4QUSA

1.28 angstrom resolution crystal structure of predicted acyltransferase with acyl-coa n-acyltransferase domain (ypea) from escherichia coli str. k-12 substr. mg1655
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
140
structure length
140
Chain Sequence
MEIRVFRQEDFEEVITLWERCDLLRPWNDPEMDIERKMNHDVSLFLVAEVNGDVVGTVMGGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPEDNDMVLGMYERLGYEHADVLSLGKRLIEDEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase YpeA
publication title 1.28 Angstrom resolution crystal structure of predicted acyltransferase with acyl-CoA N-acyltransferase domain (ypeA) from Escherichia coli str. K-12 substr. MG1655
rcsb
source organism Escherichia coli str. k-12 substr. mg1655
molecule tags Transferase
total genus 39
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4qusA01
2EUIA 1YREA 2D4PA 1YK3A 4AVCA 4FD4A 4NSQA 2A4NA 1S7LA 3W91A 4IF5A 3H4QA 5KTCA 2DXQA 2ZPAA 4R57A 3QAHA 4M3SA 2GE3A 3TT2A 3TTHA 2ZW5A 2OH1A 3OWCA 3F0AA 1YLEA 3VWDA 4JJXA 4OADA 2Q44A 2OU2A 4R3KA 3D3SA 2FT0A 2FSRA 2I79A 2R98A 3RYOA 4AB7A 2K5TA 1Y7RA 3LODA 4PK2A 3FB3A 4F0YA 2FIAA 4CAVA 4JXRA 4NEXA 3EC4A 4KUBA 1Q2YA 3EXNA 4KOSA 1XIXA 2BSWA 3DR8A 4H89A 1BOBA 1KZFA 5J8FA 4MBUA 4K30A 5KTAA 4HNYB 3W6XA 4KOWA 5IX3A 4Y49C 2CNMA 2REFA 2ATRA 1WWZA 5DWNA 3S6HA 1YX0A 3GY9A 4PV6A 2Z10A 4YGOA 1KUVA 3V8IA 4NCZA 1PUAA 3G8WA 2AJ6A 2CY2A 2VI7A 4LX9A 3ZJ0A 2Q7BA 2B5GA 4UA3A 4IUSA 3W6SA 2NMTA 5GCNA 2CNSA 1M44A 5F48A 2D4OA 2ZW4A 2PSWA 1S60A 5HMNA 5JPHA 3EY5A 1M4IA 4XPLA 4YRHA 3P2HA 2FS5A 2EVNA 5HH1A 4KVME 1P4NA 3FYNA 1LRZA 4HNWB 4QC6A 4KLWA 4RI1A 2FIWA 1YVKA 4EVYA 3NE7A 1WK4A 1FY7A 3UY5A 1M4GA 2Q0YA 1XE4A 4H6ZA 2P6FA 3DNSA 4E8OA 2Y0MA 2JLMA 1MJAA 2HQYA 2VZYA 3GKRA 2JEVA 3D2MA 4JXQA 5JQ4A 4H6UA 2Q4VA 4AG9A 2B4DA 1I1DA 4FD5A 2GANA 4MJ8A 4J3GA 1B87A 4XPDB 3EFAA 1R57A 3CXQA 1S7FA 1QSOA 2PR1A 3I3GA 4FD7A 2OZUA 4XPDC 4CAXA 1SQHA 4KZTA 1NSLA 4B5PA 4UWJA 2KCWA 3G3SA 4UBRA 3FXTA 3FBUA 3TE4A 2CNTA 4X5KA 1IYKA 2J8RA 4II9A 4HKFA 4DNCA 2ARHA 2WPXA 3SXOA 1PU9A 3S6KA 4KUAA 1V0CA 4Y49B 1UFHA 3TCVA 3T9YA 2PRBA 2O28A 3S6FA 5F46A 4M85A 1QSTA 3TO7A 4OLLA 3VWEA 3FIXA 4L8AA 1QSRA 3DSBA 1IB1E 2VXKA 2ZW6A 1XF8A 3TOAA 3JUWA 2QMLA 1U6MA 2REEA 2X7BA 1NMTA 4ONUA 3R9FA 2Q4YA 5CNPA 4FD6A 2RC4A 3WR7A 4NF1A 3T90A 1XMTA 3CXSA 4E0AA 4KLVA 4KVXA 1Q2DA 4BMHA 1VHSA 2FL4A 4R9MA 4OAEA 2HV2A 2G3AA 2G3TA 3FNCA 1CJWA 5FVJA 2GIVA 5ISVA 4QVTA 2PQ8A 3E0KA 5E96A 2PC1A 3P2FA 3I9SA 1CM0A 2R7HA 3DR6A 4XNHB 2FXFA 4KORA 3IGRA 3C26A 2BL1A 2FCKA 4RS2A 4CRYB 2WPWA 4XNHC 3K9UA 5J8CA 3N7ZA 3BLNA 2G0BA 4R3LA 4F6AA 4KOUA 1I12A 5I0CA 4MY3A 1VKCA 3PP9A 5KTDA 1P0HA 2J8MA 3R9GA 3BJ7A 2B3VA 1QSMA 2F5IA 2BUEA 2VQYA 4QUSA 3TOBA 2P0WA 1Y9KA 4PSWA 3BJ8A 1XEBA 2ZXVA 1S7NA 3DDDA 2Q04A 3PZJA 4L89A 1Q2CA 3S6GA 3R95A 4CRZB 1YGHA 1MK4A 5EBVA 3SHPA 3LD2A 3R1KA 3ZZIA 4QB9A 4KOXA 3TFYA 3EO4A 1ON0A 2P6EA 2B4BA 3D8PA 1BO4A 2HUZA 4U9YA 4KOVA 3R96A 3B8GA 2VEZA 1IICA 3GYAA 2QIRA 5EC4A 1MJBA 4ZBGA 3JVNA 2R1IA 2H5MA 1IIDA 1YR0A 1B6BA 4U5YA 2B58A 2OZGA 4MI4A 2JDCA 1NE9A 1S5KA 4KVOE 4MHDA 2BEIA 2IL4A 2ZW7A 1Z4RA 1TIQA 2B5GB 4NXYA 1Z4EA 4JWPA 1L0CA 3F5BA 1IYLA 4CAWA 2I00A 2JDDA 1S7KA 4JD6A 2P6GA 4PK3A 4KOTA 2OZHA 5F49A 3QB8A 4XPKA 4LUAA 2B3UA 4AVAA 3PGPA 4R87A 4ORFA 5DWMA 3R9EA 4AG7A 1QSNA 1N71A 1RO5A 1YVOA 1J4JA 2PDOA 1I21A 3KKWA 2Z0ZA 1OZPA 1S3ZA 3TO6A 1MJ9A 1KUXA 4CS0B 2J8NA 2VBQA 1GHEA 3MGDA 2PR8A 1Z9UA 4QBJA 3TO9A 5F47A 4JLYA 5C82A 2C27A 2B4DB 3FRMA 2OB0A 3F8KA 4MY0A 2QECA 4HNXB 4UWIA 4B5OA 4YFJA 4GS4A 1M1DA 1KUYA 5IB0A 2VZZA 3IWGA 1RXTA 1M4DA 2FE7A 2Z11A 4E2AA 1K4JA 4I49A 4B5PB 3SXNA 5H84A 5H86A 1Y9WA 4PSXA 5IV0A 4U9ZA 5C88A 2AE6A 3D2PA 4KOYA 2R8VA 3CXPA 4AVBA
chains in the Genus database with same CATH superfamily
