4BINA

Crystal structure of the e. coli n-acetylmuramoyl-l-alanine amidase amic
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
Knots found
sequence length
379
structure length
348
Chain Sequence
b'FQGHMQVVAVRVWPASSYTRVTVESNRQLKYKQFALSNPERVVVDIEDVNLNSVLKGMAAQIRADDPFIKSARVGQFDPQTVRMVFELKQNVKPQLFALAPVAGFKERLVMDLYPAPLLALLEDYNSGPQPGKAGRDRPIVIMLDPGHGGEDSGAVGKYKTREKDVVLQIARRLRSLIEKEGNMKVYMTRNEDIFIPLQVRVAKAQKQRADLFVSIHADAFTSRQPSGSSVFALSTKGATSTAAKYLAQTQNASDLIGGVSDMVQSLTIADSLKFGKAVLNKLGKINKLHKNQVEQAGFAVLKAPDIPSILVETAFISNVEEERKLKTATFQQEVAESILAGIKAYFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLMURAMOYL-L-ALANINE AMIDASE AMIC
publication title The Crystal Structure of the Cell Division Amidase Amic Reveals the Fold of the Amin Domain, a New Peptidoglycan Binding Domain.
pubmed doi rcsb
molecule tags Hydrolase
total genus 109
structure length 348
sequence length 379
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.5.1.28: N-acetylmuramoyl-L-alanine amidase.
pdb deposition date 2013-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
A PF11741 AMIN AMIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3500 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4binA01
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 4binA02
3QAYA 4M6IA 4RN7A 5EMIA 3CZXA 3NE8A 4LQ6A 1JWQA 4M6GA 4BINA 2Q7SA 2ODFA 4M6HA 1XOVA
chains in the Genus database with same CATH superfamily
4KO6A 3UMNA 1PNCA 1KOAA 1X5GA 4JDZA 4E42B 2FX7L 5F72S 2BK8A 1U93B 4P2QE 2L7UA 3Q3GA 4EI5A 2ZENA 1E43A 5CLYA 4B5OA 3QJFA 2YRBA 1H19A 3DMMA 5ID1A 4HWNA 2A73A 2WXGA 1OZUA 3P11H 1ZLSL 4J2XA 4M9OA 4HJJH 1WT5C 2KL6A 5ELIA 3ZZSA 2VC2L 3EHBD 2BC4A 3GK8L 5EU6B 3GBMH 3I6KB 2CK2A 3GGWB 1VHOA 4NQDD 1FVEA 2FSEA 2YKLL 5JOPE 2VR3A 3BAWA 3IGLA 3F83A 1OAXH 3K7UA 1EUTA 3SE8L 3K6FA 1T6BX 3GIZH 2C7FA 4GQ9L 2NUPB 1E67A 3WIAA 4UZSA 3ZE2E 2RHEA 1XCQB 5IIEA 4WHTA 2NNCA 4FXGA 4ANUA 3O6LL 1RPUA 5IF0A 1B0GB 3O8XD 2QHLA 3VXQB 3HCVB 3HKFA 4R4BB 1JNNH 3Q8EA 2FE0A 3FQUA 2VDKL 4AYBA 1N71A 1BJ1J 1DLHA 5IESL 1NM4A 4YX2L 1UXWB 4R3SA 5B4MC 4JZJA 1CIDA 2G5BB 4H8QA 1HCZA 1DQQA 3VI3B 4A2HA 5JHLL 4RVBA 1U42A 4HUUA 1YPZF 3EADA 1OTSD 2J72A 2VM3A 5EBLA 4O58L 4W68A 5F7FA 5FLUA 3VA2C 4XCFH 1XOVA 1XFOA 2F1BA 3HR6A 5ADPL 5EEZA 2X2HA 2FX7H 4WDIA 3HRZB 4HXAL 5IREA 5GZNA 4WI6A 4O02H 4R83A 3PJNA 1H5BC 3Q5TA 2NSXA 2C3HA 2NNXA 3FUEA 5GRJH 5TQ0L 2BSCA 1OSZB 5ECGA 3ZE1B 4F9UA 3B7YA 4GLRH 2BVTA 3BSZL 5CCKL 2ZUQC 2VC2H 3GK8H 3I9IA 4YIQA 4WFHE 5LGHL 4OCMC 1IAMA 4MZ3A 2YKLH 5KYUA 4JHVA 4H8WL 4Z7QB 5JPMC 4BH8A 3SE8H 2HWZH 1AR1C 1XSKA 1FG9C 4FKEA 4GQ9H 1KG0B 5I0WA 3FCGA 1KDJA 2Y36L 3G6DH 3UPRA 3JWDC 4H0IA 4NN7B 3HFFA 3O6LH 3STLB 2XACC 4YEEA 4YQXL 5KAQG 3NJGA 4XNHB 3A24A 4XNZB 4EI5B 3ME0B 4P2OC 4GAYA 1SF3A 2VDKH 3E38A 4EAEA 1XEUA 1Y6KR 3DMMB 3UY5A 3T6XA 3VARA 2AFSA 2XVLA 5IESH 3ZHFA 4LQGA 1ZKAA 3AREB 3GS7A 2E6PA 4YX2H 5EIIB 2GTZB 4R8FA 3QUYA 1NE9A 3EYQD 1IFHL 5JHLH 2VUYA 4LPXA 5MEND 5SX4I 1FVEB 2UXTA 3BZFB 3OAZK 2I7OA 4O58H 5E1IA 3D2TA 3VXUD 3RBUA 5CNPA 3EH3B 3ZDXF 2QQQA 2VDPH 1M53A 3BD5A 5F6IB 3EAKA 1QHPA 2IWFA 3LDBB 2OI9C 4HXAH 1WTGT 4FXGB 3B83A 4PY8I 4DUWA 2J4WH 3Q2CA 4B27A 3U4EA 3VXRB 4LSVL 1JDDA 3P3UA 5DMGD 1A4CA 5TQ0H 1AIFA 4G7SB 2XXCB 3A23A 3FQUB 1ZIAA 3CHOA 4RDBA 3P9WB 1JNLL 2M8XA 2HTLC 4H88L 5CCKH 4MX7B 4PK3A 2YA2A 4L9DA 1BREA 4NC2B 3UTTB 4HS6B 2D2OA 4JZJB 4W9JC 3RU8L 3LPGA 3KYNA 3UBXG 2BZCA 4N2NA 5LGHH 3W81A 1G9NC 1XH3B 4AEFA 4P46D 4H8WH 4ICWA 2D8KA 4HMEA 2PQ8A 4HEMA 4OC3A 1I7RA 1KNOB 5EBLB 2V9QA 2ZW5A 1HHHA 4D0CA 2F7IA 2VSCA 5L8LB 2Y36H 5A2BA 1YLBB 3WHXB 2Z7ZA 3ULUD 2B9AA 1VZGA 4M00A 4LESA 4YXKH 4I0PC 1ACZA 3HAEH 4PCTA 1IIIA 4MMZC 4TM9A 4YQXH 4Z78B 2TSAA 2XRAL 2XN0A 1ZVYA 3IGFA 2DM2A 4C4UA 5C6TL 1Z3GL 1IAOA 3T4AA 3LRKA 4X8JB 1A7PH 3CFDB 3MFFA 3VI3E 2MQGA 1PY4A 1IFHH 1FC2D 3KWTA 1YAIA 5GSRB 4DZBB 1UUSA 4MJIA 1JHKL 1BVOA 4X7TA 5KSUA 2VDML 4D9QD 3DRTA 4MWFA 3QI9B 3QR2A 3O6KH 5DQ9A 4QWWC 2FO4A 3KBPA 2ZCZA 2A0LC 4JCLA 4PG2C 1ZTMA 3UC0H 5IJKC 4CKVX 3VMNA 5E56A 4FCHA 4YXLL 4HAFA 4FNPA 5AAMA 5C9JB 2JCCB 4WI0A 4LSVH 4X0NA 1PZBA 1LK3L 3KAAA 4GAYB 1LE9B 5L2KA 4H88H 3BKCL 4AG4L 3ZX1A 5C92A 1F11B 4NLHA 3ROLA 1BF5A 1B6DA 1GPOL 3P4NA 3L54A 2CDEB 3DJZA 4X7FC 1BM3L 1UKQA 3R19A 3MRJB 1F1GA 4P2RD 1BVKA 4F33A 5LXGL 3NPSC 2OR4A 3KR3L 3PHSA 2OS7A 3AFLA 1KTBA 4V11A 3N06B 4BSJA 2A77L 1AVAA 3C5ZD 5MEQB 3WKYA 4HQQL 1PZ3A 3ARGD 1EHLL 4FKHA 4H4NA 4PWGA 3CZKA 3VD2A 2XRAH 4H6UA 4HJSA 1SJXA 2FO1A 1MLCB 3DPDA 2HKHL 3CXHK 3UTOA 1MK4A 4JFQA 1PDKA 4MHPA 1QSMA 1Z3GH 4FFTA 4OGAD 1EHNA 4DETA 3FB8A 4QDGA 2CIJA 5I1JL 4MJ6B 1JHKH 1IBHA 2CY2A 3VXUE 2VDMH 4GBXB 5IQNA 3FCUB 1TZIA 4ZDHB 5ABAA 5HH1A 2EUIA 2QBWA 1MJ7L 4QOKA 4KKAD 2J1XA 3L1EA 5DJ6B 2F8XC 3WXWL 3NSCA 2XNAB 4XRCB 4YXLH 2JKXA 2EUWA 2E27H 1MAKA 1A3QA 3QQXA 4AIXA 2CJUH 4BWTA 4BGDA 4PGJA 4WCYH 1W6LA 5SV4A 2WVVA 5EV7A 3RZCA 3EFFB 1XR8B 2EIKB 2CJTA 4AG4H 1T2QH 5AG6A 1GPOH 4GP8B 2MCPL 4ZW3A 3FRPA 3SO5A 3MFFB 1BM3H 2FRGP 2EUZA 4HXBH 2Q0ZX 3EYSL 1CPSA 2YSTA 5LXGH 2IBBA 3SI0A 4MJIB 4XVUC 4MCSA 4KC3B 4MYPA 1U58A 3W38A 2Y2WA 1YJDL 2X4RA 4FYTA 2PCYA 4DPBX 1UXSA 2A77H 5DD5H 1CJWA 2FO4B 