4FBEA

Crystal structure of the c136a/c164a variant of mitochondrial isoform of glutaminyl cyclase from drosophila melanogaster
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
316
structure length
303
Chain Sequence
ELVDIPKISYNPSELSEPRFLEYSNLSDKLHLREAIDKILIPRVVGTTNHSIVREYIVQSLRDLDWDVEVNSFHDHAPIKGKLHFHNIIATLNPNAERYLVLSAHYDSKYMPGVEFLGATDSAVPAAMLLNLAQVLQEQLKPLKKSKLSLMLLFFDGEEAFEEWGPKDSIYGARHLAKKWHHEGKLDRIDMLVLLDLLGAPDPAFYSFFENTESWYMRIQSVETRLAKLQLLERYFQSQAMRSSFIEDDHIPFLRRNVPILHLIPVPFPSVWHTPDDNASVIDYATTDNLALIIRLFALEYLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, hydrolase
molecule keywords CG5976, isoform B
publication title Crystal Structures of Glutaminyl Cyclases (QCs) from Drosophila melanogaster Reveal Active Site Conservation between Insect and Mammalian QCs.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 104
structure length 303
sequence length 316
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4fbeA00
4OP4A 2VL1A 4OC3A 1ARLA 3S9NA 1DE4C 1HEEA 1LCPA 2J9AA 1CPSA 3N5FA 1Q7LA 4F9UA 4MHNA 1BLLE 4OC2A 4UIBA 2ZEDA 2WYRA 4IHMA 3V7ZA 4UEZA 1XJOA 1XRYA 1FNOA 2O53A 2G9DA 4OKOA 4OC5A 5K8PA 3PFEA 3KQXA 3D7GA 1BAVA 2JEWA 4P4IA 2ZEFA 3L2NA 3CPXA 1Z5RA 4A37A 3FECA 4PXCA 4P4FA 2QVPA 3KASA 3PRTA 1TXRA 4MCPA 2F8HA 3K2KA 4FBEA 2PJBA 3SI1A 3SJXA 2PIZA 3VH9A 1AMPA 3TX8A 2PRQA 3SI0A 5THWA 3IWWA 1ZG7A 1OBRA 1CX8A 5ELYA 2PJ8A 3GUXA 1M4LA 1ARMA 3SJGA 3D68A 3HUVA 2XEFA 4F9VA 4W9YA 2EWBA 1Z2LA 1VGYA 3S9MA 1F2PA 3IJ3A 3FX6A 1ZLHA 5JH9A 4P4EA 4AXVA 2AFSA 3SJFA 4P6YA 4EFDA 2PIYA 4UIAA 4Z65A 4MCSA 3FEEA 3KZWA 2QYVA 3PB6X 3FF3A 1XBUA 1LAPA 2Q51A 1H8LA 2FVGA 4TWEA 1F57A 3CT9A 1TKFA 2EK9A 4ZX9A 3JRUA 2GREA 3NA6A 3FEDA 3FJUA 1QMUA 1YSJA 4ZI6A 1ELMP 4ONWA 4P4JA 3RZAA 1ZG9A 3B3SA 2IQ6A 3PB4X 2JBJA 5J1QA 4LQGA 1VHEA 4ZYQA 3NH8A 5K8OA 7CPAA 2HC9A 1RTQA 2V8HA 2V8VA 4NGMA 2CTBA 1TF9A 3GB0A 2GLFA 2BCOA 1Y0RA 4ZY1A 3WT4A 4X2TA 3IC1A 4OMEA 5IB9A 3FMCA 4A38A 2AFOA 1DTDA 4UEFA 3KI9A 4X8IA 2F7VA 3RAMA 1CBXA 3BI0A 2AFMA 3D66A 5JGFA 1VHOA 1EE3P 1R3NA 1IGBA 3TC8A 3PB8X 4FAIA 4OC1A 4OC4A 3WC5A 4MMOA 1HDQA 6CPAA 4FWUA 3B2YA 4Q7AA 1Z8LA 5DS0A 2PJCA 2O4HA 4P10A 4NJRA 2PE3A 1YW4A 2RFHA 2AFWA 5I4MA 8CPAA 2ZEOA 4BD9A 4K3NA 4OIDA 1YW6A 4A94A 5HXDA 3KHZA 2ZEGA 2NYQA 4NGPA 3D67A 2C6PA 4JZ0A 4R8FA 5LYLA 1UWYA 3RBUA 5CBMA 4O23A 2PJ3A 3PBEA 3I1UA 2PJ4A 2PJ5A 3B3VA 2ZELA 2RB7A 5D29A 3PFOA 2PJ1A 2NSMA 4MCRA 1ZLIA 2PJ9A 2XEJA 3H8FA 4NGNA 3VATA 3D7DA 3KHXA 2BOAA 4YU9A 4DUKA 3CPAA 3B7IA 3KQZA 1CP7A 1LFWA 3H8GA 4R76A 3LWUA 4P4DA 4KSIA 3B35A 5LRJA 5D8NA 2XEGA 4NFRA 3IFEA 3V38A 3WC6A 3FVLA 1PYTB 4JYWA 4F8ZA 1FT7A 4R7MA 3QNVA 4EMEA 2IJZA 3SJEA 5HVFA 3PB9X 3IIBA 1AYEA 1CPXA 5HVHA 4FUUA 4YWYA 1BPNA 1LAMA 5K8MA 4PXEA 3KR4A 1BPMA 3VARA 3NH5A 1CP6A 2ANPA 2PJ2A 4P4BA 3SI2A 1GYTA 3DGVA 4TNUA 1CG2A 1XMBA 2ZEPA 3PEIA 3NFZA 2PVWA 1VIXA 3T8WA 4RUHA 5LRKA 3K9TA 1NSAA 1Y0YA 3BXMA 5LRGA 3D7FA 2DEAA 2Q4ZA 1Y7EA 1YMEA 3NH4A 5CPAA 2PJ0A 4EWTA 4NGTA 3WC7A 3DLJA 4MHZA 1XFOA 2AFXA 4ZY0A 4MRIA 1IY7A 4H2KA 4IK2A 1R43A 4MHYA 4NJQA 2ZEMA 1HDUA 4GM5A 2IMOA 2OR4A 3ISZA 4P44A 2POKA 2AFUA 1TKHA 3H8EA 4ZY2A 4PXBA 2ZENA 3S9LA 4PXDA 4PPZA 3D4UA 2Q43A 5F09A 2ZOFA 5LYIA 4X3RA 2OOTA 2ABZA 4ZX8A 3GLJA 4MXUA 2CF4A 2EK8A 4NGQA 3IO1A 2GLJA 3IEHA 1LANA 3KR5A 3BHXA 3B3CA 4WJBA 2WZNA 1TKJA 3PBBA 4MCQA 4DJLA 2V8GA 2PCUA 2I3CA 2V77A 2PJ7A 2C1CA 2GU2A 2ZEEA 1YLOA 3WABA 1JQGA 4NGSA 5LYDA 3B3TA 2PJAA 1QQ9A 4B6ZA 3D7HA 3MN8A 4G1PA 4NGRA 4WWVA 2XEIA 4CPAA 1TF8A 2BO9A 4PQAA 3PB7X 4IAVA 4UF4A 2C6GA 2AFZA 4OIWA 4R6TA 2C6CA 5K8NA 3KGQA 5LYFA 2ZEHA 3B3WA 1KWMA 3HLPA 3BI1A 2PJ6A 1ZG8A 2QJ8A 4A39A 1F2OA 2HB6A 5HVGA 2CTCA 3KL9A 5JM6A 3FH4A 4UEEA 3CDXA 4P45A 2ZOGA 2CIJA 4MHPA 3ISXA 4DYOA 1LOKA 2PVVA 2JBKA 3LMSA 1PCAA 1ELLP 4OC0A 2V8DA 3MRUA
chains in the Genus database with same CATH superfamily
