4UFXA

Plasmodium vivax n-myristoyltransferase in complex with a pyridyl inhibitor (compound 19)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of Pyridyl-Based Inhibitors of Plasmodium Falciparum N-Myristoyltransferase
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase
total genus 116
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ufxA00
4A31A 4CGOA 4B14A 4C7IA 2YNCC 2WSAA 3H5ZA 4C68A 2YNEA 4UFVA 5G22A 4A95A 4BBHA 4CGPA 4CYOA 4UCNA 4CYQA 4UFWA 4B13A 5A28A 4UCMA 4C2XA 4B11A 4UCPA 3IU2A 5AG7A 4CYPA 4C2ZA 5G21A 3IWEA 4CGNA 2WUUA 4UFXA 2YNCA 3JTKA 4C7HA 4CYNA 4A32A 4C2YA 2YNDA 5AGEA 5G1ZA 4CAFA 3IU1A 5G20A 4A30A 4B12A 5AG5A 4CGLA 4CGMA 4A2ZA 4CAEA 5A27A 4B10A 5AG6A 5AG4A 4A33A
chains in the Genus database with same CATH superfamily
4K30A 2CTCA 2R7HA 3TCVA 2PRBA 4PSXA 2AFMA 4LQGA 3SHPA 4CAWA 4XNHB 2RFHA 2PDOA 4B11A 1YVKA 4OKOA 4B6ZA 1VHSA 3IGRA 5IB0A 3B3TA 1KUVA 4MCRA 3B3WA 3RAMA 5D8NA 1ZG8A 2BEIA 2EK9A 3F8KA 3IFEA 3KHXA 5H86A 5HVGA 4M3SA 4DNCA 2G3TA 2OH1A 3B3SA 3FBUA 2AFWA 1IGBA 1QSOA 3NE7A 3C26A 1HDUA 1A2ZA 2AE6A 3VH9A 1X10A 5LYFA 4B5PB 2ATRA 2Q4VA 3KQZA 3GIUA 3P2HA 4UFWA 2PJ7A 3S9MA 1GHEA 1TF9A 1Z4EA 4JXQA 2ZEGA 2AFOA 3SXNA 3CZXA 3BI0A 1Z4RA 1Z9UA 3JUWA 3K9TA 4AVBA 3UY5A 4UWJA 4ONUA 3CXQA 1GYTA 1P4NA 4U9YA 5GCNA 4UEFA 1OBRA 1B6BA 1LOKA 2FXFA 3BJ7A 3NH8A 4X5KA 5FVJA 1U6MA 2C27A 3VATA 1BO4A 4KUAA 4B5OA 4OLLA 4QB9A 4R7MA 4CAVA 5K8NA 5JPHA 1FY7A 1OZPA 3S9LA 3CPXA 2JDCA 1MJBA 3LACA 5LRJA 3KGQA 2V8HA 2JDDA 3BHXA 5KTDA 4ZGYB 1YQEA 4II9A 4UBRA 1IY7A 4JXRA 2OZHA 1NE9A 4KLWA 3GLJA 3B35A 3QB8A 4UFVA 2BUEA 4UCNA 5THWA 4DYOA 2FE7A 2OR4A 1XIXA 4Z65A 4ZI6A 5IX3A 3FRMA 2C6GA 3R9GA 4KOTA 4AG7A 1QSTA 2QMLA 3A9LA 4KSIA 2ZW4A 2DXQA 3P2FA 5EC4A 2CNTA 4BINA 4ZYQA 2JBJA 1BAVA 2ZEDA 2VL1A 1CPXA 5IV0A 1S7FA 3FXTA 4KVXA 5AG5A 1Q2CA 1NMTA 1XEBA 2IMOA 5DWNA 2FIAA 2I79A 5HH1A 5F09A 1RXTA 4GM5A 1Q2YA 1X12A 2WPXA 3V38A 3KR5A 4PK3A 1M4LA 2YNCC 5LRGA 3KKWA 3PB7X 3CXPA 4OC4A 4KSFA 4PSWA 2V77A 4OC2A 4LX9A 2CXAA 2DPTA 1MJAA 2ZW5A 4K3NA 2FSRA 2FS5A 4KOUA 4YWYA 2PIYA 3IWWA 4FAIA 1XE4A 4FD5A 2POKA 2H5MA 4NFRA 4Y49C 3BJ8A 1KUXA 1QSNA 2FIWA 2Z11A 3GB0A 1XMTA 2AFZA 2Q44A 4C7HA 1QSRA 2ANPA 4CS0B 1I12A 2ZPAA 3FEEA 4Q7AA 3IU1A 4PXCA 3T90A 4NEXA 1Z8LA 4W9YA 1UFHA 5HVFA 2QJ8A 4OP4A 5LYIA 2G0BA 5JH9A 5F48A 3IO1A 1KUYA 1CBXA 4UEZA 3S6HA 5CBMA 4ZY0A 3WC6A 4P44A 4C68A 3H5ZA 3B3VA 1LANA 2J8MA 2P0WA 2V8DA 2ZENA 4MBUA 4FD6A 3PGPA 3PB8X 3DSBA 4HKFA 2PJ1A 1Y9KA 2Z10A 4RI1A 1HDQA 2EBJA 1IYLA 2EK8A 5AG7A 1PU9A 1M4DA 2PE3A 3B8GA 3LMSA 2PJ0A 4AVCA 1PUAA 2NYQA 4JYWA 4PXDA 3TFYA 3FVLA 2FL4A 3JTKA 4KZTA 3B3CA 4U5YA 4CYNA 2QVPA 2I3CA 3ZJ0A 3N5FA 1ZG7A 3VWDA 2B4BA 4KVOE 2PJ6A 1BPNA 2O4HA 4F0XA 3N7ZA 2CY2A 4CAEA 3WC5A 3EXNA 3FEDA 3D4UA 3NH5A 1YW4A 4OAEA 4RN7A 4A31A 2F5IA 4BD9A 3TO6A 3R9FA 3RO0A 4CGPA 2PJ4A 1JWQA 4F6AA 1F57A 2VQYA 4LUAA 2V8VA 2YGWA 3PFEA 3MRUA 4R76A 4E8OA 3D8PA 3HLPA 4NCZA 2ZEFA 2ZEEA 5ISVA 1DE4C 5D29A 3IWEA 3ISXA 1YW6A 1CM0A 3W6XA 4O23A 3RBUA 3TE4A 2OZGA 2IJZA 2BOAA 1YMEA 3V7ZA 3PRTA 3SJEA 4KOVA 3W91A 4AXVA 1XOVA 4KOXA 4OIWA 3S6FA 1H8LA 5KTCA 3H8GA 1ZG9A 1DTDA 2PVVA 5JQ4A 3GY9A 2BL1A 4QC6A 2PIZA 5I4MA 4KORA 3TX8A 2J8NA 4C7IA 5EBVA 4EMEA 3F0AA 4UIAA 4FD7A 1S3ZA 4MY3A 