2ZEDA

Crystal structure of the human glutaminyl cyclase mutant s160a at 1.7 angstrom resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDAAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glutaminyl-peptide cyclotransferase
publication title A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2007-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2zedA00
4MHNA 3BXMA 5K8NA 4WWVA 4OIDA 2PJ0A 4FWUA 3HUVA 4G1PA 2PIZA 4EMEA 1TKHA 3PEIA 1KWMA 4ZY1A 2V8DA 1EE3P 3FX6A 1Z8LA 3ISZA 1ELLP 4NGMA 4R7MA 3FEEA 4H2KA 2IMOA 3DLJA 4NGNA 1Z5RA 3IEHA 4UEEA 2RB7A 3S9NA 3ISXA 4IAVA 2ZOFA 3BHXA 1BLLE 4NJRA 3KHZA 1PCAA 2ZELA 4BD9A 2POKA 2NYQA 1RTQA 3FECA 4NJQA 2PJ2A 2PCUA 1VIXA 3TX8A 3VH9A 2V77A 3GB0A 2G9DA 4F8ZA 2ZOGA 3FF3A 4R76A 3KASA 2PRQA 3SI1A 1JQGA 2GLJA 3JRUA 4NFRA 3IIBA 1AYEA 4OC1A 3CT9A 1NSAA 3CPXA 3IJ3A 8CPAA 1CPSA 4MHPA 1UWYA 1QQ9A 2NSMA 3N5FA 2O4HA 4Z65A 1LANA 4LQGA 4A38A 2ZEOA 4PXDA 4R8FA 3RZAA 4OKOA 4DJLA 2AFXA 1VHEA 3GUXA 4MCRA 2JEWA 2VL1A 5DS0A 3WC6A 2IJZA 3S9LA 4NGQA 3D67A 1LFWA 2AFSA 2ZEEA 2Q4ZA 3NA6A 2EK9A 5I4MA 3SI0A 3WC7A 4ZY0A 4MHZA 5CBMA 2CTCA 3KHXA 3SI2A 3KR5A 5LYIA 2BCOA 5HVHA 3V38A 4MHYA 2JBJA 3SJGA 1QMUA 3I1UA 5JM6A 3RBUA 1HDQA 4EFDA 2RFHA 3TC8A 1YW4A 4ZY2A 5LYDA 1XRYA 2OOTA 2CIJA 3KQXA 1ZLIA 4OMEA 1ZLHA 3KQZA 2ZEDA 2FVGA 3PFEA 4TWEA 2O53A 5LRJA 4DYOA 1HEEA 4ZI6A 1TF9A 2PJAA 2C6GA 4DUKA 1CG2A 3KI9A 4P6YA 3L2NA 3B3CA 2GREA 2WYRA 1CP6A 3D7GA 3BI1A 4OC4A 3D7FA 1FNOA 2OR4A 3KR4A 3S9MA 4B6ZA 2WZNA 5LYFA 2J9AA 4MCSA 4PXCA 3B3WA 1BPMA 2Q51A 3IC1A 2ZEMA 4ZYQA 5J1QA 1F57A 2ZEPA 3MN8A 1YW6A 4W9YA 2CTBA 3FJUA 4IHMA 3D68A 5HVGA 2XEGA 3NH4A 4X3RA 4JZ0A 4Q7AA 1TXRA 4NGPA 4MRIA 3D7HA 2ZEGA 4X8IA 4GM5A 2EK8A 5LYLA 3PB8X 3FEDA 4UIAA 1LOKA 4P4BA 4X2TA 3DGVA 1TKFA 1VGYA 3B2YA 3K2KA 1YSJA 5THWA 1TKJA 4P44A 1ELMP 2DEAA 5F09A 1Y7EA 4FAIA 4OC0A 4R6TA 4CPAA 2HB6A 1CP7A 2BOAA 4YU9A 1R43A 1XFOA 4OC3A 3PB4X 2CF4A 2PJ7A 2QJ8A 3NH5A 2ANPA 3B3VA 4OP4A 1LAPA 5JH9A 2AFOA 4OIWA 4JYWA 1YMEA 3D4UA 2V8GA 1FT7A 4P4DA 4A37A 2C6CA 4RUHA 3PBEA 4A39A 3WT4A 4P4EA 4P4FA 3IFEA 2ZEFA 1AMPA 2PJ3A 3PB9X 1YLOA 3FVLA 4PQAA 4P4IA 5JGFA 3FMCA 1DE4C 4UF4A 2I3CA 2QYVA 3PB7X 3SJFA 4F9VA 5D8NA 4UIBA 2PJCA 4NGRA 3NH8A 4FBEA 3FH4A 3LWUA 3H8FA 4MMOA 1Y0RA 4P4JA 1M4LA 4PXEA 3B35A 4K3NA 1HDUA 2XEFA 5LRGA 2PVWA 2PE3A 4UEZA 3PB6X 4O23A 1CPXA 1XBUA 1LCPA 3SJEA 3KGQA 3HLPA 5K8MA 5K8OA 2IQ6A 2C1CA 3PBBA 1ARLA 2GU2A 3VARA 1VHOA 1DTDA 3NFZA 2PVVA 3H8GA 3PFOA 4TNUA 3CDXA 4ONWA 3WABA 5D29A 2AFMA 3PRTA 4P10A 2PJ9A 3GLJA 3B3SA 2ABZA 1ARMA 2PJ8A 3CPAA 2EWBA 2PJ4A 3KL9A 5LRKA 4F9UA 2QVPA 1GYTA 4NGSA 2AFWA 5K8PA 2PJ1A 2GLFA 2XEJA 4OC2A 4MXUA 2V8HA 2PJ5A 4FUUA 2Q43A 3H8EA 4WJBA 2C6PA 2JBKA 1PYTB 4ZX8A 2PIYA 2F8HA 1F2PA 1IY7A 3D7DA 1CBXA 2XEIA 3QNVA 3T8WA 3IWWA 1H8LA 1Z2LA 3WC5A 4OC5A 1OBRA 2BO9A 1BAVA 3RAMA 5HXDA 1XJOA 2PJBA 1ZG8A 1R3NA 4PPZA 7CPAA 4IK2A 3B3TA 5ELYA 5CPAA 4MCPA 1TF8A 3MRUA 2AFZA 5HVFA 3SJXA 1Q7LA 3VATA 3B7IA 4EWTA 4PXBA 1ZG9A 3KZWA 1BPNA 5IB9A 2F7VA 4MCQA 1Y0YA 1XMBA 4A94A 4ZX9A 4AXVA 1IGBA 4YWYA 3V7ZA 3IO1A 1LAMA 4KSIA 1CX8A 2ZEHA 3BI0A 4UEFA 2AFUA 3K9TA 2V8VA 6CPAA 2PJ6A 2ZENA 2HC9A 4NGTA 1ZG7A 4P45A 1F2OA 3LMSA 3D66A
chains in the Genus database with same CATH superfamily
1Q2DA 4MFZA 4MHNA 3BXMA 5K8NA 5J8FA 2CNTA 2P6GA 4KVOE 2YNDA 4OIDA 4WWVA 2PJ0A 4FWUA 4M6IA 3HUVA 4G1PA 4B14A 2B3VA 1I21A 2PIZA 4C68A 4EMEA 4KVXA 1P0HA 1TKHA 3PEIA 4L89A 4H6ZA 4UBRA 3FNCA 5DWNA 3RNZA 1KWMA 2Z3OA 2P6EA 4C7HA 3PZJA 4M6HA 2V8DA 4ZY1A 3R96A 1IOIA 1S7KA 4U9ZA 1EE3P 3R9FA 2Z3NA 1YK3A 4CYOA 3FX6A 1Z8LA 2GFQA 3ISZA 1S7NA 1ELLP 1YVOA 3FIXA 2VEZA 4NGMA 4R3KA 4R7MA 4U5YA 3FEEA 4H2KA 2IMOA 3DLJA 5G22A 1I1DA 1IB1E 4Q36A 4H6UA 5IX3A 4NGNA 2PQ8A 1Z5RA 3IEHA 4UEEA 2RB7A 3S9NA 1ZO0A 2CNSA 3ISXA 2CY2A 1B87A 4IAVA 4LX9A 2G3AA 1N71A 2ZOFA 3BHXA 3VWEA 4M3SA 