4BINA

Crystal structure of the e. coli n-acetylmuramoyl-l-alanine amidase amic
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
Knots found
sequence length
379
structure length
348
Chain Sequence
FQGHMQVVAVRVWPASSYTRVTVESNRQLKYKQFALSNPERVVVDIEDVNLNSVLKGMAAQIRADDPFIKSARVGQFDPQTVRMVFELKQNVKPQLFALAPVAGFKERLVMDLYPAPLLALLEDYNSGPQPGKAGRDRPIVIMLDPGHGGEDSGAVGKYKTREKDVVLQIARRLRSLIEKEGNMKVYMTRNEDIFIPLQVRVAKAQKQRADLFVSIHADAFTSRQPSGSSVFALSTKGATSTAAKYLAQTQNASDLIGGVSDMVQSLTIADSLKFGKAVLNKLGKINKLHKNQVEQAGFAVLKAPDIPSILVETAFISNVEEERKLKTATFQQEVAESILAGIKAYFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords N-ACETYLMURAMOYL-L-ALANINE AMIDASE AMIC
publication title The Crystal Structure of the Cell Division Amidase Amic Reveals the Fold of the Amin Domain, a New Peptidoglycan Binding Domain.
pubmed doi rcsb
total genus 109
structure length 348
sequence length 379
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.5.1.28: N-acetylmuramoyl-L-alanine amidase.
pdb deposition date 2013-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
A PF11741 AMIN AMIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3500 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4binA01
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 4binA02
2Q7SA 4LQ6A 1JWQA 4M6HA 3QAYA 4M6GA 4BINA 3CZXA 3NE8A 2ODFA 1XOVA 4M6IA 5EMIA 4RN7A
chains in the Genus database with same CATH superfamily
2EC9U 1OTUC 1E67A 1U92A 3GBDA 1CI5A 2GEEA 4L3CB 4PJBA 4C55A 1S3ZA 4UCPA 3RBSA 1ML0A 1LD9A 2DQDL 3F3HA 3FDWA 5D7EA 3NBNA 3OJVC 4YBQD 3QORD 1UZ6E 5IB1A 4KQ4L 4Z8FL 5D93C 5SWSE 1YNTF 2EXTA 4GIOA 4NGQA 3AQDA 3QPXH 1FWXA 4YDZA 4RMWA 3QWRA 4X8JA 4P5MA 1AD0B 1FN4B 4YLQT 3P73A 1M7IB 3OLGA 3N85L 4LVOB 3FT2B 3ZSSA 4EI6B 1JXGA 1Y1DA 1YNKL 3S9NA 2I5YL 3KPOB 5EU6B 1SJXA 3ILPB 4LCCA 1NBCA 2ARJQ 3L17A 1G9NH 3T2PA 4K9JA 4C47A 5C7XH 1E6OH 2BM3A 1OCWL 2A6IA 1TF4A 1FPTL 4MAYA 3VXSD 1L3NA 2D2OA 5E1QA 2R4SL 3N06B 5DURD 1E42A 1A2YB 2ICEA 4K23H 4HCGA 5IR1B 2FECI 2ZEDA 1O9WA 4CYPA 3WIFA 2PF6A 5D5MA 3FQRB 1C16B 3BPCB 1XF5B 2PJ6A 2DPSA 5DYOA 5IJBC 3VXSE 2PR9A 2ZTBA 4XXWC 5HVGA 2EICA 1F86A 1Q0YH 1FH5L 1U3JA 3OR6A 5KBNC 1VKXB 1EEUA 4YVUA 3WOVA 1Q2YA 2DPTA 4LDCA 4DZ8B 2VDQL 3ALWA 3JZYA 4N9GA 4NQDA 4A2GA 1OGTA 1EO8H 4L3EB 4WUKH 5IHBA 1H0DA 1ERNA 3SZ6A 2AK4B 1QBLH 2G4GA 4OJCA 1N9PA 4UTBA 1PZ5B 4JO8A 5FR3A 5CGMA 5HY9A 2XJLA 2OTWB 4QT5A 4PRPD 4GXVH 4X5LA 4CBPA 1VERA 3ARUA 3CHPA 3F65A 5IHUH 5IUCA 1YC7A 1AZBA 3ULUH 2VO8A 5LXVA 1VIWA 1OTUD 3BCDA 3ZZ1A 1TQUA 3D4GA 1FNGB 3IYLW 2R15A 3EJUA 3HN8A 3G5VB 3WG7B 2YGWA 1FHGA 1IBYA 4PRPE 4PQAA 1F13A 4ODXB 4J7RA 3LKOA 5AUMB 1UADC 3IJ3A 1IM9B 3U1SH 4I13B 1A7PL 3QNVA 1G7QB 1SY6H 1D2OA 3ZE1F 3I6GB 1C5BL 3E0KA 1SXBA 3VWJC 2BNUA 2Y22A 3GBNL 5CWSA 2ZX5A 2FEJA 1Q0XL 1DBKL 3S5ZA 2NT1A 5I1AB 2IAMC 3EFDH 2R69A 3QXVA 3RNQA 1PG7H 5CJXA 4ODVL 3S5YA 1B88A 4LMQI 4OR1A 1T1YA 5I6KA 5KZCB 4ATTA 4U1NB 5IQ9A 5HVWA 3RNKB 4NO5A 1N5YL 3M1CA 2P4AB 3MJ8A 4JHUA 3APMA 4K7PL 1HCVA 2F8IA 1T89A 2PP7A 4WI4A 1OSPH 2ZNXA 4JREC 4JVPA 3ULVL 1NSNL 1INQA 3LKRB 3MV8D 3HZ3A 4KQ3H 3BAEH 2F7IA 1S7RB 1YCSA 4DTGH 1RVFH 4C2ZA 2WXMA 2DQIL 1LNUB 1ZV5A 3D25A 2PWFA 3P3UA 4JHVA 4H0IA 4JZJC 1HQ4A 5DD5H 4PV1C 1DBJH 5I6PA 2BY0A 3G7TA 4Y2OB 1CK0H 1ICTA 3H1ZA 3NFNA 2VXUL 3ZR6A 4TLUA 3MV8E 2ZG3A 5A2FA 1AQDB 3IMRA 2CZNA 3GKWL 4YE4L 5GGTH 5LDUA 3RDTC 3PQYA 1MSPA 2F0CA 1ECYA 3NJHA 2GCYA 1VFAA 3NEOA 1ZS8A 1NQBA 2SEBB 3W2DL 1ZVSA 5KVFH 1UA7A 2PKDA 3C5JB 5EU5B 1F4HA 2MKLC 4MSWA 1F3RB 2QBWA 3PWLA 4EDWH 4LCCC 4B9FA 5E8EB 3LEVL 1T21B 4LHUA 3VJ6B 2AXFB 5DU7A 2NNRA 2E56A 3NIFB 2DQTL 3KXFD 2ISDA 4MAYC 3NSJA 4HZLB 1RIUH 4U1IA 2QSQA 1D9KB 2ICEC 3B9EA 4KDTA 1ZTXH 3H2QA 4Z3JA 2K0RA 4JFZH 1F6LL 5KJ7E 1YK3A 1BBJA 2A38A 4FXKB 5TK2A 2N7BA 1AGEB 3VWJD 4ZX6A 3KVDD 1F2XK 5AVYB 5E1HB 3KXFE 4ZMPA 4GKSB 3G5XB 3DECA 2AFNA 2V5MA 4ZUUA 1QRNA 3DOSB 5GZOA 3K72B 4LLUA 4HOXA 1EVUA 4UM9B 1T5XB 1PFCA 4BINA 1YEIH 3CPXA 1PY9A 1EHAA 1QO3A 4HK3N 1P7HL 3NN8B 3VW3L 5GRUL 3OC5A 4WO4D 3EJQA 4GG6E 1KCWA 1P1ZB 2KZBA 2XWJA 3LPWA 5DD6A 2ALWA 2L0DA 4KVNL 4PY7A 4FABH 5IFHH 4GIPD 4MWFB 2YZ1A 1M2VA 3OPZH 4P4IA 1JCVA 1LGVA 1QSED 5CN2A 4ADGA 5JIHA 4LAJH 1E8WA 2I9LB 1DSYA 2PYFA 1Q94A 2MCAA 1IIKA 3CFJA 3N41F 1SVCP 4PV8A 3WT4A 2FJUB 5I18H 1J4JA 1NA8A 3QIBD 3PJNA 1K8IA 3BESR 3B2PA 2HT4C 1QSEE 1EFXA 1YMMA 3NOIA 1CU4L 1NUDA 5DMGC 2XTJB 5L0QB 3S88H 3RDTD 4K7FA 3DUUA 1MFVA 3HCVA 4M5TA 1Z4RA 3WEMA 1HCYA 2R2HB 4YGOA 5AVVB 5A2IH 5BQ7A 2GJJA 4V1DA 1JHTB 3D12B 1BEYH 3KPRB 3TIEA 3HBGA 4Z3EA 3V52L 1L7TL 2DF3A 3ZYZA 5MP6L 1QFWL 2FRGP 4K2UL 1G1KA 1SMOA 1YNTB 4HIIA 4Q38A 6CPAA 4S0TD 3A67H 4JJ5B 2V5RA 1SJEA 4JLYA 4ICXA 3QW9A 4FNPA 4J2QA 5I1IH 5GRYA 1I12A 3DA0A 2WOBA 1T89C 3FTUA 1VFOA 3VRLF 1VHPA 4Y1TA 3PFQA 3KL5A 3VYOA 4AVIA 3WNLA 1R5IB 4Y2DC 2B20A 4HC1H 2X1OA 2YA2A 1LP9B 3WNJA 4OFDA 4N2OA 2OCFD 3SYOA 3P3SA 4UUJA 1W80A 1G6RA 3TL5A 4AT6A 4L9LC 1TCRA 3PF2A 5KSVA 4JRXD 1WFMA 3DX8A 1H3PL 3HC2A 3U4EA 4R76A 3ULSA 5HBBA 3DURA 2D31B 3D50A 4LKXB 4RQQA 2RACA 4OLUL 5DUBA 3VX1A 4UYQA 1EFQA 1RUQL 1RJZB 2IPUG 2WTRB 4FQ1H 4NWTH 4BWUA 4NFRA 3ZW3A 1KIQA 2Q10A 2O61A 4W81A 2EO7A 1JZ8A 3S9DB 