4BINA

Crystal structure of the e. coli n-acetylmuramoyl-l-alanine amidase amic
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
Knots found
sequence length
379
structure length
348
Chain Sequence
FQGHMQVVAVRVWPASSYTRVTVESNRQLKYKQFALSNPERVVVDIEDVNLNSVLKGMAAQIRADDPFIKSARVGQFDPQTVRMVFELKQNVKPQLFALAPVAGFKERLVMDLYPAPLLALLEDYNSGPQPGKAGRDRPIVIMLDPGHGGEDSGAVGKYKTREKDVVLQIARRLRSLIEKEGNMKVYMTRNEDIFIPLQVRVAKAQKQRADLFVSIHADAFTSRQPSGSSVFALSTKGATSTAAKYLAQTQNASDLIGGVSDMVQSLTIADSLKFGKAVLNKLGKINKLHKNQVEQAGFAVLKAPDIPSILVETAFISNVEEERKLKTATFQQEVAESILAGIKAYFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Cell Division Amidase Amic Reveals the Fold of the Amin Domain, a New Peptidoglycan Binding Domain.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords N-ACETYLMURAMOYL-L-ALANINE AMIDASE AMIC
total genus 109
structure length 348
sequence length 379
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.5.1.28: N-acetylmuramoyl-L-alanine amidase.
pdb deposition date 2013-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
A PF11741 AMIN AMIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3500 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4binA01
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 4binA02
4M6HA 4LQ6A 3NE8A 3QAYA 2Q7SA 1JWQA 4BINA 2ODFA 4RN7A 1XOVA 5EMIA 4M6GA 4M6IA 3CZXA
chains in the Genus database with same CATH superfamily
3R4RA 1WV7T 3O8XC 1A6AB 4XAKE 3IFNL 5EBVA 2NY0B 2VO5A 3HW7A 1M1XB 5IUCA 3DBSA 4Y4FA 1OD7A 3D3SA 4G6AC 1A3LH 1QSEA 3WTUA 3F5BA 5BZDA 3Q05A 1CJWA 4HKJB 4QGTA 5K5YA 5C08B 4YPJA 1JTTA 1TF4A 4FQ2H 1A7OL 2QT6A 4ZPVA 2WNXA 5HDQL 1HI6A 4NQCB 2XQYA 3DI2B 1CJYA 4PLNC 1ZA6B 1HIML 1NC4D 2XVLA 4RGOH 2WZPA 4F20A 3ZXAC 1J5HA 1FL5B 5IW3A 3VXQA 3L5IA 5F6IB 3I2CL 4L4TA 3VFVA 2Y07H 2TSAA 3PGCB 4N9GB 4Z77A 1S7SB 3STZB 1DQKA 2B08A 4FFZH 4XWOC 2GHWB 3AC0A 2EKSB 2YPKB 3FN3A 4GRWE 1RPKA 3CXHK 4OAWA 3DETD 3B7YA 4PW3A 4YNYA 5DYFA 4KKQA 3CPUA 4JANB 4RWYL 3EFOA 1CL7I 4AIEA 4O51B 3K6SB 2XOTA 2FO4B 1T3FA 4KX7A 1SEBA 4P4KD 4Y2DD 4JM4H 3WJMA 2OZ4L 3R18A 2DQCL 5F89A 1TJXA 2WNWA 2BW5A 3QDGE 4L1LA 2Z35B 1ZIAA 2ZSVA 3U0TB 2HJKB 4F7KA 4MMOA 1U8LB 4O58H 3MUJA 4Q36A 1ZHBA 3ASWA 1U41A 4IOSA 3PNWA 3IDJA 1A7QH 2YQ2A 2X0WA 3CFCL 4HLJA 4QXUH 2MHAB 5E99H 2P46B 2R2EA 1JGDB 2E9BA 3EG9B 1J10A 5E94A 4AQ1C 3VH8B 3F58L 3N40F 4UUJA 1EDQA 1UUSA 4XNQA 3A6CL 2PJ8A 4MFKA 2FWOB 3LHAA 4O2CB 2BY3A 5J1AA 2UXVA 5B3NA 2BP0A 3SCMB 2PETA 1PG7X 1F11B 5D71H 5KVMC 2M8XA 2FEDD 1H8NA 3VXRA 4F1ZA 2AEQL 3HB3D 4FUUA 2NDGA 4FCAA 4MCRA 1M4KA 3ZDXF 3IMRA 5HDOA 1ZLWK 4HUNB 3WEOA 4NGTA 1GRWA 3L4CA 4H89A 1WS8A 3NEEA 2EE6A 1BAFL 2X28A 3QIWD 4JHVA 3T2OA 3WTXA 3A4DA 1RK1A 5HY9B 2HRHA 3LQMA 3IS0X 1HILA 1ADQH 3INUH 2WINB 4KK8D 6TAAA 2ENSA 5DCCA 2EH8H 4C7IA 5CHNB 3JWOH 3FN0L 2AEQH 5D4JA 2VAAA 1M1XA 2HVKA 4A7SA 2JE8A 1F1DA 3D85B 5F1NB 1JP5A 4WFED 2HTLD 2V3FA 3BGFB 5KBNC 4JK0D 4N2HA 1ONQA 3ZDWA 1VHEA 2XYBA 1FDLH 3QXWA 3F7VB 3P4OB 4AGPA 3B2DC 4ZXBD 3D7HA 3RIAF 5BWAB 1UEMA 1P84J 3JV0A 3P30H 3UTTB 3ROOA 2YAMA 4IMLA 4HIEB 3L1GA 1GGIL 4CAEA 3TIDA 1NIFA 2IG2L 4ZOBA 4XOEA 3HAEG 1A4JB 1JZFA 4U1KB 5JUEH 2NY3C 1UM4L 1AZZC 4OF0A 1MFAH 2ESVE 5MERB 2H9GB 4R26L 4PJEA 3GT6A 4I0KA 3DETC 3S2CA 2DQFB 4YDLB 2F5IA 4R4FL 2DRUA 3IGFA 2FX7H 3H9ZA 2UY7B 4FULA 1PIGA 5TH2B 1D5XA 3HLPA 1PW3A 3L5HA 1AQDB 5DEFB 3IMWA 2MNJB 1VERA 1H3GA 5BQDA 4AMXA 1ZLSH 4H6UA 3POCA 3NIDF 1NCCL 2L7JA 1UXSB 2BCKA 2QHRL 2WVSA 2XG5B 3CMGA 5CEYA 1IICA 2TAAA 1K8IB 5HI5D 1TSHA 4M8QA 1ZGLA 3AAZB 1LO3H 1RD6A 1N0XH 2DH2A 4PJHE 3F85A 5T5FL 4BKSC 1O9VA 5AKRA 3HG1A 3QUKB 4M5ZL 3MRQB 4U3SA 1KIRB 4OH2A 3HN5A 5DJXA 4NO0B 5E23A 4R0LA 2FT6A 3L6FA 2P6FA 5C92A 2E5EA 1G1OA 4JFWA 5F93C 4X7TB 2EKJA 3B7UX 3OPZH 1V5JA 2GFQA 2ZX7A 1F3JA 1KCKA 3NVQA 3PXJA 3SGKC 3RHWK 4HBCL 2N7AA 1WWBX 3WEAA 3DMMA 4OGAD 1PD6A 2ZXAA 2A4NA 3DJRA 3WD5H 3H53A 2OP4H 4I3RL 3NH7H 1RZIA 1QEXA 3D2UD 3IFLL 4HHWA 4HK3N 4K5PA 4AVBA 3DVGB 4TSBL 1IBFA 2DXQA 4QGYA 4PJIA 2Y06H 1XB3A 1A6WH 1E2WA 2WXQA 3DX0A 3L7FA 3LHPH 1A6UH 4NBZB 4QXVA 5CZVL 3JUWA 4L9LA 4N5ED 4FRWA 3IMTA 3LEVL 2B1HL 1SFDA 4OF7A 1CR9H 3T0EC 2BS9A 1OTTD 2W07B 3STLB 1GGCH 2VWEE 4P3CH 4ZY2A 1AHWB 5F7DA 4NQQA 1ET5A 3IMUA 5IW1A 1W15A 4OADA 5KVEE 2V4LA 3NZ8B 3QIBB 7PAZA 1QHOA 3NABL 4Y4FB 3MREB 3O6LL 4HWBA 5DRZA 1AIFB 2BSDA 1S9YB 4ES9A 1G6RL 3IO1A 1WG3A 1EPFA 1MCNA 2CLZA 4A2HA 3JTBA 3ZJAA 3HE6B 2CO6B 5L2KA 1EMTH 3BQVA 4XMKL 5I66B 4V1DB 5EH1A 1NSAA 4RRPG 2CIKA 4KDTA 5ECGA 3ROLA 3SDDC 1QYGL 4OC3A 1U95B 5EEYA 2EUZA 2AQSA 4GRMA 1WEJL 3FB5A 3D0AA 4LNRA 3D3VB 5E2TL 2V2XB 3BZ4A 4AL8C 3HZVA 2PIYA 3W82A 2ZEMA 2BVUA 4OF5A 2HFEB 3TFBA 1IAIM 3ULSB 2FQGA 3GSOB 1ORSA 5I1GL 5IQ7L 3CZFA 3HLKA 1WBXB 4Y9GA 1R3LB 2GCYB 3PUUA 2ICEC 5FGSA 3EDKA 3BDXA 1FLRL 3IRCA 1S78D 3P0VH 4UCNA 3CSPA 5H37G 4CN6A 4FNTA 2VW7A 3HCVB 4XCYA 4RQQA 3LKOA 4B7IA 4DKFL 1SN5A 2DMCA 2VLJB 4P99A 1Z9SB 4IDJL 2BK8A 5TJWK 5JXED 3VD1A 5JXAL 3BVNA 4MHNA 4NQSA 5E03A 4YFLF 5CBEA 2PWEA 5I76A 1BWWA 3MRMB 4UOQA 4RSYA 3CK0L 3O0LA 1B4RA 2ZXGA 2F0CA 5IGXH 1EJFA 2HKFH 1OF0A 3C8HA 2Z92A 5HGDB 2BRQA 2AFZA 4X6FB 3SKOA 1KCRL 3VUAA 4RI1A 3RRQA 1AOZA 3MLTA 