4BINA

Crystal structure of the e. coli n-acetylmuramoyl-l-alanine amidase amic
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
Knots found
sequence length
379
structure length
348
Chain Sequence
FQGHMQVVAVRVWPASSYTRVTVESNRQLKYKQFALSNPERVVVDIEDVNLNSVLKGMAAQIRADDPFIKSARVGQFDPQTVRMVFELKQNVKPQLFALAPVAGFKERLVMDLYPAPLLALLEDYNSGPQPGKAGRDRPIVIMLDPGHGGEDSGAVGKYKTREKDVVLQIARRLRSLIEKEGNMKVYMTRNEDIFIPLQVRVAKAQKQRADLFVSIHADAFTSRQPSGSSVFALSTKGATSTAAKYLAQTQNASDLIGGVSDMVQSLTIADSLKFGKAVLNKLGKINKLHKNQVEQAGFAVLKAPDIPSILVETAFISNVEEERKLKTATFQQEVAESILAGIKAYFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYLMURAMOYL-L-ALANINE AMIDASE AMIC
publication title The Crystal Structure of the Cell Division Amidase Amic Reveals the Fold of the Amin Domain, a New Peptidoglycan Binding Domain.
pubmed doi rcsb
molecule tags Hydrolase
total genus 109
structure length 348
sequence length 379
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.5.1.28: N-acetylmuramoyl-L-alanine amidase.
pdb deposition date 2013-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01520 Amidase_3 N-acetylmuramoyl-L-alanine amidase
A PF11741 AMIN AMIN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3500 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4binA01
3.40.630.40 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn-dependent exopeptidases 4binA02
1XOVA 3CZXA 4RN7A 2Q7SA 3QAYA 4M6IA 4M6HA 4BINA 1JWQA 4M6GA 5EMIA 3NE8A 4LQ6A 2ODFA
chains in the Genus database with same CATH superfamily
3QIBC 1SVZA 2J56A 4HZLB 4I18B 4JPIA 1JHLL 1ZTMA 4G9FA 2BWIA 5JW5A 3EJRA 3QORD 5A16B 2ERJB 3FTWA 1I1FA 5GS1C 2PWFA 1F90L 2OSWA 3DX9B 4TQ8A 3BJ7A 5D7JB 1XOVA 2Y6SD 2B1AH 5E2TL 3V0GA 4BD4A 4XNHB 1QFWH 3WMPA 3RFZB 2E56A 2B2XH 4K7PY 3O2DL 2HWZL 2KS0A 5CU9A 4S1SL 5EU6D 5I0XA 1XR8B 2H6OA 1CG2A 4HPYH 4RDBA 1GZQB 4HKJB 5KN5A 5E8NA 1QVOA 1RZQA 4GINA 3VAEA 3H6AA 2B4CL 2XWTA 1P6AB 3EGXA 4PJHE 3B3TA 4IF5A 4PK3A 1WWCA 5EIIB 4RMTA 1JZJA 1HAUA 1SJEA 2VZ3A 3IWGA 1IQDB 4F15B 1MH5A 1MZZA 3LQAC 3RX8A 3TBYB 1BQRA 3WXWH 5GS0L 4WNJA 3QUMB 2R4SH 3QFGA 5C9JA 3B35A 2DEWX 4YU9A 5CKAA 3B3IB 4QNPF 1CICD 1PU9A 5BS0E 4CS0B 2P8PB 1FBIL 2JJTA 3DIFA 3AS2A 1UACH 2HVJA 3H4FA 4R4NC 1JGDA 25C8H 5AOIA 1HCYA 5HXMA 2WV3A 1G9MH 3ARBB 1WFIA 5J11C 2YD9A 2DD8L 4K8RC 4WFED 3UPRA 3E0KA 3BAEH 3V5KA 2XBDA 4L1DA 5AVRB 3G5ZA 3WXVL 2CA4A 5BNXD 2Q7YB 4B53A 3KAAA 5HI3D 4ZW7A 1WG3A 3F85A 3B2PA 2ZP9A 1HVXA 2NT1A 5EIQA 1FSKB 4NPJA 5EV7A 3MA7B 3HUJA 3FFDB 2MH4A 2X53A 3STBA 3D18A 3IGUA 4MASA 2Q86A 4O2EB 1QRNE 4C47A 1IAOB 1IGJB 3DSNB 4YPGA 1S6NA 1N68A 1HINH 3ZZSA 3RTQA 1WZMA 3V7MA 3KGTA 2J2ZA 3RNQA 4F7EA 3U2SB 3BZEA 1UOKA 1ORQA 3NIFE 4TNEA 3G9AB 1RFDL 3FB8A 5IMKA 1NDMB 2PWGA 3TNMB 4WFGE 4YEFA 1KC5L 1YUHA 2E47A 2H32H 2C1CA 3TBTB 5KG9B 3TBSA 3TT3L 1FJ1A 1M6OB 3VXMB 1L0XA 3FNCA 1ZA3B 1NFIB 2OYLA 3WGVB 4PLOB 1G0YR 1OAUH 4Y16A 3GMLA 3CLEH 3QI9B 4O2CA 3D0AA 1VHEA 4LCCB 3VXMD 4PGDB 4TOYL 5KSUA 2DYSB 3PFUA 3RIAF 4UINL 1CM0A 3MJ9H 1HOCB 1PY4A 3A4AA 4JRYD 5F21B 2IPUK 4Q4IA 2WANA 5CINH 3T0XA 4AGLA 3CZEA 1EBPA 2HTLC 3GB7A 1CGUA 4K5LA 3WY4A 3K5SA 4DO4A 3EH5B 4EAEA 5GZOD 3IWVA 1LM8V 3MX0B 1TQWA 4YAQA 1UVQA 3PXLA 1TCRA 4KHTH 1INQB 3EYOB 4NERA 2YNEA 4JXQA 3ZQWA 1RZIB 1CP7A 2FBJH 3GNML 1NGZB 3H6JA 3V4VB 1RJLB 1KB5A 1D7CA 3Q1SL 2WBJD 1DQDH 1I7RB 4HXAL 4IIZA 4PJFB 4X4YA 4B9JA 5HI5C 5IUCA 3IJ3A 1G7IB 4I49A 3V4UH 