2W95A 4GM5A 4JRXE 4FG6C 1WGOA 3B8YA 3MRKA 1MI5A 2KL6A 4U4BA 1WD9A 2BY3A 1E4JA 1S7WB 2FO8A 3SO3C 5CINL 3T3ME 5L7XL 4APXB 3IU3A 1YDPA 4JN1H 3BOVA 4J23A 5FO2A 3GMPA 3KLQA 1XCTA 2PJ2A 1SXSA 3M17A 1MIEH 4DUVA 2HT4D 3CBKB 3VFSB 2PTTA 4R9HA 1INEL 5DMGD 4BFBD 3KLSA 3P77A 1U6MA 3GM8A 5D4JA 4HGKC 2JDDA 5LRKA 3MRGA 1J5OH 1T2QH 4U1MB 3R95A 3CSPA 5L88L 1RUML 5EU7E 1MXDA 2F19L 1FP5A 5I15H 1OW0C 3HI5H 1VJSA 5GZOC 2UZPA 3ZJAA 2X2IA 4F15C 4DZBA 4A7UA 1WIUA 5GS1B 1HHKB 3ZE1B 1I1DA 4O02B 1WAAE 2CCVA 3U36B 5BV7C 4PJ5A 1CD8A 2R69H 2PXYA 3DGGB 2G9HA 2ZXWB 4DKAA 4F80A 3AROA 2CMRH 4O2EB 4NGTA 3FT1A 2IEPA 2H4EA 2GFBB 4TOYL 3SGKC 1F18A 4KITB 4GS7C 3WHE1 4Y2DD 2QLYA 1OP5H 2YEQA 4PM1A 4UDUB 2G60H 3TVMD 2ESVA 2VZSA 1K4DA 1L0XA 4OC1A 4N0RA 2JIXA 1A6TB 4WJBA 1R5WB 4J6IA 2KDYA 5J1SC 3F6LA 2PPEA 3EH3B 3EYOA 4JHAH 3MU3A 4B3EA 3CZKA 5JQ6L 1IX2A 2G5RA 1ET5A 4YFLI 2PJCA 3BYYA 2EE9A 4CDHA 1M6UA 3MOBH 5IHHA 4DFIA 3AXLA 4UT6A 4EI5D 5HXDA 5C0FB 4M7KL 3TS8A 1HKFA 2I3CA 1UM5L 1ZGLB 4LPYA 1EXUA 2LU7A 3N1QC 3VSUA 2EECA 5IB5B 3HZKA 4JDVB 1PG7W 5ANMA 2YAHA 4ES9A 5I0ZA 1U8NB 4FG6D 4PCSA 1LO2H 3QQ3A 5FB8B 1CIDA 1GGYA 2YXVA 1EX0A 5E6ZA 1R3HB 5C0IA 1WIOA 3FN9A 4JG5A 4F7KA 4B9PA 3ASWA 3L3GB 2OMVA 3STLA 1KTRL 4UF7C 3FOLB 3MRRA 4QDGA 2VN3A 2WQXA 2W59A 3BKML 4I2XA 4UILH 4WK0B 2HMIC 2WWKT 3GSNH 2PP9A 3GSRB 3HG1B 3H3PL 3B56A 3NQKA 4PREA 2YPVA 4NGRA 1X6NA 4HFWB 3EYQD 3QIUA 4JQVC 4WHDA 1RU9H 4JX0A 1V55B 4XP6L 1QBAA 3CQQA 1JK8A 1BF8A 3EKCA 4NGMA 3B7SA 1WZMA 1AJ7L 3BO8B 1N0XH 3KBEA 2BWIA 3D48R 1QRND 3S3CB 1ET7A 4IMKA 2OYMA 1WRFA 5MEQA 3SYCA 1LEKB 2VDLH 3UBXG 3UO1H 1GJUA 1U91B 3CE1A 3AUWB 3UAFA 3Q9PA 2CO7B 4IMLA 1N4XL 3FECA 3KYOB 4A7QA 2OAAA 2XBDA 3K8LA 2EIZA 3CZXA 3STBA 4DQOH 1QACA 1K3ZA 2BOAA 2XZZA 5BV7H 1T2XA 1PL3A 1QLFB 2MNJB 2P8MB 4OVVA 1JPEA 2DIEA 2NY5L 4MJ4A 3SY0B 3TWCL 3NFZA 3TNNA 4HFUL 1ONQA 3HE7B 1OAUH 1FZMA 1IGJB 3BIBX 4M1DL 1ASPA 4Q6KA 3QWNA 5JQHC 4LT7A 2YPLB 3RWEB 3S96B 1LDPL 3FUNA 4QXTB 2CDGA 1EFXD 4PIBA 5D96C 1Z2LA 4W70A 1OP3H 1A64A 3VMPA 4Z78B 1MJ9A 2PMZA 2IQAB 1F2PA 3N41B 3UOAB 2I32A 2EVNA 1H9VA 1Y18A 2Y1VA 3BUIA 4NRZA 5C07D 3WFHB 4DW2H 4FQLH 5IVXE 4V1DD 2P48B 2X1WL 3RKPA 4FGMA 1K2DB 4Z7VF 4M7ZC 4AIZA 2C9UA 4Z7IA 4CGPA 5DK0A 2BOCB 4L8CA 4ZDHB 1PCAA 3B8SA 1QG3A 1JZ7A 1NFDE 3BQUA 1ZD6A 1RZFH 4PJGF 5D1QD 5C07E 3RL2B 1UWYA 2OTUB 3T77A 2PXYC 2HMID 1E65A 1R3NA 5D55A 4QHLB 4FTVB 4JM2D 4JY5L 2BSSB 1AHKA 3STZB 3D3SA 4CAVA 2Y9RT 4FFZA 2C7FA 3UBXB 4YDLB 1Z32X 4YHZH 3IS1X 2E27L 3QG7L 2ZWKA 3AFLA 4GW1A 4C59B 3QJZA 1IEHA 1QOKA 5D1QE 4P5TB 3IDYC 2CA3A 3CHQA 3K6DA 3ZDZE 3C6LA 2ILLA 2GB2A 1IIIA 5M7QA 3BKCL 3GHBL 1W2KT 3QR2A 2D9CA 4A2MA 2GY7B 2QSCL 3UMTA 3EXJA 4FZ8L 4TLKA 4BZYA 1EWHA 3KLLA 2VH5L 1G6RH 1GTFA 1OF2A 4TQHA 4X0KA 4YSAA 1T20A 3GSWA 3ARBA 4NQQA 2ZD0A 1MCIA 4HBCH 2UX6A 3OG6B 5DRZB 3V0WH 4AKQA 4MXQD 3C9NB 2H2PC 2VAAA 3MLSL 5AW6B 2VDOB 4M3HA 5AW3B 3BLNA 5JMOC 4KMLB 4K3JL 1XCQB 3R1GL 5DK3A 4JY6B 2VB5A 1MI5D 4NZDA 2X88A 2BNRA 2WWMD 1CICD 1TQCB 1UASA 1MIML 5FOJA 5KJRH 1C5DA 1FFNA 1BA9A 2QADC 2IALB 5EFIA 4C83A 4EF3A 2Y36H 5E95B 3MV7D 4PCTA 3ZR5A 3CDFA 5MEPB 43C9A 1A7QH 4W9JC 3QFDB 2AFUA 4JDZB 3DX1A 4WGWB 5JPMC 5L2KE 4UV7H 1ZLHA 5K1VA 1OSZA 3MBXL 4HJJH 2W91A 3B2UC 1ETB1 1S3RA 5EO9B 5HHOB 2G0KA 3MV7E 1LJMA 3P2BA 4Y16A 5H2BB 2MCPH 2CXGA 1B2WL 4GBXD 4IMKC 43CAB 3QNYA 2P49B 2W5PA 1XRYA 4LBEA 3PJSA 1FL5B 1ACCA 2NQDA 2WSPA 3UZQA 3VE0B 1NPUA 3SDDA 3W0WA 1S7QB 2V5SA 1YX0A 2Q76B 5T3ZD 2EEXA 3F12A 3U9PL 3BIAX 3DVGB 3LKPB 3F62A 3IFOA 1YY9D 4HG4J 1FFOB 4LZKA 3PCYA 5IMKA 3DNKA 4MA7L 4FQ2H 3X3GH 3NSCA 4PPTA 1JXDA 3CXHK 4Z7WE 2DN7A 2F8XC 4HS6A 5T3ZE 3A6CH 3BAYA 4OU3A 4RWYH 5E9DB 3DTXB 2NUTB 2DL9A 4C2XA 4P23B 3GBEA 4XCEB 2G5BA 4LBAA 3WEXA 4P4KD 2QDVA 4MS6A 5EZPA 1BZ7A 5E8NA 3FCUB 4OSUH 4ODSL 5D4HA 3F8KA 4FERA 1EGJL 1MREL 4CYQA 4FJ6A 4ZMQA 4H26A 1N10A 4HGWB 1IZKA 5J1QA 1OPGH 1AMPA 1H8LA 2Q2EB 3OKKB 4P46D 4Y1AD 3ISZA 1KEML 1HOCB 4LLYA 4N0UA 4K94L 4M6MH 3O0LA 3R4RA 2ANPA 1I9IH 1LHZA 4ZMYA 2PE3A 1NIBA 1F42A 4L4JA 2VC2L 2F1AA 4G8IA 4JB9L 5JR1H 3OXRB 1B2YA 4GG8B 5C6TL 4FXGA 3WS3B 4Z7OF 5SWZB 1GCYA 2O6DA 2HJKA 2CO1A 3LMSA 1D5MB 5MHSD 1KTCA 4IHBA 3CZSA 5DJDA 3KR3H 2ZJSH 3BPLB 1J05A 4JRYE 5ESAB 2J8NA 3M7OA 2K45A 2R1YB 2BP8B 3V4LA 5DUPL 5L9DH 3TO6A 4Y89A 5AVTB 3C6LC 4JY4A 1RJYA 4XBEH 5HDOA 1WCBB 4PP2B 5KVEE 3FTYA 3LH2L 5C09B 3U0WH 2H5MA 4G1MA 1BX2B 1XF3A 1ZSHA 2EE0A 3L4VA 3VQ1C 1JZJA 4H0LC 2OK0H 1L5GB 3IC1A 2BOLA 4L5FH 2JE8A 3T1FB 5JOFA 1V10A 3IJHB 4XNBA 4AGQA 4JKWA 3FUEA 3V5KA 1UH4A 3VD5A 3M45A 5G21A 3IFNH 4MYWB 1JGVH 4NQEB 1SZNA 5FYLE 5H37A 1UJ3A 4KQ0A 4HPYH 4WFED 3QH3B 4H8WL 2FXFA 1JYXA 5SX4H 1AFVH 4GXHA 5BOPA 3PDDA 2YSSA 1M1DA 3H8GA 2XG4B 5DVMA 5F3FA 1A1OB 1FZJB 3R1KA 3T0BA 1TNMA 4P99A 2BFVL 1NMBH 1DE4B 3B5GA 1Q1JL 4WFEE 1C08A 1Z8XA 2NY2C 2L7EA 4B96A 2JBKA 3TZVD 3H9SA 3CBJB 4G8FB 2IWKA 1T6VN 4MCYB 4UQ3A 2GK2A 1NJ9A 5DDHB 2UUDK 4XPFH 1FL3A 4Y16C 4KUAA 5ENWB 2OTPA 1LQBC 4EOWH 4NYLB 5CCKH 1NAML 2DJSA 3U83A 1JSYA 3VWKA 2FWLB 3QG6B 4XVJL 3NQIA 1F1AA 3NTCH 3NSYA 1ZLWK 3TPUB 3SDDC 4AIXA 5JHDD 2QQNL 1MFAL 2X4OB 3WS6C 3MUZ1 1YECH 3UEQA 1SN2A 3DPDA 4MX7B 3QDJD 4GT0A 4TXVB 1HQRA 2HX8A 1UFUA 1TFHA 