4A2Z A;  4CYN A;  4C7I A;  4CYO A;  4C2Z A;  2YNC C;  4C68 A;  4A31 A;  4CYP A;  5AG6 A;  4B14 A;  5G22 A;  5A28 A;  2YND A;  4CGM A;  5AG4 A;  4C7H A;  5G21 A;  5AG7 A;  2YNE A;  5G1Z A;  4CGN A;  4BBH A;  5G20 A;  4C2Y A;  4B10 A;  4A30 A;  4A95 A;  2WSA A;  2YNC A;  3IU1 A;  4UFV A;  4CAE A; 
#chains in the Genus database with same CATH topology
 3SJF A;  3KGQ A;  1NSA A;  2ZEH A;  4OID A;  2IMO A;  4P4D A;  4XPD C;  3E0K A;  5LYF A;  1LAP A;  4R57 A;  4UFX A;  1LAN A;  2ABZ A;  4ZX9 A;  4M3S A;  4CGO A;  4W9Y A;  4H89 A;  1BLL E;  1K4J A;  3LMS A;  4RN7 A;  3S6F A;  3S6K A;  1Y9K A;  3D2M A;  3WC6 A;  2Q43 A;  1WWZ A;  2C1C A;  2FXF A;  2B5G B;  2EO8 A;  5JQ4 A;  2O28 A;  2O53 A;  4BMH A;  3KQX A;  4UIA A;  5AG6 A;  1LCP A;  6CPA A;  4B5P B;  2C6G A;  5K8N A;  4KS9 A;  1XRY A;  4DUK A;  4R8F A;  1M1D A;  2PE3 A;  1IU8 A;  3C26 A;  4HNY B;  2PDO A;  3IGR A;  3VH9 A;  2AFZ A;  4NCZ A;  5E96 A;  2XEF A;  3SJE A;  5BWA B;  3KHX A;  4IAV A;  1Z8X A;  1BO4 A;  1S3Z A;  4Q7A A;  3TT2 A;  2J8N A;  4P10 A;  3D4U A;  4P4I A;  1YK3 A;  3IC1 A;  2VI7 A;  4MI4 A;  3EXN A;  1XE4 A;  4FWU A;  3WC5 A;  2PCU A;  3LD2 A;  4MBU A;  1XFO A;  3D8P A;  3QAY A;  4PK2 A;  5LRJ A;  4AB7 A;  5K8M A;  1R3N A;  4MFJ A;  2YNE A;  3BJ8 A;  4JD6 A;  4C2Y A;  1PCA A;  1Z5R A;  3CXS A;  4OC0 A;  4NGP A;  3TO6 A;  3TO7 A;  4DNC A;  4F9V A;  2C27 A;  3MRU A;  3B3S A;  1ARL A;  4R3L A;  3PB9 X;  4P44 A;  3JRU A;  3RO0 A;  4AG9 A;  3F0A A;  4IK2 A;  4CPA A;  2DPS A;  4MFQ A;  4MY3 A;  4X3R A;  2Z3N A;  3KL9 A;  4OC5 A;  4Y49 B;  1M44 A;  1RO5 A;  2GFQ A;  2ODF A;  1B87 A;  1CP6 A;  1IYK A;  2BOA A;  2PJC A;  3G3S A;  3PB8 X;  2Z3L A;  2IQ6 A;  1DTD A;  4Q38 A;  4B6Z A;  3NH5 A;  2GLF A;  2WZN A;  2GE3 A;  2PRQ A;  2ZPA A;  2PJA A;  4FD7 A;  4JXR A;  5D29 A;  3GY9 A;  3R1K A;  3VAR A;  2DF5 A;  1YME A;  2YGW A;  1CJW A;  4NGT A;  5DS0 A;  2AE6 A;  4F9U A;  2REF A;  2PRB A;  2F5I A;  1I12 A;  5HMN A;  3NE7 A;  1VHE A;  3BI0 A;  4M6H A;  3PEI A;  3IU1 A;  4ZX8 A;  3RAM A;  1LOK A;  3D2P A;  3PZJ A;  3IIB A;  4YWY A;  4JJX A;  2EUI A;  2FCK A;  4NJQ A;  