4OP4A 2VL1A 4R3KA 2BSWA 4OC3A 1ARLA 2CXAA 1AUGA 3KKWA 5IV0A 4E2AA 4ORFA 3S9NA 1DE4C 1HEEA 1LCPA 2J9AA 1CPSA 3N5FA 5JPHA 5G21A 1Q7LA 4F9UA 2B3VA 2VBQA 1BLLE 4MHNA 4OC2A 4OLLA 4UIBA 4KOSA 4A95A 2ZEDA 1PUAA 2WYRA 4IHMA 3V7ZA 4KOWA 1VHSA 4UEZA 1XJOA 1Z8TA 1XRYA 1FNOA 1QSRA 2G9DA 2O53A 2Q7SA 2ZXVA 4OKOA 4UBRA 4RN7A 4LQ6A 4OC5A 5K8PA 3PFEA 3EXNA 4B5PA 3KQXA 2Z11A 3D7GA 1BAVA 2RC4A 2JEWA 4M6HA 4P4IA 4HNWB 3TOAA 4MFJA 3IU2A 3UY5A 2ZEFA 3L2NA 3CPXA 4YGOA 2Q04A 1Z5RA 2QMLA 3FECA 4MJ8A 4A37A 4J3GA 4KOYA 4L89A 4CYPA 3JUWA 4CAVA 4PXCA 4P4FA 1IYKA 2QVPA 5GCNA 3IWGA 4L8AA 3KASA 3PRTA 1KUVA 1TXRA 4MCPA 2F8HA 3K2KA 4C2ZA 2VEZA 4CGPA 4IF5A 2PJBA 4HNYB 2BL1A 3SI1A 3SJXA 4FBEA 2PIZA 3VH9A 1AMPA 4CYNA 4GXHA 1S7KA 5G1ZA 1XOVA 3TX8A 2PRQA 3SI0A 2ZW6A 2WPXA 3WR7A 5THWA 3IWWA 3F0AA 1ZG7A 1OBRA 2D4OA 2P0WA 1CX8A 3E0KA 5ELYA 2PJ8A 2PR1A 3GUXA 1M4LA 4H6ZA 1ARMA 4UA3A 3SJGA 1RXTA 3D68A 3HUVA 2XEFA 4B12A 4MFQA 4W9YA 4F9VA 2EWBA 3GY9A 1Y7RA 1Z2LA 1VGYA 3S9MA 3W6SA 1F2PA 3IJ3A 4KVOE 4M6IA 3FX6A 3F5BA 1ZLHA 1M4DA 2VQYA 2WPWA 3D8PA 3RO0A 4CGNA 5JH9A 4BMHA 4P4EA 1IU8A 2OZHA 1WK4A 2DXQA 4AXVA 1XIXA 2AFSA 3SJFA 4I49A 3PZJA 4P6YA 2NMTA 3TO7A 4EFDA 4FD5A 4JLYA 1M1DA 2PIYA 4UIAA 2JDCA 5F47A 3P2FA 1P4NA 4AG9A 2CY2A 4PSWA 1YQEA 4Z65A 4MCSA 3FEEA 3S6KA 3QB8A 1XF8A 3KZWA 2QYVA 3TT2A 3PB6X 2X7BA 1Q2DA 3FF3A 1XBUA 4AB7A 4MBUA 1LAPA 2Q51A 2K5TA 1M4GA 1H8LA 2FVGA 4MFLA 4KZTA 2VI7A 4TWEA 4B10A 1F57A 3CT9A 1M44A 1XEBA 1TKFA 1ON0A 2EK9A 4ZX9A 4A32A 3JRUA 2Z3MA 2GREA 3TCVA 3NA6A 3QAHA 3FEDA 3FJUA 1QMUA 1YSJA 4KOTA 4ZI6A 1ELMP 4ONWA 4P4JA 3RZAA 1ZG9A 3B3SA 2IQ6A 2DPSA 4UFWA 4YFJA 3PB4X 2JBJA 5J1QA 5G20A 5H86A 4BINA 4LQGA 4C2YA 1VHEA 4RI1A 4ZYQA 3NH8A 5G22A 5K8OA 2QIRA 7CPAA 4OC0A 2HC9A 4C7HA 1RTQA 4JJXA 2H5MA 2V8HA 4KUAA 2V8VA 5AG6A 5KTCA 4NGMA 2CTBA 4CAXA 2PQ8A 1KUYA 1TF9A 3GB0A 2GLFA 2BCOA 1Y0RA 4ZY1A 3D3SA 4UCPA 1IB1E 3WT4A 4X2TA 3FB3A 3IC1A 4OMEA 4MHDA 3FMCA 5IB9A 4A38A 2AFOA 2J8NA 5FVJA 1DTDA 4UEFA 4C68A 4UFVA 3KI9A 2Z3OA 4X8IA 5CNPA 4ZGYB 2F7VA 3RAMA 1CBXA 3LD2A 4B14A 2VZZA 1IOFA 3BI0A 2AFMA 4KOXA 4OADA 2EBJA 3D66A 5JGFA 1VHOA 1EE3P 2ZPAA 1R3NA 1IGBA 1JWQA 4GS4A 3TC8A 3PB8X 4FAIA 4H6UA 4OC1A 4OC4A 3WC5A 1B6BA 2EO8A 2P6GA 4F0XA 4DNCA 4MMOA 3IWEA 1HDQA 2GIVA 4AVAA 2G0BA 6CPAA 4FWUA 3FNCA 2J8RA 3B2YA 4Q7AA 3FBUA 4R9MA 1Z8LA 1MJAA 2OZGA 5DS0A 2PJCA 2O4HA 3EY5A 4P10A 2P6EA 4NJRA 2PE3A 1YW4A 2RFHA 2AFWA 2HV2A 4UWJA 5I4MA 8CPAA 2Z0ZA 2ZEOA 5HMNA 5F49A 4BD9A 2B58A 3R9GA 4CGOA 1Z4RA 2JLMA 4A2ZA 1FY7A 2PC1A 4FD6A 4K3NA 4OIDA 1YW6A 3PP9A 4IUSA 4A94A 2CNTA 5HXDA 3KHZA 2Q0YA 2ZEGA 2NYQA 4NGPA 3TFYA 3D67A 2C6PA 4JZ0A 4R8FA 3G3SA 5LYLA 1UWYA 1BO4A 3RBUA 5CBMA 3FYNA 4O23A 4NCZA 1B87A 3DNSA 2PJ3A 2BUEA 1TIQA 2Y0MA 3PBEA 4B5PB 2VZYA 4ONUA 1Y9KA 1Q2CA 4LX9A 3I1UA 2PJ4A 1IOIA 2PJ5A 1S7NA 2GFQA 2YNDA 3B3VA 4CRZB 2ZELA 3D2MA 4FD4A 4XPDC 2RB7A 3N7ZA 5D29A 3A9LA 1V0CA 1XMTA 2C27A 4PV6A 2FCKA 2FXFA 3PFOA 2PJ1A 3CXQA 4KOVA 1GHEA 2NSMA 1S60A 2J8MA 1ZLIA 2PJ9A 2XEJA 3H8FA 3H4QA 4MCRA 4NGNA 3VATA 1MK4A 2AJ6A 3D7DA 1WWZA 2B5GA 2Q4YA 1OZPA 3KHXA 2ZW7A 5DWNA 5A28A 2BOAA 4CGLA 4KVXA 1X10A 4YU9A 3GYAA 1I1DA 4HPSA 4DUKA 3SHPA 3T9YA 1KUXA 3CPAA 1MJBA 3B7IA 3KQZA 4XPLA 5JQ4A 1CP7A 1LFWA 1Z4EA 3H8GA 3LWUA 4R76A 2JEVA 4P4DA 5DWMA 3R96A 2GANA 2FL4A 4KSIA 3B35A 5LRJA 5D8NA 2XEGA 4NFRA 3IFEA 3V38A 4AVCA 4KVME 3WC6A 1L0CA 2B5GB 3FVLA 1PYTB 2B4DA 3F8KA 4KS9A 4JYWA 1S5KA 5H84A 2OB0A 2Q44A 3SXOA 4CRYB 4QBJA 2KCWA 1YX0A 2Z3KA 4F8ZA 3RNZA 4E0AA 1FT7A 4R7MA 3QNVA 4CYOA 5A27A 4EMEA 2IJZA 4XPKA 3SJEA 5HVFA 3GIUA 3PB9X 3MGDA 3IIBA 1M4IA 4A30A 1AYEA 5AG5A 1A2ZA 3I3GA 1CPXA 1S7FA 2B4DB 2GE3A 5HVHA 2Q7BA 4FUUA 4JWPA 3T90A 3VWEA 3RYOA 4YWYA 5F46A 1BPNA 4M6GA 4UWIA 3FIXA 4B5OA 1LAMA 5K8MA 4PXEA 2OH1A 3SXNA 2FE7A 3KR4A 1BPMA 3LACA 4HKFA 3EC4A 4RS2A 3S6GA 3R1KA 2JDDA 3VARA 3ZZIA 3NH5A 1CP6A 2ANPA 2PJ2A 3W91A 4XNHC 4P4BA 2PDOA 1GYTA 3DGVA 3JTKA 4TNUA 4XPDB 2Z3NA 3SI2A 1CM0A 2AE6A 2R98A 5C88A 4R57A 3FXTA 5EMIA 4CAEA 