4BINA

Crystal structure of the e. coli n-acetylmuramoyl-l-alanine amidase amic
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
Knots found
sequence length
379
structure length
348
Chain Sequence
FQGHMQVVAVRVWPASSYTRVTVESNRQLKYKQFALSNPERVVVDIEDVNLNSVLKGMAAQIRADDPFIKSARVGQFDPQTVRMVFELKQNVKPQLFALAPVAGFKERLVMDLYPAPLLALLEDYNSGPQPGKAGRDRPIVIMLDPGHGGEDSGAVGKYKTREKDVVLQIARRLRSLIEKEGNMKVYMTRNEDIFIPLQVRVAKAQKQRADLFVSIHADAFTSRQPSGSSVFALSTKGATSTAAKYLAQTQNASDLIGGVSDMVQSLTIADSLKFGKAVLNKLGKINKLHKNQVEQAGFAVLKAPDIPSILVETAFISNVEEERKLKTATFQQEVAESILAGIKAYFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Cell Division Amidase Amic Reveals the Fold of the Amin Domain, a New Peptidoglycan Binding Domain.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords N-ACETYLMURAMOYL-L-ALANINE AMIDASE AMIC
total genus 109
structure length 348
sequence length 379
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.5.1.28: N-acetylmuramoyl-L-alanine amidase.
pdb deposition date 2013-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
A PF11741 AMIN AMIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3500 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4binA01
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 4binA02
2ODFA 3QAYA 4BINA 3NE8A 4M6HA 5EMIA 1XOVA 4M6GA 4RN7A 4M6IA 1JWQA 2Q7SA 4LQ6A 3CZXA
chains in the Genus database with same CATH superfamily
5JR1L 1JK8B 3QIUC 3VJ6B 3TOBA 5C2BH 4QXWA 3MNMA 5HGGS 4PGDB 5JIQA 1AGDB 2ZE0A 2ZUVA 5ENWB 4KVNH 5JXAH 3AWFA 1IJNA 4PLOB 5G5DB 2VXQL 3MREA 4I48B 2WQ8A 4LCUA 5DJ6A 3GLJA 2VC2B 1SYVB 4GUPA 2C1PA 5ENWA 2PJ5A 1KZYA 2IQ6A 1MRFL 3ARFA 1E4XH 1NGXA 1BXVA 1WBYB 4JJOA 1E5AA 4YHYB 2EIBA 2B8OT 2LU7A 5IQ7L 4GBXA 5EUOA 2HJLB 2BIPA 1D7CA 1SN2A 2CO1A 2VWEC 1CG9A 4TV3A 2D03L 4MBRA 2NY5H 5D7IE 4FBEA 4X6EA 1MREH 2XIDA 4WJ5A 2VW7A 1UYWL 4QR7A 3ZRCC 5JMRA 3FUFA 3L2LA 4RIRA 1M1DA 2F0CA 2OBGA 2VITA 3NCYP 3FUJA 3CFEA 3BLKA 3L4WA 3QP3A 3QUXC 4KVPA 1SM3H 4GUQA 1FG9C 5FUOH 3CJJA 5DO8A 3S2CA 5GS1A 1KTDA 3DLQR 5BZDB 4ESKA 3FQWB 4M8QB 1PD0A 4JHZA 3SDDD 4Z23A 2JH2A 2GREA 3RGVC 1Z8LA 1MKFA 3W0WA 2UZYB 3HG1E 1HWHB 4IBSA 2RQEA 2VL4A 3T09A 2BO0A 2N7SA 3PAYA 1P5UC 4ZDHB 1CE6A 4POUB 4F7CA 3QEHA 2AXFA 4JFEE 1I31A 4PJ8A 4PJHA 4CBZA 4NCC2 1QW9A 1R19A 5IFJB 2R1YB 4NZTH 4Z3FA 5J1QA 4UIKL 1NMCB 5CN2A 2M83A 5D70H 4UNVA 1CGTA 5KJ4A 2XTJD 5CZXD 3PL6B 2YD0A 1GW6A 1HDMB 2BOBB 5E6IA 5CAYB 4R8WH 3EH4B 3OKMB 4FP8H 4KQ3L 4P2YA 3NCWA 2V8MA 2VN6A 1B4LA 2OKMA 4KTGA 2C34A 5C0FA 3D51A 3TIDB 2QVIA 3VXRA 2VLLA 1KIQA 4DNLA 1OZPA 4H8QA 1SGKA 4XP4H 2XN0A 3B2UC 4JFFB 5F7UA 1E3ZA 3FB8A 1UB5A 5J8CA 3G7TA 4L1SA 1OF0A 3D12B 4PJBA 2NW2B 5H37H 1E9OA 2NNXA 3DXAD 2X3CA 3V0HA 1WD8A 4OZGA 4FFYH 2EVNA 1AS7A 4ZMNA 5EIVA 5EIIB 3UPAA 1Z9LA 1TLKA 4DGVL 4Y4FC 2YGVA 1T04B 3QIWA 4HFUL 1CGUA 4XCFL 3WTTA 1HEJC 4XNUH 2IALB 4K7PL 2OU2A 4M93B 3LWUA 1TQWA 5GGRB 1ZG8A 2IDFA 1PD6A 2E86A 2O5XL 2X3BA 3CZJA 4L48A 4ZFOA 2J1YA 5IJCC 1MN4A 2PCPA 3CIAA 2HJKA 3KYKH 1XOVA 1MXDA 2PDOA 4F3FB 4WTZG 2Q9OA 4IS6B 1MLBA 5IW6B 2XC8A 1R3HA 5I17A 3RPIA 1XQ4A 1IB5A 3QEHB 1N18A 3BJLA 1NLDH 3EO1A 4MNGE 3K2UH 3PWPB 1OW0C 3NJIA 4ZO7A 5IEKA 3QVAA 1IKNC 1ICTA 2V2XB 4LCWA 4JPWL 2K5TA 4BZ2H 4FLOA 2NY2C 1QFOA 1UASA 2CDEB 4M00A 4JDVA 4R84A 1U58A 4U1GB 4XNHC 2VABB 3R1GL 3L4TA 5I0VA 2ZYSA 1U3HA 1L9NA 3WS3B 3ZGIA 1IICA 4CYQA 3KAAA 3LCYA 4RRPG 3TCLB 4ERSL 1CIDA 3UTOA 3RKPA 5D1QE 3AACA 4MS8C 3UZQA 2VLLB 3VE0B 2ICWI 1E27B 3JWDH 5T3ZE 1MNNA 1MJ7H 1CICA 1NFIA 3FB8B 5C0CE 3FT3B 3APCA 3MRIA 3OKKA 3IJYB 4KK6C 3IMUA 2V5RA 3ARTA 5DRNA 3PZJA 1ORQA 3QW9A 4DP5X 1MAKA 2C1OA 2QMKA 3QCUH 3W6SA 2CH8A 3I2CH 5EO0B 4XPAH 1KEMH 2NTFB 3B3TA 3KLAB 1EANA 2WXKA 4DWHA 3K74B 1VKCA 1DYZA 4PGZA 4YWGL 3GMOB 3BP7A 2H45A 4PGBB 3ZE1F 1ZLUK 1TF8A 4DESA 4GAJL 4NN7C 4UTCA 1YEJL 3L95B 3H4QA 1RUKL 3EW3B 4LPWA 3B2PA 4N9GB 5DO2C 4KNQA 1O0VA 1WA0X 4QRTA 5HXMA 2ZKXA 1A1NB 2WBXA 1RUPH 3O3EB 4I18A 2OMYA 5DMKA 2UV3A 4X0NA 3I6LD 1QFPA 1KV7A 1UCBH 1VFBB 3C5ZC 3DROA 4UT6L 2CDFB 2I79A 2XPGA 3N55A 1QSNA 1IAMA 4CDGC 2Q10A 4N8CL 1XJOA 5MEND 4JKWA 1H3WM 4GUPB 1TKWB 2Z9TA 3MODH 1RO5A 2HRPH 4ODHH 5E2TL 5JH9A 1NC4B 1T0NA 2CO6A 4LP8A 4MMOA 3ARDD 2CK0L 2GUYA 3HBGA 3HMXH 1KGCE 4QUSA 5JNYA 3EJCA 3NN8B 3SDYH 4AYGA 3U2IA 2J8UE 4ZMQA 2FDBP 1HINH 3K1KC 3L8QA 2GBUA 2JELH 4DGYH 3GSXA 4PJGF 4PJ9B 5L4MA 1S7VB 2IFFL 2OS7A 5EOTB 5EUOF 3BQUC 2VAJA 4Z9KB 1L0XA 2JJSC 4HV8A 1U8LA 2I60L 1ASPA 3WN6A 2VDKB 5AG6A 1QFWH 4NDMB 5C9JB 3I9IA 1JZIA 1TG8A 3IN2A 2GVYA 2HX8A 3EJSA 2HTKC 4EPSA 3N50A 4GXVH 5AYTA 2O6DA 1MW3A 4PRHD 5I8CB 4WUKH 5C92A 1BO4A 2AI0H 4FCHA 4PCTA 2ICES 4BH7A 5G5DA 3MLXL 3N9GL 3QYMA 4N0CD 3UAJA 4DVBA 5HGBB 3TL5A 1JZ6A 3B3CA 1C12B 5DZAA 3JWOH 3TM6A 3PNWA 1BQUA 3TIEB 3EJZD 1MI5B 1YECL 2I9LB 4CSPA 5ICZA 3MR9A 1N7MH 4WNJA 3S98A 3ZDYB 2HJLA 2K6WA 1JNHA 2O5NA 2FWLB 1QOKA 2JCWA 3L4UA 3WTXA 5DD1H 2YN5A 1OTSD 1ZHNB 3HN5A 3D25B 2VZUA 1GYCA 1JCKA 4HIJA 4JCLA 3JTBA 3MLTB 1U8QA 1U41A 2IPUG 4K2UL 3VM7A 1FNFA 4IRZH 1FAIL 2QSQA 9PCYA 1IBGL 1AHWC 4A32A 5F1IB 4YSDA 3LN5A 4HJGB 4A7QA 5DVLA 4HWNA 3SJXA 1FVDA 1WFUA 1IC1A 4UINL 4UMGA 4NGNA 2FIWA 4YHPA 3T2NL 3ZYIA 