1YSJA 2K5TA 3D7GA 5H84A 5C88A 4XPDB 2ARHA 4M6IA 3D68A 2B5GB 3IWGA 4XPLA 5JM6A 2PJCA 1XJOA 3QAYA 4QBJA 5HXDA 3RZAA 4NGQA 1S7LA 4MHDA 4H6ZA 1CJWA 4E2AA 5HMNA 3SJXA 2PJ5A 2PR1A 3LODA 4OIDA 4LQ6A 5JGFA 5K8MA 4DJLA 1F2PA 2PJ3A 3ZZIA 2JEVA 4P4BA 4FWUA 4A32A 2CNMA 5EMIA 4R3LA 2QYVA 3K2KA 4ONWA 4B12A 4GS4A 1JQGA 1Y7EA 1YREA 2OU2A 3PEIA 3FX6A 3T8WA 1ELLP 2VZZA 2ZOGA 1ELMP 4KOYA 2PSWA 2REFA 4JZ0A 3CPAA 4HNYB 3S6GA 2O53A 1NSLA 4AG9A 2D4OA 2B4DB 2EWBA 4FD4A 4A37A 4YGOA 1R3NA 6CPAA 4P4FA 4PV6A 4MMOA 2EO8A 3FNCA 5DWMA 3FB3A 4DUKA 1S5KA 2GIVA 2ZEPA 5F49A 4F8ZA 4RUHA 3NH4A 5LYLA 4AB7A 2OOTA 2QECA 4OC1A 5K8OA 4F9VA 3TOAA 4MCQA 3D2PA 4ZX9A 3CXSA 4MFPA 1YVOA 2Q7BA 4H89A 3MN8A 4JJXA 3DGVA 3TO9A 2X7BA 4KVME 2GREA 5F46A 1CG2A 1L0CA 2J9AA 2ZXVA 1BPMA 2FCKA 1XF8A 3KL9A 4P45A 1IOIA 2OZUA 4H6UA 1VHEA 4CRYB 4MHYA 4R8FA 3G8WA 4E0AA 3TTHA 3D3SA 4B14A 3FYNA 2CTBA 3KQXA 4EWTA 5G22A 1ZLIA 3HUVA 1Y9WA 4BBHA 1PCAA 1Q7LA 4NGRA 4OC3A 4CYOA 1J4JA 3IEHA 2D4PA 2ZW7A 3JVNA 4KOWA 4XPKA 3I9SA 2CNSA 4MY0A 2Q43A 1YR0A 3IIBA 3IJ3A 3WABA 2NMTA 4C2ZA 2A4NA 5LRKA 2WUUA 4MRIA 3D7FA 3PP9A 2BSWA 3EFAA 3H8EA 3JRUA 4KOSA 5AGEA 3B7IA 1EE3P 3PFOA 4UA3A 2B3UA 2ZOFA 1ARLA 4A94A 3CT9A 4KS9A 1S60A 5A27A 2Z3OA 1PYTB 5AG4A 7CPAA 3NA6A 3T9YA 3DDDA 1IIDA 3MGDA 3QNVA 2WSAA 4IK2A 3L2NA 4QVTA 5LYDA 2ZEOA 4M6HA 4YFJA 1AMPA 4NGSA 1UWYA 1V0CA 2VXKA 2PJ2A 4NGTA 1Y0RA 1Z2LA 4MHPA 4UCMA 1VHOA 3VWEA 2Z3LA 3IU2A 4MFJA 1LAMA 2WZNA 1IB1E 2P6EA 4A38A 2PRQA 1QQ9A 1TKHA 2ZEHA 3EY5A 2HB6A 3W6SA 4R87A 2ZELA 4MCPA 1YK3A 2ABZA 1RTQA 1Y0YA 2GANA 4A30A 4JLYA 1TXRA 4OC5A 2GFQA 4H2KA 4XNHC 3R96A 4CGLA 1K4JA 2VBQA 4P4EA 4Y49B 4P10A 4B5PA 1S7KA 2AFXA 3H8FA 3FH4A 3KZWA 2JLMA 3D66A 4UEEA 4PPZA 1LAPA 1Z8WA 4HNXB 4QUSA 1LCPA 2CF4A 4L89A 2Z0ZA 2FVGA 4MJ8A 4P4DA 4Q38A 1QSMA 3GUXA 2B58A 2DPSA 2WYRA 5A28A 4YRHA 2VEZA 1YLOA 2AFSA 2Z3MA 4IUSA 4MFZA 4PK2A 3WC7A 4TNUA 2VZYA 2OB0A 1YGHA 4PXBA 1IYKA 1VIXA 3PZJA 1M1DA 1AYEA 1TF8A 4RS2A 2P6GA 1TKFA 2XEJA 4X8IA 2G9DA 5DS0A 4KSAA 2C6PA 5G20A 2R98A 3KASA 3KR4A 4FBEA 3IC1A 4MI4A 5J8CA 1RO5A 1MK4A 3D67A 4EFDA 4ZY2A 5AG6A 1I1DA 4NGNA 5E96A 2PQ8A 2PC1A 4EVYA 1Y7RA 3ISZA 3KHZA 1LFWA 3BLNA 2B4DA 3QAHA 2DEAA 5BWAB 4CYQA 1FNOA 4MHZA 1ON0A 2Z3KA 4B13A 4G1PA 2XEIA 1I21A 3I3GA 2PR8A 4WJBA 4NSQA 4ORFA 2Q4ZA 1IU8A 3R1KA 1XBUA 4UFXA 1QMUA 4NJRA 3SJGA 2HQYA 3LD2A 3G3SA 5G1ZA 3B2YA 3SI0A 3GYAA 4CRZB 3R95A 3RYOA 4HNWB 2I00A 3D7HA 3FJUA 2NSMA 2Z3PA 3NFZA 1IOFA 2V8GA 3K9UA 2Q7SA 2Q0YA 1F2OA 3DR6A 3FIXA 4IHMA 4A33A 4R57A 5I0CA 4ZX8A 5K8PA 4CGOA 3BXMA 3FF3A 4ZBGA 2RC4A 5KTAA 1VGYA 2DF5A 3WR7A 3CDXA 5CNPA 1CX8A 1XRYA 3R9EA 3SJFA 1YX0A 4Q36A 4U9ZA 4YU9A 3S6KA 4JWPA 4IF5A 4F9UA 3TOBA 5ELYA 5G21A 2F7VA 3BI1A 3PBBA 2Y0MA 3WT4A 2HC9A 4P4JA 4L8AA 4MFLA 1CP6A 1Z5RA 2GLJA 5C82A 2R1IA 1KZFA 2ODFA 2ZW6A 4OMEA 4A2ZA 1Q2DA 4R3KA 1CPSA 2XEFA 4IAVA 1XMBA 4X2TA 3KI9A 4OC0A 1NSAA 4PXEA 4A95A 2Q51A 1ZO0A 2Z3NA 4A39A 4NGMA 4WWVA 4ZY1A 3I1UA 4CAXA 4M6GA 2F8HA 2FT0A 2C6CA 4UCPA 4AVAA 2B3VA 2AJ6A 2ZEMA 4M85A 4F0YA 3PB4X 3VARA 1FT7A 4CGNA 2Q04A 1HEEA 2YNCA 3EO4A 4MCSA 4J3GA 4X3RA 4C2YA 3PB9X 1R43A 4OADA 4CAFA 1Z8TA 1P0HA 1Z8XA 4I49A 2Q4YA 2J8RA 3D2MA 3OWCA 4MXUA 2IL4A 1VKCA 3NE8A 4CGMA 2C1CA 4UWIA 1B87A 1XFOA 3E0KA 4NXYA 1M44A 1SQHA 3TO7A 