4FBEA

Crystal structure of the c136a/c164a variant of mitochondrial isoform of glutaminyl cyclase from drosophila melanogaster
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
316
structure length
303
Chain Sequence
b'ELVDIPKISYNPSELSEPRFLEYSNLSDKLHLREAIDKILIPRVVGTTNHSIVREYIVQSLRDLDWDVEVNSFHDHAPIKGKLHFHNIIATLNPNAERYLVLSAHYDSKYMPGVEFLGATDSAVPAAMLLNLAQVLQEQLKPLKKSKLSLMLLFFDGEEAFEEWGPKDSIYGARHLAKKWHHEGKLDRIDMLVLLDLLGAPDPAFYSFFENTESWYMRIQSVETRLAKLQLLERYFQSQAMRSSFIEDDHIPFLRRNVPILHLIPVPFPSVWHTPDDNASVIDYATTDNLALIIRLFALEYLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG5976, isoform B
publication title Crystal Structures of Glutaminyl Cyclases (QCs) from Drosophila melanogaster Reveal Active Site Conservation between Insect and Mammalian QCs.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase, hydrolase
total genus 104
structure length 303
sequence length 316
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4fbeA00
3B3TA 1YSJA 3D7FA 3V7ZA 2EWBA 3SJXA 2V77A 2PJ2A 2V8HA 3KQZA 3WT4A 2AFUA 4UF4A 1LAPA 2ZEGA 2WYRA 3BXMA 3FH4A 3RBUA 4DJLA 1Z8LA 5LYLA 4YWYA 4AXVA 3CDXA 2C6PA 3FEDA 3JRUA 4FUUA 3PB9X 5LYFA 1UWYA 5D29A 3IEHA 2V8VA 4A38A 2GLJA 4MCSA 3CPXA 4OC5A 5K8PA 4PPZA 4OMEA 3PFOA 3KR4A 2Q4ZA 3KR5A 2GU2A 5HVFA 2AFOA 4JYWA 3D66A 2PJ9A 1M4LA 3I1UA 4PXDA 2EK8A 1RTQA 1HDUA 3CT9A 1IY7A 3LWUA 3PB6X 4OKOA 4EMEA 3IWWA 4NGSA 3TC8A 4W9YA 4MCRA 5CBMA 3KGQA 1HDQA 3S9NA 3NH4A 3DLJA 5K8MA 2V8DA 3V38A 8CPAA 4NGTA 2O53A 5I4MA 2WZNA 3VH9A 1CPXA 4KSIA 4OC3A 1F2PA 2RFHA 1LAMA 1VHEA 2XEIA 1CBXA 2XEGA 3KQXA 3WABA 1TXRA 4MRIA 5K8NA 2BOAA 1DTDA 1ZLIA 1YW6A 2PCUA 1XFOA 4EFDA 2AFWA 1ZLHA 4PQAA 1FNOA 3PBEA 2PJ1A 4NJRA 4ZY2A 4Q7AA 3WC5A 5IB9A 4FWUA 2ZENA 1OBRA 1Y0RA 5LRJA 1QQ9A 1ZG7A 3H8EA 3K9TA 3LMSA 3D7DA 3D7HA 2HB6A 1F2OA 2OOTA 1CP7A 2G9DA 2PJ8A 4R7MA 3NH5A 3FF3A 4OC4A 3BI0A 2I3CA 5HVGA 1ELLP 1IGBA 1TF9A 2ZELA 2ZOGA 2XEJA 1QMUA 4K3NA 4P10A 4P4DA 4P4BA 1CPSA 2V8GA 2PJCA 3PRTA 4IHMA 4ONWA 4ZYQA 3VARA 2FVGA 2JEWA 1TKHA 1TKFA 3NA6A 4X8IA 1Q7LA 3BHXA 4MMOA 4YU9A 2C1CA 3D4UA 3IO1A 2BO9A 2QVPA 3FX6A 4WJBA 2CTBA 1LCPA 4ZY0A 3SJEA 1DE4C 3B3CA 2QJ8A 4TWEA 4UEFA 2PJ6A 3K2KA 2BCOA 4MHZA 4MXUA 1ELMP 1BPMA 3B7IA 2PE3A 1HEEA 4JZ0A 4OC2A 4NGNA 1BPNA 6CPAA 1R3NA 4IAVA 3IIBA 3KHXA 1YLOA 4ZI6A 4P6YA 3HUVA 2PJ3A 2ZEMA 1XJOA 2PRQA 2PJ7A 1H8LA 4P4EA 1ARMA 2ZEEA 3D67A 3DGVA 4PXEA 4P45A 3BI1A 3RZAA 2GREA 4F9UA 2J9AA 4WWVA 4NGQA 2IMOA 4UEZA 3B3VA 3B3SA 1VIXA 4OIDA 1R43A 2ZEHA 3VATA 2Q43A 2CTCA 2HC9A 2IJZA 3PB4X 4DUKA 3ISXA 3L2NA 4UIBA 2JBJA 4UEEA 4P4IA 2POKA 1EE3P 2ZOFA 2F8HA 2ABZA 1AMPA 3IJ3A 3D7GA 3WC7A 5LYIA 1Y0YA 3SI2A 1YW4A 1LOKA 4NGMA 3HLPA 3FMCA 3SI0A 2QYVA 4NGRA 7CPAA 2AFSA 4X2TA 3SJFA 3B2YA 2OR4A 3PFEA 3KL9A 1ZG8A 4G1PA 1LFWA 1VHOA 3S9MA 3KHZA 3PB7X 4F8ZA 2PJ0A 1Z2LA 3IC1A 2DEAA 3MN8A 2CF4A 1VGYA 5HVHA 2IQ6A 4DYOA 3QNVA 2PJ4A 4PXBA 4X3RA 4MHYA 4R76A 3ISZA 2ANPA 3FJUA 3S9LA 2JBKA 1GYTA 3FECA 1AYEA 4GM5A 1NSAA 1LANA 2AFMA 2O4HA 4RUHA 2PIZA 3KZWA 5D8NA 5JH9A 5LRKA 2CIJA 1Z5RA 5CPAA 5JGFA 4BD9A 3PB8X 5JM6A 4R8FA 1JQGA 4R6TA 4B6ZA 2ZEPA 4OC1A 4OIWA 1XMBA 3H8FA 4F9VA 5F09A 2ZEDA 2EK9A 4NJQA 3GUXA 3MRUA 4Z65A 3PBBA 3SJGA 3WC6A 1BAVA 1CP6A 4O23A 3SI1A 3TX8A 4OP4A 1CG2A 4NGPA 3B3WA 2VL1A 2RB7A 4IK2A 4A39A 1TF8A 3CPAA 3NH8A 4OC0A 1ARLA 5THWA 4FBEA 1TKJA 4ZX8A 3FEEA 3H8GA 1PYTB 4UIAA 3GB0A 2PJBA 3FVLA 3KASA 3T8WA 4FAIA 4A37A 4EWTA 1KWMA 3NFZA 2PJ5A 1CX8A 2NYQA 4CPAA 4MHNA 2ZEOA 2AFXA 2PVWA 1FT7A 5HXDA 5LRGA 4TNUA 4P4FA 2PJAA 4A94A 2PVVA 2ZEFA 1XBUA 2GLFA 4P4JA 4P44A 4ZX9A 2C6GA 2C6CA 2XEFA 4MHPA 1BLLE 1F57A 4LQGA 4PXCA 3N5FA 2AFZA 5LYDA 5ELYA 5DS0A 4MCPA 4ZY1A 1PCAA 3GLJA 3IFEA 5K8OA 4H2KA 2F7VA 3KI9A 1Y7EA 2Q51A 3RAMA 4NFRA 3PEIA 5J1QA 1XRYA 2PIYA 3B35A 3D68A 2NSMA 1ZG9A 4MCQA 1YMEA
chains in the Genus database with same CATH superfamily