2CJSA 1L0YA 1EHLH 3QRLA 4WWKA 2XQYG 1A7NH 1CT8A 1XGQA 2ID5A 2ZX7A 3PWPA 4P59L 5FGBC 4ODBD 4ZOBA 4U2YA 1Q9OA 2HKHH 5C3IA 2WXJA 4UQDA 3NJXA 1CTNA 3BQUD 4KK9C 2I26N 5JIKA 3T6QC 2O1AA 3KEHA 4QT5A 3P4NB 1IMHC 2R1YA 2CNYA 4D9QE 1MHCA 4M03A 5CN3A 5JXAL 4P4RB 4JD6A 1BVKB 2V9RA 4FD6A 1Z2LA 2X28A 1WS7A 5DZAA 1MJ7H 1IGCL 5LG1A 2CPUA 3UBXI 4Z3TA 4JO4L 3F6IA 2VI7A 4AYID 1X5HA 3EDDA 3RURA 3WXWH 3WIHA 4UBRA 1R5VB 4X99A 4Z7NE 2Z4QA 4TSBL 1E2VA 1H0DB 5TF1H 3F7PC 3BUTA 2X3BA 2AEOA 5IMMB 3CZNA 4AGPA 1IAIM 4JFQB 1RZQA 4G1MA 3QARA 3TZVB 5LLIC 1ZK9A 5E8NA 4KTGA 2MCPH 3H9HA 4CW1B 3H8EA 2A74B 3PB6X 1BMWA 4JLYA 4HHAA 1TNNA 3FB8B 3EYSH 3TT2A 4HIJB 4Q7AA 2PR9A 1M7UA 1WAAE 2R69L 1YJDH 4HC1A 5I9QC 1E8ZA 5H4ZA 1J8RA 2BSBA 2V7HB 3E1F1 3SPVB 3QAQA 4JAMA 4QOKB 3KGUA 1KGYE 3GXUB 5HGBB 3FBUA 3S48A 3CX2A 4P59H 1FZKB 2P80D 2Y07L 3G04B 5DZ9A 3VXSA 1J5OH 1CBVH 4RS2A 2BY2A 2FQGA 2JWYA 4LCUA 4QYAA 5JIPA 4OW6A 2BCKB 2M26A 4XCNB 1UZ6F 2ADJA 3K8MA 4ZFZA 2XY1A 5HVWA 3GWJA 2YZ8A 4XN4A 1JWQA 1M4GA 2ICWI 1BXXA 4HH9A 2Z92B 2WKLA 1OT1A 4JG0L 4MMOA 3JVGA 2QR0A 5JXAH 2GLJA 1MIEH 3GPEA 2H4EA 1ODAA 3LN4A 3VXMD 4QRQA 4QXUH 2UVEA 5H94A 1AC0A 4GS7C 3RKDD 2ZXCA 1AY1L 4ADGA 2G3ZA 5BUPA 1IGCH 1UXSB 5I1HL 1Y6NR 1M71A 4HT1L 4JDTL 4JO4H 1IT9L 3KS0J 4M3SA 3O2VL 4PRDA 4QRRA 3NSYA 1J0KA 4BJLA 3WEMA 4G7RB 4TSBH 5A27A 1JV2A 3D30A 4XZUB 1YEEL 2B0SL 5F9OL 1Q9OB 3O3BB 4MB3A 3G5ZA 3W39A 4G6AD 5E4EB 2HP4A 3NJVA 5INDA 3FYNA 4RFNC 2WTOA 4LPYA 1ERNA 1PL3A 2AK4D 3K4AA 3NT0A 1QHQA 4L4TE 5D2NE 2N59A 3LEYL 4R2GB 3IS0X 2C1CA 2YLKA 1MHCB 2ZONA 4YZFF 4HLZG 4AM0B 1NCGA 2R69H 2APXA 3BEWA 3WO4C 5J06A 1TZHB 1FO0B 1MCKA 2H1PL 3VSVA 1RMFL 1FCGA 2WZ6A 3P2HA 4ZMWA 1U92A 2NYQA 3X1BA 2ANPA 3MA7B 2MHAA 1X6NA 3WKQA 3QEHB 2GK2A 3O4LB 1EXGA 4EQ3A 2LAGB 3OKOA 3CPLA 3N3EA 5F0LB 5GS1C 3CJJA 1UUNA 1DANU 1TDQA 2XHNA 1R3KA 1KULA 2YA1A 1JNJA 2XIIA 4PXEA 2FR4B 1HWGB 4HBCL 2VDLB 5DK0B 5E8NB 2VAJA 4JG0H 1KGIA 3CIAA 4PJDA 4HHAB 3C09B 1I1AA 1HXYA 1H15B 4OF7A 1NCCL 1KGCD 1KJMB 5H37G 4JNXA 1KJVA 1JERA 1KB5H 2QECA 4WHCA 3Q48A 3ARBD 5HHQA 3R0NA 2DAVA 1AY1H 5T8IA 1BA9A 5CIPA 3CGTA 4JDTH 4RMRA 1IT9H 1NSNH 3G6AA 4DT2A 2ZW4A 1KLUB 3DGCR 4OUOA 4ONFH 4BM7A 3R96A 3SOBL 1AZCA 4P5MA 5GSVB 5I8EB 1YEEH 3EYOA 5KVFL 1NDMA 1JS4A 2B0SH 2DQFA 5F9OH 5F9DC 5LN4A 1M1XA 2B39A 2J8MA 4LHJB 3UG4A 4E9YA 3KGTA 1JIBA 3HR5A 1KT2A 4DP2X 1AZRA 2NXZC 3PNRB 2WW8A 3FT4B 4ZFZB 3B7UX 1INQA 2MCG1 4HH9B 2NW3A 3VTTA 2Q04A 3QUKA 3QJZA 2QR0B 4UIKL 3U1PA 4OIWA 2J55A 3ARZA 3R7QA 2V17L 5KN5A 5HJGA 5H94B 1JL8A 4KVME 5EOCH 4MCMA 1OM3H 1RMFH 4W81A 3TP4A 1SNRA 1EANA 2B59B 2HH0L 2YAMA 4QO1B 3ZMRA 4PJ8A 4UT9L 4PRDB 4QHKJ 2X1XR 2SEBB 1R17A 3LAFA 3NCCB 1N6UA 3OHXC 4HGWA 1T83A 5B1JA 3OGCA 4PMEA 2DPTA 2EQDA 4BFNA 4ELME 4JZ0A 3T1WA 2CDFB 2D3JA 3G5ZB 4ZUTA 2BNRA 4HBCH 4P9HC 4DP9X 2Z10A 3WCYA 3W57A 3LWUA 2BHFA 2B1AL 3D07A 5HYQA 3SB3A 2G5UA 1NCCH 4JRWA 3RFZB 3QIBD 3KBFA 3N5FA 4XAKD 2Y6SC 3SOTA 1K4JA 5EC1B 4X80L 3MACL 5B1BB 3N85L 4J8RA 4PJ7A 4XCEA 4ZNEA 1QKZL 4B96A 3PXLA 1S78D 3N7ZA 1IIKA 4NF1A 1QSEA 2MHAB 4IBSA 5KVFH 4UT6A 4ZW6A 4N90D 1MCIA 4N20A 4PLKD 5FW6A 3TIEA 4PLNC 4FQIL 4YSSA 2XWZA 2WYRA 3FPYA 3P73A 1D7DA 1WT5A 5J1QA 5E6RB 2ETWA 1XF4A 2AK4E 1R3KB 2DIAA 4FXLA 3C6SA 3CFEA 2VLRE 1UD2A 4TTGA 3QUGA 4MCNA 4PJDB 3FOMA 3MA9L 4F8ZA 4J3OG 3QISA 3BUBA 4IKNA 4UIKH 4APQC 4JFVA 3HB3C 1DEEA 1M7DB 1XX9C 2V17H 3EYFA 3QUZB 4TNFA 2K5TA 3TT3L 1A9VA 4F0XA 4G8GA 4NGHH 3BZDA 4Y19D 5DEGB 3CFIC 2HH0H 3B2MA 1NGWA 4UT9H 1UFGA 1BPLB 4LASL 3CXFA 4JMXA 2X12A 4P5MB 4YAQA 4ZMYA 4R7NA 3TVMC 2GEEA 5JA8B 3ABZA 3OLGA 2DQFB 4DUKA 4WV1C 5C0AE 3TOPA 5AG9A 2PWHA 1KEGL 2JTYA 3HR5B 2F54B 4M5TA 3RWJA 1KUVA 1FGNL 3RI5K 3Q6GL 5I1LA 1HDUA 5DJ8B 1CL7I 1INQB 2B1AH 2O5XL 5D2LA 1KGCE 3BVXA 1WICA 2K45A 5ESVA 3QUKB 4JFSA 4PJ9C 3ULSA 3V6OE 1PG7L 4G9FA 3NIFB 4Z7WF 1V7MH 4KKLC 1DSFL 1IBZA 4GQRA 4X80H 3MACH 3N85H 1ZLUH 2OMUA 1LYQA 2QPSA 4WZ9A 1H5BA 1WFIA 1QKZH 3VRJA 4EVNA 5EIIG 2X6VA 2OR9H 4HPOL 4KLWA 3PBBA 4TNWK 2OX5A 4LPVA 2ZX8A 4H25A 5EC2A 3RL1A 4B11A 3BWAB 4DVRL 5C2UB 3OGCB 5E24E 4K30A 4QCIB 1YQEA 1OSPL 5CEXA 1K85A 2ED9A 3C6LC 3TO4D 2X10A 5J89A 3VI4B 3MKKA 1K6QL 3R9FA 1AGBA 5CD3B 4CMHB 5AYTA 1BBDL 4E5XG 3KXFB 5DXWA 4LFHD 3S96A 1MJ9A 1BVNP 3JWNG 1Q9WA 3TN0B 3VFUA 3VXNB 5E2TL 3T8XB 3RI5F 2MOGA 2Z35B 4V2CB 3VX0A 2WSAA 4Y7MA 4FLSA 2WZ5A 4Q6IB 4X4XB 4Q58C 1SQ2N 4F92B 5E7BA 4J8RB 2H32A 4XCEB 4CJ0A 5FUOL 1W15A 4P2OA 3ZQWA 3FU5A 3L9RA 4H8HA 2FLRT 4LASH 1KTDB 4QRPE 4X9HA 4IUSA 5FEBA 3KPLA 2ZP9A 4DGUA 4PYGA 3ULAB 4OGQC 1E4XL 2C4XA 4OZFA 4XOEA 5FYKD 5CUSL 1FGNH 2HLFD 3L4CA 2CAKA 2Q4YA 3CFCH 2DQIL 3Q6GH 4TNWF 3C6SB 2O5XH 3CFEB 1KXVC 4F7EA 4W4OC 3SGEI 1PNDA 2VSMB 3AQYA 3V5KA 1G6RH 3BH9A 2ENSA 4PU2A 2YAPA 4LLWA 3EYFB 1N10A 5T3XL 1DSFH 3DIDA 4PJXB 1A6WL 4HFWA 1F97A 1W0YT 5CSBA 1NGWB 4HPOH 2Y25A 2E46A 3NK3A 3GYAA 2HUHA 2LVEA 4HKXA 4AIOA 3UACA 4S1QL 2VABA 4NNPL 3K4ZA 4NO3A 2W95A 2J9AA 2PJCA 3FSWA 1OSPH 4H8WC 4X4KA 3SKNA 3BPNB 3RWJB 5D71H 3MLSL 1K6QH 1PX4A 2B20A 1RUQL 2HFFA 1BBDH 2IAMD 4LCCA 4GI8A 4LSSL 5ESVB 4Z77A 3ULSB 2YGVA 4RISL 3W6SA 2Z6FA 2W88A 4FFVC 4G9FB 3ZR6A 4Y19E 3VMPA 3C9NA 3UH8A 3GSWA 2X53A 3IK2A 1OE1A 3WJLC 4MMZA 2A4EA 