3PP9 A;  4MXU A;  2ZW5 A;  4PXD A;  5H86 A;  1Z8T A;  4MFK A;  4XNH B;  3SI0 A;  2PQ8 A;  2DPT A;  4OME A;  5CNP A;  4EME A;  1ZLH A;  3N7Z A;  4UEE A;  3RZA A;  2QEC A;  4C2Z A;  1F2P A;  1CP7 A;  5G22 A;  5AG7 A;  2QVP A;  3ZZI A;  4KOS A;  2PSW A;  2C6C A;  3QB8 A;  2VZZ A;  4BBH A;  3H8F A;  5C82 A;  3A9L A;  1ZG9 A;  2J9A A;  2Z3K A;  4OP4 A;  4X2T A;  1X12 A;  5DWN A;  3D67 A;  4MCQ A;  3CDX A;  3TTH A;  2F8H A;  4JYW A;  2FVG A;  4KLW A;  4KSA A;  2RFH A;  2RC4 A;  1Y0R A;  5F48 A;  2B58 A;  3JUW A;  3PBB A;  3D7D A;  1M4G A;  3TFY A;  4QUS A;  4ZI6 A;  4KOW A;  4AVA A;  3FJU A;  2PVV A;  4KVM E;  4DJL A;  4LX9 A;  1A2Z A;  4XPL A;  4A32 A;  4A2Z A;  4X8I A;  3W6X A;  1PU9 A;  4C7I A;  1YR0 A;  3FBU A;  4RUH A;  1ON0 A;  5CPA A;  1Z8L A;  3V8I A;  4F8Z A;  2G3T A;  2QML A;  1QQ9 A;  5LRK A;  1LAM A;  4A38 A;  4NGS A;  4B5P A;  1QSN A;  2VEZ A;  4NSQ A;  1R43 A;  2P6F A;  5KTD A;  5G20 A;  5C88 A;  1YW4 A;  2VZY A;  3H8E A;  2Z3O A;  2DEA A;  3H8G A;  4OC1 A;  2I3C A;  4UWI A;  4MHD A;  5JH9 A;  4A95 A;  2CTB A;  3PRT A;  5IB9 A;  3HUV A;  2XEJ A;  1F2O A;  1ARM A;  2PJ7 A;  4CAE A;  3KR5 A;  1HDU A;  1XIX A;  2HUZ A;  4YGO A;  4CGP A;  1ZG8 A;  1U6M A;  4ZY0 A;  3FX6 A;  1S7K A;  1QSM A;  2PC1 A;  2B3V A;  3DLJ A;  3IWE A;  3PB6 X;  4NF1 A;  4M6G A;  2ARH A;  5LYI A;  3SXO A;  4B11 A;  3KR4 A;  5HVF A;  1VKC A;  3IJ3 A;  2VBQ A;  1ZG7 A;  1NSL A;  2FSR A;  1V0C A;  3QAH A;  2CF4 A;  3NA6 A;  2ZOF A;  2KCW A;  4NXY A;  1M4I A;  3F5B A;  3VWD A;  1OBR A;  4MHZ A;  4ORF A;  1S7F A;  3IWG A;  2CY2 A;  3PB4 X;  5IX3 A;  3TC8 A;  4C7H A;  1BAV A;  2GAN A;  1LFW A;  4CGN A;  3CZX A;  1UFH A;  3MGD A;  1B6B A;  2VL1 A;  4TWE A;  3TOA A;  4JWP A;  1TKF A;  4PXE A;  4OC4 A;  4MMO A;  4C2X A;  2D4O A;  5AGE A;  1VGY A;  2PR1 A;  4OAD A;  4B13 A;  4KVX A;  4GM5 A;  4A39 A;  4YU9 A;  5F47 A;  3P2F A;  1RTQ A;  1BPN A;  2FS5 A;  2H5M A;  2V8H A;  2WPX A;  5IV0 A;  1AMP A;  4FD4 A;  4KOV A;  1Z4E A;  2ZW7 A;  3QNV A;  4JLY A;  3RNZ A;  2PJ3 A;  4R7M A;  3I3G A;  2Q4Y A;  4FD5 A;  1CX8 A;  2I79 A;  2OZG A;  2V8G A;  3NE8 A;  4HNW