3B3TA 4KUBA 1YSJA 3D7FA 1B87A 3V7ZA 1QSTA 2EWBA 1YREA 4HNXB 4UFWA 3SJXA 4CRZB 2V77A 3IU2A 2DXQA 1M44A 2PJ2A 2V8HA 1PUAA 3KQZA 3WT4A 2AFUA 4UF4A 1I12A 1LAPA 2ZEGA 2Y0MA 2WYRA 3BXMA 3CXPA 1IB1E 3FH4A 3FB3A 4CYOA 3S6FA 3RBUA 4DJLA 5BWAB 4Q36A 2BSWA 1Z8LA 3CZXA 5LYLA 5E96A 4YWYA 2QECA 4AXVA 3CDXA 2C6PA 3FEDA 3JRUA 3PB9X 4FUUA 4Q38A 1UWYA 5D29A 3IEHA 4A95A 5LYFA 2V8VA 4A38A 4MFQA 1M4IA 2P0WA 4LQ6A 2Z3KA 2GLJA 4Y49C 4MCSA 2WUUA 3CPXA 4OC5A 4XNHB 4PPZA 4OMEA 4CGMA 5K8PA 4E2AA 5EMIA 2FSRA 3PFOA 4QB9A 3DR6A 3KR4A 2Q4ZA 3LD2A 2C27A 3D2PA 3KR5A 1LRZA 2EUIA 3TOAA 2GU2A 3EFAA 5HVFA 4JLYA 2AFOA 4GXHA 4JYWA 1XOVA 4RN7A 4CAFA 4PV6A 3A9LA 3D66A 2PJ9A 3I9SA 1M4LA 4KZTA 3TFYA 3I1UA 4PXDA 4KVXA 2EK8A 2B4DA 4C2XA 1Q2DA 4H6ZA 2GANA 3PGPA 3W6SA 1HDUA 1RTQA 3CT9A 1IY7A 3LWUA 3PB6X 4OKOA 4EMEA 3IWWA 2PQ8A 1S60A 4NGSA 2ATRA 3TC8A 4R3LA 4W9YA 2K5TA 4MCRA 5CBMA 3KGQA 1HDQA 3S9NA 3NH4A 2P6GA 3DLJA 4E0AA 5K8MA 2V8DA 2WSAA 3V38A 8CPAA 4NGTA 4FD4A 4KS9A 2FS5A 1YR0A 2P6FA 2J8NA 2O53A 4MY0A 5I4MA 4I49A 2WZNA 3V8IA 4A31A 2B5GA 1I1DA 4MFLA 3BLNA 4JJXA 2I00A 1CPXA 4KSIA 3VH9A 4IF5A 4OC3A 1F2PA 2DPTA 2RFHA 1LAMA 3DNSA 1VHEA 2OZGA 2XEIA 4KVME 1CBXA 2XEGA 1X10A 2VQYA 4OADA 3KQXA 4UFXA 5EC4A 3R95A 3WABA 3T9YA 1TXRA 4MRIA 4UWJA 4R87A 5K8NA 2BOAA 1DTDA 1ZLIA 1YW6A 3LODA 1IU8A 2PCUA 1XFOA 2FIAA 4EFDA 5C88A 2WPWA 2AFWA 3EO4A 1ZLHA 1V0CA 4A33A 2OU2A 4PQAA 1XEBA 1FNOA 4CAVA 3PBEA 4M3SA 2PJ1A 2DF5A 3S6HA 2QMLA 4NSQA 2PR1A 4NJRA 5DWNA 4ORFA 4CS0B 3N7ZA 4MFKA 4Q7AA 4ZY2A 3WC5A 5IB9A 1MJ9A 4FWUA 4YGOA 2FIWA 3KKWA 2IL4A 4XPLA 2AE6A 5G22A 2ZENA 3TO6A 1OBRA 1Y0RA 2VBQA 4QUSA 4ONUA 5LRJA 3SHPA 1QQ9A 1ZG7A 3H8EA 3K9TA 3LMSA 2FT0A 3D7DA 3D7HA 5A27A 2HB6A 1F2OA 4MBUA 1Z4EA 2OOTA 1CP7A 2G9DA 2PJ8A 1KUXA 4LUAA 3G8WA 4R7MA 2G3AA 3EC4A 4RI1A 3IU1A 3NH5A 3FF3A 3BJ8A 4OC4A 2J8MA 3R9FA 4H6UA 3BI0A 3W6XA 2I3CA 5HVGA 3IWEA 3ZZIA 1ELLP 2KCWA 4C7HA 1IGBA 1TF9A 2CNTA 4B13A 3OWCA 1AUGA 5HH1A 2ZELA 4KOUA 2ZOGA 5F48A 2XEJA 2Q4YA 1XMTA 3QAYA 5KTAA 1QMUA 4K3NA 4NXYA 4PK2A 5H86A 4P10A 4P4DA 4P4BA 1CPSA 1XE4A 2V8GA 4C2YA 2PJCA 3PRTA 4IHMA 4ONWA 4XPDC 5F49A 4ZYQA 2F5IA 1Z8WA 4QVTA 3VARA 2FVGA 2JEWA 2ZW7A 1TKHA 2D4OA 1TKFA 4CYQA 3JVNA 3NA6A 1CJWA 4UBRA 4X8IA 1Q7LA 5IX3A 3BHXA 1M4GA 2Q7SA 4MMOA 4R9MA 3JTKA 4YU9A 2HUZA 2C1CA 4A30A 4MI4A 3D4UA 1TIQA 3IO1A 2BO9A 2QVPA 3B8GA 3FX6A 4WJBA 2CTBA 1LCPA 3S6GA 4ZY0A 3SJEA 2BL1A 1DE4C 3SXOA 1YVKA 3B3CA 2QJ8A 4TWEA 1KZFA 2JEVA 4UEFA 2PJ6A 3K2KA 2BCOA 3BJ7A 2VI7A 2GIVA 4MHZA 1R57A 4KOSA 5JQ4A 4MXUA 2P6EA 4AVBA 1ELMP 1MJBA 4B5PB 4HNWB 1VKCA 1BOBA 3QAHA 1BPMA 3B7IA 1IYKA 2PE3A 4KVOE 4II9A 1HEEA 2JDDA 1MJAA 4JZ0A 2OZHA 3DDDA 1KUYA 4MFPA 4AG9A 2ZW4A 3GIUA 4NGNA 4OC2A 5CNPA 1KUVA 2ARHA 3FRMA 4OAEA 1BPNA 5HMNA 6CPAA 3K9UA 1R3NA 2REFA 3IIBA 3KHXA 4IAVA 3W91A 4YFJA 5KTDA 1YLOA 4ZI6A 3VWDA 4P6YA 3HUVA 1Z8XA 2PJ3A 2EBJA 2ZEMA 1OZPA 1XJOA 2PRQA 3GYAA 2PJ7A 5AG7A 1H8LA 2GFQA 4GS4A 4E8OA 4P4EA 4DNCA 1ARMA 4YRHA 2H5MA 2ZEEA 3EY5A 1IYLA 2YNCA 3TT2A 2ODFA 2PR8A 3D67A 3DGVA 4KUAA 4A2ZA 4PXEA 3UY5A 4ZBGA 4P45A 3ZJ0A 3BI1A 3R9GA 3RZAA 2Z3MA 4RS2A 1Y7RA 2GREA 3P2FA 3CXQA 5IB0A 4UCMA 5FVJA 4F9UA 2FCKA 2J9AA 4WWVA 1Y9WA 4NGQA 1P4NA 2IMOA 2Z11A 1S3ZA 1B6BA 4UEZA 3B3VA 3B3SA 3T90A 4CRYB 1VIXA 2Z10A 1I21A 5G20A 3F5BA 5IV0A 2CXAA 4OIDA 1R43A 4CAWA 1NMTA 1YLEA 2VXKA 4JXRA 2ZEHA 4NF1A 5DWMA 2DPSA 3VATA 2Q43A 4CYNA 2CTCA 2HC9A 2IJZA 2Z3NA 3PB4X 1JWQA 4CGPA 3ISXA 4DUKA 3FIXA 2D4PA 1ZO0A 3L2NA 4UWIA 5A28A 4B14A 3G3SA 1WK4A 4UA3A 4UIBA 2JBJA 4UEEA 4B12A 4P4IA 3TO9A 1QSNA 4X5KA 2OH1A 1YX0A 2POKA 1EE3P 2ZOFA 3FXTA 2F8HA 3FBUA 2ABZA 1AMPA 3IJ3A 2CNSA 1S7NA 2R7HA 3D7GA 4KOTA 1S7LA 4F6AA 3WC7A 3DR8A 5LYIA 4LX9A 1Y0YA 1S7KA 4JXQA 1IOFA 2ZPAA 3F8KA 3P2HA 3RNZA 3SI2A 1YW4A 1LOKA 4NGMA 2VZZA 2GE3A 3HLPA 3FMCA 3SI0A 1MK4A 2QYVA 1Q2CA 4NGRA 7CPAA 4KOWA 2AFSA 4X2TA 2G0BA 1RXTA 3SJFA 2QIRA 3B2YA 3TTHA 2OR4A 5EBVA 1BO4A 2R98A 4UFVA 3PFEA 2Z3LA 1ZG8A 3KL9A 4G1PA 2B4DB 5AGEA 2J8RA 2OB0A 5G21A 4OLLA 