2ZEDA

Crystal structure of the human glutaminyl cyclase mutant s160a at 1.7 angstrom resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDAAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2007-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2zedA00
4OKOA 3KL9A 2O53A 1KWMA 2V77A 4NGNA 3B3TA 1DE4C 2PJ5A 3VH9A 4ZY0A 2PJ3A 1PCAA 3CDXA 1XBUA 3V7ZA 4K3NA 4Q7AA 2XEJA 3KR4A 2V8GA 5D8NA 3PRTA 4PXBA 3FMCA 4B6ZA 3SI0A 3NH8A 4PPZA 6CPAA 2QVPA 2JEWA 3WC5A 4ZI6A 1VHOA 3CPXA 3SJFA 2O4HA 3PBEA 4OC0A 3D68A 2F8HA 3B35A 4MRIA 3L2NA 4ZX8A 4OC4A 1FT7A 2Q4ZA 4OC2A 4X3RA 4MMOA 2XEIA 5HVHA 5JM6A 4MCSA 1LFWA 1ZG9A 2AFMA 4A39A 4UEEA 1HEEA 3D66A 4UIBA 2FVGA 4F9UA 2CIJA 2OR4A 1H8LA 2IQ6A 3NFZA 5LYIA 4EWTA 2C6PA 4P44A 3WC7A 2ZELA 2IJZA 2ZOFA 4FWUA 2V8VA 4TWEA 2AFUA 4KSIA 3RZAA 5K8PA 5LRKA 4NJRA 1ZG7A 8CPAA 2EK8A 2XEFA 1Y0RA 2G9DA 3H8GA 1Z8LA 1CX8A 1CG2A 4F9VA 4OMEA 3I1UA 3NH5A 1QMUA 3KR5A 2HC9A 3PFOA 1F57A 5LYFA 3K2KA 3N5FA 4R76A 4TNUA 1NSAA 3PB6X 3KGQA 1TKJA 3DGVA 5LYLA 2ZEEA 2AFXA 1XRYA 1YSJA 1ZLHA 4F8ZA 2C6CA 3KHZA 2ZEGA 2DEAA 1Y7EA 1Z5RA 3T8WA 2AFWA 1ZG8A 2V8DA 3GLJA 3JRUA 4WJBA 3FECA 5I4MA 4OC1A 4MHYA 3FX6A 5THWA 4P4IA 2PJ6A 2BOAA 4R8FA 1ARLA 4P4FA 4DUKA 2NSMA 4GM5A 2CF4A 2BCOA 1LOKA 4PQAA 3S9LA 3RBUA 3KHXA 1LAPA 5LRJA 3PB7X 5CPAA 3SJXA 4IK2A 4PXCA 1YLOA 3IWWA 3ISXA 3D4UA 3IO1A 2GLJA 1TF8A 2PJ1A 1CBXA 1BLLE 1VGYA 4A37A 5IB9A 3FH4A 1LCPA 2JBJA 3CPAA 4NGPA 2ABZA 1R3NA 1BAVA 2XEGA 1GYTA 2PE3A 2IMOA 3WC6A 1CPXA 4P4EA 3B3WA 5DS0A 3D7FA 4Z65A 3D7HA 4EMEA 4P4JA 4MCRA 1JQGA 4W9YA 5HXDA 2ZEMA 2JBKA 2AFOA 4DYOA 4PXDA 4FBEA 3B3VA 4UEFA 1CP7A 2C1CA 3SI1A 3VATA 5ELYA 2GREA 5CBMA 2PJ2A 3PFEA 3B7IA 3IJ3A 1TXRA 4MCPA 1AYEA 4OC5A 4YWYA 3SI2A 3QNVA 2PJ9A 3FF3A 5JGFA 1RTQA 2AFSA 1CP6A 3PB4X 2RB7A 1UWYA 2J9AA 3VARA 4MHPA 3KZWA 4A94A 2ZEOA 4R7MA 2EWBA 4FUUA 1F2OA 4UIAA 2PCUA 3HLPA 3NH4A 2PIZA 4BD9A 1HDQA 3MN8A 1EE3P 2WZNA 4ZYQA 5HVGA 3SJGA 3ISZA 1LAMA 1PYTB 1OBRA 2QYVA 2PJBA 1XMBA 4JZ0A 2POKA 1ARMA 2VL1A 5HVFA 4IAVA 5LRGA 3H8FA 1ELLP 3FEEA 3WT4A 3FVLA 3PEIA 3S9NA 2BO9A 3KASA 2WYRA 3IC1A 2PJCA 3NA6A 1FNOA 2RFHA 4OC3A 1TKHA 3FJUA 3BXMA 3TC8A 1DTDA 1YW6A 4RUHA 5J1QA 4NGRA 1TF9A 3IFEA 2PJ4A 3MRUA 5K8NA 2AFZA 1XFOA 2PVVA 4DJLA 3GUXA 1BPNA 3S9MA 4P6YA 7CPAA 1Y0YA 2F7VA 4WWVA 1QQ9A 2Q51A 3IEHA 4P4BA 2ZOGA 5JH9A 3V38A 4ZY1A 2OOTA 4X8IA 4JYWA 3IIBA 4UF4A 4IHMA 2ZEDA 4ONWA 4R6TA 2CTCA 3H8EA 3BI1A 3B3SA 1Z2LA 3B3CA 2GU2A 3PB8X 2PJAA 1VHEA 2V8HA 4UEZA 2GLFA 3BHXA 1IGBA 3LWUA 4CPAA 2Q43A 2QJ8A 4MHNA 3WABA 1R43A 2C6GA 4ZX9A 4YU9A 3DLJA 4NGSA 4P4DA 4MHZA 4AXVA 1YMEA 4NGQA 4P10A 5F09A 4ZY2A 5K8MA 4OIWA 1YW4A 4A38A 1XJOA 4NFRA 4NGMA 1Q7LA 3D67A 4O23A 3GB0A 2ZEFA 3KI9A 1ZLIA 4NGTA 2ZEHA 3FEDA 5D29A 2ANPA 4LQGA 4G1PA 4PXEA 2PJ7A 4MCQA 1F2PA 1IY7A 1BPMA 3CT9A 3TX8A 3KQZA 4OP4A 3K9TA 2EK9A 2CTBA 4MXUA 2I3CA 2PIYA 2PJ8A 4FAIA 4EFDA 2HB6A 3BI0A 1M4LA 1ELMP 4X2TA 4NJQA 2ZENA 2PVWA 3B2YA 3SJEA 3PB9X 1HDUA 5LYDA 3RAMA 4OIDA 1TKFA 3PBBA 3LMSA 2ZEPA 3HUVA 1VIXA 3KQXA 4P45A 1CPSA 1AMPA 2PJ0A 3D7GA 3D7DA 4H2KA 2PRQA 1LANA 2NYQA 5K8OA
chains in the Genus database with same CATH superfamily
4OKOA 5I0CA 4BBHA 3KL9A 2O53A 3SXNA 4QB9A 1KWMA 1IOFA 1X12A 1NE9A 2V77A 2BL1A 1Z4EA 5EMIA 2EBJA 2YNCC 4LUAA 3B3TA 1M4DA 3MGDA 4NXYA 3N7ZA 4NGNA 4UCPA 5GCNA 1DE4C 2PJ5A 3VH9A 4ZY0A 1YVOA 2PJ3A 1PCAA 3CDXA 3BJ8A 3H5ZA 2A4NA 1XBUA 2ZW6A 3V7ZA 3R9GA 4K3NA 4Q7AA 5AGEA 1WWZA 2XEJA 3KR4A 4M6HA 2FL4A 4NEXA 3W6SA 2V8GA 4CAXA 3QB8A 5D8NA 2REFA 3PRTA 4PXBA 3FMCA 1NSLA 1M4GA 4B6ZA 1QSOA 3SI0A 3NH8A 4HKFA 4AG7A 4PPZA 4RI1A 4NSQA 2EUIA 6CPAA 2QVPA 2DPTA 2JEWA 1IU8A 3WC5A 4ZI6A 1VHOA 5HH1A 1S7LA 2PQ8A 5F46A 2Z3PA 3CPXA 4IF5A 3SJFA 2O4HA 4XPKA 2J8MA 5G1ZA 3JUWA 3PBEA 4Q38A 4OC0A 3CXSA 3UY5A 2B5GA 4C2YA 3D68A 2F8HA 3B35A 4MRIA 4B12A 3L2NA 3QAYA 4JJXA 4ZX8A 2I79A 