2ZEDA

Crystal structure of the human glutaminyl cyclase mutant s160a at 1.7 angstrom resolution
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
329
structure length
323
Chain Sequence
ASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDAAVPCAMMLELARALDKKLLSLKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl-peptide cyclotransferase
publication title A conserved hydrogen-bond network in the catalytic centre of animal glutaminyl cyclases is critical for catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 323
sequence length 329
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2007-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 2zedA00
1IGBA 3BXMA 4WWVA 2CTBA 2C6GA 3D7FA 4W9YA 4OC4A 3KL9A 4R7MA 4F8ZA 1Z5RA 4PXDA 2Q51A 4OC5A 1YSJA 1LANA 3BI0A 5IB9A 1JQGA 1HEEA 3N5FA 4OP4A 3FVLA 4TWEA 2EK8A 2HB6A 4Z65A 2XEFA 1XRYA 1XBUA 5CPAA 2PJ1A 2JBKA 3D68A 3HUVA 4UEZA 3IEHA 5LRGA 3SJXA 3S9LA 2CF4A 5THWA 1XFOA 5D29A 2F7VA 3B7IA 1Y0YA 4B6ZA 3KZWA 4OKOA 3JRUA 1YW4A 1LCPA 4ZX8A 3BHXA 3DLJA 2VL1A 2V77A 3SJGA 3HLPA 2WZNA 1M4LA 2PIYA 3IIBA 4X2TA 1Z2LA 3KQXA 2OOTA 4EFDA 2BO9A 1QMUA 4G1PA 4OC3A 3SI2A 2HC9A 2Q4ZA 4MRIA 2PJBA 2OR4A 3KR5A 2PJCA 1DTDA 3NH5A 4FUUA 4ZY2A 1LAPA 3FEEA 1ZG9A 2PJ9A 1VGYA 3K2KA 4UIBA 2IJZA 4EMEA 5LYFA 1PCAA 3PB9X 4UEEA 4NGTA 5CBMA 5JH9A 2ZEHA 1CBXA 3VATA 4H2KA 2I3CA 4JYWA 3NH8A 1LFWA 5K8OA 2V8VA 2PJ2A 3FF3A 3TC8A 2XEGA 3D7DA 3QNVA 4PQAA 2J9AA 5K8PA 2Q43A 1GYTA 2GLJA 5LYDA 3KGQA 3D66A 2PVVA 4ZY1A 2PJ3A 4UIAA 4NGQA 1YW6A 3TX8A 3VARA 4F9UA 2PJ0A 4P4BA 1ELLP 2PE3A 3DGVA 2NSMA 1TF9A 2ANPA 3FEDA 3H8EA 3KI9A 4A39A 4NGPA 4MCPA 3WABA 5I4MA 4O23A 4NGSA 1R3NA 2ABZA 4YU9A 2ZEFA 4PXCA 4OC1A 2EK9A 3PB8X 4MHYA 2PRQA 2ZOFA 4R8FA 3H8GA 4LQGA 5K8NA 2GREA 3L2NA 1DE4C 5DS0A 2PVWA 1ARLA 2ZEGA 3RZAA 3H8FA 3SI1A 4P4JA 4MHZA 2PJ8A 3B3VA 3FMCA 2AFZA 1BLLE 4OMEA 1RTQA 3K9TA 4MCSA 5HVHA 4WJBA 3I1UA 4ZI6A 3WC5A 1NSAA 2IQ6A 1H8LA 1LOKA 1XJOA 3RBUA 2C6CA 3FH4A 5J1QA 1CX8A 2PJ4A 3KR4A 3T8WA 4P4IA 4ZYQA 4OC2A 3IWWA 2BCOA 2RB7A 1TKHA 4A38A 1HDUA 1QQ9A 4OC0A 5ELYA 2DEAA 2ZEPA 4R6TA 4UEFA 4GM5A 4A94A 1YMEA 4NJRA 2C6PA 5D8NA 3MN8A 2PJ5A 3PFEA 3S9NA 3ISZA 3CDXA 2GU2A 1F2OA 3B35A 1VHOA 5K8MA 5LRKA 1FT7A 2EWBA 2IMOA 2ZENA 4NJQA 2JEWA 4JZ0A 1IY7A 4MHNA 3NA6A 3FECA 2RFHA 4FBEA 3WT4A 1AYEA 2ZEDA 3GLJA 4ONWA 5HXDA 1ARMA 4IK2A 5JM6A 1HDQA 5LYIA 2AFSA 4R76A 3D7HA 1AMPA 3B3CA 4AXVA 2C1CA 1Y7EA 3KHZA 4MXUA 3B3WA 4P45A 2ZEOA 3IFEA 2ZELA 3CPAA 3MRUA 1R43A 3D7GA 3SI0A 3NFZA 3NH4A 4PPZA 4F9VA 1ZG7A 3RAMA 3CT9A 5LRJA 4NFRA 3FX6A 4TNUA 4X3RA 3VH9A 4NGMA 4IHMA 2V8DA 2AFXA 3SJFA 1OBRA 4NGNA 2O53A 3PRTA 2POKA 2XEIA 3D67A 1CPXA 3IC1A 1LAMA 4YWYA 3PFOA 4EWTA 4X8IA 1ELMP 5JGFA 3KQZA 1Z8LA 4RUHA 4MMOA 2BOAA 3FJUA 2AFMA 3PEIA 4ZY0A 1KWMA 4PXBA 3B2YA 4IAVA 3IJ3A 4OIDA 2CIJA 2AFOA 6CPAA 3B3TA 2QYVA 3KASA 4DJLA 1Q7LA 4BD9A 3GUXA 2G9DA 3D4UA 2FVGA 2PJ6A 3CPXA 2PIZA 3GB0A 1ZG8A 2WYRA 5LYLA 4MCQA 1FNOA 2NYQA 1TKJA 4K3NA 2V8GA 4P6YA 1EE3P 4FAIA 1CPSA 1PYTB 2PJAA 3PB4X 4P10A 1YLOA 3S9MA 2GLFA 1F57A 3PBEA 1UWYA 1XMBA 4OIWA 5HVFA 2O4HA 4CPAA 2CTCA 1TKFA 1TXRA 2V8HA 4Q7AA 4P4FA 4DYOA 3LWUA 4P44A 3BI1A 2AFUA 2QJ8A 1Y0RA 2AFWA 1BPMA 1VHEA 1ZLHA 1TF8A 1CG2A 4DUKA 1BPNA 3V38A 4P4DA 3ISXA 2XEJA 3WC7A 1CP6A 1CP7A 2F8HA 8CPAA 1VIXA 4P4EA 3PB6X 4UF4A 3LMSA 3WC6A 5F09A 2QVPA 4A37A 4MCRA 3IO1A 2JBJA 3KHXA 7CPAA 1F2PA 2ZOGA 4FWUA 4ZX9A 4MHPA 4KSIA 5HVGA 2ZEMA 3PBBA 2PCUA 4NGRA 2PJ7A 3B3SA 1ZLIA 1BAVA 4PXEA 3SJEA 2ZEEA 3V7ZA 3PB7X
chains in the Genus database with same CATH superfamily