1LFWA 1VHOA 3S9MA 1QSMA 3FNCA 3KHZA 3PB7X 4KOVA 4MHDA 2PJ0A 1Z2LA 4F8ZA 1IOIA 3IC1A 3GY9A 2DEAA 4K30A 4M85A 3MN8A 2EVNA 3RO0A 2CF4A 1S5KA 1VGYA 1U6MA 4JD6A 3D8PA 4HNYB 3MGDA 4BINA 5HVHA 2IQ6A 4M6IA 3QNVA 4J3GA 2PJ4A 2R8VA 4PXBA 3VWEA 4CAEA 4DYOA 2CY2A 1FY7A 4C7IA 4X3RA 4MHYA 4R76A 3ISZA 2B5GB 4M6GA 3IGRA 2ANPA 3FJUA 1CM0A 3D2MA 3S9LA 4XNHC 4AVAA 4L8AA 4CGLA 2JBKA 1GYTA 3FECA 3CXSA 1AYEA 1QSRA 4GM5A 1NSAA 1LANA 2VZYA 1A2ZA 2AFMA 2O4HA 3E0KA 5F46A 4RUHA 2I79A 2PIZA 2JLMA 3KZWA 5D8NA 4CGOA 4XPKA 1J4JA 4R3KA 5JH9A 5LRKA 2CIJA 1Y9KA 3D3SA 4KOXA 2Q44A 1Z8TA 3IWGA 1Z5RA 4U9YA 5CPAA 5JGFA 4BD9A 1XF8A 2HQYA 3PB8X 4AG7A 4A32A 5JM6A 2YNDA 4R8FA 4R57A 1JQGA 4R6TA 3LACA 4PSXA 4QBJA 2FL4A 4XPDB 1SQHA 4H89A 4B6ZA 1K4JA 2ZEPA 2O28A 4OC1A 4OIWA 3TO7A 2G3TA 5G1ZA 1QSOA 1XMBA 3H8FA 4F9VA 5F09A 5J8CA 4KSFA 3C26A 4CYPA 2Q0YA 3NE8A 1S7FA 4B11A 2ZEDA 4C2ZA 1L0CA 2EK9A 4NJQA 3GUXA 4U9ZA 5GCNA 3MRUA 4U5YA 3EXNA 1Z9UA 3PBBA 4Z65A 1X12A 3F0AA 1WWZA 4MFJA 2B3UA 3SJGA 4EVYA 1GHEA 3WC6A 1BAVA 4C68A 2VEZA 1CP6A 4O23A 1M1DA 1ON0A 3SI1A 5F47A 2HV2A 4PSWA 3TX8A 2FXFA 4Y49B 1N71A 4OP4A 5KTCA 1CG2A 1RO5A 2Z3PA 3B3WA 4NGPA 2PC1A 2VL1A 4CAXA 2RB7A 4IK2A 4KOYA 4A39A 2B58A 1TF8A 3CPAA 3NH8A 4OC0A 4HKFA 2REEA 1P0HA 3H5ZA 5JPHA 1ARLA 2WPXA 2B4BA 5THWA 4ZGYB 4KORA 1PU9A 4FBEA 1TKJA 1IIDA 4B5OA 3TE4A 2Q04A 4IUSA 1Q2YA 4ZX8A 5AG4A 3FEEA 3H8GA 5H84A 1PYTB 4KLWA 4UIAA 4FD5A 2R1IA 3GB0A 2Z3OA 2PJBA 3FVLA 4M6HA 3KASA 3T8WA 4FAIA 4A37A 2Z0ZA 3TOBA 1YVOA 2X7BA 5J8FA 4KLVA 4PK3A 4EWTA 4F0YA 5ISVA 4B10A 3H4QA 1KWMA 5AG6A 3NFZA 2AJ6A 2PJ5A 1IICA 2PRBA 1CX8A 2BUEA 4CGNA 4MY3A 2NYQA 4JWPA 2YNCC 4CPAA 1YQEA 4MHNA 2YNEA 2ZEOA 3FYNA 4L89A 2JDCA 2AFXA 4B5PA 1NSLA 4NEXA 2EO8A 2PVWA 1FT7A 3JUWA 5HXDA 5AG5A 4FD7A 2RC4A 5LRGA 4TNUA 2CNMA 2ZW5A 4FD6A 4P4FA 2FE7A 3RYOA 2PJAA 3PZJA 4A94A 3R9EA 1XIXA 2PVVA 3NE7A 3QB8A 2ZEFA 4AVCA 1YK3A 3GKRA 1XBUA 2GLFA 4P4JA 1M4DA 4P44A 4ZX9A 3WR7A 2C6GA 2C6CA 2OZUA 1UFHA 2XEFA 4MHPA 4MFZA 4UCPA 1BLLE 2Q7BA 1F57A 2A4NA 4LQGA 1NE9A 4KSAA 3I3GA 4PXCA 5C82A 3N5FA 2AFZA 3SXNA 3DSBA 5ELYA 5LYDA 4BMHA 4NCZA 2ZW6A 5DS0A 4MCPA 4HPSA 4MJ8A 2PSWA 2NMTA 1Z4RA 3R96A 2PDOA 4ZY1A 3TCVA 3S6KA 4UCNA 1PCAA 3GLJA 2YGWA 3IFEA 5K8OA 4H2KA 2B3VA 2F7VA 3KI9A 3PP9A 4QC6A 3R1KA 4AB7A 4F0XA 1VHSA 1Y7EA 2Q51A 4BBHA 3RAMA 4NFRA 3PEIA 5J1QA 1XRYA 2PIYA 3B35A 3D68A 2NSMA 1ZG9A 2Q4VA 4MCQA 1YMEA 2ZXVA 5I0CA 1YGHA 2BEIA
chains in the Genus database with same CATH topology
3B3TA 1YSJA 3D7FA 3V7ZA 2EWBA 3SJXA 2V77A 2PJ2A 2V8HA 3KQZA 3WT4A 2AFUA 4UF4A 1LAPA 2ZEGA 2WYRA 3BXMA 3FH4A 3RBUA 4DJLA 1Z8LA 5LYLA 4YWYA 4AXVA 3CDXA 2C6PA 3FEDA 3JRUA 4FUUA 3PB9X 5LYFA 1UWYA 5D29A 3IEHA 2V8VA 4A38A 2GLJA 4MCSA 3CPXA 4OC5A 5K8PA 4PPZA 4OMEA 3PFOA 3KR4A 2Q4ZA 3KR5A 2GU2A 5HVFA 2AFOA 4JYWA 3D66A 2PJ9A 1M4LA 3I1UA 4PXDA 2EK8A 1RTQA 1HDUA 3CT9A 1IY7A 3LWUA 3PB6X 4OKOA 4EMEA 3IWWA 4NGSA 3TC8A 4W9YA 4MCRA 5CBMA 3KGQA 1HDQA 3S9NA 3NH4A 3DLJA 5K8MA 2V8DA 3V38A 8CPAA 4NGTA 2O53A 5I4MA 2WZNA 3VH9A 1CPXA 4KSIA 4OC3A 1F2PA 2RFHA 1LAMA 1VHEA 2XEIA 1CBXA 2XEGA 3KQXA 3WABA 1TXRA 4MRIA 5K8NA 2BOAA 1DTDA 1ZLIA 1YW6A 2PCUA 1XFOA 4EFDA 2AFWA 1ZLHA 4PQAA 1FNOA 3PBEA 2PJ1A 4NJRA 4ZY2A 4Q7AA 3WC5A 5IB9A 4FWUA 2ZENA 1OBRA 1Y0RA 5LRJA 1QQ9A 1ZG7A 3H8EA 3K9TA 3LMSA 3D7DA 3D7HA 2HB6A 1F2OA 2OOTA 1CP7A 2G9DA 2PJ8A 4R7MA 3NH5A 3FF3A 4OC4A 3BI0A 2I3CA 5HVGA 1ELLP 1IGBA 1TF9A 2ZELA 2ZOGA 2XEJA 1QMUA 4K3NA 4P10A 4P4DA 4P4BA 1CPSA 2V8GA 2PJCA 3PRTA 4IHMA 4ONWA 4ZYQA 3VARA 2FVGA 2JEWA 1TKHA 1TKFA 3NA6A 4X8IA 1Q7LA 3BHXA 4MMOA 4YU9A 2C1CA 3D4UA 3IO1A 2BO9A 2QVPA 3FX6A 4WJBA 2CTBA 1LCPA 4ZY0A 3SJEA 1DE4C 3B3CA 2QJ8A 4TWEA 4UEFA 2PJ6A 3K2KA 2BCOA 4MHZA 4MXUA 1ELMP 1BPMA 3B7IA 2PE3A 1HEEA 4JZ0A 4OC2A 4NGNA 1BPNA 6CPAA 1R3NA 4IAVA 3IIBA 3KHXA 1YLOA 4ZI6A 4P6YA 3HUVA 2PJ3A 2ZEMA 1XJOA 2PRQA 2PJ7A 1H8LA 4P4EA 1ARMA 2ZEEA 3D67A 3DGVA 4PXEA 4P45A 3BI1A 3RZAA 2GREA 4F9UA 2J9AA 