1J4JA 2GFQA 1M44A 2ZW7A 5G22A 4OC4A 1FT7A 2Q4YA 2Q4ZA 4OC2A 1XEBA 4X3RA 2IL4A 4MMOA 4KOYA 3R9FA 2XEIA 1NMTA 5F47A 5HVHA 5JM6A 4A33A 2H5MA 2Z10A 4U5YA 2VZZA 3F0AA 4MCSA 1LFWA 1ZG9A 5EBVA 3GYAA 2AFMA 3DDDA 5AG6A 4UEEA 4A39A 4M6GA 4KLVA 3T9YA 1HEEA 2G3AA 2Z3MA 3D66A 4KOUA 1QSNA 1CM0A 4KVME 4UIBA 3F8KA 1S60A 4XPLA 4FD7A 2FVGA 4AVBA 2CIJA 1LRZA 2OR4A 3TO6A 4F9UA 1H8LA 2IQ6A 3NFZA 3T90A 5LYIA 4FD6A 2HV2A 4UFWA 5KTDA 4EWTA 3FB3A 4CS0B 1SQHA 2JEVA 2C6PA 2RC4A 4P44A 3WC7A 2ZELA 5C88A 2IJZA 2ZOFA 4FWUA 2V8VA 4TWEA 3TE4A 4E8OA 4IUSA 2AFUA 4B13A 4KOTA 4KSIA 3TFYA 3RZAA 1IOIA 5K8PA 5LRKA 2AE6A 3IU2A 5C82A 4NJRA 4E2AA 1ZG7A 8CPAA 2EK8A 2XEFA 1BOBA 1Y0RA 2G9DA 1S7FA 3H8GA 4CRYB 1IICA 2P6FA 1P4NA 3PZJA 1Z8LA 4Q36A 1CX8A 1CG2A 5KTCA 4F9VA 1Z4RA 4OMEA 3I1UA 3NH5A 1QMUA 1I21A 2FS5A 1VHSA 2FE7A 3W91A 4CAWA 3R96A 3KR5A 2HC9A 3PFOA 1F57A 2Q7BA 3BLNA 1MJBA 3K2KA 5LYFA 3N5FA 2ZW5A 2OZUA 4R76A 5BWAB 3CXPA 4QBJA 4TNUA 1NSAA 2P6GA 4M6IA 3PB6X 2BSWA 1MJAA 3KGQA 4F0YA 2B5GB 3NE7A 5IB0A 1TKJA 1UFHA 2YNDA 3QAHA 3DGVA 2J8RA 5LYLA 1M1DA 2ZEEA 2AFXA 2ODFA 4UFXA 3R1KA 1XRYA 3FXTA 2JDCA 4KOVA 4JWPA 4OADA 1YSJA 2D4OA 4MFQA 4AB7A 1ZLHA 3TO9A 4F8ZA 2C6CA 2R7HA 3KHZA 2GIVA 2ZEGA 4AVAA 5G20A 2DEAA 1Y7EA 3JVNA 2B58A 2GE3A 1Z5RA 4KORA 3FIXA 3T8WA 2AFWA 1ZG8A 1IIDA 4JLYA 2V8DA 3GLJA 4JD6A 3JRUA 4WJBA 1S7KA 3FECA 5I4MA 1S7NA 4OC1A 4R57A 4MHYA 3FX6A 1PUAA 2QIRA 5DWNA 5THWA 3ZZIA 4P4IA 4H6ZA 2PJ6A 2BOAA 4EVYA 4U9YA 1OZPA 5H86A 4R8FA 4UWJA 1ARLA 2Z11A 5E96A 3DR6A 4P4FA 4DUKA 2DPSA 4MHDA 2NSMA 2HQYA 4GM5A 2CF4A 1MJ9A 2BCOA 1LOKA 2DF5A 4AVCA 4OLLA 4FD4A 4PQAA 5IX3A 2I00A 2NMTA 3S9LA 4RN7A 1L0CA 1Z8WA 3RBUA 3KHXA 2ARHA 4KLWA 1LAPA 1AUGA 2C27A 4ONUA 3VWDA 1MK4A 2K5TA 1V0CA 5LRJA 3PB7X 4CGPA 5CPAA 3TOAA 4JXQA 3SJXA 2ZW4A 4IK2A 4F6AA 4PXCA 4NCZA 4QVTA 2CXAA 4A95A 1YLOA 4LX9A 4U9ZA 4I49A 3IWWA 2R8VA 2FIAA 3VWEA 3ISXA 3D4UA 3S6HA 2PDOA 3CXQA 3IO1A 4BMHA 2ATRA 2GLJA 1TF8A 2PJ1A 1CBXA 4MBUA 1BLLE 1VGYA 1A2ZA 4A37A 5IB9A 3FH4A 5K8OA 3V8IA 1LCPA 4YFJA 2VI7A 2BEIA 2JBJA 2ZPAA 4YRHA 3DNSA 2R1IA 2FT0A 3CPAA 4C68A 3GIUA 4NGPA 2ABZA 1WK4A 4MY0A 3TCVA 1R3NA 1BAVA 1KUYA 2XEGA 3FBUA 3GKRA 1GYTA 2PE3A 2P6EA 2IMOA 3WC6A 5AG4A 1S3ZA 2CNSA 3SXOA 1CPXA 4OAEA 4KZTA 1Z8XA 3B3WA 4P4EA 5DS0A 3D7FA 4Z65A 3D7HA 1QSTA 2PR1A 4P4JA 1XOVA 4B5OA 4EMEA 4MCRA 3B8GA 2Z0ZA 1JQGA 4W9YA 5HXDA 1KUVA 1R57A 2B4DB 4C2ZA 4HPSA 2ZEMA 2JBKA 3R9EA 4A30A 4DNCA 2AFOA 4YGOA 4PXDA 4CGLA 4DYOA 4FBEA 2OH1A 3IWGA 4KVXA 3LACA 4E0AA 2J8NA 1YQEA 3B3VA 3ZJ0A 2Q4VA 4UEFA 4CAVA 1CP7A 2FIWA 2C1CA 3SI1A 3H4QA 3VATA 5ELYA 2GREA 3DR8A 4KSFA 2PJ2A 3I9SA 3PFEA 5CBMA 3B7IA 3IJ3A 5JPHA 4UA3A 1TXRA 4MCPA 5AG7A 4XNHB 4MFZA 1AYEA 1IYLA 1Z8TA 4OC5A 2EO8A 4HNXB 2B3UA 4YWYA 5AG5A 3SI2A 3QNVA 2PJ9A 3FF3A 5JGFA 1RTQA 4NF1A 1Q2YA 3I3GA 3TT2A 2VEZA 2BUEA 3IWEA 4KVOE 4B10A 3WR7A 1U6MA 2AFSA 2VZYA 1CP6A 4PSWA 3SHPA 3PB4X 5FVJA 4PV6A 2RB7A 1UWYA 2J9AA 3VARA 4QUSA 3S6KA 2WSAA 4MHPA 3KZWA 2JLMA 2GANA 4A94A 2DXQA 2ZEOA 3CZXA 2EWBA 3DSBA 4FUUA 4R7MA 1F2OA 4UBRA 4UIAA 4BINA 2Q7SA 5J8CA 2PCUA 3HLPA 3NH4A 3TTHA 5A27A 2PIZA 4KUBA 4CYPA 4XNHC 4BD9A 1HDQA 3C26A 3MN8A 4R3LA 1IYKA 1EE3P 2OU2A 2WZNA 4ZYQA 5HVGA 2REEA 1RXTA 2X7BA 3ISZA 3SJGA 1LAMA 1B6BA 1PYTB 1OBRA 2OZHA 2QYVA 2R98A 4B11A 5JQ4A 2PJBA 1XMBA 4JZ0A 2POKA 3D3SA 4CYQA 1ARMA 2Z3KA 4CAFA 2VL1A 5HVFA 4IAVA 2VBQA 5LRGA 2O28A 1M4IA 1YVKA 3H8FA 1ELLP 3NE8A 4R87A 3FEEA 3WT4A 1Y9KA 3P2HA 4B14A 3FVLA 3PEIA 3S9NA 2BO9A 1I12A 1N71A 3KASA 1YGHA 2WYRA 4MFJA 1ZO0A 3IC1A 5EC4A 3RO0A 2PJCA 3NA6A 2WPWA 3R95A 4ZGYB 1FNOA 1X10A 2RFHA 4OC3A 4CRZB 1Z9UA 2HUZA 5F48A 4UFVA 4HNWB 5DWMA 3GY9A 1TKHA 2CNMA 4GXHA 3FJUA 3BXMA 4CGOA 3TC8A 1JWQA 5H84A 1DTDA 1YW6A 4RUHA 4UWIA 5A28A 2PR8A 2G3TA 5J1QA 4C2XA 3E0KA 4FD5A 3RNZA 4NGRA 4CGMA 3D2MA 4HNYB 2PC1A 3P2FA 1TF9A 3IFEA 3F5BA 2PJ4A 