4QUSA

1.28 angstrom resolution crystal structure of predicted acyltransferase with acyl-coa n-acyltransferase domain (ypea) from escherichia coli str. k-12 substr. mg1655
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
140
structure length
140
Chain Sequence
MEIRVFRQEDFEEVITLWERCDLLRPWNDPEMDIERKMNHDVSLFLVAEVNGDVVGTVMGGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPEDNDMVLGMYERLGYEHADVLSLGKRLIEDEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acetyltransferase YpeA
publication title 1.28 Angstrom resolution crystal structure of predicted acyltransferase with acyl-CoA N-acyltransferase domain (ypeA) from Escherichia coli str. K-12 substr. MG1655
rcsb
source organism Escherichia coli str. k-12 substr. mg1655
total genus 39
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4qusA01
4XPKA 3DSBA 4R87A 4MHDA 2G3AA 2JLMA 3H4QA 2ZW5A 4KUBA 2OB0A 2ATRA 4KOSA 5HH1A 2FIAA 4R3LA 3R9EA 2Z0ZA 4KLVA 2B4BA 3GKRA 1S5KA 3WR7A 2VEZA 2OZGA 3T90A 4MY3A 1RO5A 2P6GA 4U5YA 2QMLA 3P2FA 4NF1A 5IX3A 2REFA 5J8FA 4R3KA 4PSWA 2QIRA 5CNPA 3FXTA 4LX9A 2CNSA 3W91A 5C88A 2NMTA 4I49A 1QSMA 3LD2A 4FD6A 2QECA 4UA3A 4H89A 5E96A 2PR8A 3D8PA 4HKFA 2P0WA 3V8IA 2R1IA 1Y9WA 4QB9A 3JVNA 3CXPA 4NEXA 1KUYA 3KKWA 2K5TA 3D2MA 2Y0MA 4X5KA 4M85A 2VI7A 4BMHA 4AVAA 3FNCA 1B6BA 4NXYA 4E2AA 4IUSA 3BJ7A 4QVTA 3TOAA 2J8MA 4XNHC 4HNYB 2GANA 5IV0A 5KTDA 3P2HA 2OU2A 3ZJ0A 1QSRA 2BUEA 1NE9A 2OZHA 4R9MA 2FCKA 4L89A 5DWMA 1XEBA 4ZBGA 1BO4A 3D3SA 3G3SA 2P6EA 3VWDA 4B5PA 2R98A 1LRZA 2GIVA 3W6SA 1KZFA 4AVBA 2AJ6A 2HV2A 4UWIA 5FVJA 1XE4A 3TO6A 4UWJA 3DR6A 1KUXA 4KOYA 4JD6A 4JWPA 1S7NA 5H84A 4CAVA 2BL1A 2Q04A 4PK3A 3D2PA 2ZW4A 1Y9KA 4LUAA 1CM0A 3R96A 5JPHA 4QUSA 2ZPAA 3NE7A 2ZW6A 3IGRA 3QAHA 1S7LA 4KOUA 4CAXA 2CNTA 1FY7A 2FSRA 2J8NA 1RXTA 1UFHA 1CJWA 4XPDC 1V0CA 2PR1A 2PSWA 4OADA 3EC4A 3F5BA 3RYOA 2ZW7A 3F0AA 4EVYA 2Q0YA 3FYNA 1XF8A 4ORFA 3TTHA 2B4DB 4OLLA 4KVME 5EBVA 1P0HA 4KOVA 4Y49C 3B8GA 2X7BA 1YGHA 2KCWA 2FXFA 3FBUA 3JUWA 1Q2DA 1U6MA 2Z11A 2CY2A 1IYKA 3EO4A 3EXNA 2OZUA 4K30A 3R9GA 2EVNA 2REEA 2B5GA 2ARHA 4KZTA 2PQ8A 4XNHB 4CRYB 1MK4A 2B4DA 1S3ZA 2I79A 4CS0B 3K9UA 3SHPA 4PV6A 1M4DA 3R1KA 1PUAA 4KOXA 2HUZA 1YLEA 4B5PB 2CNMA 4KOWA 5JQ4A 2FS5A 2H5MA 1GHEA 1MJ9A 1YVOA 2A4NA 1QSTA 3I9SA 4AG9A 4KOTA 3T9YA 2FIWA 2VXKA 1PU9A 1XMTA 4QBJA 4GS4A 3S6KA 5EC4A 1S60A 4MY0A 3S6HA 3TO9A 1Y7RA 2BSWA 4FD5A 5GCNA 4HNWB 4F0YA 1Z4EA 4J3GA 2Q4VA 4KVOE 1I21A 4NCZA 1R57A 3PP9A 4XPDB 4R57A 4B5OA 3TCVA 1I1DA 3F8KA 1J4JA 5KTAA 1MJBA 2EUIA 4FD7A 4RI1A 2RC4A 3BLNA 4QC6A 1TIQA 3SXNA 1M4GA 4U9YA 4F6AA 2I00A 1M44A 2J8RA 4Y49B 1I12A 4ONUA 3DDDA 2R7HA 4MI4A 2OH1A 1YVKA 3CXSA 3EY5A 1OZPA 1WK4A 1BOBA 2JEVA 1L0CA 3C26A 3UY5A 1B87A 2B3VA 2B5GB 4CRZB 1Q2YA 4KORA 2PDOA 1S7KA 5I0CA 3TFYA 2PC1A 2VQYA 2Q4YA 3VWEA 5DWNA 5ISVA 2B3UA 5F47A 1ON0A 2D4PA 3PGPA 1XIXA 3BJ8A 3DNSA 1N71A 1Z9UA 1P4NA 2P6FA 1YR0A 4YRHA 1M1DA 3TOBA 1WWZA 2FL4A 4II9A 2D4OA 2JDCA 1NSLA 2VBQA 4DNCA 2R8VA 4HNXB 2B58A 4IF5A 3S6GA 2ZXVA 3TT2A 1Q2CA 5IB0A 5KTCA 4AVCA 2VZZA 3N7ZA 1NMTA 2Z10A 3GY9A 4U9ZA 5J8CA 4PK2A 2PRBA 3GYAA 3LODA 2FE7A 2JDDA 2AE6A 1SQHA 3G8WA 1S7FA 4E8OA 4JJXA 4H6UA 4PSXA 2WPWA 4UBRA 2BEIA 4MBUA 1VKCA 1YX0A 4FD4A 2DXQA 4XPLA 3FRMA 3SXOA 2GE3A 2VZYA 4NSQA 2IL4A 5F48A 4E0AA 1MJAA 1IYLA 1KUVA 1YK3A 2Q44A 4M3SA 4CAWA 2C27A 5H86A 4YFJA 4MJ8A 3DR8A 2G0BA 1QSNA 3QB8A 4RS2A 3I3GA 1VHSA 1YREA 5HMNA 2HQYA 1QSOA 4H6ZA 3R95A 3W6XA 3TO7A 3PZJA 2G3TA 1K4JA 5F49A 4KLWA 1IIDA 2WPXA 3OWCA 4AG7A 3ZZIA 4YGOA 4AB7A 4L8AA 4JXQA 3R9FA 5F46A 2Q7BA 3FB3A 4OAEA 3S6FA 1IB1E 3CXQA 2O28A 4KUAA 5C82A 4JXRA 1Z4RA 4KVXA 3E0KA 1M4IA 2FT0A 3TE4A 3FIXA 4JLYA 1IICA 2F5IA 3IWGA 3MGDA 3EFAA
chains in the Genus database with same CATH superfamily