4WWVA 4NGQA 2IMOA 4UEZA 3B3VA 3B3SA 1VIXA 4OIDA 1R43A 2ZEHA 3VATA 2Q43A 2CTCA 2HC9A 2IJZA 3PB4X 4DUKA 3ISXA 3L2NA 4UIBA 2JBJA 4UEEA 4P4IA 2POKA 1EE3P 2ZOFA 2F8HA 2ABZA 1AMPA 3IJ3A 3D7GA 3WC7A 5LYIA 1Y0YA 3SI2A 1YW4A 1LOKA 4NGMA 3HLPA 3FMCA 3SI0A 2QYVA 4NGRA 7CPAA 2AFSA 4X2TA 3SJFA 3B2YA 2OR4A 3PFEA 3KL9A 1ZG8A 4G1PA 1LFWA 1VHOA 3S9MA 3KHZA 3PB7X 4F8ZA 2PJ0A 1Z2LA 3IC1A 2DEAA 3MN8A 2CF4A 1VGYA 5HVHA 2IQ6A 4DYOA 3QNVA 2PJ4A 4PXBA 4X3RA 4MHYA 4R76A 3ISZA 2ANPA 3FJUA 3S9LA 2JBKA 1GYTA 3FECA 1AYEA 4GM5A 1NSAA 1LANA 2AFMA 2O4HA 4RUHA 2PIZA 3KZWA 5D8NA 5JH9A 5LRKA 2CIJA 1Z5RA 5CPAA 5JGFA 4BD9A 3PB8X 5JM6A 4R8FA 1JQGA 4R6TA 4B6ZA 2ZEPA 4OC1A 4OIWA 1XMBA 3H8FA 4F9VA 5F09A 2ZEDA 2EK9A 4NJQA 3GUXA 3MRUA 4Z65A 3PBBA 3SJGA 3WC6A 1BAVA 1CP6A 4O23A 3SI1A 3TX8A 4OP4A 1CG2A 4NGPA 3B3WA 2VL1A 2RB7A 4IK2A 4A39A 1TF8A 3CPAA 3NH8A 4OC0A 1ARLA 5THWA 4FBEA 1TKJA 4ZX8A 3FEEA 3H8GA 1PYTB 4UIAA 3GB0A 2PJBA 3FVLA 3KASA 3T8WA 4FAIA 4A37A 4EWTA 1KWMA 3NFZA 2PJ5A 1CX8A 2NYQA 4CPAA 4MHNA 2ZEOA 2AFXA 2PVWA 1FT7A 5HXDA 5LRGA 4TNUA 4P4FA 2PJAA 4A94A 2PVVA 2ZEFA 1XBUA 2GLFA 4P4JA 4P44A 4ZX9A 2C6GA 2C6CA 2XEFA 4MHPA 1BLLE 1F57A 4LQGA 4PXCA 3N5FA 2AFZA 5LYDA 5ELYA 5DS0A 4MCPA 4ZY1A 1PCAA 3GLJA 3IFEA 5K8OA 4H2KA 2F7VA 3KI9A 1Y7EA 2Q51A 3RAMA 4NFRA 3PEIA 5J1QA 1XRYA 2PIYA 3B35A 3D68A 2NSMA 1ZG9A 4MCQA 1YMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B3T A;  1YSJ A;  3D7F A;  3V7Z A;  2EWB A;  3SJX A;  2V77 A;  2PJ2 A;  2V8H A;  3KQZ A;  3WT4 A;  2AFU A;  4UF4 A;  1LAP A;  2ZEG A;  2WYR A;  3BXM A;  3FH4 A;  3RBU A;  4DJL A;  1Z8L A;  5LYL A;  4YWY A;  4AXV A;  3CDX A;  2C6P A;  3FED A;  3JRU A;  4FUU A;  3PB9 X;  5LYF A;  1UWY A;  5D29 A;  3IEH A;  2V8V A;  4A38 A;  2GLJ A;  4MCS A;  3CPX A;  4OC5 A;  5K8P A;  4PPZ A;  4OME A;  3PFO A;  3KR4 A;  2Q4Z A;  3KR5 A;  2GU2 A;  5HVF A;  2AFO A;  4JYW A;  3D66 A;  2PJ9 A;  1M4L A;  3I1U A;  4PXD A;  2EK8 A;  1RTQ A;  1HDU A;  3CT9 A;  1IY7 A;  3LWU A;  3PB6 X;  4OKO A;  4EME A;  3IWW A;  4NGS A;  3TC8 A;  4W9Y A;  4MCR A;  5CBM A;  3KGQ A;  1HDQ A;  3S9N A;  3NH4 A;  3DLJ A;  5K8M A;  2V8D A;  3V38 A;  8CPA A;  4NGT A;  2O53 A;  5I4M A;  2WZN A;  3VH9 A;  1CPX A;  4KSI A;  4OC3 A;  1F2P A;  2RFH A;  1LAM A;  1VHE A;  2XEI A;  1CBX A;  2XEG A;  3KQX A;  3WAB A;  1TXR A;  4MRI A;  5K8N A;  2BOA A;  1DTD A;  1ZLI A;  1YW6 A;  2PCU A;  1XFO A;  4EFD A;  2AFW A;  1ZLH A;  4PQA A;  1FNO A;  3PBE A;  2PJ1 A;  4NJR A;  4ZY2 A;  4Q7A A;  3WC5 A;  5IB9 A;  4FWU A;  2ZEN A;  1OBR A;  1Y0R A;  5LRJ A;  1QQ9 A;  1ZG7 A;  3H8E A;  3K9T A;  3LMS A;  3D7D A;  3D7H A;  2HB6 A;  1F2O A;  2OOT A;  1CP7 A;  2G9D A;  2PJ8 A;  4R7M A;  3NH5 A;  3FF3 A;  4OC4 A;  3BI0 A;  2I3C A;  5HVG A;  1ELL P;  1IGB A;  1TF9 A;  2ZEL A;  2ZOG A;  2XEJ A;  1QMU A;  4K3N A;  4P10 A;  4P4D A;  4P4B A;  1CPS A;  2V8G A;  2PJC A;  3PRT A;  4IHM A;  4ONW A;  4ZYQ A;  3VAR A;  2FVG A;  2JEW A;  1TKH A;  1TKF A;  3NA6 A;  4X8I A;  1Q7L A;  3BHX A;  4MMO A;  4YU9 A;  2C1C A;  3D4U A;  3IO1 A;  2BO9 A;  2QVP A;  3FX6 A;  4WJB A;  2CTB A;  1LCP A;  4ZY0 A;  3SJE A;  1DE4 C;  3B3C A;  2QJ8 A;  4TWE A;  4UEF A;  2PJ6 A;  3K2K A;  2BCO A;  4MHZ A;  4MXU A;  1ELM P;  1BPM A;  3B7I A;  2PE3 A;  1HEE A;  4JZ0 A;  4OC2 A;  4NGN A;  1BPN A;  6CPA A;  1R3N A;  4IAV A;  3IIB A;  3KHX A;  1YLO A;  4ZI6 A;  4P6Y A;  3HUV A;  2PJ3 A;  2ZEM A;  1XJO A;  2PRQ A;  2PJ7 A;  1H8L A;  4P4E A;  1ARM A;  2ZEE A;  3D67 A;  3DGV A;  4PXE A;  4P45 A;  3BI1 A;  3RZA A;  2GRE A;  4F9U A;  2J9A A;  4WWV A;  4NGQ A;  2IMO A;  4UEZ A;  3B3V A;  3B3S A;  1VIX A;  4OID A;  1R43 A;  2ZEH A;  3VAT A;  2Q43 A;  2CTC A;  2HC9 A;  2IJZ A;  3PB4 X;  4DUK A;  3ISX A;  3L2N A;  4UIB A;  2JBJ A;  4UEE A;  4P4I A;  2POK A;  1EE3 P;  2ZOF A;  2F8H A;  2ABZ A;  1AMP A;  3IJ3 A;  3D7G A;  3WC7 A;  5LYI A;  1Y0Y A;  3SI2 A;  1YW4 