2QV2A 5KVGE 5K33A 2DWYA 4HWUA 4DO4A 2JSFA 3KCPB 4LASL 4KOTA 5EOQL 4PW3A 5JHDE 3AS1A 4N24A 5EF1A 1VACA 1QHQA 4FFZH 2UZIL 4PB0H 3OJMB 4I5BA 3WD5L 3K74B 3QDJE 5F7UA 2GIYA 2Z91A 4BH7A 1QWUA 2R29A 3ZIYA 3TGXA 1A1NB 1S7UA 1U2CA 5I8OL 4FEMA 1CP6A 5D72L 2E9WA 4PG2A 3IDNB 1UEMA 1E8XA 4K7PY 2HTKC 4WNQB 3D2UD 3KLAB 4F0YA 3AB0C 3QXAA 1IBFA 5TFSH 2GI7A 4A55A 5IOPB 3PL6A 4MLIA 1TKHA 2Y2YA 3IDGB 5C1MB 3HC4H 4Z7AA 4Q9QL 3D3VA 4GJTB 3QARA 4LEBA 4QRUA 4R3SA 2QVFB 3LSOB 2OMZA 2KI6A 3CV5A 5LBVA 3MJGX 4QJ4B 2DH2A 4JHWH 2HXAA 3BVVA 4K3GA 5D1ZB 1XGPB 3EOAA 1I75A 1UENA 1DCEA 5F96L 4X4ME 1UD3A 4BKLB 5JPNA 4AVHA 4YEFA 2XEIA 1TJHH 2AQPA 4E9YA 4HHAB 4N25A 4JZ0A 2ALAA 1N6VA 4H44C 3K2IA 4J8QA 2FWUA 2VDQB 5IJCC 3Q6FA 1R24B 3U6RB 3BP6B 4FA8A 3F7YB 4FLSA 2ZSVA 1KN2L 1DHKA 1W72A 4EVYA 1TQSA 1YN6B 3O6MH 3L7FA 1KV7A 1P4BH 2DKMA 4G8GB 5DS1A 3SSGA 1UHVA 2H2SC 3ZTNH 2WTPA 1NDGB 3FUIA 4Y19A 5EBGA 4LVEA 3BKJH 1CDCA 5JXED 3MYZA 2WGXA 3US9A 1KB5H 4I48B 4KSAA 4BWWA 2VMFA 4W4OA 3DK0A 4QUSA 3HHSA 5A40E 4MDJB 3WHXB 5IB4B 4OB5L 4WKZB 1D6EA 1DQML 3DGVA 2E6QA 1NCCH 4MCPA 1IQDA 2WINA 1U93B 4CVUA 4N1CA 1ZHBB 2ROXA 1FAIL 2XZCH 3MTXA 2HVKA 4JXQA 3TEWA 3W6XA 3B35A 3QP3A 1AZUA 4L3CA 1GYWA 1NMAL 5MENA 5I73B 4G80B 4EKJA 1E2ZA 1QNZL 4DGWC 1KB9J 1OCCB 3QRGL 1UYWL 4LPUA 3APNA 2HTKD 1XIXA 2WN2A 4AYMC 3CFQA 3CVHL 1FN4A 4HD5A 4XN9A 3T8MA 5JLZA 1M7IA 3IJ9A 3I75B 2CAKA 3FT2A 5DO8A 1WBZB 4EI6A 1M44A 3FQWB 4YX2H 4OTXL 1EHNA 3IMWA 5I6XB 5EU6A 3ILPA 5C6PB 2GSGA 4IBSA 3VSQA 3VWKC 5H4ZA 1OCRB 2BL1A 4HDIB 5K8NA 3T0EC 1YEDB 4KROD 5JO5A 1NGZA 3CXQA 2IGLA 5IR1A 1XXDC 2FT6A 2J12B 3HG3A 2VLRD 3SE8L 1IOIA 3FQXB 1BG9A 3ZU8A 1TLMA 3BPCA 2WPXA 3CLEL 1XF5A 4R2GB 3PB4X 2OR8A 4LSVH 4DETA 2CUMA 2QECA 3RL1A 1NIDA 2Y7QB 1WD8A 3MO1A 5CFHA 4CJ1A 3JYBA 3L13A 1VKXA 3KR5A 2B3VA 4Z7OB 4RFOH 4DZ8A 5KYWB 1DCLA 2VLRE 4NXSA 2H6UA 5I28A 3ECUA 3NCCB 5F9AC 4PVMA 2AK4A 5E4AA 4PG2C 3QXTA 1C1EL 3L9RB 1JGLH 4F2ME 3WNOA 5HDBF 2OTWA 3O3EB 8FABB 3PL6C 1UKQA 2CPUA 2J6EL 3L4WA 3WAJA 1X10A 4UBDC 1H6TA 1MKFA 3MSPA 3BI1A 4ORZC 3I6SA 1BF2A 5JIMA 1TMQA 3FTGB 4E0RB 1FNGA 2ZCHH 5KN5B 2X9ZA 3TT3L 3C09C 1SEQL 3G5VA 4AENB 3QJXA 5H37H 4XOEA 1IKNA 4ODXA 4PS7A 5AUMA 1PEWA 5JPNC 3F84A 1G7QA 2X09A 3EO0B 1GIGL 1W9XA 3KI9A 1NANH 3I6GA 1NKRA 1R34A 3H8NA 4S11A 4YHMH 3UJIL 1CPSA 1H3GA 4FJZA 1NFIB 4JFYB 1RUAL 4PTTB 5DEJA 5I1AA 4XXCA 2PJ7A 3FK3A 4PUBL 4MS8D 2C9PA 5F6HI 1LMKA 4HXAL 1U2YA 1F1DA 1RUPH 4P06A 4QF1A 1E4XH 2WVTA 2CLVB 4FQIH 4U1NA 1JYVA 3T0ED 3RNKA 1RSYA 5CLXA 3R0MA 1BYPA 4X2UA 3R0NA 3K6IA 1JGUL 3GSOB 4NRYB 4XH2B 3ZZSA 1DQJB 4ZO8A 2ATPB 2DBLL 4NUGL 4TPRH 1RXTA 2NNXA 2Z3KA 2E3VA 5CJOH 2GC7C 1LNUA 2P5EA 3M1BB 3T0EE 4CGTA 4F8PA 2ADGB 2V3DA 3L45A 2YPKA 3FF8A 4XCYB 2KLSA 3P4LA 1KUVA 1MWAL 2QGEA 3NFPB 3OSVA 5HHPA 2CPCA 4LUAA 1J1XH 2DQHH 2L04A 2R0KL 1AQDA 2IDFA 2D4PA 4UA3A 2WLLA 1SDDB 2VAJA 4ERSH 3PB6X 1A02N 4DP2X 3A22A 3GMLB 2LLNA 2ZW7A 3TE4A 4W93A 5HHXH 4OCMC 2R29H 4M6NH 4LVOC 2SEBA 2YEVB 5FKPB 2XZAH 3C5JA 4TVPH 1CPXA 4YHLH 4OLZL 2IDCA 3VFNB 5E8EA 5IB3B 2L7JA 4OD1L 4YEEA 2AXFA 2EDQA 2V9UA 3WFDL 3EH1A 2AJYL 1FJ1B 4I1RA 1CLOH 4XO5A 1EAPB 3S8WA 4UTCA 4UF4A 1IC4H 3O2DA 5L8JB 2GBTA 4FNLH 2XA8H 5FKAB 5DVOA 5DD3H 4FXKA 4HS3B 2ID5A 5JHLA 3VFVB 2AEQH 3WC5A 1AGEA 1XE4A 5C2UB 5K9OB 4JPWL 3CMOH 2YAQA 4ZZKA 4Z76B 2OR9L 4Z0XB 4E42B 2ENJA 2JKLA 3G5XA 2AC0A 4WLCA 2VL5B 2BXZA 1PCSA 3DOSA 3K72A 2XWEA 1MLCB 5IKCA 2IQ9H 4IQHA 5CEZL 2XRAL 2CRZA 1T5XA 4UM9A 1AH1A 1W72H 3ESNA 3Q2LA 3H9ZA 3SI2A 4IKNA 4NHUA 5F21B 1P1ZA 1R19A 4K9EL 4Z1PA 3D9AH 2XXFA 3ESUF 4HSAC 2OMXB 5J13B 4TTGA 4PJIA 5AVUB 1XEDA 4MWFA 4LE8A 1MRFH 1WVZA 3GK8L 3S34L 2EK8A 4LFHG 4JFHE 5D7JB 2AJZA 2I9LA 2VDNL 2CUHA 5TTRA 5FS5A 3I84A 3MLTA 5E6IB 4RN7A 1M7DB 1QFHA 2WUCL 1LO5B 3D30A 1TKWB 4JFQB 5DJZB 1I85A 3FUDA 4CS0B 4KZDL 1IKNC 3TM6A 3ETTA 3EJTA 1HAUA 2M2DA 2GTZA 5EN2B 2VXVH 5DMJB 5A3ID 1V05A 3D05A 4NUJB 4L0PB 2FWOB 2VYRE 4XMLL 4S1DD 3DR6A 5AZ2L 4ONFH 4GMTH 4BMHA 2R2HA 1E9PB 4WSJA 1PNDA 2F7RA 4NAQA 4BFNA 4N2KA 5TE4L 5B1JA 2JLMA 1MQKL 4TSCL 1F0LA 3KPRA 2ZXBA 2DLIA 4ZS6C 2CBMA 1TKJA 4Z5RB 5ELYA 1DSFH 3AVEA 3PWNB 1YNTA 1JPSH 3MZGB 4JUTA 3KHQA 5IHZB 2A4CA 2O5YH 1E4HA 4XNXL 4LDLB 1QMUA 4UM8B 1G9ML 5T5NF 2BK8A 2CE6A 4JL1A 1WC7B 3VWEA 1OALA 4FUUA 1TVDA 3AU1B 2ZXGA 1BQ5A 3NRFA 3QO1B 4G43B 5CZRA 2BHYA 2WIMA 1R5IA 2DQFB 2FVGA 2Y5TA 3DGDA 1WFTA 3NJVA 4XCCL 3ZKNC 2DRUA 1NCNA 4JKPH 5IJKA 2ZW4A 1NGWB 4Q8BA 2BXYA 1U21A 3RY4A 4YN3A 4YSTA 1N26A 1HU8A 5CBAB 4MRBA 4U1JB 2LOEA 1EAJA 4LLMA 4QO1B 5I5IA 3DJRA 1XMTA 1G87A 2VERN 4MY3A 3J27A 4LKXA 2D31A 3H9HB 4GKOA 4L3ED 2AK4D 5I30H 4FNSA 2QV4A 4WK4B 2WTRA 1JD9A 1JWUB 2FATH 5LBSH 4PRAB 3L2MA 1KENL 4DN3L 3QDMB 2N01B 2VZOA 3ZTJG 3ZUCA 4L3EE 2OMBA 4IF5A 3VTMA 2B8OT 1S7WA 1I8MB 1IIDA 1X44A 5DR5L 2AS5M 5AG6A 1SJVA 4APXA 3IAPA 2VJXA 1I3RA 1OAQH 4KHTL 5TE7L 3ABKB 5GGUA 5CS7A 2WQRA 1K4CB 5IFJB 1RJCA 3WIHA 5HDBB 3EO9H 3GS0A 1D9KC 4JFXB 1IM9D 5EZJB 2CXAA 4X2TA 4ZAKB 4NZRL 1MW3A 4Z3HA 3GJFB 3FUJA 4KJYA 4XWGL 4FXKC 4B5OA 3MV9A 3P69A 1A9VA 1NEUA 3IGKA 1JBJA 1OZTG 3BISA 1D5BB 1A7OL 5EUOF 4KUCF 4LSRL 3GIZL 2NYKA 1F4XL 4G71B 2EEFA 4PRDB 5DQJB 3QDHA 1ASQA 1NAKL 4AM0B 5KZCD 5KTDA 5GS1A 