4XPKA 1ELLP 3IEHA 3DSBA 4R87A 1LAMA 2CTCA 2PCUA 3FH4A 4MHDA 5ELYA 2G3AA 2JLMA 3PFOA 3H4QA 2ZW5A 4KUBA 2PJ1A 2PJ7A 3NH8A 2OB0A 2ATRA 2Q7SA 3RNZA 4KOSA 2C6CA 2V8VA 2ZEEA 2JBKA 5HH1A 2FIAA 2BO9A 3PB8X 2AFXA 5A27A 4R3LA 2EK8A 3R9EA 2Z0ZA 3A9LA 4KLVA 2J9AA 2B4BA 2C1CA 2QYVA 1S5KA 3GKRA 3IU2A 4PPZA 4CYNA 3WR7A 3NA6A 4OKOA 2VEZA 3FEDA 3WC5A 2OZGA 3T90A 4MY3A 1AUGA 5F09A 1RO5A 2O4HA 2P6GA 4EFDA 5LYFA 4U5YA 2QMLA 2POKA 2PJ5A 3P2FA 4NF1A 3LMSA 2PJBA 4A30A 5IX3A 5THWA 2REFA 3SJXA 3SJGA 1TF9A 5J8FA 4R3KA 3RBUA 4PSWA 2QIRA 5CNPA 3FXTA 4LX9A 3T8WA 2CNSA 2YNDA 4R8FA 4WJBA 3W91A 4A33A 2PJ6A 5C88A 2NMTA 4I49A 1QSMA 3LD2A 4B11A 4FD6A 5K8OA 3KR5A 1IU8A 3FJUA 2QECA 4UA3A 4P10A 4LQGA 4MHPA 4H89A 4H2KA 4A94A 2PJAA 3HLPA 5DS0A 5E96A 4OP4A 2PR8A 3H8EA 1JQGA 3D8PA 4HKFA 5D29A 1Z8LA 4ZX8A 4C68A 6CPAA 1BPNA 2P0WA 3V8IA 4EWTA 1OBRA 2R1IA 1Y9WA 3D67A 3N5FA 3PB4X 4P6YA 1XFOA 4Q38A 4QB9A 4UCPA 4JYWA 3JVNA 3CXPA 3D7GA 4NEXA 1KUYA 3KKWA 2PJ0A 2K5TA 2PE3A 2WUUA 2V8HA 3D2MA 2Y0MA 4X5KA 4A2ZA 4M85A 2VI7A 4BMHA 3H8GA 3FNCA 4AVAA 4F0XA 4P4FA 2RFHA 1B6BA 4NXYA 4E2AA 3MN8A 4JZ0A 2HC9A 2ZENA 2DPSA 4IUSA 3RZAA 3BJ7A 3GLJA 4QVTA 4B12A 3TOAA 2J8MA 4XNHC 5AG4A 1BLLE 4HNYB 2GANA 5IV0A 3PB6X 1ZO0A 5KTDA 4MRIA 3KZWA 3P2HA 1XOVA 2OU2A 3ZJ0A 3FMCA 1QSRA 2BUEA 1NE9A 2OZHA 1CPSA 4R9MA 5G21A 2FCKA 2YGWA 4L89A 5DWMA 4K3NA 1XEBA 3IIBA 4ZBGA 1BO4A 3D3SA 3G3SA 2P6EA 4R76A 3VWDA 4AXVA 1H8LA 2R98A 1LRZA 4MFKA 4OIDA 4B5PA 2F7VA 2GIVA 3W6SA 1KZFA 4X2TA 1DE4C 1TKFA 3CPAA 4AVBA 2AJ6A 3SJEA 2HV2A 4PXEA 4UWIA 5AGEA 3FF3A 5FVJA 3D66A 1KWMA 4A37A 1XE4A 1A2ZA 5G20A 3TO6A 4UWJA 2GLFA 3DR6A 1KUXA 4KOYA 3VH9A 4JD6A 4JWPA 2PIZA 1S7NA 4IAVA 1AYEA 4C7IA 2GU2A 4ZY0A 4PXCA 2JBJA 5H84A 4MFZA 2F8HA 1UWYA 4CAVA 2CTBA 2BL1A 3JRUA 2Q04A 4PK3A 3D2PA 2XEGA 2ZW4A 1Y7EA 1LOKA 1Y9KA 4KS9A 1CM0A 4LUAA 1CG2A 2GFQA 1Q7LA 4IK2A 2XEIA 3R96A 3K2KA 1TKHA 4QUSA 5JPHA 4P4DA 1YLOA 1ZLIA 2ZPAA 3LACA 3NE7A 3VATA 2DF5A 4CGPA 2ZW6A 1Z8XA 3IGRA 5J1QA 3QAHA 4MXUA 4MHZA 1S7LA 4P4BA 4KOUA 1YW4A 3BI1A 4C2XA 4CAXA 3GUXA 3NH5A 4F9UA 2CNTA 1FY7A 2FSRA 2J8NA 4UCMA 3KQXA 1RXTA 3KQZA 1UFHA 2PJ9A 1CJWA 3IFEA 4M6GA 4RN7A 1V0CA 4XPDC 3S9MA 3S9LA 2ZOGA 2PR1A 2PSWA 2GREA 2IJZA 5BWAB 4OADA 3EC4A 3F5BA 2IMOA 3MRUA 3RYOA 3V7ZA 1XJOA 2ZW7A 3F0AA 3IU1A 3PBBA 4YWYA 4DJLA 4EVYA 5I4MA 2Q0YA 4LQ6A 3FYNA 1XF8A 3BI0A 4UFVA 4ORFA 1LCPA 1ELMP 2NYQA 3TTHA 3D4UA 2B4DB 4OLLA 2OR4A 1DTDA 2HB6A 4KVME 4C7HA 4FWUA 2YNCA 2AFZA 4NGRA 4OIWA 2YNCC 2IQ6A 5EBVA 1P0HA 4KOVA 4PXBA 5AG6A 4Y49C 3B8GA 4ZYQA 2X7BA 1YGHA 3SI0A 2ZEOA 2KCWA 2FXFA 3BXMA 3FBUA 2Z3PA 2JEWA 1YW6A 3B3TA 3JUWA 3KHXA 3B3WA 4HPSA 2ABZA 1Q2DA 4B13A 1U6MA 2Z11A 2CY2A 3H8FA 1IYKA 3EO4A 1XBUA 3IC1A 1ARMA 4P4IA 3WC6A 2XEFA 3EXNA 2OZUA 4K30A 3R9GA 2EVNA 5EMIA 2REEA 2B5GA 2ARHA 4KZTA 4ZY2A 1ZLHA 2PQ8A 4XNHB 3RO0A 4CRYB 4Z65A 1MK4A 1RTQA 1VHOA 4CPAA 2PJ8A 2B4DA 1EE3P 1S3ZA 3NFZA 2AFSA 4BD9A 2I79A 2VL1A 4CS0B 3K9UA 3SHPA 4PV6A 1M4DA 3R1KA 1PUAA 3PBEA 4KOXA 4Q36A 2Q51A 2HUZA 2NSMA 1QQ9A 1YLEA 1F57A 4FUUA 4MCQA 4B5PB 2CNMA 4KOWA 5JQ4A 2FS5A 2H5MA 1GHEA 1MJ9A 2EO8A 4UIBA 1YVOA 4CGLA 4UFWA 2BCOA 3B3VA 1AMPA 2A4NA 5G1ZA 2AFWA 4UFXA 1M4LA 1QSTA 4CYQA 3I9SA 4AG9A 4KOTA 5CBMA 3K9TA 3T9YA 2FIWA 2VXKA 1Z2LA 2ZEGA 4OC0A 1PU9A 1XMTA 3B3CA 3D7FA 3SJFA 4G1PA 4QBJA 1VHEA 4GS4A 3S6KA 1F2OA 4KSAA 2FVGA 4B10A 3KI9A 5EC4A 1S60A 4WWVA 2ZEPA 2OOTA 5JGFA 5HVHA 4MY0A 3S6HA 3TO9A 3HUVA 1Y7RA 2PJ3A 2BSWA 4FD5A 5GCNA 1YSJA 4HNWB 4OC4A 2ANPA 2Z3LA 4F0YA 2ZEMA 1Z4EA 4J3GA 2Q4VA 4KVOE 2ZEHA 1I21A 3D7DA 4UEEA 4NCZA 1CX8A 3SI2A 1R57A 1GYTA 3PP9A 4CAEA 4XPDB 1Z8WA 1ZG9A 2RB7A 4R57A 4B5OA 3IO1A 3PB9X 1HEEA 3TCVA 1I1DA 3F8KA 4A39A 4UCNA 2WSAA 1J4JA 3KASA 5KTAA 1HDQA 1MJBA 2EUIA 4FD7A 1PYTB 4RI1A 1VGYA 2RC4A 5HVFA 3BLNA 3B35A 2I3CA 4QC6A 2GLJA 1XMBA 1TIQA 3SXNA 1CPXA 1M4GA 3TC8A 4U9YA 4C2YA 4P44A 4B14A 2QJ8A 4F6AA 2I00A 1M44A 2J8RA 5HXDA 4Y49B 4CGOA 1HDUA 1I12A 1TF8A 4RUHA 4UIAA 1NSAA 1R3NA 4W9YA 3GB0A 2WZNA 3QAYA 4ONUA 2BOAA 2Q4ZA 2R7HA 3DDDA 3VARA 2DEAA 4MI4A 3RAMA 4ZY1A 2OH1A 2CF4A 5LRKA 1YVKA 3CXSA 3EY5A 1TKJA 3FX6A 1OZPA 3WC7A 1WK4A 1BOBA 2CIJA 1ARLA 2JEVA 1L0CA 3C26A 3UY5A 4P45A 4PXDA 1B87A 4GM5A 2PVVA 3ISXA 2B3VA 3CZXA 2B5GB 5CPAA 2ZEDA 3DGVA 3B3SA 4CRZB 1Q2YA 4KORA 2PDOA 1S7KA 3CT9A 5I0CA 3TFYA 4A32A 1IY7A 2PC1A 2Q4YA 2VQYA 3VWEA 5DWNA 4UEFA 2AFMA 2EBJA 5ISVA 5JM6A 2B3UA 5F47A 2V8DA 4DUKA 1R43A 2AFUA 1ON0A 3LWUA 1VIXA 2D4PA 4OC1A 