4J8RB 4MNQE 3N5AA 3TOPA 1N8ZB 2PJ2A 3SKJH 3DR8A 3HI6L 2DF5A 4HXBL 4PY7A 3C60C 4AGOA 2E7DA 3HN8A 2DZEA 1M6OA 3RVXC 3WN5B 3PDOA 5A2CA 4IRSC 3LNGA 1QWHA 5JPNB 2ZXWB 3WTTA 3L5WA 5F7FA 5CHNA 4HD9A 3FQTA 3O2DA 4F2EA 4WO4A 2YQGA 1N68A 1NGWA 5C09D 5SWZD 4Y4KA 5DWNA 1ZT1A 3F5WB 4PG2C 1KBVA 3SDCB 4Z7NF 5C08A 5HHQB 2ZF8A 1A6ZA 1X4XA 1VEPA 3PREA 5H2BB 4YSSA 1GIGH 4OBSA 4QLRA 2E76C 1G7PA 4NQEB 1UFUA 4NGMA 2ZD0A 4JN2B 5F0PB 3RGHA 2O93L 5DLMH 5DEGB 1ZY9A 4NX0A 1Y1UA 3C5ZD 4YS4A 1Y0YA 3RTQB 1YY9D 3JWNC 4MMZA 4LPWA 4XNMB 3S8FB 3WIIL 1F4XL 4ZYKA 1G84A 5F7BA 2ODHA 2GBUA 1JWQA 4PHXA 5HHXH 1I4FB 1EFQA 5I6XC 2VE6B 3AXLA 2DJ4A 3AY4A 3EOBB 2NY6C 1DFBL 4PV9A 4P4DA 3QIUD 3U9PH 2ZEHA 2H9GA 1FT7A 1NCUA 1T3FB 4OSUL 3VFPA 1DVFC 4LPTA 3KWWB 1MHHB 1A4KA 3NCMA 3EH4B 2CBQA 2IV8A 2JQMA 1UB5B 1M6UA 5ALCH 1JGLL 2CXGA 1AD9B 4FFYL 5I9QB 1ACYL 4X0NA 2PO6A 1WHOA 3G6JA 4OSUH 1CXFA 4PLOB 5I1JH 5DMKA 4GRWH 5FLUA 4QB9A 5FUCC 3SKUD 1FZKB 3CFBA 3TZVC 3DV4A 1JNLL 3IGAB 4LAQL 3ZL1A 5KAQF 1T20B 3TO6A 3TYGH 2AEPL 3IJ7A 5LQBH 5BQ7B 2BSED 5I1JL 2QMKA 4AVAA 3MC0A 5CLXA 3SYQA 3EUDA 3QYMA 2X4UB 5KYXA 3MLWL 4DQAA 2R7HA 1Q90A 3L1OH 4N0YL 4NENB 3QEQE 4I9XA 5DZPA 3DHMA 1S5IL 5KTEL 2X1XR 4MD0A 2H2PD 1CICD 1GS7A 5DHXB 2HC9A 1JF1B 1IGCH 4UQ9A 4UQCA 3F7KA 4WSKA 4PBDA 1J1PL 4WHYH 4XMPL 1EA9C 1N26A 3RVTC 3DUUB 1UD8A 4BFBD 2PXYB 1ECYA 4PRIA 2CO3A 2EC9U 3TT2A 2DIEA 4R3KA 1VFUA 3FRPB 3UTTD 2XKSA 3SPIA 5IZ7A 2PJ3A 3L3KB 3WELA 3NRPA 4IKLA 4MHHI 3WR7A 2GBAA 1E7UA 3MLPA 3QP3A 1NBCA 4UZGA 4YHKL 3SJVA 5BW7A 3LEYH 1TTCA 3SE3C 3DYMA 3PV6A 3VXME 1JGUH 4H6ZA 1GS8A 2CNZA 1Y18A 2ZXEB 3N85H 4OM1H 2WD0A 1IC4H 2DL9A 5DO2D 3CLEL 4ELDA 5MP6H 5I8OH 4Z7OE 43C9A 5GHWL 3NIGF 2VTFA 5K9JH 2X1QA 3EO1B 4PD4K 4ZBGA 5LWYL 2GJ6D 2PCXA 3K72B 1DCEA 1FF5A 4HFUH 1FZJB 4UT9A 3WOVA 3RVWC 1K4CA 2IFFL 2DJMA 4JO3H 4M43H 1V27A 1TR7A 3O4OB 2CKBH 2YAOA 1AI1H 1T22B 4WHDA 3RAJL 4A33A 4XNHC 3VNZA 1DL7L 2FXFA 1EZUA 2IQ9L 5DD0L 1MVUB 5T3ZD 3S36H 4P5KB 3ZJ0A 3UACA 3DOIA 1HWGB 3T6ZA 5DK2A 4K2UL 3RNQA 4A7TA 5KZCB 4EBQL 1D5XB 1V55B 4JRYE 4C47A 4UDTB 1NCOA 1FL3B 3BUDA 4AL8H 4DKEL 3W6SA 3VGAC 4OZIB 1G1YA 3LXCA 4LSUH 1S9VB 4IDLA 5I75C 1DFXA 4IOIA 4QRTB 5CGTA 1M2OA 4BCZA 5HDBE 3T0XA 3MV8B 1PCAA 1KIPB 3OLIA 4KV5F 1AY1H 4U0RB 1CIDA 1X5IA 1NLBH 3TV8A 4DVRL 4S1QH 3FU6A 5JXAH 3U7YL 5IFJA 3FUKA 3S88L 5EDXA 5T5NF 4BH7A 5T1LB 1DUZA 1JZGA 1WGOA 2N59A 4O00A 4G1MB 3V4VA 1SOXA 4YHZH 2EDXA 1BXXA 1IL1A 4B9YA 1OSYA 3V7MA 4FJZA 2OMXB 5IVNA 2P48B 1MW0A 2ADFL 2XV6B 5GGSY 3SDAB 3SKOB 5IWLC 2YD8A 3QHTC 4S1RL 1JNNL 1Z9NA 4XPBL 1II4E 1KFAH 1G6RH 1GHFH 2B2XL 4ZDHB 1GHEA 4OZFG 1KZFA 1OGTA 5CBEB 4Z7WF 3OM3B 4MNQA 4NYLB 2VLJE 3FQNB 1MJ9A 4DP0X 3FSZA 1AYEA 3R9FA 1MLCA 5I1HH 1G4RA 4K0OA 3FTXA 2YAQA 3AVEA 3CFUA 1YNLH 2ZWNA 2R4SH 4I1RA 5KUMA 1G7LA 3BKCH 3AACA 4PRHB 3SOTA 4I18B 4KX8A 1LWHA 2CALA 4LRNL 2Q3ZA 1NL0H 1C7SA 2GABA 1FPTH 3CQPA 1OD9A 3LKSB 4JJOA 4JM0A 4ZPTA 5KS9A 3V4PB 2FZ3B 4OLYL 3V0WL 4ODUA 4G9DA 2R8SL 5HYEA 1BQHG 4CJ1A 1KJ3H 4ODXA 3TBWA 4JFTA 4MBUA 1XF3A 3KR4A 5DMYA 4UDUA 1ZJAA 3KW7A 2W9DH 3EY5A 3TIDB 4F57L 1JD7A 1B0IA 5JZ7D 1OAJA 1TYJA 1MFEL 5L2KB 1U91B 2XY1A 3RY5A 3SD5A 4IRJA 3ULVC 3ASNB 4AXVA 3KGSA 4CS0B 1NUNB 4QUOA 1P4BH 2XTJB 4RMRA 3H2QA 1MWAA 4YIQB 3KHXA 2JJUA 3BW9B 3KPPB 2VH5H 4DSYA 2GTZB 4ANXA 3BLNA 1ZKAA 3F84A 4HGMA 3X2QB 4IIZA 2X7BA 1U2HA 3ARGB 3SDYH 3PGDB 2NMTA 5IFAL 2WXPA 4KU1A 4JFPA 2Q7YB 3IKCA 3L1FA 4ESKA 4NO5B 1XAKA 2A38A 5D2NE 4N26A 4NXYA 2C3VA 4LDLB 2FVGA 5KSBA 1INDL 4E9TA 5ICZA 3Q6FA 2IXQA 3D51A 3LS5L 2J88H 3D3VD 4M93B 5GSVA 3OB8A 4S1DC 3NCYS 3QJTB 4B12A 3AQXA 3LKOB 5C6WH 5ELIA 3TCTA 4Z6AT 4FNSA 2CA4A 5D8NA 4XVTL 4NZJA 4GNKB 2IH1B 1A9EA 3BVVA 1GHFL 1KWGA 1JYWA 3AROA 3QNVA 2UUDH 5D7KD 4UF4A 4QHMB 2DM4A 5IMLA 1BG9A 3A4AA 4N8CH 4WUUE 4YX2L 4PJ9C 1GIGL 1CMOA 2VN4A 3L3HB 4Q9RH 3LS4H 4FOMA 5DD6B 1PL3A 1PKOA 2YXVA 3SSGA 4UCPA 2Y0MA 1TEFA 3H6JA 5DA4A 2A7BA 5EBWB 2AI0H 3W81A 3A5VA 3UZVB 4RISH 4LEEA 4N28A 3X1GA 2GANA 4BCXA 1I12A 4WI7A 3MLSL 2BL1A 1OAKL 5K59F 3HHSB 2EAEA 5DMGD 1XEUA 2IPKA 4NGSA 4Z7IA 2PPCA 1J12A 5F7LB 1D2OA 3D5OF 5CZXD 4DGUA 4D7PA 2FBJL 3EHBC 3RO0A 2IADA 4JREC 5FDWB 4PPTA 5BUAA 2XWJB 2IPUK 5FYJD 1HSBB 5ISZE 3DSNB 2BWIA 2F8VA 4Z7OB 1NBVH 3U6RB 4HPYL 4QJ5B 5A7BA 1QUNA 2ZP8A 1AR1B 1JNHA 1MCOH 2DD8H 4LCUA 3WEBA 1I9EA 2NY7L 4UEFA 3ATFA 1T5WB 5JLZA 5D1QA 1P1ZB 3VRJA 3KHQA 5HGAA 1QR4A 3HAEA 2FJHA 3TU6A 1AR1C 3DTXB 1UD3A 6PCYA 1FNGA 1SDDB 4V1DA 1FYTE 3BVXA 5D4QA 1A4JA 3FT4B 3OKMB 3WMSA 3WENA 1MDAA 3G9VA 4NKOB 1QWNA 2OYLA 2C3HA 4QHKJ 1T1XB 1TCRA 1SY6H 4GT0A 1PPIA 2R15A 4X6EB 2FT8A 1CP6A 3L4WA 4P3WA 3VFTA 3FRUA 4MCNA 1W8OA 2BS8A 2IBZX 3NFSH 4Y1AB 3VXTB 3VTMA 4TLTA 2ZX6A 3KWWA 4DJMA 4Z7QE 5KBMA 3APMA 3GHBH 3PQYD 3ZKND 1HXMB 1JZ8A 2I32A 3BHBA 3BO8A 5EZOL 2EVHA 1IAIL 4K3DL 1FGVH 2F8IA 1O0VA 1E42A 2OZNA 3BESR 3J2PA 4TLSA 2J21A 3BXNB 4KHXL 5GS0D 4G70B 3VSQA 5J1QA 4F37K 1FNEB 4KH9A 1N59A 4KKBC 1BO4A 2APBA 2C8NA 4XC3L 4MTMA 4ZFFB 3MU3A 1CT8B 4OY9A 3X1NA 2X89D 4X6BA 3GHEL 2BP5M 3V55A 1HINL 4RX4D 2O6EA 1T66D 1V3KA 5BZZA 3RPIB 2IDQA 2O5XL 2APXA 2OBGA 4P3CL 4YHYB 3D7GA 1X4ZA 4GUPB 2IDSA 1BVOA 4KUZL 5FGRA 3IU1A 1IRAY 1T5XA 2QVFB 2YUXA 3K2MC 