4UFXA

Plasmodium vivax n-myristoyltransferase in complex with a pyridyl inhibitor (compound 19)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
385
structure length
385
Chain Sequence
MDYKFWYTQPVPKINDEFNESVNEPFISDNKVEDVRKDEYKLPPGYSWYVCDVKDEKDRSEIYTLLTDNYVEDDDNIFRFNYSAEFLLWALTSPNYLKTWHIGVKYDASNKLIGFISAIPTDICIHKRTIKMAEVNFLCVHKTLRSKRLAPVLIKEITRRINLENIWQAIYTAGVYLPKPVSDARYYHRSINVKKLIEIGFSSLNSRLTMSRAIKLYRVEDTLNIKNMRLMKKKDVEGVHKLLGSYLEQFNLYAVFTKEEIAHWFLPIENVIYTYVNEENGKIKDMISFYSLPSQILGNDKYSTLNAAYSFYNVTTTATFKQLMQDAILLAKRNNFDVFNALEVMQNKSVFEDLKFGEGDGSLKYYLYNWKCASFAPAHVGIVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Discovery of Pyridyl-Based Inhibitors of Plasmodium Falciparum N-Myristoyltransferase
pubmed doi rcsb
source organism Plasmodium vivax
total genus 116
structure length 385
sequence length 385
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2015-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ufxA00
4C2ZA 5AG5A 4A31A 3JTKA 4CGLA 4UCPA 4B10A 4A95A 4B11A 4CYOA 4A2ZA 4UCMA 3IU1A 2YNDA 4CGOA 5A28A 4BBHA 4CYQA 4C7IA 4A33A 4B13A 2YNEA 4B14A 5A27A 4CGMA 5G20A 4CYPA 5AG6A 4CGPA 4C68A 3IWEA 5G1ZA 4UFXA 4C7HA 5AG4A 2WUUA 2WSAA 2YNCA 5AG7A 4C2YA 4A32A 4UFWA 5AGEA 4CAEA 5G22A 4CAFA 4CYNA 4UCNA 4A30A 3IU2A 5G21A 3H5ZA 2YNCC 4UFVA 4CGNA 4B12A 4C2XA
chains in the Genus database with same CATH superfamily
3BXMA 4CAXA 2EWBA 4UA3A 2PJ2A 1LOKA 2DXQA 4M85A 5KTAA 1JWQA 1ZO0A 2JBJA 3PB9X 3DNSA 1S7KA 1QQ9A 2CTBA 2IL4A 4NF1A 2Z3PA 3B3TA 3FXTA 2ODFA 1R43A 3D3SA 3SI0A 3S9LA 4UIBA 1Q7LA 4A33A 2GANA 2J8NA 3B3WA 3IWGA 4IUSA 4OADA 4H89A 1R3NA 2WPWA 2PR1A 1S7NA 3MGDA 2BL1A 3BJ7A 3S6HA 4ZGYB 2AFOA 2VZYA 4WJBA 1Y9KA 2ZEGA 3EXNA 4KS9A 1XE4A 3RO0A 4CAFA 3TFYA 4UCNA 1WK4A 2YNCC 1KZFA 1VHOA 4PXBA 3GUXA 3PRTA 4Y49B 5DWNA 3CXSA 5I0CA 5JGFA 4C2ZA 4CRZB 1XIXA 5F46A 1HEEA 2ZW6A 4JWPA 4MCPA 3WC6A 4EMEA 2VQYA 1F57A 4OC2A 4AVCA 4KVME 4A39A 4CAVA 3BHXA 5EBVA 1R57A 4B5OA 1VIXA 1Y0YA 4KOUA 2GU2A 4B13A 2OB0A 3B3SA 5HH1A 2V8GA 2PC1A 2WPXA 2BO9A 2AFMA 4UF4A 3D7GA 1TIQA 2J9AA 4J3GA 3KQXA 4P4EA 4C68A 3PB4X 4F9UA 2QIRA 5HXDA 4DNCA 2P6GA 4UFWA 3KZWA 6CPAA 2R8VA 1VHEA 2Q7SA 1N71A 1X12A 2NSMA 3D2MA 2Q4VA 2C27A 4CGNA 3B2YA 1ZG9A 4GM5A 5FVJA 4OC4A 3WC7A 3W91A 4UCPA 1Y9WA 2DPTA 4ZI6A 1GYTA 2REEA 2FE7A 3IWWA 1CM0A 4ZY0A 4CGOA 2ZW7A 2ZW5A 4MXUA 4H2KA 1YW6A 2V8HA 5EC4A 4CYQA 4RUHA 4GXHA 2OU2A 2JLMA 1PYTB 2CY2A 5H86A 2Z3LA 3PBEA 2EK8A 1ARLA 3TOBA 1A2ZA 4NGQA 2WUUA 4R6TA 3FECA 3LODA 1IIDA 4GS4A 1IOFA 5ELYA 2PCUA 2B5GB 1LANA 4K30A 1MJ9A 5D29A 3SXOA 2OZGA 2VXKA 4F6AA 4MFJA 5J8FA 2O4HA 2GE3A 2PJ8A 2IMOA 2C6GA 5H84A 2Z3NA 5AG5A 1M4IA 4A31A 2FS5A 2REFA 2AFWA 4MFPA 3S6GA 4PXCA 3KASA 2ZEHA 2XEFA 4KUAA 1NSLA 3SJEA 1NMTA 2IJZA 5LRKA 3IC1A 1EE3P 4MHDA 3V7ZA 1BPMA 1TKJA 4MBUA 4F8ZA 2PJBA 5K8NA 3S9NA 2PRBA 3GYAA 5LYFA 4MI4A 1ZLHA 4P4FA 3S6FA 2Z11A 3FNCA 4JJXA 3R9EA 3PB8X 2QECA 3FVLA 4FAIA 1TF9A 2ATRA 2OZUA 4MJ8A 3FX6A 4FBEA 1P4NA 1QSMA 3VARA 4UFXA 5KTCA 4BD9A 3TE4A 2PJAA 2B58A 2JDCA 1ON0A 4YGOA 1IY7A 1B6BA 4QBJA 5K8OA 2EUIA 2G3TA 4KOTA 3R1KA 4R76A 4UFVA 2O53A 1YW4A 4IHMA 2C6CA 3BJ8A 2FIAA 3RAMA 4CGLA 4AB7A 2RB7A 1HDQA 2XEGA 1XRYA 2ANPA 4UEZA 4NGMA 4L89A 4OC1A 4A94A 5F47A 4H6ZA 1CP6A 1K4JA 3EFAA 4MCSA 4MHPA 4MCQA 4XNHB 2PIYA 3K2KA 3S6KA 4ZY2A 4AG7A 1AMPA 3IGRA 