5KVEE 4ZRGA 4AVBA 3RIKA 1D7BA 2WKOF 2REFA 3TBVB 1J11A 3MLSH 5IB1B 3ZVVA 3CHSA 3R9EA 1HZLA 3I2CL 1JNNL 1J5CA 1E5CA 4BJLA 4OM1L 2MKWA 2F6AA 1J18A 2HJFA 1G43A 1P5UC 3CFDB 4KTEL 1MI5D 1DO6A 4YLBA 5AKVA 4F57H 3K91A 3WY3A 2BLFA 2MCMA 1WD9A 4ZUWA 1RSYA 5F1SA 4QHUA 1FIGH 4I2XB 4U1HA 3GY9A 3QDME 4GMSH 4JM2D 4MCZA 3QHZH 4LQFH 1RUPL 4NZRH 4EDXA 4ECNA 1S7NA 4UI2A 3JWNH 3L8QA 5C2BH 3MLXL 4U1NA 3O6ML 2JVUA 3STLB 1I8IA 2ZONA 5H37G 1BVLB 3SDDB 2DKSA 3FT2B 3DNSA 1RZ7L 1X3DA 2D7OA 2VMDA 3CLWA 4DP4X 1UD4A 1RK0B 3KL0A 1YLEA 3PHAA 4L1BA 3ARZA 2DQHH 3M8OL 4Q0XL 5LAPA 3SDDD 2AJZB 3O0RH 2VDRL 4ELDA 3IGKA 3A6CH 2BCKA 5E99L 4D9LH 2I85A 1HSAB 4K9EC 4AQAB 2EXSA 5A1AA 2NYKA 4M43H 2ITDB 2ZENA 4KNSA 4RGOL 2JKJA 3AXIA 1NCCL 4BBWA 4MD0A 3LEYH 2B5IC 1NLDH 3GSQA 5EU5A 3EYUH 5DEFA 2BX5A 1R57A 3PQYB 3WFEL 2CGZA 4Z7NE 2HUEA 3D08A 3QQNA 2O5YH 1QLEH 3GMOB 1SXCA 1SVBA 4Z5RA 1WQVT 4R7NB 2NY6C 1BJMA 1SEBB 2DL2A 8PAZA 1FGVL 4ZX8A 3PQYD 2DQEH 5JMRA 1NFAA 2HKHL 5J3HD 2P5WB 1JBJA 5K9OB 1VHOA 1AI1L 2OXGA 1QFUH 3O9WA 5ALBH 3NPSC 2CE6A 3KWWA 5AAWA 1UFGA 4HK3N 5B8CA 5CM1A 1N9PA 4G7SB 2O72A 5ESAA 2P5WD 3GRBA 3APNA 2BVPA 2GBTA 4N1HB 3VH8G 3ZT7A 1SY6L 1YC8A 2YEQA 4I3RL 2XXFA 4YXKH 5G4MA 1DJXA 3IETA 3S3BB 1DEEA 1XCWA 1U3HA 3AROA 1FZOA 3RGHA 2AKRB 5JHDE 3U1QA 1AR1B 4UF4A 3IU4H 1N6UA 2BP0B 2E6PA 4EBQH 8FABA 1AS7A 2AABH 4MDJB 4EI5C 2V2TA 3QULA 3AGWA 1YMMB 1KMGA 1AR1D 1MVYA 4PJ7E 1KV7A 5JPNC 2NR6C 4APQC 1W72B 1AH1A 5DHVB 3T0WA 3L9BA 1YMMD 3TM6A 1KGJA 1WITA 2FSRA 1LCPA 3LACA 3N55A 3MRBA 3ATAA 1EGJL 4WU7A 4Y19B 1H5BC 1NMAH 4HFUH 2CKBB 1G94A 5JHLL 3D9AH 5EOCL 4P10A 4TNFA 1BBDL 3FFCE 3DYMA 3FUKA 4OLYL 4X5XA 1HXYB 4Z18A 4Y19D 3DIVA 2AK4B 3EJTA 1LFWA 2QVMA 1LQBC 1PKQB 5D9SB 2JQZA 1D9KD 3S37X 1BGXL 3WL9A 1NBCA 1JMXA 4EIUA 2BZDA 1IVTA 1A6ZA 4L37B 2F7PA 4MB4A 5FECB 3L1EA 2EH8L 4ZY1A 3JTSA 4OCLC 3AWFA 1A2ZA 2J25A 3NN8B 1NBVL 3O4LA 3Q5YA 2CJUL 1GC1H 2LGNA 3UC0H 4U7MA 2GB2A 5AG9A 1KEGL 3DO4A 4KC3B 4PJXA 3UG4A 4AMWA 4ZYKA 1P84K 4HQQH 1ZA6B 3QWRA 4K23L 3BRDA 2JJSC 43C9A 3GLDA 4ODWA 4DCQB 2XC8A 1ACYL 3NFNA 1JZ5A 1KG0A 1X9RA 4L8BB 5IOPB 1PW3A 1VKCA 3RDTD 3F8KA 3HVDA 1CTOA 1DBJL 2Y36H 3K6IA 4FJYA 3I6LE 4NZTH 3K71A 5KSAA 4M4RB 3MACH 5BQ7A 4NZFA 1DO5A 2RCSL 5FKPB 3RGVA 2C4FT 1A1OA 4P4KA 3APCA 4G6KL 3BH9A 1I8LA 1FFRA 2YN3A 2OXHB 5AW6B 4XO8A 4Y4KB 2EDRA 5KJRH 3WNNA 3EOAB 3NH4A 2BC4A 1KXQA 4OIAA 1CXKA 5EWIL 4OTXL 4XWGL 1U3NA 1IC0A 2YSSB 4W9EC 4Y4KD 5H37A 4AEHL 3QZLA 2PTTA 1T89A 1MVFA 3KNBA 1THAA 1BG9A 5ADPL 4TNVK 2GC7C 1EA9C 2EKJA 1D5IH 1GHFL 4HJ0D 3LQZB 2FYYA 1H3WM 2Y5TB 2OR9H 4WK2B 3WT4A 3BESR 4LLWA 3UGUA 1B4JH 2OMTB 1W8OA 3S6HA 1J8HE 3L95B 3MYZA 4ZZFA 1PG7L 1T0PB 3VWJA 3B6SB 3CFKB 3SY6A 2TSAA 2YMTA 3VB9A 3MLWL 1DBKL 4WCYL 1UKTA 1RLBA 3HNTH 2YRBA 4DK5A 2ZTBA 3BKYH 4HS6A 2GHZA 2Z1PA 2YD0A 2PXYA 2VYRE 5FYKH 5IT2L 1CI3M 3LKNB 5I26A 4JM2F 3E7JA 1J05B 3CFEB 3Q5OA 5IQ9B 4CGNA 2EYSA 4ZSOB 2DQTL 1IOFA 2OU2A 4R5TA 3RU8L 1S9KC 2QFRA 3BD3A 1S9XB 3GJFH 3VH8A 1RZKH 4G8GA 5F0MB 3G5VA 4UQEA 4MB1A 4MA1B 4U1SB 1AZZC 2QQNH 2XN9B 2Y9RT 4C83B 4QOKB 1VACA 4NRYB 4YQXL 4LSVL 3B9KA 5B1JA 4P4FA 4G6FB 4O02L 4XNMA 3O41B 2XN9D 3NGBC 3HCVA 1KCUL 1OP9A 3G04A 2AFSA 4G6FD 2WUUA 1JV5B 2Y1YA 3CXHJ 4HJUA 4X5PA 1TLKA 1MVUA 1VIXA 1CLOH 1QTSA 4MRBA 3RI5K 3AQYA 4F3FB 4CRYB 5F7BA 1NL0H 4WKZB 5EPMA 1PYWA 1G9HA 1WLHA 1F2OA 3QIWD 4YDKL 4F7TA 1OZTG 4GPVA 3QJTB 3UCQA 1PD1A 3B8GA 2V8VA 3DHMA 3SJVE 1OHQA 2MNJB 