3DR8A 1BLLE 4DNCA 4KUBA 4NJRA 3I3GA 4KOUA 3KHZA 1Y9WA 2Z3PA 3FXTA 1PCAA 2ZELA 4A31A 4BD9A 5A27A 2REEA 4F0XA 2POKA 2NYQA 1RTQA 3FECA 4NJQA 3R95A 2BL1A 2PJ2A 1S60A 1SQHA 4KOXA 2Q7BA 2PCUA 3FBUA 1GHEA 1YR0A 4C2XA 1V0CA 2ZW6A 1VIXA 4FD6A 3TX8A 1Y9KA 2V77A 5AG7A 3GB0A 3VH9A 2Z3KA 3IWEA 4C7IA 4CYPA 2G9DA 4XPLA 2GIVA 4RI1A 1NE9A 4F8ZA 2ZOGA 3FF3A 4JXRA 4HKFA 4MBUA 3KASA 4R76A 2YNEA 2AJ6A 3IU1A 2PRQA 2D4OA 4KVME 4CGOA 3S6GA 4GXHA 3SI1A 1IOFA 1JQGA 2Q4VA 3JTKA 1BOBA 1R57A 2GLJA 3JRUA 4KLWA 4NFRA 4FD4A 4RS2A 2EO8A 2OH1A 4HNWB 2JEVA 1AYEA 3IIBA 4OC1A 3CT9A 4HNXB 4A2ZA 1P4NA 2YNCC 4UFVA 1NSAA 3CPXA 3IJ3A 8CPAA 3NE7A 4ORFA 2B4DB 4AG7A 1CPSA 2HV2A 4H89A 4MHPA 1UWYA 4CAXA 3QB8A 2B4DA 2DF5A 2VI7A 1QQ9A 3BJ7A 3LD2A 2NSMA 1Q2CA 3N5FA 1XE4A 3TOBA 2O4HA 5H84A 4Z65A 1LANA 4LQGA 2VZYA 2J8MA 4A38A 2Z10A 3P2HA 4UCMA 2ZEOA 4PXDA 4R8FA 3LACA 3R9GA 4OAEA 4UWIA 3DSBA 3PGPA 4OKOA 3RZAA 2AFXA 4CAFA 4DJLA 2G0BA 5IV0A 1VHEA 3CZXA 3GUXA 4MCRA 2JEWA 1XOVA 4ZBGA 2VL1A 4MY0A 4Q38A 5DS0A 2PSWA 3H5ZA 3WC6A 1QSOA 2IJZA 4PK3A 3W91A 2FIAA 2VQYA 2PDOA 3S9LA 4NGQA 3D67A 1LFWA 2AFSA 2ZEEA 2Q4ZA 2ODFA 3NA6A 2HUZA 2EK9A 3QAYA 4GS4A 1YQEA 1YGHA 5I4MA 3SI0A 3WC7A 4ZY0A 4MHZA 5CBMA 1M44A 2CTCA 4JXQA 1QSRA 3SHPA 4U9YA 3KHXA 3SI2A 4BBHA 3KR5A 5LYIA 1Z8WA 2BCOA 3MGDA 3PP9A 2D4PA 3TO6A 3V38A 5HVHA 4MHYA 2JBJA 3SJGA 3TOAA 1QMUA 1S5KA 3I1UA 5JM6A 2EUIA 4KS9A 1HDQA 2PR1A 3RBUA 4EFDA 2ARHA 2RFHA 1MK4A 1AUGA 1KUYA 5J8CA 3CXSA 3TC8A 4R57A 4KOTA 1YW4A 3EC4A 4ZY2A 1S3ZA 5LYDA 4AVBA 2QIRA 1XRYA 5C88A 2OOTA 2B3UA 2CIJA 3KQXA 3SXNA 1ZLIA 4OMEA 2O28A 4JD6A 1YX0A 5KTCA 1ZLHA 1NSLA 3KQZA 1I12A 2ZEDA 4I49A 2FVGA 3PFEA 1YREA 4TWEA 2A4NA 2O53A 4LQ6A 5LRJA 4DYOA 4MFJA 5JPHA 1HEEA 3K9UA 4ZI6A 5F46A 1CM0A 1WWZA 2P0WA 4C2ZA 2HQYA 1TF9A 2FIWA 2PJAA 1B6BA 2C6GA 2Q7SA 2WPXA 1OZPA 5F47A 1CG2A 1M4IA 2OU2A 3KI9A 4P6YA 4DUKA 2IL4A 3JUWA 3GYAA 5G20A 2Q0YA 3L2NA 4QB9A 3B3CA 1PU9A 2GREA 1IU8A 3IU2A 3UY5A 4QBJA 3P2FA 4JLYA 2WYRA 3TTHA 3TFYA 1CP6A 2Z11A 3D7GA 3BI1A 4OC4A 3D7FA 3D3SA 1FNOA 2R7HA 2OR4A 3KR4A 3V8IA 4CAWA 3S9MA 2WUUA 4M6GA 4B6ZA 2WZNA 3WR7A 5LYFA 2J9AA 4MCSA 2B5GB 4PXCA 3B3WA 1BPMA 2BUEA 2Q51A 2ZEMA 3IC1A 4AB7A 4ZYQA 5J1QA 4II9A 1F57A 3W6SA 2ZEPA 5AGEA 3MN8A 2JDCA 3D8PA 1YW6A 3F8KA 4W9YA 3DNSA 2CTBA 4B5OA 3FJUA 4IHMA 5E96A 4A95A 3D68A 3I9SA 4MI4A 5A28A 2QECA 5HVGA 4E0AA 3B8GA 2QMLA 2XEGA 5GCNA 3NH4A 4EVYA 2G3TA 4X3RA 4JZ0A 1IYKA 3BJ8A 4Q7AA 1TXRA 2OZGA 4NGPA 1X10A 4MRIA 3D7HA 5BWAB 2ZEGA 1NMTA 1YVKA 2ZW4A 3GKRA 4X8IA 1KZFA 2EVNA 4GM5A 1QSTA 2EK8A 4J3GA 4AVCA 2R8VA 4UWJA 5LYLA 3EO4A 3PB8X 3FEDA 4UIAA 4XNHB 4YGOA 4CGLA 1LOKA 3E0KA 4P4BA 4X2TA 4B10A 2Q44A 4QUSA 5F49A 2I00A 4NF1A 1IICA 3DGVA 1J4JA 2FS5A 1RXTA 1TKFA 2J8RA 3EXNA 4KZTA 4RN7A 1VGYA 2CXAA 1M4GA 2OB0A 3B2YA 3K2KA 1YSJA 4CAEA 3BLNA 5THWA 1TKJA 4P44A 1ELMP 3S6KA 2DEAA 1X12A 4IUSA 5F09A 1Y7EA 4FAIA 4OC0A 4R6TA 4CPAA 2HB6A 1WK4A 1CP7A 4UCPA 2BOAA 3R9EA 1Z4EA 4YU9A 4E2AA 1R43A 1XFOA 1FY7A 3KKWA 4OC3A 4CYNA 4OLLA 3PB4X 2CF4A 2ZXVA 2PJ7A 2DPSA 2FL4A 2QJ8A 2OZHA 3NH5A 2ANPA 3B3VA 4JWPA 4KOSA 4IF5A 4OP4A 1LAPA 5JH9A 1U6MA 3T90A 3TCVA 2AFOA 2ZW5A 4OIWA 3TO7A 4JYWA 4AG9A 2WSAA 1YMEA 4ONUA 3D4UA 2V8GA 1FT7A 4P4DA 4A37A 2C6CA 4PSXA 4RUHA 3F0AA 4X5KA 3PBEA 4PK2A 5EC4A 3WT4A 4A39A 4P4EA 3F5BA 2AE6A 4P4FA 3IFEA 2ZEFA 1AMPA 2PJ3A 3SXOA 1XEBA 3DDDA 3PB9X 1YLOA 3FVLA 4PQAA 4P4IA 5JGFA 1TIQA 3FMCA 2DPTA 3OWCA 3T9YA 1DE4C 4UF4A 2GANA 2I3CA 1M1DA 2QYVA 3PB7X 2OZUA 4QC6A 3SJFA 2P6FA 4F9VA 4Y49B 4E8OA 5D8NA 4UIBA 4KUAA 2PJCA 3G8WA 4NGRA 4ZGYB 4QVTA 1S7FA 4A33A 3NH8A 1MJAA 4FBEA 1QSNA 3FH4A 3LWUA 4CAVA 3CXQA 3N7ZA 1S7LA 3H8FA 5F48A 4HPSA 4KSAA 4MMOA 1Y0RA 1KUXA 4P4JA 1M4LA 4PXEA 4KSFA 2B58A 2FXFA 4XPDB 3B35A 5G21A 4K3NA 1HDUA 1IYLA 2XEFA 5LRGA 4NEXA 2PVWA 4A32A 3TE4A 2PE3A 2C27A 4JJXA 1CJWA 1PUAA 4UEZA 4XPKA 3PB6X 1XMTA 5AG5A 