1TKHA 4HNYB 4OIWA 3WABA 4R7MA 3ZJ0A 2B4DA 2AFXA 2B3UA 2ZEFA 1M1DA 1ZG8A 2ZENA 3K9TA 4R87A 4CPAA 3H8EA 2G3AA 2AFUA 4JYWA 5AG4A 1Y7EA 4TNUA 3KGQA 5K8MA 1I12A 4NCZA 4M6GA 2J8RA 4AG9A 1AUGA 4OIDA 5CNPA 4B12A 4YFJA 3FF3A 4NGRA 1BAVA 3I1UA 3KI9A 4NGPA 4KOVA 3TO9A 1TXRA 2Q0YA 3FH4A 3CXQA 2ZEPA 3ISZA 1CG2A 4A2ZA 4AXVA 2Z3MA 4PV6A 4UIAA 4F0XA 1Z4RA 3DR6A 4HKFA 3S9MA 1CX8A 1YVKA 3KR4A 4RS2A 2PVVA 3SJGA 4QB9A 2D4OA 3PGPA 4KSIA 4OC3A 4FD6A 3F0AA 3P2FA 3UY5A 1I1DA 1YGHA 1XF8A 3FMCA 3IFEA 2B5GA 4UWJA 3KQZA 4EVYA 4KSFA 4F9VA 1IYKA 1ARMA 1LCPA 3FJUA 4CAEA 3PB6X 1KUYA 1LRZA 1SQHA 5DS0A 5HMNA 4II9A 4ZX9A 5IB0A 4PSWA 5KTDA 3BI1A 4R8FA 3H4QA 3N7ZA 3D4UA 3D7FA 1M44A 1DE4C 4KUBA 1I21A 2Z0ZA 2Y0MA 4FD4A 4OC5A 4EWTA 4NGNA 3KL9A 1FT7A 4FWUA 1S7FA 5BWAB 3B3CA 3G3SA 3LWUA 2ZW4A 4E2AA 4KOWA 2BUEA 1U6MA 3MN8A 1VKCA 5LRJA 4Q36A 4KOSA 1LAMA 1Z8LA 4A38A 2YGWA 4OC0A 5LYIA 2P0WA 2H5MA 2V77A 4C7HA 4CAWA 4NSQA 1UWYA 1JQGA 3W6XA 1XBUA 3FRMA 3IU2A 4P6YA 4R9MA 2WYRA 2JBKA 4YWYA 3T90A 4OAEA 4UWIA 1H8LA 4F0YA 5EMIA 4B5PB 3PFEA 3GY9A 1ZG7A 2V8VA 4IAVA 2HUZA 1FNOA 4A95A 2FVGA 1PCAA 2CF4A 1CPSA 1NE9A 2DEAA 3FB3A 2CIJA 1BOBA 4C7IA 4MY3A 1Z5RA 2CTCA 2FT0A 1KUXA 5AG6A 1RXTA 3IWEA 3EY5A 3PZJA 1MK4A 4HNXB 1ELLP 2JEVA 1Z4EA 5HVFA 5LRGA 2IQ6A 5CPAA 1J4JA 3GB0A 2PJ9A 4DYOA 2CNMA 2G9DA 4LUAA 1TKFA 3KHXA 3DGVA 4MCRA 4YRHA 3ZZIA 2PQ8A 2AJ6A 1IB1E 3DR8A 2F7VA 2PJ3A 2HB6A 2HC9A 2PRQA 3IIBA 3LD2A 3PFOA 2A4NA 2I3CA 4MFLA 2EBJA 4XPDB 3QB8A 2FXFA 4X3RA 1IU8A 3ISXA 4UEEA 1LFWA 2FL4A 1YVOA 2PJ0A 2ZOGA 3VWDA 2JDDA 1KUVA 2ZOFA 4P45A 5IX3A 1Z8WA 2XEIA 5D8NA 4P4IA 3GLJA 1BLLE 4PXEA 2CXAA 4JD6A 4KVXA 4UEFA 3SJXA 4EFDA 4PSXA 1M4GA 3E0KA 3H5ZA 4PK2A 4HNWB 3DSBA 2Z10A 4KORA 4C2XA 3WT4A 1XMBA 3IU1A 3V8IA 2YNDA 2BEIA 3KR5A 4Z65A 3SXNA 3EO4A 4XPLA 1QMUA 3PBBA 3CXPA 7CPAA 4RN7A 3N5FA 2DPSA 4OKOA 4M3SA 2AFSA 1S3ZA 1XFOA 3NE8A 2D4PA 1QSNA 3HUVA 1PU9A 3D2PA 1CBXA 3G8WA 1S5KA 5G20A 4JXQA 3RBUA 2K5TA 4QUSA 1P0HA 4CGPA 2VEZA 3NH4A 3CPAA 1FY7A 2PJ4A 1ZLIA 4Q38A 3B35A 4NGTA 2PJ7A 3SJFA 2B4BA 4MHZA 3TTHA 2ZEEA 4A30A 4OP4A 1YQEA 2F8HA 2EK9A 2HQYA 4WWVA 2PJ6A 3PB7X 2ZEDA 3F8KA 4B11A 2OR4A 4U9ZA 3LACA 1YLOA 3HLPA 4NXYA 3FYNA 1CPXA 2C1CA 3WC5A 1PUAA 2PE3A 1XOVA 2AFZA 3I9SA 3RYOA 3JUWA 3TC8A 4P10A 4O23A 5HVGA 2QMLA 4FD5A 1QSTA 3B7IA 1Q2YA 2F5IA 5IB9A 1TF8A 2Q4YA 4C2YA 5JH9A 3T9YA 5CBMA 3I3GA 3DLJA 3CDXA 4RI1A 4MMOA 3MRUA 1UFHA 1YX0A 4I49A 4Y49C 2QYVA 3NFZA 5J8CA 4DUKA 1MJAA 3KKWA 4KLWA 4LQ6A 4OLLA 4ONWA 5ISVA 3DDDA 5LYLA 3D67A 4KSAA 5JQ4A 4E8OA 4QVTA 2EO8A 4X5KA 3TOAA 3L2NA 3RZAA 2WZNA 1M4LA 3JVNA 2YNEA 3JRUA 4HPSA 3OWCA 4KVOE 5THWA 3VATA 5A27A 4PPZA 3D8PA 4P4JA 3A9LA 4UBRA 2Q51A 3GIUA 3RNZA 2ZEMA 5G1ZA 3D66A 2BCOA 4Q7AA 4LQGA 4NGSA 4KOXA 2Z3OA 3SI1A 1V0CA 3IO1A 2R98A 3SHPA 4JXRA 2AE6A 1CP7A 2VL1A 3TO6A 1VHSA 2OH1A 2O28A 3NA6A 2KCWA 1MJBA 4KZTA 3TX8A 4PK3A 3TT2A 4JLYA 4NEXA 4M6IA 2PR8A 1Y7RA 5A28A 4BINA 1WWZA 2ZELA 1XEBA 4BBHA 4L8AA 5JPHA 4B14A 3VH9A 4FUUA 4XPKA 1XMTA 1VGYA 1YMEA 4X2TA 5F49A 4CYPA 3F5BA 1S7LA 5JM6A 2J8MA 4OMEA 2B4DB 1F2PA 4MHYA 4TWEA 2ARHA 1IICA 4R3KA 1HDUA 2DF5A 2X7BA 4KOYA 5G22A 2Q7BA 4MFQA 3PEIA 3QAHA 1IOIA 3QNVA 4DJLA 5HVHA 3R9FA 2GFQA 4PQAA 2RC4A 4B6ZA 4JZ0A 4R3LA 3B3VA 3H8GA 5C88A 2VI7A 1YLEA 2PIZA 1YR0A 2R7HA 3CZXA 3NE7A 3D7DA 4MFZA 3GKRA 4ORFA 4XPDC 4CS0B 3NH5A 3TCVA 