1N71A 1IGBA 1XF8A 3BXMA 2WPWA 1KUVA 4KOTA 4WWVA 2CTBA 1PUAA 4U9YA 3QAYA 2OZHA 5EC4A 2C6GA 3NE7A 3D7FA 4UWJA 4W9YA 4OC4A 5AG5A 4JD6A 1YLEA 3KL9A 4R7MA 2DF5A 2YNCA 4F8ZA 2J8RA 1Z5RA 4GS4A 4B11A 3LD2A 4PXDA 5E96A 4CAEA 3CXQA 3R9GA 5F46A 2Q51A 2YNEA 4OC5A 4KVXA 1YSJA 1LANA 1S5KA 3OWCA 1B6BA 4ZBGA 3BI0A 3VWEA 2GANA 4MFQA 5IB9A 1JQGA 2I00A 4YRHA 1HEEA 1QSTA 3N5FA 2Z3NA 3FVLA 4OP4A 2EK8A 2HB6A 4TWEA 4Z65A 2XEFA 1XRYA 1XBUA 2H5MA 4PK3A 5CPAA 1BOBA 2PJ1A 1M4IA 1J4JA 2JBKA 3D68A 3I3GA 4QUSA 1P0HA 3HUVA 4UEZA 3IEHA 4XNHB 1IYLA 5LRGA 3SJXA 3S9LA 2CF4A 3FBUA 5THWA 4FD4A 1XFOA 1Y7RA 2EUIA 2F7VA 1NMTA 3F5BA 3B7IA 5D29A 4M6HA 1Y0YA 3CXSA 4B6ZA 3KZWA 5C88A 4OKOA 3JRUA 2GIVA 1YW4A 2G0BA 4LX9A 2VBQA 4MI4A 2PQ8A 1LCPA 4ZX8A 3BHXA 3DLJA 2VL1A 2V77A 4KUAA 4B5PB 1YREA 3LODA 4QVTA 4M6GA 3SJGA 3HLPA 4HNYB 3PZJA 3LACA 5IX3A 2WZNA 1M4LA 2PIYA 3IIBA 4X2TA 1Z2LA 3KQXA 2OOTA 4EFDA 2BO9A 1QMUA 4FD6A 3EFAA 4G1PA 4OC3A 2HC9A 4KSAA 4JWPA 4XNHC 2CNMA 2Q4ZA 3SI2A 4MRIA 2PJBA 3F8KA 4CAXA 2OR4A 2FT0A 3KR5A 2PJCA 3JVNA 1DTDA 1VKCA 4LQ6A 5IB0A 2VXKA 1MJBA 3NH5A 4FUUA 2OZUA 1LAPA 4KOVA 4ZY2A 2P6EA 3FEEA 4A31A 5G21A 3FB3A 4XPKA 2ODFA 1ZG9A 2PJ9A 4CGNA 1YVOA 1VGYA 3K2KA 4UIBA 2IJZA 4NCZA 4EMEA 4U9ZA 2IL4A 5LYFA 1PCAA 3PB9X 4UEEA 5F47A 4NGTA 4MY0A 5CBMA 5JH9A 2Z3OA 2ZEHA 4XPDB 1CBXA 4RI1A 4UCMA 4H89A 2A4NA 3VATA 4H2KA 2I3CA 2Q4YA 3PGPA 2CNSA 3NH8A 4JYWA 4BMHA 3R9EA 1MJ9A 1LFWA 2OH1A 5K8OA 2V8VA 2PJ2A 3FF3A 5FVJA 2XEGA 3D7DA 3TC8A 3QNVA 4MFKA 2J9AA 4NEXA 4PQAA 4AVBA 5K8PA 2Q43A 4M3SA 4C2XA 1GYTA 2G3TA 3DR6A 2GLJA 2Z3PA 5LYDA 4BINA 3KGQA 2F5IA 2Z3LA 1JWQA 3D66A 5GCNA 1GHEA 5BWAB 4HNWB 2PVVA 4A95A 3D2MA 4ZY1A 5CNPA 2PJ3A 1I12A 4UIAA 1CM0A 4NGQA 1YW6A 3TX8A 4PSXA 3VARA 2Q44A 4HNXB 4F9UA 2PJ0A 4P4BA 1ELLP 2PE3A 3BLNA 3DGVA 4B10A 2NSMA 2QIRA 1TF9A 4C7HA 3H5ZA 2ANPA 2BEIA 4H6ZA 5H86A 2KCWA 2OU2A 3EY5A 3FEDA 3GIUA 3H8EA 3KI9A 4KOSA 2K5TA 3WR7A 2ZXVA 4A39A 4C2ZA 4ONUA 1Z4EA 4NGPA 1M1DA 1QSMA 2GE3A 4UWIA 2Z10A 4E8OA 2AJ6A 1M4GA 4MCPA 3WABA 5I4MA 4O23A 1PU9A 4NGSA 1VHSA 4CGPA 3FRMA 1R3NA 2ABZA 2VEZA 4YU9A 4JXQA 3GKRA 2ZEFA 4PXCA 1Z8WA 2J8NA 4OC1A 2B4DA 4MFPA 4IUSA 3TTHA 2EK9A 3PB8X 4MHYA 4H6UA 4ORFA 2PRQA 2PR8A 4Q36A 2ZOFA 4R8FA 4RN7A 3H8GA 4CYNA 2YGWA 1MK4A 2Q04A 1IIDA 2FE7A 4MFZA 4LQGA 5K8NA 4JLYA 3EXNA 2GREA 5EBVA 4F6AA 3L2NA 4PV6A 4F0YA 3S6HA 1DE4C 1LRZA 5DS0A 4CYPA 2PVWA 3GYAA 5HH1A 1ARLA 2ZEGA 3RZAA 5J8CA 1YGHA 3H8FA 4KUBA 3SI1A 2BL1A 1S60A 3FNCA 4L8AA 2OZGA 4P4JA 2JEVA 4MHZA 5A28A 1QSNA 1BO4A 2EBJA 2PJ8A 4AG7A 2ZPAA 4UFVA 1V0CA 3B3VA 5F48A 3FMCA 2AFZA 4UCNA 4ZGYB 3QAHA 5AG6A 1TIQA 4HPSA 4OADA 1BLLE 3D2PA 4OMEA 1RTQA 3IWGA 1K4JA 2P0WA 1XOVA 3K9TA 1YX0A 4MCSA 1KUYA 2AE6A 2D4OA 1YR0A 4R57A 5HVHA 4WJBA 3I1UA 2Q7BA 4PSWA 2FXFA 4ZI6A 3WC5A 1NSAA 2IQ6A 5JQ4A 4AG9A 4E2AA 1OZPA 2VZYA 1H8LA 1LOKA 3DR8A 1XJOA 3G3SA 2C6CA 3FH4A 3RBUA 3UY5A 4A33A 4B13A 5J1QA 1CX8A 3R9FA 2PJ4A 3KKWA 3KR4A 3R96A 3T8WA 2B4DB 3VWDA 4P4IA 4ZYQA 4OC2A 3IWWA 2BCOA 2RB7A 4R3LA 1Z8TA 1TKHA 4A38A 3QB8A 1HDUA 1FY7A 1QQ9A 4JXRA 4OC0A 5ELYA 2DEAA 4A32A 2ZEPA 4R6TA 4UEFA 5DWNA 1R57A 1M4DA 3SXOA 4CYQA 1X10A 3JUWA 4GM5A 3TO7A 4A94A 1YMEA 4II9A 4LUAA 2CY2A 3MGDA 5G22A 3W91A 4NJRA 2C6PA 2VI7A 2YNDA 5D8NA 4CAFA 3MN8A 1ZO0A 1S7KA 2PJ5A 3PFEA 2EO8A 3S9NA 3ISZA 5A27A 3CDXA 2GU2A 3NE8A 1F2OA 2ZW4A 3B35A 1VHOA 2ATRA 2BUEA 5K8MA 5LRKA 1FT7A 2EWBA 2IMOA 3K9UA 2ZENA 4KORA 4M85A 2JEWA 1U6MA 2HQYA 4JZ0A 4MJ8A 1NE9A 3DDDA 3I9SA 4NJQA 5EMIA 4BBHA 1IY7A 2RC4A 4MHNA 3NA6A 4J3GA 1I1DA 1Y9WA 2RFHA 1XEBA 3FECA 3S6GA 4FBEA 3WT4A 1AYEA 2ZEDA 1WWZA 3GLJA 4HKFA 4E0AA 4ONWA 5HMNA 4NXYA 5HXDA 4UCPA 4KOXA 5I0CA 4CS0B 1B87A 1ARMA 4IK2A 4C68A 2B4BA 3IGRA 1UFHA 1XE4A 1HDQA 3PP9A 5JM6A 5LYIA 2FSRA 2AFSA 3CXPA 3D7HA 4R76A 4B12A 1AMPA 2VQYA 3B3CA 4AXVA 4XPDC 2C1CA 1Y7EA 2P6FA 3KHZA 4MXUA 2CNTA 3B3WA 3FYNA 5KTAA 4QB9A 4P45A 2B3VA 2ZEOA 2R98A 4C2YA 3IFEA 2ZELA 5KTDA 3CPAA 3MRUA 1R43A 3D7GA 4MY3A 3SI0A 3TO6A 4A2ZA 3NFZA 4QC6A 3NH4A 4PPZA 4CAWA 4F9VA 1ZG7A 3RAMA 5DWMA 3CZXA 4UFWA 3CT9A 5LRJA 2ARHA 4NFRA 3FX6A 4TNUA 4X3RA 2ZW6A 3VH9A 5H84A 4NGMA 2G3AA 2PC1A 4IHMA 2Z3MA 2V8DA 2AFXA 2DXQA 3SJFA 1OBRA 1YQEA 4NGNA 2O53A 2REEA 2Q4VA 3PRTA 2POKA 