5THWA 2EUIA 3V38A 1DTDA 1TF8A 5K8OA 1YREA 2IQ6A 2D4PA 1YK3A 2PJ4A 4B6ZA 2V8VA 4EWTA 4AVCA 4FD4A 3B3TA 2Q51A 4UFWA 4Q36A 2BOAA 2DPSA 4NSQA 2A4NA 5G1ZA 2BO9A 3T8WA 4GM5A 1S7LA 3W91A 4IF5A 3H4QA 5KTCA 2DXQA 2ZPAA 4R57A 2WYRA 3QAHA 4A94A 4C7IA 4F9UA 4M3SA 1Z8LA 2GE3A 3TT2A 1ZO0A 3TTHA 2ZW5A 2OH1A 3OWCA 3F0AA 4Z65A 3IO1A 1YLEA 3VWDA 4JJXA 3K9TA 2AFUA 4OADA 2Q44A 2OU2A 4MHPA 2GLFA 3D3SA 2HB6A 4R3KA 4B11A 5I4MA 2EBJA 2C6PA 2FT0A 2FSRA 2I79A 2R98A 4A39A 3RYOA 4AB7A 2ZOFA 5G22A 2K5TA 1Y7RA 3GUXA 3LODA 4MCSA 4PK2A 3FB3A 2ZEHA 4F0YA 2FIAA 4CAVA 4IAVA 4JXRA 2IJZA 4NEXA 4FBEA 3EC4A 4KUBA 1Q2YA 2XEFA 3D7GA 3EXNA 4KOSA 4M6IA 1DE4C 1XIXA 3HLPA 4OC4A 2BSWA 2EO8A 3D68A 2PRQA 1BOBA 3DR8A 3IC1A 4H89A 4OIWA 2PJCA 1KZFA 5J8FA 1CG2A 4K30A 3N5FA 4MBUA 2BCOA 4HNYB 3W6XA 5KTAA 4KOWA 2XEIA 5IX3A 4Y49C 4P4FA 2CNMA 2REFA 4FAIA 3KHZA 2ATRA 5F09A 1WWZA 2O53A 3KZWA 5DWNA 3S6HA 4A32A 1HEEA 4ZY0A 2PJ1A 4F8ZA 4R6TA 1YW4A 4CAEA 2YNCC 2GFQA 4RN7A 1YX0A 4OC1A 5LYFA 3GY9A 4PV6A 2Z10A 1XJOA 3WC5A 2PCUA 1HDUA 2CXAA 4UEEA 4YGOA 1FT7A 1VHEA 1KUVA 1LFWA 3V8IA 1ARMA 3SJEA 2EK8A 1AMPA 2PVVA 3BI1A 4NCZA 1PUAA 3G8WA 4OC5A 5DS0A 1NSAA 2AJ6A 2CY2A 2VI7A 4A31A 3FVLA 4LX9A 1EE3P 4YWYA 1Z8XA 3ZJ0A 2Q7BA 2B5GA 4UA3A 4IUSA 3W6SA 2V8GA 3TX8A 1CBXA 4UCMA 2NMTA 4Q7AA 1BAVA 2ZEEA 5GCNA 2CNSA 4CGNA 1M44A 3BI0A 1CX8A 2ZEPA 4JYWA 5F48A 3RO0A 2D4OA 2ZW4A 2PSWA 1S60A 5HMNA 5JPHA 4MRIA 3EY5A 1M4IA 4XPLA 3JTKA 4CGOA 1Y7EA 4YRHA 3P2HA 2FS5A 2EVNA 4UIBA 5HH1A 1YQEA 4KVME 3FF3A 3PB8X 1P4NA 3FYNA 3KASA 1LRZA 4HNWB 4QC6A 4KLWA 4OP4A 2PJ0A 4PQAA 4RI1A 5G20A 2ZOGA 2FIWA 1YVKA 4EVYA 1WK4A 2WSAA 3NE7A 1FY7A 3UY5A 1F57A 2V8HA 2EK9A 3HUVA 1PCAA 1M4GA 1R3NA 2Q0YA 1XE4A 4H6ZA 2P6FA 1PYTB 3DNSA 2JEWA 2V77A 4E8OA 2Y0MA 2JLMA 4NJQA 1TKJA 3NA6A 4EFDA 2GLJA 1MJAA 2HQYA 4YU9A 8CPAA 2VZYA 3GKRA 3JRUA 4F9VA 2JEVA 1Z2LA 2XEGA 3D2MA 3CDXA 4MCQA 2PJAA 1TXRA 4JXQA 5JQ4A 4H6UA 3B2YA 2Q4VA 1X12A 4M6GA 3NFZA 2IMOA 1ARLA 4LQ6A 1BPMA 4AG9A 2B4DA 4MXUA 3IU1A 1I1DA 3NH5A 2GANA 4FD5A 4MJ8A 4J3GA 1B87A 2DEAA 4XPDB 3EFAA 1R57A 3CXQA 3D7DA 4UCNA 3QAYA 1S7FA 3NH4A 1QSOA 2PR1A 3I3GA 1Z5RA 4FD7A 1TF9A 2OZUA 4XPDC 4CAXA 1SQHA 4KZTA 2NSMA 1NSLA 4B5PA 4DUKA 4UWJA 2PJ7A 2KCWA 3G3SA 2WZNA 1Z8TA 4UBRA 3FXTA 4ZY1A 3FBUA 5HVGA 3TE4A 3FEEA 3SI1A 3A9LA 1ZG7A 3D67A 2CNTA 3KR4A 2AFSA 4IK2A 4P4DA 1IYKA 4X5KA 3IIBA 2ABZA 4NGQA 4ZI6A 3LWUA 2QJ8A 5JM6A 2ZEDA 2DPTA 4JZ0A 2J8RA 4II9A 1ZLHA 4HKFA 3PB4X 1QQ9A 3IU2A 5AG4A 4DNCA 3H5ZA 5AG5A 2ARHA 2Z3KA 2WPXA 3KQZA 4MFPA 3SXOA 1PU9A 4EMEA 3GB0A 3S6KA 4OC2A 4KUAA 4OMEA 1V0CA 4Q38A 5D29A 2F8HA 3B7IA 3PBEA 4Y49B 1UFHA 3SI2A 3TCVA 1X10A 3BHXA 4ZYQA 3T9YA 4MFJA 2PRBA 4PPZA 2O28A 4MFLA 5HVFA 4R7MA 3KHXA 4MHZA 2C6GA 3S6FA 5F46A 2VL1A 4M85A 1QSTA 4ONWA 3TO7A 1AYEA 4OLLA 4O23A 4A30A 3VWEA 3FIXA 2RB7A 4L8AA 1QSRA 4UCPA 2PIYA 4B13A 4NGPA 2Z3MA 3DSBA 1IB1E 2VXKA 2ZW6A 4ZX8A 1XF8A 3TOAA 4BINA 3JUWA 2QMLA 1U6MA 4UEFA 2REEA 1RTQA 2X7BA 2Z3NA 4PXBA 1NMTA 3KR5A 4NGNA 2C6CA 4ONUA 3R9FA 2Q4YA 4IHMA 1IU8A 5CNPA 2Z3LA 5K8MA 4NJRA 4FD6A 2RC4A 5JGFA 4NGRA 3WR7A 4NF1A 4PXCA 4F0XA 3T90A 4ZY2A 1OBRA 2ZEFA 1CP6A 1XMTA 3CXSA 5G21A 5D8NA 4KLVA 4E0AA 4KVXA 1Q2DA 4BMHA 1VHSA 2PJ9A 3H8FA 3VARA 2FL4A 4OC3A 5ELYA 2C1CA 3VATA 4R9MA 1UWYA 2J9AA 2PJ8A 4OAEA 4KSFA 2HV2A 2G3AA 4MMOA 2G3TA 3FNCA 2Z3OA 5K8PA 4NGTA 1CJWA 4UFXA 4UF4A 5FVJA 2GIVA 3SI0A 3MN8A 2Q43A 5EMIA 5ISVA 3V7ZA 4QVTA 4CAFA 4K3NA 4MFZA 3CPXA 2PQ8A 3E0KA 4FWUA 5E96A 4KS9A 4MHYA 2OOTA 2PC1A 2PIZA 4H2KA 2EWBA 3VH9A 2OR4A 3P2FA 3I9SA 3IJ3A 4CYPA 1AUGA 1CM0A 2R7HA 4GXHA 5CPAA 2ANPA 2DF5A 3D4UA 2PJ3A 3DR6A 4XNHB 1LCPA 3KL9A 4X3RA 3WT4A 2FXFA 4KORA 3IGRA 2PJ2A 3C26A 1IGBA 2BL1A 2FCKA 3DGVA 3DLJA 4RS2A 3SJXA 4CRYB 2WPWA 4XNHC 1QMUA 3MRUA 2Q7SA 3K9UA 4MFQA 4AXVA 5J8CA 3N7ZA 2CIJA 3BLNA 4C2YA 2G0BA 4MFKA 4R3LA 4F6AA 4X2TA 1BLLE 2WUUA 3LMSA 3IWWA 4KOUA 1I12A 1LAMA 1IY7A 3RNZA 3KGQA 3H8EA 1VKCA 3PP9A 4MY3A 5I0CA 5KTDA 4P44A 1P0HA 2J8MA 4BD9A 1FNOA 3R9GA 3NE8A 3BJ7A 4PXEA 4UFVA 2AFWA 1VHOA 2B3VA 1QSMA 2F5IA 2BUEA 2VQYA 4UEZA 7CPAA 4QUSA 3TOBA 2P0WA 3CPAA 1Y9KA 3PRTA 3RZAA 4PSWA 4A33A 1ZG8A 2Q4ZA 1F2OA 2ZEGA 3ISZA 3BJ8A 1XEBA 1LOKA 3GIUA 2ZXVA 3B35A 1S7NA 4WWVA 3DDDA 2Q04A 3PZJA 4L89A 1Q2CA 2JBKA 2YNEA 4CYNA 5LYLA 3S6GA 4OKOA 5LYDA 5CBMA 3R95A 4KSIA 2V8DA 3ISXA 3KI9A 4CRZB 1YGHA 4B14A 2ZENA 4P4EA 1Y0YA 2RFHA 2PVWA 1MK4A 4NFRA 4C68A 6CPAA 3CZXA 3FJUA 5A27A 5AG6A 1LAPA 4B12A 1YW6A 