5ISVA 1CG2A 3FRMA 1XMBA 2FIAA 4MFPA 2ZEPA 2VXKA 3PEIA 3NFZA 2PVWA 3GKRA 1VIXA 3BLNA 3T8WA 5BWAB 4RUHA 5LRKA 3QAYA 4E8OA 2YGWA 4YRHA 3K9TA 4KSAA 1NSAA 1Y0YA 3BXMA 1YVKA 4EVYA 2ATRA 4UFXA 5KTAA 5LRGA 3D7FA 2DEAA 4AVBA 2Q4ZA 2QECA 1Y7EA 1YVOA 1J4JA 1XE4A 1YMEA 2YNEA 3NH4A 2HUZA 5CPAA 2PJ0A 4EWTA 4NGTA 4F6AA 1Z8XA 3DLJA 1NE9A 4PK3A 3WC7A 2FT0A 3CZXA 3VWDA 5F48A 4BBHA 4B11A 2D4PA 2Q4VA 4NEXA 3S6HA 4B13A 3DDDA 2O28A 2B3UA 4MHZA 1XFOA 2ODFA 2AFXA 1Z9UA 1CJWA 4ZY0A 2P6FA 4MRIA 2EVNA 2FIWA 4CAWA 1IY7A 1IYLA 4U9ZA 4H2KA 3DR8A 3P2HA 3ZJ0A 4IK2A 4K30A 5AGEA 3B8GA 4Q38A 1R43A 4MHYA 4NJQA 3TOBA 4AG7A 1I21A 4HNXB 5AG7A 2ZEMA 4QC6A 1HDUA 1IIDA 1UFHA 3PGPA 2IMOA 2F5IA 2OR4A 3ISZA 4GM5A 4PSXA 2FS5A 2PSWA 4P44A 2WSAA 2POKA 2AFUA 1TKHA 2EUIA 2G3TA 4CS0B 3H8EA 1NMTA 4ZY2A 3TO9A 4PXBA 3V8IA 4KSFA 1PU9A 2CNSA 1IICA 3IU1A 2ZENA 4QUSA 4JD6A 3S9LA 4PXDA 4PPZA 3D4UA 2Q43A 4NF1A 4XNHB 2HQYA 4A31A 5EC4A 1RO5A 5F09A 4KORA 1K4JA 2ZOFA 5LYIA 3IGRA 2REEA 1QSOA 4X3RA 2OOTA 3R9FA 1YR0A 2ABZA 4MY0A 4ZX8A 5J8FA 3GLJA 4MXUA 2CF4A 2EK8A 3NE8A 4NGQA 4Y49C 4A33A 4FD7A 3IO1A 1YREA 3LODA 1Y9WA 4MFZA 1KZFA 2I00A 4M3SA 2GLJA 3IEHA 1LANA 3KR5A 5J8CA 4OAEA 1P0HA 3NE7A 3BHXA 3B3CA 1Q2YA 1U6MA 3BJ7A 4MY3A 4KOUA 2WZNA 3CXPA 4WJBA 1TKJA 2IL4A 2Z10A 3PBBA 4JXRA 4MCQA 2V8GA 4DJLA 5I0CA 2PCUA 2I3CA 2V77A 2PJ7A 2C1CA 3I9SA 1QSNA 4QB9A 4M85A 4C2XA 2GU2A 2ZEEA 4MFKA 1YLOA 4MI4A 1JQGA 4NGSA 5LYDA 2ZW4A 3H5ZA 2WUUA 3B3TA 4U5YA 3WABA 2PJAA 1QQ9A 3OWCA 4B6ZA 5IB0A 3TE4A 4CAFA 2ZW5A 3TTHA 5KTDA 1S3ZA 3D7HA 3MN8A 4G1PA 3W6XA 4CYQA 4NGRA 4WWVA 2YNCC 1NSLA 3EO4A 2XEIA 4CPAA 4ZBGA 1TF8A 3TO6A 2BO9A 4PQAA 4F0YA 1SQHA 3PB7X 4IAVA 3JVNA 3DR6A 4UCMA 2OZUA 3CXSA 1S7LA 1Z8WA 2R8VA 4UF4A 2C6GA 4KUBA 1BOBA 2AFZA 4H89A 2V8DA 5C82A 3K9UA 1X12A 1MJ9A 4OIWA 3G8WA 4II9A 2A4NA 4NXYA 1N71A 1LRZA 4R6TA 2Z3LA 2C6CA 5EBVA 1VKCA 4UCNA 5K8NA 1I12A 2Z3PA 2R7HA 3KGQA 4NSQA 4CGMA 2OU2A 5LYFA 4PK2A 4Q36A 2ZEHA 3B3WA 5HH1A 2FSRA 2PRBA 4LUAA 3EFAA 3BJ8A 1KWMA 3R95A 3HLPA 3BI1A 2PJ6A 1ZG8A 3S6FA 2QJ8A 4A39A 1F2OA 1ZO0A 2HB6A 3R9EA 4R3LA 5AG4A 5HVGA 2CTCA 1QSMA 2DF5A 4QVTA 4Y49B 3KL9A 5JM6A 3C26A 3FH4A 4R87A 4X5KA 2REFA 3D2PA 4KLWA 4UEEA 1QSTA 2I79A 2BEIA 3CDXA 4P45A 2ZOGA 4C7IA 2CIJA 2B4BA 4MHPA 2YNCA 2CNMA 1R57A 2R1IA 3ISXA 4DYOA 1LOKA 2PVVA 5IX3A 2JBKA 3DSBA 5E96A 4KLVA 1YK3A 4U9YA 3LMSA 1PCAA 1YLEA 1ELLP 2G3AA 4JXQA 2DPTA 1YGHA 2PR8A 2ARHA 3MRUA
chains in the Genus database with same CATH topology
4OP4A 2VL1A 4OC3A 1ARLA 3S9NA 1DE4C 1HEEA 1LCPA 2J9AA 1CPSA 3N5FA 1Q7LA 4F9UA 4MHNA 1BLLE 4OC2A 4UIBA 2ZEDA 2WYRA 4IHMA 3V7ZA 4UEZA 1XJOA 1XRYA 1FNOA 2O53A 2G9DA 4OKOA 4OC5A 5K8PA 3PFEA 3KQXA 3D7GA 1BAVA 2JEWA 4P4IA 2ZEFA 3L2NA 3CPXA 1Z5RA 4A37A 3FECA 4PXCA 4P4FA 2QVPA 3KASA 3PRTA 1TXRA 4MCPA 2F8HA 3K2KA 4FBEA 2PJBA 3SI1A 3SJXA 2PIZA 3VH9A 1AMPA 3TX8A 2PRQA 3SI0A 5THWA 3IWWA 1ZG7A 1OBRA 1CX8A 5ELYA 2PJ8A 3GUXA 1M4LA 1ARMA 3SJGA 3D68A 3HUVA 2XEFA 4F9VA 4W9YA 2EWBA 1Z2LA 1VGYA 3S9MA 1F2PA 3IJ3A 3FX6A 1ZLHA 5JH9A 4P4EA 4AXVA 2AFSA 3SJFA 4P6YA 4EFDA 2PIYA 4UIAA 4Z65A 4MCSA 3FEEA 3KZWA 2QYVA 3PB6X 3FF3A 1XBUA 1LAPA 2Q51A 1H8LA 2FVGA 4TWEA 1F57A 3CT9A 1TKFA 2EK9A 4ZX9A 3JRUA 2GREA 3NA6A 3FEDA 3FJUA 1QMUA 1YSJA 4ZI6A 1ELMP 4ONWA 4P4JA 3RZAA 1ZG9A 3B3SA 2IQ6A 3PB4X 2JBJA 5J1QA 4LQGA 1VHEA 4ZYQA 3NH8A 5K8OA 7CPAA 2HC9A 1RTQA 2V8HA 2V8VA 4NGMA 2CTBA 1TF9A 3GB0A 2GLFA 2BCOA 1Y0RA 4ZY1A 3WT4A 4X2TA 3IC1A 4OMEA 5IB9A 3FMCA 4A38A 2AFOA 1DTDA 4UEFA 3KI9A 4X8IA 2F7VA 3RAMA 1CBXA 3BI0A 2AFMA 3D66A 5JGFA 1VHOA 1EE3P 1R3NA 1IGBA 3TC8A 3PB8X 4FAIA 4OC1A 4OC4A 3WC5A 4MMOA 1HDQA 6CPAA 4FWUA 3B2YA 4Q7AA 1Z8LA 5DS0A 2PJCA 2O4HA 4P10A 4NJRA 2PE3A 1YW4A 2RFHA 2AFWA 5I4MA 8CPAA 2ZEOA 4BD9A 4K3NA 4OIDA 1YW6A 4A94A 5HXDA 3KHZA 2ZEGA 2NYQA 4NGPA 3D67A 2C6PA 4JZ0A 4R8FA 5LYLA 1UWYA 3RBUA 5CBMA 4O23A 2PJ3A 3PBEA 3I1UA 2PJ4A 2PJ5A 3B3VA 2ZELA 2RB7A 5D29A 3PFOA 2PJ1A 2NSMA 4MCRA 