2J8MA 2XEIA 2B5GB 3D67A 1CPXA 3IC1A 4CRYB 1LAMA 4YWYA 4CAVA 2I79A 3IU1A 3PFOA 4CRZB 4KVOE 4X8IA 4EWTA 1ELMP 3FXTA 5JGFA 1IOIA 1S7FA 3ZJ0A 2C27A 3KQZA 1Z8LA 3RO0A 4RUHA 1Z4RA 2QMLA 4MMOA 5G1ZA 5KTCA 4CGLA 2BOAA 3FJUA 1Z8XA 2AFMA 4KOYA 4KVME 3PEIA 3TE4A 3DSBA 3TOAA 4ZY0A 1S7NA 1KWMA 4PXBA 4B14A 4DNCA 3B2YA 4IAVA 3IJ3A 4OIDA 5AG7A 1Y9KA 4YGOA 2CIJA 1KZFA 2AFOA 3SHPA 3D3SA 4A30A 6CPAA 4GXHA 1XIXA 3B3TA 4KLWA 2QYVA 5JPHA 2PSWA 3KASA 1X12A 4DJLA 2JLMA 1Q7LA 4L89A 1KUXA 4BD9A 1IB1E 3GUXA 2G9DA 3D4UA 2FIWA 3FIXA 2FVGA 2PJ6A 3TCVA 3N7ZA 4MFLA 3CPXA 4KOUA 3R95A 2PIZA 4QBJA 2PDOA 4NSQA 4KZTA 3GB0A 1ZG8A 1A2ZA 2WYRA 3IWEA 5LYLA 1FNOA 2NYQA 1IYKA 4MCQA 3P2FA 2B58A 4PK2A 4CYOA 5IV0A 4KLVA 4MBUA 3P2HA 3ZZIA 1TKJA 4X5KA 4K3NA 1M44A 2V8GA 4KSFA 4P6YA 1Q2CA 1EE3P 2O28A 4UBRA 4FAIA 1CPSA 1PYTB 2R7HA 2EVNA 2PJAA 4NF1A 4Q38A 4AB7A 2Z3KA 1IICA 3PB4X 1Q2YA 3V8IA 1QSOA 1Q2DA 4K30A 3TO9A 4P10A 1I21A 2PRBA 2VZZA 2Z11A 4OLLA 2OB0A 4KOWA 1YLOA 1YK3A 4UA3A 2ZW7A 4EVYA 5J8FA 3DNSA 2GLFA 3S9MA 1F57A 3PBEA 2X7BA 1YVKA 3D8PA 1QSRA 4FD5A 1NSLA 1UWYA 3B8GA 4MFJA 1XMBA 4OIWA 3IU2A 5HVFA 2O4HA 3T90A 4F0XA 5C82A 4OAEA 3W6SA 3H4QA 4CPAA 2WSAA 2CTCA 1TKFA 2B5GA 3BJ7A 4FD7A 1MJAA 1TXRA 2V8HA 4Q7AA 3R1KA 4MHDA 4P4FA 2REFA 4DYOA 3LWUA 4P44A 4C7IA 3BI1A 2AFUA 3C26A 4B5OA 1CJWA 3T9YA 1L0CA 2PR1A 2QECA 4I49A 4Y49B 2HV2A 4XPLA 3S6FA 2QJ8A 1Y0RA 2AFWA 2CXAA 3G8WA 3GY9A 1BPMA 1S7LA 4IF5A 1VHEA 3RYOA 5AG4A 4RS2A 1ZLHA 2JDCA 2BSWA 2WPXA 3TT2A 1TF8A 1CG2A 2JDDA 3W6XA 4DUKA 2HUZA 4R87A 1BPNA 2FCKA 3A9LA 3V38A 2D4PA 4P4DA 3ISXA 2R8VA 2XEJA 2R1IA 3WC7A 2Q0YA 2FL4A 2WUUA 1CP6A 5F49A 2YNCC 3JTKA 5ISVA 1IOFA 1XMTA 1CP7A 2F8HA 8CPAA 1RO5A 1VIXA 3PB6X 4P4EA 1P4NA 4UF4A 3LMSA 3SXNA 3WC6A 5F09A 5G20A 2QVPA 4A37A 4YFJA 4Y49C 4MCRA 3IO1A 3F0AA 2JBJA 2NMTA 3KHXA 2DPSA 4R3KA 1Z9UA 2DPTA 2ZW5A 3S6KA 1WK4A 2Y0MA 7CPAA 2Z0ZA 3RNZA 2GFQA 1F2PA 4M6IA 2ZOGA 1RXTA 4FWUA 2P6GA 4ZX9A 4MHPA 1SQHA 4KSIA 5HVGA 4UFXA 2ZEMA 2FIAA 3PBBA 3BJ8A 2Q7SA 2PCUA 3EC4A 4JJXA 4NGRA 3TOBA 4AVCA 4R9MA 3E0KA 2PJ7A 2B3UA 4U5YA 3EO4A 4AVAA 1ON0A 1ZLIA 1IU8A 3B3SA 3TFYA 2FS5A 1BAVA 1S3ZA 4PXEA 1AUGA 4CGOA 4KS9A 3SJEA 2ZEEA 5AGEA 3V7ZA 4CGMA 4B5PA 3PB7X
chains in the Genus database with same CATH topology
1IGBA 3BXMA 4WWVA 2CTBA 2C6GA 3D7FA 4W9YA 4OC4A 3KL9A 4R7MA 4F8ZA 1Z5RA 4PXDA 2Q51A 4OC5A 1YSJA 1LANA 3BI0A 5IB9A 1JQGA 1HEEA 3N5FA 4OP4A 3FVLA 4TWEA 2EK8A 2HB6A 4Z65A 2XEFA 1XRYA 1XBUA 5CPAA 2PJ1A 2JBKA 3D68A 3HUVA 4UEZA 3IEHA 5LRGA 3SJXA 3S9LA 2CF4A 5THWA 1XFOA 5D29A 2F7VA 3B7IA 1Y0YA 4B6ZA 3KZWA 4OKOA 3JRUA 1YW4A 1LCPA 4ZX8A 3BHXA 3DLJA 2VL1A 2V77A 3SJGA 3HLPA 2WZNA 1M4LA 2PIYA 3IIBA 4X2TA 1Z2LA 3KQXA 2OOTA 4EFDA 2BO9A 1QMUA 4G1PA 4OC3A 3SI2A 2HC9A 2Q4ZA 4MRIA 2PJBA 2OR4A 3KR5A 2PJCA 1DTDA 3NH5A 4FUUA 4ZY2A 1LAPA 3FEEA 1ZG9A 2PJ9A 1VGYA 3K2KA 4UIBA 2IJZA 4EMEA 5LYFA 1PCAA 3PB9X 4UEEA 4NGTA 5CBMA 5JH9A 2ZEHA 1CBXA 3VATA 4H2KA 2I3CA 4JYWA 3NH8A 1LFWA 5K8OA 2V8VA 2PJ2A 3FF3A 3TC8A 2XEGA 3D7DA 3QNVA 4PQAA 2J9AA 5K8PA 2Q43A 1GYTA 2GLJA 5LYDA 3KGQA 3D66A 2PVVA 4ZY1A 2PJ3A 4UIAA 4NGQA 1YW6A 3TX8A 3VARA 4F9UA 2PJ0A 4P4BA 1ELLP 2PE3A 3DGVA 2NSMA 1TF9A 2ANPA 3FEDA 3H8EA 3KI9A 4A39A 4NGPA 4MCPA 3WABA 5I4MA 4O23A 4NGSA 1R3NA 2ABZA 4YU9A 2ZEFA 4PXCA 4OC1A 2EK9A 3PB8X 4MHYA 2PRQA 2ZOFA 4R8FA 3H8GA 4LQGA 5K8NA 2GREA 3L2NA 1DE4C 5DS0A 2PVWA 1ARLA 2ZEGA 3RZAA 3H8FA 3SI1A 4P4JA 4MHZA 2PJ8A 3B3VA 3FMCA 2AFZA 1BLLE 4OMEA 1RTQA 3K9TA 4MCSA 5HVHA 4WJBA 3I1UA 4ZI6A 3WC5A 1NSAA 2IQ6A 1H8LA 1LOKA 1XJOA 3RBUA 2C6CA 3FH4A 5J1QA 1CX8A 2PJ4A 3KR4A 3T8WA 4P4IA 4ZYQA 4OC2A 3IWWA 2BCOA 2RB7A 1TKHA 4A38A 1HDUA 1QQ9A 4OC0A 5ELYA 2DEAA 2ZEPA 4R6TA 4UEFA 4GM5A 4A94A 1YMEA 4NJRA 2C6PA 5D8NA 3MN8A 2PJ5A 3PFEA 3S9NA 3ISZA 3CDXA 2GU2A 1F2OA 3B35A 1VHOA 5K8MA 5LRKA 1FT7A 2EWBA 2IMOA 2ZENA 4NJQA 2JEWA 4JZ0A 1IY7A 4MHNA 3NA6A 3FECA 2RFHA 4FBEA 3WT4A 1AYEA 