4C7HA 4R9MA 3MRUA 5K8NA 2AFZA 3OWCA 1XFOA 4X5KA 3RYOA 2PVVA 2KCWA 3W6XA 4DJLA 2JDDA 3GUXA 1BPNA 1Q2CA 3S9MA 4P6YA 7CPAA 1Y0YA 2YNEA 2F7VA 1BO4A 4A31A 5J8FA 4WWVA 1I1DA 1QQ9A 4XPDB 1KZFA 2Q51A 2EVNA 3IEHA 2VXKA 4P4BA 4A2ZA 2ZOGA 3EFAA 3D8PA 4II9A 1YREA 5JH9A 3V38A 3KKWA 1QSMA 4ZY1A 3K9UA 2OOTA 1KUXA 4JYWA 3IIBA 4UF4A 4IHMA 4L8AA 4X8IA 4M85A 4ZBGA 2OZGA 2D4PA 2ZEDA 4ONWA 3TO7A 4PSXA 4R6TA 2CTCA 3H8EA 5F49A 3BI1A 3B3SA 1Z2LA 2Q04A 2FSRA 3B3CA 3PP9A 4C7IA 5KTAA 2GU2A 3PB8X 2PJAA 1VHEA 3A9LA 4MJ8A 1Y7RA 2OB0A 2V8HA 1XIXA 4UEZA 2Z3LA 1XMTA 1GHEA 3D2PA 2GLFA 1VKCA 3S6FA 3G3SA 4XPDC 2YNCA 3BHXA 1IGBA 4F0XA 5ISVA 1Q2DA 3LWUA 4CPAA 4H6UA 2Q43A 3BJ7A 2QJ8A 4MY3A 4MHNA 3WABA 5IV0A 1R43A 3FRMA 4B5PA 3FNCA 2C6GA 1YR0A 3TOBA 1ON0A 1YK3A 3DLJA 4L89A 2QMLA 4YU9A 4ZX9A 4NGSA 4QC6A 4P4DA 4JXRA 4MHZA 4AXVA 2Z3NA 4UCNA 1YMEA 4NGQA 1B87A 5HMNA 4P10A 5F09A 4ZY2A 4KSAA 4ORFA 3S6GA 5K8MA 4OIWA 4PK2A 1YW4A 4A38A 1CJWA 2Q44A 4KUAA 2CNTA 2AJ6A 3IGRA 5G21A 4LQ6A 2PRBA 3G8WA 2B3VA 1XJOA 3JTKA 4NFRA 2PSWA 3EC4A 1Q7LA 4NGMA 3D67A 4O23A 3GB0A 2ZEFA 3KI9A 3EY5A 1ZLIA 4NGTA 4MFKA 2ZEHA 3FEDA 4A32A 2VQYA 1FY7A 1IB1E 5D29A 2ANPA 4LQGA 4PK3A 4K30A 1RO5A 4G1PA 4M3SA 4PXEA 2PJ7A 4MCQA 1F2PA 4Y49B 3EXNA 1IY7A 4J3GA 4MI4A 2Y0MA 2B4BA 1BPMA 2QECA 4RS2A 4KOXA 1QSRA 3CT9A 3TX8A 2WPXA 2F5IA 1XE4A 1PU9A 3KQZA 2Q0YA 4CYOA 4KS9A 4UCMA 1S5KA 4CYNA 4OP4A 4CAEA 4H89A 3K9TA 3EO4A 2EK9A 4MFPA 1P0HA 2CY2A 1K4JA 2CTBA 2I3CA 2PIYA 2PJ8A 4MXUA 4EFDA 4FAIA 1TIQA 2Z3OA 2FCKA 3LODA 2HB6A 3BI0A 3PGPA 1XF8A 1M4LA 2WUUA 1ELMP 4X2TA 4R3KA 4Y49C 4NJQA 4GS4A 2ZENA 2PVWA 3B2YA 3SJEA 2P0WA 3LD2A 3PB9X 2G0BA 1HDUA 5LYDA 4B5PB 3RAMA 3IU1A 5CNPA 1Y9WA 4OIDA 1TKFA 4AG9A 1YLEA 3LMSA 2FXFA 2ZEPA 1VIXA 3HUVA 3PBBA 4MFLA 2YGWA 1YX0A 3KQXA 4P45A 1CPSA 4KOSA 1AMPA 2PJ0A 3D7GA 3D7DA 4KOWA 4H2KA 2PRQA 4CGNA 1LANA 3FYNA 2NYQA 2ZXVA 2B4DA
chains in the Genus database with same CATH topology
4OKOA 3KL9A 2O53A 1KWMA 2V77A 4NGNA 3B3TA 1DE4C 2PJ5A 3VH9A 4ZY0A 2PJ3A 1PCAA 3CDXA 1XBUA 3V7ZA 4K3NA 4Q7AA 2XEJA 3KR4A 2V8GA 5D8NA 3PRTA 4PXBA 3FMCA 4B6ZA 3SI0A 3NH8A 4PPZA 6CPAA 2QVPA 2JEWA 3WC5A 4ZI6A 1VHOA 3CPXA 3SJFA 2O4HA 3PBEA 4OC0A 3D68A 2F8HA 3B35A 4MRIA 3L2NA 4ZX8A 4OC4A 1FT7A 2Q4ZA 4OC2A 4X3RA 4MMOA 2XEIA 5HVHA 5JM6A 4MCSA 1LFWA 1ZG9A 2AFMA 4A39A 4UEEA 1HEEA 3D66A 4UIBA 2FVGA 4F9UA 2CIJA 2OR4A 1H8LA 2IQ6A 3NFZA 5LYIA 4EWTA 2C6PA 4P44A 3WC7A 2ZELA 2IJZA 2ZOFA 4FWUA 2V8VA 4TWEA 2AFUA 4KSIA 3RZAA 5K8PA 5LRKA 4NJRA 1ZG7A 8CPAA 2EK8A 2XEFA 1Y0RA 2G9DA 3H8GA 1Z8LA 1CX8A 1CG2A 4F9VA 4OMEA 3I1UA 3NH5A 1QMUA 3KR5A 2HC9A 3PFOA 1F57A 5LYFA 3K2KA 3N5FA 4R76A 4TNUA 1NSAA 3PB6X 3KGQA 1TKJA 3DGVA 5LYLA 2ZEEA 2AFXA 1XRYA 1YSJA 1ZLHA 4F8ZA 2C6CA 3KHZA 2ZEGA 2DEAA 1Y7EA 1Z5RA 3T8WA 2AFWA 1ZG8A 2V8DA 3GLJA 3JRUA 4WJBA 3FECA 5I4MA 4OC1A 4MHYA 3FX6A 5THWA 4P4IA 2PJ6A 2BOAA 4R8FA 1ARLA 4P4FA 4DUKA 2NSMA 4GM5A 2CF4A 2BCOA 1LOKA 4PQAA 3S9LA 3RBUA 3KHXA 1LAPA 5LRJA 3PB7X 5CPAA 3SJXA 4IK2A 4PXCA 1YLOA 3IWWA 3ISXA 3D4UA 3IO1A 2GLJA 1TF8A 2PJ1A 1CBXA 1BLLE 1VGYA 4A37A 5IB9A 3FH4A 1LCPA 2JBJA 3CPAA 4NGPA 2ABZA 1R3NA 1BAVA 2XEGA 1GYTA 2PE3A 2IMOA 3WC6A 1CPXA 4P4EA 3B3WA 5DS0A 3D7FA 4Z65A 3D7HA 4EMEA 4P4JA 4MCRA 1JQGA 4W9YA 5HXDA 2ZEMA 2JBKA 2AFOA 4DYOA 4PXDA 4FBEA 3B3VA 4UEFA 1CP7A 2C1CA 3SI1A 3VATA 5ELYA 2GREA 5CBMA 2PJ2A 3PFEA 3B7IA 3IJ3A 1TXRA 4MCPA 1AYEA 4OC5A 4YWYA 3SI2A 3QNVA 2PJ9A 3FF3A 5JGFA 1RTQA 2AFSA 1CP6A 3PB4X 2RB7A 1UWYA 2J9AA 3VARA 4MHPA 3KZWA 4A94A 2ZEOA 4R7MA 2EWBA 4FUUA 1F2OA 4UIAA 2PCUA 3HLPA 3NH4A 2PIZA 4BD9A 1HDQA 3MN8A 1EE3P 2WZNA 4ZYQA 5HVGA 3SJGA 3ISZA 1LAMA 1PYTB 1OBRA 2QYVA 2PJBA 1XMBA 4JZ0A 2POKA 1ARMA 2VL1A 5HVFA 4IAVA 5LRGA 3H8FA 1ELLP 3FEEA 3WT4A 3FVLA 3PEIA 3S9NA 2BO9A 3KASA 2WYRA 3IC1A 2PJCA 3NA6A 1FNOA 2RFHA 4OC3A 1TKHA 3FJUA 3BXMA 3TC8A 1DTDA 1YW6A 