1T5KA 4O02A 5KUMA 3U36A 1AYEA 5BJTB 2ABZA 1EA9C 2HPTA 4OCSL 4QHPA 1DDHB 1I9RH 2LVEA 1SQ2N 2GFBA 12E8L 2PO6B 3M88A 2G3MA 1CO1A 1F11A 3ZKND 3CFEB 2HB0A 1TSHA 4FYQA 1KCUL 3C5ZD 2VR4A 4K5PA 2R0LL 5HD8C 2VXSL 4OGXL 2B58A 1ITBB 1XD1A 2Z0ZA 1JQGA 4ALAC 6CGTA 2VT0A 4J5VA 4U7MA 1NIFA 3GYAA 2Z7WA 1I85C 5DFTA 1JDDA 3FPXA 4F24A 4UI2A 3UYRH 5BS0D 1JZ3A 1JF1B 4PJ9D 3K80A 5C0FA 1IBBA 1BAFL 1ZK5A 1DUZB 1BFOB 1JZIA 2FGWH 1ZVNA 2XTJC 3JV6B 4MNGB 4JQIL 4B50A 1ZGLA 2RB8A 1CFVH 5DXWA 2CRYA 1R3IH 4RFNB 5HHMB 5IB5A 1NSLA 4JDVA 1DJWA 2W92A 1OL0A 1KGJA 1U8NA 5B1JC 3MZTA 4HOZA 5DA0B 1AKPA 1R3HA 4UAHA 5BS0E 4LGRB 5ALBL 1UOLA 3ZE0F 2DLHA 3UBHA 3OR7B 2GAZA 1R4XA 3L3GA 3DIFA 4X7TB 2QPUA 3F7VA 3SEPA 5SWQA 2OR4A 4FMVA 4L9DA 3BSZA 3HG1A 3SE4A 1D9KD 3EJYD 3QCTH 1WEJL 3NACL 3TA4D 5L2KD 1QVOA 4HFWA 1V8HA 3F7LA 4BWTA 5DMYA 3BQVA 3FEDA 4PN6A 2COQA 3MCLL 1E3FA 3GT6A 3RP1A 3JYCA 5IJKC 4O51A 1P4LB 4EZKA 2WOYA 1JTOA 1GS6X 3EJZD 4P04A 2OXGB 5JHLH 3H4HA 4G7YH 4UM9D 1LEKA 2B4BA 4A63A 4UOZA 2IH3B 1ZLVK 4GQPH 5E0FA 2OZ4L 2NZIA 4RMUA 5F7MC 5EIQA 5L2JB 2L3BA 4H20L 3KYOA 5B38G 1I7UA 2PWEA 2X6AA 3DLQR 2XV2A 3UC0L 1WBXA 4Z7NF 4XWOC 5HYEA 4Z95L 4IS6B 4OM1H 2AJ3A 2TAAA 4DT2A 3S8GB 4HSQA 2P8MA 2HFTA 1CR9L 2V0AA 2JQAA 4C56A 4TQEH 2WTOA 2GW5A 3NCJL 1L0QA 3QZWA 5FYKD 3SY0A 3VFWB 4AZ8B 2CJ3A 5TF1H 4YFEA 4KSIA 5HD8D 1D6VH 3HE7A 5AG9A 3FQYA 3PHAA 4Y9FA 4LOEA 4N5UA 4BK5A 3H2WA 3KWWB 3RWEA 4MHDA 5FYKH 5C3LD 4JPQA 4W9IC 3S96A 4PY8I 4OIDA 1KPVA 2ZYIA 4QXTA 2WZ5A 4IW4C 3ZUNC 3EBHA 5C2BH 4Z78A 1JCKA 5DLMH 5FYKE 3T8VA 2IQAA 1WT5A 3G04B 3Q1SL 4HJUA 4ALAH 5TJWK 4WWID 3WFHA 1G7PB 3NIDF 2FH6A 3KPRD 1K2DA 4RIRB 1OF0A 1OE3A 5LRGA 2ZPKL 4XPLA 2UXFA 1T0PB 1UUNA 2BOCA 1AZNA 4H0GA 5GS1C 1YJDC 1TSRA 2JJWA 3HMWH 3DRTB 3RL2A 4P45A 2HKHH 2OTUA 3O4LB 3WO4C 3MAWA 5ALCH 1GC1C 1S7TB 4JPKL 3TH4T 3INUH 2EDNA 4QHLA 1IU8A 4XBMA 2BSSA 3STZA 3AQYA 3IFLH 3LKSB 2WM0A 4XOBA 5D7IF 5D6DA 2H1LM 5EBLB 1MWOA 1O0VA 3QS2A 4GNKB 4NC0B 1K9TA 4PS8A 4G42B 4R26L 1H6FA 4P5TA 4Q2ZA 4CSSA 5B38B 4DHLA 1J12A 1RZQA 5A2LH 4ELDA 5GGVL 5EIVA 4FQJL 5LGHL 3LD8B 3MRCA 4W6WB 3V6ZA 5F48A 4PJHE 2R7EB 3F7RA 5J3HC 2QFRA 4A39A 4KKAC 4OZIE 3BZFB 5AD0B 1LP9E 4M85A 2OSLB 3CZNA 3AADB 1L9MA 3MLYH 2NRDA 1OB0A 5DI8B 4L2YA 5DRZA 3HNTH 2OM5A 3C9NA 3VG9B 2VC2B 4F9UA 3I9GH 3RDJA 3WNMA 1XCQA 3IDXH 4OQTA 1TG8A 4XNYH 4JY6A 1RCYA 3D18B 3D4YA 3VGDA 3L95A 5FM8A 4M48L 3V6FB 1BFSA 2IALA 3EYFA 1KEGH 2OI9B 1MJ7H 4B7LA 3BI0A 4PXDA 5TQ2H 4TSAL 2VJ0A 5DZNA 5EF2A 5MEPA 1XDTT 3EFFB 4K0OA 4Z65A 4X6FA 5C0CB 3VI4E 5EEYA 3HVNA 2QIRA 3QEQB 4ZPVB 5EOCH 2N59A 1ILSA 2D3LA 4QTFA 2W9DL 3WIHH 4XZ4A 1NGQH 3IXAB 4FYSA 1WISA 4LSUL 5EZLB 5H2BA 1JN6B 4XBPB 5HJ3B 43CAA 1P4NA 1HXMB 3QJHB 1V3KA 1OQOA 3I2CH 4NUMA 4HMEA 4GAJH 1FL5A 3POHA 4NQCB 1LK3L 5KW9H 1RZJC 2GUOB 3RIFF 3FS9A 4LSQL 4KBPA 3WFZA 4LCWB 4H7VA 4UEEA 3LKPA 4GI6A 5HYJA 5BVJB 1YJDH 3EDJA 2WZ0A 1CE1L 2YOCA 4O02H 4XPAL 4X4XB 1FFOA 3GMMB 4IBLT 3Q5OA 1HVXA 2Z0BA 4OLWH 4HK0A 3T3PF 4BHUA 2F74B 3ZE1E 1BIIB 2XUWA 1GC1H 3MNZA 3NSFA 1UB6B 1H3TA 3S97C 4TSBH 3KYNB 1NANI 1MNUL 2Z31B 3HE7C 4FFYA 1HE8A 4MHHI 4NT6B 1PU9A 3QHZH 2I7OA 3P4NB 4BK5C 3A21A 5E9DA 1WA1X 2EXYD 3DTXA 3BUQA 2NUTA 1VEOA 5J3HD 2NXZB 1FI8C 5HYSG 3O45B 3KWUA 3QFGA 3WLBB 4NKIL 4X6DF 2I24N 2LQRA 2YD2A 3DHJA 4F9PA 5F89B 5B21A 1WT5C 1YEKH 1F90L 3PWPB 2UUDH 1AZZC 1E4XI 4IKJA 1NAMB 4PJ8A 1WZLA 4N2NA 4HEME 5FV2A 1NM9A 4HGWA 4AYFA 5GISH 2A6KB 4E9VA 2AXHA 4N86A 4F8QA 2RC4A 3OKKA 1J48A 4CYOA 3ETBF 4HIEB 3ZE2F 1F6AB 3OZLA 5INCA 1HOCA 4S2SA 4MXVF 5JW5B 4X5PA 1DJSA 2G9KA 2FEDC 3K4DA 2H45A 3L1GA 4ADJA 4YLCA 4OJFL 4U6VH 1AO7A 4NBZB 1GW6A 1MXGA 3KS0J 4GG8A 4K5MA 3L1OL 3QE5A 4NPYA 3VFUB 1C12B 3Q8EA 4UFWA 2AJSH 3WS3A 5EU3B 3ZE0B 4E5XA 3AT8A 2C6PA 1D5MA 3GUFA 4HGMA 4MQXC 4YDLC 3Q3GA 5D6DC 3Q8AA 3PUCA 3OHMB 1TJXA 3TC9A 3BSZH 1S7XB 1T7VA 4RMVA 1TTGA 2DJMA 4DO6A 2VXKA 2R1YA 2BP8A 4P5TC 3IU2A 4JCMA 4F33B 1BVZA 4O5LH 1MJ8L 1TYRA 1NBVL 3IIBA 1WCBA 3N40P 1CG9B 1JWSA 1SGKA 1XIWA 2Q3ZA 3FU0A 5AVXB 4R87A 3FRUA 1FO0L 3TCVA 3CHXA 3UTTB 1KTLB 1L5GA 1GGBH 1J0HA 1DVFD 1T1ZB 4S10A 5KSAD 1T03L 1VEMA 3E6HB 3T1FA 2WQAA 4QXGH 2CHNA 2JI2A 5CLYA 3IJHA 2JKIS 5TDNA 2BJMH 3T1WA 3D7DA 2H8PB 4B9KC 4ZY1A 1CDJA 1QFOA 2DLGA 3P4OB 4U3CA 1RZJH 5MI0B 1X12A 3B37A 4G1EA 1J5DA 1F3JA 2MTAA 1S3KL 4MMOA 1TQCC 5E94A 3QH3A 1IAIL 5DJ2B 4GPVA 3BUYB 3FJTA 1F4WH 1HHHB 2FD6L 5T1LD 2R59A 4Z7NB 3EYUH 2YPLD 2R2BB 4YR6B 3RPIB 3E7JA 4MAZA 1A1OA 1FZJA 1W15A 4Z3FA 2A4EA 5KTEL 1EEQA 2LGNA 3CMGA 4O9HH 4N0CC 1JZEA 4LRNH 2HKFH 3O6FB 4R4BB 1SMAA 4G8FA 3OZKA 4WJG3 5E56A 5CD3A 4MCYA 2YPLE 3I9AA 5DDHA 3SJFA 1KTBA 4ZYKB 1Z9PA 3EOYG 2JCCF 4ILDA 5ENWA 3TT1L 4TVUA 5D1XB 2YKLH 4UCFA 3ES6A 2FEDD 1GS7A 3LZQA 3MRBB 3UMNA 3SXOA 3K2KA 4NQXB 3GNMH 2V3FA 3TPUA 4P2YA 2G3ZA 2X4OA 3NIDB 3QEUA 2Y06H 4CSTA 4DUXA 1MCBA 4Z7VA 4JPVL 4FTVD 5I1JH 2B1AL 2CBQA 4MX7A 3WXWL 3RVWD 1GA2A 4PK2A 2A2QT 3K5RA 4MQXD 5D9SA 5HPOA 3ARVA 1HEHC 1X9LA 4YSPA 3NAAL 4KTDL 3B2YA 3KCPA 4PJGA 1FIGH 4P5TD 1JUFB 1OAKL 3RFRA 4R5XA 3C60B 1L6PA 3LHPL 1IEBB 4ZUVB 4ZNEA 4DN4H 4F2EA 5I6NA 1FLRH 3MFFB 4I49A 1A0QH 4HHWA 4FTVE 3TCLB 3C2AL 1NFAA 3ILQD 3CVHB 4OCNC 1YG9A 4P23C 5D7IB 4GO6B 2DMKA 