5DZVA 3LRGA 5FUOH 1H5BB 1NCUA 1OCWL 1NPUA 2XG5B 3TU6A 3VRJB 3WN5B 3ZTJG 1WD9A 5KSVA 2OX5B 4H25B 5EC2B 4YO0B 3IDJA 3T8VA 5PCYA 1G4RA 4HNYB 1E4XH 4F57H 2PP7A 2NY2C 4DQOL 2ZUQB 1DJSA 5CUSH 3DX6A 4OJFL 2DQIH 5DCCA 4IMKC 1EFQA 1OLLA 3MLVH 4X9GA 1YHPA 1AGBB 2APVA 5D7KE 3SDAD 5JPMB 1JRHH 3U7AA 2ZWSA 2OMTB 2X7BA 1RQ5A 3L5XL 1XB3A 2C5DC 4OQ1A 4Y8DC 1I75A 5B1KA 3PBEA 3JQOB 4UQIM 2JLLA 1DN0B 5IJKA 3GINA 4PGDB 4HIIB 4PJGF 4MJ2A 3ZK0A 1YEDB 4EOWL 4XP5H 5C0ND 1EX0A 2UUDK 3FT2B 1K5WA 1MJ8L 3BIKA 4P2OB 3L9RB 3V4VB 4S1QH 3IJ8A 1NFKA 2R0ZL 3KPLB 1MCLA 2B3RA 1BF2A 5DS8A 1IGFH 1NICA 3U1SL 1VIWA 3M17A 1O6VA 1SLXA 3FT9A 4OJYA 5IB3A 1F5WA 5HVGB 4P23D 5DZPA 3UDWC 4XPDC 1EWHA 1PCSA 3QQ4B 1RUQH 2A6IB 3IU4L 4KNUA 3NZHH 4HWBL 4F7EB 5BRZE 5KSAC 1FLTX 2IDUA 4HJGA 2IFFL 4ODHL 2UY6A 4LDOB 4RISH 4TUJA 3WTUA 3U46B 1KIUB 1KTKE 3BVDB 3QFJE 4LLWB 3OC5A 5DC2A 1BXAA 3HZMB 2BP8B 4HFWB 2OI9B 3QORA 1OQOA 2UWEF 1YYLH 4P06A 1HZKA 3LRSB 4FQ1L 1OCWH 1FVDA 2FATL 4I87A 4IKJA 1INEL 2ZSVA 1FG2A 3GFUA 3SCMD 2OCCB 3WNNA 4HKXB 1X7TA 4G6FD 4NKOA 1ZK5A 1FF5A 4XCYA 5IROD 1YREA 2VABB 3ZMEA 3ZTEA 5FYKE 5ACZA 1JWSA 1R75A 1TEYA 4OJFH 2VW6A 3FUMA 2E7MA 2XJKA 1DQLL 2BWDA 4N0FB 3CZSA 2DLGA 2FL4A 3O6FD 2HFFB 4EFDA 4QXWA 1QUPA 5DFWH 4Z77B 3RAJL 3D2UA 4F8NA 2R7EB 1NM9A 3C9NB 2BVPB 5HGGS 1NC2B 2PCPA 2JJSC 4I0PB 5JW3L 4EZMA 4EOWH 4NGMA 4NQSB 1DQIA 1MJ8H 2FWSA 5C0CE 4DERA 3NBNA 1IGIL 1V54B 3L7EB 1A66A 3B34A 3KPSA 5D5MF 3J07A 5J6HB 2R0ZH 4CRPA 4UFVA 3IBOA 3U1SH 4K5OA 1TVHB 3US9A 4DSYA 3ABKB 1HEJC 2Z0UA 1E27A 2DEYX 5LXVA 3UTPE 5L4JA 3CLEL 2IBZX 4HWBH 5FKPB 4LSRH 2IO5A 2VDOB 3HC3L 2IFFH 4ODHH 3R9EA 1P7KB 4NUJA 2ENPA 4MB5A 2Q8BL 1AS6A 1LO0L 4KK5C 1U8LA 5GGRA 2V8GA 2YC1A 1A9EA 1CVSC 4Q4IA 1S7SB 2FATH 5DJ0B 1INEH 2HKAA 3BIKB 4KUCD 4LP8A 3E2HC 2KDYA 4MNGA 2CCWA 5IQMA 1R5WB 4JZOB 2WXRA 4GO8A 4P3CL 5DS8B 2J8UE 1S9XB 4PJBB 4TPRL 3ULUL 2HKFL 4CMMA 1RH8A 1PZCA 5DI8A 4GUPA 3NPSB 1AMPA 3CBKB 3APMA 3RAJH 4HKJB 4NO2A 4TUJB 4W70A 5SX5H 4A2LA 1YK3A 4HD5A 5ISVA 4J12A 4Z0BH 3U0WL 4KUAA 4CILA 2OMWA 2I9TA 3ZW3A 1LP9A 2DL9A 5G55A 1IGIH 4FC3E 2P8LA 1A7OL 3KJ6L 4MJHA 2YNEA 1KJ3L 3MODL 4NKOB 1H6EA 2LVCA 2P48B 4XCYB 3RGVB 2HPOA 1P7HL 1ZSDA 5IQ7L 3E0GA 1DBBL 2OL3L 5DK3A 1LO4L 1YJDC 5ACZB 5IB5A 4N2HA 1SHSA 1HYSD 5IHHA 3CLEH 5B8CB 1M4KA 1MCRA 3WJJA 4DO6A 2WKOF 4X7SL 2LABA 5DHDA 2R1IA 3WNMA 3IXTB 2Q8BH 1YVKA 1H6TA 3D2UB 1LO0H 2PCPB 5EZPA 3SYCA 3ZBMA 4DPCX 4KHXL 5IB1A 3DOIA 1A47A 1THAA 2PP8A 2ZUUA 1AHKA 1E4WL 4Y16C 4UYPA 2EILB 3KPSB 1W16A 3LKQA 2VXSL 4LHUA 2H0PA 5CGYD 3H85A 5BJTA 1NBQA 3CDZA 2GT9B 3Q5OA 1F4WL 4TPRH 3I02A 4OZ4B 2HKFH 1ADWA 1CFQB 5SV3A 3TA3C 1E27B 4DNLA 2J8NA 2WIIA 4KROC 1J0ZA 4JB9L 2WSDA 3FCTB 3ZHNA 1HJBC 2AVFA 4CS0B 3Q2WA 2EYRB 1TF4A 3B1UA 3C5JA 1MW1A 2R1WB 3QEQD 5HHNA 2G60L 4PJ5E 1ZLVH 2EDNA 2O53A 1I3GH 3RPKA 4R3KA 4HWEL 1FVCA 1IZJA 3F7VA 4RFEB 2EXWC 1J8HA 3TV3L 5KYXA 1IJ9A 2F1AA 3W91A 1LO2H 4HSQA 1A9EB 3Q8CA 1OAZL 2V9TA 4AX3A 3ZE2F 2FIKA 3JT2A 1A7OH 3KJ6H 1GW6A 3KHQA 1KJ3H 3MODH 5TE6L 4MNGB 4XXDB 3KI9A 4JG9A 2VXTL 5C71A 4MFZA 1ICTA 3KPRD 4PFEA 2GPZA 3KDPB 2NSQA 5IQ7H 1YYCA 1TTAA 2OL3H 1DBBH 2D7PA 1LO4H 2E47A 3NRFA 1P4LB 3O3DA 3HE6D 4W9IC 4XMKL 2NZ9D 1CXKA 1SUJA 4YHNA 2Z1KA 1BQKA 5T5NG 2UXFA 2C3VA 3GUFA 4OLUL 2VXUL 3KYKL 5IHZA 2WAQA 1PZ5A 4U1MA 4X7SH 5BS0B 2VL5A 4A2DA 3GSRA 3NIGE 5KG9A 2F0CA 1Q94B 3UX9B 3EYUL 3RZAA 4OZHA 1A6ZB 2E6JA 4KMQA 4M48L 4O2CA 4UIMB 1S46A 1JK9B 4U9ZA 2OP4L 5T1MA 2OMWB 4KHXH 2LQRA 12E8L 1HHIA 1E4WH 3HTLX 1SN5A 4PRPA 2X44D 5GS1A 3QZBA 4ZSOE 5C0GB 1OWRM 2VXSH 4Y2DA 4XO3A 2YGWA 3IXAA 1NCJA 3MRMA 4PHXA 1X7SA 4P4EA 1F4WH 1ZSDB 4EI6A 3BPCB 8PAZA 5IB5B 1HKLL 1E4HA 4JB9H 5E08H 1C8QA 3T3MB 3KVDD 2J43A 1MWAL 2GCYA 2YQ3A 4ADJA 1QEWA 3CH1B 2JKJA 1FAKT 2G60H 4OM1L 3P3TA 3C60D 2V37A 5E9DA 4HCRL 4QJ3B 3TV3H 4DF9A 2YXWA 2XJLA 1EFXA 3IPBA 2PE3A 2BSSB 3EF4A 3IU1A 4MD5B 1OAZH 3MDJA 1EVTC 1JPTL 1F2QA 1GOHA 3FHQA 4JQIA 1MFAL 3FYIB 5TE6H 1TVBA 2YNCC 2VXTH 3ETBF 3LEXA 3WHE1 3U6RB 4KORA 2AQSA 3LXBA 3T8MA 4MQ7A 1AP2A 3CDZB 5BJTB 4XMKH 3I02B 1KCWA 3TBVA 1RJZB 3QFDB 2WIIB 4N2OA 4OLUH 2VXUH 2K3HA 3IDXL 1FFRA 3A4AA 3LACA 1HWHB 1KTCA 4ELKA 2CUIA 1S2EA 4G8AC 3EYUH 3UTSD 4QXTA 1A4JB 1JGEA 3QJUB 1J8HB 4M48H 2VDQH 3HVDA 3P02A 4JFUA 4JM4L 5C09A 1KIRB 2OP4H 4X6CE 12E8H 5CN1A 5CP3A 5HPMA 1WISA 4I2XE 1E40A 4Y5VC 3MLPA 4Y9EA 1BQ5A 3IN2A 2XIDA 1N26A 1OAUL 1DYZA 5AG5A 1UC6A 1RLBA 2DIBA 1WBZA 2NSMA 3MLYL 4GO9A 4RFNB 1NFIA 4WFED 1NFDA 1HKLH 3IFEA 4F27A 2EIEA 4JMNA 3AXLB 3UIYA 1PZ5B 4RRPA 1PSKL 4U1MB 4FA6A 3WO4B 3MLZL 4MMYB 4OM1H 2ZUVA 3BVVA 3OMAB 3GSRB 1J8KA 2YMTA 1H8NA 1UZGA 3BDXA 4CAWA 1U95B 3QPKA 2BSRB 4LCWA 1N67A 3O11A 3NJIA 2K9FB 5AOJA 5T1MB 1CG9B 1IFGA 2CRYA 2X1WL 4ZMPA 1Q2DA 3O3EA 4HG4J 3VWJC 4XGZA 2YPLE 3H4HA 3KPRE 5GS1B 2UX7A 4Z7UE 4YHLL 2OH1A 4KRPC 4HOMA 3X11A 1BQUA 2NDFA 2HJLA 3AXHA 2NYYC 3S37X 4GPVA 1HE8A 4IEFB 5AEAA 2UZXB 3B7SA 5C07B 4JRXB 1ET8A 4APQA 4EZJA 3IDXH 2GCYB 3VH8G 1QEWB 3VJ6A 2VH5L 1L5GA 1UM6L 5E9DB 4QF1A 4L05A 5DYFA 3RHWK 2XPGB 1ELLP 4JM4H 3JVFC 3H3BC 2X4UB 1V55B 2BNQB 1O9WA 4HZ1A 4XI5D 3MROB 5FYJE 3WUWA 4BQ8A 5EDSA 5EOCJ 3TVMA 5IKCA 4FNLH 5CKAA 2PVVA 3KQXA 3VFRB 1OAUH 1TVBB 4PWJA 3Q6FA 