2COVD 2YK1L 1Q38A 3B2YA 2N01B 4V2CB 5DZNA 2D03L 1MJBA 4KKCD 2E4TA 4JQVA 4XO8A 3L9YA 4G8FB 3LMJH 5D5MA 3NRFA 1KPUB 4AIZA 5I9QC 4HS3A 4OZ4B 4Q9QL 1RZJC 1T80A 2QV2A 3O8XB 4LARL 3TFYA 3ZVVA 4AYDC 4EUPG 2Q86B 3JVNA 1HQ4B 3MJ8B 4YDZA 5CMAA 3BZEA 3GMRA 3V79C 4HGKC 5I71B 2VZOA 3EFDH 4W9ZA 1XDTT 2NZIA 1Z32X 3B3WA 4LSPL 3U36B 4BK8A 1CFNB 4Y5VC 4NNPL 5HDBB 2H7WA 4JJXA 1UM6L 4YL9A 4XCEA 4KTEH 5PCYA 4IS6B 1YEKH 4X6CF 3BN9C 2DQFA 5J6HB 3T0EE 3FB7A 4WW1A 3AU1B 5AEAA 4YDJA 5GS2H 5KAQG 3DTXA 5E4EB 5IHUH 5F3BB 1R3IL 3KPRA 5HDRA 2RAMA 4L29B 2VC2B 4N1CA 2ID5A 4QRBA 2QSQA 2RHEA 3UCQA 3A21A 4GXUM 3DX6B 3M88A 3U79A 1YQVL 3PPEA 4XHQA 2QSCL 5J6SA 2XWZA 4AQAA 3NUKA 5TGBA 5DRXA 5F1KC 5HHVH 1UFHA 5C70A 1VPOL 2CDEB 2ZKXA 1XXFC 4JO4L 2DQTL 4PSPA 4R0LB 2KBGA 3H4HA 4WJBA 1FO0L 4KJYB 1ZWIB 4HMCA 4U1NB 2FK9A 4NFBA 5DJ2B 4HU8A 1KEGL 3WKNA 3M8OH 5IMMA 2PO6C 4U6TA 3D08A 4F80A 4X4YB 5MENB 4OCYL 2OQJB 1KELL 1VKXB 4A32A 5HD8D 4ANVA 4PXCA 7PCYA 1BWMA 4L3EE 1MJUH 2WLYA 4OC0A 3BAWA 3OAYH 4R8WL 3RGBA 4OQTL 3SIKA 2CF4A 5CCJA 2FLBT 5TDNA 5FX3A 2OK0H 3Q8CA 5AYQA 1TU2A 1P5UC 2HYMA 3ULVD 4Y4KC 3DJSA 3T6XA 2FIAA 1NBVL 2V5MA 3Q5YA 3BX7C 2D31B 5CNPA 1IM9B 1KNOA 3VGAB 4N87A 3ZY7A 5IOPB 3KJ6H 3L95B 2G3ZA 3O2DH 1N4XL 3KAAA 1XOVA 2AP2A 3EADA 2YBGA 4EVYA 3HHMA 5CGBA 1OT1A 4C8XA 2J6WA 3PQYA 2K6YA 4QHPA 4G6JH 4IK7A 3RPIA 4LASH 3H2PA 2VXKA 1OL0A 4FZEH 3HNTL 1YEJH 3D0VB 2ZUVA 5EFIB 5F7YC 4OLEA 3WSQH 1CCZA 1E4JA 5IQOA 3PF2A 1WE5A 3O3AB 2YEZB 4P46A 5JYLA 4Z0XB 2JIXD 2EUWA 3FECA 5F7AA 4UQAA 3VAEA 1RHHA 1T5KA 1J18A 3DMMD 1J8SA 1DBAH 2DF3A 2NX5A 3VVVA 1DQQA 1WBYB 3QHZL 4L89A 4M5YH 5DC2A 3ES6B 4ZODA 2IH8A 3U4EB 2BC4B 4BD4A 1FO0H 1FHNA 3H0TB 4PTUB 1XO8A 1UKQA 5DMIH 4NEHB 2JJSC 2MTPA 5EPMA 1YSJA 1LP9F 4R0LC 4DGVH 3PHQB 3O6KH 3ZT5A 4ONGH 3GSNL 5CCHE 3FQ1A 4C2ZA 4JKPL 1KLGA 4I87A 4EDWL 3LRSA 3VXSB 2IH3A 5LJYH 3KNBA 1C1EL 2EUVA 4LPXA 2ATKB 3SGKA 3EOBA 1I9RL 4JBSA 1PG7W 1GPOL 3NCCB 3B2VL 4XVSH 1UXLA 2VRKA 1CVRA 1U8HA 3QNXB 3K6DA 3NGBC 5GS3A 4X5WB 3VFMA 3ZYZA 1MCFA 2IBGA 3O11A 2J12B 5G2NA 3JWNE 3RZCC 1D2PA 1LK2B 5CEXA 1BFSA 4MJIB 3P11L 5G55A 4U49A 3TTSA 2O6CA 3D25B 3MV9A 4ZFFA 3ZPDA 1XGRB 5FYKE 4KVPA 3ZKXB 4J4PD 1U8CB 2Z7WA 4RZCB 4O9HH 1SLVA 1NM4A 4OBRA 2WNKA 4IW4C 2EEAA 5IB1B 2X4QB 4UUJB 3UYRH 2Y2TA 4OZGA 4HWBH 3M17B 1JCVA 2YUWA 1OAXH 4FFTA 5EN2B 4EOWH 2IANB 1UJ3B 3FQXA 1NGZB 4XN7A 1FBIL 3WFBL 2X6UA 4MNHB 4HK0A 1SJVA 7FABL 2I9TB 5E0FA 3EFFB 4JZOA 3F7YB 4U4IA 3HN3A 3PCYA 2BSEA 1A7BA 2W65A 2RFXA 3C6LB 1J8HD 1U4EA 4PRDA 1KSRA 1ZHLA 1AXSA 1G6VK 2XVBA 1HHKB 4QKTA 5IBUB 1E7VA 1IC7L 2J8NA 1LHZA 3GZQA 1ODUA 1MXDA 3V0DA 2QVKA 4MD0B 3GKWH 4OZIF 3D9AL 1JNHB 2G0BA 3ZE1B 5CKGA 4U7KA 4R4NC 1KYOK 1KYOJ 4MY0A 4PBXA 1M53A 3IRZA 1GMEA 4FNLL 2WVVA 5LNDA 1U0QA 4KHXH 1XMTA 4ZX9A 5EO9B 3MRBA 5KSUA 5EA0H 5C7ZA 3RVTD 3ZO0A 4DCQB 4UFVA 4MQ7B 4DZBA 2BFVL 4UI2A 5E8NB 4JLRB 4L8SC 1A7RL 1T22A 2ARJA 3FSOA 4WI3A 5IMKA 1G0YR 3SYCA 3BPOC 5BJTB 1CBJA 3UTZB 1RZFH 2OMYA 4MKTA 4EUPA 2OMBA 2DY2A 4EDWH 3SXNA 3L9RB 2ZUXA 4D0CB 5J56B 1GVIA 1UB5A 4Z7VF 2CPUA 2H5UA 3IGLA 4DGVL 1RERA 1ADQL 3INUL 4I0PB 4OIWA 1DYZA 1ECZA 5CXPA 2CIIB 3ZU8A 1C1EH 3LZRA 5DJ0A 3BVUA 2CKBA 4KH2A 4LCYA 3NIGE 2VZUA 2D4FA 35C8L 1WUZA 3I02A 5DJ2A 4ZSOA 1I9IL 3ISRA 1U3ZA 1NMAH 4D9RD 2J8UB 4TS6A 1HAWA 2VCOA 3JWOC 2NY6D 2AV1A 2IH1A 5E7BA 1I8KB 2EE3A 3QZOA 5AWNL 5INCB 1A2YA 1UWGH 4TTDD 2OOTA 4N25A 3OKOA 1H3WM 1H0DB 1X7TA 2VR5A 4J3OC 3FOLB 3F01A 3IU3A 3FB3A 2ZKMX 1BFOA 4JFFB 3O11B 3HI5H 4WWOA 2EYTA 1L0CA 2ICCA 4UQIM 4E41D 2GTWA 3QNYB 1OWRM 3WJLC 4PJ9A 2WSDA 1KC5H 3QWRD 5I1LB 4U2YA 4GAYA 1Z8LA 3QQNA 3PHOB 1DVTA 5DD0H 3NIDB 4LP5A 2K78A 5HHMB 3TBBA 5JQIB 4YFJA 4W81A 1KJMB 4KXAA 4W6YB 4G7YL 1OSEA 3H7BB 4IKJA 4AH2B 4L4JA 2ZEOA 3PWPE 4LVNC 3S6HA 1L6PA 1T1ZB 2FDBP 2D0FA 3CV5A 3DSFH 5D5ME 4FQCL 4Y2DB 1SQHA 3QXAA 3SDAA 4XWOD 2Y5TA 5DRNA 1J4JA 3IFOB 3BWAB 2TRHA 2Q86A 2VR3A 5MEQA 3C6SA 2WOBA 2C3GA 4YEEA 2CO1A 2QQKL 3SN6N 3FUHA 4M7LL 3K8MA 2CJTA 4HF5L 3ZZIA 1JV5A 4HISA 3LSOA 1Z3RA 4ZMOA 3QUHA 4B5PB 2VXVL 1UURA 3I2CH 5LBSL 1N9PA 5HTSA 3S6CA 4L0YA 4NGHH 2EO8A 3C60A 2P6EA 2EDTA 3SDXE 4KORA 3T8XA 1SEQH 3ZYOA 5BVJA 3LD8C 5A16B 2QVIA 3UG5A 2YOCA 2AS5M 2DQUL 4Y2OA 2CXKA 2H5MA 3OXSA 2Y2YA 3P2TA 3S3BB 5FOBB 1E65A 4H2KA 5GRVL 4EI5D 2QLYA 4WTZA 4OCXL 4TLKA 2DQDL 5A2IH 1F4WL 3H3PL 4BFIA 4LSRL 1QABA 1TXKA 1GOHA 2NY1D 3MACL 4HJGA 1A8JH 5DDHB 4L05A 5C07A 4BK4A 4E0AA 3PBEA 1UM5H 2ROXA 4W6WB 4OM0H 2VABA 4I5BB 1KN2L 5B7EA 4GKNB 1U95A 3CFMA 4PJIF 4PGCA 2J1XA 1RK0A 3SOBH 2VDOB 3WY3A 3L4XA 5SV3A 3FSVA 4M1DH 1BVKB 1FORL 1YLBB 2OL3B 4YHMH 1D5IH 2ZUSA 3QRGH 1K8DB 4PEEA 2B5IB 5LRGA 1TTBA 2V9RA 4TUJA 2CRZA 4ZXBC 1JXGA 2PJ7A 1PD1A 1BF8A 1DZ0A 4PJDA 1CGUA 4J28A 1G0DA 4V1DE 3HZYA 1QFUH 1USQA 3NZ8A 4HAKA 2D03H 4XN8A 3FQXB 4JN1H 1IGML 4RAVA 1MDTA 3FOMA 3TH3T 2NNRA 2YA2A 1LEIA 4LRNH 1AKJD 1DFBH 4LVEA 1JFQH 4MJ8A 4P4FA 1OB1B 4P4RA 4M6OH 1NCJA 1NCCH 2OMUA 3T2QA 2AJZA 2EUIA 4Y16C 4RIRA 3N44B 5JMOC 1TEYA 3KH4A 3PDDA 4MRCA 3P54A 3WNMA 3RG1C 3BOVA 1QFWI 3L7FB 1QW9A 3QC5X 3B3SA 1H3PL 5TFSH 4PJ8A 4OLUH 3TA4D 1XSIA 5HVHA 2AXGB 1ES0B 2VRAA 2X4PB 1ZS2A 1A3QA 4KROB 4IBLT 4QJ4B 5FO2A 1ORSB 5DHVB 2OJZH 3GO1H 