3PGPA 7CPAA 4YU9A 1LFWA 1XIXA 3NE8A 1CBXA 1TXRA 3BJ8A 3B7IA 2ODFA 3DNSA 1QMUA 1YMEA 4R7MA 2ZEFA 1N71A 1Z9UA 1P4NA 1LANA 2P6FA 1YQEA 1YR0A 4YRHA 1M1DA 3FECA 3TOBA 1WWZA 3I1UA 2FL4A 4II9A 2D4OA 1IOFA 2JDCA 4CAFA 5G22A 4MCSA 1NSLA 4PQAA 2VBQA 4ZI6A 1Z5RA 4MMOA 2EWBA 4DNCA 2R8VA 4HNXB 2B58A 1CP6A 4NGNA 4IF5A 4P4JA 2ZXVA 3S6GA 3TT2A 1Q2CA 4MFPA 5IB0A 5K8PA 3KHZA 5KTCA 2Z3KA 4A31A 4AVCA 3S9NA 2VZZA 2Q43A 3N7ZA 1NMTA 4BINA 2CXAA 4F9VA 2Z10A 3GY9A 3CDXA 4U9ZA 5J8CA 1X12A 5K8NA 4PK2A 4R6TA 2PRBA 3QNVA 2EK9A 3GYAA 4TNUA 3LODA 4O23A 8CPAA 2FE7A 3L2NA 3PRTA 4NGQA 5A28A 4CGNA 2JDDA 2PJ2A 4NGTA 2AE6A 1SQHA 2PJ4A 1FNOA 2V8GA 3IWEA 3G8WA 1S7FA 4OC2A 4JJXA 4MCRA 4H6UA 4OC3A 4E8OA 5JH9A 2ZELA 2Z3OA 3KL9A 4CYPA 2ZOFA 4X8IA 5IB9A 4PSXA 2WPWA 5K8MA 4OMEA 4TWEA 4X3RA 4DYOA 3TX8A 4UBRA 3V38A 4KSIA 4CGMA 2BEIA 3IJ3A 3WABA 2C6GA 1VKCA 1YX0A 4MBUA 1Z8TA 4FD4A 4MFJA 2O53A 2DXQA 4XPLA 3FRMA 5LYIA 3SXOA 3SI1A 2GE3A 2VZYA 1BAVA 4NSQA 2WYRA 2IL4A 5F48A 5LYLA 4E0AA 4MFQA 4A38A 1MJAA 1Y0RA 2PJCA 1IYLA 1KUVA 1YK3A 2Q44A 3IWWA 4M3SA 2C27A 4CAWA 4MCPA 5H86A 4CYOA 4MJ8A 4YFJA 3DR8A 1X10A 3CPXA 1BPMA 3BHXA 2G0BA 1QSNA 3NH4A 4IHMA 2PVWA 3B2YA 3PB7X 4MHNA 5LYDA 3QB8A 4GXHA 4RS2A 3I3GA 1VHSA 1YREA 4P4EA 5HMNA 1LAPA 2HQYA 4BBHA 3PEIA 4MFLA 1QSOA 3D68A 4H6ZA 3WT4A 4F8ZA 5AG5A 3GIUA 3R95A 4NJQA 2YNEA 3W6XA 2C6PA 1FT7A 1PCAA 2PIYA 3TO7A 5HVGA 3PFEA 3PZJA 1IOIA 2G3TA 2V77A 2G9DA 3KR4A 1K4JA 5F49A 4KLWA 4B6ZA 4M6IA 5LRJA 4A95A 4NGPA 5AG7A 1IIDA 4C2ZA 2WPXA 3OWCA 1XRYA 4AG7A 4UEZA 3ZZIA 4YGOA 4AB7A 4Q7AA 4L8AA 4JXQA 3H5ZA 3R9FA 4FAIA 5F46A 1CP7A 2DPTA 2PRQA 4NJRA 2Q7BA 3ISZA 3FB3A 4OAEA 3FVLA 2QVPA 3S6FA 1IB1E 1IGBA 3CXQA 1F2PA 5LRGA 2AFOA 4NGMA 2Z3MA 2O28A 4KSFA 4UF4A 1Y0YA 4ZX9A 4KUAA 1ZG8A 2Z3NA 2XEJA 5C82A 4MHYA 3D7HA 3KGQA 3JTKA 4JXRA 3FEEA 4EMEA 5D8NA 4ONWA 4ZGYB 1Z4RA 4KVXA 3E0KA 4OC5A 4FBEA 1M4IA 1ZG7A 2FT0A 3TE4A 4NFRA 1JWQA 3FIXA 4JLYA 1IICA 4M6HA 4NGSA 2F5IA 3IWGA 3MGDA 3EFAA 3DLJA
chains in the Genus database with same CATH topology
4XPKA 3DSBA 4R87A 4MHDA 2G3AA 2JLMA 3H4QA 2ZW5A 4KUBA 2OB0A 2ATRA 4KOSA 5HH1A 2FIAA 5A27A 4R3LA 3R9EA 2Z0ZA 3A9LA 4KLVA 2B4BA 3IU2A 3GKRA 1S5KA 4CYNA 3WR7A 2VEZA 2OZGA 3T90A 4MY3A 1RO5A 2P6GA 4U5YA 2QMLA 3P2FA 4NF1A 4A30A 5IX3A 2REFA 5J8FA 4R3KA 4PSWA 2QIRA 5CNPA 3FXTA 4LX9A 2CNSA 2YNDA 3W91A 4A33A 5C88A 2NMTA 4I49A 1QSMA 3LD2A 4B11A 4FD6A 2QECA 4UA3A 4H89A 5E96A 2PR8A 3D8PA 4HKFA 4C68A 2P0WA 3V8IA 2R1IA 1Y9WA 4Q38A 4QB9A 4UCPA 3JVNA 3CXPA 4NEXA 1KUYA 3KKWA 2K5TA 2WUUA 3D2MA 2Y0MA 4X5KA 4A2ZA 4M85A 2VI7A 4BMHA 4AVAA 3FNCA 4F0XA 1B6BA 4NXYA 4E2AA 2DPSA 4IUSA 4B12A 3BJ7A 4QVTA 3TOAA 2J8MA 4XNHC 5AG4A 4HNYB 2GANA 5IV0A 5KTDA 1ZO0A 3P2HA 2OU2A 3ZJ0A 1QSRA 2BUEA 1NE9A 2OZHA 4R9MA 5G21A 2FCKA 2YGWA 4L89A 5DWMA 1XEBA 4ZBGA 1BO4A 3D3SA 3G3SA 2P6EA 3VWDA 4B5PA 2R98A 1LRZA 4MFKA 2GIVA 3W6SA 1KZFA 4AVBA 2AJ6A 2HV2A 4UWIA 5AGEA 5FVJA 1XE4A 5G20A 3TO6A 4UWJA 3DR6A 1KUXA 4KOYA 4JD6A 4JWPA 1S7NA 4C7IA 5H84A 4MFZA 4CAVA 2BL1A 2Q04A 4PK3A 3D2PA 2ZW4A 1Y9KA 4KS9A 1CM0A 4LUAA 3R96A 5JPHA 4QUSA 2ZPAA 4CGPA 3NE7A 2ZW6A 3IGRA 3QAHA 1S7LA 4KOUA 4CAXA 4C2XA 2CNTA 1FY7A 2FSRA 2J8NA 4UCMA 1RXTA 1UFHA 1CJWA 4XPDC 1V0CA 2PR1A 2PSWA 5BWAB 4OADA 3EC4A 3F5BA 3RYOA 2ZW7A 3F0AA 3IU1A 4EVYA 2Q0YA 3FYNA 1XF8A 4UFVA 4ORFA 3TTHA 2B4DB 4OLLA 4KVME 4C7HA 2YNCA 2YNCC 5EBVA 1P0HA 4KOVA 5AG6A 4Y49C 3B8GA 2X7BA 1YGHA 2KCWA 2FXFA 3FBUA 2Z3PA 3JUWA 1Q2DA 4B13A 1U6MA 2Z11A 2CY2A 1IYKA 3EO4A 3EXNA 2OZUA 4K30A 3R9GA 2EVNA 2REEA 2B5GA 2ARHA 4KZTA 2PQ8A 4XNHB 4CRYB 1MK4A 2B4DA 1S3ZA 2I79A 4CS0B 3K9UA 3SHPA 4PV6A 1M4DA 3R1KA 1PUAA 4KOXA 4Q36A 2HUZA 1YLEA 4B5PB 2CNMA 4KOWA 5JQ4A 2FS5A 2H5MA 1GHEA 1MJ9A 4CGLA 1YVOA 4UFWA 2A4NA 5G1ZA 4UFXA 1QSTA 4CYQA 3I9SA 4AG9A 4KOTA 3T9YA 2FIWA 2VXKA 1PU9A 1XMTA 4QBJA 4GS4A 3S6KA 4KSAA 4B10A 5EC4A 1S60A 4MY0A 3S6HA 3TO9A 1Y7RA 2BSWA 4FD5A 5GCNA 4HNWB 2Z3LA 4F0YA 1Z4EA 4J3GA 2Q4VA 4KVOE 1I21A 4NCZA 1R57A 3PP9A 4CAEA 4XPDB 4R57A 4B5OA 3TCVA 1I1DA 3F8KA 4UCNA 2WSAA 1J4JA 5KTAA 1MJBA 2EUIA 4FD7A 4RI1A 2RC4A 3BLNA 4QC6A 1TIQA 3SXNA 1M4GA 4U9YA 