1MJ9A 2KCWA 3H4QA 1IICA 4TWEA 3SXOA 2VI7A 2QIRA 1M4GA 1YLEA 1TKJA 2P6FA 4JD6A 4PQAA 4UIBA 1CP7A 1BLLE 2RB7A 2EUIA 3V8IA 1KWMA 3D7DA 5IB9A 3SI2A 2JBKA 4MFKA 4R9MA 8CPAA 4KLVA 1R57A 3GKRA 4FUUA 2GE3A 2AFUA 3PBEA 3TT2A 2R8VA 4UF4A 1BOBA 5HVHA 1M4IA 4NGPA 3TC8A 2O28A 4KUBA 3SI1A 2BCOA 2PJ8A 5J1QA 1N71A 1WWZA 5F47A 3F5BA 2PJBA 3PB6X 4MFQA 2PVWA 4P4IA 3LWUA 2YNEA 1TIQA 2EVNA 4MHNA 2GLFA 5J8FA 3DNSA 2WPWA 2XEGA 4R6TA 4P6YA 2PJ9A 4C2XA 2G3AA 2B5GA 2IQ6A 3DLJA 1ARMA 4CYPA 4CPAA 2JEWA 1AUGA 2HV2A 1S7NA 2GU2A 2PJAA 2REEA 3FECA 4GXHA 4BMHA 2HUZA 3EC4A 4HPSA 3DR8A 4NJQA 4B10A 2CIJA 2PCUA 2YNDA 3RNZA 4XPDC 1ZLHA 2BO9A 3FMCA 4NF1A 3S9NA 1LRZA 5CPAA 1WK4A
chains in the Genus database with same CATH topology
4K30A 2R7HA 3TCVA 2PRBA 4PSXA 3SHPA 4CAWA 4XNHB 2PDOA 4B11A 1YVKA 1VHSA 3IGRA 5IB0A 1KUVA 2BEIA 3F8KA 5H86A 4M3SA 4DNCA 2G3TA 2OH1A 3FBUA 1QSOA 3NE7A 3C26A 2AE6A 4B5PB 2ATRA 2Q4VA 3P2HA 4UFWA 1GHEA 1Z4EA 4JXQA 3SXNA 3JUWA 1Z4RA 1Z9UA 4AVBA 3UY5A 4UWJA 4ONUA 3CXQA 1P4NA 4U9YA 5GCNA 1WK4A 2FXFA 1B6BA 3BJ7A 4X5KA 5FVJA 1U6MA 2C27A 1BO4A 4KUAA 4B5OA 4OLLA 4QB9A 4CAVA 5JPHA 1FY7A 1OZPA 2JDCA 1MJBA 2JDDA 5KTDA 4ZGYB 4II9A 4UBRA 4JXRA 2OZHA 1NE9A 4KLWA 3QB8A 4UFVA 2BUEA 4UCNA 2FE7A 1XIXA 5IX3A 3FRMA 3R9GA 4KOTA 4AG7A 1QSTA 2QMLA 3A9LA 2ZW4A 2DXQA 3P2FA 5EC4A 2CNTA 5IV0A 1S7FA 3FXTA 4KVXA 5AG5A 1Q2CA 1NMTA 1XEBA 5DWNA 2FIAA 2I79A 5HH1A 1RXTA 1Q2YA 2WPXA 4PK3A 2YNCC 3KKWA 3CXPA 4KSFA 4PSWA 4LX9A 2CXAA 2DPTA 1MJAA 2ZW5A 2FSRA 2FS5A 4KOUA 1XE4A 4FD5A 2H5MA 4Y49C 3BJ8A 1KUXA 1QSNA 2FIWA 2Z11A 1XMTA 2Q44A 4C7HA 4CS0B 1QSRA 1I12A 2ZPAA 3IU1A 3T90A 4NEXA 1UFHA 2G0BA 5F48A 1KUYA 3S6HA 4C68A 3H5ZA 2J8MA 2P0WA 4MBUA 4FD6A 3PGPA 3DSBA 4HKFA 1Y9KA 2Z10A 4RI1A 1IYLA 5AG7A 1PU9A 1M4DA 3B8GA 4AVCA 1PUAA 3TFYA 4KZTA 2FL4A 3JTKA 4CYNA 4U5YA 3ZJ0A 3VWDA 2B4BA 4KVOE 4F0XA 3N7ZA 2CY2A 4CAEA 3EXNA 4OAEA 4A31A 2F5IA 3TO6A 3R9FA 4CGPA 4F6AA 2VQYA 4LUAA 2YGWA 4E8OA 3D8PA 4NCZA 5ISVA 3IWEA 1CM0A 3W6XA 3TE4A 2OZGA 4EVYA 3W91A 4KOVA 4KOXA 3S6FA 5KTCA 5JQ4A 3GY9A 2BL1A 4QC6A 4KORA 4C7IA 2J8NA 5EBVA 3F0AA 4FD7A 1S3ZA 4MY3A 2K5TA 5H84A 5C88A 4XPDB 2ARHA 2B5GB 3IWGA 4XPLA 4QBJA 1S7LA 4MHDA 4H6ZA 1CJWA 4E2AA 5HMNA 3LODA 2PR1A 3ZZIA 2JEVA 4A32A 2CNMA 4R3LA 4B12A 4GS4A 1YREA 2OU2A 2VZZA 4KOYA 2PSWA 2REFA 4HNYB 3S6GA 1NSLA 4AG9A 2D4OA 2B4DB 4FD4A 4YGOA 4PV6A 3FNCA 5DWMA 3FB3A 1S5KA 2GIVA 5F49A 4AB7A 2QECA 3TOAA 3D2PA 3CXSA 4MFPA 1YVOA 2Q7BA 4H89A 4JJXA 5F46A 3TO9A 2X7BA 4KVME 1L0CA 2ZXVA 2FCKA 1XF8A 4CRYB 4H6UA 2OZUA 3G8WA 4E0AA 3TTHA 3D3SA 4B14A 3FYNA 5G22A 1Y9WA 4BBHA 4CYOA 1J4JA 2D4PA 2ZW7A 3JVNA 4KOWA 4XPKA 3I9SA 2CNSA 4MY0A 1YR0A 4C2ZA 2NMTA 2A4NA 2WUUA 3PP9A 2BSWA 3EFAA 4KOSA 5AGEA 4UA3A 2B3UA 4KS9A 1S60A 5A27A 2Z3OA 5AG4A 3T9YA 3DDDA 1IIDA 3MGDA 2WSAA 4QVTA 4YFJA 1V0CA 2VXKA 4UCMA 3VWEA 2Z3LA 3IU2A 4MFJA 1IB1E 2P6EA 3EY5A 3W6SA 4R87A 1YK3A 4A30A 2GANA 4JLYA 4XNHC 3R96A 4CGLA 1K4JA 2VBQA 4Y49B 4B5PA 1S7KA 2JLMA 4HNXB 4QUSA 4L89A 2Z0ZA 4Q38A 4MJ8A 1QSMA 2B58A 2DPSA 5A28A 4YRHA 2VEZA 2Z3MA 4PK2A 4IUSA 4MFZA 2VZYA 2OB0A 1YGHA 1IYKA 3PZJA 1M1DA 4RS2A 2P6GA 4KSAA 5G20A 2R98A 4MI4A 5J8CA 1RO5A 1MK4A 5AG6A 1I1DA 5E96A 2PQ8A 2PC1A 1Y7RA 3QAHA 3BLNA 2B4DA 5BWAB 4CYQA 1ON0A 2Z3KA 4B13A 1I21A 