1A1NA 4ZX4A 2CHXA 4GSDL 1ODUA 4F9PC 1L9QA 3AXHA 5KEZA 3IDNA 5I8KH 5E2UH 2Q7SA 1T7YA 1M6OB 4YIQB 1CFQB 3KLAA 1BQHG 2J7LA 2K3TA 5IOPA 4NSKA 5D7SL 5JIQA 3IDGA 2DTMH 2ZCLH 1JHLL 4FF9A 4FKKA 5E8OA 1F8TL 4PFEA 2N0KA 3VDAA 4XO8A 2NR6A 1Q2CA 2ZXAA 3LSOA 4RVBA 1FZOB 4I77L 2VDOH 2UY6B 3AS0A 4P05A 2DDQH 1SLXA 2YXWA 1A6VH 4OLLA 4OQTH 1XGPA 3PABB 1XD0A 2NYQA 2NX5B 3LIZL 4A30A 3O3BB 1O9VA 1GCFA 2IGFH 3L4TA 3DBSA 1MAJA 4FQQB 2XTLA 1AGDB 4N0CD 4M5SA 4XC1L 2BERA 5E03A 1R24A 2OP4L 3BP6A 3BPLC 1MVUA 5HHOD 4YWGH 1CDGA 1UD4A 4X7SH 3U6XS 3J7HA 1YN6A 2DKSA 2NY7L 1GYCA 1OEZW 4OFPA 1BAWA 4Z0BH 1MHHA 4G8GA 3LNFA 4J3WA 4LX9A 3EOTH 3V4VL 4AY0A 4LLWB 4APQB 5E8DL 3HR5A 1CLYH 5HHOE 2MRYA 2PVWA 2PW2B 3CLFL 4H8QA 3T65B 5ID1B 3MLZL 1L9NA 1ET8A 6PCYA 1J86A 3WHXA 5IB4A 4DGVH 3UAJD 4UT7H 4WKZA 3N5AA 3H4QA 1XCWA 2ICCA 3MLRL 1HYSC 3BJ7A 4EN2A 5ITFB 3JVGC 2ZUUA 2RGSA 4OLVH 1ZHBA 3MRDB 3HUJE 1BJ8A 2EE6A 1PCXA 4U0RB 2ZT9C 1BQHB 4G3YH 4X7DC 1UXLA 4P23D 4DGYL 2FS5A 2BSRB 3T3PB 4G80A 3N9GL 3FUMA 2AP2A 2VLJB 2V8HA 1T83A 1DE4C 4YZWA 1DN2A 5C0DA 1OPOA 1T22B 3IO1A 3VXUB 3B7YA 3W37A 3TIDB 4JMNA 4TWEA 3P11L 5AAMA 5JA8B 4NKOB 3QZOA 4HKJA 3I75A 4ABUA 2XPGB 1WBZA 3OHXB 4QNPF 3UPAA 3FQWA 5BVPL 2VQ1B 1DVZA 5D7HA 4JM4H 1Z3GH 1FE8H 4HDIA 3JV0A 2EADA 1YEDA 2I85A 2CIIA 4OLXL 5E4EB 4NPJA 5FWRA 1UJTA 3IVKB 1FFPA 3EDKA 2AJ6A 1RHHB 1NMCB 3ZE2B 5SWZD 1EJ8A 5D70L 5J11B 1MWAB 2JCWA 3KPPB 5LWYL 3FQXA 3E2HC 4FZEL 4NJ9L 1ZEAH 1EERB 4LEXH 1ZT1A 5AKTA 2Y7QA 5JNYB 1D5IL 1LO0L 4F91B 2DQCH 2ZP0T 3N1MC 1AZCA 1NCHA 1IGCH 2W0KA 1BQLL 5B1BB 5SWZE 5DMIH 3WEBA 5C09D 5KYWA 35C8H 3VFRB 4OIIL 3LPFA 4EIUA 3GRGA 3LKQB 2NW3B 2B9BA 3PGFL 4U0QB 4I7ZC 1JGEB 4IBZA 1PLGH 5B22A 3T9YA 4PLOB 3M8OL 1AS8A 4NQED 5C09E 2Q7YB 3S6GA 2P6EA 2W38A 1BZDA 2OA9A 3GLZA 2NR6C 4BBWA 4FL4B 3WEOA 1CGVA 5KN5A 1S46A 1SN5A 4ZUWB 3VUAA 4PBVC 5D1ZC 4AENA 2ATKB 2OMTA 4ZFOL 4NQEE 1AE6L 3KVQA 1XF2B 1N0LB 2O1AA 4N5EC 4KY2A 5ID0B 5KYYB 4X5KA 1QFUL 1SHSA 4HOWA 3WFBL 1NFIA 2PJ8A 4JFYA 4HKZA 4PTTA 1JNJA 4HXBL 4XODA 2CLRB 2VR5A 4D8PB 5E2VL 4JKNA 4ZMOA 1TJGL 3CTTA 1AI1H 4ZD3L 1P4UA 5FW8A 2BLFA 5GS0L 4DKEH 4R8FA 2FLRT 1U8LB 3CFBB 4Z6AT 3KS0H 1WBYB 4UIKL 2XHNA 5ESVA 2FYYB 5I1GH 3IJSB 4OT1L 3SKOB 3L1EA 4F58L 2VDNB 4OZFA 4JW3A 3GINA 4NRYA 3E38A 1EO5A 4RNRB 3SKMB 3S5LG 3ZK0A 1ZLUK 1DQJA 5D7LE 1A3RL 2ATPA 4FCHA 2JTYA 2OXHB 4U31A 4ONOA 1ZKAA 4M1CC 4BFJA 1FGNL 2EEDA 5EZIL 4BFIA 5ADOH 1E4WL 3QCVH 1GH7A 5GSRA 4XP4L 1B0WA 4XCYA 4H40A 4RDBA 2VTFA 3NFPA 2DQDH 2WXLA 4L2LA 1NBQA 1PZ3A 5I73C 1AGFB 1BXAA 1N18A 3PJLA 4KQ4H 3H54A 4P2QB 3ZKMD 4AIEA 1E9OB 4YGVB 4Z8FH 3B1UA 3UBGA 1DQQB 1P7QB 3NA9L 1MG2C 1T83C 3UABA 1OSYA 2BSEA 3MLWL 1U30A 3AG1B 3G9VA 4LLAA 4QMEA 4CVZB 3MJ6A 4AG7A 2A6DB 2A74A 4L3AA 2G9DA 3GQFA 2EYTB 3OJ2C 1AQKL 3N85H 2APWA 2ZEOA 4X4YA 3D0LA 1YNKH 1UD8A 1OK0A 2I5YH 1D5ZB 5DQDL 2ZUQB 4ZYQA 5I6XC 1TVBB 2GJPA 3B3BA 3VFNA 4AGOA 5IB3A 1EZLA 1SFDA 4FFWD 3AG4B 3BYTA 1OCWH 3WNIA 3FRMA 1FPTH 3HRZB 1EAPA 2QVTA 1KIRB 2R4SH 3BN9C 2BY1A 3PGCA 5D1ZD 5I4MA 5DVKA 3SDXE 4LCIL 2KS0A 1N6QH 1KV3A 4HS3A 3ZMNA 5AW7B 1ID2A 1RY7B 3VFVA 3BGMB 4R2GC 3FCGA 4UQDA 3C12A 5CGTA 5KBPA 4E42A 2EUWA 4PV9A 2VL5A 1FH5H 2NOYA 2IMOA 3QB8A 2OKMA 1Y6MR 4ZPTB 3S5LB 2VDQH 5CILL 5IBTL 3FQTB 4HAGA 2ZCKL 3SODB 4N68A 2HJLB 4HUWA 2EDRA 3EDDA 1YEFL 5GPRA 3RVUC 1XZWA 1TF8A 2PJ9A 4R6TA 3H7LA 3UZVB 2BIPA 2XN9B 4FYTA 2HH0L 5BUGA 1TYJA 3BFWA 4AG9A 4RRPM 4KNTA 4XN2A 3VGEA 4KK8D 4Q14A 5DZAA 2D7MA 1OANA 4PJCF 4AM0Q 1M7DA 1R33A 5CCHE 2DPKA 5ISZD 4PJXF 2L8AA 2V77A 3REWB 2VSMB 4FD6A 3SYPA 1UFGA 5DJZA 2ZUYA 4EN3D 4NX0A 4XB3A 4YPGA 2ETWA 3DVIA 3LZLA 1A7PH 2EDEA 4XN4A 4Q9BA 5CJ8A 1EVTC 2IH8A 4DK5A 1C5BH 1TZOA 4NUJA 2J20A 4MZ3A 3RIAK 1DQLL 3GBNH 3WTXA 1Q0XH 1DBKH 2UXTA 2W80C 4RWHA 4W1TA 4D3CL 5ISZE 1E9PA 1IGIL 2N56A 3HA0A 3TOAA 2Y69B 4PRBA 4Z18A 3GSQB 3A3YB 3UZEC 4ODVH 4Z5RA 1KDIA 1X5FA 15C8L 3AMLA 2O6FA 5I24A 3ULVD 4PJFE 1W91A 1RLWA 2C5DC 4WW2A 4A2LA 5IHZA 5CP7B 3AITA 1N5YH 2BS8A 5DO2C 5DC2A 5A6LA 3PNWB 2KERA 2HWZL 4X4KA 4K7PH 3RWJB 4UM8A 2DLTA 4KRLB 4AQ1B 2UV3A 1CN4A 1NSNH 2FIAA 3HG5A 4G43A 4PHZA 3QO1A 1M3IA 4YXKL 3ULVE 2BCKB 2DQIH 4YK4B 4HUXB 4R2GD 1E2VA 5IMOB 3WNPA 3D7PA 2VQ4A 3DDFA 4NO2B 1HXKA 1ZAGA 3DSNA 2VXUH 3L6FA 1OZUA 5CBAA 4N6RB 4U1JA 4Q0XL 5HDQL 4CYNA 4QO1A 5JYMA 1MLBB 1RK1A 5LYLA 5AENA 3GKWH 4YE4H 5IW6A 2XXCB 2C4FT 3IJEA 1MZYA 2Q8BL 2QR0B 5CSGA 3CDZB 3L5JA 4JFFB 3BHBB 1AGBA 1NBZA 2HVJA 1EBPA 4PMEA 1NCDL 3IKKA 3BVXA 4UTAL 4FA7B 3W2DH 1NEPA 1KPUB 1XWVA 3GSXB 4RGNB 3QCUL 3LEVH 2HV2A 1G0DA 4MCZB 4S0SD 4X9GA 1I8MA 2FX7L 2DQTH 2JQMA 4BSVB 4WI0B 5GGVY 1K4CA 4UOQA 4XC3L 2HFFA 1NCOA 2HN7A 25C8L 1ES0B 4JFXA 5EZJA 5ADPL 5D2NB 2EKSB 4ZAKA 1O7SA 3GJFA 4H1LG 4IYKA 4R0LB 1P7KB 5CCGE 2MJWA 5HH1A 4NN6B 1G1YA 1D5BA 3RIFK 3MUUA 3MQIA 1MW2A 1KBGL 1KXQE 1Z2KA 4C57C 5E8PB 1ZE3C 3KM2A 1OBRA 3IFPB 5CF3A 1UZ6F 2VJ8A 4PYHA 4DPAX 3K7UA 5CAYB 2ZOLB 3OWEA 1ZDSA 2V5TA 5I0XA 1M1XA 2G2NA 4NP9A 1RJLB 5GRUH 4F37F 2V8GA 3SPIA 5DJXA 3S37L 3N55A 5I1CL 4Q58C 4KVNH 1YYLL 5DC9B 5C0AB 3DI3B 4L89A 5HMNA 4UQ2B 2MPAL 2Q44A 3BJ91 1J9CT 2AK1L 3DX6B 3CFEA 5D7JC 3ZJ0A 4M7LT 1QBML 1VZGA 2CRIA 5F88B 5C7ZA 2A0LD 2GJRA 5E6IC 2X1XR 5ANHA 