4C2YA 4B14A 4F6AA 2I00A 1M44A 2J8RA 4Y49B 4CGOA 1I12A 4ONUA 3DDDA 2R7HA 4MI4A 2OH1A 1YVKA 3CXSA 3EY5A 1OZPA 1WK4A 1BOBA 2JEVA 1L0CA 3C26A 3UY5A 1B87A 2B3VA 2B5GB 4CRZB 1Q2YA 4KORA 2PDOA 1S7KA 5I0CA 3TFYA 4A32A 2PC1A 2VQYA 2Q4YA 3VWEA 5DWNA 5ISVA 2B3UA 5F47A 1ON0A 2D4PA 3PGPA 1XIXA 3BJ8A 3DNSA 1N71A 1Z9UA 1P4NA 2P6FA 1YR0A 4YRHA 1M1DA 3TOBA 1WWZA 2FL4A 4II9A 2D4OA 2JDCA 4CAFA 5G22A 1NSLA 2VBQA 4DNCA 2R8VA 4HNXB 2B58A 4IF5A 3S6GA 2ZXVA 3TT2A 1Q2CA 4MFPA 5IB0A 5KTCA 2Z3KA 4A31A 4AVCA 2VZZA 3N7ZA 1NMTA 2CXAA 2Z10A 3GY9A 4U9ZA 5J8CA 4PK2A 2PRBA 3GYAA 3LODA 2FE7A 5A28A 4CGNA 2JDDA 2AE6A 1SQHA 3IWEA 3G8WA 1S7FA 4E8OA 4JJXA 4H6UA 2Z3OA 4CYPA 4PSXA 2WPWA 4UBRA 4CGMA 2BEIA 4MBUA 1VKCA 1YX0A 4FD4A 4MFJA 2DXQA 4XPLA 3FRMA 3SXOA 2GE3A 2VZYA 4NSQA 2IL4A 5F48A 4E0AA 4MFQA 1MJAA 1IYLA 1KUVA 1YK3A 2Q44A 4M3SA 4CAWA 2C27A 4CYOA 5H86A 4YFJA 4MJ8A 3DR8A 2G0BA 1QSNA 3QB8A 4RS2A 3I3GA 1VHSA 1YREA 5HMNA 2HQYA 4BBHA 4MFLA 1QSOA 4H6ZA 5AG5A 3R95A 3W6XA 2YNEA 3TO7A 3PZJA 2G3TA 1K4JA 5F49A 4KLWA 4A95A 5AG7A 1IIDA 4C2ZA 2WPXA 3OWCA 4AG7A 3ZZIA 4YGOA 4AB7A 4L8AA 4JXQA 3H5ZA 3R9FA 5F46A 2DPTA 2Q7BA 3FB3A 4OAEA 3S6FA 1IB1E 3CXQA 2Z3MA 2O28A 4KSFA 4KUAA 2Z3NA 5C82A 3JTKA 4JXRA 4ZGYB 1Z4RA 4KVXA 3E0KA 1M4IA 2FT0A 3TE4A 3FIXA 4JLYA 1IICA 2F5IA 3IWGA 3MGDA 3EFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XPK A;  3DSB A;  4R87 A;  4MHD A;  2G3A A;  2JLM A;  3H4Q A;  2ZW5 A;  4KUB A;  2OB0 A;  2ATR A;  4KOS A;  5HH1 A;  2FIA A;  4R3L A;  3R9E A;  2Z0Z A;  4KLV A;  2B4B A;  3GKR A;  1S5K A;  3WR7 A;  2VEZ A;  2OZG A;  3T90 A;  4MY3 A;  1RO5 A;  2P6G A;  4U5Y A;  2QML A;  3P2F A;  4NF1 A;  5IX3 A;  2REF A;  5J8F A;  4R3K A;  4PSW A;  2QIR A;  5CNP A;  3FXT A;  4LX9 A;  2CNS A;  3W91 A;  5C88 A;  2NMT A;  4I49 A;  1QSM A;  3LD2 A;  4FD6 A;  2QEC A;  4UA3 A;  4H89 A;  5E96 A;  2PR8 A;  3D8P A;  4HKF A;  2P0W A;  3V8I A;  2R1I A;  1Y9W A;  4QB9 A;  3JVN A;  3CXP A;  4NEX A;  1KUY A;  3KKW A;  2K5T A;  3D2M A;  2Y0M A;  4X5K A;  4M85 A;  2VI7 A;  4BMH A;  4AVA A;  3FNC A;  1B6B A;  4NXY A;  4E2A A;  4IUS A;  3BJ7 A;  4QVT A;  3TOA A;  2J8M A;  4XNH C;  4HNY B;  2GAN A;  5IV0 A;  5KTD A;  3P2H A;  2OU2 A;  3ZJ0 A;  1QSR A;  2BUE A;  1NE9 A;  2OZH A;  4R9M A;  2FCK A;  4L89 A;  5DWM A;  1XEB A;  4ZBG A;  1BO4 A;  3D3S A;  3G3S A;  2P6E A;  3VWD A;  4B5P A;  2R98 A;  1LRZ A;  2GIV A;  3W6S A;  1KZF A;  4AVB A;  2AJ6 A;  2HV2 A;  4UWI A;  5FVJ A;  1XE4 A;  3TO6 A;  4UWJ A;  3DR6 A;  1KUX A;  4KOY A;  4JD6 A;  4JWP A;  1S7N A;  5H84 A;  4CAV A;  2BL1 A;  2Q04 A;  4PK3 A;  3D2P A;  2ZW4 A;  1Y9K A;  4LUA A;  1CM0 A;  3R96 A;  5JPH A;  4QUS A;  2ZPA A;  3NE7 A;  2ZW6 A;  3IGR A;  3QAH A;  1S7L A;  4KOU A;  4CAX A;  2CNT A;  1FY7 A;  2FSR A;  2J8N A;  1RXT A;  1UFH A;  1CJW A;  4XPD C;  1V0C A;  2PR1 A;  2PSW A;  4OAD A;  3EC4 A;  3F5B A;  3RYO A;  2ZW7 A;  3F0A A;  4EVY A;  2Q0Y A;  3FYN A;  1XF8 A;  4ORF A;  3TTH A;  2B4D B;  4OLL A;  4KVM E;  5EBV A;  1P0H A;  4KOV A;  4Y49 C;  3B8G A;  2X7B A;  1YGH A;  2KCW A;  2FXF A;  3FBU A;  3JUW A;  1Q2D A;  1U6M A;  2Z11 A;  2CY2 A;  1IYK A;  3EO4 A;  3EXN A;  2OZU A;  4K30 A;  3R9G A;  2EVN A;  2REE A;  2B5G A;  2ARH A;  4KZT A;  2PQ8 A;  4XNH B;  4CRY B;  1MK4 A;  2B4D A;  1S3Z A;  2I79 A;  4CS0 B;  3K9U A;  3SHP A;  4PV6 A;  1M4D A;  3R1K A;  1PUA A;  4KOX A;  2HUZ A;  1YLE A;  4B5P B;  2CNM A;  4KOW A;  5JQ4 A;  2FS5 A;  2H5M A;  1GHE A;  1MJ9 A;  1YVO A;  2A4N A;  1QST A;  3I9S A;  4AG9 A;  4KOT A;  3T9Y A;  2FIW A;  2VXK A;  1PU9 A;  1XMT A;  4QBJ A;  4GS4 A;  3S6K A;  5EC4 A;  1S60 A;  4MY0 A;  3S6H A;  3TO9 A;  1Y7R A;  2BSW A;  4FD5 A;  5GCN A;  4HNW B;  4F0Y A;  1Z4E A;  4J3G A;  2Q4V A;  4KVO E;  1I21 A;  4NCZ A;  1R57 A;  3PP9 A;  4XPD B;  4R57 A;  4B5O A;  3TCV A;  1I1D A;  3F8K A;  1J4J A;  5KTA A;  1MJB A;  2EUI A;  4FD7 A;  4RI1 A;  2RC4 A;  3BLN A;  4QC6 A;  1TIQ A;  3SXN A;  1M4G A;  4U9Y A;  4F6A A;  2I00 A;  1M44 A;  2J8R A;  4Y49 B;  1I12 A;  4ONU A;  3DDD A;  2R7H A;  4MI4 A;  2OH1 A;  1YVK A;  