2ZEDA 3GLJA 4ONWA 5HXDA 1ARMA 4IK2A 5JM6A 1HDQA 5LYIA 2AFSA 4R76A 3D7HA 1AMPA 3B3CA 4AXVA 2C1CA 1Y7EA 3KHZA 4MXUA 3B3WA 4P45A 2ZEOA 3IFEA 2ZELA 3CPAA 3MRUA 1R43A 3D7GA 3SI0A 3NFZA 3NH4A 4PPZA 4F9VA 1ZG7A 3RAMA 3CT9A 5LRJA 4NFRA 3FX6A 4TNUA 4X3RA 3VH9A 4NGMA 4IHMA 2V8DA 2AFXA 3SJFA 1OBRA 4NGNA 2O53A 3PRTA 2POKA 2XEIA 3D67A 1CPXA 3IC1A 1LAMA 4YWYA 3PFOA 4EWTA 4X8IA 1ELMP 5JGFA 3KQZA 1Z8LA 4RUHA 4MMOA 2BOAA 3FJUA 2AFMA 3PEIA 4ZY0A 1KWMA 4PXBA 3B2YA 4IAVA 3IJ3A 4OIDA 2CIJA 2AFOA 6CPAA 3B3TA 2QYVA 3KASA 4DJLA 1Q7LA 4BD9A 3GUXA 2G9DA 3D4UA 2FVGA 2PJ6A 3CPXA 2PIZA 3GB0A 1ZG8A 2WYRA 5LYLA 4MCQA 1FNOA 2NYQA 1TKJA 4K3NA 2V8GA 4P6YA 1EE3P 4FAIA 1CPSA 1PYTB 2PJAA 3PB4X 4P10A 1YLOA 3S9MA 2GLFA 1F57A 3PBEA 1UWYA 1XMBA 4OIWA 5HVFA 2O4HA 4CPAA 2CTCA 1TKFA 1TXRA 2V8HA 4Q7AA 4P4FA 4DYOA 3LWUA 4P44A 3BI1A 2AFUA 2QJ8A 1Y0RA 2AFWA 1BPMA 1VHEA 1ZLHA 1TF8A 1CG2A 4DUKA 1BPNA 3V38A 4P4DA 3ISXA 2XEJA 3WC7A 1CP6A 1CP7A 2F8HA 8CPAA 1VIXA 4P4EA 3PB6X 4UF4A 3LMSA 3WC6A 5F09A 2QVPA 4A37A 4MCRA 3IO1A 2JBJA 3KHXA 7CPAA 1F2PA 2ZOGA 4FWUA 4ZX9A 4MHPA 4KSIA 5HVGA 2ZEMA 3PBBA 2PCUA 4NGRA 2PJ7A 3B3SA 1ZLIA 1BAVA 4PXEA 3SJEA 2ZEEA 3V7ZA 3PB7X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IGB A;  3BXM A;  4WWV A;  2CTB A;  2C6G A;  3D7F A;  4W9Y A;  4OC4 A;  3KL9 A;  4R7M A;  4F8Z A;  1Z5R A;  4PXD A;  2Q51 A;  4OC5 A;  1YSJ A;  1LAN A;  3BI0 A;  5IB9 A;  1JQG A;  1HEE A;  3N5F A;  4OP4 A;  3FVL A;  4TWE A;  2EK8 A;  2HB6 A;  4Z65 A;  2XEF A;  1XRY A;  1XBU A;  5CPA A;  2PJ1 A;  2JBK A;  3D68 A;  3HUV A;  4UEZ A;  3IEH A;  5LRG A;  3SJX A;  3S9L A;  2CF4 A;  5THW A;  1XFO A;  5D29 A;  2F7V A;  3B7I A;  1Y0Y A;  4B6Z A;  3KZW A;  4OKO A;  3JRU A;  1YW4 A;  1LCP A;  4ZX8 A;  3BHX A;  3DLJ A;  2VL1 A;  2V77 A;  3SJG A;  3HLP A;  2WZN A;  1M4L A;  2PIY A;  3IIB A;  4X2T A;  1Z2L A;  3KQX A;  2OOT A;  4EFD A;  2BO9 A;  1QMU A;  4G1P A;  4OC3 A;  3SI2 A;  2HC9 A;  2Q4Z A;  4MRI A;  2PJB A;  2OR4 A;  3KR5 A;  2PJC A;  1DTD A;  3NH5 A;  4FUU A;  4ZY2 A;  1LAP A;  3FEE A;  1ZG9 A;  2PJ9 A;  1VGY A;  3K2K A;  4UIB A;  2IJZ A;  4EME A;  5LYF A;  1PCA A;  3PB9 X;  4UEE A;  4NGT A;  5CBM A;  5JH9 A;  2ZEH A;  1CBX A;  3VAT A;  4H2K A;  2I3C A;  4JYW A;  3NH8 A;  1LFW A;  5K8O A;  2V8V A;  2PJ2 A;  3FF3 A;  3TC8 A;  2XEG A;  3D7D A;  3QNV A;  4PQA A;  2J9A A;  5K8P A;  2Q43 A;  1GYT A;  2GLJ A;  5LYD A;  3KGQ A;  3D66 A;  2PVV A;  4ZY1 A;  2PJ3 A;  4UIA A;  4NGQ A;  1YW6 A;  3TX8 A;  3VAR A;  4F9U A;  2PJ0 A;  4P4B A;  1ELL P;  2PE3 A;  3DGV A;  2NSM A;  1TF9 A;  2ANP A;  3FED A;  3H8E A;  3KI9 A;  4A39 A;  4NGP A;  4MCP A;  3WAB A;  5I4M A;  4O23 A;  4NGS A;  1R3N A;  2ABZ A;  4YU9 A;  2ZEF A;  4PXC A;  4OC1 A;  2EK9 A;  3PB8 X;  4MHY A;  2PRQ A;  2ZOF A;  4R8F A;  3H8G A;  4LQG A;  5K8N A;  2GRE A;  3L2N A;  1DE4 C;  5DS0 A;  2PVW A;  1ARL A;  2ZEG A;  3RZA A;  3H8F A;  3SI1 A;  4P4J A;  4MHZ A;  2PJ8 A;  3B3V A;  3FMC A;  2AFZ A;  1BLL E;  4OME A;  1RTQ A;  3K9T A;  4MCS A;  5HVH A;  4WJB A;  3I1U A;  4ZI6 A;  3WC5 A;  1NSA A;  2IQ6 A;  1H8L A;  1LOK A;  1XJO A;  3RBU A;  2C6C A;  3FH4 A;  5J1Q A;  1CX8 A;  2PJ4 A;  3KR4 A;  3T8W A;  4P4I A;  4ZYQ A;  4OC2 A;  3IWW A;  2BCO A;  2RB7 A;  1TKH A;  4A38 A;  1HDU A;  1QQ9 A;  4OC0 A;  5ELY A;  2DEA A;  2ZEP A;  4R6T A;  4UEF A;  4GM5 A;  4A94 A;  1YME A;  4NJR A;  2C6P A;  5D8N A;  3MN8 A;  2PJ5 A;  3PFE A;  3S9N A;  3ISZ A;  3CDX A;  2GU2 A;  1F2O A;  3B35 A;  1VHO A;  5K8M A;  5LRK A;  1FT7 A;  2EWB A;  2IMO A;  2ZEN A;  4NJQ A;  2JEW A;  4JZ0 A;  1IY7 A;  4MHN A;  3NA6 A;  3FEC A;  2RFH A;  4FBE A;  3WT4 A;  1AYE A;  2ZED A;  3GLJ A;  4ONW A;  5HXD A;  1ARM A;  4IK2 A;  5JM6 A;  1HDQ A;  5LYI A;  2AFS A;  4R76 A;  3D7H A;  1AMP A;  3B3C A;  4AXV A;  2C1C A;  1Y7E A;  3KHZ A;  4MXU A;  3B3W A;  4P45 A;  2ZEO A;  3IFE