3LEXB 1ASOA 2NXZB 1QYGL 3Q01A 4ZFGH 3LH9A 4MXUA 4NSQA 4PJ9A 2XZQL 1TOXA 5E4OA 3P77B 1NCOA 1HDMB 2W91A 1VKXA 1PSKH 1XF5B 3MLZH 1CK0H 4YDVA 1H3GA 5I0XA 4IHMA 3CXDL 1RK1B 2X9ZA 3RDTB 3D8MA 3II3A 5IBTL 4QXTB 5IFJB 3BD3A 4YHIA 3MN8A 5C09B 3FTGB 4QRTA 2CLRA 5CJBA 2V8LA 3OHXB 5FK9B 3GHPA 2FZ3B 3P0VL 4CVWA 1YMMD 3UZVA 2RC4A 3QH3B 1OOWA 3RHWF 4YHLH 4YHPB 3C6LA 4TF4A 3DNKA 4FTVD 2A7BA 1WBZB 3T3PE 3BWUF 1D6VL 3VH9A 1NFDB 1X5AA 4Q14A 1BX2A 4LOUC 3NACH 4ZMVA 2ZEDA 3JV4B 5HDQH 3MFGB 3UEZA 4EQ2A 1EJFA 3MLUL 5H35A 5JIQA 3V8CA 2WXKA 5ENWA 4LVOC 5L4FA 4KDTA 1JZ3A 2XQ0A 5ERWA 2H5MA 3P2TA 5K1VA 1P84K 3RL2A 1BZOA 2OMBA 2JI3A 3V6FA 1WZ1L 5IBLC 2FL5A 4GG6A 3VD3A 1S9YB 1XH1A 5JHLA 4N24A 2I3CA 1I8IB 3O3EB 2DWDA 4XGZB 4BFOA 2VWEE 1ML0A 2Z0BA 4JJHA 4YSTA 1QYGH 2X2IA 3X11B 4M8RA 1I7ZB 4W4OA 3AROA 2GAZB 4U1HA 3LH8A 3NDYE 2IMOA 2XZQH 3AT0A 2BO9A 2AQTA 2QGCA 2YRLA 2BFGA 4Z95L 1L5GB 1T7VA 3CXDH 2H8PA 4UZUA 4YC2B 4CVZA 3D68A 3HI1B 4BCXA 1LK2B 3FSVA 4IRSD 4X4YA 3BSZA 2K8QA 3P0YL 2DDQL 4YL9A 2EC9U 1WA0X 5EA0L 2E9IA 2GFBA 2QPEB 4B9IA 2VJXA 3GSXB 5JQHC 3RA7L 3P0VH 3TVMB 1NLBL 1H9VA 3ZXAC 2WN3A 4WV1B 1AGCA 1RK0B 4N26A 4XXWC 5L8JB 3REVA 2NW2A 3LQAH 1WBYB 4W9DC 3Q6FB 2C4FT 2C8NA 4C83B 1D6VH 4NQEB 3QE5A 1QSNA 3D1MC 3FFCA 4YDLC 4N6RA 4LIQL 3ZDWA 1Y9KA 2CO3A 1BCIA 5G2NA 3HAEA 2DJSA 4O02B 4S1DC 3MLUH 3AADB 4L1HA 3UG5A 4PWHA 1J05A 4KXZI 3VFSA 2A6JA 1G1YA 3MBED 1ETA1 4HKBA 1IEAB 2BVUA 3WJLA 5BZDB 2BY3A 4BSWA 5DSCA 1WZ1H 1IAKA 2WMPB 1SDDA 3HG1B 4WWPA 4LEOA 5GRYA 5F47A 2VN7A 3GMOA 2VC2B 4QRTB 4HS8H 3JTSA 2IH8A 5E6UB 3LV3B 2NMSA 5DDHA 5DS0A 1QFUL 1WC7B 1YRKA 3NSFA 4Z7NF 4UOW1 1KN2L 3C6LB 2GBUA 4RZCB 4IMKA 2R2EA 3DXAE 5TQ2L 1MQKL 3FFOA 5JMRA 4QYOA 4BK5C 1BX2B 3KYOA 5EU6D 1PG7W 3TBYA 2BWIA 2L8AA 5DFTA 3B6SA 4Z95H 5H35B 3I75B 5ENWB 1ADQH 2G9HB 3ABGA 1I9IL 5D9SA 1OV8A 1WO2A 3RL2B 5EEWA 1L3NA 3P0YH 2DDQH 4G8EA 4PI2A 1HU8A 1NKGA 4WW2C 4EXKA 2FVGA 2FL5B 2B5IC 1WGVA 1URLA 3RA7H 1I31A 2FYYB 1CG2A 5EIQA 2WQRA 2E7HA 1NLBH 4KU1A 3OWCA 1TLKA 7CGTA 2VLJE 4FTVE 4G5ZL 3G5YA 1AE6L 3LZPA 5K9QG 4A1RA 1HHKA 1FDLL 1ZS8A 4A66A 5CAYB 2F7OA 43CAA 1QR1B 3QAZC 3UDWA 1KZFA 2VDPB 5FB8A 6PAZA 3OKEB 2XTJE 3B5HA 4GAGL 5KSAA 4LIQH 4Y1TA 3IJSA 4YHOL 3VFPA 4XAWL 4V1DE 1PCAA 2W65B 4LVEA 4OBRA 4NFDA 4QXGL 4S0SD 4F7PB 2ZWLT 2PJ6A 4JKLA 4CYPA 4ZY0A 2W9LA 5D8JL 2F53A 1T89C 1JK8A 4ZUUA 4LGSB 35C8H 4D9RD 3K81A 2APFA 4NQXA 5E1GA 2CBPA 2C7UB 2CO6A 4X5XA 5E8OA 2ADYA 2DEXX 4PRAA 1U8NA 2XV2A 2VAAA 4X9BA 2ODFA 4C4KO 4JY6B 1QFUH 4L8CB 1AKJD 1AGCB 1KN2H 2I9LB 3REVB 1BYPA 5JZ7D 1S9VA 5TQ2H 3UXFA 5CMAA 1MQKH 1EAOA 2Q86A 4KI5C 3MREA 4GINA 3U2SA 2EACA 1T6WA 2WWKT 3FFCB 3O45A 3QXAB 4N6RB 1EQWA 4ELDA 4X6DB 1EAPA 1I3RB 3HAEB 2YRZA 3B5TA 4PEEA 2DYPA 1XQ4A 5FO2A 3LZNA 1XZ0A 2V2TB 3U2JA 4U6VL 2JJSA 1VACB 1X7QA 4YVNA 5HVHA 4WWOA 5KUMA 3S35X 5DEFB 3N55A 1XBRA 4ZMXA 1OM9A 3SEPA 1IAKB 3LPOA 1N9PA 4LEOB 3GMOB 3PJLA 4G5AA 4KKCD 4EI5D 4AGMA 2E0PA 3ALPA 1NCNA 3ECWA 3NEXA 4G5ZH 3DMMD 1AE6H 2NY2B 2AXJA 3WNIA 3HBGA 1FDLH 2XN9E 3X1GA 4TRPL 2KZBA 2R2EB 3D50A 4UI2A 4GAGH 2PJAA 5FOJA 4QYOB 5CF3A 1SXBA 5LO7A 1EAQA 3CVIH 4XAWH 5KVEH 1DQVA 3B6SB 5C0FA 5D8JH 2B4CL 3APCA 5D9SB 4O4YL 4AY0A 1XEBA 3I9SA 1B88A 5IR1A 3KG5A 5EIVA 4NLAA 4CAXA 5D7IA 3H9SB 2PPAA 3VXRD 4XMPL 3GQFA 3DNSA 4MQSB 5KVDE 4Z7VA 2EIDA 3WGUB 4NM8L 1FL3B 2WYIA 4MFQA 5B1AB 1VPOL 3BH8B 3T77B 3G5YB 4N5ED 3CU1A 5ANMA 4L8AA 1HHKB 2WKGA 2EDOA 5IFAH 1VFOA 1FNEB 5D6DC 4JO8A 4JO3L 3WTVA 1D7BA 4ENED 5KSAB 3T0VA 2Z8RA 3NUKA 1F6FB 3VFPB 5IVZA 1KBBA 4N1EA 5F1IA 1OW0A 2PWFA 3BDYL 3EZ8A 3RVXD 1DR9A 2LU4A 4U6VH 5KBDA 2VXQL 1XIWC 4GRLB 2CTCA 3ILPA 2F53B 5DHMC 1JK8B 1C5BL 2H9GA 3IPFA 4NQXB 4JZNA 5ADOL 2CO6B 5GZND 3IDNA 5HVFB 3NFSL 1U8NB 2DIEA 2VAAB 1J7VR 2NT0A 3MGOB 4PCKA 3ZYJA 4PJCF 4A7GA 2VDMB 3OQRA 2BVOB 2BS8A 3QQNA 5HYJA 3WS3A 1FNAA 4DK6A 2ZXGA 1S9VB 3NSDA 4TRPH 3Q0HA 3DLQR 2Q86B 1NGYB 1ZTXE 3OF6A 4TSAL 1MXDA 1YMHB 4ZX3A 5A6LA 5CSZA 2DYPB 5E5MA 5JORA 2RALA 3ZKMC 2B4CH 2X0VA 2XKNB 3H9ZA 4OIAA 2JE8A 4O4YH 5EU5A 4D9RE 2DM4A 1X7QB 4EIBA 5KSBE 4PRIB 3MV8A 1YUHA 4TMPA 5D7LA 5AOIA 3PUUA 3FTWA 4XMPH 3AT8A 5SX4H 3ESVF 3D4UA 3SY0A 4LXFA 1A6PA 2CIKA 1CFVL 4PWKA 5HTSA 1PKQA 1EZLA 1VPOH 4F24A 2BHZA 3C12A 5C0DA 4GT7A 4B50A 5IQOA 2B3VA 1UD5A 4ZQTA 4R9MA 4JXRA 4JO3H 2AE6A 1CC3A 2OJEA 2QVIA 3AQDA 4MZIA 3QUYD 4K8RD 1I3VA 2RD0A 1SMDA 4JFTA 5K9QI 1KN4L 4JVUA 2YSSB 3BDYH 3Q9QA 5LGKA 3VG9C 2VXQH 3MQIA 5T1KB 3U79A 1YY9D 3T6WA 4X7EC 1JWUB 5EZOL 4OC5A 5ADOH 4KKQA 1CF8L 1I85C 1QFWI 3E2HB 3V7MA 3ULVD 3MRFA 3RWIB 2EDWA 3S2AA 2BSTB 4ZUWA 5HD8C 4ONUA 3ESUF 2R69A 4EN3B 5IV2A 1XEDA 4ZMNA 4XNMA 5E0QA 2VZ1A 1MREL 1AG6A 1OGAA 4KPHL 3ATFA 1H3PL 4FD0A 2Q4VA 4GBXD 2ZUXA 3EDFA 3FC8A 3RPIA 4UFWA 3S5ZA 2HAZA 3ILPB 2WB7A 4Q9RL 2H6OA 5HJ3B 2JJWA 3WELA 4E9XA 2XBZA 4JZNB 4JY5L 3IDNB 3FH8A 1JOIA 1QAWA 1PQZA 5GRUL 1CFVH 4CN6A 1NMBL 2NX5A 4KJYA 4ZUSA 3QAHA 5HYJB 3WEAA 4W1TA 2R98A 1QFHA 5AG7A 3TTYA 5CPAA 1E3FA 2GBTA 4DEPC 2YD3A 3KKWA 3BVNB 4JDEB 4QRUA 1YSJA 3GMQA 2UYLA 3QK0A 2NY4C 1KN4H 1EK3A 3FB5B 4KKBC 4MJID 1G7MB 4HKZB 4Y1AB 5CSZB 5JQ4A 4LL4A 4XHJD 5E5MB 3T0EE 5JORB 1W8EA 4PD4J 2ESVA 4HIHB 4N2FA 5EZOH 4MVBD 3LVTA 1G7IA 4QHUA 