3CXS A;  3EY5 A;  1OZP A;  1WK4 A;  1BOB A;  2JEV A;  1L0C A;  3C26 A;  3UY5 A;  1B87 A;  2B3V A;  2B5G B;  4CRZ B;  1Q2Y A;  4KOR A;  2PDO A;  1S7K A;  5I0C A;  3TFY A;  2PC1 A;  2VQY A;  2Q4Y A;  3VWE A;  5DWN A;  5ISV A;  2B3U A;  5F47 A;  1ON0 A;  2D4P A;  3PGP A;  1XIX A;  3BJ8 A;  3DNS A;  1N71 A;  1Z9U A;  1P4N A;  2P6F A;  1YR0 A;  4YRH A;  1M1D A;  3TOB A;  1WWZ A;  2FL4 A;  4II9 A;  2D4O A;  2JDC A;  1NSL A;  2VBQ A;  4DNC A;  2R8V A;  4HNX B;  2B58 A;  4IF5 A;  3S6G A;  2ZXV A;  3TT2 A;  1Q2C A;  5IB0 A;  5KTC A;  4AVC A;  2VZZ A;  3N7Z A;  1NMT A;  2Z10 A;  3GY9 A;  4U9Z A;  5J8C A;  4PK2 A;  2PRB A;  3GYA A;  3LOD A;  2FE7 A;  2JDD A;  2AE6 A;  1SQH A;  3G8W A;  1S7F A;  4E8O A;  4JJX A;  4H6U A;  4PSX A;  2WPW A;  4UBR A;  2BEI A;  4MBU A;  1VKC A;  1YX0 A;  4FD4 A;  2DXQ A;  4XPL A;  3FRM A;  3SXO A;  2GE3 A;  2VZY A;  4NSQ A;  2IL4 A;  5F48 A;  4E0A A;  1MJA A;  1IYL A;  1KUV A;  1YK3 A;  2Q44 A;  4M3S A;  4CAW A;  2C27 A;  5H86 A;  4YFJ A;  4MJ8 A;  3DR8 A;  2G0B A;  1QSN A;  3QB8 A;  4RS2 A;  3I3G A;  1VHS A;  1YRE A;  5HMN A;  2HQY A;  1QSO A;  4H6Z A;  3R95 A;  3W6X A;  3TO7 A;  3PZJ A;  2G3T A;  1K4J A;  5F49 A;  4KLW A;  1IID A;  2WPX A;  3OWC A;  4AG7 A;  3ZZI A;  4YGO A;  4AB7 A;  4L8A A;  4JXQ A;  3R9F A;  5F46 A;  2Q7B A;  3FB3 A;  4OAE A;  3S6F A;  1IB1 E;  3CXQ A;  2O28 A;  4KUA A;  5C82 A;  4JXR A;  1Z4R A;  4KVX A;  3E0K A;  1M4I A;  2FT0 A;  3TE4 A;  3FIX A;  4JLY A;  1IIC A;  2F5I A;  3IWG A;  3MGD A;  3EFA A; 
#chains in the Genus database with same CATH topology
 4XPK A;  1ELL P;  3IEH A;  3DSB A;  4R87 A;  1LAM A;  2CTC A;  2PCU A;  3FH4 A;  4MHD A;  5ELY A;  2G3A A;  2JLM A;  3PFO A;  3H4Q A;  2ZW5 A;  4KUB A;  2PJ1 A;  2PJ7 A;  3NH8 A;  2OB0 A;  2ATR A;  2Q7S A;  3RNZ A;  4KOS A;  2C6C A;  2V8V A;  2ZEE A;  2JBK A;  5HH1 A;  2FIA A;  2BO9 A;  3PB8 X;  2AFX A;  5A27 A;  4R3L A;  2EK8 A;  3R9E A;  2Z0Z A;  3A9L A;  4KLV A;  2J9A A;  2B4B A;  2C1C A;  2QYV A;  1S5K A;  3GKR A;  3IU2 A;  4PPZ A;  4CYN A;  3WR7 A;  3NA6 A;  4OKO A;  2VEZ A;  3FED A;  3WC5 A;  2OZG A;  3T90 A;  4MY3 A;  1AUG A;  5F09 A;  1RO5 A;  2O4H A;  2P6G A;  4EFD A;  5LYF A;  4U5Y A;  2QML A;  2POK A;  2PJ5 A;  3P2F A;  4NF1 A;  3LMS A;  2PJB A;  4A30 A;  5IX3 A;  5THW A;  2REF A;  3SJX A;  3SJG A;  1TF9 A;  5J8F A;  4R3K A;  3RBU A;  4PSW A;  2QIR A;  5CNP A;  3FXT A;  4LX9 A;  3T8W A;  2CNS A;  2YND A;  4R8F A;  4WJB A;  3W91 A;  4A33 A;  2PJ6 A;  5C88 A;  2NMT A;  4I49 A;  1QSM A;  3LD2 A;  4B11 A;  4FD6 A;  5K8O A;  3KR5 A;  1IU8 A;  3FJU A;  2QEC A;  4UA3 A;  4P10 A;  4LQG A;  4MHP A;  4H89 A;  4H2K A;  4A94 A;  2PJA A;  3HLP A;  5DS0 A;  5E96 A;  4OP4 A;  2PR8 A;  3H8E A;  1JQG A;  3D8P A;  4HKF A;  5D29 A;  1Z8L A;  4ZX8 A;  4C68 A;  6CPA A;  1BPN A;  2P0W A;  3V8I A;  4EWT A;  1OBR A;  2R1I A;  1Y9W A;  3D67 A;  3N5F A;  3PB4 X;  4P6Y A;  1XFO A;  4Q38 A;  4QB9 A;  4UCP A;  4JYW A;  3JVN A;  3CXP A;  3D7G A;  4NEX A;  1KUY A;  3KKW A;  2PJ0 A;  2K5T A;  2PE3 A;  2WUU A;  2V8H A;  3D2M A;  2Y0M A;  4X5K A;  4A2Z A;  4M85 A;  2VI7 A;  4BMH A;  3H8G A;  3FNC A;  4AVA A;  4F0X A;  4P4F A;  2RFH A;  1B6B A;  4NXY A;  4E2A A;  3MN8 A;  4JZ0 A;  2HC9 A;  2ZEN A;  2DPS A;  4IUS A;  3RZA A;  3BJ7 A;  3GLJ A;  4QVT A;  4B12 A;  3TOA A;  2J8M A;  4XNH C;  5AG4 A;  1BLL E;  4HNY B;  2GAN A;  5IV0 A;  3PB6 X;  1ZO0 A;  5KTD A;  4MRI A;  3KZW A;  3P2H A;  1XOV A;  2OU2 A;  3ZJ0 A;  3FMC A;  1QSR A;  2BUE A;  1NE9 A;  2OZH A;  1CPS A;  4R9M A;  5G21 A;  2FCK A;  2YGW A;  4L89 A;  5DWM A;  4K3N A;  1XEB A;  3IIB A;  4ZBG A;  1BO4 A;  3D3S A;  3G3S A;  2P6E A;  4R76 A;  3VWD A;  4AXV A;  1H8L A;  2R98 A;  1LRZ A;  4MFK A;  4OID A;  4B5P A;  2F7V A;  2GIV A;  3W6S A;  1KZF A;  4X2T A;  1DE4 C;  1TKF A;  3CPA A;  4AVB A;  2AJ6 A;  3SJE A;  2HV2 A;  4PXE A;  4UWI A;  5AGE A;  3FF3 A;  5FVJ A;  3D66 A;  1KWM A;  4A37 A;  1XE4 A;  1A2Z A;  5G20 A;  3TO6 A;  4UWJ A;  2GLF A;  3DR6 A;  1KUX A;  4KOY A;  3VH9 A;  4JD6 A;  4JWP A;  