4FHKA 1H6UA 3HKZA 1CU4H 1MFDL 3E1F1 2CG9X 1BFOA 3JV6A 4PLJD 1MW1A 4O2CA 3TYFB 1LVEA 4UZSA 2FBJL 3CSTA 4WTXA 4AW4A 3T4AB 3FXTA 3G6AB 3W5MA 1YUKB 2TSAA 1I8UA 3FSWA 4YXHL 2K5TA 4WU5A 1L3WA 4L4VB 3V52H 1L7TH 1CP7A 5MP6H 1QFWH 4K2UH 4L4TB 4G1PA 4B27A 4JM0A 5KJ4A 1OWRM 3OB8A 5C0EB 4H1LB 2YD1A 3SI1A 3JTBA 4X7TA 3JV4B 4JN2B 2PTVA 2FUQA 4ENEC 5TDOA 5EC4A 3TX8A 4ZJ9A 2XY2A 2AFZA 3W39A 4GT7A 5EHFA 4KOBA 1PYWA 1ROCA 1XAKA 3O3AA 4BSWA 1XBRA 3AWEA 2D0FA 5DZOA 4Y4KB 5G4OA 2YEZA 2CDFB 1CYWA 1LE5B 3QDAA 3BVUA 5DSCA 3FL7A 2YD0A 4XMKL 1R5VB 1T04B 2XPZA 3QUXB 4YGAB 4HWEL 2QHRL 1IC1A 1P4LA 2VLKD 1FNHA 2GBUA 3R18A 2QL1A 4AZUA 1CT8B 5JXAL 1H3PH 2QPDB 3AABA 1YREA 4XPHL 3CSGA 4V2CB 2BVOB 2YOAA 4DF9A 2BIIA 1F58L 3E0GA 4OLUH 3ZGHA 3I3DA 1RUQH 1ZE3H 2JJSC 2JKSA 4GQ9L 3GB0A 1QSRA 2VLKE 4S1QL 1DANT 3VD1A 3MA7B 4IS6A 3V9CA 1OHZA 1WZ1L 1YEHL 1N8OE 2IAAC 3IPFA 3F5BA 1P0SE 5LXGL 5FECB 4H2CA 1U95B 5T3ZL 1LOKA 5D7JD 3Q7JA 4RESB 4R7NB 2DD8L 5CINH 4AZ8A 3F00A 1BJ1H 1DO5A 5L7XH 3TT2A 2LE9A 5E6ID 1M4IA 4UQAA 1BXXA 1CGSL 4EUPG 3E1ZA 4NNXB 3I02A 1INEH 3D39B 1JS4A 3U4BL 3U7WL 4RA0C 1F5WA 3KNBB 2RMNA 4YDVB 4ZAKC 4KZEL 3G04A 5DJYB 3GI9L 5I1LB 5L88H 2GE3A 1RUMH 2F19H 4PJCB 2OSYA 4PJXB 4AQEB 1G7PA 4NZFA 4DUKA 2ZOFA 2FBRA 5I0WA 3B4NA 3QFJD 1PMYA 1QA9B 4RIRA 2VZ3A 4X9YA 2EABA 3R9EA 2B3RA 5DEZA 3CX2A 2E8YA 3TCXA 1MJUL 2LTQB 3L4UA 3ZHDA 2OZNA 2P7TB 3FQUB 2NY5C 5CJQL 1UG9A 3ZDXF 1JDAA 5GZNA 4TOYH 2DYPB 1MFMA 2QSTA 3QFJE 1TF9A 4BHUI 1GHFL 1MCNA 3FB3A 2BHFA 3C5XA 1BD2D 4CKVX 5EWIL 5EBLA 4Y1SA 4FN0A 3Q1EA 5AGEA 4G42A 1P1VA 5KVEL 3QDGB 1RZ7L 1XL4A 4KXAA 5B38A 1J7VR 4WI8A 1EGJA 4YBLB 5HDWA 2OYPA 5JQ6H 3I9SA 4BFOA 4OFYA 1BD2E 2R7EA 3KEDA 4MJ2A 4Y2LA 2IIJA 2V2XA 1I1YB 4QHKI 4M7KH 4LFHD 4IU2B 5AD0A 1UM5H 5D6CB 1YPZE 4KKBD 2B0SL 3B9AA 4BDVB 3MRPA 1AKJA 4RFNC 4LIQE 4IBTA 2NSMA 3RWGB 4QRBA 4BFKA 5FYLL 1RK0B 4EUPB 3QDMD 1HIML 1Z4EA 1ZV9A 4ZW6A 4KO6A 5GS3A 5CZVL 1QSFB 3VRJB 4JO4L 3D18A 1M57B 4WEBL 5J7CC 3TN0B 2BO9A 2CNSA 4MCQA 3BWAB 3EUUA 4GG6F 5E00A 3FC8A 3V6FA 1EZUA 2YD8A 5GS2D 5CBMA 5C0BD 3IBOA 3H3PH 1FORL 3QDME 3PREA 2BWQA 3ARFD 3U9WA 1A6WL 3UROR 2AQTA 2MQGA 4XP6H 5C0CA 4ZY0A 4KVOE 3QEQA 5GS2H 4BZ2L 4E9RA 2XYCA 3GTVA 1AJ7H 3ATDA 3EJCA 1NWPA 4N3TA 4ONGL 1FA4A 1FO0B 5C0BE 3IXAA 3QQ4B 2RHEA 3FTSA 5EZLA 2FJSA 3GJFH 3WY1A 4E41A 3C6SA 3LHAA 1JN6A 3OKOB 3CC5A 4RGOL 5HJ3A 4ZMZA 2VM3A 3JTTB 1FYHB 4CN6A 1DQIA 1CQKA 1X4XA 3TFBA 1JNNL 2RIKA 5KS9E 5AOIA 1EJOL 5BRZB 4NQCA 1NEZG 1FHNA 1N4XH 3BXNB 5BW7A 4OH2A 5EUOA 5EF0A 1UZ8B 7FABL 3RNZA 1AC0A 1UWEL 2YHGA 4NO0A 2DWEB 4LCWA 4M4RA 1X9QA 2J1ZA 4OF6A 4R96B 5KVGL 2NY1B 5TDPB 4G6FB 4XI5C 3L5IA 1DLFL 2PO6D 3GMMA 1CG2A 1HL8A 2JK5B 1GYTA 3VXRD 1SYVB 2F74A 2NY5H 1ZSDB 1UT2A 4MJJA 3TWCH 1BO4A 4HFUH 1UB6A 1JK9B 3VMNA 3KYNA 2Z31A 2PJ5A 4M1DH 1WWAX 1UOWA 1RZGB 4HA1A 4PB9L 1H3WM 3D66A 2J1WA 4PJAB 1LDPH 3HRPA 1M2OA 1ZV2A 3BWZA 4KI1A 4UNIA 2DY2A 3VXRE 2FNWA 4MHPA 2DOCA 2BIHA 4GXUM 3BSGA 3ATBA 2K7PA 1KJ2L 2E9JA 3ZTJH 3QXDB 1EHLL 1TO5A 2UWEA 1F6AA 4MJ5B 4X5WA 1GPOL 5FW6A 1OHQA 1J10A 5INDB 5JW5A 2F53B 1X9UA 3FSVA 4MNGE 4AJYV 4K5OA 4DPCX 2DWTA 1SJHB 3HAEG 2P47B 4UQ9A 3V5HB 4E0AA 4QTIL 4B3VA 4PD4J 5DURB 2FL4A 4ONHA 1IQWL 3FCSB 5GZNC 4F20A 4JY5H 1EZVY 1K6QL 3GRWL 1C12A 3GLAA 3DKHA 1Q38A 5BO1L 3S3DB 2E27H 3QG7H 3T3MF 1IMHC 3R9FA 1R17A 1NEZB 1N12A 1S7XA 2HTLC 1IGFL 1WTLA 4KHXL 5K69A 3SGJA 4F33A 1CC3A 2EIEA 3BKCH 3GHBH 1I3GL 3KVPA 2QSCH 3LD8C 1CG9A 1YEEL 4LGSB 4KXBA 3FJUA 3CH8A 3V7AE 1X5KA 4FZ8H 1XH2A 2VH5H 4JJHA 4ENZA 5EULV 3UTTA 3IMBA 1KTLA 1T1ZA 5IUSA 2OZGA 3CXHJ 3FOMA 3ENEA 3IGAA 5HHVL 3Q06A 3KYMB 3MFGB 3RVUD 4K94C 4CU8A 2ED6A 4PRPB 1Z9SA 3MLSH 4OCXL 2H8PA 1UOVA 2YGPA 4KO7A 1ITCA 3DUHA 3P4OA 3VG9C 4MFZA 4K3JH 3R1GH 1TZ8A 4NSQA 2PIZA 1WAAF 1MIMH 3HBQA 3UG3A 3KPSD 1JXFA 4QOKA 2EILB 4DVBB 9CGTA 1AYOA 5BZDB 2OI9C 4FHBD 1EEZB 4R7XA 2R2BA 3T8WA 4U1KB 3RPIA 1OK8A 3LRSA 5GIRB 4BM7A 3OGOE 1TTCA 1HWGB 3ZT7A 4X6BB 2PCXA 5K1JA 3GXFA 3KPSE 4MJ8A 1O5PA 2WSKA 3CSFA 3PP4L 3MBXH 3EO1B 4JO5A 3V4VB 1CM0A 3ECBA 3HAEB 3O6FA 5CR1A 4URTB 3L5WB 3PWUB 4YHNB 1B2WH 1OWWA 4ZYKA 1FC2D 1WAEA 4UB0L 3UFIA 4LK4A 5D1XA 4BUGA 3NDZE 3MRBA 1ZT4A 3V0DA 3V4PL 4QWWC 3FSZA 4G11A 4HIHB 5DJCB 4NQXA 3UPCA 5H35A 5AW2B 5BW7C 4LL1A 3O4LD 4OZ4A 4PXCA 3QJFB 2Q7AA 3U9PH 2BIMA 4L1DA 3FTWA 4N2EA 4H8WC 3MV8B 2WGNB 1KC5L 4XAWL 1QQDA 4QRPA 4XN7A 4I0KA 4TULL 4MA7H 2A9NL 1AVAA 2DM3A 3CUPA 4BXVA 2AXGB 3RFZB 2HFEA 1YN7A 3BSHA 4LSPL 1ZA3B 1CTMA 2HTLD 4UT9A 5DD1L 4F7MB 5I1DB 3GPSA 2WKGA 4B60A 3O4LE 2WWNA 2DIBA 2Z31C 3ZDXB 4ZUVA 1IEBA 2E9BA 4ZOAA 3MFFA 3TCLA 1U4EA 3CQPA 2YGQA 3EG9A 2YBGA 3CVHA 4OFYD 2NXZC 5D7IA 4YH6A 4HCRA 4Q9RL 1U8JB 2ZWYA 4JFWA 4ODSH 1EGJH 1MREH 4L1LA 5I9QB 4B13A 4IK7A 1X5JA 1B4RA 4YIQA 3SCMD 1MCSA 4GXUN 4KH9A 4KJWD 5E24E 4MQ7B 4UOW0 1IAKA 1A7BA 3RPBA 4K8RD 2HRGA 1KEMH 3MKKA 4X8XA 1QWNA 4G8EB 3RAJL 4K94H 2X2JA 2LVCA 3SJGA 3KXFB 2ZOKB 3P0GB 2I9TB 1FZOA 4GAYB 3M7FB 5IROD 4HUMB 2EIKB 4I18A 2VC2H 1J9TA 4JB9H 5ERWA 4X0NA 4AJWA 5C6TH 2B1OA 1S7VB 3PABA 3I74A 3PAYA 2YD7A 4OF0A 3K1DA 1KJMB 2R8SL 5CHNB 3O3BA 2FJFB 4AV4A 2YARA 4FQQA 1S9XA 5F0LB 1EDHA 3CSYB 3O8XD 4JO1L 3FBQA 3C8KB 3HE6A 4LAQL 4GG6B 4BRJA 