3I1UA 5EBVA 3LD2A 1YSJA 3R1KA 4KSAA 3H8GA 3SHPA 4MCPA 4UIAA 2AFOA 3ZZIA 4CPAA 3PB6X 3FEDA 4QB9A 4HPSA 4KOXA 3TFYA 1IOFA 3EO4A 1ON0A 4B10A 1KWMA 4DJLA 2P6EA 2B4BA 2F7VA 2PJBA 3D8PA 4A95A 4P4JA 3IEHA 4W9YA 1YMEA 1BO4A 1LANA 2HUZA 4U9YA 4A37A 5JH9A 1F2PA 4A2ZA 5J1QA 4KOVA 3R96A 5LRKA 3B8GA 1JQGA 2VEZA 1IICA 3PB7X 3GYAA 1Y0RA 2I3CA 2QIRA 5EC4A 1MJBA 2GREA 2Z3PA 1H8LA 4ZBGA 2G9DA 3JVNA 2R1IA 1IOIA 2H5MA 1Q7LA 3PEIA 1IIDA 4NGSA 1YLOA 1YR0A 1B6BA 4U5YA 5HVHA 2B58A 2JBJA 2OZGA 4MI4A 1BPNA 2JDCA 3PB9X 3PFOA 4P10A 4MHNA 1NE9A 1S5KA 4KVOE 4P4BA 4MHDA 3B3WA 3FH4A 2BEIA 1XRYA 2IL4A 2ZW7A 1JWQA 1TIQA 1Z4RA 4OC0A 2B5GB 4BBHA 2ODFA 4NXYA 4TWEA 2HC9A 3K2KA 1HDQA 2ZEMA 1Z4EA 4C2ZA 4JWPA 1L0CA 3GLJA 3F5BA 3SJFA 1IYLA 4CAWA 2I00A 5LRGA 3IFEA 1GYTA 2JDDA 1S7KA 2P6GA 4JD6A 4PK3A 4KOTA 4P6YA 2OZHA 4C2XA 5F49A 3QB8A 4CGMA 2CTBA 4XPKA 4LUAA 1ELMP 2B3UA 4AVAA 3PGPA 4R87A 2YNCA 4ORFA 3D7HA 5K8NA 3B3VA 4G1PA 4ZGYB 5BWAB 2O4HA 4P45A 5DWMA 3R9EA 2FVGA 3RAMA 1QSNA 3WABA 4AG7A 1N71A 3PBBA 2ZEOA 1RO5A 1YVOA 2GU2A 3KQXA 4LQGA 4P4IA 1TKHA 1XFOA 3WC7A 1J4JA 2PDOA 1ELLP 1I21A 5LRJA 4ZX9A 3KKWA 2QVPA 1OZPA 2Z0ZA 3CT9A 5AGEA 1S3ZA 3TO6A 3S9LA 1MJ9A 5IB9A 1KUXA 3PFEA 2AFMA 4MCRA 4CS0B 2J8NA 4CGLA 2VBQA 1GHEA 2QYVA 1CPSA 3MGDA 5AG7A 2PR8A 1Z9UA 4QBJA 2POKA 3TO9A 4CGPA 2PJ6A 5LYIA 3FMCA 1CP7A 3FX6A 3BXMA 5F47A 4JLYA 3TC8A 4A38A 5C82A 2YGWA 2C27A 3D66A 3LACA 2B4DB 3FRMA 2OB0A 3F8KA 4MY0A 4PXDA 1VIXA 2QECA 1A2ZA 3QNVA 4HNXB 4UWIA 4WJBA 4B5OA 1XMBA 2AFZA 4YFJA 5A28A 4GS4A 2XEJA 1M1DA 3RBUA 1KUYA 5IB0A 2NYQA 1R43A 2VZZA 1XBUA 1RXTA 3IWGA 4R8FA 4R76A 1M4DA 2FE7A 2Z11A 3IWEA 4X8IA 2YNDA 3S9MA 3FECA 3B3CA 1CPXA 2CTCA 4E2AA 4OIDA 3SJGA 4RUHA 1K4JA 4CYOA 4I49A 4B5PB 3SXNA 5H84A 5H86A 1Y9WA 1Z8WA 2AFXA 1ZG9A 2PJ5A 4CYQA 2CF4A 1VGYA 4PSXA 2PE3A 2ZELA 3NH8A 4FUUA 4U9ZA 3B3SA 3D7FA 5IV0A 5C88A 3S9NA 1TKFA 2AE6A 3L2NA 3D2PA 3WC6A 4AVBA 4KOYA 2R8VA 1M4LA 1XOVA 3CXPA 4C7HA 1ZLIA 4TNUA 4DYOA 4M6HA 5HXDA 4NGMA
chains in the Genus database with same CATH topology
2EUIA 1YREA 2D4PA 1YK3A 4AVCA 4FD4A 4UFWA 4Q36A 2DPSA 4NSQA 2A4NA 5G1ZA 1S7LA 3W91A 4IF5A 3H4QA 5KTCA 2DXQA 2ZPAA 4R57A 3QAHA 4C7IA 4M3SA 2GE3A 3TT2A 1ZO0A 3TTHA 2ZW5A 2OH1A 3OWCA 3F0AA 1YLEA 3VWDA 4JJXA 4OADA 2Q44A 2OU2A 4R3KA 4B11A 3D3SA 2FT0A 2FSRA 2I79A 2R98A 3RYOA 4AB7A 5G22A 2K5TA 1Y7RA 3LODA 4PK2A 3FB3A 4F0YA 2FIAA 4CAVA 4JXRA 4NEXA 3EC4A 4KUBA 1Q2YA 3EXNA 4KOSA 1XIXA 2BSWA 3DR8A 4H89A 1BOBA 1KZFA 5J8FA 4MBUA 4K30A 5KTAA 4HNYB 3W6XA 4KOWA 5IX3A 4Y49C 2CNMA 2REFA 2ATRA 1WWZA 5DWNA 3S6HA 4A32A 4CAEA 2YNCC 1YX0A 3GY9A 4PV6A 2Z10A 2CXAA 4YGOA 1KUVA 3V8IA 4NCZA 1PUAA 3G8WA 2AJ6A 2CY2A 2VI7A 4A31A 4LX9A 3ZJ0A 2Q7BA 2B5GA 4UA3A 4IUSA 3W6SA 4UCMA 2NMTA 5GCNA 2CNSA 4CGNA 1M44A 5F48A 2D4OA 2ZW4A 2PSWA 1S60A 5HMNA 5JPHA 3EY5A 1M4IA 4XPLA 3JTKA 4CGOA 4YRHA 3P2HA 2FS5A 2EVNA 5HH1A 4KVME 1P4NA 3FYNA 1LRZA 4HNWB 4QC6A 4KLWA 4RI1A 5G20A 2FIWA 1YVKA 4EVYA 2WSAA 3NE7A 1WK4A 1FY7A 3UY5A 1M4GA 2Q0YA 1XE4A 4H6ZA 2P6FA 3DNSA 4E8OA 2Y0MA 2JLMA 1MJAA 2HQYA 2VZYA 3GKRA 2JEVA 3D2MA 4JXQA 5JQ4A 4H6UA 2Q4VA 4AG9A 2B4DA 3IU1A 1I1DA 4FD5A 2GANA 4MJ8A 4J3GA 1B87A 4XPDB 3EFAA 1R57A 3CXQA 4UCNA 1S7FA 1QSOA 2PR1A 3I3GA 4FD7A 2OZUA 4XPDC 4CAXA 1SQHA 4KZTA 1NSLA 4B5PA 4UWJA 2KCWA 3G3SA 4UBRA 3FXTA 3FBUA 3TE4A 3A9LA 2CNTA 4X5KA 1IYKA 2DPTA 2J8RA 4II9A 4HKFA 3IU2A 5AG4A 4DNCA 3H5ZA 5AG5A 2ARHA 2Z3KA 2WPXA 4MFPA 3SXOA 1PU9A 3S6KA 4KUAA 1V0CA 4Q38A 4Y49B 1UFHA 3TCVA 3T9YA 4MFJA 2PRBA 2O28A 4MFLA 3S6FA 5F46A 4M85A 1QSTA 3TO7A 4OLLA 4A30A 3VWEA 3FIXA 4UCPA 4L8AA 1QSRA 4B13A 2Z3MA 3DSBA 1IB1E 2VXKA 2ZW6A 1XF8A 3TOAA 3JUWA 2QMLA 1U6MA 2REEA 2X7BA 2Z3NA 1NMTA 4ONUA 3R9FA 2Q4YA 5CNPA 2Z3LA 4FD6A 2RC4A 3WR7A 4NF1A 4F0XA 3T90A 1XMTA 3CXSA 5G21A 4E0AA 4KLVA 4KVXA 1Q2DA 4BMHA 1VHSA 2FL4A 4R9MA 4OAEA 4KSFA 2HV2A 2G3AA 2G3TA 3FNCA 2Z3OA 1CJWA 4UFXA 5FVJA 2GIVA 5ISVA 4QVTA 4CAFA 4MFZA 2PQ8A 3E0KA 5E96A 4KS9A 2PC1A 3P2FA 4CYPA 3I9SA 1CM0A 2R7HA 3DR6A 4XNHB 2FXFA 4KORA 3IGRA 3C26A 2BL1A 2FCKA 4RS2A 4CRYB 2WPWA 4XNHC 3K9UA 4MFQA 5J8CA 3N7ZA 3BLNA 4C2YA 2G0BA 4MFKA 