4AQ1C 4LLDA 5IK3A 5GSVB 3C6SB 1PLCA 2GFBB 3QGVA 3QNXA 4XXWA 3IGLA 3L9BA 4TSBL 1AY1H 3D7GA 3D7PA 3HG1D 4XP9H 5SWZD 1ERNA 3DX6A 2RBLA 1RZ7L 4AQ8A 2ITCB 2DRUA 1I7RA 3RVTC 3ARYA 2OM5A 5I74C 3SEPA 4E8OA 2YPLA 2XX1A 3CG8A 3PAVA 3VWDA 4DZBB 3PXLA 4O02A 4XPTL 5GQBA 3BIKB 1E3FA 1MZYA 4QBJA 1HS6A 1UM5H 4YBLC 2NQ3A 2WYRA 5KSVB 4DT2A 3KW7A 5DJXA 4YLBA 4B9CA 1JE6A 1PLGH 2DYSB 3K7UA 1ECYA 4ISVB 2HWZH 5HD8C 3VI3B 5A2CA 4P46D 3C09B 1IQWH 3LKNB 4L3AA 3IPEA 1WO2A 5IBLC 5T3ZL 1S3RA 2ABZA 1J9TA 1KCVL 3O6LH 4H6UA 3K80A 4Z7QB 4GAYB 3F83A 2OZGA 3GJFH 1YJDH 1YUHA 3KYKL 1UEYA 1INEH 1VHOA 2GFQA 3RU8L 3TBTA 1ILUA 2EEFA 2CGYA 3CFDA 4LMQE 2ZKHH 3MLRL 5BXFA 1K4CA 3X1NA 3D05A 3FFCB 1QSFB 1BXAA 2OTUB 1XGUB 4KOBA 1J88A 1YPZB 3ESOA 4XNXH 2OMNA 1S4IA 3GMLB 4FQJL 4K94L 4HVBA 3EOAB 4F27A 3VD9A 4HPSA 4R3KA 2WV3A 1MCFA 4CAGA 1WF5A 2KH2B 3DECA 3RRQA 4NFRA 3QC5X 3TO4D 3O6FC 5D93C 3VFMA 3VXUE 4X7CC 2FIKA 4YDJB 4NS0A 4G1EB 4M85A 4ZUTA 5J13C 3CZFB 3INUL 5D7LD 4GG6E 2B2XH 4AG7A 3WNOA 4NFBA 2L0DA 4Z95L 2ESVB 4J3OF 4U0RC 3WYRA 2J1ZA 5CU9A 4MHYA 3RB7A 3OKKB 3GM8A 2WCGA 4XOBA 3JQOB 3UTZB 2DLFL 5IW1A 1CG2A 2EK8A 2NY3B 2QADC 1BCIA 4L4TE 4BINA 2EUVA 1WLHA 2C6GA 3KJ6L 2VLJD 4B9KC 3KR3H 1HEZA 1HCFX 1CB4A 2ZWNA 5LGKA 4PBXA 4DUKA 3ARWA 3ARDA 3CX2A 3O2VH 2CGZA 4D9LL 4G7SB 4OIDA 1N3NA 3OHMB 4X6CF 3FUHA 4ZMZA 2QSVA 1MELA 2KYIA 4PP1C 3D1MC 1HL4A 3MV8B 5JA8B 1GHFH 4PAZA 4PB9L 3CLFL 2EIJB 1ZTXH 4XNDA 4Y16C 1IIKA 3A4EA 4AEEA 4NXYA 2JE8A 3E6HB 1M42A 3RWDB 3SY0B 3RIAF 2W88A 3WFBL 1MFMA 2ZF9A 3HZMB 4JL2A 4OD1L 2F58L 1YNTB 3A6CL 1UUSA 3TOPA 3ZT6A 2JKRM 1OCCB 2JLPA 4YH6A 4I0PA 3ROOA 4AKOA 2FIKB 3QDJD 3SIKA 1E9PA 5C8JA 1A7OL 5FS5A 3WFEH 1TEYA 3SQBA 1ZV5A 4WW2F 3KVDD 3PWLA 2EIDA 5MEOA 2R9HC 4PJ6A 4LEBA 1VDGA 2VLKE 1A4JA 3LEYL 2E8ZA 2IGTA 2X4RB 4FFZL 4ACTA 2V5TA 1NTDA 4H8PA 4QWWC 5D8JL 4GS7C 1KCUL 2V6HA 1NCHA 4TYUA 5EU3A 3LDBB 1B88A 4AYMC 1I1YB 1GAFL 5ALCL 2XQYG 3VWJD 5HDBF 4AKPA 1I85C 4U1GC 2CIIA 4HG4K 1DO6A 4XHJD 4LLDB 4KFMA 2L7EA 1ZPLA 1CFSB 2BRRL 4DN4H 1GHEA 2KS0A 4L1DA 4OCWL 1EFXB 4MWFB 3QFGA 1AYOA 2ED8A 4YVNA 4Z7QF 3GTTA 5GZOA 3VATA 3W9DB 5E6SB 4AYFA 1I9RH 3BPLC 3H0TA 1PZDA 3X13B 1WGVA 5HVFA 1OOAA 3WDHA 3TN0C 4AEHL 2P7TA 4AEIH 3NSXA 2A6JA 5EOCJ 5AWNL 3G04A 2H2SC 1JWSB 3TWYA 5DS1A 4X6DE 5C88A 5F88B 1AP2B 4W81A 1KFAH 1KXVA 3O9WC 4ZBJA 3MFGB 1KLGA 5MENE 5E8EA 3VI4E 2VSKB 1HQ4A 3L45A 1Y07A 4FQ1H 3FFCE 3GSNH 4MJIE 4AM0B 4UEEA 2WZ0A 3T3ME 2WIMA 1ETZA 3GO1L 5DEFA 3UMTA 3BD3A 1DQTA 2M1KA 1M2VB 4E9VA 2JBJA 5JIIA 4Z7OB 4FNUA 1HILA 4FG4A 5GGUA 2CHNA 2YAHA 3LJ3A 4DUXA 3O0RH 4OLEA 4XP9L 3IU4L 2TRHA 3OD3A 3QORC 4O5LL 4G3YH 4ATWA 3O9WB 1S7UA 4G9FD 4G11A 2AZUA 4UU9B 5L2KD 2VDOH 2OYLA 4NKMB 3POCA 3KLKA 3IEAA 2DDQH 2ESVD 5AZEH 3O41B 4U4IA 1AQHA 4M29A 2L7UA 4IU3B 5I74B 4XTRD 1CO1A 4WLCA 4RNRB 1Z32X 4QUOA 5GZOC 2BK8A 5G21A 5AYUL 3TOAA 1QZ1A 3QDAA 1I8LA 1HHGB 3AABA 3EDEA 3GBMH 3GBNL 2W94A 2A77H 2PWEA 4F0YA 1YNTF 3S88L 3VXRE 1I1CA 4N0YL 4P05A 1LP9B 1KC5L 1SN0A 2CK2A 3C12A 4GSRA 1OIOA 3IB4A 1NBCA 3SE6A 2FB4H 2FJUB 3RWGA 2AXHA 1MRDL 4GI9A 1EZVY 3IJHA 1N6VA 3JRUA 4FQPA 4OIFA 3TEXA 2ZEDA 3CVHH 3L3JB 4C58B 4QXGH 1U42A 1J0HA 4JAMB 1WBYA 1AGFA 1D9KB 1JF1B 1UXMA 5TE4H 5BW7A 4G42B 4PP2B 2OR7A 4PJXA 4U3CA 5EN2A 1IIDA 4F0XA 3C5XA 1KCBA 4H40A 1FNEB 2B0SL 1T7VA 5E7BA 1FSKB 4ZX4A 1DVFD 1P9MC 2EKSB 2Q86A 3RGVB 5LYIA 3D48R 2X6AA 4XCFH 4AYBA 4U9ZA 1M56B 1B4JL 3GXMA 5GSRA 3BVTA 5EHFA 4F58L 3QG7L 2P5PA 1ZS2A 3JVGC 1QRNB 4KX9A 4F7MA 4ODWB 5IMMA 4RAUA 3UDWA 3F7RA 3HG3A 5F1NB 4YXKH 4F24A 2ITEA 1AQMA 4WY7H 4P2RE 2OV0A 3HN3A 3LKQA 1U3ZA 3FQRB 1OHQA 2DQJL 3C5JB 5IG7B 5H37A 1ES0B 4LPTA 1G94A 1Z0MA 4X9IA 3QBTB 5CJBA 4K23L 1YEDB 2AFNA 3WXVL 4MB4A 2VC2L 4H89A 1R6VA 3AROA 2RGSA 3OWRA 1S9VB 5EBGA 3TBBA 5J1TC 3B3WA 2XWDA 5I28A 4LPUA 3DYPA 4DH2A 2R0WH 3OXRA 1NZRA 2WBJA 1KSRA 2W91A 1MVFA 1YQVH 1DCLA 4N6RA 3HFFA 4X8GA 4JLRA 1T0MA 4XCCL 4NRZA 4QAMB 4A7VA 1XAUA 1DJZA 1NCBH 1NGWA 2B15A 1MHPH 2AJVL 3RL2B 1A6WL 1PCXA 2DMGA 2YHGA 4H88L 1D2OA 4GKNA 2Z3PA 1UWEH 1I1FB 3DUSB 5E94A 4PRIE 1IM3D 2C4FU 3C6LA 4XP1L 5B1BB 3G6JB 3ABMB 3OGOE 1MIMH 3BH8A 1WE5A 2JKSA 4Y4HC 4BFIB 1ZSDB 5D4QA 5E00A 4DO4A 4PB0H 4E9SA 4BFGA 3GMMB 4WFEE 3GMOA 4JFHE 4OZHF 5C2UB 4HQQL 3MRPB 1K4DB 3NH4A 1NBQA 1A3RL 4LNVA 4E9LA 2ROYA 4AT6B 1A47A 4GKSA 4TTDC 5I6PA 3RTQD 3UTSB 3V4VH 2AFZA 5FGRA 3AAZB 1G7IB 1NAML 1QUPA 4Z7WA 1A1NA 1S3KL 3ABGA 3PWLB 2NYYC 1BQ5A 4MCZA 2D4PA 4OCNC 4ALAL 1WIUA 3MLPA 1MFAL 4FFTA 3VNYA 2CBTA 5EOCL 4N2AA 4RWHA 1HH6B 1U58B 2NR6A 3QZWB 4DKFH 4A33A 4Y4HD 3V6OC 2QSTA 3WS3A 4KJYA 1HE7A 1YW6A 4IEFB 4PGEA 5GS2D 2OMBA 2CIIB 4JO2L 1OPOA 4PU2A 3Q8BA 1X5XA 5HJDA 2W59A 4JFOB 3R1KA 1F4YH 1YNLL 7CGTA 5JW5A 4KJWD 3IDJB 4YAQA 3N5FA 4MZRA 4JE4B 4M1CC 4MX7A 1UM4L 3E0KA 4JM2A 4KOWA 3STZA 4NUJB 5E0FA 2KUTA 1GZQA 5DD3H 1N12A 3F2LA 4WUUD 1IGML 4QIRA 1B4TA 3U7WL 4NP4H 3QHTC 4XH2B 4MD0A 3W0WE 2P5EE 4L8BA 2GJPA 5I15H 3ULVD 4WWPA 1O5DT 4M48L 1HAWA 4QTFA 3E9UA 3QQ9C 2GTZA 5BZXA 2QVMA 4FTVE 5TGBA 4BV1A 3D67A 1LQBC 3NH7H 3JT0A 2VSMB 3PP3H 3EJRA 2D7QA 3K72B 3HR5A 3KCPB 4KSAA 3N0AA 3Q8AA 5TGBB 4U9YA 3BKML 1EHLL 1E4KC 5B38B 3BE1L 4ES8A 3F7VB 1TETH 1V7ML 5CEZD 3OKNB 1EGJH 1OCWL 