1ZLIA 2PJ9A 2XEJA 3H8FA 4NGNA 3VATA 3D7DA 3KHXA 2BOAA 4YU9A 4DUKA 3CPAA 3B7IA 3KQZA 1CP7A 1LFWA 3H8GA 4R76A 3LWUA 4P4DA 4KSIA 3B35A 5LRJA 5D8NA 2XEGA 4NFRA 3IFEA 3V38A 3WC6A 3FVLA 1PYTB 4JYWA 4F8ZA 1FT7A 4R7MA 3QNVA 4EMEA 2IJZA 3SJEA 5HVFA 3PB9X 3IIBA 1AYEA 1CPXA 5HVHA 4FUUA 4YWYA 1BPNA 1LAMA 5K8MA 4PXEA 3KR4A 1BPMA 3VARA 3NH5A 1CP6A 2ANPA 2PJ2A 4P4BA 3SI2A 1GYTA 3DGVA 4TNUA 1CG2A 1XMBA 2ZEPA 3PEIA 3NFZA 2PVWA 1VIXA 3T8WA 4RUHA 5LRKA 3K9TA 1NSAA 1Y0YA 3BXMA 5LRGA 3D7FA 2DEAA 2Q4ZA 1Y7EA 1YMEA 3NH4A 5CPAA 2PJ0A 4EWTA 4NGTA 3WC7A 3DLJA 4MHZA 1XFOA 2AFXA 4ZY0A 4MRIA 1IY7A 4H2KA 4IK2A 1R43A 4MHYA 4NJQA 2ZEMA 1HDUA 4GM5A 2IMOA 2OR4A 3ISZA 4P44A 2POKA 2AFUA 1TKHA 3H8EA 4ZY2A 4PXBA 2ZENA 3S9LA 4PXDA 4PPZA 3D4UA 2Q43A 5F09A 2ZOFA 5LYIA 4X3RA 2OOTA 2ABZA 4ZX8A 3GLJA 4MXUA 2CF4A 2EK8A 4NGQA 3IO1A 2GLJA 3IEHA 1LANA 3KR5A 3BHXA 3B3CA 4WJBA 2WZNA 1TKJA 3PBBA 4MCQA 4DJLA 2V8GA 2PCUA 2I3CA 2V77A 2PJ7A 2C1CA 2GU2A 2ZEEA 1YLOA 3WABA 1JQGA 4NGSA 5LYDA 3B3TA 2PJAA 1QQ9A 4B6ZA 3D7HA 3MN8A 4G1PA 4NGRA 4WWVA 2XEIA 4CPAA 1TF8A 2BO9A 4PQAA 3PB7X 4IAVA 4UF4A 2C6GA 2AFZA 4OIWA 4R6TA 2C6CA 5K8NA 3KGQA 5LYFA 2ZEHA 3B3WA 1KWMA 3HLPA 3BI1A 2PJ6A 1ZG8A 2QJ8A 4A39A 1F2OA 2HB6A 5HVGA 2CTCA 3KL9A 5JM6A 3FH4A 4UEEA 3CDXA 4P45A 2ZOGA 2CIJA 4MHPA 3ISXA 4DYOA 1LOKA 2PVVA 2JBKA 3LMSA 1PCAA 1ELLP 4OC0A 2V8DA 3MRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OP4 A;  2VL1 A;  4OC3 A;  1ARL A;  3S9N A;  1DE4 C;  1HEE A;  1LCP A;  2J9A A;  1CPS A;  3N5F A;  1Q7L A;  4F9U A;  4MHN A;  1BLL E;  4OC2 A;  4UIB A;  2ZED A;  2WYR A;  4IHM A;  3V7Z A;  4UEZ A;  1XJO A;  1XRY A;  1FNO A;  2O53 A;  2G9D A;  4OKO A;  4OC5 A;  5K8P A;  3PFE A;  3KQX A;  3D7G A;  1BAV A;  2JEW A;  4P4I A;  2ZEF A;  3L2N A;  3CPX A;  1Z5R A;  4A37 A;  3FEC A;  4PXC A;  4P4F A;  2QVP A;  3KAS A;  3PRT A;  1TXR A;  4MCP A;  2F8H A;  3K2K A;  4FBE A;  2PJB A;  3SI1 A;  3SJX A;  2PIZ A;  3VH9 A;  1AMP A;  3TX8 A;  2PRQ A;  3SI0 A;  5THW A;  3IWW A;  1ZG7 A;  1OBR A;  1CX8 A;  5ELY A;  2PJ8 A;  3GUX A;  1M4L A;  1ARM A;  3SJG A;  3D68 A;  3HUV A;  2XEF A;  4F9V A;  4W9Y A;  2EWB A;  1Z2L A;  1VGY A;  3S9M A;  1F2P A;  3IJ3 A;  3FX6 A;  1ZLH A;  5JH9 A;  4P4E A;  4AXV A;  2AFS A;  3SJF A;  4P6Y A;  4EFD A;  2PIY A;  4UIA A;  4Z65 A;  4MCS A;  3FEE A;  3KZW A;  2QYV A;  3PB6 X;  3FF3 A;  1XBU A;  1LAP A;  2Q51 A;  1H8L A;  2FVG A;  4TWE A;  1F57 A;  3CT9 A;  1TKF A;  2EK9 A;  4ZX9 A;  3JRU A;  2GRE A;  3NA6 A;  3FED A;  3FJU A;  1QMU A;  1YSJ A;  4ZI6 A;  1ELM P;  4ONW A;  4P4J A;  3RZA A;  1ZG9 A;  3B3S A;  2IQ6 A;  3PB4 X;  2JBJ A;  5J1Q A;  4LQG A;  1VHE A;  4ZYQ A;  3NH8 A;  5K8O A;  7CPA A;  2HC9 A;  1RTQ A;  2V8H A;  2V8V A;  4NGM A;  2CTB A;  1TF9 A;  3GB0 A;  2GLF A;  2BCO A;  1Y0R A;  4ZY1 A;  3WT4 A;  4X2T A;  3IC1 A;  4OME A;  5IB9 A;  3FMC A;  4A38 A;  2AFO A;  1DTD A;  4UEF A;  3KI9 A;  4X8I A;  2F7V A;  3RAM A;  1CBX A;  3BI0 A;  2AFM A;  3D66 A;  5JGF A;  1VHO A;  1EE3 P;  1R3N A;  1IGB A;  3TC8 A;  3PB8 X;  4FAI A;  4OC1 A;  4OC4 A;  3WC5 A;  4MMO A;  1HDQ A;  6CPA A;  4FWU A;  3B2Y A;  4Q7A A;  1Z8L A;  5DS0 A;  2PJC A;  2O4H A;  4P10 A;  4NJR A;  2PE3 A;  1YW4 A;  2RFH A;  2AFW A;  5I4M A;  8CPA A;  2ZEO A;  4BD9 A;  4K3N A;  4OID A;  1YW6 A;  4A94 A;  5HXD A;  3KHZ A;  2ZEG A;  2NYQ A;  4NGP A;  3D67 A;  2C6P A;  4JZ0 A;  4R8F A;  5LYL A;  1UWY A;  3RBU A;  5CBM A;  4O23 A;  2PJ3 A;  3PBE A;  3I1U A;  2PJ4 A;  2PJ5 A;  3B3V A;  2ZEL A;  2RB7 A;  5D29 A;  3PFO A;  2PJ1 A;  2NSM A;  4MCR A;  1ZLI A;  2PJ9 A;  2XEJ A;  3H8F A;  4NGN A;  3VAT A;  3D7D A;  3KHX A;  2BOA A;  4YU9 A;  4DUK A;  3CPA A;  3B7I A;  3KQZ A;  1CP7 A;  1LFW A;  3H8G A;  4R76 A;  3LWU A;  4P4D A;  4KSI A;  3B35 A;  5LRJ A;  5D8N A;  2XEG A;  4NFR A;  3IFE A;  3V38 A;  3WC6 A;  3FVL A;  1PYT B;  4JYW A;  4F8Z A;  1FT7 A;  4R7M A;  3QNV A;  4EME