1BHGA 1E50A 3MV8B 1YUHB 2PTUA 5D7LB 1BZQK 4Y16B 5KBPA 4HMCA 4RX4A 3EFDL 2Q10A 2YNCA 1BZ8A 2G75A 3QXWA 1EDYA 1L7IH 2FBJL 2ZCLL 4OLYL 1CURA 2COVD 3H56A 5FFOA 1GGCL 1KGUA 3MV9E 4OKOA 4F7CB 1DVXA 5SWZE 5LWYL 3Q2NA 5L2KD 5FO9B 1SXAA 3T2NL 3TA3B 3U48A 1U30A 4KROB 5JDSA 4PWFA 1MREH 1ELMP 1OD7A 1OCOB 1RZPA 2PCFA 4RETB 2MTPA 3WAKA 1SEBA 1Z9SA 3PF2A 4KPHH 3EFOA 3II1A 3L6FB 1JCVA 1H3PH 3LEVL 3D0AA 4M1GL 4NO5A 1SLVA 1UQSA 2GJ6B 1A25A 2P8MA 4Z76B 5B39G 4WEMB 4LLMA 5I1AB 3NH4A 4Q9RH 3DSNA 4Y5VA 5IFHL 5EG6C 1BQLH 3UROR 2X2JA 4OF3A 4FQXC 4JY5H 4CDGC 1CFNB 3OJ2C 3BO8A 4PGCA 1PLAA 4CL7A 3EIFA 1Z0MA 2HVKA 3PAUA 1MI5A 1NMBH 5GRUH 4EZKA 2Z31A 5IEKA 2AAVA 2YD0A 3ZDYB 2HMID 1QTPA 1LD9A 2R23A 2VR6A 1IVTA 1LRZA 3QJVB 3TZVD 1RULH 4K5NA 3RWGA 1DDTA 4XNMB 1UADC 4OKVA 2OMVA 5HYIA 2CF4A 1FFNB 1OTUD 2OSLB 4QHPA 3IU3A 3IE4A 3IMUA 4E9RA 2ABZA 1OGAB 5IHLB 2IF7A 2N1TE 4JVPA 2HN7A 5F8RC 4LLDA 3O3AB 2W0FB 4ZBGA 5DWMA 4OUUB 3LMJL 4QOKD 4NNXA 4UCFA 4JFFE 5EUOA 5ISZA 2AFUA 3QG6A 4W9FC 4PB9L 4GAAA 3VWJA 4KJQD 1XDTT 2R29L 3EFDH 1GGIL 2GIXA 2FBJH 2ZCLH 1G94A 3RX7A 1UH2A 3W0WB 1IM9A 5ETUA 1BFVL 4AE1A 1S7QA 5L0QB 1U21A 1QW8A 2GI0A 2PJ2A 2XEJA 3D12B 4FD7A 3B9KC 5GZOC 1KB5B 2OZ4L 4O2EB 3D0VA 4PTTB 4ZUSB 3RZCD 2PIYA 3T2NH 2PC1A 4MQXC 1YNTB 4JFDA 2OFQA 1RKRA 3L3HA 4Z7OF 1OHQA 1RIUL 2WZAA 1FV1A 4J3UA 3KPPA 4BH7B 4UT9A 3FCSA 2HG5B 3E8VA 2OYPA 1BAVA 3GMQB 4OJAA 1R24B 3LRLA 1QVOA 3LEVH 1T2JA 1TITA 1MFCL 2ZCHL 3V52H 5LHDA 1BD2A 1P9MC 3MYJA 3TXAA 2EVHA 1JPST 3D87B 2YLHA 4OZIB 3ZKSD 2MQCA 1G7IB 5IFHH 4N68A 1S7NA 1BBJB 4PW4A 5F7EH 4AW7A 3WC7A 1R1CA 5F6HJ 3WNJA 5IVXF 2BXZA 3PWPD 3L3OA 1C5DA 1ZWIA 4L5FH 3K9TA 1K5NA 2B77A 4DJMA 1IGJA 1U8IA 3NESA 5L4MA 3LQZB 3REWA 4YGVA 4NC1C 1NUDA 1QLRB 2K7QA 5JDSB 4A7SA 1F42A 3RFRA 3MUZ1 3U1QA 4R2GD 1Z9SB 2P0WA 1WFUA 2JXMA 2XIBA 1CU4L 1AOZA 1PEWA 3PU7A 3AG1B 1UQSB 3K6NA 3G5VA 4N87A 4OLEA 3LMJH 4N1HB 4NJAL 3DSNB 4PB9H 4Y5VB 2R29H 5D4QA 1GGIH 1MF2L 1ORQA 2CKNA 1OTTD 3ESPA 3MJ9L 4PGCB 2WQWA 4D94A 3SSGA 3O4LD 5CR1A 5L2KE 4YUEL 3WR7A 2OZ4H 5IEKB 3VXTB 1UT1A 1LD9B 2R23B 5ES4B 3PL6C 2Q0YA 1RIUH 1CDHA 5IM7A 2OMVB 5FW8A 3UP6A 5E6IC 3DUSA 3IU3B 3MJ6A 2NXYC 2IQAA 1JF1B 1LDSA 1MFCH 1FBIL 2EO7A 4U1IA 4LLDB 3IGRA 1H8LA 4JLRA 4WWID 4JN1L 5DO8A 4FYSA 2XG4A 3FUDA 3NJNA 2VRQA 1U3HC 5EU4A 3GNML 3VWJB 2FQEA 2AJZB 5FLVA 4LQ6A 5KEZA 3GJFA 4ZS7L 3V8IA 4KRPB 5KTCA 1S7QB 2EKJA 2IPKA 4TQ8A 3PPSA 3VXSD 3DVGA 3ATEA 2CLVB 1DUYB 3DHMA 4EDXB 4LAQL 1RERA 2BVQB 2Q3ZA 1ED3B 2Z9TA 4L8DB 4QHKI 1NQBA 5CEYB 2CA4A 3LKSA 3S9LA 2GSIB 1JUFA 2EZ0D 3KPPB 4KQ0A 1NCAL 3SYOA 3PWVB 4G3YH 1QVOB 3FSOA 5H2BA 3NTCH 3IRCA 3BVUA 4ANKA 2EDTA 4EKXA 4ONGH 1CXHA 2VQ1A 2DQGL 4TV3A 4OCNC 3PXJA 4BFJA 1F4XL 4J6RL 2ZXQA 3LQAC 3MRPB 4TULH 1F0LA 3MU3A 3B2UD 4AQ8C 1BYOA 4PI0A 4KSFA 4XNAA 3AM8A 4FQLL 3LKOA 3NGBC 3K0YA 2VISA 1MF2H 2F8IA 2NTFA 3MGTA 4JM2F 4QRRD 1PKOA 2B1OA 4OF8A 1LJMA 1VA9A 4XXWA 1C5DB 1ZWIB 3FQ4A 2FEDC 2N7AA 1I7UA 1U8IB 3TNNA 3RYOA 3L3JA 4MDJA 4B0MB 2EVIA 2ED6A 3K46A 4HWUA 1SDYA 2HT2D 2F7QA 2I25N 1A1NA 1ETB1 3P1VA 3QP3A 4FJZA 4KK6D 2NPLX 4IK2A 1EO5A 3VTAA 5I16A 1FBIH 4PSWA 2X4NA 3HG5A 1QACA 4PJEA 5BXFB 4OZIE 4IKLA 1KPVA 3NJHA 4JN1H 4PRBB 4PBDA 4E9TA 4M3KB 3B7IA 2ZP8A 1IL1B 4FLOA 3ARRA 2F74A 2IOMA 2YEVB 3U9UA 1V3LA 3AB0C 3NJFA 3FNKA 3D25A 3PWPE 1YLEA 3GNMH 1NMCB 4MJ5A 3BRDA 1T4WA 2ITDB 3F6LA 1QSFE 4ZS7H 2C9XA 4Q97A 1EV2E 4UUJA 2HTKC 1AGFB 5ID0A 2XFXB 2Z3FA 5HDBE 3NRQA 3MUGA 2Q6WA 1XD0A 3BXNA 3MLTB 4LAQH 1JHTB 3U0PA 4BK5A 4OZGB 2Y0SA 2NLJA 3NOIA 1XO8A 3UJTL 5IM7B 2IBZY 1P2CA 1ECZA 4NOBA 3QQDA 4IK7A 1DJXA 3DUSB 1I1AD 4LVOB 4B6ZA 1RUAH 3KGQA 4RGOH 4WI8A 5JHAA 2YEZA 2XWTB 1XBUA 4LSQL 1FFTB 3QUZD 2DQGH 4I48B 5D1XE 2Z3NA 2NZ1A 1F4XH 1M1SA 1BEXA 1QABA 3KLSA 4J6RH 4WW2A 4XN9A 2I7SA 1SOKA 1RSYA 2D31B 1EIBA 1QNIA 3CX5J 2XG4B 4FQLH 3IFOB 1NL0H 2FEJA 5C1MB 3WY1A 5EU4B 1N3NB 2GBAA 2W81C 1G6RB 4MFHA 3RQ3A 3TC9A 3FH4A 3SIKA 3WL9A 2WXMA 3BYYA 4K7FA 5C0BB 5FF6A 3DOHA 4A94A 3BD4A 2IPKB 1E8XA 1OZTG 3DVGB 1U8CA 4YHKL 2SODB 3QWNA 4HOZA 2YAHA 4L23A 2VB5A 5AVYB 1JN6B 2AJVL 2X6CA 5D7JC 3ENEA 4DGIL 3BZ4B 3U7WL 2REFA 1A8JH 1T89A 2JIXA 5F3BA 4YL4A 3R9GA 5GGSB 1FJ1B 2ITFA 4TQIA 2GHZA 4ZO7A 1DSWA 3CC5A 3G5WA 1DZ0A 4PLJD 2PW1B 4PSXA 2FO8A 5E8PA 3VFOB 4CGLA 5C0RL 1CL7L 2EIZB 2YUZA 4FLHA 2R56L 5CBEA 3V79C 1D5BB 2EE2A 2W0LA 3LKOB 4PJ8D 2VISB 4X6EA 3MGTB 4BIKA 1Y9WA 3CXHJ 3VXSE 3N41F 4K5MA 3H2WA 3MCKA 3ISYA 4OD3L 4Z3EA 4TUUA 5C7ZA 2KCWA 1DQDL 1I7UB 3JZ7A 3L3JB 2CHZA 4YDLB 4GRMA 2CNSA 1BW8A 3MO1B 2QMLA 1A1NB 2F7RA 5C08A 4EO5A 4WWNA 1ZDSA 5HI4D 4JHUA 3GXPA 5I16B 2WY3B 4LSQH 2QGEA 2X4NB 4CRYB 2BFVL 1JHLL 5FWQA 3S37L 5DA0B 1KPVB 1O7VA 1U8HA 4ECNA 3NIGF 4WO4C 1XGUB 2Z93A 3D25B 4HWBA 1CQYA 1MRDL 2QSTA 1GSKA 1QSED 4MJ5B 5HHOA 1GJWA 4DP8X 4FNUA 2EADA 3NZUA 4YHKH 5EBMB 4PJAE 3ZL1A 3U0PB 1S5HA 4IKKA 4P4DA 2FAUA 1OBRA 4DN4L 3N44F 1P2CB 2AJVH 1T7WA 1FFQA 3JV6B 3NJLA 3QQDB 4DGIH 1T6VN 3ASOB 3LKRA 4ODVL 2P3YA 4AITA 2Z64C 5AVSB 3RWFA 4DTGL 2YD8A 1M2VA 3PJSB 5JO5A 4PJIE 4G8GD 3V0JA 3IMBA 2B5IB 2X4PB 5DEJA 5C0RH 1CL7H 2AITA 1VERA 2YAOA 3TH3T 2BP3A 5EHFA 1A4KB 3IDMB 1MY7A 3MRDA 1EPFA 2KHAA 1LO5B 4HPYL 5BRQA 3QAZB 1DQDH 4MAZA 5D6DA 