4O23A 4F6AA 4L8AA 2VBQA 1CPXA 3DR6A 1Z9UA 1XBUA 4UFWA 1LCPA 2Q04A 4MHDA 1KUVA 4MFKA 5HH1A 2CNMA 3H4QA 1Z4RA 2RC4A 2ATRA 4CRYB 3FB3A 2REFA 3SJEA 3KGQA 3HLPA 5K8MA 5K8OA 2IQ6A 2DXQA 5IB0A 4M85A 2JDDA 4CRZB 2C1CA 4YFJA 3PBBA 4KOYA 1ARLA 3CXPA 2GU2A 1M4DA 4FD7A 3VARA 1VHOA 1VHSA 1DTDA 2B5GA 3FYNA 3NFZA 2PVVA 5KTDA 4XNHC 3G3SA 3H8GA 3PFOA 4TNUA 3CDXA 4KOWA 4ONWA 3WABA 5D29A 1Z8TA 2AFMA 3PRTA 4P10A 1XF8A 5I0CA 2PJ9A 3W6XA 4NSQA 3GLJA 3R1KA 4AVAA 2Q4YA 2ABZA 1ARMA 2PJ8A 3B3SA 3LODA 2Z3LA 3CPAA 2EWBA 2PRBA 1XIXA 5AG4A 2PJ4A 3IWGA 4BINA 4R3LA 4KOVA 3KL9A 5LRKA 4F9UA 4K30A 2QVPA 2GE3A 1A2ZA 1LRZA 3RO0A 2K5TA 1GYTA 4NGSA 4KORA 2AFWA 5K8PA 2PJ1A 4CGPA 4B13A 4MFQA 4B11A 3S6HA 2GLFA 2XEJA 4OC2A 1IIDA 3FRMA 4MXUA 4FD5A 2X7BA 2V8HA 2PJ5A 1BO4A 1JWQA 2Q43A 4FUUA 4R87A 5AG6A 5G1ZA 4C2YA 5JQ4A 3H8EA 4WJBA 3EY5A 2C6PA 2JBKA 1PYTB 2PR8A 4ZX8A 2PIYA 3TO9A 1Q2YA 4HNYB 1ON0A 2F8HA 1F2PA 1IY7A 3D7DA 3VWDA 1RO5A 2FSRA 4UCNA 4YRHA 2ZW7A 4R9MA 1CBXA 2XEIA 5EMIA 5HMNA 3QAHA 3QNVA 3ZZIA 3T8WA 3IWWA 1H8LA 1Z2LA 2BEIA 4OC5A 3WC5A 5DWMA 4B5PB 1OBRA 2BO9A 4B12A 1BAVA 5H86A 3RAMA 5HXDA 1XJOA 2PJBA 2NMTA 3NE8A 4B5PA 1ZG8A 1R3NA 4PPZA 1Y7RA 4MY3A 4CS0B 2J8NA 7CPAA 1VKCA 4KLVA 4IK2A 2VZZA 3RYOA 4Y49C 3B3TA 4LUAA 4MFLA 5ELYA 4MJ8A 5CPAA 4MCPA 2EBJA 1TF8A 3D2MA 3IGRA 1UFHA 3MRUA 1YLEA 5CNPA 2AFZA 2Z0ZA 1Z8XA 2Z3MA 5HVFA 3SJXA 1K4JA 3JVNA 4CGMA 2R98A 1Q7LA 2R1IA 3VATA 5ISVA 2WPWA 3B7IA 3D2PA 4EWTA 2ZPAA 5EBVA 2FCKA 4PXBA 4OADA 3GIUA 4XPDC 4PSWA 5C82A 2YNCA 1ZG9A 3KZWA 1BPNA 5IB9A 4CGNA 2VXKA 2B4BA 2KCWA 1L0CA 3EFAA 3ZJ0A 2F7VA 4F0YA 3A9LA 1Y0YA 1XMBA 4MCQA 4A94A 4UFXA 4ZX9A 4AXVA 1IGBA 4YWYA 3V7ZA 3IO1A 1MJ9A 4MFPA 1LAMA 4KSIA 1CX8A 2ZEHA 3BI0A 4UEFA 5KTAA 4NXYA 3C26A 2AFUA 3K9TA 2V8VA 4CYQA 2PJ6A 2JLMA 6CPAA 1QSMA 2FT0A 2H5MA 2ZENA 2BSWA 4UA3A 2I79A 2FE7A 4PV6A 2HC9A 3TT2A 5FVJA 4BMHA 4NGTA 1ZG7A 2PC1A 3GY9A 2Y0MA 2YGWA 4P45A 4A30A 1F2OA 1MJBA 3LMSA 4NCZA 3D66A 3S6FA 2F5IA
chains in the Genus database with same CATH topology
4MHNA 3BXMA 5K8NA 4WWVA 4OIDA 2PJ0A 4FWUA 3HUVA 4G1PA 2PIZA 4EMEA 1TKHA 3PEIA 1KWMA 4ZY1A 2V8DA 1EE3P 3FX6A 1Z8LA 3ISZA 1ELLP 4NGMA 4R7MA 3FEEA 4H2KA 2IMOA 3DLJA 4NGNA 1Z5RA 3IEHA 4UEEA 2RB7A 3S9NA 3ISXA 4IAVA 2ZOFA 3BHXA 1BLLE 4NJRA 3KHZA 1PCAA 2ZELA 4BD9A 2POKA 2NYQA 1RTQA 3FECA 4NJQA 2PJ2A 2PCUA 1VIXA 3TX8A 3VH9A 2V77A 3GB0A 2G9DA 4F8ZA 2ZOGA 3FF3A 4R76A 3KASA 2PRQA 3SI1A 1JQGA 2GLJA 3JRUA 4NFRA 3IIBA 1AYEA 4OC1A 3CT9A 1NSAA 3CPXA 3IJ3A 8CPAA 1CPSA 4MHPA 1UWYA 1QQ9A 2NSMA 3N5FA 2O4HA 4Z65A 1LANA 4LQGA 4A38A 2ZEOA 4PXDA 4R8FA 3RZAA 4OKOA 4DJLA 2AFXA 1VHEA 3GUXA 4MCRA 2JEWA 2VL1A 5DS0A 3WC6A 2IJZA 3S9LA 4NGQA 3D67A 1LFWA 2AFSA 2ZEEA 2Q4ZA 3NA6A 2EK9A 5I4MA 3SI0A 3WC7A 4ZY0A 4MHZA 5CBMA 2CTCA 3KHXA 3SI2A 3KR5A 5LYIA 2BCOA 5HVHA 3V38A 4MHYA 2JBJA 3SJGA 1QMUA 3I1UA 5JM6A 3RBUA 1HDQA 4EFDA 2RFHA 3TC8A 1YW4A 4ZY2A 5LYDA 1XRYA 2OOTA 2CIJA 3KQXA 1ZLIA 4OMEA 1ZLHA 3KQZA 2ZEDA 2FVGA 3PFEA 4TWEA 2O53A 5LRJA 4DYOA 1HEEA 4ZI6A 1TF9A 2PJAA 2C6GA 4DUKA 1CG2A 3KI9A 4P6YA 3L2NA 3B3CA 2GREA 2WYRA 1CP6A 3D7GA 3BI1A 4OC4A 3D7FA 1FNOA 2OR4A 3KR4A 3S9MA 4B6ZA 2WZNA 5LYFA 2J9AA 4MCSA 4PXCA 3B3WA 1BPMA 2Q51A 3IC1A 2ZEMA 4ZYQA 5J1QA 1F57A 2ZEPA 3MN8A 1YW6A 4W9YA 2CTBA 3FJUA 4IHMA 3D68A 5HVGA 2XEGA 3NH4A 4X3RA 4JZ0A 4Q7AA 1TXRA 4NGPA 4MRIA 3D7HA 2ZEGA 4X8IA 4GM5A 2EK8A 5LYLA 3PB8X 3FEDA 4UIAA 1LOKA 4P4BA 4X2TA 3DGVA 1TKFA 1VGYA 3B2YA 3K2KA 1YSJA 5THWA 1TKJA 4P44A 1ELMP 2DEAA 5F09A 1Y7EA 4FAIA 4OC0A 4R6TA 4CPAA 2HB6A 1CP7A 2BOAA 4YU9A 1R43A 1XFOA 4OC3A 3PB4X 2CF4A 2PJ7A 2QJ8A 3NH5A 2ANPA 3B3VA 4OP4A 1LAPA 5JH9A 2AFOA 4OIWA 4JYWA 1YMEA 3D4UA 2V8GA 1FT7A 4P4DA 4A37A 2C6CA 4RUHA 3PBEA 4A39A 3WT4A 4P4EA 4P4FA 3IFEA 2ZEFA 1AMPA 2PJ3A 3PB9X 1YLOA 3FVLA 4PQAA 4P4IA 5JGFA 3FMCA 1DE4C 4UF4A 2I3CA 2QYVA 3PB7X 3SJFA 4F9VA 5D8NA 4UIBA 