3I3GA 2PR8A 4NSQA 4ORFA 3R1KA 4UFXA 2HQYA 3LD2A 3G3SA 5G1ZA 3GYAA 4CRZB 3R95A 3RYOA 4HNWB 2I00A 2Z3PA 3K9UA 2Q0YA 3FIXA 3DR6A 4A33A 4R57A 5I0CA 4CGOA 4ZBGA 2RC4A 5KTAA 3WR7A 5CNPA 3R9EA 1YX0A 4Q36A 4U9ZA 3S6KA 4JWPA 4IF5A 3TOBA 5G21A 2Y0MA 4L8AA 4MFLA 5C82A 2R1IA 1KZFA 4A2ZA 1Q2DA 4R3KA 4A95A 1ZO0A 2Z3NA 4CAXA 2FT0A 4UCPA 4AVAA 2B3VA 2AJ6A 4M85A 4F0YA 4CGNA 2Q04A 2YNCA 3EO4A 4J3GA 4C2YA 4OADA 4CAFA 1P0HA 4I49A 2Q4YA 2J8RA 3D2MA 3OWCA 4CGMA 2IL4A 1VKCA 4UWIA 1B87A 3E0KA 4NXYA 1M44A 1SQHA 3TO7A 1MJ9A 2KCWA 3H4QA 1IICA 3SXOA 2VI7A 2QIRA 1M4GA 1YLEA 2P6FA 4JD6A 2EUIA 3V8IA 4MFKA 4R9MA 4KLVA 1R57A 3GKRA 2GE3A 3TT2A 2R8VA 1BOBA 1M4IA 2O28A 4KUBA 1N71A 1WWZA 5F47A 3F5BA 4MFQA 2YNEA 1TIQA 2EVNA 5J8FA 3DNSA 2WPWA 4C2XA 2G3AA 2B5GA 4CYPA 2HV2A 1S7NA 2REEA 4BMHA 2HUZA 3EC4A 3DR8A 2YNDA 4XPDC 4NF1A 1LRZA 4B10A 2ZW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A31 A;  4CGO A;  4B14 A;  4C7I A;  2YNC C;  2WSA A;  3H5Z A;  4C68 A;  2YNE A;  4UFV A;  5G22 A;  4A95 A;  4BBH A;  4CGP A;  4CYO A;  4UCN A;  4CYQ A;  4UFW A;  4B13 A;  5A28 A;  4UCM A;  4C2X A;  4B11 A;  4UCP A;  3IU2 A;  5AG7 A;  4CYP A;  4C2Z A;  5G21 A;  3IWE A;  4CGN A;  2WUU A;  4UFX A;  2YNC A;  3JTK A;  4C7H A;  4CYN A;  4A32 A;  4C2Y A;  2YND A;  5AGE A;  5G1Z A;  4CAF A;  3IU1 A;  5G20 A;  4A30 A;  4B12 A;  5AG5 A;  4CGL A;  4CGM A;  4A2Z A;  4CAE A;  5A27 A;  4B10 A;  5AG6 A;  5AG4 A;  4A33 A; 
#chains in the Genus database with same CATH topology
 4K30 A;  2CTC A;  2R7H A;  3TCV A;  2PRB A;  4PSX A;  2AFM A;  4LQG A;  3SHP A;  4CAW A;  4XNH B;  2RFH A;  2PDO A;  4B11 A;  1YVK A;  4OKO A;  4B6Z A;  1VHS A;  3IGR A;  5IB0 A;  3B3T A;  1KUV A;  4MCR A;  3B3W A;  3RAM A;  5D8N A;  1ZG8 A;  2BEI A;  2EK9 A;  3F8K A;  3IFE A;  3KHX A;  5H86 A;  5HVG A;  4M3S A;  4DNC A;  2G3T A;  2OH1 A;  3B3S A;  3FBU A;  2AFW A;  1IGB A;  1QSO A;  3NE7 A;  3C26 A;  1HDU A;  1A2Z A;  2AE6 A;  3VH9 A;  1X10 A;  5LYF A;  4B5P B;  2ATR A;  2Q4V A;  3KQZ A;  3GIU A;  3P2H A;  4UFW A;  2PJ7 A;  3S9M A;  1GHE A;  1TF9 A;  1Z4E A;  4JXQ A;  2ZEG A;  2AFO A;  3SXN A;  3CZX A;  3BI0 A;  1Z4R A;  1Z9U A;  3JUW A;  3K9T A;  4AVB A;  3UY5 A;  4UWJ A;  4ONU A;  3CXQ A;  1GYT A;  1P4N A;  4U9Y A;  5GCN A;  4UEF A;  1OBR A;  1B6B A;  1LOK A;  2FXF A;  3BJ7 A;  3NH8 A;  4X5K A;  5FVJ A;  1U6M A;  2C27 A;  3VAT A;  1BO4 A;  4KUA A;  4B5O A;  4OLL A;  4QB9 A;  4R7M A;  4CAV A;  5K8N A;  5JPH A;  1FY7 A;  1OZP A;  3S9L A;  3CPX A;  2JDC A;  1MJB A;  3LAC A;  5LRJ A;  3KGQ A;  2V8H A;  2JDD A;  3BHX A;  5KTD A;  4ZGY B;  1YQE A;  4II9 A;  4UBR A;  1IY7 A;  4JXR A;  2OZH A;  1NE9 A;  4KLW A;  3GLJ A;  3B35 A;  3QB8 A;  4UFV A;  2BUE A;  4UCN A;  5THW A;  4DYO A;  2FE7 A;  2OR4 A;  1XIX A;  4Z65 A;  4ZI6 A;  5IX3 A;  3FRM A;  2C6G A;  3R9G A;  4KOT A;  4AG7 A;  1QST A;  2QML A;  3A9L A;  4KSI A;  2ZW4 A;  2DXQ A;  3P2F A;  5EC4 A;  2CNT A;  4BIN A;  4ZYQ A;  2JBJ A;  1BAV A;  2ZED A;  2VL1 A;  1CPX A;  5IV0 A;  1S7F A;  3FXT A;  4KVX A;  5AG5 A;  1Q2C A;  1NMT A;  1XEB A;  2IMO A;  5DWN A;  2FIA A;  2I79 A;  5HH1 A;  5F09 A;  1RXT A;  4GM5 A;  1Q2Y A;  1X12 A;  2WPX A;  3V38 A;  3KR5 A;  4PK3 A;  1M4L A;  2YNC C;  5LRG