2PIZ A;  1S7N A;  4IAV A;  1AYE A;  4C7I A;  2GU2 A;  4ZY0 A;  4PXC A;  2JBJ A;  5H84 A;  4MFZ A;  2F8H A;  1UWY A;  4CAV A;  2CTB A;  2BL1 A;  3JRU A;  2Q04 A;  4PK3 A;  3D2P A;  2XEG A;  2ZW4 A;  1Y7E A;  1LOK A;  1Y9K A;  4KS9 A;  1CM0 A;  4LUA A;  1CG2 A;  2GFQ A;  1Q7L A;  4IK2 A;  2XEI A;  3R96 A;  3K2K A;  1TKH A;  4QUS A;  5JPH A;  4P4D A;  1YLO A;  1ZLI A;  2ZPA A;  3LAC A;  3NE7 A;  3VAT A;  2DF5 A;  4CGP A;  2ZW6 A;  1Z8X A;  3IGR A;  5J1Q A;  3QAH A;  4MXU A;  4MHZ A;  1S7L A;  4P4B A;  4KOU A;  1YW4 A;  3BI1 A;  4C2X A;  4CAX A;  3GUX A;  3NH5 A;  4F9U A;  2CNT A;  1FY7 A;  2FSR A;  2J8N A;  4UCM A;  3KQX A;  1RXT A;  3KQZ A;  1UFH A;  2PJ9 A;  1CJW A;  3IFE A;  4M6G A;  4RN7 A;  1V0C A;  4XPD C;  3S9M A;  3S9L A;  2ZOG A;  2PR1 A;  2PSW A;  2GRE A;  2IJZ A;  5BWA B;  4OAD A;  3EC4 A;  3F5B A;  2IMO A;  3MRU A;  3RYO A;  3V7Z A;  1XJO A;  2ZW7 A;  3F0A A;  3IU1 A;  3PBB A;  4YWY A;  4DJL A;  4EVY A;  5I4M A;  2Q0Y A;  4LQ6 A;  3FYN A;  1XF8 A;  3BI0 A;  4UFV A;  4ORF A;  1LCP A;  1ELM P;  2NYQ A;  3TTH A;  3D4U A;  2B4D B;  4OLL A;  2OR4 A;  1DTD A;  2HB6 A;  4KVM E;  4C7H A;  4FWU A;  2YNC A;  2AFZ A;  4NGR A;  4OIW A;  2YNC C;  2IQ6 A;  5EBV A;  1P0H A;  4KOV A;  4PXB A;  5AG6 A;  4Y49 C;  3B8G A;  4ZYQ A;  2X7B A;  1YGH A;  3SI0 A;  2ZEO A;  2KCW A;  2FXF A;  3BXM A;  3FBU A;  2Z3P A;  2JEW A;  1YW6 A;  3B3T A;  3JUW A;  3KHX A;  3B3W A;  4HPS A;  2ABZ A;  1Q2D A;  4B13 A;  1U6M A;  2Z11 A;  2CY2 A;  3H8F A;  1IYK A;  3EO4 A;  1XBU A;  3IC1 A;  1ARM A;  4P4I A;  3WC6 A;  2XEF A;  3EXN A;  2OZU A;  4K30 A;  3R9G A;  2EVN A;  5EMI A;  2REE A;  2B5G A;  2ARH A;  4KZT A;  4ZY2 A;  1ZLH A;  2PQ8 A;  4XNH B;  3RO0 A;  4CRY B;  4Z65 A;  1MK4 A;  1RTQ A;  1VHO A;  4CPA A;  2PJ8 A;  2B4D A;  1EE3 P;  1S3Z A;  3NFZ A;  2AFS A;  4BD9 A;  2I79 A;  2VL1 A;  4CS0 B;  3K9U A;  3SHP A;  4PV6 A;  1M4D A;  3R1K A;  1PUA A;  3PBE A;  4KOX A;  4Q36 A;  2Q51 A;  2HUZ A;  2NSM A;  1QQ9 A;  1YLE A;  1F57 A;  4FUU A;  4MCQ A;  4B5P B;  2CNM A;  4KOW A;  5JQ4 A;  2FS5 A;  2H5M A;  1GHE A;  1MJ9 A;  2EO8 A;  4UIB A;  1YVO A;  4CGL A;  4UFW A;  2BCO A;  3B3V A;  1AMP A;  2A4N A;  5G1Z A;  2AFW A;  4UFX A;  1M4L A;  1QST A;  4CYQ A;  3I9S A;  4AG9 A;  4KOT A;  5CBM A;  3K9T A;  3T9Y A;  2FIW A;  2VXK A;  1Z2L A;  2ZEG A;  4OC0 A;  1PU9 A;  1XMT A;  3B3C A;  3D7F A;  3SJF A;  4G1P A;  4QBJ A;  1VHE A;  4GS4 A;  3S6K A;  1F2O A;  4KSA A;  2FVG A;  4B10 A;  3KI9 A;  5EC4 A;  1S60 A;  4WWV A;  2ZEP A;  2OOT A;  5JGF A;  5HVH A;  4MY0 A;  3S6H A;  3TO9 A;  3HUV A;  1Y7R A;  2PJ3 A;  2BSW A;  4FD5 A;  5GCN A;  1YSJ A;  4HNW B;  4OC4 A;  2ANP A;  2Z3L A;  4F0Y A;  2ZEM A;  1Z4E A;  4J3G A;  2Q4V A;  4KVO E;  2ZEH A;  1I21 A;  3D7D A;  4UEE A;  4NCZ A;  1CX8 A;  3SI2 A;  1R57 A;  1GYT A;  3PP9 A;  4CAE A;  4XPD B;  1Z8W A;  1ZG9 A;  2RB7 A;  4R57 A;  4B5O A;  3IO1 A;  3PB9 X;  1HEE A;  3TCV A;  1I1D A;  3F8K A;  4A39 A;  4UCN A;  2WSA A;  1J4J A;  3KAS A;  5KTA A;  1HDQ A;  1MJB A;  2EUI A;  4FD7 A;  1PYT B;  4RI1 A;  1VGY A;  2RC4 A;  5HVF A;  3BLN A;  3B35 A;  2I3C A;  4QC6 A;  2GLJ A;  1XMB A;  1TIQ A;  3SXN A;  1CPX A;  1M4G A;  3TC8 A;  4U9Y A;  4C2Y A;  4P44 A;  4B14 A;  2QJ8 A;  4F6A A;  2I00 A;  1M44 A;  2J8R A;  5HXD A;  4Y49 B;  4CGO A;  1HDU A;  1I12 A;  1TF8 A;  4RUH A;  4UIA A;  1NSA A;  1R3N A;  4W9Y A;  3GB0 A;  2WZN A;  3QAY A;  4ONU A;  2BOA A;  2Q4Z A;  2R7H A;  3DDD A;  3VAR A;  2DEA A;  4MI4 A;  3RAM A;  4ZY1 A;  2OH1 A;  2CF4 A;  5LRK A;  1YVK A;  3CXS A;  3EY5 A;  1TKJ A;  3FX6 A;  1OZP A;  3WC7 A;  1WK4 A;  1BOB A;  2CIJ A;  1ARL A;  2JEV A;  1L0C A;  3C26 A;  3UY5 A;  4P45 A;  4PXD A;  1B87 A;  4GM5 A;  2PVV A;  3ISX A;  2B3V A;  3CZX A;  2B5G B;  5CPA A;  2ZED A;  3DGV A;  3B3S A;  4CRZ B;  1Q2Y A;  4KOR A;  2PDO A;  1S7K A;  3CT9 A;  5I0C A;  3TFY A;  4A32 A;  1IY7 A;  2PC1 A;  2Q4Y A;  2VQY A;  3VWE A;  5DWN A;  4UEF A;  2AFM A;  2EBJ A;  5ISV A;  5JM6 A;  2B3U A;  5F47 A;  2V8D A;  4DUK A;  1R43 A;  2AFU A;  