4R3LA 4F6AA 2WUUA 4KOUA 1I12A 5I0CA 4MY3A 1VKCA 3PP9A 5KTDA 1P0HA 2J8MA 3R9GA 3BJ7A 4UFVA 2B3VA 1QSMA 2F5IA 2BUEA 2VQYA 4QUSA 3TOBA 2P0WA 1Y9KA 4PSWA 4A33A 3BJ8A 1XEBA 2ZXVA 1S7NA 3DDDA 2Q04A 3PZJA 4L89A 1Q2CA 2YNEA 4CYNA 3S6GA 3R95A 4CRZB 1YGHA 4B14A 4C68A 1MK4A 5A27A 5AG6A 4B12A 5EBVA 3SHPA 3LD2A 3R1KA 4KSAA 3ZZIA 4QB9A 4KOXA 3TFYA 3EO4A 1ON0A 4B10A 2P6EA 2B4BA 4A95A 3D8PA 1BO4A 2HUZA 4U9YA 4A2ZA 4KOVA 3R96A 3B8GA 2VEZA 1IICA 3GYAA 2QIRA 5EC4A 1MJBA 2Z3PA 4ZBGA 3JVNA 2R1IA 2H5MA 1IIDA 1YR0A 1B6BA 4U5YA 2B58A 2OZGA 4MI4A 2JDCA 1NE9A 1S5KA 4KVOE 4MHDA 2BEIA 2IL4A 2ZW7A 1Z4RA 1TIQA 4BBHA 2B5GB 4NXYA 1Z4EA 4C2ZA 4JWPA 1L0CA 3F5BA 1IYLA 4CAWA 2I00A 2JDDA 1S7KA 4JD6A 2P6GA 4PK3A 4KOTA 4C2XA 2OZHA 5F49A 3QB8A 4CGMA 4XPKA 4LUAA 2B3UA 4AVAA 3PGPA 4R87A 2YNCA 4ORFA 4ZGYB 5BWAB 5DWMA 3R9EA 4AG7A 1QSNA 1N71A 1RO5A 1YVOA 1J4JA 2PDOA 1I21A 3KKWA 2Z0ZA 1OZPA 5AGEA 1S3ZA 3TO6A 1MJ9A 1KUXA 4CS0B 2J8NA 4CGLA 2VBQA 1GHEA 3MGDA 5AG7A 2PR8A 1Z9UA 4QBJA 4CGPA 3TO9A 5F47A 4JLYA 5C82A 2YGWA 2C27A 2B4DB 3FRMA 2OB0A 3F8KA 4MY0A 2QECA 4HNXB 4UWIA 5A28A 4B5OA 4YFJA 4GS4A 1M1DA 1KUYA 5IB0A 2VZZA 3IWGA 1RXTA 1M4DA 2FE7A 2Z11A 3IWEA 2YNDA 4E2AA 1K4JA 4CYOA 4I49A 4B5PB 3SXNA 5H84A 5H86A 1Y9WA 4CYQA 4PSXA 5IV0A 4U9ZA 5C88A 2AE6A 3D2PA 4KOYA 2R8VA 3CXPA 4C7HA 4AVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EUI A;  1YRE A;  2D4P A;  1YK3 A;  4AVC A;  4FD4 A;  4NSQ A;  2A4N A;  1S7L A;  3W91 A;  4IF5 A;  3H4Q A;  5KTC A;  2DXQ A;  2ZPA A;  4R57 A;  3QAH A;  4M3S A;  2GE3 A;  3TT2 A;  3TTH A;  2ZW5 A;  2OH1 A;  3OWC A;  3F0A A;  1YLE A;  3VWD A;  4JJX A;  4OAD A;  2Q44 A;  2OU2 A;  4R3K A;  3D3S A;  2FT0 A;  2FSR A;  2I79 A;  2R98 A;  3RYO A;  4AB7 A;  2K5T A;  1Y7R A;  3LOD A;  4PK2 A;  3FB3 A;  4F0Y A;  2FIA A;  4CAV A;  4JXR A;  4NEX A;  3EC4 A;  4KUB A;  1Q2Y A;  3EXN A;  4KOS A;  1XIX A;  2BSW A;  3DR8 A;  4H89 A;  1BOB A;  1KZF A;  5J8F A;  4MBU A;  4K30 A;  5KTA A;  4HNY B;  3W6X A;  4KOW A;  5IX3 A;  4Y49 C;  2CNM A;  2REF A;  2ATR A;  1WWZ A;  5DWN A;  3S6H A;  1YX0 A;  3GY9 A;  4PV6 A;  2Z10 A;  4YGO A;  1KUV A;  3V8I A;  4NCZ A;  1PUA A;  3G8W A;  2AJ6 A;  2CY2 A;  2VI7 A;  4LX9 A;  3ZJ0 A;  2Q7B A;  2B5G A;  4UA3 A;  4IUS A;  3W6S A;  2NMT A;  5GCN A;  2CNS A;  1M44 A;  5F48 A;  2D4O A;  2ZW4 A;  2PSW A;  1S60 A;  5HMN A;  5JPH A;  3EY5 A;  1M4I A;  4XPL A;  4YRH A;  3P2H A;  2FS5 A;  2EVN A;  5HH1 A;  4KVM E;  1P4N A;  3FYN A;  1LRZ A;  4HNW B;  4QC6 A;  4KLW A;  4RI1 A;  2FIW A;  1YVK A;  4EVY A;  3NE7 A;  1WK4 A;  1FY7 A;  3UY5 A;  1M4G A;  2Q0Y A;  1XE4 A;  4H6Z A;  2P6F A;  3DNS A;  4E8O A;  2Y0M A;  2JLM A;  1MJA A;  2HQY A;  2VZY A;  3GKR A;  2JEV A;  3D2M A;  4JXQ A;  5JQ4 A;  4H6U A;  2Q4V A;  4AG9 A;  2B4D A;  1I1D A;  4FD5 A;  2GAN A;  4MJ8 A;  4J3G A;  1B87 A;  4XPD B;  3EFA A;  1R57 A;  3CXQ A;  1S7F A;  1QSO A;  2PR1 A;  3I3G A;  4FD7 A;  2OZU A;  4XPD C;  4CAX A;  1SQH A;  4KZT A;  1NSL A;  4B5P A;  4UWJ A;  2KCW A;  3G3S A;  4UBR A;  3FXT A;  3FBU A;  3TE4 A;  2CNT A;  4X5K A;  1IYK A;  2J8R A;  4II9 A;  4HKF A;  4DNC A;  2ARH A;  2WPX A;  3SXO A;  1PU9 A;  3S6K A;  4KUA A;  1V0C A;  4Y49 B;  1UFH A;  3TCV A;  3T9Y A;  2PRB A;  2O28 A;  3S6F A;  5F46 A;  4M85 A;  1QST A;  3TO7 A;  4OLL A;  3VWE A;  3FIX A;  4L8A A;  1QSR A;  3DSB A;  1IB1 E;  2VXK A;  2ZW6 A;  1XF8 A;  3TOA A;  3JUW A;  2QML A;  1U6M A;  2REE A;  2X7B A;  1NMT A;  4ONU A;  3R9F A;  2Q4Y A;  5CNP A;  4FD6 A;  2RC4 A;  3WR7 A;  4NF1 A;  3T90 A;  1XMT A;  3CXS A;  4E0A A;  4KLV A;  4KVX A;  1Q2D A;  4BMH A;  1VHS A;  2FL4 A;  4R9M A;  4OAE A;  2HV2 A;  2G3A A;  2G3T A;  3FNC A;  1CJW A;  5FVJ A;  2GIV A;  5ISV A;  4QVT A;  2PQ8 A;  3E0K A;  5E96 A;  2PC1 A;  3P2F A;  3I9S A;  1CM0 A;  2R7H A;  3DR6 A;  4XNH B;  2FXF A;  4KOR A;  3IGR A;  3C26 A;  2BL1 A;  2FCK A;  4RS2 A;  4CRY B;  2WPW A;  4XNH C;  3K9U A;  5J8C A;  3N7Z A;  3BLN A;  2G0B A;  4R3L A;  4F6A A;  4KOU A;  1I12 A;  5I0C A;  4MY3 A;  1VKC A;  3PP9 A;  5KTD A;  1P0H A;  2J8M A;  3R9G A;  3BJ7 