4WWVA 2HJFB 1U8HB 3LRMA 1NTDA 3UCQA 5DUPH 2IFGA 3MRJB 1SUJA 4NM4L 3MUY1 1X7SA 1M4GA 2HX9A 1ZANL 2ROYA 3VVVA 1X4YA 2APVA 3D85D 3IKCA 4QXWA 3LH2H 1NE9A 4LLWA 2HLFC 1I1FB 4OKVB 4WO4B 4DVRL 2J6EA 4APQA 5FDWA 2ENSA 5HVHA 5IB0A 2FNBA 1KCLA 4WJ5A 5IVXF 1RHFA 2K4AA 1KIPA 1I3VA 2CUIA 4MMZB 4JLRB 4P2RA 3X14A 5HP5A 1YAIA 2P43B 4N90D 4YSOA 5FYJD 2V2WA 4NP4L 2YC1B 5MI0C 4OF3A 4JO2L 3GBML 4GSQA 2YFNA 4P4RB 4Y0GA 4ZFOB 1NFDF 5EUKB 5ITFA 1KF9B 1Y0YA 1A6ZB 4H8WH 5EPMA 2Z31D 5C3TA 3MRDA 3SPVB 3GPEA 4UOJA 4OADA 4UAOC 4ABVA 4I88A 3BPNB 5FYJE 4Q52A 2BSRA 2BFVH 2AITA 3QUGA 2ZKHL 1Q1JH 3PRZA 1W8NA 1T0NB 4JFEA 3PWPD 2WLIB 1T22A 3B7UX 4WVRA 4XE5B 3ZDZF 4NS0A 4N3UA 1KMGA 2V7NA 3MYJB 3TIDA 1G6VK 4FFVC 3O6FC 5JYLA 4JM2F 2NT0A 3G5YB 1F3DJ 2XPGA 3NPSB 1JI2A 4M6GA 1B0GA 1AXTL 2J8UB 1E4KA 2WXOA 4G7RB 4ICWA 5CEXB 4Q56A 5FO9B 4X6DA 5I16B 1NAMH 5D1XC 5EMYA 1PAMA 4K07A 4X6CA 1HH9B 4XVJH 4B5ZA 3PWPE 5HHQA 2EK9A 2G2RA 2QQNH 2OZHA 1MFAH 2Y3AA 3RURA 4NQUA 4S1RL 1HAWA 3PP3K 3IVKA 4MNQD 1W8EA 2O5ZL 3MOAL 1RHHA 3APCA 1OGAB 4F2FA 1MWAA 2VO5A 3KPPA 2W9EL 3RUGE 2Z3LA 5THWA 3ARGB 4LASH 5EOQH 2J55A 4HJTA 2K9FB 4FQPA 5JW3L 5H94A 3P2TA 4EJ1C 2Z93B 2CM6A 3C60C 1ZGLM 2UZIH 3WD5H 1ZRUA 1S9WB 4MNQE 1CYXA 2WXKA 1IAOB 1U3ZA 2XNAA 4PRIB 5AOMA 3X1FA 5I8OH 1QFWI 2Z1KA 5TE6H 5D72H 4KOVA 3V79C 3LKQA 2NW3A 4MJID 3WKYA 1ZHLA 1LK2B 4HHGA 2CKBL 4B6ZA 2ZENA 4MI4A 2GU2A 4ZQKB 3A23A 1JGEA 3MNWB 4G5ZL 1PZCA 4HETA 4CRYB 4FXTA 5F1KC 2X4NB 2PJ3A 3IM1A 1FZKB 5K39B 3K6SB 4Q9QH 3O11A 2O6EA 1CLVA 1ZS2A 4PBXA 5FA4B 1ZHKB 3K0WA 4L3FA 1EANA 4MJIE 1VPOL 3JRUA 3EHBB 1B0RB 4Y49B 2C7UB 5DRXB 3G5WA 2AMUA 4ZUWA 5F96H 1GL4B 3MGDA 2R98A 1XF2A 4MA3B 2VZ1A 5T5FA 1AXSB 1HCZA 4OGAC 2C9RA 4F37K 5E1AA 4Z7WF 5ID0A 2EXWC 5KYYA 3UG4A 4FKEA 3HE6C 1KN2H 5K9QG 1UACL 3O6FD 4XZUB 4BQBA 1JPFA 2CLRA 3ZZQA 4D8PA 4KGLA 5A1AA 3BWSA 4YSUA 4K5NA 3RVTD 1UGKA 4XAKD 4AK1A 2GITA 3VYPA 3II3A 1WBYA 4APQC 1OZPA 1RERA 3DMMD 4KGJA 1KYOJ 1KLGB 3IJSA 5LO7A 4P4FA 3SKOA 2DTSA 4FYRA 3F6IA 3SKMA 4RNRA 4U1HB 3NJLA 4OB5H 3RLSA 2JCCA 3TNMB 1WJ3A 1X5HA 1DQMH 3VNZA 4ZFFB 3TVMB 1JVOA 3RHWF 4ZX3A 1C7SA 3MR9B 4XAKE 2AE6A 4YHYC 4XRCB 4XPGL 4HX1B 3OAZH 3U30B 2ARJB 1FAIH 3U0TA 4PK3A 3KW7A 3C60D 2GSMB 4ABWA 4LQFL 3HMXL 4ZS7L 3GB7B 1XB6A 1Z66A 1N7ML 4U0RC 1NMAH 2BH0A 3CPUA 2FQGA 5J89A 1L9PA 4XVUD 4OUUB 4N0FA 2AQSA 5DGQA 4P2QA 2R2EB 4PP1C 4EI5B 1QNZH 5HHNA 1E9OA 4YGVA 5LAPA 1O5DT 2Q9OA 1HN1A 1I53A 1DQQA 2AXWA 1P7QA 1UYWH 3QRGH 3WUWA 2P6GA 2A73A 3FO0L 3CFNA 3WNNA 3MCG1 4NZUL 2D7TL 4CVZA 2PCFA 4IKLA 1OM3L 3CVHH 2X87A 2ZWNA 3MXWL 3QYMA 3ATAA 4FTDA 3SQOL 2JI3A 2Y7OA 3VGFA 3FT3A 2OJEB 3P9WB 4OTXH 1AXIB 1QTSA 3OHXC 4M56A 4R7VA 3FU5A 1D5ZA 3RZCA 3IWVA 3BD5A 3K71B 1QATA 4KSFA 3AAZB 1NCAL 2NY3B 1QUPA 2N7AA 4PQXA 2OU2A 2RQEA 1P2CB 2WQUA 1PX3A 3HRZA 3O3DB 1KIRA 3WV0A 5E4EC 4FNQA 5JW4R 3NJIA 2NX5D 2QT6A 3SIKA 3DLJA 1NMCC 3H6AA 1PZAA 2WZNA 4KX7A 5F9OL 4HUUB 3U7YL 1ZDQA 4AYBA 2WPWA 1ZLSL 2EXWD 4K73A 3BGMA 3CLEH 4QHKJ 3R19A 3CZLA 3D7FA 2YXMA 2J2ZA 4H2AA 3V0VB 2GIXA 3FQ2A 2NX5E 5AW8B 4Y5XB 4ZPTA 5F3HB 5GCNA 1S9KC 1BVNT 2ZKWA 2NY4B 4WSGA 4F57L 1AHWB 4ZMLA 2WO4A 1H9DA 1J5CA 3I50L 3QUZD 3RGVB 3X2QB 1C1EH 1UFHA 1OAZL 1J0JA 1A4AA 5AG5A 1AD9B 3DARA 3S4SB 2VMJA 3QEGL 2J6EH 3GXPA 4UU9B 5KANG 3NEEA 2XN9A 2H7WA 3UZVA 1LAPA 1LAMA 1Z5RA 2C1OB 3PLYA 3AREB 1CGWA 4MD5A 5F8RC 4NUQA 2E6JA 3FFDA 4QHNB 1MCPL 4PGCB 3MMEB 4H89A 4PEEA 5IVXB 1ZGLP 3TT3H 4BZ1L 1MCHA 3QIWA 1SEQH 4FL4C 3ABMB 4XO9A 3REWA 3S0PA 4LPVA 1U58B 2LABA 4PP1D 4HJGB 3K81A 2BWDA 3LRHA 2VLJD 1GIGH 1XX9C 1NFDB 4U2YA 1JDCA 5C07B 3K46A 3UJIH 3VXUD 2VQYA 4JRLA 4L29B 4PBWD 2EDDA 1RUAH 5E23A 1YAZA 3WDIA 2YD4A 1VSCA 4PUBH 1LWRA 2DQJL 4AXWB 1OSEA 4DPBX 4BEIA 3V0JA 4HXAH 3L4XA 4K9EC 1A6UL 4WI6A 5F1SA 5FF6B 4NENB 2VLJE 3QR1A 3QHFL 5D1QB 2XETA 3V6OA 2MCG1 3VXUE 2IVFC 3CN4A 5CP7A 3T0AA 4Q6IB 1JGUH 3GGWA 2A9BA 3PNWA 4AQZA 2NNAB 3IDIB 4AQ1A 1MH5B 4OQ1A 4G7QB 2DBLH 4NUGH 3HR6A 5IESL 2ZP9A 2BCKA 2AFXA 2D7NA 1LRZA 2QHLA 3ZRSA 2GSIB 3N43B 4HKXB 3ZN6A 2VR6A 1ZY9A 5IMOA 4FLHA 1PKOA 1ZWIA 3EFOA 2FDBP 4NO2A 2AV1B 4H88L 4JQIA 1MWAH 4F7EB 2CLZB 2EIDA 1R46A 4N6RA 4Y9GA 4ELKB 3GSUB 2KDGA 4J12A 2Q5BA 2R0KH 4X5XA 4Y5VB 4H13C 1G7MB 4MNHB 5EC2B 1QX1A 2AEPL 2F6AA 2P5WA 4IIQB 1IUZA 2I79A 4ZMVA 4OFVA 1NL0L 1P6AB 4JFFA 3GBLA 4GI9A 3OXSB 3AWFA 1EDYA 1E3XA 3GSXA 1CICB 1G9MC 4OLZH 1IGML 2ZUQC 2DF5A 3OPUA 1TIUA 3P02A 4OD1H 3EO4A 3WFDH 3LACA 2AJYH 2C8NA 1KTKE 3AT0A 3MV7B 4WI0A 1KWKA 3TA3B 2V17L 3HRZC 1ZG9A 5IBLD 2VOTA 3RWCA 2QFPA 3K6FA 1ES0A 1WWBX 2QVIA 2ZEEA 1IRAY 5D2NA 2EKSA 2E7BA 2E86A 1BBDL 3JWDL 4U5YA 1P7KA 5CEZD 2RFHA 4KX9A 4OJYA 3MUJA 4JPWH 1NDMB 1ZG8A 1ORQB 2OR9H 1BFVL 2FJHA 4H25B 2OZ4A 3QC6X 1MRCL 3QNZB 5A2CA 5BPPA 5LYFA 4GBXB 1U8OB 4GKLA 2Q2LA 4PJ7E 2MEJB 5CEZH 2H3KA 2XRAH 1J5HA 3DIVA 3KHOA 2EE3A 3B8GA 4UIMB 1JJUA 4A2FA 5JMRA 2ZOLA 4NI3A 4Z7WB 5CEZE 3PYCA 1UM6H 3GYRA 3CN0A 2BIOA 2AJUL 4CNIA 4K9EH 4LDEB 2VR8A 2EH7L 3OKMB 4ACTA 3BLKA 3ZO9A 5KSUB 5JUEL 5C0AA 4UMSA 3GK8H 4UQ2A 3S34H 2C9AA 3RB5A 3QZBA 4PV6A 2E7CA 2VDNH 2XN0A 4A7VA 2OMYB 2RFXB 4IM8A 1HCFX 4E68A 5F88A 1XGUB 3WXVL 1XGZA 2Y6SC 2WUCH 3GXNA 3T5WA 3TJEL 3UTQA 2EH8L 1DUYA 3QIWC 3NJMA 4A95A 