B;  4EWT A;  3D66 A;  3DR6 A;  2EBJ A;  3SI2 A;  4E2A A;  1BOB A;  1IID A;  4B14 A;  2BL1 A;  2O4H A;  1NE9 A;  4L8A A;  4B5O A;  2AFW A;  5GCN A;  3R9F A;  5IB0 A;  3FYN A;  4E0A A;  4NJR A;  4CAV A;  1XMT A;  1FT7 A;  2BCO A;  2FIA A;  3K9U A;  3GUX A;  4Y49 C;  2BUE A;  2ZEM A;  4BIN A;  2WSA A;  2CXA A;  2JBJ A;  2AFM A;  2PJ8 A;  2J8R A;  2OR4 A;  4A37 A;  5THW A;  5I4M A;  2ZEF A;  4X5K A;  3FRM A;  2P6E A;  2ZEP A;  1YRE A;  4QC6 A;  3WAB A;  2XEG A;  5JGF A;  2DXQ A;  1CPS A;  2Z11 A;  3K2K A;  4CYQ A;  4MHN A;  4B12 A;  8CPA A;  4ZY1 A;  2EWB A;  1CG2 A;  1ELM P;  4KLV A;  2C6P A;  1S7L A;  2OU2 A;  2HC9 A;  3NH8 A;  5JM6 A;  4ZBG A;  1KUX A;  1F57 A;  4MHY A;  3KHZ A;  4OC2 A;  1AUG A;  2ZEN A;  1KUV A;  4ONU A;  1YGH A;  3ISZ A;  4LQG A;  3S9M A;  3B7I A;  5FVJ A;  1S7N A;  4ZY2 A;  2AFX A;  2Z3M A;  3KI9 A;  2GIV A;  1Y7R A;  4KSI A;  2ZXV A;  3R96 A;  1QSR A;  3JTK A;  2R7H A;  4JZ0 A;  4I49 A;  4FAI A;  4R87 A;  4GXH A;  2PR8 A;  3G8W A;  5J8C A;  3P2H A;  4KSF A;  3WR7 A;  3FED A;  3R95 A;  5K8O A;  3RBU A;  2QYV A;  3B3C A;  1XF8 A;  2K5T A;  2NMT A;  5HXD A;  2IL4 A;  5AG5 A;  1JQG A;  4OKO A;  4F0Y A;  3PGP A;  3V38 A;  1TKJ A;  4IUS A;  1IY7 A;  4KOT A;  1GYT A;  4MHP A;  2Q0Y A;  2PIY A;  4PPZ A;  3R9E A;  4CGM A;  3B35 A;  4OC3 A;  4WJB A;  5ELY A;  4CRZ B;  3CPX A;  2QJ8 A;  4IHM A;  4R6T A;  4HPS A;  2QIR A;  4P45 A;  3NFZ A;  4E8O A;  5F49 A;  3TO9 A;  3PB7 X;  2YNC A;  2R1I A;  4UBR A;  3FH4 A;  4AG7 A;  3S9N A;  3TCV A;  2HQY A;  4UCM A;  5KTA A;  1ZLI A;  3D7F A;  4ZGY B;  5HVH A;  1IYL A;  4PSX A;  4UCP A;  3CT9 A;  4OLL A;  2VQY A;  2RB7 A;  4R76 A;  2WUU A;  2JEV A;  1ZO0 A;  3FEC A;  3CXQ A;  4FUU A;  5J1Q A;  1AYE A;  1HDQ A;  3FXT A;  4NFR A;  4CYO A;  2PJ1 A;  4NEX A;  4HNX B;  2PVW A;  3UY5 A;  4QB9 A;  2CTC A;  3SHP A;  2PJ5 A;  5A28 A;  2G9D A;  2YND A;  1MJ9 A;  3CXP A;  3K9T A;  4FD6 A;  4PV6 A;  2Y0M A;  1WK4 A;  3IEH A;  2PJ9 A;  4YRH A;  5DWM A;  2PJ0 A;  3DSB A;  4B10 A;  1VIX A;  4KUA A;  3T9Y A;  3EO4 A;  4A30 A;  2JDD A;  4LUA A;  2CIJ A;  2AFU A;  2R98 A;  2F7V A;  4K3N