2HPTA 3OX8A 3NP3A 4PJGE 3SPGA 5C0AB 4OAEA 1N4XH 1RCYA 4S1QH 1ZT4A 3O2DA 1NCDH 5GPRA 4KZDL 1CDCA 4PJXF 4EEEA 2K3TA 4LBEB 4L9DA 1KTDB 1BFVL 3OAYK 4TTDD 1D6EA 3TEZA 1SHXA 3J07A 2IOOA 2Y1YA 2FO4A 3T8XB 1RERA 3IDJA 3MRJB 4B53A 4BZ2A 1U8IB 2P1YA 2UZYA 1PZCA 3QISA 2ZOLB 3V7ZA 1QA9B 2Y6SC 3NIFB 5E56A 4C83B 4L89A 4JEGB 3I50H 4IGBA 1YEEL 4B96A 1INQA 4NLAA 2B4DA 5EU5B 4Y9FA 4ATTA 5KYWA 3G3SA 4IS6A 1N68A 2R2BA 3KLDA 4RGND 2EH8H 3D0LB 3V4PH 3FO9B 3D7HA 3DIDA 5F0JB 2YD8A 3B9EA 5E70A 5IB0A 3BMWA 3NE7A 4JO5A 3Q43A 5CNPA 3D85A 2VJ0A 3UP1A 2ZP8A 3HHSA 2OSLA 4JG1H 1I1AA 3O45A 2G9HB 5JIPA 2X6BA 5D2NA 1AMYA 4ANWA 3IEHA 5IM7B 1CI3M 1SYVA 2LLGA 2EE9A 2WD0A 4L4VD 4OZGB 5LG6A 3LNHA 2WXOA 5HI3C 3UBXA 4LEXL 4UMSA 2KT6A 2DJUA 4DEPC 2RCSH 4G80A 3UCRA 4FN0A 1DL7H 4U1NA 1U8CA 3MNWB 3SE9L 4AVKA 3JWDL 4KO5A 4UT6A 1ZHBA 5EBLB 3DJSA 4WJ5B 4WJBA 1ESOA 4KUZH 4EUPB 4KK8C 4JCWA 3FOMA 1EHNA 4UDTB 5F1NA 1NOFA 4Y1SA 1H9VA 4HJTA 5J0BA 5HI4D 4PIBA 1J10A 4M5YH 4MNHB 4R2GB 5E1QA 1TPXB 1EZVX 2LHAA 1YVLA 1LD9A 1MPAL 2XZAH 1SXZA 4AQ8C 5IG7A 2R69A 4ZO6A 4Y2DA 3O3BB 3ZKMC 1RUKH 1RKRA 3CFKB 5DEGB 2AV7B 2R2EA 1KJ2B 4OJAA 2AABH 3ZDZE 1ACYL 4WI5A 1MCBA 2MEJB 4R4ND 2BIIA 4P5SA 2WKGA 4AW7A 3K6IA 4H25A 3TVMC 1RUML 4EMZA 4P2AA 5EEXA 3MBXL 1RUMH 4CS0B 2V4LA 3EDKA 5D2LB 2IEPA 1YLOA 2NX5B 4FLQA 2DAVA 2FT7A 4G1EA 3DGVA 3SJFA 3O3UN 2IQ9L 4ZW6A 1YLEA 4LQ1A 5ESVA 4X6DA 3ULUH 2YKKA 5DJ2B 1DSWA 2W80C 1A7QH 1VERA 4LOUD 3ARGB 3CFQA 3PQYE 2EECA 3FUDA 2E7HA 4M7LT 2AV1B 3HR6A 4GY4A 5F7LB 2C9SA 1QPPA 1NUNB 1R17A 2OL3A 3FTSA 5T1MA 2JELL 2AQSA 4FNPA 5KN5B 4YN3A 4ZFQA 1YY8A 1GTFA 4HU2A 1U8PA 1DFBL 1DUYA 2NY0B 2X1OA 4NNYB 4M3KB 3UAJC 4ABVA 1M7UA 2DS4A 5E8DL 1WISA 1T7ZA 2ZD0A 1VCAA 1GTNA 1MWAH 4I0PD 4ZMPA 2ZKHL 2XDHA 3SKMB 1CP7A 4LHUD 3N1FC 4LOUC 3PNWB 3P4MA 3QARA 4FQ1L 1JD9A 2AV7A 4KOCA 2YFNA 2VLKA 4JFTA 4Y1AE 3MR9B 1NC4A 5DJYA 2IBZY 4L5FH 4M62H 3HZMA 4MFHA 3H3PH 3WFZA 1XL4A 3EDJA 4LHUA 4N2EA 3GKRA 1PBYA 1KN2L 2CDEA 5HDOA 4RRPA 1PU0A 3HNTL 3HHMA 3NH5A 2EYRA 1ZT4B 4R5VA 1WFNA 2Z7WA 3HAEA 1T7YA 1WA2X 5EORL 4KO9A 5IVZB 3VD0A 4FQHA 5AZ2L 3JWNC 3NTCL 3QJHB 4A38A 4XNHB 4ZUUB 3NTCH 1I9JH 1X9UA 2Q7AA 3D2TA 5E96A 3HE6C 4AIZA 4LPXA 1FH5L 3QWQB 3EYOB 1WRFA 2CD0A 4A94A 2Z3MA 3DI2B 4TVPH 5GRWA 1L9OA 3QIBB 5AOIA 1N70A 1MG2C 1I3VA 1HDQA 1S7VA 4ZMTA 5C6TH 4H2CA 1J0ZA 3QPQD 4YDMA 2LFEA 2BWQA 5D7JB 3TJHD 5PCYA 4ZJ9A 4AENA 5KWYC 4GXHA 1N6QH 1T3FA 1JXDA 1WSST 2NLJA 5IQLA 5KVEL 1C12A 5KVEH 2WQWA 5BQDA 4P2OC 5ITBL 1XSKA 5EU7E 3TASA 3RUGB 1QVOA 4KJPC 2VIRA 1KJVB 4UOJA 1GVIA 3W9DA 3QJXA 8FABB 4ZFGH 1LFWA 4DPAX 2X44D 1G6VK 1HHHA 3FQNA 1QUNB 1F3RB 5ICXB 4OD2A 3G04B 4FA7B 4HJUA 4U6XA 4GKZB 5GGSA 1RSFA 3MUUA 4PLNC 6CPAA 3IAQA 5DHYA 4A2FA 2IGFH 4KU1A 4TVPE 5C8JB 5H84A 2D0FA 4I0KA 2LVEA 3WTYA 1BPLB 1IM9B 1QSRA 3NG5A 1FVCB 3VACA 3T0EE 3RGBA 4BRVA 5F7EL 3C60D 3MLVL 2KLSA 2G60L 4N5UA 2CLZA 3WKMH 3O4OB 3SBQA 3SZ6A 3WFHA 3TU6A 2R0ZH 3B9DA 3S5LG 3IPFA 5IV2B 2OZHA 5IB9A 3CXHJ 5DC4B 3DHMA 1WTLA 2VISB 1X9LA 2W38A 1SHSA 3KLSA 4OD3L 4P07A 1P5UB 1FFOB 4NGHL 3L17A 5D72H 2VKXA 4PMFA 4OC5A 5JHLL 1UD8A 5J7CC 3GMLA 4RMWA 4NWTH 3SCMC 4GIPD 2XHNA 2SEBB 4BCYA 4BSVB 4EI0A 2VDLL 4AV5A 5KS9B 2HMID 4JG1L 4MWFA 1P4LB 2CGRL 2F19H 1P5UA 3HI1A 3NQKA 4JFEB 4K23H 5E4EB 3TO4C 3D2MA 1OBRA 5F48A 4GRWF 4A31A 3NFNA 2ZJSL 2OMTA 4GEJA 4XN5A 1MJAA 3FMGL 4ELMB 4MCNA 4Y8DC 4AE0A 4E41B 4MJIA 5DD0H 3EYSL 15C8L 2Q1EA 4DSYA 3N85L 1A7BA 2ZXCA 1E3XA 1R46A 1HZLA 2J8MA 4D3CL 4NN7B 5ABZA 1A22B 3C09C 5DEJA 1N0LB 1LO0H 3S2AA 4NHCH 5DTFA 1P7QD 3HLKA 4O2FB 5ADOL 5EC4A 4HUNB 3ASWA 4H88H 2YZ8A 3NCEB 5KSVA 4TSCH 1CL7H 2ZIDA 3G3LA 3TBTB 2IDCA 3I6LE 5FDWA 4KOVA 5F96H 2Z4QB 1OARL 1KTCA 4WKZA 3K71B 3BSZL 1VKXB 3ZTDC 4BFJA 1URIA 3WO3B 3GXDA 3QDJB 5F1IA 1R47A 3RZAA 4PJGA 3FBKA 1XL6A 3DX1A 1E9QA 1QMUA 2CY2A 3EH1A 4NQEA 3MRGB 4LGRB 4OBRA 1ID5I 1XB3A 3Q6GL 5AVTB 3H2QA 3VG0H 3DTXA 1A4CA 4FABH 1BX2B 3IFNL 1UJTA 4MLSA 3TBVB 4FABL 2CF4A 4PR5A 3SODB 4JFZH 3P40A 2HH0L 5SWZE 3ESVF 2CQVA 4EN3A 5K59F 1E2ZA 1OAXH 4IJTA 3VFMB 1IVTA 1A14H 1XGPA 5I76A 3N1GC 4B10A 1QRNA 1BVLA 2CR6A 3WFCH 1KLUA 1FL3A 2CO3A 3OLIA 4C4KT 4I0PB 1UA6L 4BSWB 4XHJC 5DJYB 5KG9B 1M4KA 1JZ2A 4DEWA 5KJRL 1FFQA 1K2DB 4GSQA 1HJBC 3WFDH 4WEBL 3V0FA 2OZ4A 1PF3A 3QWNA 4NQEE 2WXMA 2XETA 3BIKA 3FKUS 4HEMA 5FECB 2WXHA 4NNPL 2FWUA 4QWWD 2X12A 4M6MH 2EYRB 4NNPH 3U1QA 1FFRA 2D31B 3MLWL 5F89A 2XY2A 4KTEH 2WKOF 3FN0L 3WTVA 3T0XA 1WEJH 2P3YA 3EYQD 3BLPX 4L1BA 1AOHA 2DWTA 3GMPA 3QI9B 1UXLA 1NMAL 2Q51A 1SOKA 1TVDA 1W6WA 3ARDB 3MJ9A 4X6FA 1WS8A 1IC7H 4NQDB 2CE6A 5BRZE 4P2OB 2DI7A 3MO1B 3WC5A 4D0BA 4ODXB 2P43B 1T0MB 4M4RA 2MQ3A 2VQYA 1N0XL 2VTFA 1IU1A 3H6AA 2HT3C 1N5AB 1EV2E 2N7BA 1T1XA 3N7ZA 3S9LA 5CFAA 2W60B 4XMWA 1DQDL 4IKJA 4TPRH 4TULL 4F9LA 3KHQA 1N5AA 4KKLC 4JVPA 1SLWA 3NIGF 4K3NA 4ZX3A 3P3TA 4PJ5E 1V3LA 2WINB 2AEQH 1RIUL 1FI8C 2REEA 2XA8L 1ZE3C 2V7HA 2CBPA 3L2MA 3IDNA 3QG7H 5DYOB 3CSYA 2QGEA 3IJ7A 1UH4A 4JRXA 4BSWA 1IGFL 1J5OL 1J5OH 2NW3A 4LCYB 1KT2A 4G8EA 4F6AA 4R7MA 2BNQB 2JCCF 5C6WH 4F92B 4UEZA 4OCLC 1PVHA 1BOYA 1VB9A 3M7FB 4TSAL 4Y4KC 2R1WA 4L4TB 3V10A 1T66D 3SXNA 4OJDH 1IGIL 1T2JA 1I82A 2H0JA 3HMXA 4O2CB 4CSTA 4Y7MA 1YVKA 