2PJCA 4NGRA 3NH8A 4FBEA 3FH4A 3LWUA 3H8FA 4MMOA 1Y0RA 4P4JA 1M4LA 4PXEA 3B35A 4K3NA 1HDUA 2XEFA 5LRGA 2PVWA 2PE3A 4UEZA 3PB6X 4O23A 1CPXA 1XBUA 1LCPA 3SJEA 3KGQA 3HLPA 5K8MA 5K8OA 2IQ6A 2C1CA 3PBBA 1ARLA 2GU2A 3VARA 1VHOA 1DTDA 3NFZA 2PVVA 3H8GA 3PFOA 4TNUA 3CDXA 4ONWA 3WABA 5D29A 2AFMA 3PRTA 4P10A 2PJ9A 3GLJA 3B3SA 2ABZA 1ARMA 2PJ8A 3CPAA 2EWBA 2PJ4A 3KL9A 5LRKA 4F9UA 2QVPA 1GYTA 4NGSA 2AFWA 5K8PA 2PJ1A 2GLFA 2XEJA 4OC2A 4MXUA 2V8HA 2PJ5A 4FUUA 2Q43A 3H8EA 4WJBA 2C6PA 2JBKA 1PYTB 4ZX8A 2PIYA 2F8HA 1F2PA 1IY7A 3D7DA 1CBXA 2XEIA 3QNVA 3T8WA 3IWWA 1H8LA 1Z2LA 3WC5A 4OC5A 1OBRA 2BO9A 1BAVA 3RAMA 5HXDA 1XJOA 2PJBA 1ZG8A 1R3NA 4PPZA 7CPAA 4IK2A 3B3TA 5ELYA 5CPAA 4MCPA 1TF8A 3MRUA 2AFZA 5HVFA 3SJXA 1Q7LA 3VATA 3B7IA 4EWTA 4PXBA 1ZG9A 3KZWA 1BPNA 5IB9A 2F7VA 4MCQA 1Y0YA 1XMBA 4A94A 4ZX9A 4AXVA 1IGBA 4YWYA 3V7ZA 3IO1A 1LAMA 4KSIA 1CX8A 2ZEHA 3BI0A 4UEFA 2AFUA 3K9TA 2V8VA 6CPAA 2PJ6A 2ZENA 2HC9A 4NGTA 1ZG7A 4P45A 1F2OA 3LMSA 3D66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MHN A;  3BXM A;  5K8N A;  4WWV A;  4OID A;  2PJ0 A;  4FWU A;  3HUV A;  4G1P A;  2PIZ A;  4EME A;  1TKH A;  3PEI A;  1KWM A;  4ZY1 A;  2V8D A;  1EE3 P;  3FX6 A;  1Z8L A;  3ISZ A;  1ELL P;  4NGM A;  4R7M A;  3FEE A;  4H2K A;  2IMO A;  3DLJ A;  4NGN A;  1Z5R A;  3IEH A;  4UEE A;  2RB7 A;  3S9N A;  3ISX A;  4IAV A;  2ZOF A;  3BHX A;  1BLL E;  4NJR A;  3KHZ A;  1PCA A;  2ZEL A;  4BD9 A;  2POK A;  2NYQ A;  1RTQ A;  3FEC A;  4NJQ A;  2PJ2 A;  2PCU A;  1VIX A;  3TX8 A;  3VH9 A;  2V77 A;  3GB0 A;  2G9D A;  4F8Z A;  2ZOG A;  3FF3 A;  4R76 A;  3KAS A;  2PRQ A;  3SI1 A;  1JQG A;  2GLJ A;  3JRU A;  4NFR A;  3IIB A;  1AYE A;  4OC1 A;  3CT9 A;  1NSA A;  3CPX A;  3IJ3 A;  8CPA A;  1CPS A;  4MHP A;  1UWY A;  1QQ9 A;  2NSM A;  3N5F A;  2O4H A;  4Z65 A;  1LAN A;  4LQG A;  4A38 A;  2ZEO A;  4PXD A;  4R8F A;  3RZA A;  4OKO A;  4DJL A;  2AFX A;  1VHE A;  3GUX A;  4MCR A;  2JEW A;  2VL1 A;  5DS0 A;  3WC6 A;  2IJZ A;  3S9L A;  4NGQ A;  3D67 A;  1LFW A;  2AFS A;  2ZEE A;  2Q4Z A;  3NA6 A;  2EK9 A;  5I4M A;  3SI0 A;  3WC7 A;  4ZY0 A;  4MHZ A;  5CBM A;  2CTC A;  3KHX A;  3SI2 A;  3KR5 A;  5LYI A;  2BCO A;  5HVH A;  3V38 A;  4MHY A;  2JBJ A;  3SJG A;  1QMU A;  3I1U A;  5JM6 A;  3RBU A;  1HDQ A;  4EFD A;  2RFH A;  3TC8 A;  1YW4 A;  4ZY2 A;  5LYD A;  1XRY A;  2OOT A;  2CIJ A;  3KQX A;  1ZLI A;  4OME A;  1ZLH A;  3KQZ A;  2ZED A;  2FVG A;  3PFE A;  4TWE A;  2O53 A;  5LRJ A;  4DYO A;  1HEE A;  4ZI6 A;  1TF9 A;  2PJA A;  2C6G A;  4DUK A;  1CG2 A;  3KI9 A;  4P6Y A;  3L2N A;  3B3C A;  2GRE A;  2WYR A;  1CP6 A;  3D7G A;  3BI1 A;  4OC4 A;  3D7F A;  1FNO A;  2OR4 A;  3KR4 A;  3S9M A;  4B6Z A;  2WZN A;  5LYF A;  2J9A A;  4MCS A;  4PXC A;  3B3W A;  1BPM A;  2Q51 A;  3IC1 A;  2ZEM A;  4ZYQ A;  5J1Q A;  1F57 A;  2ZEP A;  3MN8 A;  1YW6 A;  4W9Y A;  2CTB A;  3FJU A;  4IHM A;  3D68 A;  5HVG A;  2XEG A;  3NH4 A;  4X3R A;  4JZ0 A;  4Q7A A;  1TXR A;  4NGP A;  4MRI A;  3D7H A;  2ZEG A;  4X8I A;  4GM5 A;  2EK8 A;  5LYL A;  3PB8 X;  3FED A;  4UIA A;  1LOK A;  4P4B A;  4X2T A;  3DGV A;  1TKF A;  1VGY A;  3B2Y A;  3K2K A;  1YSJ A;  5THW A;  1TKJ A;  4P44 A;  1ELM P;  2DEA A;  5F09 A;  1Y7E A;  4FAI A;  4OC0 A;  4R6T A;  4CPA A;  2HB6 A;  1CP7 A;  2BOA A;  4YU9 A;  1R43 A;  1XFO A;  4OC3 A;  3PB4 X;  2CF4 A;  2PJ7 A;  2QJ8 A;  3NH5 A;  2ANP A;  3B3V A;  4OP4 A;  1LAP A;  5JH9 A;  2AFO A;  4OIW A;  4JYW A;  1YME A;  3D4U A;  2V8G A;  1FT7 A;  4P4D A;  4A37 A;  2C6C A;  4RUH A;  3PBE A;  4A39 A;  3WT4 A;  4P4E A;  4P4F A;  3IFE A;  2ZEF A;  1AMP A;  2PJ3 A;  3PB9 X;  1YLO A;  3FVL A;  4PQA A;  4P4I A;  5JGF A;  3FMC A;  1DE4 C;  4UF4 A;  2I3C A;  2QYV A;  3PB7 X;  3SJF A;  4F9V A;  5D8N A;  4UIB A;  2PJC A;  4NGR A;  3NH8 A;  4FBE A;  3FH4 A;  3LWU A;  3H8F A;  4MMO A;  