1IB5A 5I8KH 1AXSB 4AVJA 3JWNG 1RUKH 4ZGYB 1EJOH 4G80B 2F5BL 4IHBA 1T1YB 3UTQA 1ZEAH 2XBDA 5IGXL 2MMXA 4MB4A 4P2QE 4MMXB 5CGMA 5H94A 4KI5F 3MLXH 4LKXB 4MZRA 1ZCRA 4J1UB 2JKWA 5JZ7C 1IGFH 4DKDC 2J43A 4U9YA 4HSAC 5HHNA 2RFHA 4LOEA 43CAA 4HU2A 2Q87A 4MMZB 4XNMA 4TVPL 2QVPA 4L8BB 4HV8B 2OLDA 4KVNL 2VDRL 3NZSA 1JV2A 2VXSL 5IWLA 4QVTA 1Z7JA 2FX8L 3GLAA 3LJ3A 5JHLL 4W4OC 1SF3A 3L3DA 4ABQA 4EN3B 2X53A 1KENL 1K5WA 4OUUB 3RTQA 3DLJA 4LB8A 1AXIB 2QL1A 3MBXH 3ECVA 2VNCA 4R2GB 2PVVA 1XIWB 1F3DH 1G7QA 2PPFA 2CKBL 3FQ4A 4MJ6A 3T2PA 2XEGA 5L6YH 4C83B 5G20A 1NMAL 3Q2LA 1MFMA 4S2SA 4NM4L 4LXFA 3ZRFC 4NERA 1GC1L 3L5WB 4ZX6A 2YOAA 5ABDE 1MFCH 3MCYA 4MX7B 2F68X 3KBHE 3PLYA 3ABZA 1NDGB 4NP4H 3L13A 4AUJA 4YLCA 1BLLE 1PX8A 1BPNA 5BUPA 3MRJA 1A0QL 2XVKA 4WDIA 1RO5A 3HBGA 4QRRB 3LVTA 1MFNA 4MNGB 4Y9BA 4LCWD 3NH5A 2VDKB 3WIHL 4PREA 1AHMA 5H37A 4KDWA 3OKOB 1HOCB 2AF2A 4J8QA 4K3EL 1HL8A 1WWZA 5DXWA 1A6PA 5HYSB 2PMZA 2CDFA 1DLHB 5EC1A 4CU8A 1J9TA 4GW1A 2FGWL 3ZTDC 3ZOAA 4L0ZA 4XPHH 3IJSA 3LNHA 5C0BD 2VQ1A 2WXIA 4K94L 5AZUA 5T1LD 1CDJA 4KOTA 1SQMA 3X1BA 4N2KA 2OSWA 1CTNA 5EF1A 1Z3GH 4G8FA 1BW8A 1CD9B 2DDQH 3QFGA 4R7DA 1GTNA 4GAAA 1KTLB 4BH8B 3X14B 4P2RB 3KPQA 2VC2L 1JPTL 4FNPA 5EFIA 5F6IC 4ORGA 1BJ8A 3LD2A 4FFYA 1U21A 4B3EA 4PJ5A 4GEIA 4MJHA 4MAYD 5AVXB 1O5DT 1AZBA 4KOCA 2GUYA 1MLBB 2Y7MA 1IAOB 5EU7E 3B8YA 5CILL 1ZTXE 2XACC 3PWPD 3PYCA 1GGYA 2XFXB 4JL2A 5D1XC 4ABVA 4BFFA 1TKWB 2JLPA 3RWHA 4ALAL 2V33A 4OCLC 2F15A 4DCQA 2B1HH 2OXGA 4ZW3A 3FF8A 3BP4B 3ZE1E 1XL6A 4WQOA 2YNCA 2BSSA 1A6WL 2O5NA 2W8CA 3FU0A 4A39A 3ZE1F 5FF6A 3S8WA 2ZOFA 3P02A 5ECJE 4LCWA 1RCYA 2OR8A 5A2AA 4UILL 3FF3A 1JIBA 4QT5B 1S6NA 1E8WA 2ODFA 3AT9A 1TVBA 4JDTH 2R0WH 2XWRA 4X4YA 1J9RA 1FVCB 2VEZA 1FZKA 1XR8B 5DJCB 5IJDC 3GSWA 4HULB 2HJFA 1LNUA 2G3AA 3S4SA 3HJ0A 4V11A 2XWBB 5T3ZH 4XBEL 3ARSA 2Q9OA 3LNFA 4JRYA 3CBJB 4DQOH 1AD9A 3GMPB 4QEGA 3QEQD 5F1OB 5GS0C 3SDXB 1HCYA 1TYEB 2EVGA 2VOTA 3U6XA 1X5ZA 4PW9A 3PABB 2YMXL 1UA3A 2XRAH 4IEFB 5GZNA 3TA3B 1FLTX 1R3HA 4I1NB 4LEBA 3N5FA 2XQYG 1BSIA 2YKKA 2YN5A 3VFSB 4JFYA 1DBAL 3WTVA 4EMEA 3TBTB 4P3DA 1RULH 3MNZA 5FWRA 2FYVA 4LZKA 5L8JB 1ILSA 1A3RH 4G3YH 4GB9A 4AY0A 4K8RH 3GJFA 2DDQL 2D73A 4JRXE 3TLRA 1LEGA 3EUUA 3MRHA 4NCC1 1IQWL 2BJML 2QFRA 4LDCA 4IS6A 5IOPA 5E9AA 2A4ZA 3VXMA 3RWEB 5ID0B 3STBA 1UVQA 2CO2A 4PR5A 3SJVE 3VWKC 1EEUA 4PJ8D 3UTSB 3HRZB 3BAJA 5BXFB 4B5OA 2ADJB 4JHWH 43C9B 1FWXA 4R83A 3E2HC 4UTBL 1NMBL 1M7IB 3CXPA 3TVMD 1ORQA 4HF5H 5K8OA 2PTUA 3H9SA 4U0RC 5I30L 3ZZSA 4XBPB 4WWKB 3CDGB 4TMPA 3VQLA 3P9MB 4UWQB 3DRQA 3N44F 3LEXB 1PVHA 1XL4A 3EDFA 1GKEA 3QEQA 1W0VB 4PTUA 1UXSA 2BCKB 1CICC 4ZD3L 4LLVB 2CGYA 4PMFA 2EEBA 2DQTH 1RMFL 3G5ZB 2AEIT 2L7EA 1FZMA 2JJTC 2G9DA 2VXTL 4A68A 3E80A 4DUVA 3LMSA 1OGTB 1C12A 5GIRB 3ABGA 2AJVH 4H20H 4FFZA 4FTVD 5TF1L 5JIMA 4OP4A 2VDPL 3BVWA 3QDJA 2DQCH 2BP8B 2DYPA 2LVEA 5HMNA 4L5FE 3PNRB 3T08A 1MAJA 5HVFB 5KVFL 1G7HA 4KO9A 1YUHA 4EDXA 2J9AA 5EU6E 4H7VA 3QYCA 2VQ1B 1WIUA 3RNKA 4J3OF 3NESA 2FD6L 1QO3A 2QQQA 3B9AA 4EZKA 5C07D 3D66A 2HJFB 1AACA 1SHSA 2FRGP 2PWGA 2WLJA 5DJXB 1A4BA 3GMOB 1NBZA 4ZQKB 3NIDE 1IARB 1W9XA 5KSAC 5ILTH 5IEHB 5I8KL 4J3GA 4WU7B 2DW5A 3K2UL 2QPDB 5EBMB 2WTRB 1N2RA 3OR7B 4X99B 2B59B 2VSCA 5IJVA 4QAMB 1IAOA 3QUZC 4NZUH 4C57C 1NPUA 4XO9A 5IVXE 4PJFB 1Z4EA 2WPWA 2HQYA 2ZSWA 3FONB 3LEVH 3R1KA 5F21B 3K5RA 3KR3H 1DSYA 4OJYA 1I7TB 3V6OA 1KZYA 1RZFL 3MV9B 4BIKA 2HLEB 2J8HA 1EUTA 2GTQA 5KYWB 4G6FD 1RIVH 3POHA 3MREA 2BFVH 5DRZB 3C9NB 5MERA 2DLTA 2J56A 5F7EH 3S9MA 2ZYSA 4AV0A 4EE2A 3BXMA 1NAMH 5GZND 3ESUF 1A1MA 3H54A 3PWJB 1MCPL 3VM5A 2KLTA 3SHPA 4JB9H 4TNWF 5AG5A 4NZUL 2HJKA 4HH9B 1DSWA 2CU9A 4HIQA 3UDWA 4N8VA 1N10A 3UAJD 1I1YB 4Q4IA 1AJ7L 1I1CA 4LSTL 5EORH 5EU3A 5A40E 2F61A 5AAWA 5K1NA 4HKZA 4WWVA 3CDXA 1RLWA 4Y5YB 1JS4A 1HYSC 4IU2A 1E9QA 4XNUH 5ENWA 3UPCA 3AUVA 4BWWA 3QI9C 1B4LA 2CLZB 2NXZD 4OLZH 2GEQA 5B8CA 2G75B 4JRYB 4FQ1L 1RSFA 4GBXA 5EOCJ 3KPPA 1MSPA 5D7JA 3L4VA 3LRKA 4FD0A 4JLRA 3II1A 3WE6A 3JVGA 2C6CA 4G83A 1ZVYA 4MJ2A 5D7IB 3P1VA 4KHTL 3X11B 4NPYA 3FQWA 3VXPA 3Q43A 1G9EA 2DTML 1BCIA 5I1HL 5KSBB 3BEWA 3GWJA 2BX5A 3ELQA 4JFQA 5AB1A 2ZELA 2X09A 1R0AL 5GRJH 3OXRB 3FTUA 5TE4L 1LMKA 1MCDA 2EXWC 3FU8A 1NWOA 4B7LA 3OKMA 1B9ZA 4F3FB 3VFUB 2OU2A 5EUKB 3WT4A 2MSPA 4CSZA 2OYMA 3BWUC 4Z7OF 4I77L 4LLVA 3HCVA 2R69A 4PJIB 4QRPD 3S0PA 4DIXA 1SN2A 4NC1C 4H25A 3ABMB 5F7EL 4UIMA 4X5XA 2D4OA 2CR0A 1FGNH 2V7HA 4W70A 5DK3A 4J4PC 1IIDA 1G6RB 3RIFF 1CD1B 4AW7A 1XBDA 3DSNA 5INDA 3O81A 2ENPA 1DQDH 3NFSL 2C1PB 1P69B 2HMIC 4HK0B 1YJDL 1NKRA 3G6JF 1IY7A 1IZJA 3OTTA 3ZRCC 2HH0H 4TQHA 2VZ3A 2APVA 2KLRA 3UZQB 4P5TB 5KEZA 3NZUA 3WNLA 2OSLB 4FQPA 5DD6A 4X7EC 1F00I 4JHWL 4ELMB 1H9DA 5IBLD 5D70L 2JEVA 1SLUA 4U1LB 1LYQA 4WUUD 1G7IA 3ISYA 1X6NA 4FFWD 4WAFA 4P2OB 3FUFA 4DPCX 1BVLA 2P28B 2YSSB 3FHAA 2NOYA 3QIBA 1K4DA 5D6DA 5KYWA 2XT1B 3MNWA 4QHUB 3CFIC 3QEGL 4XNXL 4XNZB 2LLNA 1Y6KR 3GSVA 4YHOL 5D9SB 1ZLIA 2OH1A 5M94B 2BXYA 4IGBC 1RZJL 1WTGT 2EYSA 4P2QA 2DBLH 4G9FA 1EAOA 2WVVB 1LK2A 4XP6L 1NGPL 3FONA 2XPGB 4GW5A 4K3GA 5FCUH 5AZ2H 4X8CA 2X4SA 4B0MB 2OL3H 3WTSA 4WHYG 3L3GA 3DHUA 4JDVA 5FFOA 4GFTB 4MFPA 5JNYB 3VDBA 2XA8H 3W11C 