4P07A 3DMMA 5GGQH 1R5IB 5L9DL 3CT9A 4M85A 4MAYD 4M1GL 1YN7B 3RPIB 1BD2B 4Y9CA 3VD2A 2PCYA 5I1HH 3WGUB 4WWKB 1TNMA 2P6GA 4MZ3A 4OFVA 3NCMA 5DT1L 3RZAA 2X3AA 2A5UA 4PB9L 2P5EE 3SGKA 1IC5H 3UYRH 4NKQB 4PJIA 1F2XK 2NZIA 5L4MA 1P7BA 4H40A 2QKIC 4Y4FB 2OL3H 3D0VB 3IAPA 2J3SA 2H0PA 3M07A 1P4LB 2ZWNA 1S5HB 5E8EB 4YSCA 4FYQA 2FS5A 3VA6A 4X7FC 3QJZA 5EEYA 2R8SL 4D9RD 5C0BE 4Y4FD 2EECA 4N0CD 4ZTOL 4LCYB 4UU9B 1AGEB 3VG0H 2ZEGA 1F1AA 3QUGA 2ZKHH 2G9DA 2VLKE 3MUHL 3G08A 1MG3C 4J4PC 4NLHA 4K3EH 4LSRL 1MEXL 5CIPB 4ZX6A 2Y4SA 4Y5XA 3BKJH 4ATTA 2G30A 4DEPB 5T1DH 2WCPA 4L3EE 4LASH 3KPSB 5BZXA 3S34L 5KVEH 4QYOB 5EIIG 3I75A 4MJHA 1RPKA 4JFFE 1E4HA 4UT9L 3ZIMA 4XCFL 4LESA 4ZXBC 3FQXB 2I25N 5LGYA 5LDSA 3D12B 4M7KH 1F6FB 3NH7H 3WTUA 4WI5A 5EBWB 2OI9B 1UWFA 3W37A 2ZYRA 1F3DJ 5I74C 4NFCA 5DZVA 1JGLH 1ZLIA 3WD5L 1E4KA 4X7SL 3FU0A 2IWKA 3X13B 5G20A 2ZEPA 4J8RA 5HVHB 5F0LB 5I0WA 2VN3A 2FEEL 2HSIA 1HEHC 4QNPE 1NCAL 1UT9A 4OZGE 4YWGL 2EYTA 4MAUL 3H0TB 3PV7A 4YRHA 2IAMA 3LXBA 1FDLL 1FFOA 5I8KL 4RCAA 4TS6A 2X2UA 3CWGA 2F1BA 5DD6A 2E7CA 3L3OA 2YPLA 2X6UA 1RMFL 3KLHC 3EJSA 2V5YA 1FFQA 2P8MB 1UM6L 4PEEA 1D5BB 3B3SA 3EJJX 3KPRB 4P2OA 2I27N 4XCNB 4NKDA 4XC1L 3KMDA 3RIFF 2IO5A 2Q3XA 5ECJE 4AM0A 1Z3RA 3O6FA 1RZGA 2WKGA 3AT9A 3CU7A 1IEHA 3BUYA 2WLYA 3GSOB 3RTLA 2SEBA 3AU1B 2ZW5A 1NAMH 4YK4C 4FL4B 2UWEE 5CU5A 3CDGA 4WW2F 2WLMA 1NFDB 2HUHA 2AJ3B 2OBGA 3CGTA 5DJ6B 3A47A 1IM9D 5T1LB 1F3JA 4UFVA 3WEOA 4OM0L 1OBRA 3I9GH 1JHKL 3POHA 2XV6B 5FYKU 4JHWH 5IG7B 5T1LD 1JF6A 3P9WB 2JKLA 4N90D 5IBTL 3TIDA 4Y1AB 4FI6A 2EUVA 1VERA 4J3WA 4KY1H 4D0DB 3J27A 1I7ZA 5DZJA 1HQ4A 4EVNA 2OMXA 1AG6A 4YDLC 5KSVB 1KJ2H 2Q1EA 1DVUA 1RSFA 4Y1AD 3KYNA 2EIZA 5C0GB 2D3LA 4XRCB 4MXWL 4NQDE 1GYVA 1WO2A 1A7OH 3L3IB 4FQCH 5ESVA 3TA3B 5EF3A 4EI6B 3RNZA 1KELH 1GIGL 5J13B 3C5SB 2LABA 2QYVA 3TA3D 3OXSA 3HUVA 2X42A 1R5WA 5J57B 5C0AE 3DTXB 2DWXA 3BWUC 4ZO7A 4PRHE 2LVEA 4WIQA 4YBHA 1AR2A 3FCTA 4GEJA 1YEJH 2F0CA 4NQUA 1SNRA 4YXLL 5IFJB 4N24A 4OD2A 3IE4A 4PY7B 3M46A 1OAYH 1CFMA 2VXVL 4PJ9A 4MQSB 3DSBA 1J9CT 1JNHA 3Q8BA 4HCRL 4R4BB 5L0QC 2IOMA 1AQDA 3C60C 4YUEL 4N28A 1L7TL 5KVMC 1ARMA 1FC2D 4H8WH 4CVXA 2WXRA 2BCMA 4BSWB 3PWJB 2XPGB 3VFMB 1P4NA 5IROC 3K9TA 4PJ5A 4ZMZA 1HWGB 3IDXH 2AEQL 3TEYA 7PCYA 4FNRA 4ILDA 1Y6MR 4IRZH 2X2YA 3QJRB 3V6OC 1Z9UA 4X80L 1MFDL 1I7TA 5CN1A 2VTFA 3BVUA 3ZKXC 5CZVL 4LSSH 4AY0A 1IGCL 3EBHA 1K8DA 2AEPH 3DX9A 1A6VH 4UV4H 4FABL 1IGTA 2UZYA 3SE8H 3RFZA 1PF3A 1C5CH 1T22B 1DQTA 1QR1A 4TLKA 5D2LB 1LDSA 1WWAX 3U4BH 3CDFA 1ZS2A 2WLHA 2WPWA 4E9VA 3FXTA 1DQIA 1EJ6A 4A63A 4DP2X 2QGEA 1E4XL 3W0WA 4Z7OF 3QG7L 4A2LA 4U6XB 1I3UA 4OZHE 2PIZA 4AYSA 3GXUB 1YW4A 1X5MA 1QSZA 1QWUA 4ZUVA 3SKUD 1IQDA 3F58H 5I8OH 3HZVB 4PHXA 5F97E 5IVXF 1BOYA 3NQIA 3GO1H 2VERA 4LOFA 2P47B 3PNWA 2Z11A 4M1DL 3BJLA 1JQGA 4HCIA 2E46A 4FHKA 4HIJA 2DLIA 3AM8C 1RD6A 4J3GA 4XNAA 3SKMA 2RFXA 1HHKB 2HP4A 5IBUG 1W80A 4NPYB 1HQRB 3IAQA 5EORH 1LEIA 1NC2A 2X9WA 1WGOA 4XBMA 4WUKH 5KBDA 2C9PA 3FRUB 5DVLA 4L4VE 2O6FA 3PS6A 4RGNC 1IM3B 4U4IA 1XSKA 5FR3A 2VDOH 4Z3HA 4RBPH 2BNRB 4I48A 4YEEA 4O58L 4Z95H 2ICWI 5I75C 2ZKWA 4YFDB 1UOWA 4KHXH 3NA9L 3X11A 3E8UH 4NO3B 5EEXA 3P2HA 1IBZA 2XTJB 4KTYA 1IM3D 4EOWH 3ZKMD 4FE9A 2D73A 2BNRD 4B3EA 4Q89A 5IWLA 5D2NC 1JPTL 2VXUL 1B3JA 3PGCA 4Y7OC 3GLEA 4IS6B 2UXVA 5ALCH 1WIUA 4MSWB 5EU6E 2ANPA 4CAGA 4PW4A 3V0VB 4YHLL 2Z31B 1PMYA 1MHHA 5EO1B 2MOVA 4C7IA 4WO4C 2Z4QB 7CPAA 1ZTXH 