A;  5HVG A;  3IWW A;  2PIZ A;  4O23 A;  1VHS A;  4KOU A;  4Z65 A;  3KKW A;  5EC4 A;  5JPH A;  1P0H A;  4NGR A;  1TIQ A;  2BEI A;  2FIW A;  2ZEE A;  4UFW A;  4DYO A;  1XOV A;  2JDC A;  2Q51 A;  2Q7S A;  2R8V A;  1BPM A;  5ISV A;  3W91 A;  4R9M A;  2B4B A;  1Q2C A;  4CYP A;  1VHO A;  2IJZ A;  4IF5 A;  1FY7 A;  2ZED A;  1Z4R A;  2V8V A;  4MFZ A;  3FEE A;  3OWC A;  3CPA A;  1XEB A;  3GLJ A;  4A94 A;  2Q4V A;  1QST A;  4UEF A;  1JWQ A;  1GHE A;  3FNC A;  3S6G A;  4H6U A;  1QSO A;  5I0C A;  4CAW A;  3MN8 A;  4BD9 A;  1S60 A;  3PBE A;  4UIB A;  2Z0Z A;  1R57 A;  1YQE A;  3GIU A;  5F09 A;  4MFL A;  2ANP A;  1Z2L A;  2OZU A;  4WWV A;  4KOY A;  3WT4 A;  4RI1 A;  3DDD A;  4A33 A;  1N71 A;  3B3V A;  4M6I A;  4MCS A;  3N5F A;  2BO9 A;  5EMI A;  2HB6 A;  4KZT A;  3I1U A;  2I00 A;  1RXT A;  2PJ6 A;  4UEZ A;  4A31 A;  2ZEO A;  2ATR A;  2JEW A;  3KZW A;  2Q7B A;  2G0B A;  4MY0 A;  4P4F A;  1CBX A;  2BSW A;  4TNU A;  1IGB A;  3KAS A;  2B4D A;  1TF9 A;  5D8N A;  2B5G A;  1NMT A;  2AFS A;  3FB3 A;  4J3G A;  2ZW4 A;  4K30 A;  4OIW A;  4AVB A;  1YW6 A;  1DE4 C;  4NGM A;  5H84 A;  1FNO A;  3TX8 A;  1H8L A;  1YLO A;  3W6S A;  2GLJ A;  1OZP A;  1I21 A;  4NGQ A;  5LYL A;  4UCN A;  3SXN A;  7CPA A;  3BJ7 A;  1TKH A;  3LOD A;  4KOX A;  2D4P A;  3LAC A;  2GRE A;  4HKF A;  2A4N A;  2WPW A;  4P4B A;  3BXM A;  4AVC A;  1YLE A;  4OAE A;  1YX0 A;  4PXB A;  3NH4 A;  2P0W A;  3BHX A;  1L0C A;  4PSW A;  4UWJ A;  2VXK A;  5CBM A;  3IFE A;  3TOB A;  4EVY A;  3H4Q A;  1UWY A;  2EK9 A;  4UF4 A;  3S6H A;  1QMU A;  4P4E A;  3D3S A;  2EVN A;  3IO1 A;  3L2N A;  4MFP A;  4RS2 A;  1PUA A;  2Q44 A;  2V8D A;  4ZYQ A;  4KVO E;  2ZEL A;  4FBE A;  3LWU A;  1YVK A;  3FF3 A;  2POK A;  1X10 A;  2JBK A;  3DR8 A;  3FVL A;  1CM0 A;  4UFV A;  2WYR A;  1TXR A;  4PQA A;  1YVO A;  2CNM A;  2EK8 A;  4XNH C;  5HH1 A;  3ISX A;  2PJ4 A;  1IOI A;  2AFO A;  4P4J A;  4MRI A;  4CGL A;  2OH1 A;  1M4D A;  4QVT A;  2CNS A;  4PK3 A;  1SQH A;  2J8M A;  3B3T A;  3EY5 A;  4CAF A;  4CYN A;  4MJ8 A;  1I1D A;  2XEI A;  4U5Y A;  2JLM A;  2CNT A;  2YNC C;  3B3W A;  1HEE A;  3EFA A;  2OOT A;  5LRG A;  