4YWYA 4NQVB 1T5XB 1BFOB 1S7LA 1K3IA 3CC5A 1EJ6A 5I1LA 1T20A 4BFNA 3OXRB 3EGXB 3FOLA 4ZZFA 4RRPM 4EI5B 2ZW5A 3PDDA 2APWA 3AS2A 2CCWA 4NQVA 2F7QA 4NKMA 4D9LH 4Y8AA 3CUPB 2BEIA 1TFPA 5ITBH 2CRYA 1EJFA 3QXAA 4PVMA 4WK4B 3C6LC 3PJSB 4KC3B 5D71L 3V4PL 4M4RB 4HETA 1AHKA 4M1GH 1XX9C 1CVSC 3HA0A 4KXBA 1BV8A 1OT2A 4H8VA 3F64A 4AZ8A 2OCCB 3QYCA 3LQZA 4KH9A 3VD2A 3AG3B 3MRHA 1G84A 3FRPA 2YQ3A 4ZS6C 4DVBB 1FGVH 4HOXA 5KYYA 1UWEL 4H20L 1LGVA 2J6EH 5KEZA 5C0AD 2P26A 5ICUA 4OFPA 3LIZA 1EFXA 2X6UA 3T8VA 2GJ6E 4KRNA 3M45A 1AQKH 2XIBA 3NRPA 4QHUA 3T0ED 4ZSOA 5T1LB 3UTQA 4Y9GA 2ALWA 1GOHA 3ZDZF 4R0LC 1OE2A 4HJIA 1IGTA 4G1MA 2FVGA 4HBQA 4OLYL 4RAHA 1URLA 1N10A 4QRQB 2R0ZL 3ZKXC 1MFBH 3ZXAC 2F53B 3VQ2C 2ROXA 4BA8A 3RJDA 1WFMA 3GSOA 3Q1EA 4TLUA 1B90A 4KI1A 4F33B 5SWZA 1FYTD 2Y1ZA 3AT9A 1KLGB 3SKJL 1OD9A 1RXTA 3FT9A 3WIFB 5CN1A 3CDYA 3KL5A 4JZJA 3EYFA 1FVDB 1TZ8A 2VDLH 4IRZL 3CDZB 1CT8B 1DCEA 2OR9H 4RAVB 5IVOA 3ZZQA 5IV2A 1Z8TA 1NBVH 1H3GA 2DD8H 4A37A 4EVYA 4L0PB 2WOYA 2J2ZB 4MGXA 4ZAKA 3JUZA 4JM2C 2JF1A 2BZCA 4R4FH 4PG2A 2VDNL 1TJIH 1GJWA 3KQXA 2CNYA 4C4UA 2H3NB 3H85A 3GB7B 3DVNA 4K3GA 1OGAB 3Q06A 1OL0A 1S5KA 5H2BA 4AEFA 1E2VA 4YNYB 1PDKB 2CAKA 4X99B 2L8AA 1BBDL 1QA9A 4DW2H 2XN9D 1XDTT 2EH8L 4IGBB 5ANME 1BSIA 3HB3B 4E36A 5IJVB 1KFAL 2A6IB 1H0DA 3PWNB 4BBWA 3HS0B 3QEQA 1Q2YA 4DKAA 4QNPF 1N0LA 3MMEA 2XN1A 4YVUA 5JQHC 4HGKC 4KK6D 5I5RA 4O2FA 3SD2A 3DBXA 3U1SL 5FYLD 4LSPL 1OM3L 1GSMA 3QDHA 5C82A 3EFDH 4JFYA 3AZUA 3ARBC 4IMLB 2QQNH 3WL9A 3HHSB 3L7FB 4N1EA 3MNZA 5A2JH 5AAMC 4HZLA 5HJGA 5I19L 4JPVL 5FHBH 1NGWB 2R0WL 2O5XH 3E0GA 4IKIA 2ORBH 4LVHC 2HH0H 4LCWD 2MRYA 4MDRA 5TK4A 3MHZA 4ZPVB 1V5JA 1HYSC 4G9FE 5F47A 5F97E 1JFHA 4HT1L 3G5YB 4RIRB 3GPEA 1EAPB 4KUZL 1U8MA 2QSCL 3TT1L 1KLFB 2MHAB 5CGMA 1CLOL 4KSIA 5IUCA 2VRKA 5HBBA 3QDGA 3KLHC 3FTWA 2VW4A 3BGMA 1KCSH 3FUIA 4PJBF 5EZLA 1BREA 2ZOLA 5HYSB 1X5JA 1E8XA 5CINH 1ZAGA 3DO4A 5HGAB 1W0VB 1NQBA 3BZEA 4X42A 1VJSA 4XPKA 5IB4B 3HHRB 1ZEAL 1JGDB 2AKRB 5IIEA 4A04A 5ISZB 4HFUH 4KTEL 3PGDB 5DYFA 3TPUA 3FQUB 3SBRA 3KCWA 1JUFB 3CSTA 5DJZB 3HS0A 3QEQB 3ABZA 3W2DL 4AVHA 2JTYA 2B4CL 4F5CA 1F4XH 3OHXC 5F9OH 4FKKA 3Q9PA 5FYLH 1GGCL 2CNSA 4B6ZA 3OKMA 3B9KB 1WA1X 2XLLA 3KLHD 1C16B 4MFLA 1M9WA 3UO1H 4IRZA 4N2DA 4QYAA 4YE0A 5KSAC 1J7VR 4IOSD 5ETUB 1JRHL 4UF4A 3B9KA 5I8KL 5LBSA 1YEJH 5BZWB 4FEMA 4PJCE 1UH2A 4H2AA 1QP1A 1UACL 1BPMA 4IW4C 5D7SL 3D08A 3ZL4H 4N4YB 3AREB 2IBZX 1QSVA 3RDTC 4AGNA 3OKEB 1Y7VA 4F2ME 3UBXG 1GZQB 3SZKC 1XWVA 4GS4A 2FQDA 3CFCH 1JPFB 3DRQB 4OZIF 3FRPB 1TO5A 3MLYH 5E7FA 3T71A 1FC2D 4AY0A 1R3KA 3CZGA 4X9BA 3US9A 4M1DH 1PZ5A 3PB9X 4ZY1A 5LGJB 3LNDA 4NIYE 4EBQL 4W9GC 1KXVC 5E00B 3OR7A 5EA0L 1CXKA 4I8DA 3A6CH 3BX7C 2P28B 4LZKA 4ANUA 1JOIA 1R3HB 4G43B 2FEDC 5I17B 1OWWA 4E68A 5HHPA 4YSEA 5F1SA 1R3IH 2F53A 3L4XA 1OF2A 3KL9A 3ZSSA 3GLZA 4HZ1A 4JMXA 1T20B 2PYFA 4RGNE 1AQDA 3SO5A 4G7YL 1QYGL 1BF5A 4OZIB 1NCCL 5HYEA 4ZTOL 4N2IA 1E4XI 3QZLA 4JFOA 4FFWD 4JZJB 3MJ8B 1BW8A 1CE1H 2IQAB 1BDYA 2FT6A 3O6KL 4G72B 1AE6L 3FSVA 4JZNB 3VG9B 4XNYL 5F9WB 2RAMA 4D0DA 3HAEB 4AQOA 2QQLL 2UYLB 5ID1A 4GMSL 4L2LA 4MD5A 1WVZA 1WDAA 2IH1A 4Z0BH 4PV6A 3TNNB 1EERB 4M9PA 1FRGL 4AIZB 4RMUA 3ZE1E 1BEXA 3P30H 3APDA 5J12B 1Y18A 3UAFA 4H0GA 3HB3D 1P7KB 5DD0L 3FTGA 3K0YA 4B3VA 3R8QA 3EDDA 3IETB 2MCMA 3KGRA 3JV6B 4HBCL 4I18C 3BDXA 3VX0A 3RY4A 4RA0C 1PL3A 2FATL 4QLRA 2Z31D 3C5ZA 4WSKA 4CA4A 1RTQA 5GS2H 1YSOA 4LCUB 5DJ6B 1QBML 1T4WA 1ZHKB 5HYJD 1QASA 4Q74A 2WXRA 2O4EA 1VZIA 3TX8A 5CJ8A 1IFHH 3FX6A 1TU2B 2A83B 4JJXA 4TRPL 1PTZA 1QTYT 1WZMA 3RIFK 4YL9A 2FJHA 2N1KA 4X7SL 5C09B 4LVOB 4K8RC 4ZSOE 4NERA 5JIHA 1KYFA 3L5WB 2UUDK 3TO2A 5B4MC 2FEEI 4XE0A 3NN8A 1UZ8B 1MLCB 2DBLL 4AH2A 3HNSL 1U3HC 4JG5A 4PGJA 1CFNB 2XZQH 3NCYS 4LLMA 4AC4A 2D2OA 2VH5L 2ZSWB 3PY9A 2XVBA 2F54B 2IVFC 1UZ8A 2ENQA 2CHDA 5F46A 1LCPA 1U8QB 3MCYA 3C9NB 1M2OA 3MJ9H 1LE5B 3E2HC 2BCOA 1IGMH 5I0WA 2OLDA 1SYSA 4WI9A 3F8UB 3RTQA 3WNIA 4HK0A 3KWVA 3ARQA 4I89A 5CJQL 5I1GL 1FH5H 4PJCA 5FYLE 2CNZA 2V8LA 2XN9E 4CAXA 4YHLH 2RJMA 1QQDA 2MTAA 3FL7A 4HPOH 3GZQA 2G5UA 2H2PD 3DVFA 3P1VA 5C09E 3RNKA 4RFEB 3OJVC 4EFDA 4WO0A 2OB0A 2Q20A 4XPFL 5LN8A 5CMAB 4UCPA 1EK3A 1P1ZB 1PZSA 1QZNA 3KD4A 4GB9A 4H25B 2NY7L 3SYCA 4BH7B 2EXSA 4FAIA 5TDOB 4O51B 4OLVH 1Y6KR 4BELD 2JJTA 4HIHB 4D3CH 4KKPA 1D9KC 3L9RB 1B0WA 2E7LC 1WPCA 2I69A 4KZEH 3RU8H 1HL8A 4R26H 5DVNA 1NCNA 4R26L 3IMRA 2EE3A 2IANE 3KPTA 3U0TB 2NT1A 2ZWSA 4BFEA 1AHMA 2E5EA 1E0OB 3T9YA 5IM7A 5HHQA 2BVEA 5C0BA 2F7OA 5AALA 4Q4EA 1CGVA 3UCQA 4U6VH 3K5RA 1HT6A 2ZSVA 3L16A 4JFXB 4GUOA 5I1HL 4PQAA 2Z4QA 1TXRA 4HJGA 4X80H 4JK0D 3MOQA 5B38G 4NGTA 1KJ3L 2YAFA 4ANKA 3IDYB 4Q8BA 4FG2A 4CMMB 3CCHB 2GB2A 3KWWB 2QV4A 5ID0B 4Q9QH 3G5VA 1PZ5B 3F6IA 3EZJB 3FS9A 3PGDA 3LSOB 3ZZ1A 2AJUH 2APVA 4OM1L 5CGBA 2DEAA 2XEJA 4Q52A 4YSPA 4BSVA 3FCSB 1TVBA 2B16A 5G1ZA 4XB3A 4EQ2A 3SKUD 4E9TA 2EACA 2R2BB 2WHVA 1A6AB 1G0DA 2BSTA 4AYSA 1Q90A 1U3HD 1BBJB 4PBVC 2YGQA 4NHUB 3GEWB 4MJIB 5EZOL 1VEMA 2H2PC 3WE1A 3JWNE 3U36A 1CBJA 3Q5TA 1CXEA 2Q3AA 5K9QG 3MN8A 4HNWB 1K5NA 3QJQB 4KNUA 4LCVA 4B7LA 2NXZB 3GBML 5IHUL 1SOXA 4XNMB 5KSBA 2XN9A 4P4EA 2IWKA 2W1NA 4DCQB 4PLJD 4ZYKA 3N1PC 5LBGA 