1CJWA 3CT9A 1BPNA 1S60A 2FIWA 1Y0RA 1GHEA 5LYDA 4QC6A 2P6EA 4KLVA 1YREA 2R1IA 2QVPA 3FIXA 2FSRA 4P44A 2C6PA 2Z3KA 4MFKA 3BLNA 2WSAA 2V8DA 4W9YA 3B8GA 4A32A 3V38A 2ZPAA 4AVAA 2ABZA 1OZPA 2VZZA 4P4DA 1BO4A 2PJCA 4PXDA 4R57A 1OBRA 3LMSA 5E96A 3W6SA 2HV2A 3EC4A 1IYLA 3D68A 5F09A 3K9UA 3KHZA 1F2OA 3R96A 3VWEA 4A37A 4CYNA 1L0CA 1X10A 4B10A 1YK3A 4IF5A 2ZEOA 3SI2A 8CPAA 4UCMA 2VBQA 2XEJA 1ELMP 5GCNA 3TO7A 1AYEA 5IV0A 3QAYA 1Q2DA 2BOAA 4ZY1A 3FEDA 4XNHC 5I4MA 3P2HA 1Z2LA 4ONUA 2PJ5A 1Z8TA 1B87A 2PDOA 2QJ8A 4CGMA 3PP9A 4NFRA 3FEEA 1QSOA 2POKA 4M6HA 2NYQA 2YNCA 4LX9A 5AG7A 4E0AA 4NJRA 3R9GA 4MY0A 2G0BA 2GLFA 4ZYQA 1KWMA 1XJOA 2GREA 4H6UA 3WR7A 4B5PA 3T8WA 1RO5A 2CNTA 3H8FA 2PVWA 3JTKA 5C82A 1RTQA 1YSJA 2BSWA 2I79A 3C26A 2EVNA 4MHNA 2B3VA 2CNSA 2OOTA 2Q44A 4CYOA 2I00A 3NH8A 3D7HA 4YU9A 4MRIA 3CPXA 2NMTA 4G1PA 3BI0A 4P4BA 4X8IA 3R95A 4NJQA 4IK2A 5J1QA 2Q43A 5F48A 1QSRA 2GLJA 4K3NA 4FD7A 5K8PA 1DTDA 2GIVA 2RFHA 4CRYB 1M4DA 2OZHA 2Q04A 2ZXVA 3IEHA 4ZBGA 1NSAA 1Z9UA 3IJ3A 4U5YA 4ZX8A 5AGEA 1Z8XA 4AVBA 1Q2CA 1LAPA 4U9YA 2FCKA 4BMHA 2PJ1A 5G21A 5DWMA 1IGBA 2JEWA 2P6FA 2Q4ZA 3FBUA 2PSWA
chains in the Genus database with same CATH topology
4CAXA 4UA3A 4M85A 2DXQA 5KTAA 1ZO0A 3DNSA 1S7KA 2IL4A 4NF1A 2Z3PA 3FXTA 3D3SA 4A33A 2GANA 2J8NA 3IWGA 4IUSA 4OADA 4H89A 2WPWA 2PR1A 1S7NA 3MGDA 2BL1A 3BJ7A 3S6HA 4ZGYB 2VZYA 1Y9KA 3EXNA 4KS9A 1XE4A 4CAFA 3TFYA 4UCNA 1WK4A 2YNCC 1KZFA 5I0CA 4Y49B 5DWNA 3CXSA 4C2ZA 4CRZB 1XIXA 5F46A 2ZW6A 4JWPA 2VQYA 4AVCA 4KVME 4CAVA 5EBVA 1R57A 4B5OA 4KOUA 4B13A 2OB0A 5HH1A 2PC1A 2WPXA 4J3GA 1TIQA 4C68A 2QIRA 4DNCA 2P6GA 4UFWA 2R8VA 1N71A 3D2MA 2Q4VA 2C27A 4CGNA 5FVJA 3W91A 4UCPA 1Y9WA 2DPTA 2REEA 2FE7A 1CM0A 4CGOA 2ZW7A 2ZW5A 4CYQA 5EC4A 2OU2A 2JLMA 2CY2A 5H86A 2Z3LA 3TOBA 2WUUA 3LODA 1IIDA 4GS4A 2B5GB 4K30A 1MJ9A 4F6AA 3SXOA 2OZGA 2VXKA 4MFJA 5J8FA 2GE3A 5H84A 2Z3NA 5AG5A 1M4IA 4A31A 2FS5A 2REFA 4MFPA 3S6GA 4KUAA 1NSLA 1NMTA 4MHDA 4MBUA 2PRBA 3GYAA 4MI4A 3S6FA 2Z11A 3FNCA 4JJXA 3R9EA 2QECA 2ATRA 2OZUA 4MJ8A 1P4NA 1QSMA 5KTCA 4UFXA 3TE4A 2B58A 2JDCA 1ON0A 4YGOA 1B6BA 4QBJA 2EUIA 2G3TA 4KOTA 3R1KA 4UFVA 3BJ8A 2FIAA 4CGLA 4AB7A 4L89A 5F47A 4H6ZA 1K4JA 3EFAA 4XNHB 3S6KA 4AG7A 3IGRA 4HNYB 3ZJ0A 2B4DA 2B3UA 4R87A 1M1DA 5AG4A 2G3AA 1I12A 4NCZA 2J8RA 4AG9A 5CNPA 4B12A 4YFJA 3TO9A 4KOVA 2Q0YA 3CXQA 4A2ZA 2Z3MA 4PV6A 4F0XA 1Z4RA 3DR6A 4HKFA 4RS2A 1YVKA 4QB9A 2D4OA 3PGPA 4FD6A 3F0AA 3P2FA 3UY5A 1I1DA 1YGHA 1XF8A 2B5GA 4UWJA 4EVYA 4KSFA 1IYKA 4CAEA 1KUYA 1LRZA 1SQHA 5HMNA 4II9A 5IB0A 4PSWA 5KTDA 3H4QA 3N7ZA 1M44A 4KUBA 1I21A 2Z0ZA 2Y0MA 4FD4A 1S7FA 5BWAB 3G3SA 2ZW4A 4E2AA 4KOWA 2BUEA 1U6MA 1VKCA 4Q36A 4KOSA 4CAWA 2YGWA 4C7HA 2P0WA 2H5MA 4NSQA 3W6XA 3FRMA 3IU2A 4R9MA 3T90A 4OAEA 4UWIA 4F0YA 4B5PB 3GY9A 2HUZA 4A95A 1NE9A 3FB3A 1BOBA 4C7IA 4MY3A 2FT0A 1KUXA 5AG6A 1RXTA 3IWEA 3EY5A 3PZJA 1MK4A 4HNXB 2JEVA 1Z4EA 1J4JA 2CNMA 4LUAA 4YRHA 3ZZIA 2PQ8A 2AJ6A 1IB1E 3DR8A 3LD2A 4MFLA 2A4NA 4XPDB 3QB8A 2FXFA 2FL4A 1YVOA 3VWDA 2JDDA 1KUVA 5IX3A 2CXAA 4JD6A 4KVXA 4PSXA 1M4GA 3E0KA 3H5ZA 4PK2A 4HNWB 3DSBA 2Z10A 4KORA 4C2XA 3IU1A 3V8IA 2YNDA 2BEIA 3SXNA 3EO4A 4XPLA 3CXPA 2DPSA 4M3SA 1S3ZA 2D4PA 1QSNA 1PU9A 3D2PA 3G8WA 1S5KA 5G20A 4JXQA 2K5TA 4QUSA 1P0HA 4CGPA 2VEZA 1FY7A 4Q38A 2B4BA 3TTHA 4A30A 2HQYA 3F8KA 4B11A 4U9ZA 4NXYA 3FYNA 1PUAA 