5J8F A;  5AG4 A;  1ELL P;  5G21 A;  2FT0 A;  2Q04 A;  2OZH A;  4L89 A;  2ZOG A;  4KOR A;  2B3U A;  3DGV A;  4MCP A;  3V7Z A;  4LQ6 A;  4P6Y A;  3B8G A;  2V77 A;  3BI1 A;  3S9L A;  1Y7E A;  2X7B A;  3TE4 A;  1XJO A;  4CS0 B;  1MJB A;  1MJA A;  1Y9W A;  3FIX A;  1XBU A;  3PFO A;  2P6G A;  1LRZ A;  4MCR A;  3HLP A;  3ZJ0 A;  4CAX A;  4F0X A;  1YSJ A;  1P4N A;  1KZF A;  3FMC A;  3SI1 A;  3F8K A;  3GB0 A;  3SJX A;  4EFD A;  1KWM A;  3EC4 A;  4M85 A;  4AXV A;  1Q2Y A;  3RYO A;  2ZW6 A;  3D7H A;  1CPX A;  2Z10 A;  3JVN A;  4YFJ A;  2AJ6 A;  1M4L A;  1Y0Y A;  2Z3P A;  2GU2 A;  4UA3 A;  3D7G A;  3GKR A;  1Q7L A;  5G1Z A;  3GYA A;  3R9G A;  3B2Y A;  1MK4 A;  3SJG A;  2NSM A;  3T8W A;  5KTC A;  1EE3 P;  4QBJ A;  3DNS A;  4G1P A;  3PFE A;  1KUY A;  3KQZ A;  5F46 A;  1S5K A;  1J4J A;  2HV2 A;  1IIC A;  4F6A A;  1IOF A;  4R3K A;  4H6Z A;  3IU2 A;  4H2K A;  4KUB A;  4NGN A;  4PXC A;  3BLN A;  4XPK A;  2FL4 A;  1Z9U A;  5LYD A;  4U9Y A;  5A27 A;  2PJB A;  4Q36 A;  2FE7 A;  3VAT A;  2REE A;  1IB1 E;  4U9Z A;  2NYQ A;  4GS4 A;  5EBV A;  1Z8W A;  2G3A A;  4C68 A;  3WC7 A;  2Q4Z A;  1XMB A;  3VWE A;  4JXQ A;  1TF8 A;  3T90 A;  1Q2D A;  4ONW A;  4CRY B;  3I9S A;  2B4D B;  2PJ2 A;  2ZEG A;  4XPD B;  3D68 A;  2OB0 A;  3H5Z A;  5K8P A;  4II9 A;  1PYT B; 
#chains in the Genus database with same CATH homology
 4XPD C;  3E0K A;  4R57 A;  4UFX A;  4M3S A;  4CGO A;  4H89 A;  1K4J A;  3S6F A;  3S6K A;  1Y9K A;  3D2M A;  1WWZ A;  2FXF A;  2B5G B;  5JQ4 A;  2O28 A;  4BMH A;  5AG6 A;  4B5P B;  4KS9 A;  1M1D A;  3C26 A;  4HNY B;  2PDO A;  3IGR A;  4NCZ A;  5E96 A;  5BWA B;  1BO4 A;  1S3Z A;  3TT2 A;  2J8N A;  1YK3 A;  2VI7 A;  4MI4 A;  3EXN A;  1XE4 A;  3LD2 A;  4MBU A;  3D8P A;  4PK2 A;  4AB7 A;  4MFJ A;  2YNE A;  4JD6 A;  3BJ8 A;  4C2Y A;  3CXS A;  3TO6 A;  3TO7 A;  4DNC A;  2C27 A;  4R3L A;  4AG9 A;  3F0A A;  2DPS A;  4MFQ A;  4MY3 A;  2Z3N A;  4Y49 B;  1M44 A;  1RO5 A;  1B87 A;  1IYK A;  3G3S A;  4Q38 A;  2Z3L A;  2ZPA A;  2GE3 A;  4FD7 A;  4JXR A;  3GY9 A;  3R1K A;  2YGW A;  1CJW A;  2AE6 A;  2REF A;  2PRB A;  2F5I A;  1I12 A;  5HMN A;  3NE7 A;  