4GO8A 2ZOWA 2MH4A 3RI5K 4DCQB 4P4KB 3LV3B 1FYTA 2FB4L 1J8HE 1H5BB 1L0PA 3VRIB 5J57B 3BZEB 1S7FA 3D52A 4R4NC 4XMLH 5EORL 5AZ2H 5BCAA 3T4AA 3RWDB 5TE4H 3VXQB 2E7LA 1HXYA 1MQKH 1RI8A 4IRZL 4P46B 4TSCH 4LEEA 3WN6A 1BECA 4Y7OC 2CO2A 3D08A 4L4VA 1FDLL 7PAZA 4L4TA 4M61A 3WR7A 1KJVB 1KZYA 4GP8B 1QBLL 4JRYB 4KUBA 5C0EA 3IDUA 2ADJB 4H1LA 2REFA 3Q2CA 3V6OC 3JV4A 2XWBB 3NK4A 4JN2A 1BZQK 4XNXH 3RWIB 1OLLA 3ZVVA 4TUOA 1K8DB 1G9MH 1S60A 5IBUG 4AQ1C 3DI2B 5KYNA 3SDAB 3FEEA 4Y4KA 2IXQB 1Z5HA 2NMTA 2CDFA 3SQBB 1LE5A 5IEHB 2GHZA 3SJVB 2H0PA 1FQ9C 2IOIA 4AYID 3QQXA 4DP7X 4LCYA 1GGCL 3G6DL 2ICWJ 4XCCH 1MFEL 4YK4C 2BRRL 5CSZB 1FNEB 1T04A 3QUXA 2QELA 4PCYA 1FVEB 5ACZA 2ODFA 2EJ1A 2X6VA 3ZTEA 3DPBA 2PRBA 3E9TA 3TBTB 5A27A 2I25N 1FGVL 3OKEB 4TTDD 5A43C 4WWOA 1IY7A 2WVUA 5DHEA 1KLUB 4H8VA 1JHKL 1CDIA 4OZHB 4QC6A 1LXMA 3DX9B 1XGRA 5E2JA 3CXDL 2H9GB 3OL2A 4XPTL 1BPNA 1OTSC 1KENH 3MA7A 4DN3H 4XNMB 3FB6A 2XN9D 4Z3IA 4J8RB 5FECA 4M6IA 1YGHA 1U95A 2HSIA 3D51A 3NJKA 5HI4D 3LXCA 4RGNC 3ZL1A 3QRFM 2XEFA 5DR5H 1OP5K 2Y6SD 4XNQA 1KUYA 4KHTH 5TE7H 1UXWB 2B2XL 3FO9B 3QULB 4J1UB 5IB9A 2VZTA 4NNXA 5I71B 1LO3L 2ADIB 1NCBL 4NZRH 1URZA 5D2NC 3KNBA 4XWGH 1YYCA 4ODWA 4R4ND 1HILB 5JDSA 2FEEL 5DJYA 3TZVB 1A7OH 1UA6L 4LQ1A 4NN6C 3BIKB 2VXQL 4MRCA 4PJCA 4LSRH 3GIZH 4PJXA 1F4XH 4TYUA 4X9HA 1FNLA 3HLAB 1AGCA 5IBUB 2ZEHA 1NAKH 4P10A 4H6ZA 3UPRB 4U3SB 5FCUL 4PRHE 2NSQA 5DVLA 2Z64C 2Q3AA 2P7TA 1DBAL 4OCSH 1CBVL 1Q7LA 4LOUC 5CD5C 4UIBA 4IKIA 4GMSL 12E8H 1IE4A 5CKGA 2CNTA 1X9RA 3CCHB 5CP3A 2CSPA 4P8QA 3G08A 3WTSA 2XKNB 5CBEB 3SBWA 1KOAA 2X4UB 2WJ7A 3IN0A 5T1MB 1KCUH 1TTUA 2DJUA 2ZX7A 5FOBB 3WE6B 3N3EA 2R0LH 4YSRA 2VXSH 4OGXH 2HG5B 5DJ0B 3VXOA 4KNQA 1GMEA 1Z0MA 1KJ2B 2ZQKA 4M7LL 3P2DA 3V7ZA 3GHPA 1I1YA 4HUKB 1BAFH 1L0YA 5D6CA 4JQIH 2VRKA 1KYFA 5E1GA 4BDVA 3PWJB 5EDXA 3CFMA 4U6YB 4XB7A 3T4AC 2OH1A 3IAGC 2WXRA 4OC3A 3KPLA 5IVZA 2PN5A 3ABGA 1RK0A 4JPSA 3T8XB 4EUPA 1UC6A 1WYJA 5ALBH 1EE3P 1QSFA 4RGND 3T0DA 2O93L 4TNVK 4GRLB 3QWOB 1GHEA 3IDJB 3TN0A 1TZHA 1YSOA 3BWAA 1DTDA 1BQRA 3FSOA 1SBSL 4FBEA 1CE6A 4B5PA 1WEJH 3NACH 5DK2B 5HVFB 4Y4KC 3D69B 4KKCC 4RGNE 4X42A 3TU6A 2ENYA 3MCLH 1OAXL 4N2BA 1OP3K 5A7EA 1THCA 3L4YA 2FCBA 3CZEA 1AIFB 1FO0A 3QUXC 2IDQA 3ILEA 2VKWA 2KLTA 1E40A 1G0YR 4PI0A 5FPIA 2YNCA 3OKNB 3LQMA 1IC7L 5GJTL 2VRAA 2DEWX 3TH2T 5HGBA 3BH8A 1L4IA 3JTTA 2PYED 1YNLL 4WNJA 2OZ4H 1AY1L 3H0TB 4DEUA 1MHCB 5BRZA 3L1FA 3CFCL 1G5AA 4H20H 3BXNA 1UCBL 1ULVA 4LOUD 5CD5D 1UZ8A 2VSCA 4WI2A 3UC0H 3HZMB 1HHIB 5HGGS 2P80A 3MRFA 4Z95H 1A7NL 3MJ9L 4PLKD 4BUHA 5TDPA 2Q6WB 2A6JB 1CR9H 5DZVA 5SWSA 5I66B 1CD9B 3O41A 2PYEE 3TV3L 1SYVA 5DWNA 1D7BA 3VFGL 3NCJH 1OT2A 3N50A 1HHJB 4YHKL 1M05A 1MUJB 1VDGA 4JFPA 3KQXA 1WFJA 2ZSWB 1S4IA 4G83A 4WZ9A 5E6RB 4UBRA 4BFRA 3L3KB 3ESPA 1UXSB 1OXYA 3KQZA 1IARB 3QORA 4U4IA 4ZXBB 3D68A 4BE5A 3R06B 2XN1A 3TF4A 1GOHA 2JXMB 2ZPAA 3DVFA 1CIUA 3Q1SH 2CR0A 4P5KB 2B15A 1U3HB 1HK6A 2EZ0C 2TRHA 3ELAT 5E1IA 2WD0A 3IF1B 4W9CC 5J1AB 3V4PB 4O58L 4Q97A 1J5IA 3WJLA 4QRRD 3WJJC 2B3IA 3L3IB 3QVAA 4L4VD 3W56A 5I75B 2ZPKH 2DQEL 1UURA 2CQVA 4EQ3A 4BYHA 5AG8A 1GZPA 1VB9A 1VFBB 3CFDB 2B59A 2LTQC 1SJHA 3VXSA 5I0VA 1NUFA 4M62L 1AQMA 1RIVL 1CDHA 4KROB 4YXLL 2QDWA 3MRMB 4QRRE 4JPKH 3ESMA 1BAVA 2FQEA 2VLRB 4H1LH 4UTBL 3FQ4A 4AGLA 1D7CA 1SRDA 2CO6B 2CBOA 3L16A 4MKTA 5I76A 3SBWC 3RZWA 4QCIB 3S6KA 2PLTA 4R26H 2NSXA 1NC2D 5B3JE 1NEZA 4RDQF 3RWHB 2KQMA 4ZTEA 4F2MB 5GGVH 4NDMB 4XNZB 4FQJH 1QFWM 5LGHH 2X42A 1JV5B 3NVQA 4YBLC 1T1XB 3U4AA 5C08E 1PD0A 3MBEB 5IREA 1IFHL 1CJWA 1KT2B 1MCRA 3KGTA 3KYMA 4NB7A 3BT2L 1CXFA 3TTYA 5LN4A 4B9JA 4PRPA 4I8DA 2IWEA 2O30A 5LGYA 3WAKA 2POKA 3MRLA 1AQ8A 1KXHA 2CO4A 4PIRF 1E2WA 4H6UA 4KK6D 3T4YB 1SY6A 3KLHC 4OC5A 3TN0C 2GBAA 1DZ0A 1JRHL 4AVCA 4M48H 5CZKA 4DVBA 4A94A 3DYPA 3RY5A 4Q6YA 3S3SA 5BZDA 4TSAH 2XN2A 1EEZA 2EEBA 3ZHFA 4CPAA 4G82A 1D2PA 3D39D 3H7BA 4U1KA 1XBUA 4AH2B 3CN3A 2F1EA 4X6BA 2EZ0D 2W9DH 2DH3A 3IGRA 1G9EA 3V4VA 1CLCA 1VA9A 3EO1A 1G0XA 2EE2A 3ZQ9A 1JZ4A 4KMTL 1NFKA 3ECQA 2E4FA 4LSUH 1VRSA 3L5WA 3OB0H 1J8KA 1J9RA 5D2LE 3EYSL 3PWUA 2DIAA 4YUEL 4YHNA 2KC0A 1GY1A 3L81A 3D39E 4U6XB 2QMJA 2ZAIA 2GY5A 5AW4B 1WCQA 2WAHA 4JBSA 3LAFA 1LK3H 1TZAA 1SQMA 3K0YA 2JV6A 1AYRA 4LSQH 1TVHB 4A7SA 3QJFA 4EMEA 1SOSA 3E8UL 1JPGB 2DYPD 4NLHA 4ZK8A 4XPAH 1CE1H 3MV8A 1MHEA 2NY1C 1HZHL 2OSXA 1QR4A 2WXNA 5JHBA 1N67A 2JI1A 2AKRB 4CGLA 3R9GA 4UV4L 3UYPB 3QXUA 3RTQB 3RFZA 2AXGA 2XOTA 1ZA3A 3KBFA 4F7MA 1KLFB 4D9RD 5GGTA 2VDPL 1MNUH 2VCOA 3QDGD 5C82A 5CP3H 4IBVA 1NUNB 2R9HC 2HC9A 2YD3A 4YBQC 4DEWA 1U8MA 3WL9B 2PCYA 3QWQB 2A83B 1I31A 4NKIH 4OC4A 1U8QB 1JD7A 1C9SA 4LLDB 1F90H 4D9RE 4A2EA 5J8CA 3QDGE 4TS6A 1SXZA 2WYRA 3QSKB 3IMTA 3T71A 2I27N 4IDJL 3WJLC 2NW2A 3UBFA 1VKCA 4D9LL 4NQSB 5DVPA 3KLHD 3CK0L 4GSXA 1H8NA 5IJDC 3KXFA 2ZOKA 3PP3H 5IFAL 4GAYA 4OJFH 1CB4A 4EUPH 5DS0A 7CGTA 2FZ3B 3HFML 3L1OH 5KG9B 1HNYA 4QXVA 1KJMA 3TP4A 2FJFA 3MUHL 3VWJA 4DO5A 3GC3A 1RQ5A 4FA6A 3CSYA 3P9LB 3IETB 5E08L 4MJHA 4GG6A 5DFAA 2EO1A 1U8HA 1XF1A 3DX7B 1N6UA 4HK3J 1CFSB 3LPPA 3QNXA 2Y6TE 4PJEE 3LN9A 1MJ8H 1NBVH 1TU2B 2CKBB 3HPJA 4W9LC 4ISVA 5C70A 4X9FA 1VHEA 1MCKA 2A7BA 2AI0L 1FO0H 3PWVB 3FULA 4FQC