3I9SA 3RYOA 3JUWA 2QMLA 4FD5A 1QSTA 1Q2YA 2F5IA 2Q4YA 4C2YA 3T9YA 3I3GA 4RI1A 1UFHA 1YX0A 4I49A 4Y49C 5J8CA 1MJAA 3KKWA 4KLWA 4OLLA 5ISVA 3DDDA 4KSAA 5JQ4A 4E8OA 4QVTA 3TOAA 4X5KA 3JVNA 2YNEA 4KVOE 5A27A 3OWCA 3D8PA 4UBRA 3A9LA 5G1ZA 4KOXA 2Z3OA 1V0CA 2R98A 3SHPA 4JXRA 2AE6A 3TO6A 1VHSA 2OH1A 2O28A 2KCWA 1MJBA 4KZTA 4PK3A 3TT2A 4JLYA 4NEXA 2PR8A 1Y7RA 5A28A 1WWZA 4BBHA 1XEBA 4L8AA 5JPHA 4B14A 4XPKA 1XMTA 4CYPA 5F49A 3F5BA 1S7LA 2J8MA 2B4DB 2ARHA 1IICA 4R3KA 5G22A 4KOYA 2X7BA 2Q7BA 4MFQA 3QAHA 3R9FA 2RC4A 4R3LA 5C88A 2VI7A 1YLEA 1YR0A 2R7HA 3NE7A 4MFZA 4ORFA 4XPDC 3GKRA 4CS0B 3TCVA 1CJWA 1S60A 2FIWA 1GHEA 4QC6A 2P6EA 4KLVA 1YREA 2R1IA 3FIXA 2FSRA 2Z3KA 4MFKA 3BLNA 2WSAA 3B8GA 4A32A 4AVAA 2ZPAA 1OZPA 2VZZA 1BO4A 4R57A 3W6SA 5E96A 2HV2A 3EC4A 1IYLA 3K9UA 3VWEA 3R96A 4CYNA 1L0CA 4B10A 1YK3A 4IF5A 4UCMA 2VBQA 5GCNA 3TO7A 5IV0A 1Q2DA 4XNHC 3P2HA 4ONUA 1B87A 2PDOA 4CGMA 3PP9A 1QSOA 4LX9A 2YNCA 5AG7A 4E0AA 3R9GA 4MY0A 2G0BA 4H6UA 3WR7A 4B5PA 1RO5A 2CNTA 3JTKA 5C82A 2I79A 2BSWA 3C26A 4CYOA 2EVNA 2B3VA 2CNSA 2Q44A 2I00A 2NMTA 3R95A 5F48A 1QSRA 4FD7A 2GIVA 4CRYB 1M4DA 2OZHA 2Q04A 2ZXVA 4ZBGA 1Z9UA 4U5YA 5AGEA 4AVBA 1Q2CA 4U9YA 2FCKA 4BMHA 5G21A 5DWMA 2P6FA 3FBUA 2PSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2Z A;  5AG5 A;  4A31 A;  3JTK A;  4CGL A;  4UCP A;  4B10 A;  4A95 A;  4B11 A;  4CYO A;  4A2Z A;  4UCM A;  3IU1 A;  2YND A;  4CGO A;  5A28 A;  4BBH A;  4CYQ A;  4C7I A;  4A33 A;  4B13 A;  2YNE A;  4B14 A;  5A27 A;  4CGM A;  5G20 A;  4CYP A;  5AG6 A;  4CGP A;  4C68 A;  3IWE A;  5G1Z A;  4UFX A;  4C7H A;  5AG4 A;  2WUU A;  2WSA A;  2YNC A;  5AG7 A;  4C2Y A;  4A32 A;  4UFW A;  5AGE A;  4CAE A;  5G22 A;  4CAF A;  4CYN A;  4UCN A;  4A30 A;  3IU2 A;  5G21 A;  3H5Z A;  2YNC C;  4UFV A;  4CGN A;  4B12 A;  4C2X A; 
#chains in the Genus database with same CATH topology
 3BXM A;  4CAX A;  2EWB A;  4UA3 A;  2PJ2 A;  1LOK A;  2DXQ A;  4M85 A;  5KTA A;  1JWQ A;  1ZO0 A;  2JBJ A;  3PB9 X;  3DNS A;  1S7K A;  1QQ9 A;  2CTB A;  2IL4 A;  4NF1 A;  2Z3P A;  3B3T A;  3FXT A;  2ODF A;  1R43 A;  3D3S A;  3SI0 A;  3S9L A;  4UIB A;  1Q7L A;  4A33 A;  2GAN A;  2J8N A;  3B3W A;  3IWG A;  4IUS A;  4OAD A;  4H89 A;  1R3N A;  2WPW A;  2PR1 A;  1S7N A;  3MGD A;  2BL1 A;  3BJ7 A;  3S6H A;  4ZGY B;  2AFO A;  2VZY A;  4WJB A;  1Y9K A;  2ZEG A;  3EXN A;  4KS9 A;  1XE4 A;  3RO0 A;  4CAF A;  3TFY A;  4UCN A;  1WK4 A;  2YNC C;  1KZF A;  1VHO A;  4PXB A;  3GUX A;  3PRT A;  4Y49 B;  5DWN A;  3CXS A;  5I0C A;  5JGF A;  4C2Z A;  4CRZ B;  1XIX A;  5F46 A;  1HEE A;  2ZW6 A;  4JWP A;  4MCP A;  3WC6 A;  4EME A;  2VQY A;  1F57 A;  4OC2 A;  4AVC A;  4KVM E;  4A39 A;  4CAV A;  3BHX A;  5EBV A;  1R57 A;  4B5O A;  1VIX A;  1Y0Y A;  4KOU A;  2GU2 A;  4B13 A;  2OB0 A;  3B3S A;  5HH1 A;  2V8G A;  2PC1 A;  2WPX A;  2BO9 A;  2AFM A;  4UF4 A;  3D7G A;  1TIQ A;  2J9A A;  4J3G A;  3KQX A;  4P4E A;  4C68 A;  3PB4 X;  4F9U A;  2QIR A;  5HXD A;  4DNC A;  2P6G A;  4UFW A;  3KZW A;  6CPA A;  2R8V A;  1VHE A;  2Q7S A;  1N71 A;  1X12 A;  2NSM A;  3D2M A;  2Q4V A;  2C27 A;  4CGN A;  3B2Y A;  1ZG9 A;  4GM5 A;  5FVJ A;  4OC4 A;  3WC7 A;  3W91 A;  4UCP A;  1Y9W A;  2DPT A;  4ZI6 A;  1GYT A;  2REE A;  2FE7 A;  3IWW A;  1CM0 A;  4ZY0 A;  4CGO A;  2ZW7 A;  2ZW5 A;  4MXU A;  4H2K