4NGPA 3HC3L 4PXEA 4ENEC 4UILH 2V3DA 2QMLA 1ORQB 1YQVL 1FZMA 2HAZA 2VN7A 3HE7B 2ZWKA 2CDGA 3FCUB 3P9LB 4MAUH 2D31A 5MI0B 2GY7B 1N59B 2ADYA 2E6JA 1JZEA 4N24A 1LAPA 1F11B 2WO4A 4EJ1C 1FZMB 4G80B 2BSBA 3ESMA 3UBHA 1KTKE 2DY2A 1EAJA 2VMDA 3CZSA 4NEXA 3OMIB 4XO3A 5DFVD 2CMRL 3SGDH 2NNRA 1E6OL 4DGIH 4G6JL 3VYNA 1P5VB 2H1XA 4KKQA 3P02A 4JCMA 1COBA 3OKDB 1CD9B 2WXLA 3PHQA 3B3BA 4HWUA 1RZFL 1DQML 2A9MH 3HN8A 2XQBL 4RI1A 1N3NB 2RFXA 3ULVF 1PZAA 1H8SA 3DGGA 4QOKD 4PWIA 4U2YA 5C0EA 5TQ0H 3ILPB 3CZLA 3I85A 4JPIB 5TQ0L 3V4VA 1YR0A 2QIRA 4N90E 2CTCA 1MLBB 3LQMA 4B9GA 5IW6A 4PY7A 1IGBA 4NEHB 1HHIA 4XI5C 1NAMB 2D4FA 1ETJA 3V0WH 2Q8AH 4GKZA 5GGSB 3V0WL 5FGCE 3VB9A 1JAEA 4HIXL 2X70A 2PCXA 3QQDA 4POZC 1AXTH 1AYRA 2KI6A 5F8QC 5J6GB 4V11A 3VFGH 2WUCL 3MRNA 2BOCB 2EKJA 4NOFA 3U4AA 3NIGE 4JRXE 3QDMD 4JO1H 1YC8A 1CZ8L 1IAKB 5H37G 1T2QL 1NGZB 5D7KD 4ZYKB 5I9QB 4DCQA 3U82B 5LBSH 4Z3HA 1ZLHA 2IGLA 3L7EA 4HEPA 3LVEA 4LLWA 3SYOA 1LEGB 4Z0XB 2WPWA 4PCSA 3NEOA 1RPQA 3DRTB 2WZPD 4LEOA 3GRGA 3BUIA 3L7EB 3V0AC 3TPKA 2HVBA 4K5MA 5EO0A 1CBVL 5CLWA 4MHDA 3C6SA 3QNXB 5MHSE 3H4HA 3NJJA 3CPXA 2PUQT 3U7YH 3DTDA 3QRBA 4L8BB 1SLVA 3WO4C 2LU5A 3QIBA 1A7NL 2ZAGA 2VIRB 1F2XK 2DLGA 3NK3A 4PPZA 1TTBA 1E4WL 4PRNB 1R3LB 2P80A 5HGHA 5JXED 3MREB 1J4JA 1CUOA 4YK4B 3S97C 1EQWA 2QDWA 2ZJSH 3LHAA 4NQDD 3P4MB 1F6AA 1PU9A 2BS71 5L7XL 2X4TB 4OQ1A 4U31A 3DMMB 5F93C 3NUKA 3ARFB 3D39E 3WDJA 1MCNA 2DYPD 3LKSB 1KT2B 2Q4ZA 2DH2A 2FX7L 1ZS8A 4PCKA 4P3CH 5DD1L 1ZLSL 1MNUH 1FNGA 2QL1A 3ILDA 3IMBA 3VXTB 5J8FA 3GM0A 5T33L 5ESAB 3CFEB 3D06A 1G7MB 1RK0A 4TVPL 3IVKB 1DE4C 3RUGF 3DX8B 3G6JE 1CFVL 4U1SB 2WY3B 3L48A 2CLRB 5J11C 1A6ZA 1LK3H 3DO7A 5SWSA 3TYGH 2DB8A 3X1BA 1ZEAH 3KPQB 5EMIA 5GRXG 3RAJH 3EUDA 2JXMB 4M56A 4AXVA 1XGUA 1Z0NA 2RMNA 3G5VB 4IGBC 1IAIL 1DVUA 1RLBA 2LW3A 2XY1A 3LKOA 1ET5A 4O2EA 2VNCA 3BVUA 5F70A 3T1WA 4MCSA 3ARGC 5BO0D 1QEWA 1XR9B 2VXSH 2AK4A 4JGJA 5EU6E 3P73B 1YRKA 1CP6A 1FY7A 5D7JA 1F4XL 2DJ4A 2LE9A 1KLUB 4ZAKC 4PN6A 1TJXA 1OAUL 5I8CA 2FO1A 1TVHB 1KIRB 5B8CB 1EZSA 3RI5K 5DD3L 2E9GA 4WFHE 1Q7LA 1XHHA 4LSVL 1VCBC 1BZ7A 3UJJH 3CFTA 5HTSA 4HWEH 3PFUA 3ENEA 4ISVA 5FECA 4NNXA 3MRDB 1MI5A 2I9LA 5HJBA 4LHQB 4UV7H 3T4YA 4P9HL 2E0PA 3B2VH 4OGYL 5JORA 2PJ6A 4EMEA 2WWNA 2J56A 1FVEB 3SO3B 4QRUB 4NNXB 2ZONA 5E5UB 2E75C 4KK5C 3ZE1B 1BQLL 3QI9A 4M6NH 1C5CL 4ABUA 2FEJA 3RBUA 3WN5A 1YN7B 3VI4F 2Z3NA 2AFUA 1BECA 5LAXB 1ZG9A 3QK0A 2L7JA 2M26A 4MXWH 2BP8A 1V55B 3FW6A 1I8UA 2B39A 4AMWA 4I2XA 1BX2A 2Q7NA 3VSTA 1JFQL 1A4BA 5C08A 1IGCL 5K9KA 1P2CB 5L4IA 4JN1H 4FD6A 5DSCA 1SJEB 2QSCH 4OFYD 1KBKA 3TT1H 2DW5A 2ZZUT 3WTUA 3K2UL 3S35H 3BUPA 2O1AA 3IRCA 4FGMA 2NT0A 2EEBA 4ZI6A 2XACC 3QUHA 3QAHA 2XT1B 4M6IA 3QAZC 1MH5B 1LTXA 3MJGX 4JDEB 5GSRB 3MRFA 3VQ1C 3ZMNA 4R4FL 1R3NA 1Z5RA 3OAYH 2ENYA 4JR9L 3P73A 4MRCA 4Q58C 5GGSY 4OSUH 5CEZL 3P9MB 4FXLA 3Q8CA 2NY6D 3NFNB 4N2OA 4NUMA 1IM3A 3C6LD 2NNCA 5J3HC 4FZEH 1LWRA 5FHAH 3AU1A 3FCGA 5I5JA 3EOTL 1IAOB 1BVLB 3HRZC 5JOFB 3L3OB 5BV7L 5J6HB 3P77B 4QPEA 3IAPA 4Q7DA 5IOPB 4UT9A 1EEYB 4R90H 4N8VA 3MCLH 3T04D 4KVCL 4JY6A 4X2TA 2Y3AA 3QIUA 4ABQA 2JIXB 1P4UA 4Y49C 2DLFH 4X4XB 2VDRB 3RZWA 3QIBD 4HHAB 3FF7A 4KKRA 3UXFA 2GKIA 1AO7D 2XQ0A 3DIFB 3UDWC 2CWRA 4GG8A 2H41A 1R33A 2JJWA 2GT9B 5JW4R 5GGTA 2IADA 3O2VL 1G9HA 3FCTB 3HMWL 3L4ZA 3MV8A 3CN3A 3QWRD 3D39B 4I9XA 1QR1B 5C2BL 3GSWB 2HFTA 2P6GA 5FK9B 4LVEA 1IEHA 3R06B 4NQCA 3QPKA 1ZLWH 4HIXH 1F1AA 3OR6B 4NCDA 3VA2C 2ZXWB 1KUMA 3LNFA 2GEQA 1HHIB 4XN7A 3H54A 4R2GD 3I9GL 2J20A 1J12A 1NDTA 5IIEB 3CVHB 3LEXB 4LCCA 3JTSA 2KHAA 2H5UA 5KSAD 5B3SB 2VLMD 2XKNA 4QCIB 4ZUWA 3VFNA 3BVWA 3N0PB 3LDBC 2O72A 3ECQA 4K5OA 4NC1E 1F90H 2NCEA 4MRBA 3SI2A 3CSGA 4ZX9A 5ECGA 4ZZKA 4URKA 3ML8A 3D5OF 1PNCA 4MNQD 2P5WD 1WEJL 5E6UB 1NCWH 2DIEA 5DO2D 1WK0A 5AVUB 4JKPL 4PRHA 1JGEA 3D6GA 4F7TB 2VQ4A 4EXKA 1MJ7L 1INDL 5E99H 1OF2B 5F1KC 4TNEA 5AZ2H 1C16A 1KEGH 2B3UA 1Z9UA 3EYOA 4OV5B 4W4OC 1O7DE 2W0FA 1T2XA 4OJFH 1BEYL 3I74A 4APQA 2FX8H 2WBJB 4A7GA 4EQ3A 4PRHB 4FFZA 3SE8H 1IL1B 2Y1AA 4HSAC 5C0AE 4E42A 5JM6A 5FB8B 1JI1A 3VW3H 3RX9A 4G6AD 1GYVA 2WWMD 1IM9D 4PJAE 3WHXB 1SF5A 4OLXL 2V9UA 1ZCRA 2AI0L 3A9LA 1E4WH 2CO4A 3B1TA 4KJQC 3V38A 1XGYL 3RL2A 4ZW5A 2F1EA 2DD8L 4PJHF 3A6OA 4IBYA 2F7PA 4J12A 2ZOUA 3L4YA 4JM4H 3CTTA 3NIFF 4R7VA 3LEVL 2DYPB 5DZJA 2QECA 3QULA 4MX7B 1KXTA 4L4JA 1YDPA 3V2AR 3UADA 1IMHC 3S9NA 4X8IA 4OZHE 3STZB 5KSUA 2BOLA 3B2YA 2G0BA 4HBCH 5IHHA 4G7VL 1V10A 2YC1B 2RD0A 4R7LA 2G9DA 4MCYB 1AY1L 2OJZH 5FCSH 4F8OA 3CLWA 2HLAB 2ZNXA 3O6MH 4L3EE 2VXKA 4FNLH 3NMEA 1NC4D 5FWQA 4I0CC 1VSCA 3PV6A 4L8CA 1DHKA 2XKNB 4QCIA 3BP6B 3E1ZA 4ZUWB 1OTSC 4BUGA 4X0KB 2NSMA 4J3OG 3K46A 2QJ8A 4RX4A 1HK6A 4ONHB 3KDMA 5CSBA 1DJGA 5EA0H 4GP4B 5ALBH 2P42B 5BO1H 1MWOA 3BXNA 3KEDA 5ALBL 1JZJA 1FO0L 3IN0A 4N2LA 4EKXA 4XBEH 5JQ4A 1J18A 3VFVB 4HX1B 1VGKB 1GZPA 4W9DC 2CIKB 1G1KA 1YC7A 4GJTB 3BP4A 3RIFF 4RX4D 2OULB 3ZZLA 5LCVA 5IFHL 5ICYB 1OAYH 1XCWA 4M1GL 2MKWA 1DVZA 4CGUB 1SJEA 4WDIB 2YLKA 1UWYA 3QFJD 4FQXA 4FQIL 1BVKB 1SOSA 4GXVL 4Z3GA 2CPCA 4OLUH 5DZPA 2VITB 4D7PA 2J2ZA 2OMWB 4ZAKB 4YBHA 2ZUQB 1IAII 1EEQA 3ISXA 2DL2A 2MNWA 1CXHA 1HHGA 2FBRA 3AB0C 1XZWA 2QKIA 4XAKD 4ELMA 