1ON0 A;  3LWU A;  1VIX A;  2D4P A;  4OC1 A;  3PGP A;  7CPA A;  4YU9 A;  1LFW A;  1XIX A;  3NE8 A;  1CBX A;  1TXR A;  3BJ8 A;  3B7I A;  2ODF A;  3DNS A;  1QMU A;  1YME A;  4R7M A;  2ZEF A;  1N71 A;  1Z9U A;  1P4N A;  1LAN A;  2P6F A;  1YQE A;  1YR0 A;  4YRH A;  1M1D A;  3FEC A;  3TOB A;  1WWZ A;  3I1U A;  2FL4 A;  4II9 A;  2D4O A;  1IOF A;  2JDC A;  4CAF A;  5G22 A;  4MCS A;  1NSL A;  4PQA A;  2VBQ A;  4ZI6 A;  1Z5R A;  4MMO A;  2EWB A;  4DNC A;  2R8V A;  4HNX B;  2B58 A;  1CP6 A;  4NGN A;  4IF5 A;  4P4J A;  2ZXV A;  3S6G A;  3TT2 A;  1Q2C A;  4MFP A;  5IB0 A;  5K8P A;  3KHZ A;  5KTC A;  2Z3K A;  4A31 A;  4AVC A;  3S9N A;  2VZZ A;  2Q43 A;  3N7Z A;  1NMT A;  4BIN A;  2CXA A;  4F9V A;  2Z10 A;  3GY9 A;  3CDX A;  4U9Z A;  5J8C A;  1X12 A;  5K8N A;  4PK2 A;  4R6T A;  2PRB A;  3QNV A;  2EK9 A;  3GYA A;  4TNU A;  3LOD A;  4O23 A;  8CPA A;  2FE7 A;  3L2N A;  3PRT A;  4NGQ A;  5A28 A;  4CGN A;  2JDD A;  2PJ2 A;  4NGT A;  2AE6 A;  1SQH A;  2PJ4 A;  1FNO A;  2V8G A;  3IWE A;  3G8W A;  1S7F A;  4OC2 A;  4JJX A;  4MCR A;  4H6U A;  4OC3 A;  4E8O A;  5JH9 A;  2ZEL A;  2Z3O A;  3KL9 A;  4CYP A;  2ZOF A;  4X8I A;  5IB9 A;  4PSX A;  2WPW A;  5K8M A;  4OME A;  4TWE A;  4X3R A;  4DYO A;  3TX8 A;  4UBR A;  3V38 A;  4KSI A;  4CGM A;  2BEI A;  3IJ3 A;  3WAB A;  2C6G A;  1VKC A;  1YX0 A;  4MBU A;  1Z8T A;  4FD4 A;  4MFJ A;  2O53 A;  2DXQ A;  4XPL A;  3FRM A;  5LYI A;  3SXO A;  3SI1 A;  2GE3 A;  2VZY A;  1BAV A;  4NSQ A;  2WYR A;  2IL4 A;  5F48 A;  5LYL A;  4E0A A;  4MFQ A;  4A38 A;  1MJA A;  1Y0R A;  2PJC A;  1IYL A;  1KUV A;  1YK3 A;  2Q44 A;  3IWW A;  4M3S A;  2C27 A;  4CAW A;  4MCP A;  5H86 A;  4CYO A;  4MJ8 A;  4YFJ A;  3DR8 A;  1X10 A;  3CPX A;  1BPM A;  3BHX A;  2G0B A;  1QSN A;  3NH4 A;  4IHM A;  2PVW A;  3B2Y A;  3PB7 X;  4MHN A;  5LYD A;  3QB8 A;  4GXH A;  4RS2 A;  3I3G A;  1VHS A;  1YRE A;  4P4E A;  5HMN A;  1LAP A;  2HQY A;  4BBH A;  3PEI A;  4MFL A;  1QSO A;  3D68 A;  4H6Z A;  3WT4 A;  4F8Z A;  5AG5 A;  3GIU A;  3R95 A;  4NJQ A;  2YNE A;  3W6X A;  2C6P A;  1FT7 A;  1PCA A;  2PIY A;  3TO7 A;  5HVG A;  3PFE A;  3PZJ A;  1IOI A;  2G3T A;  2V77 A;  2G9D A;  3KR4 A;  1K4J A;  5F49 A;  4KLW A;  4B6Z A;  4M6I A;  5LRJ A;  4A95 A;  4NGP A;  5AG7 A;  1IID A;  4C2Z A;  2WPX A;  3OWC A;  1XRY A;  4AG7 A;  4UEZ A;  3ZZI A;  4YGO A;  4AB7 A;  4Q7A A;  4L8A A;  4JXQ A;  3H5Z A;  3R9F A;  4FAI A;  5F46 A;  1CP7 A;  2DPT A;  2PRQ A;  4NJR A;  2Q7B A;  3ISZ A;  3FB3 A;  4OAE A;  3FVL A;  2QVP A;  3S6F A;  1IB1 E;  1IGB A;  3CXQ A;  1F2P A;  5LRG A;  2AFO A;  4NGM A;  2Z3M A;  2O28 A;  4KSF A;  4UF4 A;  1Y0Y A;  4ZX9 A;  4KUA A;  1ZG8 A;  2Z3N A;  2XEJ A;  5C82 A;  4MHY A;  3D7H A;  3KGQ A;  3JTK A;  4JXR A;  3FEE A;  4EME A;  5D8N A;  4ONW A;  4ZGY B;  1Z4R A;  4KVX A;  3E0K A;  4OC5 A;  4FBE A;  1M4I A;  1ZG7 A;  2FT0 A;  3TE4 A;  4NFR A;  1JWQ A;  3FIX A;  4JLY A;  1IIC A;  4M6H A;  4NGS A;  2F5I A;  3IWG A;  3MGD A;  3EFA A;  3DLJ A; 
#chains in the Genus database with same CATH homology
 4XPK A;  3DSB A;  4R87 A;  4MHD A;  2G3A A;  2JLM A;  3H4Q A;  2ZW5 A;  4KUB A;  2OB0 A;  2ATR A;  4KOS A;  5HH1 A;  2FIA A;  5A27 A;  4R3L A;  3R9E A;  2Z0Z A;  3A9L A;  4KLV A;  2B4B A;  3IU2 A;  3GKR A;  1S5K A;  4CYN A;  3WR7 A;  2VEZ A;  2OZG A;  3T90 A;  4MY3 A;  1RO5 A;  2P6G A;  4U5Y A;  2QML A;  3P2F A;  4NF1 A;  4A30 A;  5IX3 A;  2REF A;  5J8F A;  4R3K A;  4PSW A;  2QIR A;  5CNP A;  3FXT A;  4LX9 A;  2CNS A;  2YND A;  3W91 A;  4A33 A;  5C88 A;  2NMT A;  4I49 A;  1QSM A;  3LD2 A;  4B11 A;  4FD6 A;  2QEC A;  4UA3 A;  4H89 A;  5E96 A;  2PR8 A;  3D8P A;  4HKF A;  4C68 A;  2P0W A;  3V8I A;  2R1I A;  1Y9W A;  4Q38 A;  4QB9 A;  4UCP A;  3JVN A;  3CXP A;  4NEX A;  1KUY A;  3KKW A;  2K5T A;  2WUU A;  3D2M A;  2Y0M A;  4X5K A;  4A2Z A;  4M85 A;  2VI7 A;  4BMH A;  4AVA A;  3FNC A;  4F0X A;  1B6B A;  4NXY A;  4E2A A;  2DPS A;  4IUS A;  4B12 A;  3BJ7 A;  4QVT A;  3TOA A;  2J8M A;  4XNH C;  5AG4 A;  4HNY B;  2GAN A;  5IV0 A;  5KTD A;  1ZO0 A;  3P2H A;  2OU2 