A;  3KKW A;  3PB7 X;  3CXP A;  4OC4 A;  4KSF A;  4PSW A;  2V77 A;  4OC2 A;  4LX9 A;  2CXA A;  2DPT A;  1MJA A;  2ZW5 A;  4K3N A;  2FSR A;  2FS5 A;  4KOU A;  4YWY A;  2PIY A;  3IWW A;  4FAI A;  1XE4 A;  4FD5 A;  2POK A;  2H5M A;  4NFR A;  4Y49 C;  3BJ8 A;  1KUX A;  1QSN A;  2FIW A;  2Z11 A;  3GB0 A;  1XMT A;  2AFZ A;  2Q44 A;  4C7H A;  1QSR A;  2ANP A;  4CS0 B;  1I12 A;  2ZPA A;  3FEE A;  4Q7A A;  3IU1 A;  4PXC A;  3T90 A;  4NEX A;  1Z8L A;  4W9Y A;  1UFH A;  5HVF A;  2QJ8 A;  4OP4 A;  5LYI A;  2G0B A;  5JH9 A;  5F48 A;  3IO1 A;  1KUY A;  1CBX A;  4UEZ A;  3S6H A;  5CBM A;  4ZY0 A;  3WC6 A;  4P44 A;  4C68 A;  3H5Z A;  3B3V A;  1LAN A;  2J8M A;  2P0W A;  2V8D A;  2ZEN A;  4MBU A;  4FD6 A;  3PGP A;  3PB8 X;  3DSB A;  4HKF A;  2PJ1 A;  1Y9K A;  2Z10 A;  4RI1 A;  1HDQ A;  2EBJ A;  1IYL A;  2EK8 A;  5AG7 A;  1PU9 A;  1M4D A;  2PE3 A;  3B8G A;  3LMS A;  2PJ0 A;  4AVC A;  1PUA A;  2NYQ A;  4JYW A;  4PXD A;  3TFY A;  3FVL A;  2FL4 A;  3JTK A;  4KZT A;  3B3C A;  4U5Y A;  4CYN A;  2QVP A;  2I3C A;  3ZJ0 A;  3N5F A;  1ZG7 A;  3VWD A;  2B4B A;  4KVO E;  2PJ6 A;  1BPN A;  2O4H A;  4F0X A;  3N7Z A;  2CY2 A;  4CAE A;  3WC5 A;  3EXN A;  3FED A;  3D4U A;  3NH5 A;  1YW4 A;  4OAE A;  4RN7 A;  4A31 A;  2F5I A;  4BD9 A;  3TO6 A;  3R9F A;  3RO0 A;  4CGP A;  2PJ4 A;  1JWQ A;  4F6A A;  1F57 A;  2VQY A;  4LUA A;  2V8V A;  2YGW A;  3PFE A;  3MRU A;  4R76 A;  4E8O A;  3D8P A;  3HLP A;  4NCZ A;  2ZEF A;  2ZEE A;  5ISV A;  1DE4 C;  5D29 A;  3IWE A;  3ISX A;  1YW6 A;  1CM0 A;  3W6X A;  4O23 A;  3RBU A;  3TE4 A;  2OZG A;  2IJZ A;  2BOA A;  1YME A;  3V7Z A;  3PRT A;  3SJE A;  4KOV A;  3W91 A;  4AXV A;  1XOV A;  4KOX A;  4OIW A;  3S6F A;  1H8L A;  5KTC A;  3H8G A;  1ZG9 A;  1DTD A;  2PVV A;  5JQ4 A;  3GY9 A;  2BL1 A;  4QC6 A;  2PIZ A;  5I4M A;  4KOR A;  3TX8 A;  2J8N A;  4C7I A;  5EBV A;  4EME A;  3F0A A;  4UIA A;  4FD7 A;  1S3Z A;  4MY3 A;  1YSJ A;  2K5T A;  3D7G A;  5H84 A;  5C88 A;  4XPD B;  2ARH A;  4M6I A;  3D68 A;  2B5G B;  3IWG A;  4XPL A;  5JM6 A;  2PJC A;  1XJO A;  3QAY A;  4QBJ A;  5HXD A;  3RZA A;  4NGQ A;  1S7L A;  4MHD A;  4H6Z A;  1CJW A;  4E2A A;  5HMN A;  3SJX A;  2PJ5 A;  2PR1 A;  3LOD A;  4OID A;  4LQ6 A;  5JGF A;  5K8M A;  4DJL A;  1F2P A;  2PJ3 A;  3ZZI A;  2JEV A;  4P4B A;  4FWU A;  4A32 A;  2CNM A;  5EMI A;  4R3L A;  2QYV A;  3K2K A;  4ONW A;  4B12 A;  4GS4 A;  1JQG A;  1Y7E A;  1YRE A;  2OU2 A;  3PEI A;  3FX6 A;  3T8W A;  1ELL P;  2VZZ A;  2ZOG A;  1ELM P;  4KOY A;  2PSW A;  2REF A;  4JZ0 A;  3CPA A;  4HNY B;  3S6G A;  2O53 A;  1NSL A;  4AG9 A;  2D4O A;  2B4D B;  2EWB A;  4FD4 A;  4A37 A;  4YGO A;  1R3N A;  6CPA A;  4P4F A;  4PV6 A;  4MMO A;  2EO8 A;  3FNC A;  5DWM A;  3FB3 A;  4DUK A;  1S5K A;  2GIV A;  2ZEP A;  5F49 A;  4F8Z A;  4RUH A;  3NH4 A;  5LYL A;  4AB7 A;  2OOT A;  2QEC A;  4OC1 A;  5K8O A;  4F9V A;  3TOA A;  4MCQ A;  3D2P A;  4ZX9 A;  3CXS A;  4MFP A;  1YVO A;  2Q7B A;  4H89 A;  3MN8 A;  4JJX A;  3DGV A;  3TO9 A;  2X7B A;  4KVM E;  2GRE A;  5F46 A;  1CG2 A;  1L0C A;  2J9A A;  2ZXV A;  1BPM A;  2FCK A;  1XF8 A;  3KL9 A;  4P45 A;  1IOI A;  2OZU A;  4H6U A;  1VHE A;  4CRY B;  4MHY A;  4R8F A;  3G8W A;  4E0A A;  3TTH A;  3D3S A;  4B14 A;  