4Q7AA 5DR5L 3IXAA 3L54A 3U9PL 3FQ2A 4NBXB 5KSUB 1W72A 4JGMA 4Y5YC 2FBJL 1FCCA 1IAOA 2NUTA 3RL1B 3GXNA 4LSTH 2NUPB 1MUJB 4S11A 4KRMB 3MNZB 1M7DA 4P2RB 4LASH 1TQBC 5TDOA 1F4AA 4Y2DD 5A6IA 2AC0A 3OM3B 1YN7A 1HDMA 2BOBA 5E6IB 3BEWB 1CJWA 2DQ6A 3GSOB 4JDZA 4XMKL 5F9JA 1JQGA 2FUTA 1X4ZA 5DVPA 4X6BB 1BPNA 4JANA 4WI6A 3L9YA 4HLJA 4I2XB 3SHSA 1IYKA 3RGVA 1U8NA 4KRPB 2QPUA 1B4RA 2XA3A 4K94H 3W39B 3DETD 4AK1A 2KPWA 4LU5H 4JANB 4NUPA 3BOVA 2O28A 3DUSA 3F0AA 1MJ8H 5IESH 4UU9A 2UVFA 3NJFA 4UIMA 1BF8A 2DBLH 5KYNA 5GJTL 2DICA 1B6BA 2VT0A 4RISL 1MFEL 4P5RA 1Z9MA 1MFEH 3RTQB 2ZXAA 3TFBA 3GB7A 3HKFA 1ZT7B 1D9KD 4MQ7B 2VLJA 1IM3B 3QO0A 4WUUE 4FQCL 5CP7A 1N6UA 2VLRA 2WN2A 3OWCA 2ODFA 4KV5E 3FO9A 5D7KE 3S48A 3EBAA 1ZGLA 2FT0A 1YO4A 1J5CA 4FQ2H 2X7LB 2KERA 1VPOL 1FF5A 2QVTA 2WLLA 4I2XE 3LRHA 4WEBH 2I00A 1BWWA 3CPUA 3HI6H 4FD4A 4I1NB 2XZCL 3IPBA 4QRPB 4BFKA 3MRLB 2X7LA 3UL4A 4GQ9H 1SNRA 2P5ED 5ACZB 1HFUA 1Y0RA 2JKIS 1CDGA 4YR6B 4JFPB 6TAAA 2J88L 1ZVSA 4PS4H 4AYEC 4P5TD 5B8CC 4WFED 1L7IH 4Q0XH 2OOTA 3BEWA 4UIBA 4FTVD 4PTUA 1NUDA 3NRFA 4FMFA 4MKMA 3T0DA 4N25A 3O6FD 4X6BA 2D7TH 4WIQA 1MWAL 3ZO9A 1P53A 4X4YB 2BSSA 4ZXBC 3FAXA 2HZHA 1AUGA 3SJEA 5LXVA 2E27L 3MGTA 4P4FA 5ACLA 2X5PA 4EVNA 3S36L 2QBWA 3S36H 5K9JH 5EF2A 1L4IA 2PXYC 3VXSD 1KPVA 1RHHA 4CW1A 1YDPB 3CBRA 1H6FA 4Y16D 2ODHA 3B2UD 2WQXA 4YGVB 4XXWC 3VRLE 5EC1A 3CBKB 4Y2DC 2I9TB 1ZOXA 2XVKA 3VXMB 1XEDA 1W15A 1JNNH 1JK8A 5FW6A 1WJ3A 4NXSA 4WEUD 3LEYH 2CUHA 2F53D 3O3EA 3RPIB 3FSAA 4KTDL 3C26A 4U1IA 3P2TA 2Y36H 5TQ2L 3WHE1 4E0AA 2PC1A 3QUYA 2QGCA 3DVIA 3IGRA 5FF6B 2CDFA 4PHXA 4XWOC 6FABH 4JUSA 5I1KH 3ERXA 3MLZH 1CFBA 4NGSA 4LDLB 4UBDD 4M5ZH 5KVGE 1KCLA 2CBQA 1OPGL 5AVVB 4TUJB 2LVCA 3BP4B 4XN2A 5AD0A 4KOYA 1F2OA 3CQFA 2Z0ZA 3PBEA 5E9DB 4P23D 1D6EB 4XN1A 4WVRA 5CF3A 4I49A 2ZOFA 1IKFH 2DLTA 2KC0A 3A47A 3MRJA 5J12C 4LLWB 5DZNA 4PRBA 1KXTB 1LOKA 2BZ7A 4CC4A 2HN7B 5EZJB 1GA2A 1X4XA 3C5SA 4LCIH 4YC2B 3IS1X 1NWPA 5FKAA 2O30A 4MB1A 4IRJB 2NY4D 3SOBL 4LKXA 1CR9H 4ZTPH 1S7QB 3FC8A 4Y19B 3ARUA 2DPSA 5FO8B 4O58H 5C9JA 3WNKA 2GQHA 1A9VA 3UH8A 1UM5L 3VB8A 2AK1H 2VAAB 2R8SL 3H6JA 5LBVA 3K4AA 3LOWA 4JDTH 2YBGA 1TTUA 4G6FB 2OMUA 1AH1A 2OL3L 3ILPA 5AYUH 2EDRA 4ODTH 4FXGC 3PREA 1FO0B 1L7TH 2FCBA 4O23A 4FD5A 1AZVA 3GIZL 4LDEB 5DS0A 3Q5OA 1CM0A 3KI9A 4R76A 4C2YA 1NCCH 5C3IA 2YSSB 1OW0A 3FT2A 3PP9A 1JGVL 3CSPA 1QATA 2FO8A 4UT6H 1HSAB 1MRDH 3T77A 3O3AB 4Y16B 3T2OA 4FS0A 1T0NB 2CO6B 1IKOP 4HEPG 4I3SL 5C0BB 5EZPA 5LNGA 4NO2A 4OF8A 1CGWA 4QXGL 2F1AA 3K2IA 4BWUA 2A73A 3QS2A 4A68A 1ORSA 1BJ8A 4XRCB 4CGOA 3P9WB 5AL8A 4NO2B 1YAIA 5TH2A 1EXGA 3H9SA 3J8F7 1WGOA 2L04A 2HT4D 3HZKB 3RPKA 1PCAA 4YAQB 4S1RL 3K8LA 4RMSA 1V3KA 4N0YH 2G3AA 1VHPA 1TOXA 4QT5A 1HCVA 2X09A 4X80L 5KAQG 2GG1A 1MREL 1IRAY 1TQTA 3NP4A 3RJOA 4KRLB 2PNDA 5CFHA 1WZ1L 3L1OH 3NPZB 3GJFK 5CLXA 3PHOB 1ZA6A 5DUML 5ADOH 3MCLL 3PFQA 4IOSA 4KITB 1RU9L 5C0RL 4CRZB 3IIBA 3CVIL 4NO0D 2FGWH 5FWRA 4KXDA 1YLBB 2XEGA 1W16A 3VWJB 1C7SA 1B9KA 1A6TA 3L7FA 2FWOB 3QUMH 3MRKA 2YPLB 3GS4A 3T2PA 1YVOA 2XBTA 1BZEA 2VERA 2EJ1A 4G7QB 3OG4B 1VFAA 4HKXA 4JRYD 2NW2A 5FFGA 5HI4C 1G7QB 5DUBB 2WBKA 3ZIMA 5LGYA 3ZHDA 4NZUL 3IWUA 3EYUL 1FL6A 1YEFL 1P69B 4HIJB 3IMWA 2WXPA 2FEDD 3II1A 3QHFH 5DC9B 1DBBH 2R56L 5LO7A 4A7UA 2J1XA 4N0UE 2R4SH 1DL7L 2XEFA 1EGJA 5FUOL 2JKTM 3PL6D 1MHHA 2W95A 3GFUA 1FE8H 3DKHA 4Y9EA 2B5GA 1RQ5A 2O5ZL 5JW3L 2DOCA 4UCFA 5KS9F 1S46A 4ORFA 1SMOA 1DQQB 1KEML 3ZBMA 2A0LD 4GM5A 5E6ID 5FKPB 2KZKA 4HKZB 3CFDB 4GQRA 5C08B 2WLMA 1A2YA 1ET8A 5BXFB 3GXIA 3K2KA 1H3PL 1KELH 4MVBC 5I0XA 4BD4A 1VZGA 3ZZIA 4LSSH 2Z8RA 4FNRA 1FNHA 3AQYA 1YMMA 3KPRE 2E56A 1TJGH 3FTZA 2IFGA 1DVFC 4JKPH 5I1EH 4J3GA 3VXPB 4LX9A 4UTBL 3GNML 2EDJA 5IJDC 5HVGB 4DPRA 4F7KA 1F86A 3VD4A 3FH7A 5DJ0B 1RAMA 3V0VA 3AU1B 1I21A 3MRDA 3WLWD 4I5BA 2Q7YA 3ES6B 5EBVA 3ZDXF 5AW0B 4YSSA 2OTWB 3DX0A 4A30A 5CLYA 1PPIA 5IOPA 3FQYA 1JRHH 3HG1B 2VE6A 4YHKL 1V3MA 2HB6A 4TULH 5INCA 3SI1A 2OTWA 4K15A 1AXSA 4MJ6A 2J44A 4OJCA 5I1JL 2WLZA 4PXDA 1DQLH 3Q2CA 3UEQA 4YIQA 4PY8J 1YMHA 3MYZA 2WW8A 1ZSDA 3LRSB 1U93B 5T3ZH 3RVWD 1BWMA 1A4AA 3OF6D 2PJ8A 4NJ9L 3LX9A 3PS6A 3M7OA 4OLWL 3MLYL 5E1AB 4MHHG 2BUEA 4FAAB 1MJJB 4FOMA 5CCGE 1J87A 2H32A 2O26U 4IK7A 2EDKA 4S2SA 1KYOK 1G6RB 2K1MA 4UV4L 3X12B 2QR0B 4NZFA 1NIBA 4H44C 2ENJA 4L29B 1F42A 3QUYB 4P57B 2G75B 1EEUA 3WD5L 4F15B 3NZUA 1OM9A 3HE6D 4GFTB 5DQJA 1M6OA 4ZG1A 1TTRA 1D7DA 4P4IA 3ZHFA 4M62L 3ZMRA 1IAKA 5C0BD 1QLEH 1T5KA 5ANMA 1Z5YD 4PJEE 3KJ4C 1A5FL 4PJDA 1AO7B 2PR4H 4LCCC 3DIVA 4ABWA 1KIUB 1IB1E 4QXTB 3X17A 4KSFA 3MBEC 3GRWH 1AANA 1AE6H 4LLQA 5T3XD 4N22A 3VFWA 3QCUL 1UFHA 4FXKB 3IXTA 4XPAL 4YOKA 4O2CA 3GMPB 3U1PA 2A4NA 1KIUA 3OBAA 3JVFC 4MVBD 5CNHA 1Z4EA 5SWSB 2EH7H 2VO8A 3A67H 1AZZC 3M1BB 4U7SA 1SOQA 4OIIL 2FRGP 3G08A 5SX5H 5HPMB 1GGYA 5I6NA 2PWGA 5CJOH 1PSKL 3LNGA 4JY5L 3SSGA 3O8XC 4JE0A 4R7NB 4X9FA 1U93A 2AJ3A 1H3XA 1W0WB 2HKFH 4ODSH 3VU1A 1QEWB 1TSHA 3UTSD 5LVEA 3EFFB 4PXBA 3I9AA 4FJZA 1BMZA 3NJMA 4YHNB 1N6QL 5DLML 4Y89A 2N7AA 4G7VH 3K72A 4B41A 3BPOB 1G6RA 3ETSA 3I6SA 5I16B 2MPAH 1X44A 1TT6A 2PPFA 2WLYA 3ARFC 1ZHLA 4N2BA 4EOWH 4HULB 4RS2A 5EU6B 4GW4A 3R96A 5GGVH 3BI0A 5I0YA 3VWJA 