4RUHA 5J1QA 4NGRA 1TF9A 3IFEA 2PJ4A 3MRUA 5K8NA 2AFZA 1XFOA 2PVVA 4DJLA 3GUXA 1BPNA 3S9MA 4P6YA 7CPAA 1Y0YA 2F7VA 4WWVA 1QQ9A 2Q51A 3IEHA 4P4BA 2ZOGA 5JH9A 3V38A 4ZY1A 2OOTA 4X8IA 4JYWA 3IIBA 4UF4A 4IHMA 2ZEDA 4ONWA 4R6TA 2CTCA 3H8EA 3BI1A 3B3SA 1Z2LA 3B3CA 2GU2A 3PB8X 2PJAA 1VHEA 2V8HA 4UEZA 2GLFA 3BHXA 1IGBA 3LWUA 4CPAA 2Q43A 2QJ8A 4MHNA 3WABA 1R43A 2C6GA 4ZX9A 4YU9A 3DLJA 4NGSA 4P4DA 4MHZA 4AXVA 1YMEA 4NGQA 4P10A 5F09A 4ZY2A 5K8MA 4OIWA 1YW4A 4A38A 1XJOA 4NFRA 4NGMA 1Q7LA 3D67A 4O23A 3GB0A 2ZEFA 3KI9A 1ZLIA 4NGTA 2ZEHA 3FEDA 5D29A 2ANPA 4LQGA 4G1PA 4PXEA 2PJ7A 4MCQA 1F2PA 1IY7A 1BPMA 3CT9A 3TX8A 3KQZA 4OP4A 3K9TA 2EK9A 2CTBA 4MXUA 2I3CA 2PIYA 2PJ8A 4FAIA 4EFDA 2HB6A 3BI0A 1M4LA 1ELMP 4X2TA 4NJQA 2ZENA 2PVWA 3B2YA 3SJEA 3PB9X 1HDUA 5LYDA 3RAMA 4OIDA 1TKFA 3PBBA 3LMSA 2ZEPA 3HUVA 1VIXA 3KQXA 4P45A 1CPSA 1AMPA 2PJ0A 3D7GA 3D7DA 4H2KA 2PRQA 1LANA 2NYQA 5K8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OKO A;  3KL9 A;  2O53 A;  1KWM A;  2V77 A;  4NGN A;  3B3T A;  1DE4 C;  2PJ5 A;  3VH9 A;  4ZY0 A;  2PJ3 A;  1PCA A;  3CDX A;  1XBU A;  3V7Z A;  4K3N A;  4Q7A A;  2XEJ A;  3KR4 A;  2V8G A;  5D8N A;  3PRT A;  4PXB A;  3FMC A;  4B6Z A;  3SI0 A;  3NH8 A;  4PPZ A;  6CPA A;  2QVP A;  2JEW A;  3WC5 A;  4ZI6 A;  1VHO A;  3CPX A;  3SJF A;  2O4H A;  3PBE A;  4OC0 A;  3D68 A;  2F8H A;  3B35 A;  4MRI A;  3L2N A;  4ZX8 A;  4OC4 A;  1FT7 A;  2Q4Z A;  4OC2 A;  4X3R A;  4MMO A;  2XEI A;  5HVH A;  5JM6 A;  4MCS A;  1LFW A;  1ZG9 A;  2AFM A;  4A39 A;  4UEE A;  1HEE A;  3D66 A;  4UIB A;  2FVG A;  4F9U A;  2CIJ A;  2OR4 A;  1H8L A;  2IQ6 A;  3NFZ A;  5LYI A;  4EWT A;  2C6P A;  4P44 A;  3WC7 A;  2ZEL A;  2IJZ A;  2ZOF A;  4FWU A;  2V8V A;  4TWE A;  2AFU A;  4KSI A;  3RZA A;  5K8P A;  5LRK A;  4NJR A;  1ZG7 A;  8CPA A;  2EK8 A;  2XEF A;  1Y0R A;  2G9D A;  3H8G A;  1Z8L A;  1CX8 A;  1CG2 A;  4F9V A;  4OME A;  3I1U A;  3NH5 A;  1QMU A;  3KR5 A;  2HC9 A;  3PFO A;  1F57 A;  5LYF A;  3K2K A;  3N5F A;  4R76 A;  4TNU A;  1NSA A;  3PB6 X;  3KGQ A;  1TKJ A;  3DGV A;  5LYL A;  2ZEE A;  2AFX A;  1XRY A;  1YSJ A;  1ZLH A;  4F8Z A;  2C6C A;  3KHZ A;  2ZEG A;  2DEA A;  1Y7E A;  1Z5R A;  3T8W A;  2AFW A;  1ZG8 A;  2V8D A;  3GLJ A;  3JRU A;  4WJB A;  3FEC A;  5I4M A;  4OC1 A;  4MHY A;  3FX6 A;  5THW A;  4P4I A;  2PJ6 A;  2BOA A;  4R8F A;  1ARL A;  4P4F A;  4DUK A;  2NSM A;  4GM5 A;  2CF4 A;  2BCO A;  1LOK A;  4PQA A;  3S9L A;  3RBU A;  3KHX A;  1LAP A;  5LRJ A;  3PB7 X;  5CPA A;  3SJX A;  4IK2 A;  4PXC A;  1YLO A;  3IWW A;  3ISX A;  3D4U A;  3IO1 A;  2GLJ A;  1TF8 A;  2PJ1 A;  1CBX A;  1BLL E;  1VGY A;  4A37 A;  5IB9 A;  3FH4 A;  1LCP A;  2JBJ A;  3CPA A;  4NGP A;  2ABZ A;  1R3N A;  1BAV A;  2XEG A;  1GYT A;  2PE3 A;  2IMO A;  3WC6 A;  1CPX A;  4P4E A;  3B3W A;  5DS0 A;  3D7F A;  4Z65 A;  3D7H A;  4EME A;  4P4J A;  4MCR A;  1JQG A;  4W9Y A;  5HXD A;  2ZEM A;  2JBK A;  2AFO A;  4DYO A;  4PXD A;  4FBE A;  3B3V A;  4UEF A;  1CP7 A;  2C1C A;  3SI1 A;  3VAT A;  5ELY A;  2GRE A;  5CBM A;  2PJ2 A;  3PFE A;  3B7I A;  3IJ3 A;  1TXR A;  4MCP A;  1AYE A;  4OC5 A;  4YWY A;  3SI2 A;  3QNV A;  2PJ9 A;  3FF3 A;  5JGF A;  1RTQ A;  2AFS A;  1CP6 A;  3PB4 X;  2RB7 A;  1UWY A;  2J9A A;  3VAR A;  4MHP A;  3KZW A;  4A94 A;  2ZEO A;  4R7M A;  2EWB A;  4FUU A;  1F2O A;  4UIA A;  2PCU A;  3HLP A;  3NH4 A;  2PIZ A;  4BD9 A;  1HDQ A;  3MN8 A;  1EE3 P;  2WZN A;  4ZYQ A;  5HVG A;  3SJG A;  3ISZ A;  1LAM A;  1PYT B;  1OBR A;  2QYV A;  2PJB A;  1XMB A;  4JZ0 A;  2POK A;  1ARM A;  2VL1 A;  5HVF A;  4IAV A;  5LRG A;  3H8F A;  1ELL P;  3FEE A;  3WT4 A;  3FVL A;  3PEI A;  3S9N A;  2BO9 A;  3KAS A;  2WYR A;  3IC1 A;  2PJC A;  3NA6 A;  1FNO A;  2RFH A;  4OC3 A;  1TKH A;  3FJU A;  3BXM A;  3TC8 A;  1DTD A;  1YW6 A;  4RUH A;  5J1Q A;  4NGR A;  