A;  2ZEL A;  3CPA A;  3MRU A;  1R43 A;  3D7G A;  3SI0 A;  3NFZ A;  3NH4 A;  4PPZ A;  4F9V A;  1ZG7 A;  3RAM A;  3CT9 A;  5LRJ A;  4NFR A;  3FX6 A;  4TNU A;  4X3R A;  3VH9 A;  4NGM A;  4IHM A;  2V8D A;  2AFX A;  3SJF A;  1OBR A;  4NGN A;  2O53 A;  3PRT A;  2POK A;  2XEI A;  3D67 A;  1CPX A;  3IC1 A;  1LAM A;  4YWY A;  3PFO A;  4EWT A;  4X8I A;  1ELM P;  5JGF A;  3KQZ A;  1Z8L A;  4RUH A;  4MMO A;  2BOA A;  3FJU A;  2AFM A;  3PEI A;  4ZY0 A;  1KWM A;  4PXB A;  3B2Y A;  4IAV A;  3IJ3 A;  4OID A;  2CIJ A;  2AFO A;  6CPA A;  3B3T A;  2QYV A;  3KAS A;  4DJL A;  1Q7L A;  4BD9 A;  3GUX A;  2G9D A;  3D4U A;  2FVG A;  2PJ6 A;  3CPX A;  2PIZ A;  3GB0 A;  1ZG8 A;  2WYR A;  5LYL A;  4MCQ A;  1FNO A;  2NYQ A;  1TKJ A;  4K3N A;  2V8G A;  4P6Y A;  1EE3 P;  4FAI A;  1CPS A;  1PYT B;  2PJA A;  3PB4 X;  4P10 A;  1YLO A;  3S9M A;  2GLF A;  1F57 A;  3PBE A;  1UWY A;  1XMB A;  4OIW A;  5HVF A;  2O4H A;  4CPA A;  2CTC A;  1TKF A;  1TXR A;  2V8H A;  4Q7A A;  4P4F A;  4DYO A;  3LWU A;  4P44 A;  3BI1 A;  2AFU A;  2QJ8 A;  1Y0R A;  2AFW A;  1BPM A;  1VHE A;  1ZLH A;  1TF8 A;  1CG2 A;  4DUK A;  1BPN A;  3V38 A;  4P4D A;  3ISX A;  2XEJ A;  3WC7 A;  1CP6 A;  1CP7 A;  2F8H A;  8CPA A;  1VIX A;  4P4E A;  3PB6 X;  4UF4 A;  3LMS A;  3WC6 A;  5F09 A;  2QVP A;  4A37 A;  4MCR A;  3IO1 A;  2JBJ A;  3KHX A;  7CPA A;  1F2P A;  2ZOG A;  4FWU A;  4ZX9 A;  4MHP A;  4KSI A;  5HVG A;  2ZEM A;  3PBB A;  2PCU A;  4NGR A;  2PJ7 A;  3B3S A;  1ZLI A;  1BAV A;  4PXE A;  3SJE A;  2ZEE A;  3V7Z A;  3PB7 X; 
#chains in the Genus database with same CATH topology
 1N71 A;  1IGB A;  1XF8 A;  3BXM A;  2WPW A;  1KUV A;  4KOT A;  4WWV A;  2CTB A;  1PUA A;  4U9Y A;  3QAY A;  2OZH A;  5EC4 A;  2C6G A;  3NE7 A;  3D7F A;  4UWJ A;  4W9Y A;  4OC4 A;  5AG5 A;  4JD6 A;  1YLE A;  3KL9 A;  4R7M A;  2DF5 A;  2YNC A;  4F8Z A;  2J8R A;  1Z5R A;  4GS4 A;  4B11 A;  3LD2 A;  4PXD A;  5E96 A;  4CAE A;  3CXQ A;  3R9G A;  5F46 A;  2Q51 A;  2YNE A;  4OC5 A;  4KVX A;  1YSJ A;  1LAN A;  1S5K A;  3OWC A;  1B6B A;  4ZBG A;  3BI0 A;  3VWE A;  2GAN A;  4MFQ A;  5IB9 A;  1JQG A;  2I00 A;  4YRH A;  1HEE A;  1QST A;  3N5F A;  2Z3N A;  3FVL A;  4OP4 A;  2EK8 A;  2HB6 A;  4TWE A;  4Z65 A;  2XEF A;  1XRY A;  1XBU A;  2H5M A;  4PK3 A;  5CPA A;  1BOB A;  2PJ1 A;  1M4I A;  1J4J A;  2JBK A;  3D68 A;  3I3G A;  4QUS A;  1P0H A;  3HUV A;  4UEZ A;  3IEH A;  4XNH B;  1IYL A;  5LRG A;  3SJX A;  3S9L A;  2CF4 A;  3FBU A;  5THW A;  4FD4 A;  1XFO A;  1Y7R A;  2EUI A;  2F7V A;  1NMT A;  3F5B A;  3B7I A;  5D29 A;  4M6H A;  1Y0Y A;  3CXS A;  4B6Z A;  3KZW A;  5C88 A;  4OKO A;  3JRU A;  2GIV A;  1YW4 A;  2G0B A;  4LX9 A;  2VBQ A;  4MI4 A;  2PQ8 A;  1LCP A;  4ZX8 A;  3BHX A;  3DLJ A;  2VL1 A;  2V77 A;  4KUA A;  4B5P B;  1YRE A;  3LOD A;  4QVT A;  4M6G A;  3SJG A;  3HLP A;  4HNY B;  3PZJ A;  3LAC A;  5IX3 A;  2WZN A;  1M4L A;  2PIY A;  3IIB A;  4X2T A;  1Z2L A;  3KQX A;  2OOT A;  4EFD A;  2BO9 A;  1QMU A;  4FD6 A;  3EFA A;  4G1P A;  4OC3 A;  2HC9 A;  4KSA A;  4JWP A;  4XNH C;  2CNM A;  2Q4Z A;  3SI2 A;  4MRI A;  2PJB A;  3F8K A;  4CAX A;  2OR4 A;  2FT0 A;  3KR5 A;  2PJC A;  3JVN A;  1DTD A;  1VKC A;  4LQ6 A;  5IB0 A;  2VXK A;  1MJB A;  3NH5 A;  4FUU A;  2OZU A;  1LAP A;  4KOV A;  4ZY2 A;  2P6E A;  3FEE A;  4A31 A;  5G21 A;  3FB3 A;  4XPK A;  2ODF A;  1ZG9 A;  2PJ9 A;  4CGN A;  1YVO A;  1VGY A;  3K2K A;  4UIB A;  2IJZ A;  4NCZ A;  4EME A;  4U9Z A;  2IL4 A;  5LYF A;  1PCA A;  3PB9 X;  4UEE A;  5F47 A;  4NGT A;  4MY0 A;  5CBM A;  5JH9 A;  2Z3O A;  2ZEH A;  4XPD B;  1CBX A;  4RI1 A;  4UCM A;  4H89 A;  2A4N A;  3VAT A;  4H2K A;  2I3C A;  2Q4Y A;  3PGP A;  2CNS A;  3NH8 A;  4JYW A;  4BMH A;  3R9E A;  1MJ9 A;  1LFW A;  2OH1 A;  5K8O A;  2V8V A;  2PJ2 A;  3FF3 A;  5FVJ A;  2XEG A;  3D7D A;  3TC8 A;  3QNV A;  4MFK A;  2J9A A;  4NEX A;  4PQA