4F5CE 4P2OD 4WWNA 1AJ7L 2VXQH 1GHFL 4PB9H 4XX1G 5HGHB 4NENB 3BAEH 1SDDB 1WP6A 4GG6A 4N26A 2GJ6A 2AJXL 4NJAL 2CKBL 4ZUVB 4L0YA 3FB5A 4HLZH 5EEZA 3FU5A 1M4GA 3NESA 2PVWA 5K93A 4B9PA 5DZLA 5TE6H 2EDBA 4F7TA 2YAQA 2Y7QB 4R97B 1GCFA 4J4PC 1A6ZB 3DXAA 2RTTA 3TVMD 1O6VA 5HYJB 1VIXA 1ZK5A 4DHLA 2G60H 1LO2H 3PIQB 4S10A 5I1CL 1ZGLP 3ZOAA 1T6BX 4PRPD 3EH5B 3H3KA 1MFBL 3VFVA 5ESAA 1NMTA 4E9WA 3EGDB 3U4EA 5AG4A 3T6XA 1BYOA 4F7PB 4HV8B 5FYJD 4K3EH 4GRMA 5C0RH 1UVQB 3D0LA 2CNTA 1MK4A 3LPWA 3WJLC 4UDUA 1UGKA 3KHXA 4F7PA 5CCKH 1L0YA 2LAGB 1XGPB 2DEWX 2IJ0C 1CXFA 3Q2NA 1F45A 3NIGB 3RVXD 3WELA 2M2DA 2VUKA 4AENB 5DURB 2VL5A 4MBUA 3BI1A 3QAQA 4RSYA 4UQ3B 3IU3B 1UZ6F 5CZXC 2QPDB 3P2BA 1X6NA 4JM4L 5C0JA 4NZTL 4X99A 1RUAH 5THWA 5IJBC 1SEBA 3ZLQC 4R3SB 4HS3B 5C0GA 5AVQB 4PM1A 8FABA 4PRDA 2FJSA 3QWOB 3RVTD 5D1ZI 1YW4A 3PV6B 4Q6IC 1SQ2N 2EDYA 2VM4A 3MMEB 3D30A 4L1LA 2R98A 1FUNA 5J9PA 2WK2A 1IC4L 3I3BA 2H6OA 2JIXA 1G7LA 2P8MA 4G8GB 4Z7VB 5DHYB 1FHNA 4FQQB 2J25A 4PJ9C 4DJLA 1MAMH 5IT2L 1OAJA 1OD7A 1EDHA 3OKOB 1ZHBB 4JQIH 2ZSVB 4OCSL 4UI2A 5EBLA 5TF1L 2PIYA 1O7SA 1M3IA 3JV5A 3PP3K 3D39D 4NQEB 3HBPA 3US0A 1J1OH 3UC0H 3RTQC 3V7MA 3WKQA 4LGPB 2VZ3A 3RHWF 1G1YA 4YBQD 5B39A 3VWKA 5LWYH 4YDKL 1A3RH 1B0GA 4XMVA 1IJ9A 4U49A 3ZE2B 3TTYA 4G83A 1EO8H 2DKSA 2VR7A 5GZND 2NMTA 2YXMA 3E3QC 3G9AB 4F1SA 5HYQB 4LK4A 2Y1VA 4PVNA 1HXKA 2OMWA 1A0QH 1F13A 4J2XA 3ZDXE 4OP4A 1TO4A 3SKOA 1S7XA 5EPMB 4CYPA 4B9YA 1PDKA 1QHQA 2BFVH 4KMTH 1EWHA 1NBYA 2OJEB 4JRWA 1Q9LB 3HRZB 1U92B 3GSNB 3HIZA 5DMJB 4FNSA 1B3IA 3BSHA 5IMOA 1RZIA 3STLA 5JOFA 4YJZL 1FZOB 1MCLA 2GAZA 2F7RA 3SJVA 2PW2A 4WV1A 2PWDA 4XWGL 5I8KH 4NYLB 5SWSE 3B2VL 4OGYH 1EFQA 4N85A 4NAMA 4M43H 4F2FA 4R3SA 5C0GB 4GW5B 4P2QB 1MFCH 1QSFD 4OBSA 4ORGA 5FYKE 5DVKA 5J56B 4PJ5B 3R9FA 1Q8MA 1F56A 3S88H 1HE8A 2QV2A 3N06B 3TLRA 1G7JA 2EUWA 2ARJB 5IW3A 4YQXH 2ZEFA 4NN5B 2GSIB 3BT0A 2Z0UA 3W2DH 2GPZA 2B4CH 3BYYA 3E9TA 4LASL 3GUXA 4FX5A 1BHGA 3MX0B 5BMFH 3TE4A 1KB5L 3L4VA 1I8MB 3WMPA 4H8HA 4NQDE 1NWOA 2CMRH 3MAWA 1PG7H 2XWBB 5EIQA 2WB1A 2VO5A 3D50A 3FFCA 4TLSA 3BQVA 3KJ6H 3QRFM 2WGXA 1YPZA 5FC9A 4Z8FH 5BOPA 4PG9B 3LS4H 1XF3B 4RN7A 2VLJB 3CVDA 3MRFB 1QYGH 3CDFA 5H8DA 3BE1H 2AEWA 1OP4A 3GI9H 4NT6A 4P9HC 5GIRB 5JIDA 4CGMA 3VXMA 4KHTL 5DGQA 4YLQT 1S5HA 3S34L 4GKSB 1GSKA 3UTSA 4S1QL 5JYLA 2VDMB 4E9XA 3CVHA 3LEXA 4LCCB 4JS7A 2PR1A 4P5KB 7PCYA 3BT2L 3FB5B 4HJEA 1QACA 4LLQB 4KVXA 2H1LM 1HWWA 3MI6A 5LLIC 5I1KL 2Y6SD 4B5EA 4ZXBB 4PJFF 2GBTA 4NKQB 1ZLUH 4YR6A 5EOTA 4G6KL 3QIUB 3CVBA 4G6KH 1LE9A 1CT8A 4N5ED 3NFPA 3QJUB 3J7HA 4BWTA 4HHGA 2BERA 3VFUA 4IBWA 4I85A 3I75B 1PX3A 1F8TH 2IQAA 4PH8A 4WW2C 4ELKA 3IMVA 1QTPA 5IX3A 5I6OA 4C56E 5GRVK 4URTB 1S78C 1OTTD 3T65B 2CSPA 3KGQA 3UJIL 2OXHA 4L8SA 4TRPH 4P5TA 2PTTA 3BPCB 3MGDA 4NF1A 1KFGA 3MCKA 1VIWA 1FBIH 3D33A 3BUBA 1QX1A 3L1FA 1P7KA 1MF2L 2R23B 1XF4A 3LXBA 3DMMA 5IB2A 1R5IA 1YYLH 1L3NA 3JV6A 4OR1A 4KO7A 3BH9B 3AQZA 1U91A 1A7PL 1AD0B 3D9AH 3WFEL 4NKDA 4QF1A 5D6CB 3ZRSA 3IJHB 3EUUA 5CHNB 2K6YA 4HUMB 3S37X 3SDAB 4YSCA 3BH9A 4GXFA 2DIBA 4E5XB 2XWEA 4HXBH 1LEIB 4B5PA 3I84A 2X7BA 1JXKA 5IROD 4AW4A 4LUAA 4U0RB 4N3TA 5MEPA 2EWBA 2FX8L 1SM3L 4AEHH 3GJFA 2YA0A 5IZ7A 4UT9H 3QUKB 4OZIA 3EJYC 4HC1A 1AMPA 4KROB 3V0EA 3OKNA 3MVSA 2X4NB 3MJ8A 3WOVA 4YHLL 4X5QA 3NFPB 5EOCH 5GZOD 4TQ8A 3S4SG 2H0EA 3S5LB 3VFGL 4B9IA 2EDNA 2W07B 2A4CA 4K8RL 4JZJC 4AH2B 1S7RA 1QFWI 4RETB 5I8EB 5IY5B 4ZPTA 3UGXA 1BYPA 1E4XL 1JI2A 2A9CA 2H0PA 3O3DA 2ZCHH 3RFZB 1RZKC 3PJSA 4ODWA 4YFEA 3M46A 1L0CA 4OZ4A 3HJ0A 1CFSA 1EXUB 4P9ML 1IKFL 4Y1AA 2DIJA 5D5MF 2XZQL 5GGRY 3TZVB 1Y18B 2PETA 3DYOA 1SBBA 1E28B 1E7VA 1DLHB 1X5KA 1AO7E 4IBTA 1F1DA 4MAYA 1HTYA 4ONFH 3TPUB 2GIMA 4GRLD 5BRZB 3X13A 1R0AH 4IHOA 1A3QA 1XTMA 1CL7L 4Y1AD 4HXAH 3K6DA 4PJEF 1YNKL 5F88A 2BCMA 1ND0A 3FB6B 3GLDA 5A16A 2YUZA 4P5TC 1XGRA 1C5BH 1FNAA 4MAYD 1R43A 3ZHNA 1MUJA 3SBWC 3WKPA 1ZLIA 2DWEB 3DBSA 3NYKA 3GBNH 4WHTA 1WCQA 3QR1A 4DGUA 1GMIA 1TTCA 2Z31A 1KCVH 1DANU 2XIIA 3O11B 3O6LL 5AW6B 4DP9X 2FQFA 1GZHC 5AKSA 2V9TA 4HEME 2IV9A 1SY6H 4KTYA 3BESR 1UD4A 2ZCLH 1BIHA 4OTXL 3VRIA 4R8WL 4AGPA 3OZKA 3F62A 4XCCH 4OLUL 2WIIB 4KI5C 1AFVL 4HT1H 1X10A 4YDIH 4OCXH 2CKBB 2ZP9A 4PR5B 1NCDL 1YGHA 4U1NB 4XP4L 4Y0GA 3T8XA 3C2SA 3DTUB 3BPLB 2HJFB 4WV1C 2A99A 5EZOH 2VDML 5DEZA 3O41A 3PUCA 3DVNB 1U92A 3GSNA 2DM4A 2K9UA 1K4DA 3EGSA 1DQQA 3VXNB 3FMGH 4H1LH 1OO2A 4CMMA 5EU5A 3WS6A 1YUKB 3ET9F 5BOZG 3OKLA 3KPMA 2X2IA 3VO0A 3TESA 3WKNA 2VDKL 2C9XA 5JHDE 2XG5A 2OMXB 2ZUWA 4MCZB 3D4CA 1DQJB 3V55A 2PJ1A 3BSGA 1SBSL 4U33A 3H55A 3KH4A 3GNMH 1I3RB 3CGTA 1JYNA 4F9VA 1IBFA 3T0VA 1AQDB 4XNZB 3VTAA 3JTTA 4HWBH 1FGNL 2FSDA 4N1HB 4KVCH 3B3IA 4CAFA 5HVGA 3LHPL 3DIFA 2J43A 4A7SA 1AKJA 5CIPH 5EUOE 4CL7A 2A0LC 4LIQH 4KAQH 3K1DA 3R7RA 4DKFL 2YRPA 4N2MA 3U2JA 1XXFC 3H7BA 3K4ZA 4WW1B 2RFHA 4NCC1 3ATAA 3S6CA 1TNMA 1XCQB 3HE7A 3T1FB 5G22A 2HUHA 4RISH 1SZNA 4PP1D 3OG6B 4JZOA 2VB5A 3MYJA 2AEIT 5EC1B 1CDUA 1SJMA 2AGJH 3G5YA 1HOCA 4X5WA 4JFZL 5F3FA 1CFTA 2VBQA 3T1FA 4HG4J 1LWJA 1VADB 4XCYA 3R4RA 2Q8AL 5HYSA 3DPDA 1CK0L 2VAAA 4WJG3 1NCAH 4TUUA 3VFNB 3WNPA 2WCSA 1AVAA 3FCSA 1R5WB 4UM9D 2WBJD 3V9FA 4EI6B 2DJSA 3EOBB 4LAJH 