4I5BB 3GXNA 3ILQC 3U2SA 2OMWB 4E41E 4L9LB 5CEYA 2Z31D 1MRDH 4O02B 1F2QA 1WH0A 1KCRH 4A38A 5BZDB 3PV6A 1DCEA 1MRCH 2F7VA 4OUUB 5IEHB 1CBXA 4NLAA 2VRAA 3GK8L 3T2QA 2H4EA 3BGFB 3BFQG 1VEMA 2VZSA 4Z3IA 2ZG2A 4IBYA 4J3UA 5GGVY 2D03H 4B0MB 1IRAY 1DVZA 2MQ3A 1LEKB 3UBXG 1JZFA 2EDTA 4PGDA 1HWHB 4YDIH 2VKXA 1JZGA 2YQ2A 4NNYA 1TQBC 1S3KL 1UB5A 3HI6L 3NABH 1FVEB 4JZJB 1N3NB 1OE3A 2EP6A 2WN3A 4N68A 4N20A 4P3CL 4B41A 5IJKC 2MIZA 4WGWB 3INUH 1OGTB 3GSUA 2A99A 4N2CA 3EGSB 4PJCE 1FI8C 2EILB 4N0YH 4A31A 1ES0B 3EYOA 3GXFA 1SJXA 4YFEA 1RZIA 3JTBA 5AG8A 2IQAA 4A7GA 5PAZA 4NP4L 1RJLA 3E6HB 4HIEA 4PJFA 5J6GA 5D71L 1I7RA 3JWOL 5DUJA 4QRPB 4ENED 4LGPB 4I88A 3LB6C 5AW4B 2G2PA 5DK0B 1FL3A 2VDPH 4XVUD 1KYDA 5TK2A 4NN7C 3TONA 2RFHA 2R39A 4QRRA 3MODH 1NFDF 1BAFL 4QRPD 1XCQA 2WTRA 1A4KB 1AJ7H 3O0LA 1ZLVK 4L0YA 2Y0SA 5JQ4A 1OALA 2HT4C 5CJBA 3VFWB 2Q7NA 3BUBA 2BWQA 4G43B 4XPTH 1YNTF 1MAMH 1WC7B 5HJ3A 1ZGLA 1UEYA 1HJCA 4QHNA 2CMRH 2WNKA 5KW9L 4XGZB 2Z7YA 3GZOA 2PR4H 1UOVA 4Y2DA 4K3JH 5ERWA 5IB3B 3B2VL 3WAKA 2ITEA 3UIZA 3UAFA 3FT2A 3V0WH 2C1OB 4XMKL 4ANWA 2NRDA 4N6RA 3QJVB 4F7PA 3EY5A 4XMPL 3KQZA 3SJEA 1Z0MA 5FOBB 4A39A 1FRGH 1QATA 1WZLA 1WRFA 4BV1A 4KMTH 2R0ZH 12E8H 2IWFA 4GKNA 1HI6B 4K7PL 5I1IL 2FCBA 3D25B 4AQAA 4TSAL 3EHBD 5B3JF 2B1HL 1YG9A 1XH3B 4GP4B 4H2AA 4KX8A 3FB5B 4I8DA 5E03A 3ZXAC 3PUCA 1SJHA 5BUGA 5JQHC 1PZDA 3MTXA 4K94L 1TVBA 5HI4D 4M00A 4OZFH 1Q9WB 1SXNA 3PWVB 3NIDB 4XX5A 3GMOA 4PREB 2Y1AA 3QFJE 1I1CA 2M26A 4IDJH 2ZOUA 1SHMA 2B9BA 1YPZA 2XLLA 4R7NA 3STZB 3U4KA 3SZ6A 5JPMB 1MHEA 2GAZB 4NWTH 3PAZA 1M6UA 1FV1B 2KKQA 2AI0H 2BNQE 2Z91B 4GKSA 4OGAC 4H25B 1NGQL 5ABZA 4WHYG 4HJGB 5HHPB 3ZHKA 1F4XL 1E4JA 1EEQA 4PJEE 4Z0XB 3BAIA 4M5SA 3WC5A 2CRMA 3H42L 4LP5A 4ONWA 1CLZH 2VL4A 5KS9F 2ENQA 2YC1A 5FM4A 1I4FB 4FXTA 1G7QB 3MJWA 3MRLA 1RK1A 3BSZA 1F4YL 1AGFA 4IKIA 2F8XC 1HDMB 2X0WA 1HHJA 3IJEB 4MDJA 1U8MA 2YIHA 3TJEL 3ATEA 1DANT 2HQYA 1N12A 2ZEFA 2CDGB 2ZXDA 5ID0A 3EJPA 1UA7A 1WHPA 1BSIA 2WBWB 3LH8A 1OV8A 4WTQA 2EDQA 2QHLA 5CN2A 3ZTDC 3Q0HA 2N7AA 4L48A 1TYRA 5IMOA 4XBEH 4PM1A 1KWKA 2YGQA 4NO5A 3WLBB 2VQUA 1KYFA 4IKNA 1M4KA 3EG9B 4JZOA 1IKOP 4OJFH 3QAZB 5I76A 1A5FH 1QOKA 2CBTA 1R17A 3CVHA 2MPAL 4JFEB 4WHTB 2VDKH 2D3NA 3NQKA 4JFXA 3TFKC 4L18A 1BM7A 2AK4A 4KAQH 3CPUA 4AL8C 5KBLA 1VESA 3Q2VA 4IHOB 3OAZH 4NQCE 1AYRA 5DVNA 2EVFA 2P0WA 1AO7A 3R1GL 1CE6A 5EC2A 2JTYA 3I84A 4E68A 4B13A 2COVD 2LV4A 3TZVA 3MKKA 3L9RB 4Y16C 3UBXA 3H56A 5EEUA 4FG6D 1CZ8L 2B0SL 1OCOB 3BWZA 4CGPA 1X6LA 3EH1A 2QSCH 3V6ZA 4ONFH 2Z10A 3DOHA 5CUSL 4ODBD 2PW2B 4ALAC 1A3RL 1K8IA 3DURA 4MS6A 5HDRA 2IL4A 1VFMA 2GK0B 4HG4J 5AW3B 1C1EL 3KH4A 1MFNA 3BIKA 5G22A 2ED8A 4KZDL 3KGSA 4LNVA 4XMXA 2N01B 5ILTL 3SDYH 3HB3C 1RQ5A 2EUIA 2EDOA 2NQDA 3IEHA 4WF7A 2GFBB 1NCBH 1KJMA 4XVSL 3CXHK 3GC3A 4UM8B 4NSQA 5IOPA 1KLFB 2AAAA 2DQGL 2TSBA 4DP7X 4U3SB 2QVKA 1OEZW 3C09B 2W5PA 2HRHA 4NNPH 4E9LA 5IVOA 1TZGH 5C0CB 3VFSB 1YEFH 3GMNB 3P3SA 3P4NA 4JKPH 5K93A 2OMBA 3FTYA 4GG8B 2OXHA 2ZCLH 3FUEA 5C0CD 2PJ4A 2DQCH 1U4FA 4HWZA 4EUPB 1TFHA 1TEFA 2FQFA 2G5RA 2CDEA 4FQHA 4L5FL 2BRQA 3VTMA 3D4ZA 3P9LA 4CMMB 2XWJB 3WKPA 1IBGL 4R0LB 1M56B 4P4KD 4HUUB 1SVCP 2FHBA 5K69A 3KCPA 4PJ8B 4J3OC 3V8IA 5J1AA 3GEFA 5HHMD 2VSMB 3DPBB 1OAZL 3B9DA 3BMWA 3L95A 1ADQL 3ECBA 1CD0A 3Q44A 4JO1L 3VFUB 4E42A 2CCWA 5EUOA 4AZ8B 1ZT1B 5K9JL 3IDNB 1KN2L 3IU1A 2CG9X 3TWCL 2G75B 4OD1L 4GIAA 1X5IA 3BZDA 4RA0C 1XF4B 1Q9OA 5C6WH 