3FYN A;  2CTB A;  3KQX A;  4EWT A;  5G22 A;  1ZLI A;  3HUV A;  1Y9W A;  4BBH A;  1PCA A;  1Q7L A;  4NGR A;  4OC3 A;  4CYO A;  1J4J A;  3IEH A;  2D4P A;  2ZW7 A;  3JVN A;  4KOW A;  4XPK A;  3I9S A;  2CNS A;  4MY0 A;  2Q43 A;  1YR0 A;  3IIB A;  3IJ3 A;  3WAB A;  2NMT A;  4C2Z A;  2A4N A;  5LRK A;  2WUU A;  4MRI A;  3D7F A;  3PP9 A;  2BSW A;  3EFA A;  3H8E A;  3JRU A;  4KOS A;  5AGE A;  3B7I A;  1EE3 P;  3PFO A;  4UA3 A;  2B3U A;  2ZOF A;  1ARL A;  4A94 A;  3CT9 A;  4KS9 A;  1S60 A;  5A27 A;  2Z3O A;  1PYT B;  5AG4 A;  7CPA A;  3NA6 A;  3T9Y A;  3DDD A;  1IID A;  3MGD A;  3QNV A;  2WSA A;  4IK2 A;  3L2N A;  4QVT A;  5LYD A;  2ZEO A;  4M6H A;  4YFJ A;  1AMP A;  4NGS A;  1UWY A;  1V0C A;  2VXK A;  2PJ2 A;  4NGT A;  1Y0R A;  1Z2L A;  4MHP A;  4UCM A;  1VHO A;  3VWE A;  2Z3L A;  3IU2 A;  4MFJ A;  1LAM A;  2WZN A;  1IB1 E;  2P6E A;  4A38 A;  2PRQ A;  1QQ9 A;  1TKH A;  2ZEH A;  3EY5 A;  2HB6 A;  3W6S A;  4R87 A;  2ZEL A;  4MCP A;  1YK3 A;  2ABZ A;  1RTQ A;  1Y0Y A;  2GAN A;  4A30 A;  4JLY A;  1TXR A;  4OC5 A;  2GFQ A;  4H2K A;  4XNH C;  3R96 A;  4CGL A;  1K4J A;  2VBQ A;  4P4E A;  4Y49 B;  4P10 A;  4B5P A;  1S7K A;  2AFX A;  3H8F A;  3FH4 A;  3KZW A;  2JLM A;  3D66 A;  4UEE A;  4PPZ A;  1LAP A;  1Z8W A;  4HNX B;  4QUS A;  1LCP A;  2CF4 A;  4L89 A;  2Z0Z A;  2FVG A;  4MJ8 A;  4P4D A;  4Q38 A;  1QSM A;  3GUX A;  2B58 A;  2DPS A;  2WYR A;  5A28 A;  4YRH A;  2VEZ A;  1YLO A;  2AFS A;  2Z3M A;  4IUS A;  4MFZ A;  4PK2 A;  3WC7 A;  4TNU A;  2VZY A;  2OB0 A;  1YGH A;  4PXB A;  1IYK A;  1VIX A;  3PZJ A;  1M1D A;  1AYE A;  1TF8 A;  4RS2 A;  2P6G A;  1TKF A;  2XEJ A;  4X8I A;  2G9D A;  5DS0 A;  4KSA A;  2C6P A;  5G20 A;  2R98 A;  3KAS A;  3KR4 A;  4FBE A;  3IC1 A;  4MI4 A;  5J8C A;  1RO5 A;  1MK4 A;  3D67 A;  4EFD A;  4ZY2 A;  5AG6 A;  1I1D A;  4NGN A;  5E96 A;  2PQ8 A;  2PC1 A;  4EVY A;  1Y7R A;  3ISZ A;  3KHZ A;  1LFW A;  3BLN A;  2B4D A;  3QAH A;  2DEA A;  5BWA B;  4CYQ A;  1FNO A;  4MHZ A;  1ON0 A;  2Z3K A;  4B13 A;  4G1P A;  2XEI A;  1I21 A;  3I3G A;  2PR8 A;  4WJB A;  4NSQ A;  4ORF A;  2Q4Z A;  1IU8 A;  3R1K A;  1XBU A;  4UFX A;  1QMU A;  4NJR A;  3SJG A;  2HQY A;  3LD2 A;  3G3S A;  5G1Z A;  3B2Y A;  3SI0 A;  3GYA A;  4CRZ B;  3R95 A;  3RYO A;  4HNW B;  2I00 A;  3D7H A;  3FJU A;  2NSM A;  2Z3P A;  3NFZ A;  1IOF A;  2V8G A;  3K9U A;  2Q7S A;  2Q0Y A;  1F2O A;  3DR6 A;  3FIX A;  4IHM A;  4A33 A;  4R57 A;  5I0C A;  4ZX8 A;  5K8P A;  4CGO A;  3BXM A;  3FF3 A;  4ZBG A;  2RC4 A;  5KTA A;  1VGY A;  2DF5 A;  3WR7 A;  3CDX A;  5CNP A;  1CX8 A;  1XRY A;  3R9E A;  3SJF A;  1YX0 A;  4Q36 A;  4U9Z A;  4YU9 A;  3S6K A;  4JWP A;  4IF5 A;  4F9U A;  3TOB A;  5ELY A;  5G21 A;  2F7V A;  3BI1 A;  3PBB A;  2Y0M A;  3WT4 A;  2HC9 A;  4P4J A;  4L8A A;  4MFL A;  1CP6 A;  1Z5R A;  2GLJ A;  5C82 A;  2R1I A;  1KZF A;  2ODF A;  2ZW6 A;  4OME A;  4A2Z A;  1Q2D A;  4R3K A;  1CPS A;  2XEF A;  4IAV A;  1XMB A;  4X2T A;  3KI9 A;  4OC0 A;  1NSA A;  4PXE A;  4A95 A;  2Q51 A;  1ZO0 A;  2Z3N A;  4A39 A;  4NGM A;  4WWV A;  4ZY1 A;  3I1U A;  4CAX A;  4M6G A;  2F8H A;  2FT0 A;  2C6C A;  4UCP A;  4AVA A;  2B3V A;  2AJ6 A;  2ZEM A;  4M85 A;  4F0Y A;  3PB4 X;  3VAR A;  1FT7 A;  4CGN A;  2Q04 