1MY7A 4WI0B 3PF2A 3BEVA 4B7IA 2XWJB 3PFOA 1Q9OA 5I18L 2HVKA 1W2KT 3MUGB 2FR4B 1YAZA 4MAZA 2G75A 1JL8A 3B7RL 1Z7JA 5AOLA 4WI0A 4N8PA 3G5XA 1KTLB 1QWUA 2VLKB 2P46B 4B0MB 1CDIA 4PVLA 5G2NA 1GY1A 5D1QB 4WCYL 3HUJE 3MOAH 2XFXA 4RZKA 1SXSA 1NMAH 3BKMH 5A3ID 4DK3A 1EHLH 1HEEA 2XG4B 3VXQB 1I1YA 3CUPA 3EIFA 1QPXA 4CGPA 1M7IB 2B3RA 5GRVL 5T8IA 1FNLA 3UZQB 4PRBB 1QFUL 3OGCB 2Z1PA 4ILDA 3VFRA 1VFUA 5EU4A 2AQPA 1OAZL 1XH3B 3QJVB 3SPHA 4IU2A 3NOIA 1MF2H 4FXKA 4OT1L 1S7WB 5F7BA 2YPLD 1NJ9B 2ARWA 3FZUD 2MWCA 4MJID 2P48B 3W56A 5H86A 4C54A 1K6QH 1T66C 2HT2C 4GKNB 1OE3A 3I02B 3LXUX 4J1UB 4WFFD 5LHDA 1BGXL 3CHXA 3BLNA 1LO5B 1NANI 3W81A 2R23A 5ANHA 2X1QA 3PPEA 4JZ0A 1G9NH 2DQEH 2HFEA 3F04A 3IM1A 3BDYH 2I3CA 3BCDA 4PSPA 2OMVB 2I9TA 4U6YA 2KPNA 1JERA 1TTAA 5CHNA 2X4QA 3TEWA 2NLJB 1E4HA 4YHNA 5B1JC 4QO1B 1RZJL 4BK5C 3TA3C 3AFLA 4Z7NF 3GC3A 3V9CA 2BFGA 2G0LA 3MLSL 3QUKA 5D1XC 4HHWA 2DBJA 2BJML 1NEZB 3CZEA 1HILB 3PWPE 3FN9A 5AW9B 5GGUB 2XTJB 3X1EA 4D8PB 2CU9A 3OV6A 4N3UA 1P0SE 2ZSWA 5T1KB 4ZT1A 1OZUA 4JHVA 3T2QA 4Z5RB 4YHML 5FPIA 2ZEMA 1NKGA 1S7RB 2XPZA 2IAMC 4P9MH 3NH8A 5C9KA 3IU4H 2DLIA 5AVWB 5T1KA 2VH5H 4EE2A 4LHUG 3DJRA 4OQTL 5D2LE 1UC6A 4EZLA 1RPUA 2ORBL 2UY7A 5KVDH 1JV2A 1RJZA 5T5FH 4BRJA 4CRPA 2PJ4A 4HALA 4XTRC 2P5WE 5HD8D 2HSIA 1N4XL 2JCCA 4D0CA 1NUGA 1T0PB 1CBXA 1J86A 3FUKA 2AK1L 4DGWC 4Y2LA 1H6EA 2JXMA 4DVRH 4KKZA 4GBXD 5KVDE 2Q76A 3G5ZB 2A74B 1DEEB 1T3FB 3F01A 5T3XL 5I73B 3IJEB 3BQUD 5EF0A 4IKLA 2HWZL 4WFGE 1USZA 5JW4N 3EXJA 2G9HA 2YXVA 1GC1L 1TCMA 4N90D 1KIRA 5B8CA 3L3JA 1MRCH 2KDYA 5HDBB 2A83A 1J11A 4P59H 3O6ML 2GU2A 2PR9A 2J1WA 1V05A 5EN2B 1U8NB 1NGYA 3DHPA 4BFFA 3CZXA 4KVOE 4CU7A 2AJSH 2VE6B 3KH3A 3F7YB 4LF3B 1N0XH 4N2NA 3GMQB 4HJSA 3BVNA 3DV6B 3EH3B 3U6RB 1AXSB 2QFRA 1J8HE 1V54B 3R18A 3VUAA 3WBDA 1EZUA 4WTXA 4KPHH 2VEZA 5F6HJ 1U2YA 2ZWLT 3TYFA 1V7NH 4LOFA 2WO3B 3DX8A 5FKPA 4OSUL 2WQRA 5BZZA 5CEZH 4LFHG 4KOUA 4OUUB 1UB6A 4HCRH 5L2KA 3VGDA 3DI3B 1A2YB 1WD9A 3DOSB 1CFTB 2EQDA 2HRLA 4AL8H 5C0IA 3FO0L 1XB6A 1UT1A 2Z0BA 2VRQA 1T22A 3ABKB 4MCRA 5K39A 1H5BB 2W5PA 3FN3A 4S2SB 5IK3B 4Z65A 4NJ9H 3RWCA 3INUH 4X5XA 5HVHC 2YEVB 3HZYB 3PNRB 4IAVA 4XMPH 2R2HA 5CD5C 4BSJA 1I1DA 3CHPA 4M9OA 4H5SB 5DZ9A 5DQJB 3UYOD 3NFSL 3NJVA 4XO8A 5CEYA 4D9RE 1Q9OB 1VEPA 3W38A 1ACZA 4KAQL 1KGUA 3HI6L 1C08B 3AXLA 4P4KC 1OE1A 1FL3B 5D4HA 3STLB 4NO5B 3CPAA 4IHBA 3KE0A 4R0LA 1BZ8A 2V2WB 2VMFA 4TM9A 1M53A 1BQHB 3LXCA 5IHUH 2FBJH 1NGZA 2I26N 3H3PL 4XR8C 2N3JA 3ZTNH 4L5FE 1L7IL 4TVPD 2IL4A 4UWIA 2CUMA 1USQA 4Z7VA 2AFWA 1JK9A 2FYYA 2PYEE 3MV9B 3EO0A 2ESVA 3DRTA 4GKLA 4W9KC 5IMKA 2QYVA 1TZHA 1GR7A 1HNYA 2YAPA 3NK4A 2FHBA 1ED3A 1I7TA 1MHPL 2AJVH 3BP7B 3NPSB 3ZE2F 3ZYJA 3ZJ0A 1JIBA 2I25N 2CM5A 3UBXI 4XNBA 1VKXA 4JHAL 4UQDA 5INCB 3VFTA 1MHHB 1IBDA 2NTSP 3PXJA 4XODA 5A2LH 3WENA 4DERA 5TDPB 4MLIA 3SYPA 2VDPB 4XO5A 1MFUA 4WNQA 4PJXE 3KYOA 4OCRL 2YD1A 4DUWA 5BVJA 1I8MA 1FFPA 3E80A 1ZPUA 4AJVA 3VXME 4RUHA 3D2UB 2ISDA 2HKFL 5EULV 3TA3A 5GGTL 1TZAA 1ULVA 3BEVB 1NAMA 5CBMA 2QHLA 1G9MH 2K0RA 3Q3GB 1DDTA 2G2RB 2GTWB 3BVDB 3O6KH 2PYEB 3MV9E 1QSED 3N1MC 2NMSA 3E6HA 3B4NA 1SDDA 1YEKL 4M7JH 3SY0A 4AJ0A 4GG6B 2XFXB 3MRQB 4KOXA 4ZFGL 2IQ9H 4HFWB 4QB9A 5IVZA 5DFTA 2XWXA 1A1OB 1NC2D 2GUOA 2IAAC 3OSVA 4KVNL 5BS0D 5JXAL 2VUYA 5EBMA 5L8KB 1Q1PA 1UA6H 1VAHA 1SVZA 2FT8A 4KK8D 4XMUA 3WMQA 1BQHA 4PJ7B 5JIKA 2COVD 1HWGB 1E7UA 2IH3B 1IV8A 1OVZA 4X7DC 5AENA 2BIMA 1FLTX 3AXHA 3V6BR 4TNWK 1IBYA 4UINH 1C9SA 1WAEA 4MMXC 2ZG2A 1FN4B 3HE7C 1M7XA 3SQOH 3QB8A 3EC4A 4WFGD 3Q8EA 1FL5B 3E6FB 2IH3A 4IRSC 5FAAA 5AUMA 5JPMA 4WHYG 2YBRB 3WY2A 4MYWB 3MLVH 5DRNB 1I9IL 2C5DC 2ATKA 4Q2ZB 1KWMA 3FB7B 3QEQD 1FL5A 2DF3A 4EDXA 1KEGL 2IADB 4LQFH 4PSWA 3M1BA 4ODVH 2WLJA 4ODVL 5KS9A 2B5IB 4EN2A 3V8CA 3OQRA 2X1XR 5C6PB 1QSOA 5ECJE 4PJ5D 1PEWA 5FM5O 3C6EA 3H2PA 1KJVA 1OB1B 2XWTA 3KLQA 4GP5B 3PJNA 1WUZA 4NI6A 5T1DL 4EO5A 2IV8A 3D2UA 5EZIL 2F5IA 2MOQA 4KI5E 3EFFA 2RFXB 3TA3B 2BCKB 2QMJA 3K2MC 4NENA 1AG0A 3NQIA 5DC2A 3S3DB 4O02B 4XOEA 4GT7A 3F7QA 3JTSB 3BP5B 1GMEA 5E2UH 4DN4L 2FJHB 2VDRH 2G2RA 1M44A 4KJPD 2CO2A 4AYDC 3THML 2X9YA 1KGYE 2HUZA 4KY1L 3LZRA 2PIZA 2VZVA 3EADA 4GSUA 2FECL 3NA6A 1FQ9C 3ESPA 4NKDB 6PAZA 2VN5A 3O81A 1DVYA 4Q9RH 1DVFB 5LAXA 3NZHL 4UOW0 2EBJA 4GXUM 1JV2B 1RJZB 3KGTA 4TOYL 2J1KA 1SYSB 3QO1A 1QO3A 1JWUA 4XCNA 2FH8A 2GI7A 3DOSA 1CFMA 1FPTL 2CPUA 4N0RA 1FP5A 5F0PB 2BSDA 4WI4A 1PY9A 3DX6B 3GZPA 1EEZB 2FYVA 1RJYA 1AD9A 2EO9A 2LFGA 1TF9A 3S3JA 1WIOA 4JO3L 1Q4NX 3E38A 1MRCL 1RZKL 4H1LG 3FFCD 3RY6A 5CO1A 4DZBA 5CR8A 5KYYB 1YK3A 3W6XA 4UDUB 3V79C 2GJRA 2IH8A 4RQQB 1I3GH 3QHZH 1RU9H 3FT4B 1C08A 3AXLB 3SOBH 3KYNB 2FSRA 1U91B 1HIML 2AMGA 1FGVL 5GZNA 2A6IA 5JGFA 2J6EL 3DHJA 1HKLH 4C2XA 1EO7A 2RIKA 2F19L 3S3BB 3VMNA 3WXWH 4TNVF 3LKSA 2XTLA 4GINA 4N8VG 4LDCA 1AG6A 3TA4D 2V3EA 3QS3A 1YMEA 4OZFH 5F6IB 1GCYA 1OOWA 3VSQA 4QI3A 3V5DA 1UATA 5FCUL 1DBKL 4RDQG 2ICEA 1YMMD 4LQ6A 1M2VA 5F7MC 4ZOBA 2OZNA 3MXWH 1XXDC 3GHEH 2WUBH 4OTXH 5F72S 3H9SD 1OCRB 5E95B 2JK5B 5HGDB 3TCXA 1Z8XA 1M05A 1Q72H 2G4EA 3QUZD 4CN6A 3SDXB 1U95B 3MV8D 1AZRA 2C9PA 1XEBA 4PJ7F 4JPKH 2V0AA 4JGUA 4U7KA 3B8GA 5FYKD 1BF2A 1PAZA 2JVUA 2F58H 3O3BA 3LIZH