A;  2B3V A;  1QSM A;  2F5I A;  2BUE A;  2VQY A;  4QUS A;  3TOB A;  2P0W A;  1Y9K A;  4PSW A;  3BJ8 A;  1XEB A;  2ZXV A;  1S7N A;  3DDD A;  2Q04 A;  3PZJ A;  4L89 A;  1Q2C A;  3S6G A;  3R95 A;  4CRZ B;  1YGH A;  1MK4 A;  5EBV A;  3SHP A;  3LD2 A;  3R1K A;  3ZZI A;  4QB9 A;  4KOX A;  3TFY A;  3EO4 A;  1ON0 A;  2P6E A;  2B4B A;  3D8P A;  1BO4 A;  2HUZ A;  4U9Y A;  4KOV A;  3R96 A;  3B8G A;  2VEZ A;  1IIC A;  3GYA A;  2QIR A;  5EC4 A;  1MJB A;  4ZBG A;  3JVN A;  2R1I A;  2H5M A;  1IID A;  1YR0 A;  1B6B A;  4U5Y A;  2B58 A;  2OZG A;  4MI4 A;  2JDC A;  1NE9 A;  1S5K A;  4KVO E;  4MHD A;  2BEI A;  2IL4 A;  2ZW7 A;  1Z4R A;  1TIQ A;  2B5G B;  4NXY A;  1Z4E A;  4JWP A;  1L0C A;  3F5B A;  1IYL A;  4CAW A;  2I00 A;  2JDD A;  1S7K A;  4JD6 A;  2P6G A;  4PK3 A;  4KOT A;  2OZH A;  5F49 A;  3QB8 A;  4XPK A;  4LUA A;  2B3U A;  4AVA A;  3PGP A;  4R87 A;  4ORF A;  5DWM A;  3R9E A;  4AG7 A;  1QSN A;  1N71 A;  1RO5 A;  1YVO A;  1J4J A;  2PDO A;  1I21 A;  3KKW A;  2Z0Z A;  1OZP A;  1S3Z A;  3TO6 A;  1MJ9 A;  1KUX A;  4CS0 B;  2J8N A;  2VBQ A;  1GHE A;  3MGD A;  2PR8 A;  1Z9U A;  4QBJ A;  3TO9 A;  5F47 A;  4JLY A;  5C82 A;  2C27 A;  2B4D B;  3FRM A;  2OB0 A;  3F8K A;  4MY0 A;  2QEC A;  4HNX B;  4UWI A;  4B5O A;  4YFJ A;  4GS4 A;  1M1D A;  1KUY A;  5IB0 A;  2VZZ A;  3IWG A;  1RXT A;  1M4D A;  2FE7 A;  2Z11 A;  4E2A A;  1K4J A;  4I49 A;  4B5P B;  3SXN A;  5H84 A;  5H86 A;  1Y9W A;  4PSX A;  5IV0 A;  4U9Z A;  5C88 A;  2AE6 A;  3D2P A;  4KOY A;  2R8V A;  3CXP A;  4AVB A; 
#chains in the Genus database with same CATH topology
 5THW A;  2EUI A;  3V38 A;  1DTD A;  1TF8 A;  5K8O A;  1YRE A;  2IQ6 A;  2D4P A;  1YK3 A;  2PJ4 A;  4B6Z A;  2V8V A;  4EWT A;  4AVC A;  4FD4 A;  3B3T A;  2Q51 A;  4UFW A;  4Q36 A;  2BOA A;  2DPS A;  4NSQ A;  2A4N A;  5G1Z A;  2BO9 A;  3T8W A;  4GM5 A;  1S7L A;  3W91 A;  4IF5 A;  3H4Q A;  5KTC A;  2DXQ A;  2ZPA A;  4R57 A;  2WYR A;  3QAH A;  4A94 A;  4C7I A;  4F9U A;  4M3S A;  1Z8L A;  2GE3 A;  3TT2 A;  1ZO0 A;  3TTH A;  2ZW5 A;  2OH1 A;  3OWC A;  3F0A A;  4Z65 A;  3IO1 A;  1YLE A;  3VWD A;  4JJX A;  3K9T A;  2AFU A;  4OAD A;  2Q44 A;  2OU2 A;  4MHP A;  2GLF A;  3D3S A;  2HB6 A;  4R3K A;  4B11 A;  5I4M A;  2EBJ A;  2C6P A;  2FT0 A;  2FSR A;  2I79 A;  2R98 A;  4A39 A;  3RYO A;  4AB7 A;  2ZOF A;  5G22 A;  2K5T A;  1Y7R A;  3GUX A;  3LOD A;  4MCS A;  4PK2 A;  3FB3 A;  2ZEH A;  4F0Y A;  2FIA A;  4CAV A;  4IAV A;  4JXR A;  2IJZ A;  4NEX A;  4FBE A;  3EC4 A;  4KUB A;  1Q2Y A;  2XEF A;  3D7G A;  3EXN A;  4KOS A;  4M6I A;  1DE4 C;  1XIX A;  3HLP A;  4OC4 A;  2BSW A;  2EO8 A;  3D68 A;  2PRQ A;  1BOB A;  3DR8 A;  3IC1 A;  4H89 A;  4OIW A;  2PJC A;  1KZF A;  5J8F A;  1CG2 A;  4K30 A;  3N5F A;  4MBU A;  2BCO A;  4HNY B;  3W6X A;  5KTA A;  4KOW A;  2XEI A;  5IX3 A;  4Y49 C;  4P4F A;  2CNM A;  2REF A;  4FAI A;  3KHZ A;  2ATR A;  5F09 A;  1WWZ A;  2O53 A;  3KZW A;  5DWN A;  3S6H A;  4A32 A;  1HEE A;  4ZY0 A;  2PJ1 A;  4F8Z A;  4R6T A;  1YW4 A;  4CAE A;  2YNC C;  2GFQ A;  4RN7 A;  1YX0 A;  4OC1 A;  5LYF A;  3GY9 A;  4PV6 A;  2Z10 A;  1XJO A;  3WC5 A;  2PCU A;  1HDU A;  2CXA A;  4UEE A;  4YGO A;  1FT7 A;  1VHE A;  1KUV A;  1LFW A;  3V8I A;  1ARM A;  3SJE A;  2EK8 A;  1AMP A;  2PVV A;  3BI1 A;  4NCZ A;  1PUA A;  3G8W A;  4OC5 A;  5DS0 A;  1NSA A;  2AJ6 A;  2CY2 A;  2VI7 A;  4A31 A;  3FVL A;  4LX9 A;  1EE3 P;  4YWY A;  1Z8X A;  3ZJ0 A;  2Q7B A;  2B5G A;  4UA3 A;  4IUS A;  3W6S A;  2V8G A;  3TX8 A;  1CBX A;  4UCM A;  2NMT A;  4Q7A A;  1BAV A;  2ZEE A;  5GCN A;  2CNS A;  4CGN A;  1M44 A;  3BI0 A;  1CX8 A;  2ZEP A;  4JYW A;  5F48 A;  3RO0 A;  2D4O A;  2ZW4 A;  2PSW A;  1S60 A;  5HMN A;  5JPH A;  4MRI A;  3EY5 A;  1M4I A;  4XPL A;  3JTK A;  4CGO A;  1Y7E A;  4YRH A;  3P2H A;  2FS5 A;  2EVN A;  4UIB A;  5HH1 A;  1YQE A;  4KVM E;  3FF3 A;  3PB8 X;  1P4N A;  3FYN A;  3KAS A;  1LRZ A;  4HNW B;  4QC6 A;  4KLW A;  4OP4 A;  2PJ0 A;  4PQA A;  4RI1 A;  5G20 A;  2ZOG A;  2FIW A;  1YVK A;  4EVY A;  1WK4 A;  2WSA A;  3NE7 A;  1FY7 A;  3UY5 A;  1F57 A;  2V8H