A;  1HEE A;  2YNC A;  3EO4 A;  4MCS A;  4J3G A;  4X3R A;  4C2Y A;  3PB9 X;  1R43 A;  4OAD A;  4CAF A;  1Z8T A;  1P0H A;  1Z8X A;  4I49 A;  2Q4Y A;  2J8R A;  3D2M A;  3OWC A;  4MXU A;  2IL4 A;  1VKC A;  3NE8 A;  4CGM A;  2C1C A;  4UWI A;  1B87 A;  1XFO A;  3E0K A;  4NXY A;  1M44 A;  1SQH A;  3TO7 A;  1MJ9 A;  2KCW A;  3H4Q A;  1IIC A;  4TWE A;  3SXO A;  2VI7 A;  2QIR A;  1M4G A;  1YLE A;  1TKJ A;  2P6F A;  4JD6 A;  4PQA A;  4UIB A;  1CP7 A;  1BLL E;  2RB7 A;  2EUI A;  3V8I A;  1KWM A;  3D7D A;  5IB9 A;  3SI2 A;  2JBK A;  4MFK A;  4R9M A;  8CPA A;  4KLV A;  1R57 A;  3GKR A;  4FUU A;  2GE3 A;  2AFU A;  3PBE A;  3TT2 A;  2R8V A;  4UF4 A;  1BOB A;  5HVH A;  1M4I A;  4NGP A;  3TC8 A;  2O28 A;  4KUB A;  3SI1 A;  2BCO A;  2PJ8 A;  5J1Q A;  1N71 A;  1WWZ A;  5F47 A;  3F5B A;  2PJB A;  3PB6 X;  4MFQ A;  2PVW A;  4P4I A;  3LWU A;  2YNE A;  1TIQ A;  2EVN A;  4MHN A;  2GLF A;  5J8F A;  3DNS A;  2WPW A;  2XEG A;  4R6T A;  4P6Y A;  2PJ9 A;  4C2X A;  2G3A A;  2B5G A;  2IQ6 A;  3DLJ A;  1ARM A;  4CYP A;  4CPA A;  2JEW A;  1AUG A;  2HV2 A;  1S7N A;  2GU2 A;  2PJA A;  2REE A;  3FEC A;  4GXH A;  4BMH A;  2HUZ A;  3EC4 A;  4HPS A;  3DR8 A;  4NJQ A;  4B10 A;  2CIJ A;  2PCU A;  2YND A;  3RNZ A;  4XPD C;  1ZLH A;  2BO9 A;  3FMC A;  4NF1 A;  3S9N A;  1LRZ A;  5CPA A;  1WK4 A; 
#chains in the Genus database with same CATH homology
 4K30 A;  2R7H A;  3TCV A;  2PRB A;  4PSX A;  3SHP A;  4CAW A;  4XNH B;  2PDO A;  4B11 A;  1YVK A;  1VHS A;  3IGR A;  5IB0 A;  1KUV A;  2BEI A;  3F8K A;  5H86 A;  4M3S A;  4DNC A;  2G3T A;  2OH1 A;  3FBU A;  1QSO A;  3NE7 A;  3C26 A;  2AE6 A;  4B5P B;  2ATR A;  2Q4V A;  3P2H A;  4UFW A;  1GHE A;  1Z4E A;  4JXQ A;  3SXN A;  3JUW A;  1Z4R A;  1Z9U A;  4AVB A;  3UY5 A;  4UWJ A;  4ONU A;  3CXQ A;  1P4N A;  4U9Y A;  5GCN A;  1WK4 A;  2FXF A;  1B6B A;  3BJ7 A;  4X5K A;  5FVJ A;  1U6M A;  2C27 A;  1BO4 A;  4KUA A;  4B5O A;  4OLL A;  4QB9 A;  4CAV A;  5JPH A;  1FY7 A;  1OZP A;  2JDC A;  1MJB A;  2JDD A;  5KTD A;  4ZGY B;  4II9 A;  4UBR A;  4JXR A;  2OZH A;  1NE9 A;  4KLW A;  3QB8 A;  4UFV A;  2BUE A;  4UCN A;  2FE7 A;  1XIX A;  5IX3 A;  3FRM A;  3R9G A;  4KOT A;  4AG7 A;  1QST A;  2QML A;  3A9L A;  2ZW4 A;  2DXQ A;  3P2F A;  5EC4 A;  2CNT A;  5IV0 A;  1S7F A;  3FXT A;  4KVX A;  5AG5 A;  1Q2C A;  1NMT A;  1XEB A;  5DWN A;  2FIA A;  2I79 A;  5HH1 A;  1RXT A;  1Q2Y A;  2WPX A;  4PK3 A;  2YNC C;  3KKW A;  3CXP A;  4KSF A;  4PSW A;  4LX9 A;  2CXA A;  2DPT A;  1MJA A;  2ZW5 A;  2FSR A;  2FS5 A;  4KOU A;  1XE4 A;  4FD5 A;  2H5M A;  4Y49 C;  3BJ8 A;  1KUX A;  1QSN A;  2FIW A;  2Z11 A;  1XMT A;  2Q44 A;  4C7H A;  4CS0 B;  1QSR A;  1I12 A;  2ZPA A;  3IU1 A;  3T90 A;  4NEX A;  1UFH A;  2G0B A;  5F48 A;  1KUY A;  3S6H A;  4C68 A;  3H5Z A;  2J8M A;  2P0W A;  4MBU A;  4FD6 A;  3PGP A;  3DSB A;  4HKF A;  1Y9K A;  2Z10 A;  4RI1 A;  1IYL A;  5AG7 A;  1PU9 A;  1M4D A;  3B8G A;  4AVC A;  1PUA A;  3TFY A;  4KZT A;  2FL4 A;  3JTK A;  4CYN A;  4U5Y A;  3ZJ0 A;  3VWD A;  2B4B A;  4KVO E;  4F0X A;  3N7Z A;  2CY2 A;  4CAE A;  3EXN A;  4OAE A;  4A31 A;  2F5I A;  3TO6 A;  3R9F A;  4CGP A;  4F6A A;  2VQY A;  4LUA A;  2YGW A;  4E8O A;  3D8P A;  4NCZ A;  5ISV A;  3IWE A;  