A;  1YW6 A;  2V8H A;  5EC4 A;  4CYQ A;  4RUH A;  4GXH A;  2OU2 A;  2JLM A;  1PYT B;  2CY2 A;  5H86 A;  2Z3L A;  3PBE A;  2EK8 A;  1ARL A;  3TOB A;  1A2Z A;  4NGQ A;  2WUU A;  4R6T A;  3FEC A;  3LOD A;  1IID A;  4GS4 A;  1IOF A;  5ELY A;  2PCU A;  2B5G B;  1LAN A;  4K30 A;  1MJ9 A;  5D29 A;  3SXO A;  2OZG A;  2VXK A;  4F6A A;  4MFJ A;  5J8F A;  2O4H A;  2GE3 A;  2PJ8 A;  2IMO A;  2C6G A;  5H84 A;  2Z3N A;  5AG5 A;  1M4I A;  4A31 A;  2FS5 A;  2REF A;  2AFW A;  4MFP A;  3S6G A;  4PXC A;  3KAS A;  2ZEH A;  2XEF A;  4KUA A;  1NSL A;  3SJE A;  1NMT A;  2IJZ A;  5LRK A;  3IC1 A;  1EE3 P;  4MHD A;  3V7Z A;  1BPM A;  1TKJ A;  4MBU A;  4F8Z A;  2PJB A;  5K8N A;  3S9N A;  2PRB A;  3GYA A;  5LYF A;  4MI4 A;  1ZLH A;  4P4F A;  3S6F A;  2Z11 A;  3FNC A;  4JJX A;  3R9E A;  3PB8 X;  2QEC A;  3FVL A;  4FAI A;  1TF9 A;  2ATR A;  2OZU A;  4MJ8 A;  3FX6 A;  4FBE A;  1P4N A;  1QSM A;  3VAR A;  4UFX A;  5KTC A;  4BD9 A;  3TE4 A;  2PJA A;  2B58 A;  2JDC A;  1ON0 A;  4YGO A;  1IY7 A;  1B6B A;  4QBJ A;  5K8O A;  2EUI A;  2G3T A;  4KOT A;  3R1K A;  4R76 A;  4UFV A;  2O53 A;  1YW4 A;  4IHM A;  2C6C A;  3BJ8 A;  2FIA A;  3RAM A;  4CGL A;  4AB7 A;  2RB7 A;  1HDQ A;  2XEG A;  1XRY A;  2ANP A;  4UEZ A;  4NGM A;  4L89 A;  4OC1 A;  4A94 A;  5F47 A;  4H6Z A;  1CP6 A;  1K4J A;  3EFA A;  4MCS A;  4MHP A;  4MCQ A;  4XNH B;  2PIY A;  3K2K A;  3S6K A;  4ZY2 A;  4AG7 A;  1AMP A;  3IGR A;  1TKH A;  4HNY B;  4OIW A;  3WAB A;  4R7M A;  3ZJ0 A;  2B4D A;  2AFX A;  2B3U A;  2ZEF A;  1M1D A;  1ZG8 A;  2ZEN A;  3K9T A;  4R87 A;  4CPA A;  3H8E A;  2G3A A;  2AFU A;  4JYW A;  5AG4 A;  1Y7E A;  4TNU A;  3KGQ A;  5K8M A;  1I12 A;  4NCZ A;  4M6G A;  2J8R A;  4AG9 A;  1AUG A;  4OID A;  5CNP A;  4B12 A;  4YFJ A;  3FF3 A;  4NGR A;  1BAV A;  3I1U A;  3KI9 A;  4NGP A;  4KOV A;  3TO9 A;  1TXR A;  2Q0Y A;  3FH4 A;  3CXQ A;  2ZEP A;  3ISZ A;  1CG2 A;  4A2Z A;  4AXV A;  2Z3M A;  4PV6 A;  4UIA A;  4F0X A;  1Z4R A;  3DR6 A;  4HKF A;  3S9M A;  1CX8 A;  1YVK A;  3KR4 A;  4RS2 A;  2PVV A;  3SJG A;  4QB9 A;  2D4O A;  3PGP A;  4KSI A;  4OC3 A;  4FD6 A;  3F0A A;  3P2F A;  3UY5 A;  1I1D A;  1YGH A;  1XF8 A;  3FMC A;  3IFE A;  2B5G A;  4UWJ A;  3KQZ A;  4EVY A;  4KSF A;  4F9V A;  1IYK A;  1ARM A;  1LCP A;  3FJU A;  4CAE A;  3PB6 X;  1KUY A;  1LRZ A;  1SQH A;  5DS0 A;  5HMN A;  4II9 A;  4ZX9 A;  5IB0 A;  4PSW A;  5KTD A;  3BI1 A;  4R8F A;  3H4Q A;  3N7Z A;  3D4U A;  3D7F A;  1M44 A;  1DE4 C;  4KUB A;  1I21 A;  2Z0Z A;  2Y0M A;  4FD4 A;  4OC5 A;  4EWT A;  4NGN A;  3KL9 A;  1FT7 A;  4FWU A;  1S7F A;  5BWA B;  3B3C A;  3G3S A;  3LWU A;  2ZW4 A;  4E2A A;  4KOW A;  2BUE A;  1U6M A;  3MN8 A;  1VKC A;  5LRJ A;  4Q36 A;  4KOS A;  1LAM A;  1Z8L A;  4A38 A;  2YGW A;  4OC0 A;  5LYI A;  2P0W A;  2H5M A;  2V77 A;  4C7H A;  4CAW A;  4NSQ A;  1UWY A;  1JQG A;  3W6X A;  1XBU A;  3FRM A;  3IU2 A;  4P6Y A;  4R9M A;  2WYR A;  2JBK A;  4YWY A;  3T90 A;  4OAE A;  4UWI A;  1H8L A;  4F0Y A;  5EMI A;  4B5P B;  3PFE A;  3GY9 A;  1ZG7 A;  2V8V A;  4IAV A;  2HUZ A;  1FNO A;  4A95 A;  2FVG A;  1PCA A;  2CF4 A;  1CPS A;  1NE9 A;  2DEA A;  3FB3 A;  2CIJ A;  1BOB A;  4C7I A;  4MY3 A;  1Z5R A;  2CTC A;  2FT0 A;  1KUX A;  5AG6 A;  1RXT A;  3IWE A;  3EY5 A;  3PZJ A;  1MK4 A;  4HNX B;  1ELL P;  2JEV A;  1Z4E A;  