5B4MD 4LLQA 1JP5A 3FF7A 5DO2C 2EEBA 4P57B 3OPUA 4HUXA 4FERA 1W8OA 3U9PL 4HLZH 5THWA 4XVTL 1YEFH 2HX7A 1XGYL 3LZOA 3OB8A 1XIWA 4I3RL 1BVZA 3QNFA 4FE9A 4G9FD 5F3BB 1E5AA 2H3KA 1JHLH 4ZTEA 3S37H 2DEWX 1S7TB 4ATTA 2RMNA 3CC5B 4MCZB 5IW1A 1ORSA 4MJ4A 4J3GA 5EO9B 1ZRUA 3ZE0B 3IJHA 5CBEB 3FQTA 1ACXA 2FJGA 4ZMZA 1A21A 4H7VA 4EN2A 5JW5A 3KCPA 4FQHA 1L0PA 4CKQA 5CLTA 3V6ZA 4FADA 1RP8A 2VLKE 1E7UA 4KOXA 5EPMB 2B4CC 4A67A 5C0JA 5H37H 4DN4H 4GRMB 3K5RA 3F12A 2ZYRA 1SFHA 5FO8A 3RBSA 2MEJB 3A4EA 1A9BA 4JJ5A 2RFXA 3KM2A 4JPIB 3BUYA 1AR1D 3UC2A 3RX9A 3EJZC 1NCIA 4DTGH 1UZ8A 3IAQA 4A7UA 1Z32X 5AVRB 3MNVA 1N0XL 2IDQA 1ASQA 1U8HB 4C56E 4N0CC 1MEXL 1NH6A 3DGVA 2YUXA 3BCDA 5J1AB 2Z93B 4P2OD 2ZT9C 5HHOB 2XEIA 2XC8A 3CLWA 3KLAA 4HPYH 1F58L 4KNTA 2YFOA 1A7QL 4KX7A 3JVNA 2WQUA 2O72A 4OGZA 5DUPL 4ANVA 2Y9RT 2BNRE 2BERA 5DD0L 5G4NA 4Y49C 4HZAA 5D1QC 3U9PH 1SM3L 3GRWL 4GAJL 2R83A 1WVZA 1TJIL 5ILTL 5C0EB 3CU7A 4JFOA 4FMKA 3LKRB 4I3RH 2VRAA 4BFRA 1NCHA 5IBUB 1BXVA 1PX3A 5IP4A 1M2VB 2EEAA 1RHFA 2OL3A 2AGJL 2J56A 3P4OA 4PJ7E 5H4YA 3FQRB 1IQDA 3HS0C 1MHEA 3LN5A 5ICUA 4YJZL 4XPAH 1B2YA 1W8NA 2AEWA 3MRDB 3ZL4L 2HTLD 2G2PA 2Z11A 4KKPA 2Z34A 3T90A 2VL4A 1NBYA 4P4KC 4KFZC 3F58L 5CEZD 4HUXB 5I6XC 1UM4L 2BVYA 3CLFL 4QTIL 4YRHA 1N5AA 5BCAA 3IC1A 1G9MH 3HUJA 4CSTA 2B15A 3KDMA 3OMZA 1PUAA 1XIWB 4I3GA 4ZZKA 1YZZA 1QUNB 4G8GE 5EEYA 4FP8H 1N0XH 1NC2D 25C8L 1MCQA 3ARGA 4WGVB 4I0PD 2CO7A 2QQNH 4HWZA 4C2YA 4Z9KB 1MEXH 2JBJA 1IGML 2YXFA 2VM4A 4L2LA 3IJHB 2A4ZA 2FJGB 4GUOA 4NRZA 3K1DA 3KCPB 2EVJA 4HH8A 1F58H 3GRBA 2WINA 5K9OB 1A7QH 1X5FA 3V6ZB 5ITFA 5DUPH 2HFEB 5DD0H 1BIHA 4AQEA 4NZRL 1KXTA 1SM3H 1U6AL 3GRWH 4J3OH 5D2LE 5C0JB 2RA1A 1HHJA 1MCNA 3T3PF 2CXAA 2PYFA 5MHSD 1FFPA 3GI9L 3FVLA 3N0AA 3BUYB 4NS0A 2P26A 2IC2A 4QWWD 1M6OA 4OKDA 3IETA 3WDJA 4CU7A 1UZ8B 2A0LD 3L2NA 3MUHL 3OHMB 3T65A 4P10A 4R6UA 2CO1A 2AGJH 3PHAA 4IRJC 5JHDE 5F7KC 4Q2ZA 1WK4A 3PGPA 4YU9A 2CO2A 1TXRA 1BPMA 2CGRL 2XZAL 3ZL4H 1CVRA 1NCTA 2MSPA 3FL7A 4BUQA 4J23A 2R39A 4AYDC 4WQOA 1NCDL 1X9UA 4G6KL 3F58H 5DWPA 1UM4H 4P2AA 1RZJL 4N8VB 5C2BL 3AS1A 3CLFH 1HC1A 4QTIH 2DQCL 4F3FA 2R27A 2IALB 4JFOB 4OJCA 4GRWE 5FOBA 2CBOA 3OX8A 3VXPA 3VG9B 4CA4A 3FK3A 4IHBA 4DK3A 4DVBA 2BINA 4MA3A 1IEHA 1ZT4A 3M1BA 25C8H 3W9DB 2OL3B 3H3PL 4HF5L 5DMIL 3P4OB 3G9AB 3ILQC 3SKUD 1IGMH 2HB6A 2DMHA 3A9LA 1UKTA 1MWAA 3FQWA 1T5WA 1NAKL 3QS2A 4H40A 1UWEH 1IQDB 2AQRA 3FRPG 3HNVL 3KHOA 3LN5B 4PVMA 1XGZA 4CVUA 4A04A 4YDKL 4GOSA 1NC4A 5TGBA 5FPIA 4AQ1C 3S8FB 4HCRA 5JW4M 2PYEE 4WJKB 3S35L 1AMYA 5C3TA 1XCXA 4NZRH 1U6AH 1NBYB 2GJZA 1U8PA 2XICA 4NENB 2X3AA 4OCRL 3STZA 1RL1A 3B8YA 4UM9B 4FHBD 3JWNH 1CFBA 4TOYL 2GUOB 2GANA 1N5AB 1N64H 4KMTL 3HUJB 3CMOL 4KITB 4L89A 2Y4SA 3D2UD 3GLDA 4WJ5B 4ZW7A 1ON0A 3OGOE 5EUKA 3SBQA 3FEDA 1BXUA 2YEQA 4HWZB 4F2ME 1UCTA 4K8RL 1TETL 1Z5YD 3P2DA 1OB1A 2IXQA 2ISDA 5GZOA 2XZAH 2DMGA 4UMGA 5IMKB 2C34A 3KPSD 2D0HA 3DK0A 1KUXA 4B95C 4UWQB 1JI2A 2DXQA 1NCDH 4DEPB 4HHGA 4G6KH 1AI1L 1UM5L 4PH8A 4OI8A 1RZJH 3L4UA 3QJQB 5BVPL 1TTCA 2DQCH 3D69A 2Q76A 2GSGB 1Q1JL 1VEMA 1X5ZA 1P9MA 4LNVA 2DL2A 1GC1L 4XVUD 1FFPB 4F7MB 3FQNB 4I13B 4JREC 4FBEA 4JHBA 1M6OB 1S6NA 1GL4B 3QBTB 3NA4A 2XYBA 3WGVB 3H3PH 4HF5H 1YYML 4LCYB 5DMIH 5M7QA 2CR6A 4Q2ZB 3ZZ1A 4FDWA 3GZOA 1JMZA 2H0JA 4ATWA 3G8WA 2NY3C 1NAKH 2J88L 3HNVH 4X5QA 1S7UA 2OMNA 3NZSA 3RWCA 4YDKH 4KK9D 3QXVA 2P24A 3A3YB 1MCDA 3SE9L 3S35H 3KH3A 1TQUA 4GW1A 1ZXKA 1Z1WA 3PWUB 4P5RA 4OCRH 1Q38A 1XAUA 2VDQB 2W59A 3BIBX 3VD1A 4JE0A 4M61A 5F96L 3M1CA 5CFHA 4TOYH 1YN7A 3OLDA 2CU9A 3QNYA 3VXMA 1WG3A 4KMTH 4C58B 5B3JE 5BS0D 5FOBB 3OX8B 1MJJA 3E6FA 3KD4A 2B14A 3V95A 2ENQA 4MA3B 4UEEA 1ZHNA 3M1BB 3ZTJH 3W82A 5GIRB 1AQ8A 1IM3B 4H5SA 1N8OE 4W9YA 4FQXB 2YPVL 1TETH 1GYTA 4YSOA 5F1OB 1P1ZA 3SDXE 3VFNA 3PL6A 3IEAA 1NC4B 1P7QA 5AAWA 2FX9L 4OCXL 1AI1H 1UM5H 4BQBA 4YSQA 3D3VE 3L1OL 5EOQL 1SXNA 3VFWB 3DDDA 5BVPH 2UXVA 3U4KA 4Y4HC 1B4RA 1S7WB 1RPKA 1Q1JH 4KBPA 2CUAA 1A2ZA 4PP2B 1GC1H 2X0UA 2P5EB 3KLQA 4NHUA 3GMRA 3H2PA 4OF0A 4L0ZA 1EO8L 4AGNA 3TJPA 1J1XH 1FNHA 3DJRA 1YYMH 1ZPLA 5FIEA 4M29A 1U3HA 4ORFA 5J6SA 2FJFA 1M2OA 1T1YA 2IPUK 1AQDB 1RCYA 4L8BB 2MJWA 3DUHA 3T6ZA 3M7FB 4RWYL 4FQ2L 1OB1B 5I23A 1DE4A 3U6XS 3B9KB 3DR8A 4PJHA 1JZEA 2ZZUT 3I85A 5D7SL 1MDTA 1V5JA 2NCEA 4LHUD 4BHUI 1MN4A 3IJEB 4LSTL 5K8MA 1MCWW 4IIQC 2I00A 3A6CH 2GLFA 4GIAA 1AR2A 3KPMB 5GS0L 1LDPH 3D69B 1DJWA 2Q76B 4PYHA 5TFSH 4DKDC 3DVNB 4MA8H 3S34L 5DJYA 3SHSA 3WTXA 5IB0A 1NWOA 2HV2A 4N0UB 4YR6A 1KIPA 1E5CA 4ZPTA 4AQ8A 3EFAA 1J8HD 2BIQA 4F1ZA 3VQLA 1NBVL 3OB0H 3PGCB 2YPVH 3GTTA 4CVXA 4XC1H 1K8IB 1QLFB 5E4IA 1N12A 4XP1H 2EECA 4NOFA 3RWHA 1BAWA 1SLUA 3PHQA 4H89A 4L1LA 3HG4A 3QQ9C 4KOWA 1XXFC 2XWDA 4K3GA 2P24B 4KS9A 1INDL 4XPKA 3D8PA 2FX9H 3KEDA 4OCXH 2IANA 5ABDE 2FJSA 1YPZE 1RJCA 1QRNA 2OZHA 3L1OH 4I8DA 1AZBA 4M61B 4W9KC 1YN7B 2BOBA 2ZELA 3FRMA 4NQTA 1AO7B 4BDVA 5L4IA 4X5KA 4RBPH 1F56A 1HSBA 1MJJB 5HDOA 1EO8H 4ODXA 2X41A 5FYLL 2BNUA 4NRYA 1KTLA 2VIRB 4H5SB 3VGAC 4UM8B 1ZLEA 4KKZA 4RWYH 4FQ2H 2AJ3B 2ICWJ 4PRPD 5D7SH 5CINL 2BWQA 1IV8A 1R3HA 3PL6B 3RY4A 1G7LB 4LSTH 3ZYOA 5DD3L 5G20A 4XO9A 5KZCB 5AW1B 5F71A 5E6IB 5C07D 4A95A 3UYPA 2NXYB 5GS0H 4QNPE 