A;  2EK9 A;  3HUV A;  1PCA A;  1M4G A;  1R3N A;  2Q0Y A;  1XE4 A;  4H6Z A;  2P6F A;  1PYT B;  3DNS A;  2JEW A;  2V77 A;  4E8O A;  2Y0M A;  2JLM A;  4NJQ A;  1TKJ A;  3NA6 A;  4EFD A;  2GLJ A;  1MJA A;  2HQY A;  4YU9 A;  8CPA A;  2VZY A;  3GKR A;  3JRU A;  4F9V A;  2JEV A;  1Z2L A;  2XEG A;  3D2M A;  3CDX A;  4MCQ A;  2PJA A;  1TXR A;  4JXQ A;  5JQ4 A;  4H6U A;  3B2Y A;  2Q4V A;  1X12 A;  4M6G A;  3NFZ A;  2IMO A;  1ARL A;  4LQ6 A;  1BPM A;  4AG9 A;  2B4D A;  4MXU A;  3IU1 A;  1I1D A;  3NH5 A;  2GAN A;  4FD5 A;  4MJ8 A;  4J3G A;  1B87 A;  2DEA A;  4XPD B;  3EFA A;  1R57 A;  3CXQ A;  3D7D A;  4UCN A;  3QAY A;  1S7F A;  3NH4 A;  1QSO A;  2PR1 A;  3I3G A;  1Z5R A;  4FD7 A;  1TF9 A;  2OZU A;  4XPD C;  4CAX A;  1SQH A;  4KZT A;  2NSM A;  1NSL A;  4B5P A;  4DUK A;  4UWJ A;  2PJ7 A;  2KCW A;  3G3S A;  2WZN A;  1Z8T A;  4UBR A;  3FXT A;  4ZY1 A;  3FBU A;  5HVG A;  3TE4 A;  3FEE A;  3SI1 A;  3A9L A;  1ZG7 A;  3D67 A;  2CNT A;  3KR4 A;  2AFS A;  4IK2 A;  4P4D A;  1IYK A;  4X5K A;  3IIB A;  2ABZ A;  4NGQ A;  4ZI6 A;  3LWU A;  2QJ8 A;  5JM6 A;  2ZED A;  2DPT A;  4JZ0 A;  2J8R A;  4II9 A;  1ZLH A;  4HKF A;  3PB4 X;  1QQ9 A;  3IU2 A;  5AG4 A;  4DNC A;  3H5Z A;  5AG5 A;  2ARH A;  2Z3K A;  2WPX A;  3KQZ A;  4MFP A;  3SXO A;  1PU9 A;  4EME A;  3GB0 A;  3S6K A;  4OC2 A;  4KUA A;  4OME A;  1V0C A;  4Q38 A;  5D29 A;  2F8H A;  3B7I A;  3PBE A;  4Y49 B;  1UFH A;  3SI2 A;  3TCV A;  1X10 A;  3BHX A;  4ZYQ A;  3T9Y A;  4MFJ A;  2PRB A;  4PPZ A;  2O28 A;  4MFL A;  5HVF A;  4R7M A;  3KHX A;  4MHZ A;  2C6G A;  3S6F A;  5F46 A;  2VL1 A;  4M85 A;  1QST A;  4ONW A;  3TO7 A;  1AYE A;  4OLL A;  4O23 A;  4A30 A;  3VWE A;  3FIX A;  2RB7 A;  4L8A A;  1QSR A;  4UCP A;  2PIY A;  4B13 A;  4NGP A;  2Z3M A;  3DSB A;  1IB1 E;  2VXK A;  2ZW6 A;  4ZX8 A;  1XF8 A;  3TOA A;  4BIN A;  3JUW A;  2QML A;  1U6M A;  4UEF A;  2REE A;  1RTQ A;  2X7B A;  2Z3N A;  4PXB A;  1NMT A;  3KR5 A;  4NGN A;  2C6C A;  4ONU A;  3R9F A;  2Q4Y A;  4IHM A;  1IU8 A;  5CNP A;  2Z3L A;  5K8M A;  4NJR A;  4FD6 A;  2RC4 A;  5JGF A;  4NGR A;  3WR7 A;  4NF1 A;  4PXC A;  4F0X A;  3T90 A;  4ZY2 A;  1OBR A;  2ZEF A;  1CP6 A;  1XMT A;  3CXS A;  5G21 A;  5D8N A;  4KLV A;  4E0A A;  4KVX A;  1Q2D A;  4BMH A;  1VHS A;  2PJ9 A;  3H8F A;  3VAR A;  2FL4 A;  4OC3 A;  5ELY A;  2C1C A;  3VAT A;  4R9M A;  1UWY A;  2J9A A;  2PJ8 A;  4OAE A;  4KSF A;  2HV2 A;  2G3A A;  4MMO A;  2G3T A;  3FNC A;  2Z3O A;  5K8P A;  4NGT A;  1CJW A;  4UFX A;  4UF4 A;  5FVJ A;  2GIV A;  3SI0 A;  3MN8 A;  2Q43 A;  5EMI A;  5ISV A;  3V7Z A;  4QVT A;  4CAF A;  4K3N A;  4MFZ A;  3CPX A;  2PQ8 A;  3E0K A;  4FWU A;  5E96 A;  4KS9 A;  4MHY A;  2OOT A;  2PC1 A;  2PIZ A;  4H2K A;  2EWB A;  3VH9 A;  2OR4 A;  3P2F A;  3I9S A;  3IJ3 A;  4CYP A;  1AUG A;  1CM0 A;  2R7H A;  4GXH A;  5CPA A;  2ANP A;  2DF5 A;  3D4U A;  2PJ3 A;  3DR6 A;  4XNH B;  1LCP A;  3KL9 A;  4X3R A;  3WT4 A;  2FXF A;  4KOR A;  3IGR A;  2PJ2 A;  3C26 A;  1IGB A;  2BL1 A;  2FCK A;  3DGV A;  3DLJ A;  4RS2 A;  3SJX A;  4CRY B;  2WPW A;  4XNH C;  1QMU A;  3MRU A;  2Q7S A;  3K9U A;  4MFQ A;  4AXV A;  5J8C A;  3N7Z A;  2CIJ A;  3BLN A;  4C2Y A;  2G0B A;  4MFK A;  4R3L A;  4F6A A;  4X2T A;  1BLL E;  2WUU A;  3LMS A;  3IWW A;  4KOU A;  1I12 A;  1LAM A;  1IY7 A;  3RNZ A;  3KGQ A;  3H8E A;  1VKC A;  3PP9 A;  4MY3 A;  5I0C A;  5KTD A;  4P44 A;  1P0H A;  2J8M A;  4BD9 A;  1FNO A;  3R9G A;  3NE8 A;  3BJ7 A;  4PXE A;  4UFV A;  2AFW A;  1VHO A;  2B3V A;  1QSM A;  2F5I A;  2BUE A;  2VQY A;  4UEZ A;  7CPA A;  4QUS A;  3TOB A;  2P0W A;  3CPA A;  1Y9K A;  3PRT A;  3RZA A;  4PSW A;  4A33 A;  1ZG8 A;  2Q4Z A;  1F2O A;  2ZEG A;  3ISZ A;  3BJ8 A;  1XEB A;  1LOK A;  3GIU A;  2ZXV A;  3B35 A;  1S7N A;  4WWV A;  3DDD A;  2Q04 A;  3PZJ A;  4L89 A;  1Q2C A;  2JBK A;  2YNE A;  4CYN A;  5LYL A;  3S6G A;  4OKO A;  5LYD A;  5CBM A;  3R95 A;  4KSI A;  2V8D A;  3ISX A;  3KI9 A;  4CRZ B;  1YGH A;  4B14 A;  2ZEN A;  4P4E A;  1Y0Y A;  2RFH A;  2PVW A;  1MK4 A;  4NFR A;  4C68 A;  6CPA A;  3CZX A;  3FJU A;  5A27 