A;  2IJZ A;  3SJE A;  5HVF A;  3PB9 X;  3IIB A;  1AYE A;  1CPX A;  5HVH A;  4FUU A;  4YWY A;  1BPN A;  1LAM A;  5K8M A;  4PXE A;  3KR4 A;  1BPM A;  3VAR A;  3NH5 A;  1CP6 A;  2ANP A;  2PJ2 A;  4P4B A;  3SI2 A;  1GYT A;  3DGV A;  4TNU A;  1CG2 A;  1XMB A;  2ZEP A;  3PEI A;  3NFZ A;  2PVW A;  1VIX A;  3T8W A;  4RUH A;  5LRK A;  3K9T A;  1NSA A;  1Y0Y A;  3BXM A;  5LRG A;  3D7F A;  2DEA A;  2Q4Z A;  1Y7E A;  1YME A;  3NH4 A;  5CPA A;  2PJ0 A;  4EWT A;  4NGT A;  3WC7 A;  3DLJ A;  4MHZ A;  1XFO A;  2AFX A;  4ZY0 A;  4MRI A;  1IY7 A;  4H2K A;  4IK2 A;  1R43 A;  4MHY A;  4NJQ A;  2ZEM A;  1HDU A;  4GM5 A;  2IMO A;  2OR4 A;  3ISZ A;  4P44 A;  2POK A;  2AFU A;  1TKH A;  3H8E A;  4ZY2 A;  4PXB A;  2ZEN A;  3S9L A;  4PXD A;  4PPZ A;  3D4U A;  2Q43 A;  5F09 A;  2ZOF A;  5LYI A;  4X3R A;  2OOT A;  2ABZ A;  4ZX8 A;  3GLJ A;  4MXU A;  2CF4 A;  2EK8 A;  4NGQ A;  3IO1 A;  2GLJ A;  3IEH A;  1LAN A;  3KR5 A;  3BHX A;  3B3C A;  4WJB A;  2WZN A;  1TKJ A;  3PBB A;  4MCQ A;  4DJL A;  2V8G A;  2PCU A;  2I3C A;  2V77 A;  2PJ7 A;  2C1C A;  2GU2 A;  2ZEE A;  1YLO A;  3WAB A;  1JQG A;  4NGS A;  5LYD A;  3B3T A;  2PJA A;  1QQ9 A;  4B6Z A;  3D7H A;  3MN8 A;  4G1P A;  4NGR A;  4WWV A;  2XEI A;  4CPA A;  1TF8 A;  2BO9 A;  4PQA A;  3PB7 X;  4IAV A;  4UF4 A;  2C6G A;  2AFZ A;  4OIW A;  4R6T A;  2C6C A;  5K8N A;  3KGQ A;  5LYF A;  2ZEH A;  3B3W A;  1KWM A;  3HLP A;  3BI1 A;  2PJ6 A;  1ZG8 A;  2QJ8 A;  4A39 A;  1F2O A;  2HB6 A;  5HVG A;  2CTC A;  3KL9 A;  5JM6 A;  3FH4 A;  4UEE A;  3CDX A;  4P45 A;  2ZOG A;  2CIJ A;  4MHP A;  3ISX A;  4DYO A;  1LOK A;  2PVV A;  2JBK A;  3LMS A;  1PCA A;  1ELL P;  4OC0 A;  2V8D A;  3MRU A; 
#chains in the Genus database with same CATH topology
 4OP4 A;  2VL1 A;  4R3K A;  2BSW A;  4OC3 A;  1ARL A;  2CXA A;  1AUG A;  3KKW A;  5IV0 A;  4E2A A;  4ORF A;  3S9N A;  1DE4 C;  1HEE A;  1LCP A;  2J9A A;  1CPS A;  3N5F A;  5JPH A;  5G21 A;  1Q7L A;  4F9U A;  2B3V A;  2VBQ A;  1BLL E;  4MHN A;  4OC2 A;  4OLL A;  4UIB A;  4KOS A;  4A95 A;  2ZED A;  1PUA A;  2WYR A;  4IHM A;  3V7Z A;  4KOW A;  1VHS A;  4UEZ A;  1XJO A;  1Z8T A;  1XRY A;  1FNO A;  1QSR A;  2G9D A;  2O53 A;  2Q7S A;  2ZXV A;  4OKO A;  4UBR A;  4RN7 A;  4LQ6 A;  4OC5 A;  5K8P A;  3PFE A;  3EXN A;  4B5P A;  3KQX A;  2Z11 A;  3D7G A;  1BAV A;  2RC4 A;  2JEW A;  4M6H A;  4P4I A;  4HNW B;  3TOA A;  4MFJ A;  3IU2 A;  3UY5 A;  2ZEF A;  3L2N A;  3CPX A;  4YGO A;  2Q04 A;  1Z5R A;  2QML A;  3FEC A;  4MJ8 A;  4A37 A;  4J3G A;  4KOY A;  4L89 A;  4CYP A;  3JUW A;  4CAV A;  4PXC A;  4P4F A;  1IYK A;  2QVP A;  5GCN A;  3IWG A;  4L8A A;  3KAS A;  3PRT A;  1KUV A;  1TXR A;  4MCP A;  2F8H A;  3K2K A;  4C2Z A;  2VEZ A;  4CGP A;  4IF5 A;  2PJB A;  4HNY B;  2BL1 A;  3SI1 A;  3SJX A;  4FBE A;  2PIZ A;  3VH9 A;  1AMP A;  4CYN A;  4GXH A;  1S7K A;  5G1Z A;  1XOV A;  3TX8 A;  2PRQ A;  3SI0 A;  2ZW6 A;  2WPX A;  3WR7 A;  5THW A;  3IWW A;  3F0A A;  1ZG7 A;  1OBR A;  2D4O A;  2P0W A;  1CX8 A;  3E0K A;  5ELY A;  2PJ8 A;  2PR1 A;  3GUX A;  1M4L A;  4H6Z A;  1ARM A;  4UA3 A;  3SJG A;  1RXT A;  3D68 A;  3HUV A;  2XEF A;  4B12 A;  4MFQ A;  4W9Y A;  4F9V A;  2EWB A;  3GY9 A;  1Y7R A;  1Z2L A;  1VGY A;  3S9M A;  3W6S A;  1F2P A;  3IJ3 A;  4KVO E;  4M6I A;  3FX6 A;  3F5B A;  1ZLH A;  1M4D A;  2VQY A;  2WPW A;  3D8P A;  3RO0 A;  4CGN A;  5JH9 A;  4BMH A;  4P4E A;  1IU8 A;  2OZH A;  1WK4 A;  2DXQ A;  4AXV A;  1XIX A;  2AFS A;  3SJF A;  4I49 A;  3PZJ A;  4P6Y A;  2NMT A;  3TO7 A;  4EFD A;  4FD5 A;  4JLY A;  1M1D A;  2PIY A;  4UIA A;  2JDC A;  5F47 A;  3P2F A;  1P4N A;  4AG9 A;  2CY2 A;  4PSW A;  1YQE A;  4Z65 A;  4MCS A;  3FEE A;  3S6K A;  3QB8 A;  1XF8 A;  3KZW A;  2QYV A;  3TT2 A;  3PB6 X;  2X7B A;  1Q2D A;  3FF3 A;  1XBU A;  4AB7 A;  4MBU A;  1LAP A;  2Q51 A;  2K5T A;  1M4G A;  1H8L A;  2FVG A;  4MFL A;  4KZT A;  2VI7 A;  4TWE A;  4B10 A;  