1AMPA 1TJIH 1ASPA 4XCCH 3P54A 2R0WH 5T33H 5ESQA 1XR9B 1PSKL 2AFWA 1O5PA 4HUXB 2X28A 3LSOA 3LKNA 4AJ0A 1YEHL 4QJ3B 1UFHA 4UBDD 4WGVB 1ZT4A 2AQPA 5DZ9A 4Y9BA 2QPSA 3CFEA 1PFOA 2TAAA 3HN3A 3O9WC 5AAWC 1YVLA 1VCAA 2J43A 2ICEA 4P9HL 4DKFH 5B8CC 4M3SA 1KBKA 4BSVB 4B12A 4OMEA 5TE7H 2NT0A 3TYGL 2A83B 4QXVA 1I8KB 4Y5VB 5IJCC 3JUWA 4MXVF 4TLSA 4BCZA 5IQ7H 1CG9B 4D0BB 1J12A 4PWGA 3GMRA 4BHUI 3OHXA 3EGDB 4WK0B 1U3HC 1OAJA 3RVXD 3DRQB 3VNYA 4NRYA 2IC2A 4GIOA 4NQED 1N8ZA 5J8CA 4F33A 4KI1A 2FK9A 1O9WA 3T8VA 5DRWB 4RUHA 3EXJA 3ZOAA 1N18A 4KNQA 5FM8A 4P44A 1U4EA 4F58H 4HLEA 1LNUB 5EZIL 3LN5B 3CDXA 5HDBB 5BZWB 4DZBB 4XP9L 5I5JA 1RUQH 2V5MA 1YYLH 4IJTA 2DJMA 1BMZA 1E27B 3OV6A 1IL1B 4EDWH 3V79C 4N86A 4LMQE 3B9KD 1O9VA 1V3LA 3MMEA 4HJIA 4AMKH 1CFVH 2P6EA 3U9PH 2VJ0A 1DBML 4JPVH 4UOQA 5FW7A 5DJCB 3U48A 2FATH 4BCYA 1JDCA 4GRLA 4ZS6C 1FO0H 2FL5B 1QKZH 2XX0A 5FB8A 4GKZA 3FSWA 4TLTA 1XGUA 4NKIL 2ARWA 2J88L 1CFNB 3LXAA 3EYSH 4MMYB 2WBKA 1ZLUH 3W82A 1BFTA 1BF5A 3T8MA 2CPUA 2GLJA 5I5IA 1JE6A 2G5BA 3PWUB 4N9GA 5DD5H 1ORSA 3IFOB 1U36A 3QUMH 5EO9B 5EZJA 4DGYH 1OSPH 2D9QB 3THMH 4CNIA 1HDUA 3DSFL 2EKSB 1WFNA 3KPQB 2V9QA 1DN2A 1S5HA 2X4QA 5E8EA 2AJVL 2NY3C 5EEVA 1YSJA 3NACL 3P30L 2VLJA 3NCJH 2A4NA 4IHBA 1MF2H 1FE8L 4PSXA 4K30A 5CLZA 1AGEA 2VZZA 1BPLB 3BP4B 1OY3B 5LRJA 1BJ8A 3KXFE 3HHSB 2XQBL 3ES6B 5K5YA 5D1QA 3EBGA 3VGEA 1F4WL 3DX6A 4WI4A 2FWSA 5CIPA 1A6WL 5D1ZC 4A6YL 5CCGE 3EFOA 1KPRB 3U7AA 3JZYA 3OLGA 1KCLA 4CYNA 2ALAA 1WTGT 1QAWA 2J20A 4TL4A 3MUGB 4DZ8B 4YE4L 5ECGA 3AQXA 4FA6A 4XP4L 1PZCA 1JPSL 2IDUA 4H5SB 3IRCA 2EAEA 3D2UA 4P5TB 1MW3A 3GXDA 2OTWB 2E9GA 5GRUL 3HEIB 1B2WH 4MQ7B 4R57A 5KSAC 4QXUL 2QVTA 3X13A 5KVFH 3RGVC 4IMLB 1XH0A 2VZVA 4LFHD 2QMKA 4P5TD 1FT7A 2BSCA 3U83A 1SUJA 1TVHB 4X6EA 1JP5A 4AUJA 3NCWA 2OZHA 4Y5YB 5DD3L 2DJSA 2A6KB 4ZK8A 3IKCB 1A9EA 5IB2A 1L9MA 3T8WA 4XVTH 3UTQB 4YBQC 5C09A 1S9WA 3PJSA 3S6GA 1A3LH 1T89C 5IVZB 5C3TA 3V8CA 4GM5A 4GXUN 3OR7A 4R3SB 2E59A 3KPRA 2QPUA 5E0QA 5HPMA 3DX2A 3RWFA 4OCYL 2DQIH 3JZ7A 4YH6A 2DIAA 1YY8B 3GHBL 1HYRC 3LIZL 3LRSA 2GEEA 2IAMD 4GBXB 3RWJB 3RY6C 5LVEA 2N3JA 4CVWA 4QXGL 4YFLF 3NCEB 1OGAE 1X7QB 1SY6A 3RZWA 1UJTA 3KYKH 3S48A 3VWJC 3PEIA 4KOUA 3HNSH 1JZDC 4GBXD 3BQUB 1KJ3H 5I66B 1OCWL 4OCRL 4WU5A 5IEKB 3UZEC 3A4DA 4P2OD 1TXKA 4AKQA 2YJQA 2FX8L 4PJXF 1RUMH 2PXYC 3SGEH 1TYEB 4DSYA 1DFBH 5AW9B 4DP1X 2Q87A 4WFHD 5DURD 2QTEA 4AXWB 2HB0A 4CC1A 2MCAA 4PRBA 4QHMB 4F2ME 1INEH 5FFOA 1T5WB 2ZCKL 3N1FC 5E00A 4D0DA 4TLUA 4MMXA 3HS9A 2QPFA 3DOSB 5FCSH 4MCSA 4HP5A 2F08A 4Z7WE 3H4QA 5LN4A 4P2RB 1J1OH 1ZRUA 1EGJA 1GKEA 2Y1VA 4P5MB 5C0GA 3TN0C 4B9IA 1XBDA 4EVYA 1SGKA 1I3RA 5JHLA 3UTSA 5FKAB 4XO3A 4P2RD 2VDLB 1KCKA 2HXAA 1A14L 3ZYZA 4FERA 3QAHA 5MI0B 2W65B 5I23A 5GGSA 2H9GA 3IDYC 3F0AA 2O4EA 1FYTA 5FF6B 4OLEA 2ZSVB 2ORBL 2VJ8A 1TPXC 2WC7A 3IDJA 1I9RL 3U9WA 4M61A 4OT1L 4JFYB 4JR9L 4KQ3H 2AVFA 4LL9A 4CAWA 4DP9X 4JHUA 3NK3A 4N2BA 2OSLB 2XU9A 1NGWA 3MRRB 5EF0A 2IDFA 3N0PB 2DWEB 3D39B 4JN2A 4KSAA 2B4BA 2W07B 5D4JA 4EKJA 1JN6A 1UH3A 4XO4A 3V7AE 3Q48A 3FB6B 4JFOA 4M3KB 4BSWA 1H3GA 1DVYA 1MPAL 3S5YA 5JGFA 4PJ9D 5EF2A 4Q38A 4KORA 1L5GA 3UERA 3MRMA 5F2FA 2KDYA 3HFFA 1A7RL 1IGYB 2WPGA 2F8OA 1DVTA 3B9AA 4MMZA 4DN3H 1U3ZA 5D7KE 2R23B 1PCXA 3CSBA 3ECVA 4BFJA 4J3BA 5CZXD 2R0LH 2P9RA 2WM0A 4RAHA 1FHNA 3TH4T 3LRHA 3PBEA 5HHNB 1HH9A 1T6BX 2BS71 2J6EL 5D2LA 1WBYB 4OLZL 3H9SE 3KBHE 1Z9SA 3MREB 5EOQL 1QI4A 2ZJSL 2WXHA 