A;  4AVB A;  5K8P A;  2Q43 A;  4M3S A;  4C2X A;  1GYT A;  2G3T A;  3DR6 A;  2GLJ A;  2Z3P A;  5LYD A;  4BIN A;  3KGQ A;  2F5I A;  2Z3L A;  1JWQ A;  3D66 A;  5GCN A;  1GHE A;  5BWA B;  4HNW B;  2PVV A;  4A95 A;  3D2M A;  4ZY1 A;  5CNP A;  2PJ3 A;  1I12 A;  4UIA A;  1CM0 A;  4NGQ A;  1YW6 A;  3TX8 A;  4PSX A;  3VAR A;  2Q44 A;  4HNX B;  4F9U A;  2PJ0 A;  4P4B A;  1ELL P;  2PE3 A;  3BLN A;  3DGV A;  4B10 A;  2NSM A;  2QIR A;  1TF9 A;  4C7H A;  3H5Z A;  2ANP A;  2BEI A;  4H6Z A;  5H86 A;  2KCW A;  2OU2 A;  3EY5 A;  3FED A;  3GIU A;  3H8E A;  3KI9 A;  4KOS A;  2K5T A;  3WR7 A;  2ZXV A;  4A39 A;  4C2Z A;  4ONU A;  1Z4E A;  4NGP A;  1M1D A;  1QSM A;  2GE3 A;  4UWI A;  2Z10 A;  4E8O A;  2AJ6 A;  1M4G A;  4MCP A;  3WAB A;  5I4M A;  4O23 A;  1PU9 A;  4NGS A;  1VHS A;  4CGP A;  3FRM A;  1R3N A;  2ABZ A;  2VEZ A;  4YU9 A;  4JXQ A;  3GKR A;  2ZEF A;  4PXC A;  1Z8W A;  2J8N A;  4OC1 A;  2B4D A;  4MFP A;  4IUS A;  3TTH A;  2EK9 A;  3PB8 X;  4MHY A;  4H6U A;  4ORF A;  2PRQ A;  2PR8 A;  4Q36 A;  2ZOF A;  4R8F A;  4RN7 A;  3H8G A;  4CYN A;  2YGW A;  1MK4 A;  2Q04 A;  1IID A;  2FE7 A;  4MFZ A;  4LQG A;  5K8N A;  4JLY A;  3EXN A;  2GRE A;  5EBV A;  4F6A A;  3L2N A;  4PV6 A;  4F0Y A;  3S6H A;  1DE4 C;  1LRZ A;  5DS0 A;  4CYP A;  2PVW A;  3GYA A;  5HH1 A;  1ARL A;  2ZEG A;  3RZA A;  5J8C A;  1YGH A;  3H8F A;  4KUB A;  3SI1 A;  2BL1 A;  1S60 A;  3FNC A;  4L8A A;  2OZG A;  4P4J A;  2JEV A;  4MHZ A;  5A28 A;  1QSN A;  1BO4 A;  2EBJ A;  2PJ8 A;  4AG7 A;  2ZPA A;  4UFV A;  1V0C A;  3B3V A;  5F48 A;  3FMC A;  2AFZ A;  4UCN A;  4ZGY B;  3QAH A;  5AG6 A;  1TIQ A;  4HPS A;  4OAD A;  1BLL E;  3D2P A;  4OME A;  1RTQ A;  3IWG A;  1K4J A;  2P0W A;  1XOV A;  3K9T A;  1YX0 A;  4MCS A;  1KUY A;  2AE6 A;  2D4O A;  1YR0 A;  4R57 A;  5HVH A;  4WJB A;  3I1U A;  2Q7B A;  4PSW A;  2FXF A;  4ZI6 A;  3WC5 A;  1NSA A;  2IQ6 A;  5JQ4 A;  4AG9 A;  4E2A A;  1OZP A;  2VZY A;  1H8L A;  1LOK A;  3DR8 A;  1XJO A;  3G3S A;  2C6C A;  3FH4 A;  3RBU A;  3UY5 A;  4A33 A;  4B13 A;  5J1Q A;  1CX8 A;  3R9F A;  2PJ4 A;  3KKW A;  3KR4 A;  3R96 A;  3T8W A;  2B4D B;  3VWD A;  4P4I A;  4ZYQ A;  4OC2 A;  3IWW A;  2BCO A;  2RB7 A;  4R3L A;  1Z8T A;  1TKH A;  4A38 A;  3QB8 A;  1HDU A;  1FY7 A;  1QQ9 A;  4JXR A;  4OC0 A;  5ELY A;  2DEA A;  4A32 A;  2ZEP A;  4R6T A;  4UEF A;  5DWN A;  1R57 A;  1M4D A;  3SXO A;  4CYQ A;  1X10 A;  3JUW A;  4GM5 A;  3TO7 A;  4A94 A;  1YME A;  4II9 A;  4LUA A;  2CY2 A;  3MGD A;  5G22 A;  3W91 A;  4NJR A;  2C6P A;  2VI7 A;  2YND A;  5D8N A;  4CAF A;  3MN8 A;  1ZO0 A;  1S7K A;  2PJ5 A;  3PFE A;  2EO8 A;  3S9N A;  3ISZ A;  5A27 A;  3CDX A;  2GU2 A;  3NE8 A;  1F2O A;  2ZW4 A;  3B35 A;  1VHO A;  2ATR A;  2BUE A;  5K8M A;  5LRK A;  1FT7 A;  2EWB A;  2IMO A;  3K9U A;  2ZEN A;  4KOR A;  4M85 A;  2JEW A;  1U6M A;  2HQY A;  4JZ0 A;  4MJ8 A;  1NE9 A;  3DDD A;  3I9S A;  4NJQ A;  5EMI A;  4BBH A;  1IY7 A;  2RC4 A;  4MHN A;  3NA6 A;  4J3G A;  1I1D A;  1Y9W A;  2RFH A;  1XEB A;  3FEC A;  3S6G A;  4FBE A;  3WT4 A;  1AYE A;  2ZED A;  1WWZ A;  3GLJ A;  4HKF A;  4E0A A;  4ONW A;  5HMN A;  4NXY A;  5HXD A;  4UCP A;  4KOX A;  5I0C A;  4CS0 B;  1B87 A;  1ARM A;  4IK2 A;  4C68 A;  2B4B A;  3IGR A;  1UFH A;  1XE4 A;  1HDQ A;  3PP9 A;  5JM6 A;  5LYI A;  2FSR A;  2AFS A;  3CXP A;  3D7H A;  4R76 A;  4B12 A;  1AMP A;  2VQY A;  3B3C A;  4AXV A;  4XPD C;  2C1C A;  1Y7E A;  2P6F A;  3KHZ A;  4MXU A;  2CNT A;  3B3W A;  3FYN A;  5KTA A;  4QB9 A;  4P45 A;  2B3V A;  2ZEO A;  2R98 A;  4C2Y A;  3IFE A;  2ZEL A;  5KTD A;  3CPA A;  3MRU A;  1R43 A;  3D7G A;  4MY3 A;  3SI0 A;  3TO6 A;  4A2Z A;  3NFZ A;  4QC6 A;  3NH4 A;  4PPZ A;  4CAW A;  4F9V A;  1ZG7 A;  3RAM A;  5DWM A;  3CZX A;  4UFW A;  3CT9 A;  5LRJ A;  2ARH A;  4NFR A;  3FX6 A;  4TNU A;  4X3R A;  2ZW6 A;  3VH9 A;  5H84 A;  4NGM A;  2G3A A;  