1TF9 A;  3IFE A;  2PJ4 A;  3MRU A;  5K8N A;  2AFZ A;  1XFO A;  2PVV A;  4DJL A;  3GUX A;  1BPN A;  3S9M A;  4P6Y A;  7CPA A;  1Y0Y A;  2F7V A;  4WWV A;  1QQ9 A;  2Q51 A;  3IEH A;  4P4B A;  2ZOG A;  5JH9 A;  3V38 A;  4ZY1 A;  2OOT A;  4X8I A;  4JYW A;  3IIB A;  4UF4 A;  4IHM A;  2ZED A;  4ONW A;  4R6T A;  2CTC A;  3H8E A;  3BI1 A;  3B3S A;  1Z2L A;  3B3C A;  2GU2 A;  3PB8 X;  2PJA A;  1VHE A;  2V8H A;  4UEZ A;  2GLF A;  3BHX A;  1IGB A;  3LWU A;  4CPA A;  2Q43 A;  2QJ8 A;  4MHN A;  3WAB A;  1R43 A;  2C6G A;  4ZX9 A;  4YU9 A;  3DLJ A;  4NGS A;  4P4D A;  4MHZ A;  4AXV A;  1YME A;  4NGQ A;  4P10 A;  5F09 A;  4ZY2 A;  5K8M A;  4OIW A;  1YW4 A;  4A38 A;  1XJO A;  4NFR A;  4NGM A;  1Q7L A;  3D67 A;  4O23 A;  3GB0 A;  2ZEF A;  3KI9 A;  1ZLI A;  4NGT A;  2ZEH A;  3FED A;  5D29 A;  2ANP A;  4LQG A;  4G1P A;  4PXE A;  2PJ7 A;  4MCQ A;  1F2P A;  1IY7 A;  1BPM A;  3CT9 A;  3TX8 A;  3KQZ A;  4OP4 A;  3K9T A;  2EK9 A;  2CTB A;  4MXU A;  2I3C A;  2PIY A;  2PJ8 A;  4FAI A;  4EFD A;  2HB6 A;  3BI0 A;  1M4L A;  1ELM P;  4X2T A;  4NJQ A;  2ZEN A;  2PVW A;  3B2Y A;  3SJE A;  3PB9 X;  1HDU A;  5LYD A;  3RAM A;  4OID A;  1TKF A;  3PBB A;  3LMS A;  2ZEP A;  3HUV A;  1VIX A;  3KQX A;  4P45 A;  1CPS A;  1AMP A;  2PJ0 A;  3D7G A;  3D7D A;  4H2K A;  2PRQ A;  1LAN A;  2NYQ A;  5K8O A; 
#chains in the Genus database with same CATH topology
 4OKO A;  5I0C A;  4BBH A;  3KL9 A;  2O53 A;  3SXN A;  4QB9 A;  1KWM A;  1IOF A;  1X12 A;  1NE9 A;  2V77 A;  2BL1 A;  1Z4E A;  5EMI A;  2EBJ A;  2YNC C;  4LUA A;  3B3T A;  1M4D A;  3MGD A;  4NXY A;  3N7Z A;  4NGN A;  4UCP A;  5GCN A;  1DE4 C;  2PJ5 A;  3VH9 A;  4ZY0 A;  1YVO A;  2PJ3 A;  1PCA A;  3CDX A;  3BJ8 A;  3H5Z A;  2A4N A;  1XBU A;  2ZW6 A;  3V7Z A;  3R9G A;  4K3N A;  4Q7A A;  5AGE A;  1WWZ A;  2XEJ A;  3KR4 A;  4M6H A;  2FL4 A;  4NEX A;  3W6S A;  2V8G A;  4CAX A;  3QB8 A;  5D8N A;  2REF A;  3PRT A;  4PXB A;  3FMC A;  1NSL A;  1M4G A;  4B6Z A;  1QSO A;  3SI0 A;  3NH8 A;  4HKF A;  4AG7 A;  4PPZ A;  4RI1 A;  4NSQ A;  2EUI A;  6CPA A;  2QVP A;  2DPT A;  2JEW A;  1IU8 A;  3WC5 A;  4ZI6 A;  1VHO A;  5HH1 A;  1S7L A;  2PQ8 A;  5F46 A;  2Z3P A;  3CPX A;  4IF5 A;  3SJF A;  2O4H A;  4XPK A;  2J8M A;  5G1Z A;  3JUW A;  3PBE A;  4Q38 A;  4OC0 A;  3CXS A;  3UY5 A;  2B5G A;  4C2Y A;  3D68 A;  2F8H A;  3B35 A;  4MRI A;  4B12 A;  3L2N A;  3QAY A;  4JJX A;  4ZX8 A;  2I79 A;  1J4J A;  2GFQ A;  1M44 A;  2ZW7 A;  5G22 A;  4OC4 A;  1FT7 A;  2Q4Y A;  2Q4Z A;  4OC2 A;  1XEB A;  4X3R A;  2IL4 A;  4MMO A;  4KOY A;  3R9F A;  2XEI A;  1NMT A;  5F47 A;  5HVH A;  5JM6 A;  4A33 A;  2H5M A;  2Z10 A;  4U5Y A;  2VZZ A;  3F0A A;  4MCS A;  1LFW A;  1ZG9 A;  5EBV A;  3GYA A;  2AFM A;  3DDD A;  5AG6 A;  4UEE A;  4A39 A;  4M6G A;  4KLV A;  3T9Y A;  1HEE A;  2G3A A;  2Z3M A;  3D66 A;  4KOU A;  1QSN A;  1CM0 A;  4KVM E;  4UIB A;  3F8K A;  1S60 A;  4XPL A;  4FD7 A;  2FVG A;  4AVB A;  2CIJ A;  1LRZ A;  2OR4 A;  3TO6 A;  4F9U A;  1H8L A;  2IQ6 A;  3NFZ A;  3T90 A;  5LYI A;  4FD6 A;  2HV2 A;  4UFW A;  5KTD A;  4EWT A;  3FB3 A;  4CS0 B;  1SQH A;  2JEV A;  2C6P A;  2RC4 A;  4P44 A;  3WC7 A;  2ZEL A;  5C88 A;  2IJZ A;  2ZOF A;  4FWU A;  2V8V A;  4TWE A;  3TE4 A;  4E8O A;  4IUS A;  2AFU A;  4B13 A;  4KOT A;  4KSI A;  3TFY A;  3RZA A;  1IOI A;  5K8P A;  5LRK A;  2AE6 A;  3IU2 A;  5C82 A;  4NJR A;  4E2A A;  1ZG7 A;  8CPA A;  2EK8 A;  2XEF A;  1BOB A;  1Y0R A;  2G9D A;  1S7F A;  3H8G A;  4CRY B;  1IIC A;  2P6F A;  1P4N A;  3PZJ A;  1Z8L A;  4Q36 A;  1CX8 A;  1CG2 A;  5KTC A;  4F9V A;  1Z4R A;  4OME A;  3I1U A;  3NH5 A;  1QMU A;  1I21 A;  2FS5 A;  1VHS A;  2FE7 A;  3W91 A;  4CAW A;  3R96 A;  3KR5 A;  2HC9 A;  3PFO A;  1F57 A;  2Q7B A;  3BLN A;  1MJB A;  3K2K A;  5LYF A;  3N5F A;  2ZW5 A;  2OZU A;  4R76 A;  5BWA