3IU1 A;  3D2P A;  3PZJ A;  4JJX A;  2EUI A;  2FCK A;  3PP9 A;  2ZW5 A;  5H86 A;  4MFK A;  4XNH B;  2PQ8 A;  2DPT A;  5CNP A;  3N7Z A;  4C2Z A;  2QEC A;  5G22 A;  5AG7 A;  3ZZI A;  4KOS A;  3QB8 A;  2PSW A;  5C82 A;  2VZZ A;  4BBH A;  3A9L A;  2Z3K A;  5DWN A;  3TTH A;  4KLW A;  4KSA A;  2RC4 A;  5F48 A;  2B58 A;  3JUW A;  3TFY A;  1M4G A;  4QUS A;  4KOW A;  4AVA A;  4KVM E;  4LX9 A;  4XPL A;  4A32 A;  4A2Z A;  3W6X A;  1PU9 A;  4C7I A;  1YR0 A;  3FBU A;  1ON0 A;  3V8I A;  2G3T A;  2QML A;  4B5P A;  1QSN A;  2VEZ A;  4NSQ A;  2P6F A;  5KTD A;  5G20 A;  5C88 A;  2VZY A;  2Z3O A;  4UWI A;  4MHD A;  4A95 A;  4CAE A;  1XIX A;  2HUZ A;  4YGO A;  4CGP A;  1U6M A;  1S7K A;  1QSM A;  2PC1 A;  2B3V A;  3IWE A;  4NF1 A;  3SXO A;  2ARH A;  4B11 A;  1VKC A;  1NSL A;  2VBQ A;  2FSR A;  1V0C A;  3QAH A;  4NXY A;  2KCW A;  3VWD A;  1M4I A;  3F5B A;  4ORF A;  1S7F A;  3IWG A;  2CY2 A;  5IX3 A;  4C7H A;  2GAN A;  4CGN A;  1UFH A;  3MGD A;  1B6B A;  3TOA A;  4JWP A;  4C2X A;  2D4O A;  5AGE A;  4OAD A;  2PR1 A;  4B13 A;  4KVX A;  5F47 A;  3P2F A;  2FS5 A;  2H5M A;  2WPX A;  5IV0 A;  4KOV A;  4FD4 A;  1Z4E A;  2ZW7 A;  4JLY A;  3I3G A;  2Q4Y A;  4FD5 A;  2I79 A;  2OZG A;  4HNW B;  3DR6 A;  4E2A A;  1BOB A;  1IID A;  4B14 A;  2BL1 A;  1NE9 A;  4L8A A;  4B5O A;  5GCN A;  3R9F A;  5IB0 A;  3FYN A;  4E0A A;  4CAV A;  1XMT A;  2FIA A;  3K9U A;  4Y49 C;  2BUE A;  2WSA A;  2CXA A;  2J8R A;  4X5K A;  3FRM A;  2P6E A;  1YRE A;  4QC6 A;  2DXQ A;  2Z11 A;  4CYQ A;  4B12 A;  4KLV A;  1S7L A;  2OU2 A;  4ZBG A;  1KUX A;  1KUV A;  4ONU A;  1YGH A;  5FVJ A;  1S7N A;  2Z3M A;  2GIV A;  1Y7R A;  2ZXV A;  3R96 A;  1QSR A;  3JTK A;  2R7H A;  4I49 A;  4R87 A;  2PR8 A;  3G8W A;  5J8C A;  3P2H A;  4KSF A;  3WR7 A;  3R95 A;  1XF8 A;  2K5T A;  2NMT A;  2IL4 A;  5AG5 A;  4F0Y A;  3PGP A;  4IUS A;  4KOT A;  2Q0Y A;  3R9E A;  4CGM A;  4CRZ B;  2QIR A;  4E8O A;  5F49 A;  3TO9 A;  2YNC A;  2R1I A;  4UBR A;  4AG7 A;  3TCV A;  2HQY A;  4UCM A;  5KTA A;  4ZGY B;  1IYL A;  4PSX A;  4UCP A;  4OLL A;  2VQY A;  2WUU A;  2JEV A;  1ZO0 A;  3CXQ A;  3FXT A;  4CYO A;  4NEX A;  4HNX