5HVF A;  5LRG A;  2IQ6 A;  5CPA A;  1J4J A;  3GB0 A;  2PJ9 A;  4DYO A;  2CNM A;  2G9D A;  4LUA A;  1TKF A;  3KHX A;  3DGV A;  4MCR A;  4YRH A;  3ZZI A;  2PQ8 A;  2AJ6 A;  1IB1 E;  3DR8 A;  2F7V A;  2PJ3 A;  2HB6 A;  2HC9 A;  2PRQ A;  3IIB A;  3LD2 A;  3PFO A;  2A4N A;  2I3C A;  4MFL A;  2EBJ A;  4XPD B;  3QB8 A;  2FXF A;  4X3R A;  1IU8 A;  3ISX A;  4UEE A;  1LFW A;  2FL4 A;  1YVO A;  2PJ0 A;  2ZOG A;  3VWD A;  2JDD A;  1KUV A;  2ZOF A;  4P45 A;  5IX3 A;  1Z8W A;  2XEI A;  5D8N A;  4P4I A;  3GLJ A;  1BLL E;  4PXE A;  2CXA A;  4JD6 A;  4KVX A;  4UEF A;  3SJX A;  4EFD A;  4PSX A;  1M4G A;  3E0K A;  3H5Z A;  4PK2 A;  4HNW B;  3DSB A;  2Z10 A;  4KOR A;  4C2X A;  3WT4 A;  1XMB A;  3IU1 A;  3V8I A;  2YND A;  2BEI A;  3KR5 A;  4Z65 A;  3SXN A;  3EO4 A;  4XPL A;  1QMU A;  3PBB A;  3CXP A;  7CPA A;  4RN7 A;  3N5F A;  2DPS A;  4OKO A;  4M3S A;  2AFS A;  1S3Z A;  1XFO A;  3NE8 A;  2D4P A;  1QSN A;  3HUV A;  1PU9 A;  3D2P A;  1CBX A;  3G8W A;  1S5K A;  5G20 A;  4JXQ A;  3RBU A;  2K5T A;  4QUS A;  1P0H A;  4CGP A;  2VEZ A;  3NH4 A;  3CPA A;  1FY7 A;  2PJ4 A;  1ZLI A;  4Q38 A;  3B35 A;  4NGT A;  2PJ7 A;  3SJF A;  2B4B A;  4MHZ A;  3TTH A;  2ZEE A;  4A30 A;  4OP4 A;  1YQE A;  2F8H A;  2EK9 A;  2HQY A;  4WWV A;  2PJ6 A;  3PB7 X;  2ZED A;  3F8K A;  4B11 A;  2OR4 A;  4U9Z A;  3LAC A;  1YLO A;  3HLP A;  4NXY A;  3FYN A;  1CPX A;  2C1C A;  3WC5 A;  1PUA A;  2PE3 A;  1XOV A;  2AFZ A;  3I9S A;  3RYO A;  3JUW A;  3TC8 A;  4P10 A;  4O23 A;  5HVG A;  2QML A;  4FD5 A;  1QST A;  3B7I A;  1Q2Y A;  2F5I A;  5IB9 A;  1TF8 A;  2Q4Y A;  4C2Y A;  5JH9 A;  3T9Y A;  5CBM A;  3I3G A;  3DLJ A;  3CDX A;  4RI1 A;  4MMO A;  3MRU A;  1UFH A;  1YX0 A;  4I49 A;  4Y49 C;  2QYV A;  3NFZ A;  5J8C A;  4DUK A;  1MJA A;  3KKW A;  4KLW A;  4LQ6 A;  4OLL A;  4ONW A;  5ISV A;  3DDD A;  5LYL A;  3D67 A;  4KSA A;  5JQ4 A;  4E8O A;  4QVT A;  2EO8 A;  4X5K A;  3TOA A;  3L2N A;  3RZA A;  2WZN A;  1M4L A;  3JVN A;  2YNE A;  3JRU A;  4HPS A;  3OWC A;  4KVO E;  5THW A;  3VAT A;  5A27 A;  4PPZ A;  3D8P A;  4P4J A;  3A9L A;  4UBR A;  2Q51 A;  3GIU A;  3RNZ A;  2ZEM A;  5G1Z A;  3D66 A;  2BCO A;  4Q7A A;  4LQG A;  4NGS A;  4KOX A;  2Z3O A;  3SI1 A;  1V0C A;  3IO1 A;  2R98 A;  3SHP A;  4JXR A;  2AE6 A;  1CP7 A;  2VL1 A;  3TO6 A;  1VHS A;  2OH1 A;  2O28 A;  3NA6 A;  2KCW A;  1MJB A;  4KZT A;  3TX8 A;  4PK3 A;  3TT2 A;  4JLY A;  4NEX A;  4M6I A;  2PR8 A;  1Y7R A;  5A28 A;  4BIN A;  1WWZ A;  2ZEL A;  1XEB A;  4BBH A;  4L8A A;  5JPH A;  4B14 A;  3VH9 A;  4FUU A;  4XPK A;  1XMT A;  1VGY A;  1YME A;  4X2T A;  5F49 A;  4CYP A;  3F5B A;  1S7L A;  5JM6 A;  2J8M A;  4OME A;  2B4D B;  1F2P A;  4MHY A;  4TWE A;  2ARH A;  1IIC A;  4R3K A;  1HDU A;  2DF5 A;  2X7B A;  4KOY A;  5G22 A;  2Q7B A;  4MFQ A;  3PEI A;  3QAH A;  1IOI A;  3QNV A;  4DJL A;  5HVH A;  3R9F A;  2GFQ A;  4PQA A;  2RC4 A;  4B6Z A;  4JZ0 A;  4R3L A;  3B3V A;  3H8G A;  5C88 A;  2VI7 A;  1YLE A;  2PIZ A;  1YR0 A;  2R7H A;  3CZX A;  3NE7 A;  3D7D A;  4MFZ A;  3GKR A;  4ORF A;  4XPD C;  4CS0 B;  3NH5 A;  3TCV A;  1CJW A;  3CT9 A;  1BPN A;  1S60 A;  2FIW A;  1Y0R A;  1GHE A;  5LYD A;  4QC6 A;  2P6E A;  4KLV A;  1YRE A;  2R1I A;  2QVP A;  3FIX A;  2FSR A;  4P44 A;  2C6P A;  2Z3K A;  4MFK A;  3BLN A;  2WSA A;  2V8D A;  4W9Y