1ELMP 3UO8B 1J5IA 3CPLA 1PFCA 3K71A 4HEPG 1GYAA 1TITA 3GS4A 3M7OA 5ACLA 5IW6B 1KUYA 3Q9PA 3K0WA 3DGVA 4GXHA 4XOBA 1SVCP 5J6HA 4WW2B 4G7RB 1P1ZA 1FFOB 1NTDA 3O2DL 5IR1B 2OZ4H 4PCKA 5CJBA 2R0LL 4WWNA 5D7JB 4PN6A 1TLMA 4XI5C 3C6SB 3HG1E 1ZTXH 4XPFL 5T1MA 4OAEA 4P46C 3CVDA 3MODH 4MNHA 2I9TA 2MOQA 4WIQA 4QO1B 1OF2A 1T1WA 5FA4B 2AQTA 2DQIL 1IGMH 4Y4FC 5GS1C 2YPLB 1QSFB 4PS4L 4UV4L 5EDSA 1DUZB 3ECWA 1KG0B 2MNUA 1DQIA 5JORB 3BVNB 3QPQD 5DU7A 3U7WL 4Z1PA 5C0RH 1IAMA 1R0AH 1TKHA 1UZ8A 1P4BL 4LLUB 3ARDB 2GG1A 3VFOB 1A9VA 3OXSB 2Y1YA 3IU4H 3WJMB 1N19A 4ANWA 1MCHA 3SQBB 4J6RH 3APNA 3TEZA 3UIZA 2X2YA 3G04A 2W0PA 3WXWL 4F8NA 1MFBH 1JZ6A 1CFTA 5DQ9A 5FECB 1YQVH 2Y7QA 1EK3A 4XRCA 4P06A 5FYLH 3OAYK 1UZ6F 1PNDA 1X5XA 4MNQB 4NYLA 5HVHC 3IDXL 2R23A 1TQVA 4DGYL 5ABAA 2GSIB 3HI1B 1S7LA 3VB9A 1QI3A 3IFNH 1J1OH 5E6RB 5J13C 1JXDA 1JHKH 1OT4A 4KTEL 1EGJA 1LM8V 4LDEB 4Q38A 1YEIH 1KCUL 4DFHA 1NGWB 1MNNA 2LE9A 2NY5C 3QORC 4KVXA 4TNVF 2JBJA 2AJZB 4JQIH 4R5TA 4ZFOA 3RWIA 2HT4D 1ZVSA 2AGJL 1CTMA 4ZS6C 4GS7C 4FQJL 3C09B 3K1KC 5L9DH 2KZ1B 3KI9A 4XN4A 4B11A 4D8PA 2ZXVA 4MA7H 1NCDH 1AGBB 2F53D 3MV11 5IVZB 4P5TA 2DH3A 3E9TA 3N55A 3BCDA 1TQBC 4UQ2A 2BNQD 5CM1A 4IJTA 2XTLA 7TAAA 4Z7VB 3RPBA 2Q76A 1HESA 4IU3B 5FA3A 3MJGX 3P11H 4N2LA 2AJ6A 3C60D 3N3EA 3K46A 1ADWA 1MCIA 3MRCA 4HLEA 5IM7B 2YD7A 3PGCA 2FS5A 3JYCA 5I17A 5E24E 1NCIA 1X5AA 3SKNA 3VQ1C 2X4SB 1X12A 1U91A 5DD3L 4AQ8C 4UDTA 2G4EA 2H1PL 1K6QH 1T89A 5DFVC 3VGBA 4FD6A 4XXDA 4J1UA 4PGCB 4TQIA 3ZDXB 4F7TA 3AG1B 4P49A 3T2LA 2J8UF 2O5XH 2XN1A 1N0XL 1MVUA 4Y5YA 4FP8H 2AAVA 4PCTA 5J6GB 1F11A 5DDHA 4XP1H 4CMHC 5C0AD 1TZIA 4LSQL 5LGJB 1GZQB 5FUOH 5DHVA 2BVQA 3V4VL 4MXQD 5I1KH 1B90A 3QHZH 3IGAA 4IBUA 4Z3EA 1OAUL 2OCCB 1R9FA 1RZKH 5TQ0L 2QADD 4JFQB 3C2AL 1G9NL 4MMYB 4Y5XB 2R2HB 2DN7A 1CGXA 3HBZA 3I3EA 3O3EB 4PGZA 3P2BA 2J57A 2BSWA 4ODHH 3NCXA 4OIFA 2OR9L 3LZFH 3DX4A 1DVFD 2QQNH 3SDXF 3W9DA 4X5RA 4CMMA 4EN3C 4RMBA 3DHJA 3OAUH 1S7TB 3C2AH 4FQXC 1CX8A 1WIPA 3ZKMC 5IQLA 3ZKSD 5IB3A 1LEIB 3MRUA 2XUWA 1WC7B 4G6AD 3P4NB 4UIMB 4X5XB 3D4GA 3WYRA 3IJYB 4JN2A 5D70H 2X4QA 4KXBA 3PB8X 1FNSL 3VWEA 2OSYA 3GEFA 3CTTA 3FQYA 4QNPE 5J4MA 3B3VA 2KZKA 3L3JB 5J5EA 2Z1KA 2QELA 2GK0B 5F1IB 1NFDA 1EHNA 1FSKC 1HYRC 1NCWH 1YEGH 2AK4D 1NM9A 5JOEA 4PI2A 2YXFA 4PVLA 3VG0H 4R7NB 5AKTA 1BAFH 1QSEE 3D67A 4XE5B 1A1NA 4RGNB 3WFEL 1KYDA 4ELKA 1HH6B 2LFEA 2WW8A 4FNQA 2J8RA 1KIQB 5EWIL 2OZ4A 4PJFF 4XMKH 2HFFB 2V5YA 3OSVA 1FC2D 1P2CB 5CBAA 1GGBL 4MJIE 4HJGB 1IKFL 3UTTA 2YNCC 4C56D 1CYXA 1Z0NA 5IG7A 1NSNL 4Y19A 1AIZA 3RWFB 4JN1L 4PV8B 1PEWA 3U36A 4R8WH 4MD4B 1R43A 3IDNB 1S7WA 3VYNA 2P42B 5F1NA 4CGUB 3GSVB 3K3QA 3AFLA 3DDFA 4RSVA 4MXVF 1NEPA 4L48A 1Z9UA 2VXQH 5EG6C 2J5LC 1UD5A 2IALB 3QUYA 1VFBB 3L16A 4NIKB 4PTTB 4WRLA 2ZEEA 2XU9A 1E5BA 3PP3K 1ZLHA 5E99L 3VD9A 2FIRT 2ZKWA 1YECL 3TV3H 4PPZA 2OZGA 2EO1A 5FF6B 3UJIH 1R5IA 3T4AB 3CFJA 3PRZA 4PJAA 4AB7A 2YUVA 5E1HB 4X80H 3TJHC 1ET8A 5IFHL 2WSKA 2DTMH 4FFYH 3TO9A 3P4LA 4MXWL 4PW4A 2VN3A 3ULUE 4H0IA 1FFRA 2VLKD 5F96H 3FULA 4HCRA 2LTQB 4OD2B 1INEL 1QA9B 4GKSA 4HKXA 5HVFA 2WKLA 3T77A 2DL2A 3TYGL 2R69L 4CILA 1E50A 1Q72H 1U8HB 2ZE0A 3T3MF 1CLYL 4Y16A 4J3OG 4J6RL 4CAFA 4FBEA 4EFDA 4OLUL 1ZHKA 2I9LB 4NO2B 3I50H 3KM1A 4H25B 3WIHA 1BQHB 4XO4A 1GW0A 1VA9A 2F19L 2CUHA 3GXUB 2BMKB 3NP3A 1CPXA 2NXYC 3RVVC 2G4GA 5HSFA 2HRPH 3ULSA 3NH4A 1TQBB 3LPPA 3VWJC 3A67L 4K5MA 1NBYB 4QOKE 4DEUA 4Q0XL 5M7QA 4NEXA 5FO8B 2EDLA 1O9WA 4M02A 5KSAA 2K45A 2ZUQB 4PB9L 2YC1B 4J3XA 1FAIL 1FVCA 2UUDK 4PWGA 5IM7A 3QORB 1CLZL 4YDIH 4GAGL 4JO2H 5D4IA 2CO6A 4RETB 1XF5B 1A2YB 4HJUA 1Q4NX 2M2DA 2YD2A 3BGAA 2P8PA 4RBPK 3WDJA 5KWYC 4L8DA 1V3MA 1OPGH 2NY3D 1UACL 3HUVA 4FQJH 4N8VG 4WHTB 3GJEA 3I1UA 4BZ1L 2HP4A 4MYPA 2BSSB 5F44A 1BDYA 4F7PB 2R8VA 2B3IA 2NRDA 3P0GB 5D1XB 4DPAX 1JN6B 2FJHB 4CAVA 3VD2A 4I0PA 1WZKA 1NKOA 3STLA 3IETB 1W0VA 1X6LA 5D55A 5F96L 5FM5M 1M56B 1PKQE 4LVHC 1NFDB 2X87A 4NB7A 1ND0B 3IKCB 2BCOA 3GMNB 1NIBA 1DJXA 4FQQA 3Q8BA 5ADOH 5I4MA 1EVUA 4H0GA 4OGXL 4N6RB 4RQQB 4A67A 2JCCF 5IMKB 3D05A 2WPGA 4AC2A 2AV1B 1KXTB 1SUHA 4PCSA 1E90A 1F4AA 1NAMA 3VJ6B 3TBVB 4F37F 5FYKU 4KO5A 1PLGH 5I66A 1M4GA 4HSQA 1N67A 5CWSA 4POZD 2W0FA 3RYOA 4FADA 1BAWA 1OHZA 4FL4B 2IAMA 1YAIA 4C56A 2DLFL 2HUEA 2Z35A 2IGTA 3EYUH 1J0JA 3D3VA 3CHQA 3OLGA 2PYFA 1DLHA 5EC1B 2VMDA 3RDTD 3QQ4A 3AT8A 5DI8A 5DUMH 2V2WB 2VMJA 4XCNA 1CS6A 1J48A 3MRDA 5T1JA 2B9AA 4S0SD 1M6OB 3CD4A 2ATPA 1U8NB 2J44A 3FFCA 4BQ8A 4YPGA 5B4MD 5C0DB 4JHZA 4XWGH 5CU9A 3FAXA 3VU1A 1I1FA 1QLFB 3H1ZA 2KPWA 3MRHB 3QSKB 4LL9A 4QTHB 4TRPL 5ERWA 3F58H 3SEPA 3KVDD 3D2UA 1E40A 4R4ND 2ZPKL 2AC0A 1BD2D 4H8UA 5HXMA 3BC9A 3FU9A 2D9CA 4RAUA 1N6VA 2RJMA 4GRLD 5F9DC 1MPAH 2E9GA 1WBZA 3H2WA 3N1FC 4K9EL 3RB7A 3RWGA 2UV3A 4LHUA 3V4PL 2PW2B 2MPVA 5I76B 2I5YL 3SDCD 3MYJA 3ARRA 5BMFL 2GK0A 5E9DD 5F1IA 4BFRA 5SWZB 5ADOL 3D39B 5DURB 3GZPA 4YWYA 3GLZA 1RUML 5FO9B 5D2NB 2EDDA 5IB4A 5JIKA 4J3VA 4TVPH 4UOW1 3T4YB 3QZPA 4CADA 1HQ4A 3MJ8A 2J7LA 4NI6A 4ZUUB 5AAWC 5L4FA 4ACTA 3SO5A 4MGXA 3HC3L 4PXDA 4FN0A 3FCTA 4BBHA 1CFNA 4OZ4A 1KV7A 2ZYHA 3HC4L 3RGVB 4PJAB 5B8CC 5CBMA 5IMOB 4M3SA 4HJSA 4LLDB 2ZNXA 2A9AA 1OCWL 4U6YA 2WQAA 3ZTCC 