3UJIH 3P73B 1REIA 3O3UN 1VFBA 3L3KB 1RULL 1WZAA 3RL1B 3WABA 4OLUL 4HHWA 3SYOA 1H9DA 2NNCA 4PTTA 3REWB 4LBEB 4Z78B 4H1LH 1M9SA 4R84A 5AKTA 3GKRA 1C5BL 1LO4H 1JJUA 2IPKA 3H1ZA 5CD5D 3ENEA 2ZZUT 1KIQA 5DHVH 1HHIB 1T2QH 3RFRA 1SXAA 5JW4M 2APBA 2AV7B 2OX5B 1P7QB 3BT2L 4CBZA 4OB5H 4YDNA 1I1RA 2GTZA 1L9PA 1AZVA 2BIPA 5CLXA 3T6ZA 2IANB 5FV2A 2DPTA 3RWEB 2JIXA 2VDQH 5E9AA 1L0PA 3DX1A 5GJTL 3VCLB 2F74A 1HQRA 2XJLA 4X8JB 2GJRA 5GJSL 2IAND 2V17H 4V1DB 3RVVD 1BEYL 4PW3A 3VJ6A 4HK0B 5KS9E 4HH9B 3QDGB 3EZJB 2M2DA 1I12A 1TTGA 3FCSB 2EEXA 4ORGB 1EXUA 1MIMH 4V1DD 4RAVA 2QQKL 2R2EB 2WUCH 3ML9A 5T3XE 1OPGH 5C08E 2O6DA 5L4FA 2VDML 3ILEA 3O6FC 5D5ME 2FT8A 2BMKB 5FYJL 4LCWB 4XZUA 5K9KB 1MFCL 2UY7A 3M17A 2PO6B 3K2KA 4NSKA 4G9FE 2CDFA 2FTAA 1U2YA 4I5BA 1MFAH 3IXTA 1YW6A 3SJXA 1CGVA 1ZHKA 3U1SH 2WXOA 2EZ0C 4WI0B 3N5AA 2CA3A 1AQHA 2V7NB 4W70A 5FCUH 1JV2A 2PO6D 3RZCB 5A3ID 3VXRB 3L7EB 4O02A 2VISB 3L3GB 4P3WA 2YK1L 3MCKB 4FHBD 4UT6L 4MLIA 2NY0B 4PJ6A 3WMSA 5BRZB 1ITCA 2OLDA 1R0AL 4X8IA 3MLZH 5JW5B 1HKFA 4E9QA 3VXTB 1IAII 5BRZD 2ITCB 3P02A 5JOFA 4U3HA 1G0XA 4LLVB 3UTOA 5A2JH 5JUEH 4ZUSB 4ZPVB 1FVEA 3RAMA 1KIUA 5C7XL 3AT0A 1N3NA 3V0JA 1BYOA 2Q2LA 3MLYH 1JGEB 1S5IH 3KHQA 4J1UB 1W0WB 4XMZA 3EOYG 4DERA 1Z2LA 2YAHA 4X0NA 3H4HA 3T6XA 2ICCA 4XTRC 2MKLC 4AEIH 1ES0A 1M2VB 2X0UA 3RWCB 1MCPH 2F8HA 4BFIB 4BQ8A 3GTTA 2CRIA 3B37A 3F7LA 3JTTB 1HILA 2RALA 2N7BA 3VFRB 4X6FA 5FLUA 2Y06H 2C7UB 1YEEH 5EBMB 5DK0A 5LGKA 2X09A 1FORH 2J5WA 4MJIB 1S7LA 2F53B 1RURH 2VW6A 2LQRA 3GRWH 1E40A 4B5EA 3X1EA 2AVGA 5BUPA 2KZ1B 5EU7C 4M1CC 3R0MA 5TFSL 1NBYA 3VFWA 5CGYC 3HUJE 1I1YB 1IC4L 2F53D 3ARQA 2A74A 4LLQA 4MJID 2DOCA 4OLXL 2V2WA 3RJDA 2NW2A 3BO8B 5I1JL 3PAVA 4NKMA 5L8LB 5IK3A 3RVTC 4EUPG 3N3EA 1JI2A 5CEXA 3MV7E 5CCJA 4L8DB 2XY1A 3RUGB 1A66A 1THCA 3DVGA 3JWDL 4UT9A 3QORC 5IB3A 4LGRB 1RIVL 2XBZA 1PY0A 4XN4A 1UJ3B 1MCQA 2LAAA 4MQXC 1B87A 2E7HA 3B1UA 4IK7A 2JFCA 4KDVA 3C8DA 3HOGA 4H8PA 1V7NL 2ERJC 4BQCA 5C70A 4PK2A 3P77A 4NN5B 4YZWA 5GZNA 4P49A 1LJMA 4M6OL 5D7JC 4CRZB 4BZ2H 3ZZQA 3ULUC 5TDOB 2R69H 1JF1A 3RFZC 4Y2DD 4R9HA 1CPSA 2HT3D 1HI6A 4AW7A 4KKLC 4HG4K 3U6RB 4K0OA 3ISWA 2HJKA 1CE1L 4NAQA 3SYQA 4HEPG 1TIQA 3FF3A 3HI5L 1A3ZA 1TKWA 4JDZB 2XZCH 2J1YA 4MLSA 1S7VB 5FS5A 3C5ZD 3FSAA 1Q9WA 3PWVA 4NWUH 4X6CA 2FVGA 4HWEH 5EA0H 4KVNH 4F15C 3I50L 3FQ1A 1QEXA 5JPMA 1CT8A 1NCWL 1ZXQA 1XB6A 5HTSA 3T04D 3OR6A 4KQ4L 2VI7A 4E9RA 1DZ0A 2Q3ZA 3MC0A 2V8DA 2Z35A 4X9HA 2GIVA 4AGOA 3U79A 2QDVA 1KIPB 1LL1A 3SPVA 3ZIYA 4FLRA 3WUWG 4Z0XA 1QSEB 4DVRH 5LG1A 1N5YH 4ELMA 1O6TA 1I4FA 3ARBC 1G7QA 1U8JA 3BP5A 5HI3C 1UT2A 1FAIL 2E7LA 4M4PA 1QSED 2WOYA 4JO4L 4ZI8A 2V7HB 1YN6B 4WY7H 1WZKA 1Q0XL 1I9JL 2X4SB 3QUXA 3SDAB 3IJEA 1LAPA 2WIIB 4QLWA 4F0XA 2CO7A 1QFOA 3MNVB 3MRNB 3X1BA 4ELKB 1QBML 4JFDB 3P0YH 1T4WA 4ODTL 3PY9A 4OD3H 1L9RA 4NKOA 4WLCA 4ERSL 4XAKD 1NUDA 3LQAL 1FVDA 4U49A 5IB5B 1BM3H 3EUUA 3TV3H 4JFDD 3PBBA 3ULUF 2PJ1A 1RCYA 3D7PA 1J8RA 1A9VA 2AFXA 3MRDB 5MENA 5EMIA 4ZX9A 3APMA 1FNLA 3DA0A 1JWSB 5F47A 4W9ZA 1YJDC 3FQWB 4HNWB 5DJDB 2XZAL 2DQFA 1X4XA 4JFVA 1CYXA 3WHE0 3N85H 4WHTA 4LP8A 5BPPA 1F00I 3KJ4B 4K8RL 3VB8A 4UIAA 1M44A 4LRNH 3W6XA 1OAKH 2JI3A 3PL6A 1XGZA 5T1KA 2Z65C 1EJOH 3QEQA 1ND0B 4PJGA 4ODSH 2EXTA 5GGVL 3KLAB 1MHCA 3U0PB 1JDDA 1Z5HA 4YX2H 3QI9C 4N2EA 3EO0A 3KHXA 1NQBA 2EK8A 1CN4A 1U93A 4PRAB 2N7SA 4R97B 3UYPA 3CZFB 2VR9A 3VXSB 4KKPA 4HCRA 1GMIA 2QECA 3BI1A 3QUZA 1G7LA 