A;  3B8G A;  4A32 A;  3V38 A;  2ZPA A;  4AVA A;  2ABZ A;  1OZP A;  2VZZ A;  4P4D A;  1BO4 A;  2PJC A;  4PXD A;  4R57 A;  1OBR A;  3LMS A;  5E96 A;  3W6S A;  2HV2 A;  3EC4 A;  1IYL A;  3D68 A;  5F09 A;  3K9U A;  3KHZ A;  1F2O A;  3R96 A;  3VWE A;  4A37 A;  4CYN A;  1L0C A;  1X10 A;  4B10 A;  1YK3 A;  4IF5 A;  2ZEO A;  3SI2 A;  8CPA A;  4UCM A;  2VBQ A;  2XEJ A;  1ELM P;  5GCN A;  3TO7 A;  1AYE A;  5IV0 A;  3QAY A;  1Q2D A;  2BOA A;  4ZY1 A;  3FED A;  4XNH C;  5I4M A;  3P2H A;  1Z2L A;  4ONU A;  2PJ5 A;  1Z8T A;  1B87 A;  2PDO A;  2QJ8 A;  4CGM A;  3PP9 A;  4NFR A;  3FEE A;  1QSO A;  2POK A;  4M6H A;  2NYQ A;  2YNC A;  4LX9 A;  5AG7 A;  4E0A A;  4NJR A;  3R9G A;  4MY0 A;  2G0B A;  2GLF A;  4ZYQ A;  1KWM A;  1XJO A;  2GRE A;  4H6U A;  3WR7 A;  4B5P A;  3T8W A;  1RO5 A;  2CNT A;  3H8F A;  2PVW A;  3JTK A;  5C82 A;  1RTQ A;  1YSJ A;  2BSW A;  2I79 A;  3C26 A;  2EVN A;  4MHN A;  2B3V A;  2CNS A;  2OOT A;  2Q44 A;  4CYO A;  2I00 A;  3NH8 A;  3D7H A;  4YU9 A;  4MRI A;  3CPX A;  2NMT A;  4G1P A;  3BI0 A;  4P4B A;  4X8I A;  3R95 A;  4NJQ A;  4IK2 A;  5J1Q A;  2Q43 A;  5F48 A;  1QSR A;  2GLJ A;  4K3N A;  4FD7 A;  5K8P A;  1DTD A;  2GIV A;  2RFH A;  4CRY B;  1M4D A;  2OZH A;  2Q04 A;  2ZXV A;  3IEH A;  4ZBG A;  1NSA A;  1Z9U A;  3IJ3 A;  4U5Y A;  4ZX8 A;  5AGE A;  1Z8X A;  4AVB A;  1Q2C A;  1LAP A;  4U9Y A;  2FCK A;  4BMH A;  2PJ1 A;  5G21 A;  5DWM A;  1IGB A;  2JEW A;  2P6F A;  2Q4Z A;  3FBU A;  2PSW A; 
#chains in the Genus database with same CATH homology
 4CAX A;  4UA3 A;  4M85 A;  2DXQ A;  5KTA A;  1ZO0 A;  3DNS A;  1S7K A;  2IL4 A;  4NF1 A;  2Z3P A;  3FXT A;  3D3S A;  4A33 A;  2GAN A;  2J8N A;  3IWG A;  4IUS A;  4OAD A;  4H89 A;  2WPW A;  2PR1 A;  1S7N A;  3MGD A;  2BL1 A;  3BJ7 A;  3S6H A;  4ZGY B;  2VZY A;  1Y9K A;  3EXN A;  4KS9 A;  1XE4 A;  4CAF A;  3TFY A;  4UCN A;  1WK4 A;  2YNC C;  1KZF A;  5I0C A;  4Y49 B;  5DWN A;  3CXS A;  4C2Z A;  4CRZ B;  1XIX A;  5F46 A;  2ZW6 A;  4JWP A;  2VQY A;  4AVC A;  4KVM E;  4CAV A;  5EBV A;  1R57 A;  4B5O A;  4KOU A;  4B13 A;  2OB0 A;  5HH1 A;  2PC1 A;  2WPX A;  4J3G A;  1TIQ A;  4C68 A;  2QIR A;  4DNC A;  2P6G A;  4UFW A;  2R8V A;  1N71 A;  3D2M A;  2Q4V A;  2C27 A;  4CGN A;  5FVJ A;  3W91 A;  4UCP A;  1Y9W A;  2DPT A;  2REE A;  2FE7 A;  1CM0 A;  4CGO A;  2ZW7 A;  2ZW5 A;  4CYQ A;  5EC4 A;  2OU2 A;  2JLM A;  2CY2 A;  5H86 A;  2Z3L A;  3TOB A;  2WUU A;  3LOD A;  1IID A;  4GS4 A;  2B5G B;  4K30 A;  1MJ9 A;  4F6A A;  3SXO A;  2OZG A;  2VXK A;  4MFJ A;  5J8F A;  2GE3 A;  5H84 A;  2Z3N A;  5AG5 A;  1M4I A;  4A31 A;  2FS5 A;  2REF A;  4MFP A;  3S6G A;  4KUA A;  1NSL A;  1NMT A;  4MHD A;  4MBU A;  2PRB A;  3GYA A;  4MI4 A;  3S6F A;  2Z11 A;  3FNC A;  4JJX A;  3R9E A;  2QEC A;  2ATR A;  2OZU A;  4MJ8 A;  1P4N A;  1QSM A;  5KTC A;  4UFX A;  3TE4 A;  2B58 A;  2JDC A;  1ON0 A;  4YGO A;  1B6B A;  4QBJ A;  2EUI A;  2G3T A;  4KOT A;  3R1K A;  4UFV A;  3BJ8 A;  2FIA A;  4CGL A;  4AB7 A;  4L89 A;  5F47 A;  4H6Z A;  1K4J A;  3EFA A;  4XNH B;  3S6K A;  4AG7 A;  3IGR A;  4HNY B;  3ZJ0 A;  2B4D A;  2B3U A;  4R87 A;  1M1D A;  5AG4 A;  2G3A A;  1I12 A;  4NCZ A;  2J8R A;  4AG9 A;  5CNP A;  4B12 A;  4YFJ A;  3TO9 A;  4KOV A;  2Q0Y A;  3CXQ A;  4A2Z A;  2Z3M A;  4PV6 A;  4F0X A;  1Z4R A;  3DR6 A;  