4F8LA 3ETSA 3UBXG 2QMJA 4FA6A 5E6SB 4MJ5A 4WFGE 4ODVL 2NTFA 4GQZA 4LHUG 1OM3L 5FUOL 2H3KA 3KPOA 4M6OL 3HNSH 4NKOA 4ZYKB 1O9ZA 4RNRA 3CUPB 4G42A 4TNVK 3F62A 5T1KB 3IGRA 5EPMB 1QLRA 1FFPB 5T5NG 1ULVA 1OAQL 2F6AA 1UJ3C 2YRPA 4XX1E 4CYQA 4WW2F 5KVGE 4KZDL 4X4ME 2H26B 4LLAA 2POKA 1J0KA 2UVEA 4XN5A 1MH5A 1NEZA 3ESNA 3MJ6A 5EC2A 5D7LB 3RUGA 2MHAA 2DOCA 4FDWA 2AV7A 1DBKL 1ZLUH 5BVJB 1TCMA 2F9BT 2DYPB 3H6AA 4G2AA 2B1AH 1CYGA 5B38B 3GBMH 4KWUA 4L1DA 4ZTEA 4F7EA 3EO9L 3OPUA 5DVOA 3OPZL 2Q8BH 1AO7E 3OC8A 3EJSA 2MQGA 2NLJA 5DJ0B 4QR7A 4MCMA 4X6CA 4ZO9A 4AYFB 3GEWB 4KY1H 5EOQH 3RA7L 2BNRB 2HRPL 2N56A 4NCC2 2HRLA 4ONOA 1RY7B 2K1MA 2F08A 4UT6A 1Z8XA 3X3FH 1DVZA 4AQEA 1I3RA 2VLRD 3I50L 2GUOB 2XTSA 4V1DD 5C1MB 4M8RA 2PCPA 2VC2H 3H3PH 1JNLH 4I8DA 4NBXB 5ANMA 3RZCB 4Q14A 1CFVL 2R56H 2ITDA 1FVDA 1IE4A 1A6AA 1MFAL 4WKZA 3SOBL 4J3WA 2X89A 1BZEA 4QIRA 1S7TA 2DAVA 4DT2A 1AS6A 2IG2H 2SEBB 3C8KA 3FOMB 1E3ZA 4WI5A 3VFWB 5ADPH 4X6FA 4WK4B 1U6AL 3LNEA 3O6MH 4LQFH 1RP9A 4NRYB 4W9DC 1JWSA 5E00A 2V2WA 4XCNB 3ZMEA 3P9LB 2ZX8A 4NKIL 1UASA 4XNBA 1S7KA 1FG2B 1NMCC 4APQC 5D6DC 1IEBA 1PG7H 2XZAH 2CGZA 3D6GA 5BMFH 4OCXH 5C3TA 3UTQB 2O61B 1KWMA 3L3IB 2YR3A 3WHE1 3WKYA 1O6TA 4PJHB 4HX1A 1NDGA 2V5TA 3UYRL 2EH8L 3LIZH 2YARA 2YHGA 4NKDA 1GMIA 1I7ZA 1LTXA 5IHZA 4JFOB 4NZRL 4QYOA 5E2UL 1A1NB 5DK2B 3PWJA 2DTSA 4KJWD 3SBWA 2PABA 1JV2B 1HHHA 1C5CL 1FYTA 5EB9A 3UY5A 1GC1H 2CA3A 1B2WL 3GXTA 1IIKA 3SYOA 2GIMA 4GQQA 4CSPA 2DQIH 4NSKA 4JKKA 3TX4A 3OKEB 4M6MH 5IB2B 2FTAA 2P5WB 4FQIL 4L3CB 4M9PA 5C09A 4MFHA 3K5SA 1E9QB 5ENWB 4BSJA 5CEZE 4EQ2A 1GL4B 4Z3TA 5DJAB 1LEKA 3FU7B 3RJQB 2OSLA 3NJMA 4RESB 3BYTA 3D52A 1N59B 3ARED 5B1CA 2Q7AA 4BSWB 3MA9L 4KGLA 4Q6IB 5CSZA 3RDTA 1C5BL 3EJPA 3P73A 2BH0A 1FH5L 2NY4C 2WBKA 2OMXA 2XIDA 1W72H 2DWDB 5GS1A 4WV1A 5DSCA 2I27N 4TUUA 2RACA 3GM0A 4TXVB 2C9QA 1CDHA 2F7QA 3LKQA 2BJMH 3SKJL 2AKRB 1A65A 1SOQA 5F3HA 3REWA 2NY2C 3IGUA 2J8OA 2FJUB 4BFIB 4M6NH 4LSUL 2WSAA 1VZGA 1BYPA 3GBNH 4MY3A 4MAUL 3SDDB 4FMVA 4PJ6A 4ZOCA 4L8CB 4G1EB 3KWUA 2APSA 4LQGA 4ZQTA 2XNAA 3DGDA 4R96B 4XPKA 1S9XA 3DMMC 3WGUB 1UOWA 1L7IL 2BHFA 3GMQA 4LCCA 1KPUA 2EILB 1S2EA 4AIZB 4P4KA 4C2XA 4WUUA 4ENEC 1QSEB 4XNZC 4F8PA 4KKRA 1NH6A 1CFTB 3CMOL 3HZKB 3NSCA 1BZ9B 3HR5B 5L2JB 4L9LC 3GPSA 1H0DA 1I9JH 3TL5A 5C2UB 4PP1C 1BQUA 1WAPA 5CLTA 5TK4A 1N4XH 1RUQH 2L04A 2GPZA 4ADJA 3GRGA 1BVLB 3T3MB 5GGQL 1QD0A 4YGVB 2EDMA 4ZUWA 5EO1A 1DJZA 3MLTB 4J8RA 3EDEA 4P2QB 3UADA 4WY7H 1LRZA 5E4AA 2NW2B 2J20A 3UMNA 3QQ3B 1QSFA 4JAMB 4OQTH 1UH2A 4DP1X 4IRJB 2GJPA 3G5YA 3QYNA 4GSQA 4W9GC 5GCNA 1QFUL 2DQEL 4IHMA 3KYKH 1E9OB 1MW3A 4ZW5A 5J8OA 3GC3A 2RD0A 1KGCE 2DS4A 4KK9C 4YWGH 2DKUA 5I19H 5D7LA 1UVQB 4PR5B 5FYJH 1IO4C 4YHML 4Y4KD 1E5CA 1P7QA 4HGWB 4XAWH 2R29A 3W38A 4G8EB 3PL6D 5F1SA 4MQ7A 4DZBB 3IDYB 3OAZH 3ESVF 3UP6A 1YNTA 5EUOB 2P5PA 3PZJA 3CPXA 4NKDB 3CUPA 3QO1B 1CGTA 4G42B 3MMEB 1KDJA 4UQBA 3IAPA 3PY9A 2VL5B 5TD4A 4MFLA 2IPUG 1BD2E 4B14A 2WAHA 3CLFH 3DVNB 4LAQH 3AMLA 2DPTA 4MJ5B 2YFNA 3B7SA 4TUKL 3UEQA 2CBMA 4NKMB 4WNQA 1FO0A 1QW8A 2XYCA 1X5MA 4MRIA 1I85A 1UD2A 3F7QA 3PABA 2WPXA 3EGDA 3BD4A 2Y06L 3ZO9A 1I8AA 1WFOA 2SEBA 3LV3B 2A9BA 1J1XL 4WGKA 1F8TL 4PGDA 5JW3H 4A7VA 4MDJA 5I2IA 2L0DA 2OP4L 3NYKA 5IQNA 4EN3A 4GO6B 1PD0A 1HH9B 3HVDA 2JI2A 1XGZA 4ICWA 1TZAA 4M62L 4W1TA 5HHOA 3VFNA 2VW6A 4XPBH 5HY9A 1Z5LA 2W91A 3MSPA 1IX2A 1ZANL 2PJ1A 3ZTJG 4G1MA 2IPKB 2ADFH 3MBEC 3MN8A 4PQAA 2ESVB 3F7YA 3GMLB 4Y8DC 4E5XA 1TO4A 5KN5B 2W38A 1Z9SA 4IMKA 4N2FA 1OCWH 3BKML 1G94A 3IU2A 1IT9H 1J0ZA 3G5WA 4GOSA 3CVHL 3U4KA 4IRSA 1KJVB 4MQSB 3WKQA 3CCHA 3V52H 1UZ6E 4OFYD 1DHKA 3PWVB 1UENA 3S37X 2WYZA 3S6KA 1HHIB 1SGKA 4Y8AA 3ZHKA 4E2OA 1CE6A 1MCOL 4HCIA 1JWMB 3E3QC 2G2NA 2X9ZA 3WY2A 3IDMA 5C0ND 1KEMH 2V3EA 4PK3A 3CN4A 3W39A 3AWGA 1G7JB 3G5VB 2J1YA 2FBJH 3VXNA 2J71A 2NY0D 4BV1A 5I73C 1HZHH 4UQ3A 2ZX9A 3II2A 2Q51A 3UTOA 1LO2L 3QDHA 3CK0H 2KYIA 3PV6B 4KRNA 1F56A 3RZAA 3QQ9D 1JHLH 2J55A 3ATAA 1XTLA 1YG9A 4OIAA 1IYLA 4N2DA 1E5ZA 1GZPA 2FX9H 4FQHA 4I48B 2P6GA 1KCRH 4X5WA 1QSZA 4OLLA 3REVA 5ID0A 1HC1A 1H9VA 2X4TA 4XPHL 4DKFH 5HPMA 2VL4A 4M8QB 4M7KH 1T1WB 1AANA 3O4LE 3QUYB 4NF1A 1CTOA 2EIKB 3G3SA 5BZWA 4Z95L 2AJVL 3NSYA 2J25A 4H20L 4K3EH 4ZY1A 2FX9L 3VG9B 1IC1A 1RURH 1NFDF 4LEOA 3QPKA 2J3SA 1QACA 4ODHL 4L18A 3CU1A 1XGRA 1VHPA 1JPGB 1VADA 1HXKA 2VR9A 3L5XL 1YUKB 1F2OA 3UMTA 1FH5H 5AAMA 4JGUA 1A22B 4B5ZA 4AI7A 4OZHE 4UZUA 8FABA 3LH2L 3FN9A 5JOFB 2QPFA 4NKMA 3I3GA 3AM8C 4OU3A 2XBZA 1R5VB 3L4UA 1D9KA 1DJIA 5LAPA 2XZQH 1ZSDA 4KQ0A 3QDJB 4G8GE 4PRIE 4HIXH 1BX2A 3QUMH 1VZHA 3O3BB 3SO3B 3LTVA 4ANKA 2HLAA 4R96A 2GBTA 2AFWA 5SX5H 3P3RA 1AQ8A 1XR8A 4XTRD 1BVZA 1ZT7A 3BKMH 2Y6SD 3LY6A 2C6GA 4JPVL 1R3NA 4Q56A 3CQFA 1SMAA 4ZMZA 4PWEA 1ZOXA 2AVGA 2BNUB 1NUDA 1XAUA 2ITDB 3HRZC 2VMEA 4WKZB 4P23D 1D6EB 4L4VD 1GYUA 2JB6A 4MFZA 1QPPA 2A9DA 3IDGB 1HDUA 4RWYH 3QJFA 1VJSA 4JRXA 1CG9A 4FQXD 2J5WA 3WNKA 3DX2A 5BW7C 2F7RA 4J12A 1SHMA 2FJSA 3T0DA 1REIA 4XX1G 4H1LG 3CDYA 2C1OB 4LSVH 5DR5L 1P7BA 3DI3B 4PJBE 4OTXH 4FXKA 3TO4C 1WJ3A 4UOZA 4XPAH 3QJOA 3O4LD 1T1ZA 2AABL 3EGSA 4O2CA 3O6FB 4TNUA 1RZ7H 3K7UA 4FXGA 4NFDA 4HZLB 4HWZA 3FCTB 4P0DA 4O5LH 1P84K 5J1SC 