B;  3UY5 A;  4QB9 A;  3SHP A;  5A28 A;  2YND A;  4FD6 A;  1MJ9 A;  3CXP A;  4PV6 A;  2Y0M A;  1WK4 A;  4YRH A;  5DWM A;  3DSB A;  4B10 A;  4KUA A;  3T9Y A;  3EO4 A;  4A30 A;  2JDD A;  4LUA A;  2R98 A;  1VHS A;  4KOU A;  3KKW A;  5EC4 A;  5JPH A;  1P0H A;  1TIQ A;  2BEI A;  2FIW A;  4UFW A;  2JDC A;  2R8V A;  5ISV A;  3W91 A;  4R9M A;  2B4B A;  1Q2C A;  4CYP A;  4IF5 A;  1FY7 A;  1Z4R A;  4MFZ A;  3OWC A;  1XEB A;  2Q4V A;  1QST A;  1GHE A;  3FNC A;  3S6G A;  4H6U A;  1QSO A;  5I0C A;  4CAW A;  1S60 A;  2Z0Z A;  1R57 A;  4MFL A;  2OZU A;  4KOY A;  4RI1 A;  3DDD A;  4A33 A;  1N71 A;  4KZT A;  2I00 A;  1RXT A;  4A31 A;  2ATR A;  2Q7B A;  2G0B A;  4MY0 A;  2BSW A;  2B4D A;  2B5G A;  1NMT A;  4J3G A;  3FB3 A;  4K30 A;  2ZW4 A;  4AVB A;  5H84 A;  3W6S A;  1OZP A;  1I21 A;  4UCN A;  3SXN A;  3BJ7 A;  3LOD A;  4KOX A;  2D4P A;  4HKF A;  2A4N A;  2WPW A;  4AVC A;  1YLE A;  4OAE A;  1YX0 A;  2P0W A;  4PSW A;  1L0C A;  4UWJ A;  2VXK A;  3TOB A;  4EVY A;  3H4Q A;  3S6H A;  3D3S A;  2EVN A;  4MFP A;  4RS2 A;  1PUA A;  2Q44 A;  4KVO E;  1YVK A;  3DR8 A;  1CM0 A;  4UFV A;  1YVO A;  2CNM A;  4XNH C;  5HH1 A;  4CGL A;  2OH1 A;  1M4D A;  4QVT A;  2CNS A;  4PK3 A;  1SQH A;  2J8M A;  3EY5 A;  4CAF A;  4CYN A;  4MJ8 A;  1I1D A;  4U5Y A;  2JLM A;  2CNT A;  2YNC C;  3EFA A;  5J8F A;  5AG4 A;  5G21 A;  2FT0 A;  2Q04 A;  4L89 A;  2OZH A;  4KOR A;  2B3U A;  3B8G A;  2X7B A;  3TE4 A;  4CS0 B;  1MJB A;  1MJA A;  1Y9W A;  3FIX A;  2P6G A;  1LRZ A;  3ZJ0 A;  4CAX A;  4F0X A;  1P4N A;  1KZF A;  3F8K A;  3EC4 A;  4M85 A;  1Q2Y A;  3RYO A;  2ZW6 A;  2Z10 A;  3JVN A;  4YFJ A;  2AJ6 A;  2Z3P A;  4UA3 A;  3GKR A;  3R9G A;  5G1Z A;  3GYA A;  1MK4 A;  5KTC A;  4QBJ A;  3DNS A;  5F46 A;  1KUY A;  1S5K A;  1J4J A;  2HV2 A;  1IIC A;  4F6A A;  4R3K A;  4H6Z A;  3IU2 A;  4KUB A;  3BLN A;  4XPK A;  2FL4 A;  1Z9U A;  4U9Y A;  5A27 A;  4Q36 A;  2FE7 A;  2REE A;  1IB1 E;  4U9Z A;  4GS4 A;  5EBV A;  2G3A A;  4C68 A;  3VWE A;  4JXQ A;  3T90 A;  1Q2D A;  4CRY B;  3I9S A;  2B4D B;  4XPD B;  2OB0 A;  3H5Z A;  4II9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...