A;  5AG6 A;  1LAP A;  4B12 A;  1YW6 A;  3I1U A;  5EBV A;  3LD2 A;  1YSJ A;  3R1K A;  4KSA A;  3H8G A;  3SHP A;  4MCP A;  4UIA A;  2AFO A;  3ZZI A;  4CPA A;  3PB6 X;  3FED A;  4QB9 A;  4HPS A;  4KOX A;  3TFY A;  1IOF A;  3EO4 A;  1ON0 A;  4B10 A;  1KWM A;  4DJL A;  2P6E A;  2B4B A;  2F7V A;  2PJB A;  3D8P A;  4A95 A;  4P4J A;  3IEH A;  4W9Y A;  1YME A;  1BO4 A;  1LAN A;  2HUZ A;  4U9Y A;  4A37 A;  5JH9 A;  1F2P A;  4A2Z A;  5J1Q A;  4KOV A;  3R96 A;  5LRK A;  3B8G A;  1JQG A;  2VEZ A;  1IIC A;  3PB7 X;  3GYA A;  1Y0R A;  2I3C A;  2QIR A;  5EC4 A;  1MJB A;  2GRE A;  2Z3P A;  1H8L A;  4ZBG A;  2G9D A;  3JVN A;  2R1I A;  1IOI A;  2H5M A;  1Q7L A;  3PEI A;  1IID A;  4NGS A;  1YLO A;  1YR0 A;  1B6B A;  4U5Y A;  5HVH A;  2B58 A;  2JBJ A;  2OZG A;  4MI4 A;  1BPN A;  2JDC A;  3PB9 X;  3PFO A;  4P10 A;  4MHN A;  1NE9 A;  1S5K A;  4KVO E;  4P4B A;  4MHD A;  3B3W A;  3FH4 A;  2BEI A;  1XRY A;  2IL4 A;  2ZW7 A;  1JWQ A;  1TIQ A;  1Z4R A;  4OC0 A;  2B5G B;  4BBH A;  2ODF A;  4NXY A;  4TWE A;  2HC9 A;  3K2K A;  1HDQ A;  2ZEM A;  1Z4E A;  4C2Z A;  4JWP A;  1L0C A;  3GLJ A;  3F5B A;  3SJF A;  1IYL A;  4CAW A;  2I00 A;  5LRG A;  3IFE A;  1GYT A;  2JDD A;  1S7K A;  2P6G A;  4JD6 A;  4PK3 A;  4KOT A;  4P6Y A;  2OZH A;  4C2X A;  5F49 A;  3QB8 A;  4CGM A;  2CTB A;  4XPK A;  4LUA A;  1ELM P;  2B3U A;  4AVA A;  3PGP A;  4R87 A;  2YNC A;  4ORF A;  3D7H A;  5K8N A;  3B3V A;  4G1P A;  4ZGY B;  5BWA B;  2O4H A;  4P45 A;  5DWM A;  3R9E A;  2FVG A;  3RAM A;  1QSN A;  3WAB A;  4AG7 A;  1N71 A;  3PBB A;  2ZEO A;  1RO5 A;  1YVO A;  2GU2 A;  3KQX A;  4LQG A;  4P4I A;  1TKH A;  1XFO A;  3WC7 A;  1J4J A;  2PDO A;  1ELL P;  1I21 A;  5LRJ A;  4ZX9 A;  3KKW A;  2QVP A;  1OZP A;  2Z0Z A;  3CT9 A;  5AGE A;  1S3Z A;  3TO6 A;  3S9L A;  1MJ9 A;  5IB9 A;  1KUX A;  3PFE A;  2AFM A;  4MCR A;  4CS0 B;  2J8N A;  4CGL A;  2VBQ A;  1GHE A;  2QYV A;  1CPS A;  3MGD A;  5AG7 A;  2PR8 A;  1Z9U A;  4QBJ A;  2POK A;  3TO9 A;  4CGP A;  2PJ6 A;  5LYI A;  3FMC A;  1CP7 A;  3FX6 A;  3BXM A;  5F47 A;  4JLY A;  3TC8 A;  4A38 A;  5C82 A;  2YGW A;  2C27 A;  3D66 A;  3LAC A;  2B4D B;  3FRM A;  2OB0 A;  3F8K A;  4MY0 A;  4PXD A;  1VIX A;  2QEC A;  1A2Z A;  3QNV A;  4HNX B;  4UWI A;  4WJB A;  4B5O A;  1XMB A;  2AFZ A;  4YFJ A;  5A28 A;  4GS4 A;  2XEJ A;  1M1D A;  3RBU A;  1KUY A;  5IB0 A;  2NYQ A;  1R43 A;  2VZZ A;  1XBU A;  1RXT A;  3IWG A;  4R8F A;  4R76 A;  1M4D A;  2FE7 A;  2Z11 A;  3IWE A;  4X8I A;  2YND A;  3S9M A;  3FEC A;  3B3C A;  1CPX A;  2CTC A;  4E2A A;  4OID A;  3SJG A;  4RUH A;  1K4J A;  4CYO A;  4I49 A;  4B5P B;  3SXN A;  5H84 A;  5H86 A;  1Y9W A;  1Z8W A;  2AFX A;  1ZG9 A;  2PJ5 A;  4CYQ A;  2CF4 A;  1VGY A;  4PSX A;  2PE3 A;  2ZEL A;  3NH8 A;  4FUU A;  4U9Z A;  3B3S A;  3D7F A;  5IV0 A;  5C88 A;  3S9N A;  1TKF A;  2AE6 A;  3L2N A;  3D2P A;  3WC6 A;  4AVB A;  4KOY A;  2R8V A;  1M4L A;  1XOV A;  3CXP A;  4C7H A;  1ZLI A;  4TNU A;  4DYO A;  4M6H A;  5HXD A;  4NGM A; 
#chains in the Genus database with same CATH homology
 2EUI A;  1YRE A;  2D4P A;  1YK3 A;  4AVC A;  4FD4 A;  4UFW A;  4Q36 A;  2DPS A;  4NSQ A;  2A4N A;  5G1Z A;  1S7L A;  3W91 A;  4IF5 A;  3H4Q A;  5KTC A;  2DXQ A;  2ZPA A;  4R57 A;  3QAH A;  4C7I A;  4M3S A;  2GE3 A;  3TT2 A;  1ZO0 A;  3TTH A;  2ZW5 A;  2OH1 A;  3OWC A;  3F0A A;  1YLE A;  3VWD A;  4JJX A;  4OAD A;  2Q44 A;  2OU2 A;  4R3K A;  4B11 A;  3D3S A;  2FT0 A;  2FSR A;  2I79 A;  2R98 A;  3RYO A;  4AB7 A;  5G22 A;  2K5T A;  1Y7R A;  3LOD A;  4PK2 A;  3FB3 A;  4F0Y A;  2FIA A;  4CAV A;  4JXR A;  4NEX A;  3EC4 A;  4KUB A;  1Q2Y A;  3EXN A;  4KOS A;  1XIX A;  2BSW A;  3DR8 A;  4H89 A;  1BOB A;  1KZF A;  5J8F A;  4MBU A;  4K30 A;  5KTA A;  4HNY B;  3W6X A;  4KOW A;  5IX3 A;  4Y49 C;  2CNM A;  2REF A;  2ATR A;  1WWZ A;  5DWN A;  3S6H A;  4A32 A;  4CAE A;  2YNC C;  1YX0 A;  3GY9 A;  4PV6 A;  2Z10 A;  2CXA A;  4YGO A;  1KUV A;  3V8I A;  4NCZ A;  1PUA A;  3G8W A;  2AJ6 A;  2CY2 A;  2VI7 A;  4A31 A;  4LX9 A;  3ZJ0 A;  2Q7B A;  2B5G A;  4UA3 A;  4IUS A;  3W6S