1F57 A;  3CT9 A;  1M44 A;  1XEB A;  1TKF A;  1ON0 A;  2EK9 A;  4ZX9 A;  4A32 A;  3JRU A;  2Z3M A;  2GRE A;  3TCV A;  3NA6 A;  3QAH A;  3FED A;  3FJU A;  1QMU A;  1YSJ A;  4KOT A;  4ZI6 A;  1ELM P;  4ONW A;  4P4J A;  3RZA A;  1ZG9 A;  3B3S A;  2IQ6 A;  2DPS A;  4UFW A;  4YFJ A;  3PB4 X;  2JBJ A;  5J1Q A;  5G20 A;  5H86 A;  4BIN A;  4LQG A;  4C2Y A;  1VHE A;  4RI1 A;  4ZYQ A;  3NH8 A;  5G22 A;  5K8O A;  2QIR A;  7CPA A;  4OC0 A;  2HC9 A;  4C7H A;  1RTQ A;  4JJX A;  2H5M A;  2V8H A;  4KUA A;  2V8V A;  5AG6 A;  5KTC A;  4NGM A;  2CTB A;  4CAX A;  2PQ8 A;  1KUY A;  1TF9 A;  3GB0 A;  2GLF A;  2BCO A;  1Y0R A;  4ZY1 A;  3D3S A;  4UCP A;  1IB1 E;  3WT4 A;  4X2T A;  3FB3 A;  3IC1 A;  4OME A;  4MHD A;  3FMC A;  5IB9 A;  4A38 A;  2AFO A;  2J8N A;  5FVJ A;  1DTD A;  4UEF A;  4C68 A;  4UFV A;  3KI9 A;  2Z3O A;  4X8I A;  5CNP A;  4ZGY B;  2F7V A;  3RAM A;  1CBX A;  3LD2 A;  4B14 A;  2VZZ A;  1IOF A;  3BI0 A;  2AFM A;  4KOX A;  4OAD A;  2EBJ A;  3D66 A;  5JGF A;  1VHO A;  1EE3 P;  2ZPA A;  1R3N A;  1IGB A;  1JWQ A;  4GS4 A;  3TC8 A;  3PB8 X;  4FAI A;  4H6U A;  4OC1 A;  4OC4 A;  3WC5 A;  1B6B A;  2EO8 A;  2P6G A;  4F0X A;  4DNC A;  4MMO A;  3IWE A;  1HDQ A;  2GIV A;  4AVA A;  2G0B A;  6CPA A;  4FWU A;  3FNC A;  2J8R A;  3B2Y A;  4Q7A A;  3FBU A;  4R9M A;  1Z8L A;  1MJA A;  2OZG A;  5DS0 A;  2PJC A;  2O4H A;  3EY5 A;  4P10 A;  2P6E A;  4NJR A;  2PE3 A;  1YW4 A;  2RFH A;  2AFW A;  2HV2 A;  4UWJ A;  5I4M A;  8CPA A;  2Z0Z A;  2ZEO A;  5HMN A;  5F49 A;  4BD9 A;  2B58 A;  3R9G A;  4CGO A;  1Z4R A;  2JLM A;  4A2Z A;  1FY7 A;  2PC1 A;  4FD6 A;  4K3N A;  4OID A;  1YW6 A;  3PP9 A;  4IUS A;  4A94 A;  2CNT A;  5HXD A;  3KHZ A;  2Q0Y A;  2ZEG A;  2NYQ A;  4NGP A;  3TFY A;  3D67 A;  2C6P A;  4JZ0 A;  4R8F A;  3G3S A;  5LYL A;  1UWY A;  1BO4 A;  3RBU A;  5CBM A;  3FYN A;  4O23 A;  4NCZ A;  1B87 A;  3DNS A;  2PJ3 A;  2BUE A;  1TIQ A;  2Y0M A;  3PBE A;  4B5P B;  2VZY A;  4ONU A;  1Y9K A;  1Q2C A;  4LX9 A;  3I1U A;  2PJ4 A;  1IOI A;  2PJ5 A;  1S7N A;  2GFQ A;  2YND A;  3B3V A;  4CRZ B;  2ZEL A;  3D2M A;  4FD4 A;  4XPD C;  2RB7 A;  3N7Z A;  5D29 A;  3A9L A;  1V0C A;  1XMT A;  2C27 A;  4PV6 A;  2FCK A;  2FXF A;  3PFO A;  2PJ1 A;  3CXQ A;  4KOV A;  1GHE A;  2NSM A;  1S60 A;  2J8M A;  1ZLI A;  2PJ9 A;  2XEJ A;  3H8F A;  3H4Q A;  4MCR A;  4NGN A;  3VAT A;  1MK4 A;  2AJ6 A;  3D7D A;  1WWZ A;  2B5G A;  2Q4Y A;  1OZP A;  3KHX A;  2ZW7 A;  5DWN A;  5A28 A;  2BOA A;  4CGL A;  4KVX A;  1X10 A;  4YU9 A;  3GYA A;  1I1D A;  4HPS A;  4DUK A;  3SHP A;  3T9Y A;  1KUX A;  3CPA A;  1MJB A;  3B7I A;  3KQZ A;  4XPL A;  5JQ4 A;  1CP7 A;  1LFW A;  1Z4E A;  3H8G A;  3LWU A;  4R76 A;  2JEV A;  4P4D A;  5DWM A;  3R96 A;  2GAN A;  2FL4 A;  4KSI A;  3B35 A;  5LRJ A;  5D8N A;  2XEG A;  4NFR A;  3IFE A;  3V38 A;  4AVC A;  4KVM E;  3WC6 A;  1L0C A;  2B5G B;  3FVL A;  1PYT B;  2B4D A;  3F8K A;  4KS9 A;  4JYW A;  1S5K A;  5H84 A;  2OB0 A;  2Q44 A;  3SXO A;  4CRY B;  4QBJ A;  2KCW A;  1YX0 A;  2Z3K A;  4F8Z A;  3RNZ A;  4E0A A;  1FT7 A;  4R7M A;  3QNV A;  4CYO A;  5A27 A;  4EME A;  2IJZ A;  4XPK A;  3SJE A;  5HVF A;  3GIU A;  3PB9 X;  3MGD A;  3IIB A;  1M4I A;  4A30 A;  1AYE A;  5AG5 A;  1A2Z A;  3I3G A;  1CPX A;  1S7F A;  2B4D B;  2GE3 A;  5HVH A;  2Q7B A;  4FUU A;  4JWP A;  3T90 A;  3VWE A;  3RYO A;  4YWY A;  5F46 A;  1BPN A;  4M6G A;  4UWI A;  3FIX A;  4B5O A;  1LAM A;  5K8M A;  4PXE A;  2OH1 A;  3SXN A;  2FE7 A;  3KR4 A;  1BPM A;  3LAC A;  4HKF A;  3EC4 A;  4RS2 A;  3S6G A;  3R1K A;  2JDD A;  3VAR A;  3ZZI A;  3NH5 A;  1CP6 A;  2ANP A;  2PJ2 A;  3W91 A;  4XNH C;  4P4B A;  2PDO A;  1GYT A;  3DGV A;  3JTK A;  4TNU A;  4XPD B;  2Z3N A;  3SI2 A;  1CM0 A;  2AE6 A;  2R98 A;  5C88 A;  4R57 A;  3FXT A;  5EMI A;  4CAE A;  5ISV A;  1CG2 A;  3FRM A;  1XMB A;  2FIA A;  4MFP A;  2ZEP A;  2VXK A;  3PEI A;  3NFZ A;  2PVW A;  3GKR