2XFGB 2NSXA 3VXUB 4GG6B 2UZIH 1BZEA 4TVPL 3VXSD 3Q6FA 1I9EA 1CGTA 3X12A 1EH9A 4KJYA 3SOBH 1KGWA 1YREA 3L4UA 3MVSA 2LW3A 5SWSB 3NDZE 2BIMA 1AP2A 3LN4A 4UQIM 1K3IA 3NSFA 1JZHA 2A6JA 2BFVH 3VD0A 4U9ZA 1D5XB 4AKPA 1W0YT 3NCXA 4OIDA 1U8NA 3DDDA 1QP1A 3T0EB 5G1ZA 5SWSD 1BQUA 4HS3B 5CGMA 3FBQA 3Q05A 5FA4B 1PX4A 1JF5A 3LD2A 4DO5A 5FX3A 4NZ8A 1CIUA 4PV9A 3T0ED 2I7OA 3P1VA 4L4JA 1MWAL 2X88A 3AS3A 5C0DB 5TDNA 4H26B 1MLBA 1AFVH 1BLNB 4JDVA 3OAZK 3EYFB 3BKCH 4H6ZA 3GWJA 3ZKND 3TIEB 2G60H 3ZDYF 4BFNA 4UZGA 4EUPA 2J4WH 2XPYA 3X17A 3IJ9A 5I2IB 2IGTA 4FZEL 2XWJA 4P57A 4O23A 2QIRA 3SDDC 4UNUA 3JVGA 4R0LA 4QO1B 1E9OA 3QEHB 3NZHH 3PFQA 2DBLL 3CK0H 4V33A 3IFPA 3QGVA 5A28A 5JYLA 4W4NA 1A7NL 1Z8TA 5CILH 5HHOA 3QWOB 5E4EB 3OF6A 3VVWA 3LIUA 4Z65A 5IW6A 3GFUA 5DFVD 5JORB 1GGCH 3E2HB 1TTRA 5DZPA 4MA3B 1FVCA 2CK0H 4WI6A 1YYMH 2AP2A 4QJ4B 4HEPA 3TVMA 4P48A 1OT4A 3NSXA 1URZA 1UXWB 3TT1L 4DKEL 5IW1B 5I24A 3O4LE 4NB7A 2WQSA 5HGBA 2JB5L 3MOBL 5HDLA 2IMOA 1LEGA 4YNYA 4LF3B 1IC7H 1EDYA 4PGEA 3FOMB 4G1MB 4PJXE 4RN7A 1E6OH 2WVSA 3WTWA 2J8UA 2OR7A 2IH9A 4C55A 4D8OA 5DQ9B 1MFVA 2NY5H 2YAEA 3BZ4B 4HX1B 2OOTA 5LHDA 4TYUA 2Y23A 4KY2A 2X70A 2FLMA 5HYQB 3WUWA 1USZA 4BK5A 2EE0A 1R47A 4AH2A 1OANA 1PUAA 3T3MB 4UDTB 4BK8A 1JYXA 1QYGH 5I8EA 2NZ9C 2F2HA 4FQIH 4PR5A 1Q4NX 3D3VB 3ZBMA 3PAUA 2PETA 4BZ1H 1CD1A 4PCTA 3O81A 4OCMC 3WLWC 1N59B 3WS3B 3RP1A 1A7QL 1E4WL 3VGDA 3RB5A 3IDUA 1IQWL 2BZ7A 4UIMB 3LN5A 4RMWA 5T3XH 3SDXA 1T5XA 2B5GB 2XI9A 3D3VD 1KXQE 1DP0A 2K7PA 3OX8B 4FNPA 5AVSB 1F0LA 1L9NA 2OCFD 2FH6A 3AZUA 3FB7B 4J12A 3VI3B 1E9QB 3EFFA 1VENA 1OAXH 4Z7VB 5HDWA 4U3CA 4X4KA 1A7PH 2XETA 4MFQA 2UZXB 4GMTH 3IDIB 1AXSB 4EMEA 1KOAA 2YRLA 3OZ9H 3ZJAA 2QFPA 4XNXL 4F9LA 1A3QA 5BJTB 2RACA 4U1KB 5IR1B 1OGPA 3VXQB 1KLGA 3KR3L 1S7WA 2ADFH 4PPZA 1NIEA 3K81A 5I82A 1Y6NR 4LKCB 1YPZF 1DQJB 2BVOB 3PWUA 4FN0A 5CLTA 3BVNB 3PB4X 2APTA 2HPOA 5AUMB 3ILPB 4H2KA 4GRLD 1TQTA 4N0UB 2VUYA 2VNCA 2EKSA 3TZVC 4QHLA 2H6PB 1L9QA 2VUOA 3TASA 3S88H 4OF6A 5B7MA 3WC6A 2R83A 2Q51A 4P8QA 1ZLWK 2NXYB 1P1ZB 3KW7A 1K9TA 5KYWB 1JTPA 3QZWG 2IV9A 4YHPB 3DUSA 1NIDA 2VEZA 3BP4A 4LIQL 1CCZA 3FSZA 5I71C 5F9JB 4CGLA 3Q2LA 3TPUB 1MFBL 2NXYD 3IVKA 4G8GE 4PG9B 5AVVB 2YFOA 5AD0A 2DWSA 3BKML 2JDCA 2QJ8A 2DLGA 4NUGL 4PP1D 5IB0A 1EDQA 2J1XA 3PU7A 1PZBA 1QSFE 4KU1A 3UTTB 4HC1L 3MO1A 4DZ8A 4ZMAT 5FV1L 3LNIA 3UOAB 1VZIA 4IAVA 5AZ2L 2VR3A 5LXGL 1T1XB 1T0MA 2WLLA 1V54B 4HHAB 5D1QD 5T8IA 5F49A 3UTTD 1FFTB 4Y49B 3CBJB 5BRQA 1FLTX 1I82A 3OHMB 5BO0D 5HYJB 2Z8RA 4OLWH 3TYFA 5CSZB 1BYPA 4IMLA 1S8DA 3SE4A 3FB3A 1IZKA 1ZLUK 1IU1A 4QR7A 3LVTA 2KLTA 2CLZB 4OIFA 3VXOA 4GAFB 1UM4L 4Y4KC 5ACZA 4YZFF 1JVKA 5D8JH 1S9VB 1FLRH 2UVEA 1ETB1 2A6KA 4WNQA 5CXPA 2YSTA 1NMCC 2VO5A 3BCDA 4HIXH 5ENWB 4HJ0C 1DDHB 4HPOH 2DW5A 4FZ8H 3VQLA 2I26N 3LKOA 4XPGH 3UC2A 3FQTA 4ZD3L 4DVBB 1YQ2A 2R0KL 5FK9A 5GS0C 3U0WL 3W39B 2X9ZA 3PP3K 2EH7H 2ZUQC 1DE4B 4OW6A 1MIEL 2UUDH 1RZ8A 4B9YA 2OYPA 1FNOA 1JK9B 3R4RA 4F24A 3RWJA 3SBQA 1FL5B 3ZE2F 4PJIE 3T9WA 3CSYB 4A67A 3AQDA 3FU7B 4N26A 5T3ZE 2C7FA 2V3EA 1JNLL 2WXGA 2NNAB 2IOIA 3ARPA 1TMCB 3BQUA 5IEKA 4KXZH 1JFQL 3MA9L 4JFTA 3KPMA 5LN8A 1RJYA 1N8OE 2EE3A 3B4NA 3FTUA 4NGQA 3OG6B 1HE8A 4MX7A 1J48A 1S78D 1D3CA 2FJHA 5KTEH 2FSEB 1SOXA 4IKLA 2W88A 4HIHA 3SKNA 1YECH 4X5LA 2VSDA 5AKSA 4EZMA 2OZGA 1KB5H 4PBXA 2A1WH 3ZO0A 5I30L 4TPRL 2KLRA 4PGCB 1VKXB 5D1XB 4YR6A 4PJBB 3TT2A 3S5ZA 4UM9A 2ICEC 2CNTA 4D3CL 