A;  1LOK A;  4NGM A;  3HLP A;  3FMC A;  3SI0 A;  2QYV A;  4NGR A;  7CPA A;  2AFS A;  4X2T A;  3SJF A;  3B2Y A;  2OR4 A;  3PFE A;  3KL9 A;  1ZG8 A;  4G1P A;  1LFW A;  1VHO A;  3S9M A;  3KHZ A;  3PB7 X;  4F8Z A;  2PJ0 A;  1Z2L A;  3IC1 A;  2DEA A;  3MN8 A;  2CF4 A;  1VGY A;  5HVH A;  2IQ6 A;  4DYO A;  3QNV A;  2PJ4 A;  4PXB A;  4X3R A;  4MHY A;  4R76 A;  3ISZ A;  2ANP A;  3FJU A;  3S9L A;  2JBK A;  1GYT A;  3FEC A;  1AYE A;  4GM5 A;  1NSA A;  1LAN A;  2AFM A;  2O4H A;  4RUH A;  2PIZ A;  3KZW A;  5D8N A;  5JH9 A;  5LRK A;  2CIJ A;  1Z5R A;  5CPA A;  5JGF A;  4BD9 A;  3PB8 X;  5JM6 A;  4R8F A;  1JQG A;  4R6T A;  4B6Z A;  2ZEP A;  4OC1 A;  4OIW A;  1XMB A;  3H8F A;  4F9V A;  5F09 A;  2ZED A;  2EK9 A;  4NJQ A;  3GUX A;  3MRU A;  4Z65 A;  3PBB A;  3SJG A;  3WC6 A;  1BAV A;  1CP6 A;  4O23 A;  3SI1 A;  3TX8 A;  4OP4 A;  1CG2 A;  4NGP A;  3B3W A;  2VL1 A;  2RB7 A;  4IK2 A;  4A39 A;  1TF8 A;  3CPA A;  3NH8 A;  4OC0 A;  1ARL A;  5THW A;  4FBE A;  1TKJ A;  4ZX8 A;  3FEE A;  3H8G A;  1PYT B;  4UIA A;  3GB0 A;  2PJB A;  3FVL A;  3KAS A;  3T8W A;  4FAI A;  4A37 A;  4EWT A;  1KWM A;  3NFZ A;  2PJ5 A;  1CX8 A;  2NYQ A;  4CPA A;  4MHN A;  2ZEO A;  2AFX A;  2PVW A;  1FT7 A;  5HXD A;  5LRG A;  4TNU A;  4P4F A;  2PJA A;  4A94 A;  2PVV A;  2ZEF A;  1XBU A;  2GLF A;  4P4J A;  4P44 A;  4ZX9 A;  2C6G A;  2C6C A;  2XEF A;  4MHP A;  1BLL E;  1F57 A;  4LQG A;  4PXC A;  3N5F A;  2AFZ A;  5LYD A;  5ELY A;  5DS0 A;  4MCP A;  4ZY1 A;  1PCA A;  3GLJ A;  3IFE A;  5K8O A;  4H2K A;  2F7V A;  3KI9 A;  1Y7E A;  2Q51 A;  3RAM A;  4NFR A;  3PEI A;  5J1Q A;  1XRY A;  2PIY A;  3B35 A;  3D68 A;  2NSM A;  1ZG9 A;  4MCQ A;  1YME A; 
#chains in the Genus database with same CATH topology
 3B3T A;  4KUB A;  1YSJ A;  3D7F A;  1B87 A;  3V7Z A;  1QST A;  2EWB A;  1YRE A;  4HNX B;  4UFW A;  3SJX A;  4CRZ B;  2V77 A;  3IU2 A;  2DXQ A;  1M44 A;  2PJ2 A;  2V8H A;  1PUA A;  3KQZ A;  3WT4 A;  2AFU A;  4UF4 A;  1I12 A;  1LAP A;  2ZEG A;  2Y0M A;  2WYR A;  3BXM A;  3CXP A;  1IB1 E;  3FH4 A;  3FB3 A;  4CYO A;  3S6F A;  3RBU A;  4DJL A;  5BWA B;  4Q36 A;  2BSW A;  1Z8L A;  3CZX A;  5LYL A;  5E96 A;  4YWY A;  2QEC A;  4AXV A;  3CDX A;  2C6P A;  3FED A;  3JRU A;  3PB9 X;  4FUU A;  4Q38 A;  1UWY A;  5D29 A;  3IEH A;  4A95 A;  5LYF A;  2V8V A;  4A38 A;  4MFQ A;  1M4I A;  2P0W A;  4LQ6 A;  2Z3K A;  2GLJ A;  4Y49 C;  4MCS A;  2WUU A;  3CPX A;  4OC5 A;  4XNH B;  4PPZ A;  4OME A;  4CGM A;  5K8P A;  4E2A A;  5EMI A;  2FSR A;  3PFO A;  4QB9 A;  3DR6 A;  3KR4 A;  2Q4Z A;  3LD2 A;  2C27 A;  3D2P A;  3KR5 A;  1LRZ A;  2EUI A;  3TOA A;  2GU2 A;  3EFA A;  5HVF A;  4JLY A;  2AFO A;  4GXH A;  4JYW A;  1XOV A;  4RN7 A;  4CAF A;  4PV6 A;  3A9L A;  3D66 A;  2PJ9 A;  3I9S A;  1M4L A;  4KZT A;  3TFY A;  3I1U A;  4PXD A;  4KVX A;  2EK8 A;  2B4D A;  4C2X A;  1Q2D A;  4H6Z A;  2GAN A;  3PGP A;  3W6S A;  1HDU A;  1RTQ A;  3CT9 A;  1IY7 A;  3LWU A;  3PB6 X;  4OKO A;  4EME A;  3IWW A;  2PQ8 A;  1S60 A;  4NGS A;  2ATR A;  3TC8 A;  4R3L A;  4W9Y A;  2K5T A;  4MCR A;  5CBM A;  3KGQ A;  1HDQ A;  3S9N A;  3NH4 A;  2P6G A;  3DLJ A;  4E0A A;  5K8M A;  2V8D A;  2WSA A;  3V38 A;  8CPA A;  4NGT A;  4FD4 A;  4KS9 A;  2FS5 A;  1YR0 A;  2P6F A;  2J8N A;  2O53 A;  4MY0 A;  5I4M A;  4I49 A;  2WZN A;  3V8I A;  4A31 A;  2B5G A;  1I1D A;  4MFL A;  3BLN A;  4JJX A;  2I00 A;  1CPX A;  4KSI A;  3VH9 A;  4IF5 A;  4OC3 A;  1F2P A;  2DPT A;  2RFH A;  1LAM A;  3DNS A;  1VHE A;  2OZG A;  2XEI A;  4KVM E;  1CBX A;  2XEG A;  1X10 A;  2VQY A;  4OAD A;  3KQX A;  4UFX A;  5EC4 A;  3R95 A;  3WAB A;  3T9Y A;  1TXR A;  4MRI A;  4UWJ A;  4R87 A;  5K8N A;  2BOA A;  1DTD A;  1ZLI A;  1YW6 A;  3LOD A;  1IU8 A;  2PCU A;  1XFO A;  2FIA A;  4EFD A;  5C88 A;  2WPW A;  2AFW A;  3EO4 A;  1ZLH A;  1V0C A;  4A33 A;  2OU2 A;  4PQA A;  1XEB A;  1FNO A;  4CAV A;  3PBE A;  4M3S A;  2PJ1 A;  