2ARJQ 4LMQE 3S34H 1J5IA 5JHBA 1C9SA 2YGNA 3AS2A 4WENB 2CMRL 4CC1A 1AXIB 5E9DD 1ZEAL 1BVNT 1EFXD 1NBVH 2H1XA 4S1RL 5D4HA 4AE0A 1FE8H 1U3HB 2BNQD 2GC4C 1LP9E 2OTUB 5F21B 1Z5LB 3V4UL 3I50H 2MCAA 2DS4A 1YEIL 2HLAB 1TR7A 2O28A 1A1OB 2CZNA 4PJHB 2G3XA 1OT4A 5HHXL 3TEUA 1FO0L 4ZFFA 1INDH 2R0LL 5GJTL 2VR8A 1PCXA 4DPAX 1FYTB 4IMLA 3ZE1F 4ZTPL 5ITBH 4X4MA 3U4AA 2DWEB 4OIFA 5KBMA 4KSIA 2Y1ZA 3ZDXE 2DQTL 3S9MA 4AEEA 3BDBA 1MFDL 5I18L 3WE6B 2EKSB 2H2SC 4S2SA 3G6JA 3BISA 4Z7QF 5GRVK 2MNWA 4YR6B 1JDAA 5JH9A 5FYLH 2DJ4A 5C09D 2V5YA 2VLLA 2ZF8A 3ASNB 3NGBB 4D9LH 5T3ZD 4GUQA 2D2CC 4N3TA 3G9VA 2VLMD 4BFIA 3K6SA 1ETZB 3MRGB 4DP0X 1SYVA 5D96C 3KHZA 3V0DA 2FSDA 1A3RL 3SJVA 4TLKA 2X4OA 3RWHB 3PHQB 5E5UB 4A31A 2EE6A 3ARDC 4ES8A 1QO3A 5GGTL 5DD3H 2AZUA 2IANB 1QTSA 5CBMA 2I24N 3FUJA 4JKPL 4OV5A 1OP3K 3RUGA 1QBAA 2EJ1A 4PBWD 4QVTA 2X2UA 4RIRA 1VFBA 2RTTA 2Y6SD 1B3IA 2Z7WA 3WSQL 1CP7A 3QUXC 3ZT6A 4N0UE 2CMRH 5F89B 4PVLA 1HOCA 3KE0A 1ZEAH 4ODXB 3GIVA 3SZ6A 3V0HA 1L0CA 4S1RH 1B4TA 4LCWD 2BNUB 4NRYB 5ESAA 1Z0NA 3IFPB 3V4UH 2AS5M 1YEIH 3C08L 3WFHA 5DLMH 3QZWA 1VRSA 4HJIA 4RRPM 5HHXH 3WI9A 1FO0H 3SI1A 3ZUNC 2R0LH 5F44A 5GJTH 4K2UH 2WLIA 2WQAA 5LAXB 5FECA 3L17A 2MRYA 4LLUB 4ZTPH 4HD9A 4LPTA 2NR6C 4APQD 4MNQE 3E6HA 3HB3D 2DQTH 1KMGA 1E28B 5KVGE 1MFDH 5I18H 1N18A 5K5YA 4HSCX 3GXMA 1HXMA 3QQ3B 4OZHE 2A9NL 2HJFA 5F88B 5ICXA 1J9CT 1MOEA 4PRHA 1FIGL 3E9TA 3ZPDA 5CJXC 4F9LC 4F1SA 4MHHG 4YDNA 2QLVB 3HHSB 5IOPB 4PRPE 1T80A 3TVMD 4OB5H 1A3RH 2J1YA 4FNTA 4E9QA 1XWVA 4Y4FC 1ZHBB 4JFEA 4HV8B 4ZFFB 5GGTH 3QG7H 1XF3A 2AJUL 1CJYA 3QZMA 2K8MA 4AEHL 4AYFA 3KNBB 4IMLB 4PXDA 4PG9A 5D7JB 4FA8A 4PJ9D 1B4LA 2NY1B 1HKFA 4JYWA 3WSQH 3U7YH 1E30A 4LKCA 4KKLD 2YD4A 2P7TB 1KV7A 1NWPA 2UX6A 2XT1B 4M7LL 4NWUL 4S2SB 3G6JB 2Y5QA 2EYTB 3KPTA 3S4SA 2DN7A 4AK2A 5KW9L 1W6WA 3AJ7A 1BOGA 3HG1D 4HEPA 2VLLB 4ISVB 4GMTL 4WKXA 1ZGLA 4YDMA 4X7DC 5J11C 3BMVA 4DP6X 4TSCL 3V0EA 3ALWA 5CZRA 5FV2A 2OULB 3KVPA 1R3NA 3UZQB 5JW4R 3C6LD 3G5XA 3EXJA 1QO3B 1T20B 4N2CA 4JFXA 1IGTB 1R43A 5TK2A 4FA7B 1FC1A 5CLZA 5EO1B 3PP3H 2IAMA 3FH7A 3CXPA 1DVYA 1U8QA 1VFBB 3DV4A 5BQDA 2LE9A 3TESA 2GHWB 2A9NH 2Q9OA 1PYWB 3RNKB 3F5WA 3P9LA 3ALXA 3FONB 4AEIH 1FIGH 1EO7A 4WO4B 1JWMA 4G42A 1J0HA 4NSKA 3OLEA 1IUZA 2VLME 4NDMB 4L4VB 4NNYA 4F5CA 4KJWC 5LBSL 4M1DL 3WFHB 3ZU8A 4R0LA 1IC7L 1DEDA 2O6EA 1G7JB 4HK3J 1LWJA 5FM8A 2WN2A 3CFJB 3ULVF 4OGXL 4YFDB 4U0QB 1QFOA 2V8VA 2VXQA 4K23L 1SY6L 4JO5A 2A6DA 4AEHH 1HH9B 5FECB 3BI1A 2P28B 1UJ3C 4IDLA 2E7LC 3EHBC 1D5MA 1NIDA 4DP7X 5B7FA 4WUUA 2D7MA 1BYNA 3QWOA 1UWXK 4NWUH 1K4CA 4M7LH 2GG1A 5I1KL 4LCWE 2IWEA 5CWSA 1JBJA 4PRHB 4E8OA 2W9EL 1AFVH 4GMTH 3HS0A 3GEWB 4F7KA 3DTUB 3PQYE 4ZOAA 4W93A 3O8XC 2UY7A 3QFGA 1HAWA 4A2ZA 1ZE3H 3ELAT 4KXZH 1JRHI 1RUKH 3DO7A 1F02I 1WYJA 1G9MC 4P4KA 4WKZA 2JVUA 4C2XA 1EAJA 3RE0A 4NB7A 3OZKA 3BQVA 4GUCA 4QRRB 3AWEA 3RY5A 4P23A 4BZ1L 1QG3A 3TO7A 3FFCD 4PG9B 2F5AL 1X9QA 5CU5A 2C1PA 4IBTA 4W6XB 1CD1B 4FFVD 2G3NA 3FF8A 5B3NA 1UOLA 3MX0B 1X4XA 5BRPA 1G7PA 1W0WA 1TQWA 4U6YA 3ETBJ 4XNQB 5CGTA 4GH7B 3ZSSA 4HYTB 3R7RA 4PPZA 2OMXA 1GS6X 3CK0L 1BOGB 3OC8A 4LEEA 5C97A 1ZGLB 1T3FA 3IAPA 4J3OC 4KXBA 3APNA 4M1DH 3DJTA 4R7DA 3A22A 4JPKL 4OGXH 4YHML 2V4LA 4K23H 1SY6H 3QO0A 4PM1A 3SBWC 3OKDA 3G5XB 3VGBA 2EAEA 3CDFA 1V3MA 3GI8L 3EG9A 3IMRA 2E4TA 2J21A 3LOWA 1I4FA 1UOKA 3FSZA 3QHFL 4JFXB 3E1ZA 4XPGL 1QSOA 3VFTA 3TPUA 4GG8A 2XCMC 5FCSH 3AGVA 2ZXVA 4DFIA 1NMTA 4AJ0A 3EDEA 2V8HA 3GSNL 1A3LL 5TDPA 3QC5X 4JO2H 2Q43A 3F5WB 3L7FA 1EEYA 4M9PA 3GZKA 4JY4A 5F7DB 4NSKB 5HYSA 2C6GA 3H9SD 5SWSA 3R1GL 3X3FH 3SKMA 4AWJC 4NGNA 3C87A 3ARFC 4UDUA 3NG5A 5DHEA 3IGKA 1RZ7H 4Y49B 1T21A 2CGZA 2CQVA 2Y1VA 3MXVL 4PBVC 2G0LA 5D1QB 4BZ1H 3QJHA 1IBDA 1FZOA 5KSAD 2F5AH 1XH2A 5DJXB 1SVCP 3MRLA 4LSDA 4X8XA 3VUAA 2OB0A 1IKNA 3DJSA 5LN8A 4WUUB 2IH3A 4L29A 1YA5A 3BCFA 5EN2B 2F53D 2G30A 1LEKA 4AVHA 3AS3A 1KBVA 2FB4L 3CK0H 1XMTA 1BAGA 4MXVE 2P44B 5JTWA 4HGMA 2VZYA 4AQ1A 4JPKH 3JWNC 4YHMH 1R5IB 1A7RL 1DP0A 5E6ZA 4GKOA 3DO7B 2LLLA 4LDLB 3EBIA 3JWDL 5IGXL 1EEZA 1OANA 4WKZB 4AVBA 1R3IL 1PGRB 3GI8H 5BZWA 1KWMA 3QHFH 5FKAA 4XPGH 4B5PA 3V4VL 1B0WA 3IJYA 1JFQL 2C1PB 3N6YA 5DHXB 2WM0A 2FLMA 1N8ZB 3WKPA 2QV2A 3GSNH 1A3LH 2DYPD 1WEJH 3JTBA 4HUMB 4P46C 3H54A 1G7PB 1W0WB 2C3GA 3HHMA 4ZO6A 5AGEA 4ZS6C 2WVSA 2QVTA 4MS8C 4UV4L 4M5YL 1FP5A 1RUML 1UT9A 2BRRL 4HIEA 1EMTL 4N28A 4W9EC 2OMXB 1LE5B 3IIBA 4FQPA 1HCFX 1ND0A 5D1ZC 3R1GH 5I1DA 1RZJC 4FLQA 5F1NB 1QPXA 5AW6B 2JMRA 3MV7B 1RAMA 1XMEB 2JK5B 2EUVA 1MFBL 3NEOA 3BN9C 5ECJE 4EBQL 1GZHC 3KQZA 3MXVH 2OA9A 5E8EA 2CLZB 5DJZA 5HDBF 5B7MA 4GG8B 3W2DL 5C3LD 2WGNB 2APWA 4Z7WB 3BT2L 4NKIL 4AV5A 8CGTA 2OYKA 1U2HA 4KK5D 4ZXBB 2ARWA 3BP7A 4ERSL 1EE3P 4IRJB 1GS8A 5T1KD 3QI9C 4YGOA 3UBXA 3GO1L 1C7SA 3L7FB 5CEZL 3T08A 1PMYA 1S7RA 3IDIA 5JOFB 5T33L 1BG9A 5CGMA 1QEXA 2R2HA 1Y18A 2Y23A 5D6CB 1A4AA 4UQ9A 2V77A 3MSPA 2JBKA 3UJJL 4Q0XH 4M7JL 4F80A 3MBWA 4GQQA 4AQAA 1HEZA 3T09A 3PNWA 1T22B 3I84A 5IGXH 2ZOTA 5KJ4A 4D0BB 2WQ8A 1X12A 3D33A 1HYRC 1R3IH 2IOOA 3MRKB 1T21B 3M6DA 2YWZA 4AC4A 1QFWL 1GYVA 3ZGHA 2R29A 3V4VH 3QDMA 5BO1H 3MRLB 1JFQH 4LSUL 4XBPB 5D29A 1RU9H 2OZ4A 3N1PC 5A3IC 4E0RB 1LCPA 4GKLA 