1Y0R A;  4P4J A;  1M4L A;  4PXE A;  3B35 A;  4K3N A;  1HDU A;  2XEF A;  5LRG A;  2PVW A;  2PE3 A;  4UEZ A;  3PB6 X;  4O23 A;  1CPX A;  1XBU A;  1LCP A;  3SJE A;  3KGQ A;  3HLP A;  5K8M A;  5K8O A;  2IQ6 A;  2C1C A;  3PBB A;  1ARL A;  2GU2 A;  3VAR A;  1VHO A;  1DTD A;  3NFZ A;  2PVV A;  3H8G A;  3PFO A;  4TNU A;  3CDX A;  4ONW A;  3WAB A;  5D29 A;  2AFM A;  3PRT A;  4P10 A;  2PJ9 A;  3GLJ A;  3B3S A;  2ABZ A;  1ARM A;  2PJ8 A;  3CPA A;  2EWB A;  2PJ4 A;  3KL9 A;  5LRK A;  4F9U A;  2QVP A;  1GYT A;  4NGS A;  2AFW A;  5K8P A;  2PJ1 A;  2GLF A;  2XEJ A;  4OC2 A;  4MXU A;  2V8H A;  2PJ5 A;  4FUU A;  2Q43 A;  3H8E A;  4WJB A;  2C6P A;  2JBK A;  1PYT B;  4ZX8 A;  2PIY A;  2F8H A;  1F2P A;  1IY7 A;  3D7D A;  1CBX A;  2XEI A;  3QNV A;  3T8W A;  3IWW A;  1H8L A;  1Z2L A;  3WC5 A;  4OC5 A;  1OBR A;  2BO9 A;  1BAV A;  3RAM A;  5HXD A;  1XJO A;  2PJB A;  1ZG8 A;  1R3N A;  4PPZ A;  7CPA A;  4IK2 A;  3B3T A;  5ELY A;  5CPA A;  4MCP A;  1TF8 A;  3MRU A;  2AFZ A;  5HVF A;  3SJX A;  1Q7L A;  3VAT A;  3B7I A;  4EWT A;  4PXB A;  1ZG9 A;  3KZW A;  1BPN A;  5IB9 A;  2F7V A;  4MCQ A;  1Y0Y A;  1XMB A;  4A94 A;  4ZX9 A;  4AXV A;  1IGB A;  4YWY A;  3V7Z A;  3IO1 A;  1LAM A;  4KSI A;  1CX8 A;  2ZEH A;  3BI0 A;  4UEF A;  2AFU A;  3K9T A;  2V8V A;  6CPA A;  2PJ6 A;  2ZEN A;  2HC9 A;  4NGT A;  1ZG7 A;  4P45 A;  1F2O A;  3LMS A;  3D66 A; 
#chains in the Genus database with same CATH topology
 1Q2D A;  4MFZ A;  4MHN A;  3BXM A;  5K8N A;  5J8F A;  2CNT A;  2P6G A;  4KVO E;  2YND A;  4OID A;  4WWV A;  2PJ0 A;  4FWU A;  4M6I A;  3HUV A;  4G1P A;  4B14 A;  2B3V A;  1I21 A;  2PIZ A;  4C68 A;  4EME A;  4KVX A;  1P0H A;  1TKH A;  3PEI A;  4L89 A;  4H6Z A;  4UBR A;  3FNC A;  5DWN A;  3RNZ A;  1KWM A;  2Z3O A;  2P6E A;  4C7H A;  3PZJ A;  4M6H A;  2V8D A;  4ZY1 A;  3R96 A;  1IOI A;  1S7K A;  4U9Z A;  1EE3 P;  3R9F A;  2Z3N A;  1YK3 A;  4CYO A;  3FX6 A;  1Z8L A;  2GFQ A;  3ISZ A;  1S7N A;  1ELL P;  1YVO A;  3FIX A;  2VEZ A;  4NGM A;  4R3K A;  4R7M A;  4U5Y A;  3FEE A;  4H2K A;  2IMO A;  3DLJ A;  5G22 A;  1I1D A;  1IB1 E;  4Q36 A;  4H6U A;  5IX3 A;  4NGN A;  2PQ8 A;  1Z5R A;  3IEH A;  4UEE A;  2RB7 A;  3S9N A;  1ZO0 A;  2CNS A;  3ISX A;  2CY2 A;  1B87 A;  4IAV A;  4LX9 A;  2G3A A;  1N71 A;  2ZOF A;  3BHX A;  3VWE A;  4M3S A;  3DR8 A;  1BLL E;  4DNC A;  4KUB A;  4NJR A;  3I3G A;  4KOU A;  3KHZ A;  1Y9W A;  2Z3P A;  3FXT A;  1PCA A;  2ZEL A;  4A31 A;  4BD9 A;  5A27 A;  2REE A;  4F0X A;  2POK A;  2NYQ A;  1RTQ A;  3FEC A;  4NJQ A;  3R95 A;  2BL1 A;  2PJ2 A;  1S60 A;  1SQH A;  4KOX A;  2Q7B A;  2PCU A;  3FBU A;  1GHE A;  1YR0 A;  4C2X A;  1V0C A;  2ZW6 A;  1VIX A;  4FD6 A;  3TX8 A;  1Y9K A;  2V77 A;  5AG7 A;  3GB0 A;  3VH9 A;  2Z3K A;  3IWE A;  4C7I A;  4CYP A;  2G9D A;  4XPL A;  2GIV A;  4RI1 A;  1NE9 A;  4F8Z A;  2ZOG A;  3FF3 A;  4JXR A;  4HKF A;  4MBU A;  3KAS A;  4R76 A;  2YNE A;  2AJ6 A;  3IU1 A;  2PRQ A;  2D4O A;  4KVM E;  4CGO A;  3S6G A;  4GXH A;  3SI1 A;  1IOF A;  1JQG A;  2Q4V A;  3JTK A;  1BOB A;  1R57 A;  2GLJ A;  3JRU A;  4KLW A;  4NFR A;  4FD4 A;  4RS2 A;  2EO8 A;  2OH1 A;  4HNW B;  2JEV A;  1AYE A;  3IIB A;  4OC1 A;  3CT9 A;  4HNX B;  4A2Z A;  1P4N A;  2YNC C;  4UFV A;  1NSA A;  3CPX A;  3IJ3 A;  8CPA A;  3NE7 A;  4ORF A;  2B4D B;  4AG7 A;  1CPS A;  2HV2 A;  4H89 A;  4MHP A;  1UWY A;  4CAX A;  3QB8 A;  2B4D A;  2DF5 A;  2VI7 A;  1QQ9 A;  3BJ7 A;  3LD2 A;  2NSM A;  1Q2C A;  3N5F A;  1XE4 A;  3TOB A;  2O4H A;  5H84 A;  4Z65 A;  1LAN A;  4LQG A;  2VZY A;  2J8M A;  4A38 A;  2Z10 A;  3P2H A;  4UCM A;  2ZEO A;  4PXD A;  4R8F A;  3LAC A;  3R9G A;  4OAE A;  4UWI A;  3DSB A;  3PGP A;  4OKO A;  3RZA A;  2AFX A;  4CAF A;  4DJL A;  2G0B A;  5IV0 A;  1VHE A;  3CZX A;  3GUX A;  4MCR A;  2JEW A;  1XOV A;  4ZBG A;  2VL1 A;  4MY0 A;  