B;  3CXP A;  4QBJ A;  4TNU A;  1NSA A;  2P6G A;  4M6I A;  3PB6 X;  2BSW A;  1MJA A;  3KGQ A;  4F0Y A;  2B5G B;  3NE7 A;  5IB0 A;  1TKJ A;  1UFH A;  2YND A;  3QAH A;  3DGV A;  2J8R A;  5LYL A;  1M1D A;  2ZEE A;  2AFX A;  2ODF A;  4UFX A;  3R1K A;  1XRY A;  3FXT A;  2JDC A;  4KOV A;  4JWP A;  4OAD A;  1YSJ A;  2D4O A;  4MFQ A;  4AB7 A;  1ZLH A;  3TO9 A;  4F8Z A;  2C6C A;  2R7H A;  3KHZ A;  2GIV A;  2ZEG A;  4AVA A;  5G20 A;  2DEA A;  1Y7E A;  3JVN A;  2B58 A;  2GE3 A;  1Z5R A;  4KOR A;  3FIX A;  3T8W A;  2AFW A;  1ZG8 A;  1IID A;  4JLY A;  2V8D A;  3GLJ A;  4JD6 A;  3JRU A;  4WJB A;  1S7K A;  3FEC A;  5I4M A;  1S7N A;  4OC1 A;  4R57 A;  4MHY A;  3FX6 A;  1PUA A;  2QIR A;  5DWN A;  5THW A;  3ZZI A;  4P4I A;  4H6Z A;  2PJ6 A;  2BOA A;  4EVY A;  4U9Y A;  1OZP A;  5H86 A;  4R8F A;  4UWJ A;  1ARL A;  2Z11 A;  5E96 A;  3DR6 A;  4P4F A;  4DUK A;  2DPS A;  4MHD A;  2NSM A;  2HQY A;  4GM5 A;  2CF4 A;  1MJ9 A;  2BCO A;  1LOK A;  2DF5 A;  4AVC A;  4OLL A;  4FD4 A;  4PQA A;  5IX3 A;  2I00 A;  2NMT A;  3S9L A;  4RN7 A;  1L0C A;  1Z8W A;  3RBU A;  3KHX A;  2ARH A;  4KLW A;  1LAP A;  1AUG A;  2C27 A;  4ONU A;  3VWD A;  1MK4 A;  2K5T A;  1V0C A;  5LRJ A;  3PB7 X;  4CGP A;  5CPA A;  3TOA A;  4JXQ A;  3SJX A;  2ZW4 A;  4IK2 A;  4F6A A;  4PXC A;  4NCZ A;  4QVT A;  2CXA A;  4A95 A;  1YLO A;  4LX9 A;  4U9Z A;  4I49 A;  3IWW A;  2R8V A;  2FIA A;  3VWE A;  3ISX A;  3D4U A;  3S6H A;  2PDO A;  3CXQ A;  3IO1 A;  4BMH A;  2ATR A;  2GLJ A;  1TF8 A;  2PJ1 A;  1CBX A;  4MBU A;  1BLL E;  1VGY A;  1A2Z A;  4A37 A;  5IB9 A;  3FH4 A;  5K8O A;  3V8I A;  1LCP A;  4YFJ A;  2VI7 A;  2BEI A;  2JBJ A;  2ZPA A;  4YRH A;  3DNS A;  2R1I A;  2FT0 A;  3CPA A;  4C68 A;  3GIU A;  4NGP A;  2ABZ A;  1WK4 A;  4MY0 A;  3TCV A;  1R3N A;  1BAV A;  1KUY A;  2XEG A;  3FBU A;  3GKR A;  1GYT A;  2PE3 A;  2P6E A;  2IMO A;  3WC6 A;  5AG4 A;  1S3Z A;  2CNS A;  3SXO A;  1CPX A;  4OAE A;  4KZT A;  1Z8X A;  3B3W A;  4P4E A;  5DS0 A;  3D7F A;  4Z65 A;  3D7H A;  1QST A;  2PR1 A;  4P4J A;  1XOV A;  4B5O A;  4EME A;  4MCR A;  3B8G A;  2Z0Z A;  1JQG A;  4W9Y A;  5HXD A;  1KUV A;  1R57 A;  2B4D B;  4C2Z A;  4HPS A;  2ZEM A;  2JBK A;  3R9E A;  4A30 A;  4DNC A;  2AFO A;  4YGO A;  4PXD A;  4CGL A;  4DYO A;  4FBE A;  2OH1 A;  3IWG A;  4KVX A;  3LAC A;  4E0A A;  2J8N A;  1YQE A;  3B3V A;  3ZJ0 A;  2Q4V A;  4UEF A;  4CAV A;  1CP7 A;  2FIW A;  2C1C A;  3SI1 A;  3H4Q A;  3VAT A;  5ELY A;  2GRE A;  3DR8 A;  4KSF A;  2PJ2 A;  3I9S A;  3PFE A;  5CBM A;  3B7I A;  3IJ3 A;  5JPH A;  4UA3 A;  1TXR A;  4MCP A;  5AG7 A;  4XNH B;  4MFZ A;  1AYE A;  1IYL A;  1Z8T A;  4OC5 A;  2EO8 A;  4HNX B;  2B3U A;  4YWY A;  5AG5 A;  3SI2 A;  3QNV A;  2PJ9 A;  3FF3 A;  5JGF A;  1RTQ A;  4NF1 A;  1Q2Y A;  3I3G A;  3TT2 A;  2VEZ A;  2BUE A;  3IWE A;  4KVO E;  4B10 A;  3WR7 A;  1U6M A;  2AFS A;  2VZY A;  1CP6 A;  4PSW A;  3SHP A;  3PB4 X;  5FVJ A;  4PV6 A;  2RB7 A;  1UWY A;  2J9A A;  3VAR A;  4QUS A;  3S6K A;  2WSA A;  4MHP A;  3KZW A;  2JLM A;  2GAN A;  4A94 A;  2DXQ A;  2ZEO A;  3CZX A;  2EWB A;  3DSB A;  4FUU A;  4R7M A;  1F2O A;  4UBR A;  4UIA A;  4BIN A;  2Q7S A;  5J8C A;  2PCU A;  3HLP A;  3NH4 A;  3TTH A;  5A27 A;  2PIZ A;  4KUB A;  4CYP A;  4XNH C;  4BD9 A;  1HDQ A;  3C26 A;  3MN8 A;  4R3L A;  1IYK A;  1EE3 P;  2OU2 A;  2WZN A;  4ZYQ A;  5HVG A;  2REE A;  1RXT A;  2X7B A;  3ISZ A;  3SJG A;  1LAM A;  1B6B A;  1PYT B;  1OBR A;  2OZH A;  2QYV A;  2R98 A;  4B11 A;  5JQ4 A;  2PJB A;  1XMB A;  4JZ0 A;  2POK A;  3D3S A;  4CYQ A;  1ARM A;  2Z3K A;  4CAF A;  2VL1 A;  5HVF A;  4IAV A;  2VBQ A;  5LRG A;  2O28 A;  1M4I A;  1YVK A;  3H8F A;  1ELL P;  3NE8 A;  4R87 A;  3FEE A;  3WT4 A;  1Y9K A;  3P2H A;  4B14 A;  3FVL A;  3PEI A;  3S9N A;  2BO9 A;  1I12 A;  1N71 A;  3KAS A;  1YGH