1WCBA 1FN4B 2ITEA 2IMNA 1F13A 5KTDA 4M85A 4NT6A 4UV4H 3K72B 4B9YA 2BRRH 4GSDL 1EMTH 3NFNB 5HYEA 3CHSA 1GXEA 1F3DJ 1SJMA 1I1FA 5AD0A 5HDLA 5AAPA 1WWZA 4CYOA 4WNQB 1VF5C 2GB2A 3V8OA 4KOSA 3VW3L 5K1JA 3BHBB 4AQ1B 5AWNH 2HRPH 1GC1C 1EJ8A 1MFBH 1U8KB 1RIVH 1RURL 3GMMA 4FI6A 4EBQH 5HYJD 1C1EL 1MAML 1SYSA 1YEKL 1IC1A 2GTQA 1JV5A 4LO9A 5G21A 5BZWB 4Y4HA 4TXVB 1SQMA 2ICWA 2WGXA 2OMYA 4ZOEA 5FKAB 5AALA 4AKOA 1RJYA 5TDOB 3UYRL 8FABA 1DTDA 3OF6D 4R96A 1TXKA 3BT2H 2A38A 2WWKO 4K94L 2J5WA 4KZEL 2L7EA 1A3ZA 3MV01 5I24A 4OC0A 4Y1AD 4JDVA 3DC0A 1RFDL 5EO0B 3CG8A 3F62A 1MCPL 3MRQA 4KZ0A 5T33H 4G11A 3MV8D 5D7LD 2JB5H 2V7NA 1ND0B 2HFTA 4QBJA 1GGBH 2X1PA 3UJJH 4M7JH 2LFGA 4UMSA 2XWJA 4XNDA 5BVJB 4Q56A 3E7JA 4IIQA 3T71A 2ZXWB 2B1HL 3I3BA 3TA3D 2CIIB 3TYGH 4KROD 3QNZB 3MR9B 3OVUB 5F70A 5DUBA 3BYTA 1UB5A 1QFWH 3KCWA 3LS4L 4ZUVA 4L3EA 4PJAF 3LXAA 2DLTA 2QFPA 4LSUH 1SN2A 2HXAA 1SJHA 4JREB 3CTTA 4Z7IA 1MG2C 2J8HA 4OLVL 5D2NC 5IJVA 4H0LC 2ZKHL 2PJBA 2GJ6D 5KBKA 2X0WA 1MNUL 2ODIA 1KLGB 4YE4H 2PPCA 2A83A 4O9HL 1HSAB 2WXPA 1X9LA 3FOLA 2NY3B 4GKSB 5BMFH 4DKEH 2R2HB 2V5RA 3AAZB 1Y18B 3X1FA 2EEXA 4KH2A 3VW3H 4U1LB 4GEIA 4P5SA 4NCZA 2QQKL 3N9GL 3MBWB 4AQAB 1RURH 4E41E 3FFDA 3PNWB 1RHHA 3LKPA 3BVWA 1C1EH 1MAMH 1YEKH 1IILE 5F9JA 2FT7A 4DKFL 3DV6A 4L48A 3BFOA 1FH5L 4MFJA 3GEFA 5I0CA 1UD6A 3IWVA 3UYRH 3ZO0A 5EU7E 2IFGA 1OGAD 4K94H 4JQVA 2QSCL 1G9HA 3QDMB 4PJDF 4KZEH 4MJJA 3UTSA 1RFDH 3FTZA 3TBSA 5I76B 3H2QA 1SVZA 4N5UA 1MHHB 1MCPH 4QTHA 5I19H 2LGNA 5J9PA 1HWWA 1JPFA 4FQQA 2XVBA 5D7IE 3RDJA 4K3EL 5JLZB 2XTLA 3SHPA 2TRHA 2E56A 3D7PA 4FTDA 4Z7VE 5AD0B 3W0WD 1H9DA 5GQBA 5GS0C 5KYYB 3QDGA 3FT3B 2NX5D 4AMKL 1Z9OA 3LIUA 4FFYL 5ANME 5F3HB 4ZI8A 3EO4A 2XQYA 2B1HH 2CD0A 4RGMC 2W0KA 4RAVB 1EEUA 4XN5A 2ICWB 3L9YA 1XGPB 3D4YA 3LS4H 2A74C 3HZYA 4XO4A 5ALBL 4CGTA 3LODA 1FSKC 5HGAA 3TO6A 2K6WA 2AVGA 1TNMA 3MNZB 2V2WB 4OLVH 1RZ8A 4LMQI 2H2PC 5DTFA 2ZKHH 4CC0A 5HHPA 4PK2A 1HL4A 2I85A 2Y5TA 1MNUH 1ZA6B 3CFTA 2EIBA 2UWEB 3EJYC 3NQIA 3P3YA 1F45A 4NQCB 5GGQL 2P5WA 4YWYA 4Q7DA 3S6HA 2ESVD 5I4MA 4O9HH 4U1SB 3AXIA 4EDWL 4YBQC 4QRSA 1KCUL 2V7NB 4AI7A 4RX4D 5KS9A 2Y7NA 2QQKH 3ZRCC 3N9GH 2XWJB 2NY7L 4DKFH 3PIQA 5FAAA 2I60L 1CDYA 1FH5H 4GW5B 3QDJE 2WCGA 4LSPH 5I71C 1DO5A 1TEGA 3RTQC 3PB8X 3IT8D 5AVUB 4LLVA 1ECYA 4KY2A 5FYJL 4DUXA 2QSCH 2YO3A 1SJHB 1XGRB 3AU1A 4YN3A 4G83A 2VO5A 5ESQA 3NCBB 4PJFA 3ML8A 2G2NA 2ZNXA 5K39B 1ZA3A 3AW5A 4BEIA 2QZ5A 1JG9A 1S7KA 3CFNA 3P9MA 2RJMA 4OIDA 5IB9A 1FYHB 4HUWA 4K3EH 3PWNA 4PS4L 1JAEA 4XOBA 3QNVA 4BE6A 1PS3A 1XE4A 4P2QA 2LFEA 1WITA 3GMLA 3HMXL 4PJ7F 3P4MA 3RWDA 1JVKA 3S3JA 2PTVA 3VFVA 3ARDA 2D3NA 4QGYA 4Q9QL 1MI5D 1V27A 2HX9A 3QJTB 1NMAL 3GT6A 4AMKH 2WVTA 2AF2A 4I1RA 3FFDB 2H3XC 4JFZH 2QSQA 2Q5BA 3IDGB 1COBA 4G7QB 2JJTC 3BSGA 3S88L 5ALBH 4QLRA 1ONQB 2J1ZA 2Y7SA 3QUXA 3KWVA 4U3SB 2F15A 3D39A 4XX1E 4PWIA 1T5KA 3LHAA 1FL6A 1XSJA 1A6AA 1DQJA 2CG9X 2R51A 3BFWA 3DA0A 1XZWA 2V33A 4XMTA 1FNLA 4JKMA 4MAYC 5JNYA 1OXYA 1VHEA 5GGQH 1PZUB 2E5EA 4ODWB 2IQ9H 5EU3A 3IKCB 3MC0A 3VGAB 3DYMA 5ISZD 3O4OC 5HDWA 3FQXA 1KCUH 3UABA 4F7TB 3VWJD 1NFAA 1NLDL 3CSFA 3QHZL 1XH0A 4BCZA 4F8QA 1IM9D 2X40A 3LH2L 1U36A 1GS7A 1QOKA 2NY6B 3BE1H 4KRPD 1I12A 2ZW6A 5IZ7A 2WQXA 2NY7H 2NYYD 2W8CA 4U6TA 2BPBA 1BOBA 2A2QT 1SXZA 2AQPA 5AW0B 5J5EA 2NR6A 1I53A 1ACCA 4JRYA 1HHGB 2A99A 2AJSL 5FYJH 1QRKA 4U49A 5HGAB 3FMGL 6CPAA 3Q43A 5D2LF 4PJGE 1BD2D 1QTYT 1WBXA 3V6OC 5ICYA 2ZEEA 2RQ8A 2EDMA 2ORBL 3GLZA 4LLYA 3S7GA 3V9CA 1QATA 5J4MA 2P5WB 3EC4A 4PREB 4JKWA 3HJEA 4PS4H 1AQHA 2B5GB 4FZEL 4ZK8A 4UIAA 1U91A 4TNVK 4P48A 4QRSB 3HMXH 4Y4FA 4Q9QH 3VWKC 4NZTH 3D08A 1CFSA 2NX5E 4RGNB 4OJEH 3E8UH 1WHOA 3SDCC 4WGWB 1Z9UA 1NMAH 4UZGA 3ARVA 1WWAX 3LB6C 2IVFC 2FEEI 3DX9A 1Z66A 1Y7VA 2YXVA 1B9KA 4WI3A 2OR7A 4YDJA 1M3JA 1JZIA 5EZJA 3S88H 1Z4EA 2WXHA 5DRXB 1I8LC 4R26L 2WXIA 5G22A 3LTVA 2YQBA 2BOCB 3FB7A 1ZLWH 5IJBC 3AU1B 3EZJB 5ESQB 2LU7A 2NNFA 4JGUA 2ESVE 4HW6A 4PJFB 3D0LA 3GXNA 3TA4D 5CBAA 1AQMA 2R15A 3RNZA 5H37A 5JPNC 2VXKA 4OF5A 1JZ8A 1ZG9A 3MJWA 1CPUA 5D96B 4C4KT 3PWNB 1TIQA 2FNBA 1S9WA 5I6OA 3QHZH 4TL5A 4P2QB 1IBGL 3GMLB 4RAUB 3LH2H 3H8GA 15C8L 2Q2EB 3ARDB 5GGUA 3VE0B 1L9OA 2OMZA 1I8MA 4IBLT 1RVFL 4R7MA 1DHKA 3KPNB 3C8KA 2P9RA 2DPSA 4LOUD 2ZF9A 1A6TB 3IN0A 1F41A 3DROA 3BRGC 3FMGH 1UYWL 3D6GA 1QZNA 1YY8A 3QIBC 3X3GL 3MVSA 2XWRA 4MLSA 1DQJB 2BSWA 1OEZW 5FHBL 1AGDB 1I1YB 2ORBH 1IGYB 4Y9CA 5IBLD 4E42A 5D5ME 1U93A 4FZEH 3ZE2B 4LUAA 3EOBB 2POKA 2BEIA 5J0BA 4MYWB 3OZ9L 1MI5E 2R0KH 1Z7JA 5I66B 2H1LM 4JRFA 3RILA 3IAGC 4JL1A 1AD9A 2DPKA 2J8OA 3IF1B 3ZO9A 5F3FA 1UJ3A 4TLSA 4XH2B 3V0WL 1JXGA 1JZ5A 3F01A 3MRHB 2E7LA 2JDDA 3I6KA 4R26H 4Z0XB 4QAMB 4X9YA 2Z91A 5KVFE 4Y0GA 1ZE3C 1E8WA 5FGSA 3MJGX 3TWYA 4QJ5B 5ISZE 4LLYB 5EUOE 5BOZG 4I9WD 3LKNB 4BA8A 5CD5C 1B0GA 4DEWA 2VQYA 4DGYL 4QB9A 1MCJA 2VM9A 1IBGH 4Y4FB 1B0RB 4R9HA 1KF9B 1CFSB 3CWGA 1F4HA 1PVHA 3D3SA 1RVFH 2JB6B 2BSDA 3VD4A 1MRFH 4JFDE 4DAGL 2YD7A 1UXWA 3R18A 4YDJB 4FN0A 4XWGL 3OL2A 5EEVA 2QJ8A 1OAKL 5EZJB 4OFIA 3VI3A 4S1DD 1AZUA 3ERXA 1TF9A 3INUL 1UYWH 1LMKA 1BD2E 4JN2B 3HOGA 3FO0L 3CDCA 2F7VA 5FHBH 4NQVB 3BGFB 4M3JA 5A2LH 1UVQB 1TZOA 4U3HA 2CR0A 3D0LB 4N6QA 1GHEA