A;  4UCM A;  2NMT A;  5GCN A;  2CNS A;  4CGN A;  1M44 A;  5F48 A;  2D4O A;  2ZW4 A;  2PSW A;  1S60 A;  5HMN A;  5JPH A;  3EY5 A;  1M4I A;  4XPL A;  3JTK A;  4CGO A;  4YRH A;  3P2H A;  2FS5 A;  2EVN A;  5HH1 A;  4KVM E;  1P4N A;  3FYN A;  1LRZ A;  4HNW B;  4QC6 A;  4KLW A;  4RI1 A;  5G20 A;  2FIW A;  1YVK A;  4EVY A;  2WSA A;  3NE7 A;  1WK4 A;  1FY7 A;  3UY5 A;  1M4G A;  2Q0Y A;  1XE4 A;  4H6Z A;  2P6F A;  3DNS A;  4E8O A;  2Y0M A;  2JLM A;  1MJA A;  2HQY A;  2VZY A;  3GKR A;  2JEV A;  3D2M A;  4JXQ A;  5JQ4 A;  4H6U A;  2Q4V A;  4AG9 A;  2B4D A;  3IU1 A;  1I1D A;  4FD5 A;  2GAN A;  4MJ8 A;  4J3G A;  1B87 A;  4XPD B;  3EFA A;  1R57 A;  3CXQ A;  4UCN A;  1S7F A;  1QSO A;  2PR1 A;  3I3G A;  4FD7 A;  2OZU A;  4XPD C;  4CAX A;  1SQH A;  4KZT A;  1NSL A;  4B5P A;  4UWJ A;  2KCW A;  3G3S A;  4UBR A;  3FXT A;  3FBU A;  3TE4 A;  3A9L A;  2CNT A;  4X5K A;  1IYK A;  2DPT A;  2J8R A;  4II9 A;  4HKF A;  3IU2 A;  5AG4 A;  4DNC A;  3H5Z A;  5AG5 A;  2ARH A;  2Z3K A;  2WPX A;  4MFP A;  3SXO A;  1PU9 A;  3S6K A;  4KUA A;  1V0C A;  4Q38 A;  4Y49 B;  1UFH A;  3TCV A;  3T9Y A;  4MFJ A;  2PRB A;  2O28 A;  4MFL A;  3S6F A;  5F46 A;  4M85 A;  1QST A;  3TO7 A;  4OLL A;  4A30 A;  3VWE A;  3FIX A;  4UCP A;  4L8A A;  1QSR A;  4B13 A;  2Z3M A;  3DSB A;  1IB1 E;  2VXK A;  2ZW6 A;  1XF8 A;  3TOA A;  3JUW A;  2QML A;  1U6M A;  2REE A;  2X7B A;  2Z3N A;  1NMT A;  4ONU A;  3R9F A;  2Q4Y A;  5CNP A;  2Z3L A;  4FD6 A;  2RC4 A;  3WR7 A;  4NF1 A;  4F0X A;  3T90 A;  1XMT A;  3CXS A;  5G21 A;  4E0A A;  4KLV A;  4KVX A;  1Q2D A;  4BMH A;  1VHS A;  2FL4 A;  4R9M A;  4OAE A;  4KSF A;  2HV2 A;  2G3A A;  2G3T A;  3FNC A;  2Z3O A;  1CJW A;  4UFX A;  5FVJ A;  2GIV A;  5ISV A;  4QVT A;  4CAF A;  4MFZ A;  2PQ8 A;  3E0K A;  5E96 A;  4KS9 A;  2PC1 A;  3P2F A;  4CYP A;  3I9S A;  1CM0 A;  2R7H A;  3DR6 A;  4XNH B;  2FXF A;  4KOR A;  3IGR A;  3C26 A;  2BL1 A;  2FCK A;  4RS2 A;  4CRY B;  2WPW A;  4XNH C;  3K9U A;  4MFQ A;  5J8C A;  3N7Z A;  3BLN A;  4C2Y A;  2G0B A;  4MFK A;  4R3L A;  4F6A A;  2WUU A;  4KOU A;  1I12 A;  5I0C A;  4MY3 A;  1VKC A;  3PP9 A;  5KTD A;  1P0H A;  2J8M A;  3R9G A;  3BJ7 A;  4UFV A;  2B3V A;  1QSM A;  2F5I A;  2BUE A;  2VQY A;  4QUS A;  3TOB A;  2P0W A;  1Y9K A;  4PSW A;  4A33 A;  3BJ8 A;  1XEB A;  2ZXV A;  1S7N A;  3DDD A;  2Q04 A;  3PZJ A;  4L89 A;  1Q2C A;  2YNE A;  4CYN A;  3S6G A;  3R95 A;  4CRZ B;  1YGH A;  4B14 A;  4C68 A;  1MK4 A;  5A27 A;  5AG6 A;  4B12 A;  5EBV A;  3SHP A;  3LD2 A;  3R1K A;  4KSA A;  3ZZI A;  4QB9 A;  4KOX A;  3TFY A;  3EO4 A;  1ON0 A;  4B10 A;  2P6E A;  2B4B A;  4A95 A;  3D8P A;  1BO4 A;  2HUZ A;  4U9Y A;  4A2Z A;  4KOV A;  3R96 A;  3B8G A;  2VEZ A;  1IIC A;  3GYA A;  2QIR A;  5EC4 A;  1MJB A;  2Z3P A;  4ZBG A;  3JVN A;  2R1I A;  2H5M A;  1IID A;  1YR0 A;  1B6B A;  4U5Y A;  2B58 A;  2OZG A;  4MI4 A;  2JDC A;  1NE9 A;  1S5K A;  4KVO E;  4MHD A;  2BEI A;  2IL4 A;  2ZW7 A;  1Z4R A;  1TIQ A;  4BBH A;  2B5G B;  4NXY A;  1Z4E A;  4C2Z A;  4JWP A;  1L0C A;  3F5B A;  1IYL A;  4CAW A;  2I00 A;  2JDD A;  1S7K A;  4JD6 A;  2P6G A;  4PK3 A;  4KOT A;  4C2X A;  2OZH A;  5F49 A;  3QB8 A;  4CGM A;  4XPK A;  4LUA A;  2B3U A;  4AVA A;  3PGP A;  4R87 A;  2YNC A;  4ORF A;  4ZGY B;  5BWA B;  5DWM A;  3R9E A;  4AG7 A;  1QSN A;  1N71 A;  1RO5 A;  1YVO A;  1J4J A;  2PDO A;  1I21 A;  3KKW A;  2Z0Z A;  1OZP A;  5AGE A;  1S3Z A;  3TO6 A;  1MJ9 A;  1KUX A;  4CS0 B;  2J8N A;  4CGL A;  2VBQ A;  1GHE A;  3MGD A;  5AG7 A;  2PR8 A;  1Z9U A;  4QBJ A;  4CGP A;  3TO9 A;  5F47 A;  4JLY A;  5C82 A;  2YGW A;  2C27 A;  2B4D B;  3FRM A;  2OB0 A;  3F8K A;  4MY0 A;  2QEC A;  4HNX B;  4UWI A;  5A28 A;  4B5O A;  4YFJ A;  4GS4 A;  1M1D A;  1KUY A;  5IB0 A;  2VZZ A;  3IWG A;  1RXT A;  1M4D A;  2FE7 A;  2Z11 A;  3IWE A;  2YND A;  4E2A A;  1K4J A;  4CYO A;  4I49 A;  4B5P B;  3SXN A;  5H84 A;  5H86 A;  1Y9W A;  4CYQ A;  4PSX A;  5IV0 A;  4U9Z A;  5C88 A;  2AE6 A;  3D2P A;  4KOY A;  2R8V A;  3CXP A;  4C7H A;  4AVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...