2DF5 A;  3S6H A;  2QML A;  4NSQ A;  2PR1 A;  4NJR A;  5DWN A;  4ORF A;  4CS0 B;  3N7Z A;  4MFK A;  4Q7A A;  4ZY2 A;  3WC5 A;  5IB9 A;  1MJ9 A;  4FWU A;  4YGO A;  2FIW A;  3KKW A;  2IL4 A;  4XPL A;  2AE6 A;  5G22 A;  2ZEN A;  3TO6 A;  1OBR A;  1Y0R A;  2VBQ A;  4QUS A;  4ONU A;  5LRJ A;  3SHP A;  1QQ9 A;  1ZG7 A;  3H8E A;  3K9T A;  3LMS A;  2FT0 A;  3D7D A;  3D7H A;  5A27 A;  2HB6 A;  1F2O A;  4MBU A;  1Z4E A;  2OOT A;  1CP7 A;  2G9D A;  2PJ8 A;  1KUX A;  4LUA A;  3G8W A;  4R7M A;  2G3A A;  3EC4 A;  4RI1 A;  3IU1 A;  3NH5 A;  3FF3 A;  3BJ8 A;  4OC4 A;  2J8M A;  3R9F A;  4H6U A;  3BI0 A;  3W6X A;  2I3C A;  5HVG A;  3IWE A;  3ZZI A;  1ELL P;  2KCW A;  4C7H A;  1IGB A;  1TF9 A;  2CNT A;  4B13 A;  3OWC A;  1AUG A;  5HH1 A;  2ZEL A;  4KOU A;  2ZOG A;  5F48 A;  2XEJ A;  2Q4Y A;  1XMT A;  3QAY A;  5KTA A;  1QMU A;  4K3N A;  4NXY A;  4PK2 A;  5H86 A;  4P10 A;  4P4D A;  4P4B A;  1CPS A;  1XE4 A;  2V8G A;  4C2Y A;  2PJC A;  3PRT A;  4IHM A;  4ONW A;  4XPD C;  5F49 A;  4ZYQ A;  2F5I A;  1Z8W A;  4QVT A;  3VAR A;  2FVG A;  2JEW A;  2ZW7 A;  1TKH A;  2D4O A;  1TKF A;  4CYQ A;  3JVN A;  3NA6 A;  1CJW A;  4UBR A;  4X8I A;  1Q7L A;  5IX3 A;  3BHX A;  1M4G A;  2Q7S A;  4MMO A;  4R9M A;  3JTK A;  4YU9 A;  2HUZ A;  2C1C A;  4A30 A;  4MI4 A;  3D4U A;  1TIQ A;  3IO1 A;  2BO9 A;  2QVP A;  3B8G A;  3FX6 A;  4WJB A;  2CTB A;  1LCP A;  3S6G A;  4ZY0 A;  3SJE A;  2BL1 A;  1DE4 C;  3SXO A;  1YVK A;  3B3C A;  2QJ8 A;  4TWE A;  1KZF A;  2JEV A;  4UEF A;  2PJ6 A;  3K2K A;  2BCO A;  3BJ7 A;  2VI7 A;  2GIV A;  4MHZ A;  1R57 A;  4KOS A;  5JQ4 A;  4MXU A;  2P6E A;  4AVB A;  1ELM P;  1MJB A;  4B5P B;  4HNW B;  1VKC A;  1BOB A;  3QAH A;  1BPM A;  3B7I A;  1IYK A;  2PE3 A;  4KVO E;  4II9 A;  1HEE A;  2JDD A;  1MJA A;  4JZ0 A;  2OZH A;  3DDD A;  1KUY A;  4MFP A;  4AG9 A;  2ZW4 A;  3GIU A;  4NGN A;  4OC2 A;  5CNP A;  1KUV A;  2ARH A;  3FRM A;  4OAE A;  1BPN A;  5HMN A;  6CPA A;  3K9U A;  1R3N A;  2REF A;  3IIB A;  3KHX A;  4IAV A;  3W91 A;  4YFJ A;  5KTD A;  1YLO A;  4ZI6 A;  3VWD A;  4P6Y A;  3HUV A;  1Z8X A;  2PJ3 A;  2EBJ A;  2ZEM A;  1OZP A;  1XJO A;  2PRQ A;  3GYA A;  2PJ7 A;  5AG7 A;  1H8L A;  2GFQ A;  4GS4 A;  4E8O A;  4P4E A;  4DNC A;  1ARM A;  4YRH A;  2H5M A;  2ZEE A;  3EY5 A;  1IYL A;  2YNC A;  3TT2 A;  2ODF A;  2PR8 A;  3D67 A;  3DGV A;  4KUA A;  4A2Z A;  4PXE A;  3UY5 A;  4ZBG A;  4P45 A;  3ZJ0 A;  3BI1 A;  3R9G A;  3RZA A;  2Z3M A;  4RS2 A;  1Y7R A;  2GRE A;  3P2F A;  3CXQ A;  5IB0 A;  4UCM A;  5FVJ A;  4F9U A;  2FCK A;  2J9A A;  4WWV A;  1Y9W A;  4NGQ A;  1P4N A;  2IMO A;  2Z11 A;  1S3Z A;  1B6B A;  4UEZ A;  3B3V A;  3B3S A;  3T90 A;  4CRY B;  1VIX A;  2Z10 A;  1I21 A;  5G20 A;  3F5B A;  5IV0 A;  2CXA A;  4OID A;  1R43 A;  4CAW A;  1NMT A;  1YLE A;  2VXK A;  4JXR A;  2ZEH A;  4NF1 A;  5DWM A;  2DPS A;  3VAT A;  2Q43 A;  4CYN A;  2CTC A;  2HC9 A;  2IJZ A;  2Z3N A;  3PB4 X;  1JWQ A;  4CGP A;  3ISX A;  4DUK A;  3FIX A;  2D4P A;  1ZO0 A;  3L2N A;  4UWI A;  5A28 A;  4B14 A;  3G3S A;  1WK4 A;  4UA3 A;  4UIB A;  2JBJ A;  4UEE A;  4B12 A;  4P4I A;  3TO9 A;  1QSN A;  4X5K A;  2OH1 A;  1YX0 A;  2POK A;  1EE3 P;  2ZOF A;  3FXT A;  2F8H A;  3FBU A;  2ABZ A;  1AMP A;  3IJ3 A;  2CNS A;  1S7N A;  2R7H A;  3D7G A;  4KOT A;  1S7L A;  4F6A A;  3WC7 A;  3DR8 A;  5LYI A;  4LX9 A;  1Y0Y A;  1S7K A;  4JXQ A;  1IOF A;  2ZPA A;  3F8K A;  3P2H A;  3RNZ A;  3SI2 A;  1YW4 A;  1LOK A;  4NGM A;  2VZZ A;  2GE3 A;  3HLP A;  3FMC A;  3SI0 A;  1MK4 A;  2QYV A;  1Q2C A;  4NGR A;  7CPA A;  4KOW A;  2AFS A;  4X2T A;  2G0B A;  1RXT A;  3SJF A;  2QIR A;  3B2Y A;  3TTH A;  2OR4 A;  5EBV A;  1BO4 A;  2R98 A;  4UFV A;  3PFE A;  2Z3L A;  1ZG8 A;  3KL9 A;  4G1P A;  2B4D B;  5AGE A;  2J8R A;  2OB0 A;  5G21 A;  4OLL A;  1LFW A;  1VHO A;  3S9M A;  1QSM A;  3FNC A;  3KHZ A;  3PB7 X;  4KOV A;  4MHD A;  2PJ0 A;  1Z2L A;  4F8Z