A;  2WYR A;  4MFJ A;  1ZO0 A;  3IC1 A;  5EC4 A;  3RO0 A;  2PJC A;  3NA6 A;  2WPW A;  3R95 A;  4ZGY B;  1FNO A;  1X10 A;  2RFH A;  4OC3 A;  4CRZ B;  1Z9U A;  2HUZ A;  5F48 A;  4UFV A;  4HNW B;  5DWM A;  3GY9 A;  1TKH A;  2CNM A;  4GXH A;  3FJU A;  3BXM A;  4CGO A;  3TC8 A;  1JWQ A;  5H84 A;  1DTD A;  1YW6 A;  4RUH A;  4UWI A;  5A28 A;  2PR8 A;  2G3T A;  5J1Q A;  4C2X A;  3E0K A;  4FD5 A;  3RNZ A;  4NGR A;  4CGM A;  3D2M A;  4HNY B;  2PC1 A;  3P2F A;  1TF9 A;  3IFE A;  3F5B A;  2PJ4 A;  4C7H A;  4R9M A;  3MRU A;  5K8N A;  2AFZ A;  3OWC A;  1XFO A;  4X5K A;  3RYO A;  2PVV A;  2KCW A;  3W6X A;  4DJL A;  2JDD A;  3GUX A;  1BPN A;  1Q2C A;  3S9M A;  4P6Y A;  7CPA A;  1Y0Y A;  2YNE A;  2F7V A;  1BO4 A;  4A31 A;  5J8F A;  4WWV A;  1I1D A;  1QQ9 A;  4XPD B;  1KZF A;  2Q51 A;  2EVN A;  3IEH A;  2VXK A;  4P4B A;  4A2Z A;  2ZOG A;  3EFA A;  3D8P A;  4II9 A;  1YRE A;  5JH9 A;  3V38 A;  3KKW A;  1QSM A;  4ZY1 A;  3K9U A;  2OOT A;  1KUX A;  4JYW A;  3IIB A;  4UF4 A;  4IHM A;  4L8A A;  4X8I A;  4M85 A;  4ZBG A;  2OZG A;  2D4P A;  2ZED A;  4ONW A;  3TO7 A;  4PSX A;  4R6T A;  2CTC A;  3H8E A;  5F49 A;  3BI1 A;  3B3S A;  1Z2L A;  2Q04 A;  2FSR A;  3B3C A;  3PP9 A;  4C7I A;  5KTA A;  2GU2 A;  3PB8 X;  2PJA A;  1VHE A;  3A9L A;  4MJ8 A;  1Y7R A;  2OB0 A;  2V8H A;  1XIX A;  4UEZ A;  2Z3L A;  1XMT A;  1GHE A;  3D2P A;  2GLF A;  1VKC A;  3S6F A;  3G3S A;  4XPD C;  2YNC A;  3BHX A;  1IGB A;  4F0X A;  5ISV A;  1Q2D A;  3LWU A;  4CPA A;  4H6U A;  2Q43 A;  3BJ7 A;  2QJ8 A;  4MY3 A;  4MHN A;  3WAB A;  5IV0 A;  1R43 A;  3FRM A;  4B5P A;  3FNC A;  2C6G A;  1YR0 A;  3TOB A;  1ON0 A;  1YK3 A;  3DLJ A;  4L89 A;  2QML A;  4YU9 A;  4ZX9 A;  4NGS A;  4QC6 A;  4P4D A;  4JXR A;  4MHZ A;  4AXV A;  2Z3N A;  4UCN A;  1YME A;  4NGQ A;  1B87 A;  5HMN A;  4P10 A;  5F09 A;  4ZY2 A;  4KSA A;  4ORF A;  3S6G A;  5K8M A;  4OIW A;  4PK2 A;  1YW4 A;  4A38 A;  1CJW A;  2Q44 A;  4KUA A;  2CNT A;  2AJ6 A;  3IGR A;  5G21 A;  4LQ6 A;  2PRB A;  3G8W A;  2B3V A;  1XJO A;  3JTK A;  4NFR A;  2PSW A;  3EC4 A;  1Q7L A;  4NGM A;  3D67 A;  4O23 A;  3GB0 A;  2ZEF A;  3KI9 A;  3EY5 A;  1ZLI A;  4NGT A;  4MFK A;  2ZEH A;  3FED A;  4A32 A;  2VQY A;  1FY7 A;  1IB1 E;  5D29 A;  2ANP A;  4LQG A;  4PK3 A;  4K30 A;  1RO5 A;  4G1P A;  4M3S A;  4PXE A;  2PJ7 A;  4MCQ A;  1F2P A;  4Y49 B;  3EXN A;  1IY7 A;  4J3G A;  4MI4 A;  2Y0M A;  2B4B A;  1BPM A;  2QEC A;  4RS2 A;  4KOX A;  1QSR A;  3CT9 A;  3TX8 A;  2WPX A;  2F5I A;  1XE4 A;  1PU9 A;  3KQZ A;  2Q0Y A;  4CYO A;  4KS9 A;  4UCM A;  1S5K A;  4CYN A;  4OP4 A;  4CAE A;  4H89 A;  3K9T A;  3EO4 A;  2EK9 A;  4MFP A;  1P0H A;  2CY2 A;  1K4J A;  2CTB A;  2I3C A;  2PIY A;  2PJ8 A;  4MXU A;  4EFD A;  4FAI A;  1TIQ A;  2Z3O A;  2FCK A;  3LOD A;  2HB6 A;  3BI0 A;  3PGP A;  1XF8 A;  1M4L A;  2WUU A;  1ELM P;  4X2T A;  4R3K A;  4Y49 C;  4NJQ A;  4GS4 A;  2ZEN A;  2PVW A;  3B2Y A;  3SJE A;  2P0W A;  3LD2 A;  3PB9 X;  2G0B A;  1HDU A;  5LYD A;  4B5P B;  3RAM A;  3IU1 A;  5CNP A;  1Y9W A;  4OID A;  1TKF A;  4AG9 A;  1YLE A;  3LMS A;  2FXF A;  2ZEP A;  1VIX A;  3HUV A;  3PBB A;  4MFL A;  2YGW A;  1YX0 A;  3KQX A;  4P45 A;  1CPS A;  4KOS A;  1AMP A;  2PJ0 A;  3D7G A;  3D7D A;  4KOW A;  4H2K A;  2PRQ A;  4CGN A;  1LAN A;  3FYN A;  2NYQ A;  2ZXV A;  2B4D A; 
#chains in the Genus database with same CATH homology