4Q38 A;  5DS0 A;  2PSW A;  3H5Z A;  3WC6 A;  1QSO A;  2IJZ A;  4PK3 A;  3W91 A;  2FIA A;  2VQY A;  2PDO A;  3S9L A;  4NGQ A;  3D67 A;  1LFW A;  2AFS A;  2ZEE A;  2Q4Z A;  2ODF A;  3NA6 A;  2HUZ A;  2EK9 A;  3QAY A;  4GS4 A;  1YQE A;  1YGH A;  5I4M A;  3SI0 A;  3WC7 A;  4ZY0 A;  4MHZ A;  5CBM A;  1M44 A;  2CTC A;  4JXQ A;  1QSR A;  3SHP A;  4U9Y A;  3KHX A;  3SI2 A;  4BBH A;  3KR5 A;  5LYI A;  1Z8W A;  2BCO A;  3MGD A;  3PP9 A;  2D4P A;  3TO6 A;  3V38 A;  5HVH A;  4MHY A;  2JBJ A;  3SJG A;  3TOA A;  1QMU A;  1S5K A;  3I1U A;  5JM6 A;  2EUI A;  4KS9 A;  1HDQ A;  2PR1 A;  3RBU A;  4EFD A;  2ARH A;  2RFH A;  1MK4 A;  1AUG A;  1KUY A;  5J8C A;  3CXS A;  3TC8 A;  4R57 A;  4KOT A;  1YW4 A;  3EC4 A;  4ZY2 A;  1S3Z A;  5LYD A;  4AVB A;  2QIR A;  1XRY A;  5C88 A;  2OOT A;  2B3U A;  2CIJ A;  3KQX A;  3SXN A;  1ZLI A;  4OME A;  2O28 A;  4JD6 A;  1YX0 A;  5KTC A;  1ZLH A;  1NSL A;  3KQZ A;  1I12 A;  2ZED A;  4I49 A;  2FVG A;  3PFE A;  1YRE A;  4TWE A;  2A4N A;  2O53 A;  4LQ6 A;  5LRJ A;  4DYO A;  4MFJ A;  5JPH A;  1HEE A;  3K9U A;  4ZI6 A;  5F46 A;  1CM0 A;  1WWZ A;  2P0W A;  4C2Z A;  2HQY A;  1TF9 A;  2FIW A;  2PJA A;  1B6B A;  2C6G A;  2Q7S A;  2WPX A;  1OZP A;  5F47 A;  1CG2 A;  1M4I A;  2OU2 A;  3KI9 A;  4P6Y A;  4DUK A;  2IL4 A;  3JUW A;  3GYA A;  5G20 A;  2Q0Y A;  3L2N A;  4QB9 A;  3B3C A;  1PU9 A;  2GRE A;  1IU8 A;  3IU2 A;  3UY5 A;  4QBJ A;  3P2F A;  4JLY A;  2WYR A;  3TTH A;  3TFY A;  1CP6 A;  2Z11 A;  3D7G A;  3BI1 A;  4OC4 A;  3D7F A;  3D3S A;  1FNO A;  2R7H A;  2OR4 A;  3KR4 A;  3V8I A;  4CAW A;  3S9M A;  2WUU A;  4M6G A;  4B6Z A;  2WZN A;  3WR7 A;  5LYF A;  2J9A A;  4MCS A;  2B5G B;  4PXC A;  3B3W A;  1BPM A;  2BUE A;  2Q51 A;  2ZEM A;  3IC1 A;  4AB7 A;  4ZYQ A;  5J1Q A;  4II9 A;  1F57 A;  3W6S A;  2ZEP A;  5AGE A;  3MN8 A;  2JDC A;  3D8P A;  1YW6 A;  3F8K A;  4W9Y A;  3DNS A;  2CTB A;  4B5O A;  3FJU A;  4IHM A;  5E96 A;  4A95 A;  3D68 A;  3I9S A;  4MI4 A;  5A28 A;  2QEC A;  5HVG A;  4E0A A;  3B8G A;  2QML A;  2XEG A;  5GCN A;  3NH4 A;  4EVY A;  2G3T A;  4X3R A;  4JZ0 A;  1IYK A;  3BJ8 A;  4Q7A A;  1TXR A;  2OZG A;  4NGP A;  1X10 A;  4MRI A;  3D7H A;  5BWA B;  2ZEG A;  1NMT A;  1YVK A;  2ZW4 A;  3GKR A;  4X8I A;  1KZF A;  2EVN A;  4GM5 A;  1QST A;  2EK8 A;  4J3G A;  4AVC A;  2R8V A;  4UWJ A;  5LYL A;  3EO4 A;  3PB8 X;  3FED A;  4UIA A;  4XNH B;  4YGO A;  4CGL A;  1LOK A;  3E0K A;  4P4B A;  4X2T A;  4B10 A;  2Q44 A;  4QUS A;  5F49 A;  2I00 A;  4NF1 A;  1IIC A;  3DGV A;  1J4J A;  2FS5 A;  1RXT A;  1TKF A;  2J8R A;  3EXN A;  4KZT A;  4RN7 A;  1VGY A;  2CXA A;  1M4G A;  2OB0 A;  3B2Y A;  3K2K A;  1YSJ A;  4CAE A;  3BLN A;  5THW A;  1TKJ A;  4P44 A;  1ELM P;  3S6K A;  2DEA A;  1X12 A;  4IUS A;  5F09 A;  1Y7E A;  4FAI A;  4OC0 A;  4R6T A;  4CPA A;  2HB6 A;  1WK4 A;  1CP7 A;  4UCP A;  2BOA A;  3R9E A;  1Z4E A;  4YU9 A;  4E2A A;  1R43 A;  1XFO A;  1FY7 A;  3KKW A;  4OC3 A;  4CYN A;  4OLL A;  3PB4 X;  2CF4 A;  2ZXV A;  2PJ7 A;  2DPS A;  2FL4 A;  2QJ8 A;  2OZH A;  3NH5 A;  2ANP A;  3B3V A;  4JWP A;  4KOS A;  4IF5 A;  4OP4 A;  1LAP A;  5JH9 A;  1U6M A;  3T90 A;  3TCV A;  2AFO A;  2ZW5 A;  4OIW A;  3TO7 A;  4JYW A;  4AG9 A;  2WSA A;  1YME A;  4ONU A;  3D4U A;  2V8G A;  1FT7 A;  4P4D A;  4A37 A;  2C6C A;  4PSX A;  4RUH A;  3F0A A;  4X5K A;  3PBE A;  4PK2 A;  5EC4 A;  3WT4 A;  4A39 A;  4P4E A;  3F5B A;  2AE6 A;  4P4F A;  3IFE A;  2ZEF A;  1AMP A;  2PJ3 A;  3SXO A;  1XEB A;  3DDD A;  3PB9 X;  1YLO A;  3FVL A;  4PQA A;  4P4I A;  5JGF A;  1TIQ A;  3FMC A;  2DPT A;  3OWC A;  3T9Y A;  1DE4 C;  4UF4 A;  2GAN A;  2I3C A;  1M1D A;  2QYV A;  3PB7 X;  2OZU A;  4QC6 A;  3SJF A;  2P6F A;  4F9V A;  4Y49 B;  4E8O A;  5D8N A;  4UIB A;  4KUA A;  2PJC A;  3G8W A;  4NGR A;  4ZGY B;  4QVT A;  1S7F A;  4A33 A;  3NH8 