A;  1VIX A;  3BLN A;  3T8W A;  5BWA B;  4RUH A;  5LRK A;  3QAY A;  4E8O A;  2YGW A;  4YRH A;  3K9T A;  4KSA A;  1NSA A;  1Y0Y A;  3BXM A;  1YVK A;  4EVY A;  2ATR A;  4UFX A;  5KTA A;  5LRG A;  3D7F A;  2DEA A;  4AVB A;  2Q4Z A;  2QEC A;  1Y7E A;  1YVO A;  1J4J A;  1XE4 A;  1YME A;  2YNE A;  3NH4 A;  2HUZ A;  5CPA A;  2PJ0 A;  4EWT A;  4NGT A;  4F6A A;  1Z8X A;  3DLJ A;  1NE9 A;  4PK3 A;  3WC7 A;  2FT0 A;  3CZX A;  3VWD A;  5F48 A;  4BBH A;  4B11 A;  2D4P A;  2Q4V A;  4NEX A;  3S6H A;  4B13 A;  3DDD A;  2O28 A;  2B3U A;  4MHZ A;  1XFO A;  2ODF A;  2AFX A;  1Z9U A;  1CJW A;  4ZY0 A;  2P6F A;  4MRI A;  2EVN A;  2FIW A;  4CAW A;  1IY7 A;  1IYL A;  4U9Z A;  4H2K A;  3DR8 A;  3P2H A;  3ZJ0 A;  4IK2 A;  4K30 A;  5AGE A;  3B8G A;  4Q38 A;  1R43 A;  4MHY A;  4NJQ A;  3TOB A;  4AG7 A;  1I21 A;  4HNX B;  5AG7 A;  2ZEM A;  4QC6 A;  1HDU A;  1IID A;  1UFH A;  3PGP A;  2IMO A;  2F5I A;  2OR4 A;  3ISZ A;  4GM5 A;  4PSX A;  2FS5 A;  2PSW A;  4P44 A;  2WSA A;  2POK A;  2AFU A;  1TKH A;  2EUI A;  2G3T A;  4CS0 B;  3H8E A;  1NMT A;  4ZY2 A;  3TO9 A;  4PXB A;  3V8I A;  4KSF A;  1PU9 A;  2CNS A;  1IIC A;  3IU1 A;  2ZEN A;  4QUS A;  4JD6 A;  3S9L A;  4PXD A;  4PPZ A;  3D4U A;  2Q43 A;  4NF1 A;  4XNH B;  2HQY A;  4A31 A;  5EC4 A;  1RO5 A;  5F09 A;  4KOR A;  1K4J A;  2ZOF A;  5LYI A;  3IGR A;  2REE A;  1QSO A;  4X3R A;  2OOT A;  3R9F A;  1YR0 A;  2ABZ A;  4MY0 A;  4ZX8 A;  5J8F A;  3GLJ A;  4MXU A;  2CF4 A;  2EK8 A;  3NE8 A;  4NGQ A;  4Y49 C;  4A33 A;  4FD7 A;  3IO1 A;  1YRE A;  3LOD A;  1Y9W A;  4MFZ A;  1KZF A;  2I00 A;  4M3S A;  2GLJ A;  3IEH A;  1LAN A;  3KR5 A;  5J8C A;  4OAE A;  1P0H A;  3NE7 A;  3BHX A;  3B3C A;  1Q2Y A;  1U6M A;  3BJ7 A;  4MY3 A;  4KOU A;  2WZN A;  3CXP A;  4WJB A;  1TKJ A;  2IL4 A;  2Z10 A;  3PBB A;  4JXR A;  4MCQ A;  2V8G A;  4DJL A;  5I0C A;  2PCU A;  2I3C A;  2V77 A;  2PJ7 A;  2C1C A;  3I9S A;  1QSN A;  4QB9 A;  4M85 A;  4C2X A;  2GU2 A;  2ZEE A;  4MFK A;  1YLO A;  4MI4 A;  1JQG A;  4NGS A;  5LYD A;  2ZW4 A;  3H5Z A;  2WUU A;  3B3T A;  4U5Y A;  3WAB A;  2PJA A;  1QQ9 A;  3OWC A;  4B6Z A;  5IB0 A;  3TE4 A;  4CAF A;  2ZW5 A;  3TTH A;  5KTD A;  1S3Z A;  3D7H A;  3MN8 A;  4G1P A;  3W6X A;  4CYQ A;  4NGR A;  4WWV A;  2YNC C;  1NSL A;  3EO4 A;  2XEI A;  4CPA A;  4ZBG A;  1TF8 A;  3TO6 A;  2BO9 A;  4PQA A;  4F0Y A;  1SQH A;  3PB7 X;  4IAV A;  3JVN A;  3DR6 A;  4UCM A;  2OZU A;  3CXS A;  1S7L A;  1Z8W A;  2R8V A;  4UF4 A;  2C6G A;  4KUB A;  1BOB A;  2AFZ A;  4H89 A;  2V8D A;  5C82 A;  3K9U A;  1X12 A;  1MJ9 A;  4OIW A;  3G8W A;  4II9 A;  2A4N A;  4NXY A;  1N71 A;  1LRZ A;  4R6T A;  2Z3L A;  2C6C A;  5EBV A;  1VKC A;  4UCN A;  5K8N A;  1I12 A;  2Z3P A;  2R7H A;  3KGQ A;  4NSQ A;  4CGM A;  2OU2 A;  5LYF A;  4PK2 A;  4Q36 A;  2ZEH A;  3B3W A;  5HH1 A;  2FSR A;  2PRB A;  4LUA A;  3EFA A;  3BJ8 A;  1KWM A;  3R95 A;  3HLP A;  3BI1 A;  2PJ6 A;  1ZG8 A;  3S6F A;  2QJ8 A;  4A39 A;  1F2O A;  1ZO0 A;  2HB6 A;  3R9E A;  4R3L A;  5AG4 A;  5HVG A;  2CTC A;  1QSM A;  2DF5 A;  4QVT A;  4Y49 B;  3KL9 A;  5JM6 A;  3C26 A;  3FH4 A;  4R87 A;  4X5K A;  2REF A;  3D2P A;  4KLW A;  4UEE A;  1QST A;  2I79 A;  2BEI A;  3CDX A;  4P45 A;  2ZOG A;  4C7I A;  2CIJ A;  2B4B A;  4MHP A;  2YNC A;  2CNM A;  1R57 A;  2R1I A;  3ISX A;  4DYO A;  1LOK A;  2PVV A;  5IX3 A;  2JBK A;  3DSB A;  5E96 A;  4KLV A;  1YK3 A;  4U9Y A;  3LMS A;  1PCA A;  1YLE A;  1ELL P;  2G3A A;  4JXQ A;  2DPT A;  1YGH A;  2PR8 A;  2ARH A;  3MRU A; 
#chains in the Genus database with same CATH homology