1CM0 A;  3W6X A;  3TE4 A;  2OZG A;  4EVY A;  3W91 A;  4KOV A;  4KOX A;  3S6F A;  5KTC A;  5JQ4 A;  3GY9 A;  2BL1 A;  4QC6 A;  4KOR A;  4C7I A;  2J8N A;  5EBV A;  3F0A A;  4FD7 A;  1S3Z A;  4MY3 A;  2K5T A;  5H84 A;  5C88 A;  4XPD B;  2ARH A;  2B5G B;  3IWG A;  4XPL A;  4QBJ A;  1S7L A;  4MHD A;  4H6Z A;  1CJW A;  4E2A A;  5HMN A;  3LOD A;  2PR1 A;  3ZZI A;  2JEV A;  4A32 A;  2CNM A;  4R3L A;  4B12 A;  4GS4 A;  1YRE A;  2OU2 A;  2VZZ A;  4KOY A;  2PSW A;  2REF A;  4HNY B;  3S6G A;  1NSL A;  4AG9 A;  2D4O A;  2B4D B;  4FD4 A;  4YGO A;  4PV6 A;  3FNC A;  5DWM A;  3FB3 A;  1S5K A;  2GIV A;  5F49 A;  4AB7 A;  2QEC A;  3TOA A;  3D2P A;  3CXS A;  4MFP A;  1YVO A;  2Q7B A;  4H89 A;  4JJX A;  5F46 A;  3TO9 A;  2X7B A;  4KVM E;  1L0C A;  2ZXV A;  2FCK A;  1XF8 A;  4CRY B;  4H6U A;  2OZU A;  3G8W A;  4E0A A;  3TTH A;  3D3S A;  4B14 A;  3FYN A;  5G22 A;  1Y9W A;  4BBH A;  4CYO A;  1J4J A;  2D4P A;  2ZW7 A;  3JVN A;  4KOW A;  4XPK A;  3I9S A;  2CNS A;  4MY0 A;  1YR0 A;  4C2Z A;  2NMT A;  2A4N A;  2WUU A;  3PP9 A;  2BSW A;  3EFA A;  4KOS A;  5AGE A;  4UA3 A;  2B3U A;  4KS9 A;  1S60 A;  5A27 A;  2Z3O A;  5AG4 A;  3T9Y A;  3DDD A;  1IID A;  3MGD A;  2WSA A;  4QVT A;  4YFJ A;  1V0C A;  2VXK A;  4UCM A;  3VWE A;  2Z3L A;  3IU2 A;  4MFJ A;  1IB1 E;  2P6E A;  3EY5 A;  3W6S A;  4R87 A;  1YK3 A;  4A30 A;  2GAN A;  4JLY A;  4XNH C;  3R96 A;  4CGL A;  1K4J A;  2VBQ A;  4Y49 B;  4B5P A;  1S7K A;  2JLM A;  4HNX B;  4QUS A;  4L89 A;  2Z0Z A;  4Q38 A;  4MJ8 A;  1QSM A;  2B58 A;  2DPS A;  5A28 A;  4YRH A;  2VEZ A;  2Z3M A;  4PK2 A;  4IUS A;  4MFZ A;  2VZY A;  2OB0 A;  1YGH A;  1IYK A;  3PZJ A;  1M1D A;  4RS2 A;  2P6G A;  4KSA A;  5G20 A;  2R98 A;  4MI4 A;  5J8C A;  1RO5 A;  1MK4 A;  5AG6 A;  1I1D A;  5E96 A;  2PQ8 A;  2PC1 A;  1Y7R A;  3QAH A;  3BLN A;  2B4D A;  5BWA B;  4CYQ A;  1ON0 A;  2Z3K A;  4B13 A;  1I21 A;  3I3G A;  2PR8 A;  4NSQ A;  4ORF A;  3R1K A;  4UFX A;  2HQY A;  3LD2 A;  3G3S A;  5G1Z A;  3GYA A;  4CRZ B;  3R95 A;  3RYO A;  4HNW B;  2I00 A;  2Z3P A;  3K9U A;  2Q0Y A;  3FIX A;  3DR6 A;  4A33 A;  4R57 A;  5I0C A;  4CGO A;  4ZBG A;  2RC4 A;  5KTA A;  3WR7 A;  5CNP A;  3R9E A;  1YX0 A;  4Q36 A;  4U9Z A;  3S6K A;  4JWP A;  4IF5 A;  3TOB A;  5G21 A;  2Y0M A;  4L8A A;  4MFL A;  5C82 A;  2R1I A;  1KZF A;  4A2Z A;  1Q2D A;  4R3K A;  4A95 A;  1ZO0 A;  2Z3N A;  4CAX A;  2FT0 A;  4UCP A;  4AVA A;  2B3V A;  2AJ6 A;  4M85 A;  4F0Y A;  4CGN A;  2Q04 A;  2YNC A;  3EO4 A;  4J3G A;  4C2Y A;  4OAD A;  4CAF A;  1P0H A;  4I49 A;  2Q4Y A;  2J8R A;  3D2M A;  3OWC A;  4CGM A;  2IL4 A;  1VKC A;  4UWI A;  1B87 A;  3E0K A;  4NXY A;  1M44 A;  1SQH A;  3TO7 A;  1MJ9 A;  2KCW A;  3H4Q A;  1IIC A;  3SXO A;  2VI7 A;  2QIR A;  1M4G A;  1YLE A;  2P6F A;  4JD6 A;  2EUI A;  3V8I A;  4MFK A;  4R9M A;  4KLV A;  1R57 A;  3GKR A;  2GE3 A;  3TT2 A;  2R8V A;  1BOB A;  1M4I A;  2O28 A;  4KUB A;  1N71 A;  1WWZ A;  5F47 A;  3F5B A;  4MFQ A;  2YNE A;  1TIQ A;  2EVN A;  5J8F A;  3DNS A;  2WPW A;  4C2X A;  2G3A A;  2B5G A;  4CYP A;  2HV2 A;  1S7N A;  2REE A;  4BMH A;  2HUZ A;  3EC4 A;  3DR8 A;  2YND A;  4XPD C;  4NF1 A;  1LRZ A;  4B10 A;  2ZW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...