A;  1IOI A;  3IC1 A;  3GY9 A;  2DEA A;  4K30 A;  4M85 A;  3MN8 A;  2EVN A;  3RO0 A;  2CF4 A;  1S5K A;  1VGY A;  1U6M A;  4JD6 A;  3D8P A;  4HNY B;  3MGD A;  4BIN A;  5HVH A;  2IQ6 A;  4M6I A;  3QNV A;  4J3G A;  2PJ4 A;  2R8V A;  4PXB A;  3VWE A;  4CAE A;  4DYO A;  2CY2 A;  1FY7 A;  4C7I A;  4X3R A;  4MHY A;  4R76 A;  3ISZ A;  2B5G B;  4M6G A;  3IGR A;  2ANP A;  3FJU A;  1CM0 A;  3D2M A;  3S9L A;  4XNH C;  4AVA A;  4L8A A;  4CGL A;  2JBK A;  1GYT A;  3FEC A;  3CXS A;  1AYE A;  1QSR A;  4GM5 A;  1NSA A;  1LAN A;  2VZY A;  1A2Z A;  2AFM A;  2O4H A;  3E0K A;  5F46 A;  4RUH A;  2I79 A;  2PIZ A;  2JLM A;  3KZW A;  5D8N A;  4CGO A;  4XPK A;  1J4J A;  4R3K A;  5JH9 A;  5LRK A;  2CIJ A;  1Y9K A;  3D3S A;  4KOX A;  2Q44 A;  1Z8T A;  3IWG A;  1Z5R A;  4U9Y A;  5CPA A;  5JGF A;  4BD9 A;  1XF8 A;  2HQY A;  3PB8 X;  4AG7 A;  4A32 A;  5JM6 A;  2YND A;  4R8F A;  4R57 A;  1JQG A;  4R6T A;  3LAC A;  4PSX A;  4QBJ A;  2FL4 A;  4XPD B;  1SQH A;  4H89 A;  4B6Z A;  1K4J A;  2ZEP A;  2O28 A;  4OC1 A;  4OIW A;  3TO7 A;  2G3T A;  5G1Z A;  1QSO A;  1XMB A;  3H8F A;  4F9V A;  5F09 A;  5J8C A;  4KSF A;  3C26 A;  4CYP A;  2Q0Y A;  3NE8 A;  1S7F A;  4B11 A;  2ZED A;  4C2Z A;  1L0C A;  2EK9 A;  4NJQ A;  3GUX A;  4U9Z A;  5GCN A;  3MRU A;  4U5Y A;  3EXN A;  1Z9U A;  3PBB A;  4Z65 A;  1X12 A;  3F0A A;  1WWZ A;  4MFJ A;  2B3U A;  3SJG A;  4EVY A;  1GHE A;  3WC6 A;  1BAV A;  4C68 A;  2VEZ A;  1CP6 A;  4O23 A;  1M1D A;  1ON0 A;  3SI1 A;  5F47 A;  2HV2 A;  4PSW A;  3TX8 A;  2FXF A;  4Y49 B;  1N71 A;  4OP4 A;  5KTC A;  1CG2 A;  1RO5 A;  2Z3P A;  3B3W A;  4NGP A;  2PC1 A;  2VL1 A;  4CAX A;  2RB7 A;  4IK2 A;  4KOY A;  4A39 A;  2B58 A;  1TF8 A;  3CPA A;  3NH8 A;  4OC0 A;  4HKF A;  2REE A;  1P0H A;  3H5Z A;  5JPH A;  1ARL A;  2WPX A;  2B4B A;  5THW A;  4ZGY B;  4KOR A;  1PU9 A;  4FBE A;  1TKJ A;  1IID A;  4B5O A;  3TE4 A;  2Q04 A;  4IUS A;  1Q2Y A;  4ZX8 A;  5AG4 A;  3FEE A;  3H8G A;  5H84 A;  1PYT B;  4KLW A;  4UIA A;  4FD5 A;  2R1I A;  3GB0 A;  2Z3O A;  2PJB A;  3FVL A;  4M6H A;  3KAS A;  3T8W A;  4FAI A;  4A37 A;  2Z0Z A;  3TOB A;  1YVO A;  2X7B A;  5J8F A;  4KLV A;  4PK3 A;  4EWT A;  4F0Y A;  5ISV A;  4B10 A;  3H4Q A;  1KWM A;  5AG6 A;  3NFZ A;  2AJ6 A;  2PJ5 A;  1IIC A;  2PRB A;  1CX8 A;  2BUE A;  4CGN A;  4MY3 A;  2NYQ A;  4JWP A;  2YNC C;  4CPA A;  1YQE A;  4MHN A;  2YNE A;  2ZEO A;  3FYN A;  4L89 A;  2JDC A;  2AFX A;  4B5P A;  1NSL A;  4NEX A;  2EO8 A;  2PVW A;  1FT7 A;  3JUW A;  5HXD A;  5AG5 A;  4FD7 A;  2RC4 A;  5LRG A;  4TNU A;  2CNM A;  2ZW5 A;  4FD6 A;  4P4F A;  2FE7 A;  3RYO A;  2PJA A;  3PZJ A;  4A94 A;  3R9E A;  1XIX A;  2PVV A;  3NE7 A;  3QB8 A;  2ZEF A;  4AVC A;  1YK3 A;  3GKR A;  1XBU A;  2GLF A;  4P4J A;  1M4D A;  4P44 A;  4ZX9 A;  3WR7 A;  2C6G A;  2C6C A;  2OZU A;  1UFH A;  2XEF A;  4MHP A;  4MFZ A;  4UCP A;  1BLL E;  2Q7B A;  1F57 A;  2A4N A;  4LQG A;  1NE9 A;  4KSA A;  3I3G A;  4PXC A;  5C82 A;  3N5F A;  2AFZ A;  3SXN A;  3DSB A;  5ELY A;  5LYD A;  4BMH A;  4NCZ A;  2ZW6 A;  5DS0 A;  4MCP A;  4HPS A;  4MJ8 A;  2PSW A;  2NMT A;  1Z4R A;  3R96 A;  2PDO A;  4ZY1 A;  3TCV A;  3S6K A;  4UCN A;  1PCA A;  3GLJ A;  2YGW A;  3IFE A;  5K8O A;  4H2K A;  2B3V A;  2F7V A;  3KI9 A;  3PP9 A;  4QC6 A;  3R1K A;  4AB7 A;  4F0X A;  1VHS A;  1Y7E A;  2Q51 A;  4BBH A;  3RAM A;  4NFR A;  3PEI A;  5J1Q A;  1XRY A;  2PIY A;  3B35 A;  3D68 A;  2NSM A;  1ZG9 A;  2Q4V A;  4MCQ A;  1YME A;  2ZXV A;  5I0C A;  1YGH A;  2BEI A; 
#chains in the Genus database with same CATH homology