3RQ3A 3IDUA 1G7PB 4II9A 3QAHA 1U8QB 2H47C 4HOXA 4YAQA 4PJHF 3U1SH 1IJ9A 3WXWH 4J5VA 4AG7A 3GTVA 1HYSD 1EE3P 1U8LA 1AGEA 4UV4H 1P0SE 4J7RA 3MHZA 3C5ZA 4MCSA 2W92A 2VSDA 3IETA 3GFUA 4ZMQA 5EF2A 2BHYA 5TE6H 3D68A 3B2XA 5GRVK 2AXJA 3DRQB 3P77A 4NN5B 3P2HA 1DJSA 4Q0XH 1K4JA 1S3ZA 1OHQA 2Y5EA 4JW3A 4P10A 2A83B 5E96A 5T3XD 3QUYD 1B0RB 1EFXA 1IAKA 3NCEB 4NQDD 5LKNA 4PIBA 1D7BA 3F7PC 3MDJA 2WO4A 3HAEH 1HZLA 2FB4H 1SHWA 1SVZA 3KR3L 2APWA 1F45A 4WV1B 4XZ4A 4IRJC 5B1KA 3V7AE 4CL7A 2F1BA 5HPMB 5K59E 3W9EB 3KPSE 4TUJB 3JYBA 4XCFL 5CEZH 1CE1H 5EUOE 4JQXA 4M1DL 1AY1L 4HXBH 2WM0A 2ZW5A 4XC3H 3BI9X 2HFGH 3BKJL 4JM2D 3NAAH 4I3SL 4LPVA 2V8HA 3V6ZA 4GINA 1Q2CA 1KJ3L 4CC4A 2XEJA 3GUXA 4KK9D 5FHBL 5AVRB 1G7JA 4HKJA 3QEHA 4PXBA 1NA8A 5EU4B 5I5JA 1Q0EA 4RAUB 4MCZA 1BFTA 5DJDA 1A7PL 1P4LB 1T89C 2FWOA 4MHHG 2ZZUT 2VXTH 1IBHA 5I8CA 3L9EA 4X6DE 2P80A 2K9FB 1RZ8B 2LAGB 3GIZH 5ETUB 1J7VR 2X88A 1VAHA 3C6EA 1A4AA 1GYCA 1QLFA 5EU5B 3WY4A 2OMWB 5GGTA 4FYSA 1YNLL 3QDGB 5KW9H 4K55A 5HDWA 4N86A 3QQDB 2OV0A 2Y4SA 5C6TH 1F3DJ 2J73A 3DDGA 2LW3A 2WP3T 3BUIA 5FR3A 5EC4A 3OKKA 5TF1H 3VH9A 1GYVA 5LWYH 3LWUA 2K4AA 3R06B 4PK2A 1GZHC 1TMCB 2AJXH 4CW1B 1N2RB 4IMLB 1NGYA 5M95B 4YK4C 2YIHA 4YBLB 3NCJL 4EN2A 5AL0A 3MTRA 1RZGA 3CLEH 4QRFA 3GUFA 1NZRA 3KL3A 1Y0LA 1ET7A 4QNPF 4PWIA 1CBVL 2ORBL 2CY2A 5D7LE 2ZT9C 2FO4A 1R34A 4ODUB 3RWJA 4CSTA 4L4VA 2AQQA 3RZWA 3WXVH 4YBLC 1Y9WA 1RPUA 2LLGA 1RTQA 3HE7B 2V77A 2BY2A 1EHLL 2X4PA 2OMVB 4Y4HC 5E8EA 2R9HD 3DNSA 2BNQE 1PY0A 4E0RB 4NJQA 1TKFA 4IK2A 3O3DB 1MHCA 2F53E 4UNIA 4L1BA 5L2KE 4EEEA 3S88H 3V2AR 3W1ZA 1GAFH 1XD1A 3QCUH 5DUML 5FYKD 2W94A 3OKLA 2OS7A 4FQQB 1H8OA 1TJHH 1OEZW 4HPYH 4JZJB 3SY0B 5A28A 3OKNB 4PRNB 3MYJB 4RVBA 4A2EA 5GQBA 3EF7A 3GIUA 2FX8H 4JKWA 4KC3B 1JWUA 4RISL 2NY5H 2AITA 2COQA 2UZIL 3MRCB 3ARYA 2HV2A 4YE4H 3ARGA 5FV2A 5C0FA 3OAUL 1MCQA 5E6IB 4R9HA 5B7FA 2EUXA 2EVNA 2D0HA 8FABB 3US1A 3HG1D 4JMXA 3M7FB 4P46D 4C54A 3NMEA 1HEEA 1MWAB 1U3JA 4YIQA 4OD3H 3ZMRA 3GNML 2QSCH 3TNMB 3SJXA 4Z7AA 2XWTA 1VLXA 2VLME 1U42A 2VZTA 1TQCC 1IT9L 2VJ0A 4OLZL 4PJIE 5SWSB 4QF1B 4R5VA 1SXNA 3IE9A 3MBEB 35C8H 3MRDB 3QPQC 3AB0B 5IV2A 3IK2A 1FRGH 4FFWC 4P59H 2AK4A 3E6HB 5IF0B 3ZUCA 2WQXA 3TZVB 4YDNA 2C9AA 3GGWB 3B35A 2FCBA 3N40P 4FQ1H 2BWDA 5HHXL 5LYIA 4H0HB 5IBTL 1RLBA 3WEXA 5F72S 1KGXA 4LLMA 3ZZ1A 1WDAA 4XP4H 1P9MC 4WFEE 2MOGA 4LCCC 5IQ9B 3GD1C 1YCSA 1E27A 1D5RA 1CD1A 3EJYC 3EZJB 1DO5A 3LMJL 3IPBA 3OWEA 4ETQA 2DBJA 4JDTL 1J86A 1EXGA 1UWFA 3GI9L 4HOZA 4KOYA 1K4CB 4ZSOB 3DX1A 4JFOA 3MNZB 5DD5L 4UA3A 4N4YB 2Q7BA 2IADB 5FDWA 4FXTA 3B9KB 1ZSHA 1L7TH 3CFNA 3R4DA 3QI9B 4PRHE 3ZIYA 2VDOL 2YEVB 1PAMA 5BOJA 1LD9B 3EIFA 3PDGA 3VXMD 2A6KA 3SKMA 5IHWA 2NR6A 2NDFA 4O5LL 5J57B 1Q0XH 2H8PA 5IEKB 3HMXA 4OF8A 4D0CA 2MEJB 3IJYA 4LMQI 4DAGH 3HPLB 1RJYB 1ILUA 4JQIL 2REEA 1VGEL 1OGAE 4JFDA 3REVB 4YGOA 3SJGA 3HFML 3KL5A 4NZFA 4YJZL 3NFNB 4KJPD 3GTTA 5DQJA 3GXNA 2ICWJ 4OGQC 3P73B 3UBGA 2M1KA 3H9SB 1ETZA 2NW3B 4X7TA 2QQLH 4Y19B 3RWFA 3BRGC 2NYKA 1SLWA 5JLZB 2G30A 1D5BA 1QVOA 3CSYB 3GHBL 4L1TA 4TVSa 4AE0A 1S7SA 3GNMH 3RGVC 3OF6A 3STZA 3X1EA 4Y5VA 3SGEH 4PVMA 4R4BB 5KOMC 1W8EA 4JFZH 1KFAL 2B2XH 5DA0B 4NRZB 4Q7DA 3VCLA 1JZIA 5LBGA 5JQ4A 4O9HL 4HJEA 2Q4ZA 2EIJB 3BJ8A 5GGQH 5AOJA 1TZIB 4OC2A 2MNWA 3Q3GB 1BBDH 3JV6B 3Q44A 3LRHA 3OZLA 2I5YH 2X4OA 5DQDH 2HZHA 3OR6B 1JD9A 1G4MA 1GJWA 2DWEA 2WOYA 4JZJC 4X6CE 5LBVA 3RX9A 4DNLA 1V3LA 4GP8B 4AT6B 3JT2A 2QDWA 3TVMC 4BE6A 2P47B 5HJ3A 5ISZD 3MOBH 4Z5RB 1CLOH 5DMGC 1GGBH 3GZOA 4QOKB 2Q10A 3MA7B 2Y3NA 3W0WE 3CVIH 1BJ1H 4MVBD 1B2YA 1E0OB 3SDAC 2CUIA 2HG5A 3DYOA 1MFUA 3VWKD 3O2WL 4R7DB 3B4NA 4B50A 1GYWA 2IWFA 2Z8WC 3MZGB 3CSGA 3WXVL 1S7XA 1JWSB 1HXYA 4Y5XA 1MEXL 3WO4C 3QUMA 3MYZA 4NQTA 1XF3B 3LAFA 3UABA 3KPLA 2DQGH 3P3SA 2IAMC 3NPSB 3LODA 1ZRUA 1A7QL 2JF1A 2DLFH 1U8MA 5JW4Q 4OCMC 1W72L 2AJXL 2AQPA 4GAFB 2ZKYA 3PGFL 5JDJA 2BW4A 1DANU 5L0QB 1CURA 1CQYA 3JTTA 1T83C 3CHXA 4G3YL 3RYMA 2N0KA 1GGTA 3U6XS 3BUBA 5IB0A 3HE6C 4AH2A 4PJ9B 5J9PA 1KGWA 2OMNA 3ECUA 3F6JA 4Y4KB 5ISZB 3CXQA 4K3NA 1HQRA 1XGYL 2PCUA 1ZA6A 4K3HA 5E1QA 3CT9A 5TQ0H 1FFNB 5JPNA 3FJUA 4L4TE 2XG4B 2UX7A 1PJ9A 4JO1H 4RMQA 4M85A 2WZ6A 1YVLA 1QG3A 4NLAA 1F97A 4Q9RL 2WIIA 4NXKA 4PGBA 4U1SA 2PO6B 1ETJA 4HKXB 4AVKA 4Q2ZB 3ES6A 1NJ9A 3DXAB 1CLZH 2KL6A 2XN9D 4Z78A 3DXAD 5K8NA 3KLAB 3JWDC 1U8IA 2ZUYA 1JERA 4WU5B 3NACH 1U4FA 4E41A 3H5ZA 3DWTA 1WIOA 2BFGA 1I3VA 5C82A 2DKMA 5KSAD 2YD3A 4NQVB 3PL6A 4PMEA 3BE1L 1EO8H 4QF1A 5JHDD 3PJSB 4QY8B 5BS0B 1IB1E 4Y9CA 3UZVA 4WCYL 1UZGA 1ZWIA 2OSXA 3BH4A 4NNXA 3H8GA 1FZOB 4APQA 5LYDA 1PZ3A 2BNRE 4QO1A 3UJTL 2VDRB 4WO4D 4Q97A 3FO1A 3V9FA 3OV6A 4PWKA 2YAFA 3AW5A 4LF3A 3SPHA 5D93C 4TM9A 5T1DL 3VCLB 4GUCA 4NSQA 4UAOB 5IX3A 4HC1A 2NXYB 3SGEI 1PKQB 1Z9MA 3EJYD 2EH7H 2UWEF 3GF8A 3T0BA 2DQMA 1AYOA 1F6AA 5IHLB 1OTUD 3TBSA 4NENA 1CLYH 3OHXB 2FSDA 3C5SB 3EKCA 1XEBA 1EEZB 1INEH 4IKIA 4HZAA 4F93B 3MAWA 3F8KA 1P6FA 5BRZB 5JA8B 2WXHA 4U5YA 3VXRB 1WWCA 1IM3B 1VKCA 3P2FA 3IFLH 2VXQL 2PYEE 3FXIC 3S34H 3T6WA 2P8PB 2XSKA 4N0FA 2HKAA 3ARVA 4UBRA 3GMMA 1O6SA 4MS8C 2QJ8A 2F54E 2WJ5A 4AJYV 2XXMB 2X4TB 3DIDA 3S97C 1BOGA 3TM6A 5AVZB 3VW3L 4KK6C 1UOVA 2LT9A 3OB0H 