2PC1 A;  4IHM A;  2Z3M A;  2V8D A;  2AFX A;  2DXQ A;  3SJF A;  1OBR A;  1YQE A;  4NGN A;  2O53 A;  2REE A;  2Q4V A;  3PRT A;  2POK A;  2J8M A;  2XEI A;  2B5G B;  3D67 A;  1CPX A;  3IC1 A;  4CRY B;  1LAM A;  4YWY A;  4CAV A;  2I79 A;  3IU1 A;  3PFO A;  4CRZ B;  4KVO E;  4X8I A;  4EWT A;  1ELM P;  3FXT A;  5JGF A;  1IOI A;  1S7F A;  3ZJ0 A;  2C27 A;  3KQZ A;  1Z8L A;  3RO0 A;  4RUH A;  1Z4R A;  2QML A;  4MMO A;  5G1Z A;  5KTC A;  4CGL A;  2BOA A;  3FJU A;  1Z8X A;  2AFM A;  4KOY A;  4KVM E;  3PEI A;  3TE4 A;  3DSB A;  3TOA A;  4ZY0 A;  1S7N A;  1KWM A;  4PXB A;  4B14 A;  4DNC A;  3B2Y A;  4IAV A;  3IJ3 A;  4OID A;  5AG7 A;  1Y9K A;  4YGO A;  2CIJ A;  1KZF A;  2AFO A;  3SHP A;  3D3S A;  4A30 A;  6CPA A;  4GXH A;  1XIX A;  3B3T A;  4KLW A;  2QYV A;  5JPH A;  2PSW A;  3KAS A;  1X12 A;  4DJL A;  2JLM A;  1Q7L A;  4L89 A;  1KUX A;  4BD9 A;  1IB1 E;  3GUX A;  2G9D A;  3D4U A;  2FIW A;  3FIX A;  2FVG A;  2PJ6 A;  3TCV A;  3N7Z A;  4MFL A;  3CPX A;  4KOU A;  3R95 A;  2PIZ A;  4QBJ A;  2PDO A;  4NSQ A;  4KZT A;  3GB0 A;  1ZG8 A;  1A2Z A;  2WYR A;  3IWE A;  5LYL A;  1FNO A;  2NYQ A;  1IYK A;  4MCQ A;  3P2F A;  2B58 A;  4PK2 A;  4CYO A;  5IV0 A;  4KLV A;  4MBU A;  3P2H A;  3ZZI A;  1TKJ A;  4X5K A;  4K3N A;  1M44 A;  2V8G A;  4KSF A;  4P6Y A;  1Q2C A;  1EE3 P;  2O28 A;  4UBR A;  4FAI A;  1CPS A;  1PYT B;  2R7H A;  2EVN A;  2PJA A;  4NF1 A;  4Q38 A;  4AB7 A;  2Z3K A;  1IIC A;  3PB4 X;  1Q2Y A;  3V8I A;  1QSO A;  1Q2D A;  4K30 A;  3TO9 A;  4P10 A;  1I21 A;  2PRB A;  2VZZ A;  2Z11 A;  4OLL A;  2OB0 A;  4KOW A;  1YLO A;  1YK3 A;  4UA3 A;  2ZW7 A;  4EVY A;  5J8F A;  3DNS A;  2GLF A;  3S9M A;  1F57 A;  3PBE A;  2X7B A;  1YVK A;  3D8P A;  1QSR A;  4FD5 A;  1NSL A;  1UWY A;  3B8G A;  4MFJ A;  1XMB A;  4OIW A;  3IU2 A;  5HVF A;  2O4H A;  3T90 A;  4F0X A;  5C82 A;  4OAE A;  3W6S A;  3H4Q A;  4CPA A;  2WSA A;  2CTC A;  1TKF A;  2B5G A;  3BJ7 A;  4FD7 A;  1MJA A;  1TXR A;  2V8H A;  4Q7A A;  3R1K A;  4MHD A;  4P4F A;  2REF A;  4DYO A;  3LWU A;  4P44 A;  4C7I A;  3BI1 A;  2AFU A;  3C26 A;  4B5O A;  1CJW A;  3T9Y A;  1L0C A;  2PR1 A;  2QEC A;  4I49 A;  4Y49 B;  2HV2 A;  4XPL A;  3S6F A;  2QJ8 A;  1Y0R A;  2AFW A;  2CXA A;  3G8W A;  3GY9 A;  1BPM A;  1S7L A;  4IF5 A;  1VHE A;  3RYO A;  5AG4 A;  4RS2 A;  1ZLH A;  2JDC A;  2BSW A;  2WPX A;  3TT2 A;  1TF8 A;  1CG2 A;  2JDD A;  3W6X A;  4DUK A;  2HUZ A;  4R87 A;  1BPN A;  2FCK A;  3A9L A;  3V38 A;  2D4P A;  4P4D A;  3ISX A;  2R8V A;  2XEJ A;  2R1I A;  3WC7 A;  2Q0Y A;  2FL4 A;  2WUU A;  1CP6 A;  5F49 A;  2YNC C;  3JTK A;  5ISV A;  1IOF A;  1XMT A;  1CP7 A;  2F8H A;  8CPA A;  1RO5 A;  1VIX A;  3PB6 X;  4P4E A;  1P4N A;  4UF4 A;  3LMS A;  3SXN A;  3WC6 A;  5F09 A;  5G20 A;  2QVP A;  4A37 A;  4YFJ A;  4Y49 C;  4MCR A;  3IO1 A;  3F0A A;  2JBJ A;  2NMT A;  3KHX A;  2DPS A;  4R3K A;  1Z9U A;  2DPT A;  2ZW5 A;  3S6K A;  1WK4 A;  2Y0M A;  7CPA A;  2Z0Z A;  3RNZ A;  2GFQ A;  1F2P A;  4M6I A;  2ZOG A;  1RXT A;  4FWU A;  2P6G A;  4ZX9 A;  4MHP A;  1SQH A;  4KSI A;  5HVG A;  4UFX A;  2ZEM A;  2FIA A;  3PBB A;  3BJ8 A;  2Q7S A;  2PCU A;  3EC4 A;  4JJX A;  4NGR A;  3TOB A;  4AVC A;  4R9M A;  3E0K A;  2PJ7 A;  2B3U A;  4U5Y A;  3EO4 A;  4AVA A;  1ON0 A;  1ZLI A;  1IU8 A;  3B3S A;  3TFY A;  2FS5 A;  1BAV A;  1S3Z A;  4PXE A;  1AUG A;  4CGO A;  4KS9 A;  3SJE A;  2ZEE A;  5AGE A;  3V7Z A;  4CGM A;  4B5P A;  3PB7 X; 
#chains in the Genus database with same CATH homology