A;  1MJA A;  4FBE A;  1QSN A;  3FH4 A;  3LWU A;  4CAV A;  3CXQ A;  3N7Z A;  1S7L A;  3H8F A;  5F48 A;  4HPS A;  4KSA A;  4MMO A;  1Y0R A;  1KUX A;  4P4J A;  1M4L A;  4PXE A;  4KSF A;  2B58 A;  2FXF A;  4XPD B;  3B35 A;  5G21 A;  4K3N A;  1HDU A;  1IYL A;  2XEF A;  5LRG A;  4NEX A;  2PVW A;  4A32 A;  3TE4 A;  2PE3 A;  2C27 A;  4JJX A;  1CJW A;  1PUA A;  4UEZ A;  4XPK A;  3PB6 X;  1XMT A;  5AG5 A;  4O23 A;  4F6A A;  4L8A A;  2VBQ A;  1CPX A;  3DR6 A;  1Z9U A;  1XBU A;  4UFW A;  1LCP A;  2Q04 A;  4MHD A;  1KUV A;  4MFK A;  5HH1 A;  2CNM A;  3H4Q A;  1Z4R A;  2RC4 A;  2ATR A;  4CRY B;  3FB3 A;  2REF A;  3SJE A;  3KGQ A;  3HLP A;  5K8M A;  5K8O A;  2IQ6 A;  2DXQ A;  5IB0 A;  4M85 A;  2JDD A;  4CRZ B;  2C1C A;  4YFJ A;  3PBB A;  4KOY A;  1ARL A;  3CXP A;  2GU2 A;  1M4D A;  4FD7 A;  3VAR A;  1VHO A;  1VHS A;  1DTD A;  2B5G A;  3FYN A;  3NFZ A;  2PVV A;  5KTD A;  4XNH C;  3G3S A;  3H8G A;  3PFO A;  4TNU A;  3CDX A;  4KOW A;  4ONW A;  3WAB A;  5D29 A;  1Z8T A;  2AFM A;  3PRT A;  4P10 A;  1XF8 A;  5I0C A;  2PJ9 A;  3W6X A;  4NSQ A;  3GLJ A;  3R1K A;  4AVA A;  2Q4Y A;  2ABZ A;  1ARM A;  2PJ8 A;  3B3S A;  3LOD A;  2Z3L A;  3CPA A;  2EWB A;  2PRB A;  1XIX A;  5AG4 A;  2PJ4 A;  3IWG A;  4BIN A;  4R3L A;  4KOV A;  3KL9 A;  5LRK A;  4F9U A;  4K30 A;  2QVP A;  2GE3 A;  1A2Z A;  1LRZ A;  3RO0 A;  2K5T A;  1GYT A;  4NGS A;  4KOR A;  2AFW A;  5K8P A;  2PJ1 A;  4CGP A;  4B13 A;  4MFQ A;  4B11 A;  3S6H A;  2GLF A;  2XEJ A;  4OC2 A;  1IID A;  3FRM A;  4MXU A;  4FD5 A;  2X7B A;  2V8H A;  2PJ5 A;  1BO4 A;  1JWQ A;  2Q43 A;  4FUU A;  4R87 A;  5AG6 A;  5G1Z A;  4C2Y A;  5JQ4 A;  3H8E A;  4WJB A;  3EY5 A;  2C6P A;  2JBK A;  1PYT B;  2PR8 A;  4ZX8 A;  2PIY A;  3TO9 A;  1Q2Y A;  4HNY B;  1ON0 A;  2F8H A;  1F2P A;  1IY7 A;  3D7D A;  3VWD A;  1RO5 A;  2FSR A;  4UCN A;  4YRH A;  2ZW7 A;  4R9M A;  1CBX A;  2XEI A;  5EMI A;  5HMN A;  3QAH A;  3QNV A;  3ZZI A;  3T8W A;  3IWW A;  1H8L A;  1Z2L A;  2BEI A;  4OC5 A;  3WC5 A;  5DWM A;  4B5P B;  1OBR A;  2BO9 A;  4B12 A;  1BAV A;  5H86 A;  3RAM A;  5HXD A;  1XJO A;  2PJB A;  2NMT A;  3NE8 A;  4B5P A;  1ZG8 A;  1R3N A;  4PPZ A;  1Y7R A;  4MY3 A;  4CS0 B;  2J8N A;  7CPA A;  1VKC A;  4KLV A;  4IK2 A;  2VZZ A;  3RYO A;  4Y49 C;  3B3T A;  4LUA A;  4MFL A;  5ELY A;  4MJ8 A;  5CPA A;  4MCP A;  2EBJ A;  1TF8 A;  3D2M A;  3IGR A;  1UFH A;  3MRU A;  1YLE A;  5CNP A;  2AFZ A;  2Z0Z A;  1Z8X A;  2Z3M A;  5HVF A;  3SJX A;  1K4J A;  3JVN A;  4CGM A;  2R98 A;  1Q7L A;  2R1I A;  3VAT A;  5ISV A;  2WPW A;  3B7I A;  3D2P A;  4EWT A;  2ZPA A;  5EBV A;  2FCK A;  4PXB A;  4OAD A;  3GIU A;  4XPD C;  4PSW A;  5C82 A;  2YNC A;  1ZG9 A;  3KZW A;  1BPN A;  5IB9 A;  4CGN A;  2VXK A;  2B4B A;  2KCW A;  1L0C A;  3EFA A;  3ZJ0 A;  2F7V A;  4F0Y A;  3A9L A;  1Y0Y A;  1XMB A;  4MCQ A;  4A94 A;  4UFX A;  4ZX9 A;  4AXV A;  1IGB A;  4YWY A;  3V7Z A;  3IO1 A;  1MJ9 A;  4MFP A;  1LAM A;  4KSI A;  1CX8 A;  2ZEH A;  3BI0 A;  4UEF A;  5KTA A;  4NXY A;  3C26 A;  2AFU A;  3K9T A;  2V8V A;  4CYQ A;  2PJ6 A;  2JLM A;  6CPA A;  1QSM A;  2FT0 A;  2H5M A;  2ZEN A;  2BSW A;  4UA3 A;  2I79 A;  2FE7 A;  4PV6 A;  2HC9 A;  3TT2 A;  5FVJ A;  4BMH A;  4NGT A;  1ZG7 A;  2PC1 A;  3GY9 A;  2Y0M A;  2YGW A;  4P45 A;  4A30 A;  1F2O A;  1MJB A;  3LMS A;  4NCZ A;  3D66 A;  3S6F A;  2F5I A; 
#chains in the Genus database with same CATH homology