 4OKO A;  3KL9 A;  2O53 A;  1KWM A;  2V77 A;  4NGN A;  3B3T A;  1DE4 C;  2PJ5 A;  3VH9 A;  4ZY0 A;  2PJ3 A;  1PCA A;  3CDX A;  1XBU A;  3V7Z A;  4K3N A;  4Q7A A;  2XEJ A;  3KR4 A;  2V8G A;  5D8N A;  3PRT A;  4PXB A;  3FMC A;  4B6Z A;  3SI0 A;  3NH8 A;  4PPZ A;  6CPA A;  2QVP A;  2JEW A;  3WC5 A;  4ZI6 A;  1VHO A;  3CPX A;  3SJF A;  2O4H A;  3PBE A;  4OC0 A;  3D68 A;  2F8H A;  3B35 A;  4MRI A;  3L2N A;  4ZX8 A;  4OC4 A;  1FT7 A;  2Q4Z A;  4OC2 A;  4X3R A;  4MMO A;  2XEI A;  5HVH A;  5JM6 A;  4MCS A;  1LFW A;  1ZG9 A;  2AFM A;  4A39 A;  4UEE A;  1HEE A;  3D66 A;  4UIB A;  2FVG A;  4F9U A;  2CIJ A;  2OR4 A;  1H8L A;  2IQ6 A;  3NFZ A;  5LYI A;  4EWT A;  2C6P A;  4P44 A;  3WC7 A;  2ZEL A;  2IJZ A;  2ZOF A;  4FWU A;  2V8V A;  4TWE A;  2AFU A;  4KSI A;  3RZA A;  5K8P A;  5LRK A;  4NJR A;  1ZG7 A;  8CPA A;  2EK8 A;  2XEF A;  1Y0R A;  2G9D A;  3H8G A;  1Z8L A;  1CX8 A;  1CG2 A;  4F9V A;  4OME A;  3I1U A;  3NH5 A;  1QMU A;  3KR5 A;  2HC9 A;  3PFO A;  1F57 A;  5LYF A;  3K2K A;  3N5F A;  4R76 A;  4TNU A;  1NSA A;  3PB6 X;  3KGQ A;  1TKJ A;  3DGV A;  5LYL A;  2ZEE A;  2AFX A;  1XRY A;  1YSJ A;  1ZLH A;  4F8Z A;  2C6C A;  3KHZ A;  2ZEG A;  2DEA A;  1Y7E A;  1Z5R A;  3T8W A;  2AFW A;  1ZG8 A;  2V8D A;  3GLJ A;  3JRU A;  4WJB A;  3FEC A;  5I4M A;  4OC1 A;  4MHY A;  3FX6 A;  5THW A;  4P4I A;  2PJ6 A;  2BOA A;  4R8F A;  1ARL A;  4P4F A;  4DUK A;  2NSM A;  4GM5 A;  2CF4 A;  2BCO A;  1LOK A;  4PQA A;  3S9L A;  3RBU A;  3KHX A;  1LAP A;  5LRJ A;  3PB7 X;  5CPA A;  3SJX A;  4IK2 A;  4PXC A;  1YLO A;  3IWW A;  3ISX A;  3D4U A;  3IO1 A;  2GLJ A;  1TF8 A;  2PJ1 A;  1CBX A;  1BLL E;  1VGY A;  4A37 A;  5IB9 A;  3FH4 A;  1LCP A;  2JBJ A;  3CPA A;  4NGP A;  2ABZ A;  1R3N A;  1BAV A;  2XEG A;  1GYT A;  2PE3 A;  2IMO A;  3WC6 A;  1CPX A;  4P4E A;  3B3W A;  5DS0 A;  3D7F A;  4Z65 A;  3D7H A;  4EME A;  4P4J A;  4MCR A;  1JQG A;  4W9Y A;  5HXD A;  2ZEM A;  2JBK A;  2AFO A;  4DYO A;  4PXD A;  4FBE A;  3B3V A;  4UEF A;  1CP7 A;  2C1C A;  3SI1 A;  3VAT A;  5ELY A;  2GRE A;  5CBM A;  2PJ2 A;  3PFE A;  3B7I A;  3IJ3 A;  1TXR A;  4MCP A;  1AYE A;  4OC5 A;  4YWY A;  3SI2 A;  3QNV A;  2PJ9 A;  3FF3 A;  5JGF A;  1RTQ A;  2AFS A;  1CP6 A;  3PB4 X;  2RB7 A;  1UWY A;  2J9A A;  3VAR A;  4MHP A;  3KZW A;  4A94 A;  2ZEO A;  4R7M A;  2EWB A;  4FUU A;  1F2O A;  4UIA A;  2PCU A;  3HLP A;  3NH4 A;  2PIZ A;  4BD9 A;  1HDQ A;  3MN8 A;  1EE3 P;  2WZN A;  4ZYQ A;  5HVG A;  3SJG A;  3ISZ A;  1LAM A;  1PYT B;  1OBR A;  2QYV A;  2PJB A;  1XMB A;  4JZ0 A;  2POK A;  1ARM A;  2VL1 A;  5HVF A;  4IAV A;  5LRG A;  3H8F A;  1ELL P;  3FEE A;  3WT4 A;  3FVL A;  3PEI A;  3S9N A;  2BO9 A;  3KAS A;  2WYR A;  3IC1 A;  2PJC A;  3NA6 A;  1FNO A;  2RFH A;  4OC3 A;  1TKH A;  3FJU A;  3BXM A;  3TC8 A;  1DTD A;  1YW6 A;  4RUH A;  5J1Q A;  4NGR A;  1TF9 A;  3IFE A;  2PJ4 A;  3MRU A;  5K8N A;  2AFZ A;  1XFO A;  2PVV A;  4DJL A;  3GUX A;  1BPN A;  3S9M A;  4P6Y A;  7CPA A;  1Y0Y A;  2F7V A;  4WWV A;  1QQ9 A;  2Q51 A;  3IEH A;  4P4B A;  2ZOG A;  5JH9 A;  3V38 A;  4ZY1 A;  2OOT A;  4X8I A;  4JYW A;  3IIB A;  4UF4 A;  4IHM A;  2ZED A;  4ONW A;  4R6T A;  2CTC A;  3H8E A;  3BI1 A;  3B3S A;  1Z2L A;  3B3C A;  2GU2 A;  3PB8 X;  2PJA A;  1VHE A;  2V8H A;  4UEZ A;  2GLF A;  3BHX A;  1IGB A;  3LWU A;  4CPA A;  2Q43 A;  2QJ8 A;  4MHN A;  3WAB A;  1R43 A;  2C6G A;  4ZX9 A;  4YU9 A;  3DLJ A;  4NGS A;  4P4D A;  4MHZ A;  4AXV A;  1YME A;  4NGQ A;  4P10 A;  5F09 A;  4ZY2 A;  5K8M A;  4OIW A;  1YW4 A;  4A38 A;  1XJO A;  4NFR A;  4NGM A;  1Q7L A;  3D67 A;  4O23 A;  3GB0 A;  2ZEF A;  3KI9 A;  1ZLI A;  4NGT A;  2ZEH A;  3FED A;  5D29 A;  2ANP A;  4LQG A;  4G1P A;  4PXE A;  2PJ7 A;  4MCQ A;  1F2P A;  1IY7 A;  1BPM A;  3CT9 A;  3TX8 A;  3KQZ A;  4OP4 A;  3K9T A;  2EK9 A;  2CTB A;  4MXU A;  2I3C A;  2PIY A;  2PJ8 A;  4FAI A;  4EFD A;  2HB6 A;  3BI0 A;  1M4L A;  1ELM P;  4X2T A;  4NJQ A;  2ZEN A;  2PVW A;  3B2Y A;  3SJE A;  3PB9 X;  1HDU A;  5LYD A;  3RAM A;  4OID A;  1TKF A;  3PBB A;  3LMS A;  2ZEP A;  3HUV A;  1VIX A;  3KQX A;  4P45 A;  1CPS A;  1AMP A;  2PJ0 A;  3D7G A;  3D7D A;  4H2K A;  2PRQ A;  1LAN A;  2NYQ A;  5K8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...