 1IGB A;  3BXM A;  4WWV A;  2CTB A;  2C6G A;  3D7F A;  4W9Y A;  4OC4 A;  3KL9 A;  4R7M A;  4F8Z A;  1Z5R A;  4PXD A;  2Q51 A;  4OC5 A;  1YSJ A;  1LAN A;  3BI0 A;  5IB9 A;  1JQG A;  1HEE A;  3N5F A;  4OP4 A;  3FVL A;  4TWE A;  2EK8 A;  2HB6 A;  4Z65 A;  2XEF A;  1XRY A;  1XBU A;  5CPA A;  2PJ1 A;  2JBK A;  3D68 A;  3HUV A;  4UEZ A;  3IEH A;  5LRG A;  3SJX A;  3S9L A;  2CF4 A;  5THW A;  1XFO A;  5D29 A;  2F7V A;  3B7I A;  1Y0Y A;  4B6Z A;  3KZW A;  4OKO A;  3JRU A;  1YW4 A;  1LCP A;  4ZX8 A;  3BHX A;  3DLJ A;  2VL1 A;  2V77 A;  3SJG A;  3HLP A;  2WZN A;  1M4L A;  2PIY A;  3IIB A;  4X2T A;  1Z2L A;  3KQX A;  2OOT A;  4EFD A;  2BO9 A;  1QMU A;  4G1P A;  4OC3 A;  3SI2 A;  2HC9 A;  2Q4Z A;  4MRI A;  2PJB A;  2OR4 A;  3KR5 A;  2PJC A;  1DTD A;  3NH5 A;  4FUU A;  4ZY2 A;  1LAP A;  3FEE A;  1ZG9 A;  2PJ9 A;  1VGY A;  3K2K A;  4UIB A;  2IJZ A;  4EME A;  5LYF A;  1PCA A;  3PB9 X;  4UEE A;  4NGT A;  5CBM A;  5JH9 A;  2ZEH A;  1CBX A;  3VAT A;  4H2K A;  2I3C A;  4JYW A;  3NH8 A;  1LFW A;  5K8O A;  2V8V A;  2PJ2 A;  3FF3 A;  3TC8 A;  2XEG A;  3D7D A;  3QNV A;  4PQA A;  2J9A A;  5K8P A;  2Q43 A;  1GYT A;  2GLJ A;  5LYD A;  3KGQ A;  3D66 A;  2PVV A;  4ZY1 A;  2PJ3 A;  4UIA A;  4NGQ A;  1YW6 A;  3TX8 A;  3VAR A;  4F9U A;  2PJ0 A;  4P4B A;  1ELL P;  2PE3 A;  3DGV A;  2NSM A;  1TF9 A;  2ANP A;  3FED A;  3H8E A;  3KI9 A;  4A39 A;  4NGP A;  4MCP A;  3WAB A;  5I4M A;  4O23 A;  4NGS A;  1R3N A;  2ABZ A;  4YU9 A;  2ZEF A;  4PXC A;  4OC1 A;  2EK9 A;  3PB8 X;  4MHY A;  2PRQ A;  2ZOF A;  4R8F A;  3H8G A;  4LQG A;  5K8N A;  2GRE A;  3L2N A;  1DE4 C;  5DS0 A;  2PVW A;  1ARL A;  2ZEG A;  3RZA A;  3H8F A;  3SI1 A;  4P4J A;  4MHZ A;  2PJ8 A;  3B3V A;  3FMC A;  2AFZ A;  1BLL E;  4OME A;  1RTQ A;  3K9T A;  4MCS A;  5HVH A;  4WJB A;  3I1U A;  4ZI6 A;  3WC5 A;  1NSA A;  2IQ6 A;  1H8L A;  1LOK A;  1XJO A;  3RBU A;  2C6C A;  3FH4 A;  5J1Q A;  1CX8 A;  2PJ4 A;  3KR4 A;  3T8W A;  4P4I A;  4ZYQ A;  4OC2 A;  3IWW A;  2BCO A;  2RB7 A;  1TKH A;  4A38 A;  1HDU A;  1QQ9 A;  4OC0 A;  5ELY A;  2DEA A;  2ZEP A;  4R6T A;  4UEF A;  4GM5 A;  4A94 A;  1YME A;  4NJR A;  2C6P A;  5D8N A;  3MN8 A;  2PJ5 A;  3PFE A;  3S9N A;  3ISZ A;  3CDX A;  2GU2 A;  1F2O A;  3B35 A;  1VHO A;  5K8M A;  5LRK A;  1FT7 A;  2EWB A;  2IMO A;  2ZEN A;  4NJQ A;  2JEW A;  4JZ0 A;  1IY7 A;  4MHN A;  3NA6 A;  3FEC A;  2RFH A;  4FBE A;  3WT4 A;  1AYE A;  2ZED A;  3GLJ A;  4ONW A;  5HXD A;  1ARM A;  4IK2 A;  5JM6 A;  1HDQ A;  5LYI A;  2AFS A;  4R76 A;  3D7H A;  1AMP A;  3B3C A;  4AXV A;  2C1C A;  1Y7E A;  3KHZ A;  4MXU A;  3B3W A;  4P45 A;  2ZEO A;  3IFE A;  2ZEL A;  3CPA A;  3MRU A;  1R43 A;  3D7G A;  3SI0 A;  3NFZ A;  3NH4 A;  4PPZ A;  4F9V A;  1ZG7 A;  3RAM A;  3CT9 A;  5LRJ A;  4NFR A;  3FX6 A;  4TNU A;  4X3R A;  3VH9 A;  4NGM A;  4IHM A;  2V8D A;  2AFX A;  3SJF A;  1OBR A;  4NGN A;  2O53 A;  3PRT A;  2POK A;  2XEI A;  3D67 A;  1CPX A;  3IC1 A;  1LAM A;  4YWY A;  3PFO A;  4EWT A;  4X8I A;  1ELM P;  5JGF A;  3KQZ A;  1Z8L A;  4RUH A;  4MMO A;  2BOA A;  3FJU A;  2AFM A;  3PEI A;  4ZY0 A;  1KWM A;  4PXB A;  3B2Y A;  4IAV A;  3IJ3 A;  4OID A;  2CIJ A;  2AFO A;  6CPA A;  3B3T A;  2QYV A;  3KAS A;  4DJL A;  1Q7L A;  4BD9 A;  3GUX A;  2G9D A;  3D4U A;  2FVG A;  2PJ6 A;  3CPX A;  2PIZ A;  3GB0 A;  1ZG8 A;  2WYR A;  5LYL A;  4MCQ A;  1FNO A;  2NYQ A;  1TKJ A;  4K3N A;  2V8G A;  4P6Y A;  1EE3 P;  4FAI A;  1CPS A;  1PYT B;  2PJA A;  3PB4 X;  4P10 A;  1YLO A;  3S9M A;  2GLF A;  1F57 A;  3PBE A;  1UWY A;  1XMB A;  4OIW A;  5HVF A;  2O4H A;  4CPA A;  2CTC A;  1TKF A;  1TXR A;  2V8H A;  4Q7A A;  4P4F A;  4DYO A;  3LWU A;  4P44 A;  3BI1 A;  2AFU A;  2QJ8 A;  1Y0R A;  2AFW A;  1BPM A;  1VHE A;  1ZLH A;  1TF8 A;  1CG2 A;  4DUK A;  1BPN A;  3V38 A;  4P4D A;  3ISX A;  2XEJ A;  3WC7 A;  1CP6 A;  1CP7 A;  2F8H A;  8CPA A;  1VIX A;  4P4E A;  3PB6 X;  4UF4 A;  3LMS A;  3WC6 A;  5F09 A;  2QVP A;  4A37 A;  4MCR A;  3IO1 A;  2JBJ A;  3KHX A;  7CPA A;  1F2P A;  2ZOG A;  4FWU A;  4ZX9 A;  4MHP A;  4KSI A;  5HVG A;  2ZEM A;  3PBB A;  2PCU A;  4NGR A;  2PJ7 A;  3B3S A;  1ZLI A;  1BAV A;  4PXE A;  3SJE A;  2ZEE A;  3V7Z A;  3PB7 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...