 4MHN A;  3BXM A;  5K8N A;  4WWV A;  4OID A;  2PJ0 A;  4FWU A;  3HUV A;  4G1P A;  2PIZ A;  4EME A;  1TKH A;  3PEI A;  1KWM A;  4ZY1 A;  2V8D A;  1EE3 P;  3FX6 A;  1Z8L A;  3ISZ A;  1ELL P;  4NGM A;  4R7M A;  3FEE A;  4H2K A;  2IMO A;  3DLJ A;  4NGN A;  1Z5R A;  3IEH A;  4UEE A;  2RB7 A;  3S9N A;  3ISX A;  4IAV A;  2ZOF A;  3BHX A;  1BLL E;  4NJR A;  3KHZ A;  1PCA A;  2ZEL A;  4BD9 A;  2POK A;  2NYQ A;  1RTQ A;  3FEC A;  4NJQ A;  2PJ2 A;  2PCU A;  1VIX A;  3TX8 A;  3VH9 A;  2V77 A;  3GB0 A;  2G9D A;  4F8Z A;  2ZOG A;  3FF3 A;  4R76 A;  3KAS A;  2PRQ A;  3SI1 A;  1JQG A;  2GLJ A;  3JRU A;  4NFR A;  3IIB A;  1AYE A;  4OC1 A;  3CT9 A;  1NSA A;  3CPX A;  3IJ3 A;  8CPA A;  1CPS A;  4MHP A;  1UWY A;  1QQ9 A;  2NSM A;  3N5F A;  2O4H A;  4Z65 A;  1LAN A;  4LQG A;  4A38 A;  2ZEO A;  4PXD A;  4R8F A;  3RZA A;  4OKO A;  4DJL A;  2AFX A;  1VHE A;  3GUX A;  4MCR A;  2JEW A;  2VL1 A;  5DS0 A;  3WC6 A;  2IJZ A;  3S9L A;  4NGQ A;  3D67 A;  1LFW A;  2AFS A;  2ZEE A;  2Q4Z A;  3NA6 A;  2EK9 A;  5I4M A;  3SI0 A;  3WC7 A;  4ZY0 A;  4MHZ A;  5CBM A;  2CTC A;  3KHX A;  3SI2 A;  3KR5 A;  5LYI A;  2BCO A;  5HVH A;  3V38 A;  4MHY A;  2JBJ A;  3SJG A;  1QMU A;  3I1U A;  5JM6 A;  3RBU A;  1HDQ A;  4EFD A;  2RFH A;  3TC8 A;  1YW4 A;  4ZY2 A;  5LYD A;  1XRY A;  2OOT A;  2CIJ A;  3KQX A;  1ZLI A;  4OME A;  1ZLH A;  3KQZ A;  2ZED A;  2FVG A;  3PFE A;  4TWE A;  2O53 A;  5LRJ A;  4DYO A;  1HEE A;  4ZI6 A;  1TF9 A;  2PJA A;  2C6G A;  4DUK A;  1CG2 A;  3KI9 A;  4P6Y A;  3L2N A;  3B3C A;  2GRE A;  2WYR A;  1CP6 A;  3D7G A;  3BI1 A;  4OC4 A;  3D7F A;  1FNO A;  2OR4 A;  3KR4 A;  3S9M A;  4B6Z A;  2WZN A;  5LYF A;  2J9A A;  4MCS A;  4PXC A;  3B3W A;  1BPM A;  2Q51 A;  3IC1 A;  2ZEM A;  4ZYQ A;  5J1Q A;  1F57 A;  2ZEP A;  3MN8 A;  1YW6 A;  4W9Y A;  2CTB A;  3FJU A;  4IHM A;  3D68 A;  5HVG A;  2XEG A;  3NH4 A;  4X3R A;  4JZ0 A;  4Q7A A;  1TXR A;  4NGP A;  4MRI A;  3D7H A;  2ZEG A;  4X8I A;  4GM5 A;  2EK8 A;  5LYL A;  3PB8 X;  3FED A;  4UIA A;  1LOK A;  4P4B A;  4X2T A;  3DGV A;  1TKF A;  1VGY A;  3B2Y A;  3K2K A;  1YSJ A;  5THW A;  1TKJ A;  4P44 A;  1ELM P;  2DEA A;  5F09 A;  1Y7E A;  4FAI A;  4OC0 A;  4R6T A;  4CPA A;  2HB6 A;  1CP7 A;  2BOA A;  4YU9 A;  1R43 A;  1XFO A;  4OC3 A;  3PB4 X;  2CF4 A;  2PJ7 A;  2QJ8 A;  3NH5 A;  2ANP A;  3B3V A;  4OP4 A;  1LAP A;  5JH9 A;  2AFO A;  4OIW A;  4JYW A;  1YME A;  3D4U A;  2V8G A;  1FT7 A;  4P4D A;  4A37 A;  2C6C A;  4RUH A;  3PBE A;  4A39 A;  3WT4 A;  4P4E A;  4P4F A;  3IFE A;  2ZEF A;  1AMP A;  2PJ3 A;  3PB9 X;  1YLO A;  3FVL A;  4PQA A;  4P4I A;  5JGF A;  3FMC A;  1DE4 C;  4UF4 A;  2I3C A;  2QYV A;  3PB7 X;  3SJF A;  4F9V A;  5D8N A;  4UIB A;  2PJC A;  4NGR A;  3NH8 A;  4FBE A;  3FH4 A;  3LWU A;  3H8F A;  4MMO A;  1Y0R A;  4P4J A;  1M4L A;  4PXE A;  3B35 A;  4K3N A;  1HDU A;  2XEF A;  5LRG A;  2PVW A;  2PE3 A;  4UEZ A;  3PB6 X;  4O23 A;  1CPX A;  1XBU A;  1LCP A;  3SJE A;  3KGQ A;  3HLP A;  5K8M A;  5K8O A;  2IQ6 A;  2C1C A;  3PBB A;  1ARL A;  2GU2 A;  3VAR A;  1VHO A;  1DTD A;  3NFZ A;  2PVV A;  3H8G A;  3PFO A;  4TNU A;  3CDX A;  4ONW A;  3WAB A;  5D29 A;  2AFM A;  3PRT A;  4P10 A;  2PJ9 A;  3GLJ A;  3B3S A;  2ABZ A;  1ARM A;  2PJ8 A;  3CPA A;  2EWB A;  2PJ4 A;  3KL9 A;  5LRK A;  4F9U A;  2QVP A;  1GYT A;  4NGS A;  2AFW A;  5K8P A;  2PJ1 A;  2GLF A;  2XEJ A;  4OC2 A;  4MXU A;  2V8H A;  2PJ5 A;  4FUU A;  2Q43 A;  3H8E A;  4WJB A;  2C6P A;  2JBK A;  1PYT B;  4ZX8 A;  2PIY A;  2F8H A;  1F2P A;  1IY7 A;  3D7D A;  1CBX A;  2XEI A;  3QNV A;  3T8W A;  3IWW A;  1H8L A;  1Z2L A;  3WC5 A;  4OC5 A;  1OBR A;  2BO9 A;  1BAV A;  3RAM A;  5HXD A;  1XJO A;  2PJB A;  1ZG8 A;  1R3N A;  4PPZ A;  7CPA A;  4IK2 A;  3B3T A;  5ELY A;  5CPA A;  4MCP A;  1TF8 A;  3MRU A;  2AFZ A;  5HVF A;  3SJX A;  1Q7L A;  3VAT A;  3B7I A;  4EWT A;  4PXB A;  1ZG9 A;  3KZW A;  1BPN A;  5IB9 A;  2F7V A;  4MCQ A;  1Y0Y A;  1XMB A;  4A94 A;  4ZX9 A;  4AXV A;  1IGB A;  4YWY A;  3V7Z A;  3IO1 A;  1LAM A;  4KSI A;  1CX8 A;  2ZEH A;  3BI0 A;  4UEF A;  2AFU A;  3K9T A;  2V8V A;  6CPA A;  2PJ6 A;  2ZEN A;  2HC9 A;  4NGT A;  1ZG7 A;  4P45 A;  1F2O A;  3LMS A;  3D66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...