4HKF A;  4RS2 A;  1YVK A;  4QB9 A;  2D4O A;  3PGP A;  4FD6 A;  3F0A A;  3P2F A;  3UY5 A;  1I1D A;  1YGH A;  1XF8 A;  2B5G A;  4UWJ A;  4EVY A;  4KSF A;  1IYK A;  4CAE A;  1KUY A;  1LRZ A;  1SQH A;  5HMN A;  4II9 A;  5IB0 A;  4PSW A;  5KTD A;  3H4Q A;  3N7Z A;  1M44 A;  4KUB A;  1I21 A;  2Z0Z A;  2Y0M A;  4FD4 A;  1S7F A;  5BWA B;  3G3S A;  2ZW4 A;  4E2A A;  4KOW A;  2BUE A;  1U6M A;  1VKC A;  4Q36 A;  4KOS A;  4CAW A;  2YGW A;  4C7H A;  2P0W A;  2H5M A;  4NSQ A;  3W6X A;  3FRM A;  3IU2 A;  4R9M A;  3T90 A;  4OAE A;  4UWI A;  4F0Y A;  4B5P B;  3GY9 A;  2HUZ A;  4A95 A;  1NE9 A;  3FB3 A;  1BOB A;  4C7I A;  4MY3 A;  2FT0 A;  1KUX A;  5AG6 A;  1RXT A;  3IWE A;  3EY5 A;  3PZJ A;  1MK4 A;  4HNX B;  2JEV A;  1Z4E A;  1J4J A;  2CNM A;  4LUA A;  4YRH A;  3ZZI A;  2PQ8 A;  2AJ6 A;  1IB1 E;  3DR8 A;  3LD2 A;  4MFL A;  2A4N A;  4XPD B;  3QB8 A;  2FXF A;  2FL4 A;  1YVO A;  3VWD A;  2JDD A;  1KUV A;  5IX3 A;  2CXA A;  4JD6 A;  4KVX A;  4PSX A;  1M4G A;  3E0K A;  3H5Z A;  4PK2 A;  4HNW B;  3DSB A;  2Z10 A;  4KOR A;  4C2X A;  3IU1 A;  3V8I A;  2YND A;  2BEI A;  3SXN A;  3EO4 A;  4XPL A;  3CXP A;  2DPS A;  4M3S A;  1S3Z A;  2D4P A;  1QSN A;  1PU9 A;  3D2P A;  3G8W A;  1S5K A;  5G20 A;  4JXQ A;  2K5T A;  4QUS A;  1P0H A;  4CGP A;  2VEZ A;  1FY7 A;  4Q38 A;  2B4B A;  3TTH A;  4A30 A;  2HQY A;  3F8K A;  4B11 A;  4U9Z A;  4NXY A;  3FYN A;  1PUA A;  3I9S A;  3RYO A;  3JUW A;  2QML A;  4FD5 A;  1QST A;  1Q2Y A;  2F5I A;  2Q4Y A;  4C2Y A;  3T9Y A;  3I3G A;  4RI1 A;  1UFH A;  1YX0 A;  4I49 A;  4Y49 C;  5J8C A;  1MJA A;  3KKW A;  4KLW A;  4OLL A;  5ISV A;  3DDD A;  4KSA A;  5JQ4 A;  4E8O A;  4QVT A;  3TOA A;  4X5K A;  3JVN A;  2YNE A;  4KVO E;  5A27 A;  3OWC A;  3D8P A;  4UBR A;  3A9L A;  5G1Z A;  4KOX A;  2Z3O A;  1V0C A;  2R98 A;  3SHP A;  4JXR A;  2AE6 A;  3TO6 A;  1VHS A;  2OH1 A;  2O28 A;  2KCW A;  1MJB A;  4KZT A;  4PK3 A;  3TT2 A;  4JLY A;  4NEX A;  2PR8 A;  1Y7R A;  5A28 A;  1WWZ A;  4BBH A;  1XEB A;  4L8A A;  5JPH A;  4B14 A;  4XPK A;  1XMT A;  4CYP A;  5F49 A;  3F5B A;  1S7L A;  2J8M A;  2B4D B;  2ARH A;  1IIC A;  4R3K A;  5G22 A;  4KOY A;  2X7B A;  2Q7B A;  4MFQ A;  3QAH A;  3R9F A;  2RC4 A;  4R3L A;  5C88 A;  2VI7 A;  1YLE A;  1YR0 A;  2R7H A;  3NE7 A;  4MFZ A;  4ORF A;  4XPD C;  3GKR A;  4CS0 B;  3TCV A;  1CJW A;  1S60 A;  2FIW A;  1GHE A;  4QC6 A;  2P6E A;  4KLV A;  1YRE A;  2R1I A;  3FIX A;  2FSR A;  2Z3K A;  4MFK A;  3BLN A;  2WSA A;  3B8G A;  4A32 A;  4AVA A;  2ZPA A;  1OZP A;  2VZZ A;  1BO4 A;  4R57 A;  3W6S A;  5E96 A;  2HV2 A;  3EC4 A;  1IYL A;  3K9U A;  3VWE A;  3R96 A;  4CYN A;  1L0C A;  4B10 A;  1YK3 A;  4IF5 A;  4UCM A;  2VBQ A;  5GCN A;  3TO7 A;  5IV0 A;  1Q2D A;  4XNH C;  3P2H A;  4ONU A;  1B87 A;  2PDO A;  4CGM A;  3PP9 A;  1QSO A;  4LX9 A;  2YNC A;  5AG7 A;  4E0A A;  3R9G A;  4MY0 A;  2G0B A;  4H6U A;  3WR7 A;  4B5P A;  1RO5 A;  2CNT A;  3JTK A;  5C82 A;  2I79 A;  2BSW A;  3C26 A;  4CYO A;  2EVN A;  2B3V A;  2CNS A;  2Q44 A;  2I00 A;  2NMT A;  3R95 A;  5F48 A;  1QSR A;  4FD7 A;  2GIV A;  4CRY B;  1M4D A;  2OZH A;  2Q04 A;  2ZXV A;  4ZBG A;  1Z9U A;  4U5Y A;  5AGE A;  4AVB A;  1Q2C A;  4U9Y A;  2FCK A;  4BMH A;  5G21 A;  5DWM A;  2P6F A;  3FBU A;  2PSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...