 4OP4 A;  2VL1 A;  4OC3 A;  1ARL A;  3S9N A;  1DE4 C;  1HEE A;  1LCP A;  2J9A A;  1CPS A;  3N5F A;  1Q7L A;  4F9U A;  4MHN A;  1BLL E;  4OC2 A;  4UIB A;  2ZED A;  2WYR A;  4IHM A;  3V7Z A;  4UEZ A;  1XJO A;  1XRY A;  1FNO A;  2O53 A;  2G9D A;  4OKO A;  4OC5 A;  5K8P A;  3PFE A;  3KQX A;  3D7G A;  1BAV A;  2JEW A;  4P4I A;  2ZEF A;  3L2N A;  3CPX A;  1Z5R A;  4A37 A;  3FEC A;  4PXC A;  4P4F A;  2QVP A;  3KAS A;  3PRT A;  1TXR A;  4MCP A;  2F8H A;  3K2K A;  4FBE A;  2PJB A;  3SI1 A;  3SJX A;  2PIZ A;  3VH9 A;  1AMP A;  3TX8 A;  2PRQ A;  3SI0 A;  5THW A;  3IWW A;  1ZG7 A;  1OBR A;  1CX8 A;  5ELY A;  2PJ8 A;  3GUX A;  1M4L A;  1ARM A;  3SJG A;  3D68 A;  3HUV A;  2XEF A;  4F9V A;  4W9Y A;  2EWB A;  1Z2L A;  1VGY A;  3S9M A;  1F2P A;  3IJ3 A;  3FX6 A;  1ZLH A;  5JH9 A;  4P4E A;  4AXV A;  2AFS A;  3SJF A;  4P6Y A;  4EFD A;  2PIY A;  4UIA A;  4Z65 A;  4MCS A;  3FEE A;  3KZW A;  2QYV A;  3PB6 X;  3FF3 A;  1XBU A;  1LAP A;  2Q51 A;  1H8L A;  2FVG A;  4TWE A;  1F57 A;  3CT9 A;  1TKF A;  2EK9 A;  4ZX9 A;  3JRU A;  2GRE A;  3NA6 A;  3FED A;  3FJU A;  1QMU A;  1YSJ A;  4ZI6 A;  1ELM P;  4ONW A;  4P4J A;  3RZA A;  1ZG9 A;  3B3S A;  2IQ6 A;  3PB4 X;  2JBJ A;  5J1Q A;  4LQG A;  1VHE A;  4ZYQ A;  3NH8 A;  5K8O A;  7CPA A;  2HC9 A;  1RTQ A;  2V8H A;  2V8V A;  4NGM A;  2CTB A;  1TF9 A;  3GB0 A;  2GLF A;  2BCO A;  1Y0R A;  4ZY1 A;  3WT4 A;  4X2T A;  3IC1 A;  4OME A;  5IB9 A;  3FMC A;  4A38 A;  2AFO A;  1DTD A;  4UEF A;  3KI9 A;  4X8I A;  2F7V A;  3RAM A;  1CBX A;  3BI0 A;  2AFM A;  3D66 A;  5JGF A;  1VHO A;  1EE3 P;  1R3N A;  1IGB A;  3TC8 A;  3PB8 X;  4FAI A;  4OC1 A;  4OC4 A;  3WC5 A;  4MMO A;  1HDQ A;  6CPA A;  4FWU A;  3B2Y A;  4Q7A A;  1Z8L A;  5DS0 A;  2PJC A;  2O4H A;  4P10 A;  4NJR A;  2PE3 A;  1YW4 A;  2RFH A;  2AFW A;  5I4M A;  8CPA A;  2ZEO A;  4BD9 A;  4K3N A;  4OID A;  1YW6 A;  4A94 A;  5HXD A;  3KHZ A;  2ZEG A;  2NYQ A;  4NGP A;  3D67 A;  2C6P A;  4JZ0 A;  4R8F A;  5LYL A;  1UWY A;  3RBU A;  5CBM A;  4O23 A;  2PJ3 A;  3PBE A;  3I1U A;  2PJ4 A;  2PJ5 A;  3B3V A;  2ZEL A;  2RB7 A;  5D29 A;  3PFO A;  2PJ1 A;  2NSM A;  4MCR A;  1ZLI A;  2PJ9 A;  2XEJ A;  3H8F A;  4NGN A;  3VAT A;  3D7D A;  3KHX A;  2BOA A;  4YU9 A;  4DUK A;  3CPA A;  3B7I A;  3KQZ A;  1CP7 A;  1LFW A;  3H8G A;  4R76 A;  3LWU A;  4P4D A;  4KSI A;  3B35 A;  5LRJ A;  5D8N A;  2XEG A;  4NFR A;  3IFE A;  3V38 A;  3WC6 A;  3FVL A;  1PYT B;  4JYW A;  4F8Z A;  1FT7 A;  4R7M A;  3QNV A;  4EME A;  2IJZ A;  3SJE A;  5HVF A;  3PB9 X;  3IIB A;  1AYE A;  1CPX A;  5HVH A;  4FUU A;  4YWY A;  1BPN A;  1LAM A;  5K8M A;  4PXE A;  3KR4 A;  1BPM A;  3VAR A;  3NH5 A;  1CP6 A;  2ANP A;  2PJ2 A;  4P4B A;  3SI2 A;  1GYT A;  3DGV A;  4TNU A;  1CG2 A;  1XMB A;  2ZEP A;  3PEI A;  3NFZ A;  2PVW A;  1VIX A;  3T8W A;  4RUH A;  5LRK A;  3K9T A;  1NSA A;  1Y0Y A;  3BXM A;  5LRG A;  3D7F A;  2DEA A;  2Q4Z A;  1Y7E A;  1YME A;  3NH4 A;  5CPA A;  2PJ0 A;  4EWT A;  4NGT A;  3WC7 A;  3DLJ A;  4MHZ A;  1XFO A;  2AFX A;  4ZY0 A;  4MRI A;  1IY7 A;  4H2K A;  4IK2 A;  1R43 A;  4MHY A;  4NJQ A;  2ZEM A;  1HDU A;  4GM5 A;  2IMO A;  2OR4 A;  3ISZ A;  4P44 A;  2POK A;  2AFU A;  1TKH A;  3H8E A;  4ZY2 A;  4PXB A;  2ZEN A;  3S9L A;  4PXD A;  4PPZ A;  3D4U A;  2Q43 A;  5F09 A;  2ZOF A;  5LYI A;  4X3R A;  2OOT A;  2ABZ A;  4ZX8 A;  3GLJ A;  4MXU A;  2CF4 A;  2EK8 A;  4NGQ A;  3IO1 A;  2GLJ A;  3IEH A;  1LAN A;  3KR5 A;  3BHX A;  3B3C A;  4WJB A;  2WZN A;  1TKJ A;  3PBB A;  4MCQ A;  4DJL A;  2V8G A;  2PCU A;  2I3C A;  2V77 A;  2PJ7 A;  2C1C A;  2GU2 A;  2ZEE A;  1YLO A;  3WAB A;  1JQG A;  4NGS A;  5LYD A;  3B3T A;  2PJA A;  1QQ9 A;  4B6Z A;  3D7H A;  3MN8 A;  4G1P A;  4NGR A;  4WWV A;  2XEI A;  4CPA A;  1TF8 A;  2BO9 A;  4PQA A;  3PB7 X;  4IAV A;  4UF4 A;  2C6G A;  2AFZ A;  4OIW A;  4R6T A;  2C6C A;  5K8N A;  3KGQ A;  5LYF A;  2ZEH A;  3B3W A;  1KWM A;  3HLP A;  3BI1 A;  2PJ6 A;  1ZG8 A;  2QJ8 A;  4A39 A;  1F2O A;  2HB6 A;  5HVG A;  2CTC A;  3KL9 A;  5JM6 A;  3FH4 A;  4UEE A;  3CDX A;  4P45 A;  2ZOG A;  2CIJ A;  4MHP A;  3ISX A;  4DYO A;  1LOK A;  2PVV A;  2JBK A;  3LMS A;  1PCA A;  1ELL P;  4OC0 A;  2V8D A;  3MRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...