3P69A 4ONHB 2PP8A 2QMLA 2YGVA 5F3BA 5KS9F 2C9RA 2V3DA 1UCBH 4FXGC 1NGXA 4KV5E 3K71B 1LD9A 4KRMB 4XN9A 1JNNH 1OP9A 4L3ED 4F91B 1SEBB 2FBOJ 4WNSA 1MHEA 2VL5A 4L3FA 3CFDA 3TJHD 5C88A 1BLNB 3AM8A 3IJHB 4KKBD 5FB8B 1HCZA 5KYYA 3AGVA 4QOKA 4KUZH 4YSEA 3EHBD 3DJ9A 5KVFE 5CLZA 2GITA 3DOSA 1U8NA 2JELL 3FFCB 5FKAB 5T8IA 4BHUI 4Y9FA 4AK2A 4JPSA 2CTBA 3ALXA 3N43F 3VFUA 3ME0B 4DP7X 1FVEB 4LMQE 2B39A 1PUAA 4N0CD 3QNXA 1ND0A 1JGDA 2V9QA 3OG6B 4EIUA 4Z3FA 1TF8A 1RMFH 4ETYA 3JV6A 3MRFA 1PZCA 4WU7A 4WFHD 5DT1H 3LRSB 5KN5A 5DJ6B 1FNEA 3NE7A 3TT1H 1OW0C 4TYUA 5JORA 2IWEA 4MA8H 2Z0UA 2V8MA 4F3FA 1AYRA 1H8LA 3VWJD 1XD0A 4W6XB 5JPMC 3TEWA 2Q3AA 3V0EA 1IC0A 2BIOA 3PWUA 1F1AA 5KUKA 4IF5A 1QRNB 4XHJD 3KE0A 1G6RA 1K2DA 1S7RB 2PYED 3QEUB 4LSQH 4IRSD 3N6YA 4MSWB 4HHAB 1ROCA 1RZKL 3PQYE 1KB9K 1B2WH 3TO4A 1JPEA 4MNGA 3QUMB 1A66A 2ICES 5I1DA 1IGYB 3K0YA 1J5CA 4NNYB 2BOLA 4AVCA 4PGJA 1AAJA 4KKLC 4A66A 3MA9H 4XVOA 1D9KB 1YR0A 2VDKH 3WNPA 4NZDA 1YVOA 4HWEL 2D7QA 2N7BA 2WLLB 3CG8A 4HKZB 2BNRA 2R23B 1D7DA 4GW5B 3J8F7 5CZRA 5F48A 1J9CT 4GRLA 2WBJB 4FF9A 5EUOF 1WBZB 4MAYB 1CIUA 5EBLA 4ZTPL 1JVOA 4FNRA 4U3CA 3C5ZC 3OL2A 1AD0B 4A30A 2D9QB 3IDIB 5EBGA 2HVKB 5FUCE 1RULL 3HC0A 3MNWB 4QHUA 2AHIA 4PRPB 1MCKA 4N0YH 3R9GA 4Z7UF 3VW3H 3OLEA 5A2FA 3TEYA 1AFVL 1GSMA 1NFDE 3BKJH 3N06B 1ZLVK 4NBYB 5TPWH 3S8GB 1D5ZA 2PCFB 3NCBB 1P7KA 5E9DE 2VBQA 5C0NC 5CEZL 2X2HA 4OCSL 3V0GA 4GSXA 4OVUA 1GJUA 5D8JL 4HUXB 4B5PA 3I75A 1OPGL 1PG7L 2XZAL 3LKRB 4KZTA 1U8IB 5DZLA 2ZKHH 2CLRA 2CTCA 3WAKA 3O6ML 4LQFL 1ACCA 3N2JA 1EDYA 4N22A 2ADJA 4F6AA 3GRWA 5GJSH 4LOUD 5FAAA 4G43A 3KPRE 3OHXC 4HJJL 1T2XA 5FKAA 3IB4A 3AXHA 4FAAB 2E4FA 2NQDA 2WKOF 2BWQA 2DQUH 5GRYA 3BJ7A 3QNFA 4UAOC 2VWEC 3ARGC 2K3HA 4DP4X 1HHIA 3BPNB 1MHEB 1SQ2N 4Y2LA 2XN9E 1JDCA 3HKZA 3LXBA 2JCCB 4JL1A 5AW4B 4AM0B 4I3GA 1WFJA 1UXWB 2PJ4A 4MCZB 5HGHB 3L9BA 4QDGA 5EO0A 5F46A 3SXOA 4Y0GA 5LLIC 5I18H 3RBUA 4A2GA 3MRIA 3QFJB 5LAXB 1PSKH 4NQDE 5CUSH 4KGJA 3RX5A 1BJMA 4H44C 3H3BC 3ZGIA 4W9HC 1R1CA 4YWGL 3WNIA 2BHUA 3J27A 5C0RL 3PFOA 3TN0A 4BGDA 3KPSD 4U6XA 3Q5OA 4M5ZH 2Z91B 4EZMA 3BH8A 3T4AC 3FK3A 1RZGB 2HLFD 4QRRA 4K7PX 1HXYB 3R96A 4JKPH 1XGYH 1UOKA 1IM3A 4OCSH 1OCCB 3UBFA 4MWFB 4C58B 1NLBL 2GSGB 1G7HB 4BDVB 4XTRC 4DVRH 4AKQA 4L4VB 3LH9A 5IW1B 1U8QA 4OGYH 4PV1C 4XBPA 2YA1A 5B22A 3ZDZE 2YC1A 3TBYA 2WB7A 5AD0A 4G71B 3TOAA 5A1AA 3NJJA 4MXQC 5DK0B 5ILTL 4HWZB 1LILA 1EZVX 1MIEH 2GJZA 2JSFA 4H1LB 1SUJA 1WAAF 2VDNB 1P4LA 3IEAA 4DN4H 4PYGA 4D94A 5BXFA 3O41B 4YU9A 4RRPM 3TT3H 1IYKA 1HSBA 2A6IA 4AX3A 4IMKC 5D1ZB 4YMPA 1IVLA 2VDPB 4E9QA 2WXRA 5G4OA 1USZA 1P53A 2R4SL 2HX8A 2NCEA 3ABKB 4EQ3A 3W0WD 5KSBF 4Y1TA 4QYOB 1BXVA 5EWIH 5I6MA 4ZYQA 4PJ8C 2AERT 1YLEA 4TSCL 2W95A 3GXMA 3FNKA 5C0FB 1LO5A 3GBNL 4UMSA 1G5AA 3FUDA 3GMNA 2J8MA 2LR4A 4H0LC 4JPIA 2Z7YA 3HB3C 2CD0A 3HE7C 1BVNT 4JFDE 1B6BA 1OGAA 4K9EH 3V6FB 4XAKD 2PDOA 3SBQA 2YQBA 3FCSB 3NSDA 2IIJA 1ZVNA 3QWQB 2WVTA 4JXRA 4HIJA 1YC7A 4FD7A 4AZUA 3BI1A 3IDGA 3BZEB 5E2TH 1EO7A 2Y9RT 1CDUA 1J0HA 1FA4A 4CAWA 2QR0A 2MWCA 4DGIL 1F6LL 5MHSD 4KVNH 1U58A 2OX5A 3P3TA 2Q43A 2V17H 4LT7A 4FG6D 3KWTA 3VI3F 1X7QB 2UYLB 5J11B 2Q4VA 2D3JA 2NZ9C 2WXOA 4DTGH 1H3UA 5H86A 4Y49C 2Z31D 1A64A 4IU2B 5D1ZD 5LNGA 1A4KB 2WV3A 1I1RA 2IV9A 2FIWA 1XJOA 1E8YA 3I9GL 4OIIH 4W4OA 1XGTB 2WBJA 4NPKA 4MJ6B 4ZFGL 3V10A 4NGQA 4J2QA 3DTUB 4HS6A 4NQSB 1WFMA 1FGNL 1THCA 1OAUH 3QZBA 2XY2A 3V0AC 4KFZC 1K72A 4FLOA 1PMYA 4RAVB 2XNAB 3KDMB 4JREB 2ENYA 2VDLH 5E4OA 5I1KL 1EFXD 4PSWA 2XQBL 2X6MA 3KHOA 2VLMD 4AM0A 4BM7A 1PY9A 2ZWSA 3ZL4L 3JVFC 2V8LA 4YXKL 4YOKA 3D33A 4XCFH 1E27B 2FQFA 2Q2LA 1CO1A 4QRSA 2G2RB 5DLLA 2QQLL 2QV4A 4L2YA 2DQHH 4DK3A 1HSAA 3MRRA 2Z10A 2N0MA 1NMCB 5KSVB 2EVIA 4BQ6A 4U2ZA 2C5DC 2BRRH 4L8SB 3WD5L 4DF9A 1DBJL 2YAHA 4GRMB 3DSBA 5I23A 3N7ZA 4OKOA 1UWXH 2AXWA 2HKHL 4KKNA 4NN6C 5ITFA 2K8QA 3OX8B 4QRUA 3QB8A 1MI5D 5FVJA 4BZ1H 2H1XA 2I07B 2NW2A 4CJ0A 3BLBA 3HRZA 3EFOB 1ZA3B 2FQDA 3A6BH 4PRBA 3HE6A 5KS9B 3A67H 3RGVA 1D5ZB 2LU4A 4G6KL 3E1F1 5EBLB 2TSBA 4Y4HD 2AAAA 2P5EB 1DQLH 4TSAH 1S9WA 5H94B 1X5LA 3BT0A 4IM8A 2JB5H 4XN1A 5G4MA 5KSBE 3I3BA 3TH2T 5DRXB 3FRPA 2IEPA 3FZUC 3E0GA 2R98A 3BAIA 3T8XB 4ZMAT 3QEHB 3EJQA 2X7LB 3EYOA 4FXKC 5K39A 3C6LC 4ACPA 3HAEB 3OJVC 3EYVA 3N43B 1KBKA 1T04B 1VGYA 2HB0A 5E94B 2E9JA 3QDME 4GI9A 4F0YA 4TVUA 2K3TA 3F6LA 4P23A 3ZSSA 2ZG2A 3WMPA 1ZXQA 1BIHA 1PDKB 1BAVA 3SQOL 3VXPB 2JCCA 4OLWL 1PQZB 4G8IB 3FMCA 2ZSVB 5BZWB 3ZE0B 2DKSA 3CH1A 3OHMB 3REWB 4B6ZA 4ZX4A 5IJBC 4DWHA 1TEGA 4K8RC 4YQXH 4ZI8A 8CGTA 4PY8I 3BHBB 5I19L 4FD4A 4WO0A 5JHMA 1IU8A 4O51A 4BUHA 4NIYE 1N8OE 1BP3B 5CF3A 4J39A 2AEOA 5DI8B 1TG8A 3JUYA 5E08H 3FCUB 2HXAA 4JM2B 2KT6A 3QNZA 1XCTB 4X80L 3U0TA 2EYRA 1AUGA 3WHE0 5I1LA 2HLFC 2YKLH 4W9EC 1MIMH 1T83A 5EMYA 2YD1A 4FYRA 3B43A 4OKDA 3T6QC 5HVWA 4DESA 4JFHD 1EIBA 4HCRH 5FKPB 1YLOA 2XV2A 2EDFA 3WFDL 1JTPA 1LMIA 3BFOA 5I0CA 2VDKL 1WYJA 4JQXC 4OMEA 3H8EA 5A2BA 4LPYA 3WS3A 2AXGA 4JO5A 1TTUA 5GZNC 4LOFA 4PVNA 5DEGA 5GGVH 5G1ZA 2VXVH 2XJLA 3D25A 1AHKA 3PPSA 1XBUA 5D29A 4IRSB 5JPNC 2HA1A 2PC1A 1TZGL 4GG6F 4UNUA 1LO0H 3NIFF 4AK1A 1HHGA 5C2BL 5FHAH 2VXQA 5F89B 3EJRA 3SQBA 1J5OL 4P9MH 3GB0A 3WBDA 5J9PB