 3B3T A;  1YSJ A;  3D7F A;  3V7Z A;  2EWB A;  3SJX A;  2V77 A;  2PJ2 A;  2V8H A;  3KQZ A;  3WT4 A;  2AFU A;  4UF4 A;  1LAP A;  2ZEG A;  2WYR A;  3BXM A;  3FH4 A;  3RBU A;  4DJL A;  1Z8L A;  5LYL A;  4YWY A;  4AXV A;  3CDX A;  2C6P A;  3FED A;  3JRU A;  4FUU A;  3PB9 X;  5LYF A;  1UWY A;  5D29 A;  3IEH A;  2V8V A;  4A38 A;  2GLJ A;  4MCS A;  3CPX A;  4OC5 A;  5K8P A;  4PPZ A;  4OME A;  3PFO A;  3KR4 A;  2Q4Z A;  3KR5 A;  2GU2 A;  5HVF A;  2AFO A;  4JYW A;  3D66 A;  2PJ9 A;  1M4L A;  3I1U A;  4PXD A;  2EK8 A;  1RTQ A;  1HDU A;  3CT9 A;  1IY7 A;  3LWU A;  3PB6 X;  4OKO A;  4EME A;  3IWW A;  4NGS A;  3TC8 A;  4W9Y A;  4MCR A;  5CBM A;  3KGQ A;  1HDQ A;  3S9N A;  3NH4 A;  3DLJ A;  5K8M A;  2V8D A;  3V38 A;  8CPA A;  4NGT A;  2O53 A;  5I4M A;  2WZN A;  3VH9 A;  1CPX A;  4KSI A;  4OC3 A;  1F2P A;  2RFH A;  1LAM A;  1VHE A;  2XEI A;  1CBX A;  2XEG A;  3KQX A;  3WAB A;  1TXR A;  4MRI A;  5K8N A;  2BOA A;  1DTD A;  1ZLI A;  1YW6 A;  2PCU A;  1XFO A;  4EFD A;  2AFW A;  1ZLH A;  4PQA A;  1FNO A;  3PBE A;  2PJ1 A;  4NJR A;  4ZY2 A;  4Q7A A;  3WC5 A;  5IB9 A;  4FWU A;  2ZEN A;  1OBR A;  1Y0R A;  5LRJ A;  1QQ9 A;  1ZG7 A;  3H8E A;  3K9T A;  3LMS A;  3D7D A;  3D7H A;  2HB6 A;  1F2O A;  2OOT A;  1CP7 A;  2G9D A;  2PJ8 A;  4R7M A;  3NH5 A;  3FF3 A;  4OC4 A;  3BI0 A;  2I3C A;  5HVG A;  1ELL P;  1IGB A;  1TF9 A;  2ZEL A;  2ZOG A;  2XEJ A;  1QMU A;  4K3N A;  4P10 A;  4P4D A;  4P4B A;  1CPS A;  2V8G A;  2PJC A;  3PRT A;  4IHM A;  4ONW A;  4ZYQ A;  3VAR A;  2FVG A;  2JEW A;  1TKH A;  1TKF A;  3NA6 A;  4X8I A;  1Q7L A;  3BHX A;  4MMO A;  4YU9 A;  2C1C A;  3D4U A;  3IO1 A;  2BO9 A;  2QVP A;  3FX6 A;  4WJB A;  2CTB A;  1LCP A;  4ZY0 A;  3SJE A;  1DE4 C;  3B3C A;  2QJ8 A;  4TWE A;  4UEF A;  2PJ6 A;  3K2K A;  2BCO A;  4MHZ A;  4MXU A;  1ELM P;  1BPM A;  3B7I A;  2PE3 A;  1HEE A;  4JZ0 A;  4OC2 A;  4NGN A;  1BPN A;  6CPA A;  1R3N A;  4IAV A;  3IIB A;  3KHX A;  1YLO A;  4ZI6 A;  4P6Y A;  3HUV A;  2PJ3 A;  2ZEM A;  1XJO A;  2PRQ A;  2PJ7 A;  1H8L A;  4P4E A;  1ARM A;  2ZEE A;  3D67 A;  3DGV A;  4PXE A;  4P45 A;  3BI1 A;  3RZA A;  2GRE A;  4F9U A;  2J9A A;  4WWV A;  4NGQ A;  2IMO A;  4UEZ A;  3B3V A;  3B3S A;  1VIX A;  4OID A;  1R43 A;  2ZEH A;  3VAT A;  2Q43 A;  2CTC A;  2HC9 A;  2IJZ A;  3PB4 X;  4DUK A;  3ISX A;  3L2N A;  4UIB A;  2JBJ A;  4UEE A;  4P4I A;  2POK A;  1EE3 P;  2ZOF A;  2F8H A;  2ABZ A;  1AMP A;  3IJ3 A;  3D7G A;  3WC7 A;  5LYI A;  1Y0Y A;  3SI2 A;  1YW4 A;  1LOK A;  4NGM A;  3HLP A;  3FMC A;  3SI0 A;  2QYV A;  4NGR A;  7CPA A;  2AFS A;  4X2T A;  3SJF A;  3B2Y A;  2OR4 A;  3PFE A;  3KL9 A;  1ZG8 A;  4G1P A;  1LFW A;  1VHO A;  3S9M A;  3KHZ A;  3PB7 X;  4F8Z A;  2PJ0 A;  1Z2L A;  3IC1 A;  2DEA A;  3MN8 A;  2CF4 A;  1VGY A;  5HVH A;  2IQ6 A;  4DYO A;  3QNV A;  2PJ4 A;  4PXB A;  4X3R A;  4MHY A;  4R76 A;  3ISZ A;  2ANP A;  3FJU A;  3S9L A;  2JBK A;  1GYT A;  3FEC A;  1AYE A;  4GM5 A;  1NSA A;  1LAN A;  2AFM A;  2O4H A;  4RUH A;  2PIZ A;  3KZW A;  5D8N A;  5JH9 A;  5LRK A;  2CIJ A;  1Z5R A;  5CPA A;  5JGF A;  4BD9 A;  3PB8 X;  5JM6 A;  4R8F A;  1JQG A;  4R6T A;  4B6Z A;  2ZEP A;  4OC1 A;  4OIW A;  1XMB A;  3H8F A;  4F9V A;  5F09 A;  2ZED A;  2EK9 A;  4NJQ A;  3GUX A;  3MRU A;  4Z65 A;  3PBB A;  3SJG A;  3WC6 A;  1BAV A;  1CP6 A;  4O23 A;  3SI1 A;  3TX8 A;  4OP4 A;  1CG2 A;  4NGP A;  3B3W A;  2VL1 A;  2RB7 A;  4IK2 A;  4A39 A;  1TF8 A;  3CPA A;  3NH8 A;  4OC0 A;  1ARL A;  5THW A;  4FBE A;  1TKJ A;  4ZX8 A;  3FEE A;  3H8G A;  1PYT B;  4UIA A;  3GB0 A;  2PJB A;  3FVL A;  3KAS A;  3T8W A;  4FAI A;  4A37 A;  4EWT A;  1KWM A;  3NFZ A;  2PJ5 A;  1CX8 A;  2NYQ A;  4CPA A;  4MHN A;  2ZEO A;  2AFX A;  2PVW A;  1FT7 A;  5HXD A;  5LRG A;  4TNU A;  4P4F A;  2PJA A;  4A94 A;  2PVV A;  2ZEF A;  1XBU A;  2GLF A;  4P4J A;  4P44 A;  4ZX9 A;  2C6G A;  2C6C A;  2XEF A;  4MHP A;  1BLL E;  1F57 A;  4LQG A;  4PXC A;  3N5F A;  2AFZ A;  5LYD A;  5ELY A;  5DS0 A;  4MCP A;  4ZY1 A;  1PCA A;  3GLJ A;  3IFE A;  5K8O A;  4H2K A;  2F7V A;  3KI9 A;  1Y7E A;  2Q51 A;  3RAM A;  4NFR A;  3PEI A;  5J1Q A;  1XRY A;  2PIY A;  3B35 A;  3D68 A;  2NSM A;  1ZG9 A;  4MCQ A;  1YME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...