A;  3ZJ0 A;  1QSR A;  2BUE A;  1NE9 A;  2OZH A;  4R9M A;  5G21 A;  2FCK A;  2YGW A;  4L89 A;  5DWM A;  1XEB A;  4ZBG A;  1BO4 A;  3D3S A;  3G3S A;  2P6E A;  3VWD A;  4B5P A;  2R98 A;  1LRZ A;  4MFK A;  2GIV A;  3W6S A;  1KZF A;  4AVB A;  2AJ6 A;  2HV2 A;  4UWI A;  5AGE A;  5FVJ A;  1XE4 A;  5G20 A;  3TO6 A;  4UWJ A;  3DR6 A;  1KUX A;  4KOY A;  4JD6 A;  4JWP A;  1S7N A;  4C7I A;  5H84 A;  4MFZ A;  4CAV A;  2BL1 A;  2Q04 A;  4PK3 A;  3D2P A;  2ZW4 A;  1Y9K A;  4KS9 A;  1CM0 A;  4LUA A;  3R96 A;  5JPH A;  4QUS A;  2ZPA A;  4CGP A;  3NE7 A;  2ZW6 A;  3IGR A;  3QAH A;  1S7L A;  4KOU A;  4CAX A;  4C2X A;  2CNT A;  1FY7 A;  2FSR A;  2J8N A;  4UCM A;  1RXT A;  1UFH A;  1CJW A;  4XPD C;  1V0C A;  2PR1 A;  2PSW A;  5BWA B;  4OAD A;  3EC4 A;  3F5B A;  3RYO A;  2ZW7 A;  3F0A A;  3IU1 A;  4EVY A;  2Q0Y A;  3FYN A;  1XF8 A;  4UFV A;  4ORF A;  3TTH A;  2B4D B;  4OLL A;  4KVM E;  4C7H A;  2YNC A;  2YNC C;  5EBV A;  1P0H A;  4KOV A;  5AG6 A;  4Y49 C;  3B8G A;  2X7B A;  1YGH A;  2KCW A;  2FXF A;  3FBU A;  2Z3P A;  3JUW A;  1Q2D A;  4B13 A;  1U6M A;  2Z11 A;  2CY2 A;  1IYK A;  3EO4 A;  3EXN A;  2OZU A;  4K30 A;  3R9G A;  2EVN A;  2REE A;  2B5G A;  2ARH A;  4KZT A;  2PQ8 A;  4XNH B;  4CRY B;  1MK4 A;  2B4D A;  1S3Z A;  2I79 A;  4CS0 B;  3K9U A;  3SHP A;  4PV6 A;  1M4D A;  3R1K A;  1PUA A;  4KOX A;  4Q36 A;  2HUZ A;  1YLE A;  4B5P B;  2CNM A;  4KOW A;  5JQ4 A;  2FS5 A;  2H5M A;  1GHE A;  1MJ9 A;  4CGL A;  1YVO A;  4UFW A;  2A4N A;  5G1Z A;  4UFX A;  1QST A;  4CYQ A;  3I9S A;  4AG9 A;  4KOT A;  3T9Y A;  2FIW A;  2VXK A;  1PU9 A;  1XMT A;  4QBJ A;  4GS4 A;  3S6K A;  4KSA A;  4B10 A;  5EC4 A;  1S60 A;  4MY0 A;  3S6H A;  3TO9 A;  1Y7R A;  2BSW A;  4FD5 A;  5GCN A;  4HNW B;  2Z3L A;  4F0Y A;  1Z4E A;  4J3G A;  2Q4V A;  4KVO E;  1I21 A;  4NCZ A;  1R57 A;  3PP9 A;  4CAE A;  4XPD B;  4R57 A;  4B5O A;  3TCV A;  1I1D A;  3F8K A;  4UCN A;  2WSA A;  1J4J A;  5KTA A;  1MJB A;  2EUI A;  4FD7 A;  4RI1 A;  2RC4 A;  3BLN A;  4QC6 A;  1TIQ A;  3SXN A;  1M4G A;  4U9Y A;  4C2Y A;  4B14 A;  4F6A A;  2I00 A;  1M44 A;  2J8R A;  4Y49 B;  4CGO A;  1I12 A;  4ONU A;  3DDD A;  2R7H A;  4MI4 A;  2OH1 A;  1YVK A;  3CXS A;  3EY5 A;  1OZP A;  1WK4 A;  1BOB A;  2JEV A;  1L0C A;  3C26 A;  3UY5 A;  1B87 A;  2B3V A;  2B5G B;  4CRZ B;  1Q2Y A;  4KOR A;  2PDO A;  1S7K A;  5I0C A;  3TFY A;  4A32 A;  2PC1 A;  2VQY A;  2Q4Y A;  3VWE A;  5DWN A;  5ISV A;  2B3U A;  5F47 A;  1ON0 A;  2D4P A;  3PGP A;  1XIX A;  3BJ8 A;  3DNS A;  1N71 A;  1Z9U A;  1P4N A;  2P6F A;  1YR0 A;  4YRH A;  1M1D A;  3TOB A;  1WWZ A;  2FL4 A;  4II9 A;  2D4O A;  2JDC A;  4CAF A;  5G22 A;  1NSL A;  2VBQ A;  4DNC A;  2R8V A;  4HNX B;  2B58 A;  4IF5 A;  3S6G A;  2ZXV A;  3TT2 A;  1Q2C A;  4MFP A;  5IB0 A;  5KTC A;  2Z3K A;  4A31 A;  4AVC A;  2VZZ A;  3N7Z A;  1NMT A;  2CXA A;  2Z10 A;  3GY9 A;  4U9Z A;  5J8C A;  4PK2 A;  2PRB A;  3GYA A;  3LOD A;  2FE7 A;  5A28 A;  4CGN A;  2JDD A;  2AE6 A;  1SQH A;  3IWE A;  3G8W A;  1S7F A;  4E8O A;  4JJX A;  4H6U A;  2Z3O A;  4CYP A;  4PSX A;  2WPW A;  4UBR A;  4CGM A;  2BEI A;  4MBU A;  1VKC A;  1YX0 A;  4FD4 A;  4MFJ A;  2DXQ A;  4XPL A;  3FRM A;  3SXO A;  2GE3 A;  2VZY A;  4NSQ A;  2IL4 A;  5F48 A;  4E0A A;  4MFQ A;  1MJA A;  1IYL A;  1KUV A;  1YK3 A;  2Q44 A;  4M3S A;  4CAW A;  2C27 A;  4CYO A;  5H86 A;  4YFJ A;  4MJ8 A;  3DR8 A;  2G0B A;  1QSN A;  3QB8 A;  4RS2 A;  3I3G A;  1VHS A;  1YRE A;  5HMN A;  2HQY A;  4BBH A;  4MFL A;  1QSO A;  4H6Z A;  5AG5 A;  3R95 A;  3W6X A;  2YNE A;  3TO7 A;  3PZJ A;  2G3T A;  1K4J A;  5F49 A;  4KLW A;  4A95 A;  5AG7 A;  1IID A;  4C2Z A;  2WPX A;  3OWC A;  4AG7 A;  3ZZI A;  4YGO A;  4AB7 A;  4L8A A;  4JXQ A;  3H5Z A;  3R9F A;  5F46 A;  2DPT A;  2Q7B A;  3FB3 A;  4OAE A;  3S6F A;  1IB1 E;  3CXQ A;  2Z3M A;  2O28 A;  4KSF A;  4KUA A;  2Z3N A;  5C82 A;  3JTK A;  4JXR A;  4ZGY B;  1Z4R A;  4KVX A;  3E0K A;  1M4I A;  2FT0 A;  3TE4 A;  3FIX A;  4JLY A;  1IIC A;  2F5I A;  3IWG A;  3MGD A;  3EFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...