4A2HA 5H94A 3PGPA 2FR4A 5D7IB 5D1ZI 3DJSA 5D1XD 3L6FB 4N0FA 4OQTL 3D09A 3GJEA 1FA4A 2G0BA 1OTSC 3B8YA 3MBEB 3JTKA 4PRPB 2FJFA 3SCMB 3NPZB 1BQLH 5E8DH 5AYTA 1N64H 3O3DA 4BKSC 2H5MA 1N0XL 3GTNA 3L48A 4U1GB 2OP4L 3MBED 3VGFA 2OH1A 1NLBH 4KI5D 5FF6A 2H26A 1W15A 2LFEA 3GYRA 1E0OB 5I1KL 3HC0B 3AGVA 1T1WB 1LTXA 1FZJB 1NDGA 2IDCA 4FFYH 2HX9A 4KXAA 2YPLE 2QT6A 1XL6A 2KZBA 4JZNA 2EXYC 1TQUA 1E8ZA 3GKWH 3MRRA 1T6WA 2Q7BA 3D39A 3EIFA 4HXBH 2B4DB 1JTOA 5FYLL 1NPUA 4X5QA 5GGRB 4ZBGA 1KF9B 4KX9A 3TA4D 3D06A 4U6VL 3ZDZE 1M7XA 3ZHFA 1DUYB 5F9AC 4OGXH 2YR3A 2FRGP 4L8AA 4HT1H 1WIPA 2YLKA 2EVJA 4WWKC 1QSOA 1NANH 4UA3A 4G82A 3WIAA 3ZTNL 2AJUL 2RGSA 3WSQH 5SWQB 5CPAA 1J10A 2NY1B 2X5PA 4N0CC 4PS3A 3BW9B 5IQLA 1IE5A 3T3MF 2WPXA 4F8QA 1C16A 2W92A 2DQDH 1UFUA 4QRSA 5E9DB 2NTFB 2MNUA 2F54E 2NY1D 4MKTA 3QZWA 2LTQC 1WGVA 3IU3B 3PAYA 4XI5C 5E9DD 2R4SL 2CO1A 1AD0A 5CEZE 2PWEA 4BH8B 1SQ2N 3QJHA 4E5XB 4KFZC 5DJZB 1V0CA 1S7TB 1S7RA 1OVZA 2GIYA 1XV8A 2EC9U 2IALB 1UACL 4ODVH 4TULL 4DEPC 3T5WA 2XT1B 1T1YB 3MYJB 1IILE 4QF1B 3REWA 5I8CA 2ZOGA 1A1MB 4M7JH 5ANHA 4Z7VF 1KGXA 1IKNA 5SX4I 1PZ5A 1TVDA 1P7QA 1MUJA 2YBGA 4GAGL 4E36A 2OQJB 2ZIDA 4HKXA 1MJJB 4XMVA 4YMPA 1AANA 1ADQA 3SQOH 3V52H 1Q94B 5MEOB 1JPGA 2K4AA 2ATKA 3FUDA 2X4TA 1E90A 1BA9A 5IVNA 2QQLH 1AS8A 4FD7A 3VCLA 5J1SC 4X6DA 1N10A 1MW1A 4N2HA 3X1FA 2N0KA 1CYGA 1OQXA 4HK0A 3GINA 4PJDB 5D8NA 3QDGA 2WP3T 2H2PC 2OTUB 3DJTA 4W9IC 4NT6B 3DETC 5AOLA 1FZKB 2FEJA 4ORGA 1OHZA 4DP5X 2WQRA 4PJ5E 4UAOB 5DSCA 2EO7A 3FCUB 4JB9L 1PG7W 5G5DA 3ETBJ 3ZJ0A 4OKVA 5IZ7A 2G3ZA 4LCWA 3QR2A 2OZ4L 2VJXA 3QEUA 4PG2A 3V9CA 2DEXX 1BCIA 1SPDA 2X10A 4FL4C 4OF0A 2F5AH 4F7MA 2QGCA 1L7IL 4EN3B 2Q9OA 3QQXA 2D2CC 5MEQB 1QSNA 3L08A 2ENPA 3DV6A 3ULUE 2XHNA 2XNAB 2A4EA 1FL6A 3MJ9L 3MLVH 1NKGA 3X1GA 3L3GA 3NAAH 3MCLH 3NTCH 4Z7QF 5SWZA 3TOPA 3OZKA 3FS9A 4BQ6A 4EIGB 1T66D 2OJ1A 1KCSH 4P2YA 2ZEDA 5F7NC 4FTVB 3KWTA 1JVOA 3W0WE 5C3LD 4JFPA 5M95B 3PFOA 4MMXC 2FBJL 3D1MC 1W8EA 4RZKA 4XBGB 1J0YA 1CX8A 5EDSA 5DJXB 2ITCA 4FTVD 4KK6C 4NBXB 3O3BB 4ZMTA 4OCXH 1GW0A 2Q76A 3HAEH 4MJ5A 4NNXA 4EXKA 4ZPVA 4GRMB 1QPXA 3TA3C 2ZOFA 3GEWB 4N1EA 2ADYA 3HR5A 1XGPB 1NH6A 3LEVH 2B77A 3FRPG 3SGDH 2Q44A 4G80A 5BXFA 2FO1A 1USQA 4H88H 4UYPA 3QZMA 5TH2B 5EMYA 3F05A 1UTDA 3MAWA 1IEAA 4FQ2H 3TO6A 4BFIA 2DB8A 2I60H 3VH9A 3JTTA 1KXVA 1ZS8A 4P5RA 1DBBH 3S2CA 35C8L 5EBMA 3CIQA 2IFFL 4MHNA 5FVJA 3ARDB 5HMNA 3I6KA 2ALWA 5D70L 3BUPA 2EVHA 3SO5A 1VGEH 1HEZA 5IFAH 1S7QB 3KH3A 1OCZB 2FWOB 2E5EA 2VZTA 2Y2YA 1NPJA 2VQ1B 4LSPH 4QTHB 3OPZH 4RMUA 4P23A 4GAYA 3TESA 1AVAA 2AC0A 5GRJH 4K3GA 2XG4B 1TTUA 4A6YA 2H1PH 4LLMB 1EANA 3MCG1 4ZMOA 1D2PA 3QYNA 2XQYK 4L8DA 3VA2C 3KASA 3SKOB 2DM3A 1QMUA 1R34A 1XIWA 1D5MA 2B59A 1CXEA 2WVVA 2HN7A 5CMAA 4M5TA 5FHAH 3ULVD 1NLDL 1TNNA 4QRUA 4MMZC 3ZDYE 3WEXA 1M1XA 1ID2A 2C3XA 3VFGL 4FYTA 1DQLH 3WFDL 1IB5A 4ZS7L 2HFGL 1JGUH 3QNXA 4KI5F 3MUY1 5TDOA 2IBBA 2H1LM 5HPOA 1D5ZB 3W11D 3QR1A 1JZ4A 3TJHD 1F97A 5BOZG 1LDPH 3CQQA 1I9IL 4ONUA 4OLVH 1QFUL 1TENA 5ALBL 3WJMA 4N5ED 1RXLA 3CZKA 2TRYA 5BMFL 4AMXA 1KT2B 5IW3A 5KJ4A 4BXVA 4P4IA 2HJLB 2ZXCA 2CCVA 5CJOL 4GUPA 2BSEA 3OC5A 5IGXH 3UEQA 1IOIA 1YDPA 4FFZH 1NGYB 2CO2A 1U30A 4IK6A 4XP1L 3K1DA 2Q8AH 3NA6A 5J89A 5AOJA 4LPCA 2BJMH 4XP5L 1B6DA 3LIZA 4WEBH 3T1FA 4HGKC 3X14A 5C88A 4EBQL 3BZ5A 4PJFE 2AABL 1JWUA 4I1PA 1HX0A 2EE2A 3ABZA 5DTFA 4X4XB 3X1NA 1QD0A 5BV7B 4RDQF 4ZBJA 4AJWA 1QR4A 5L6YH 3TX8A 1TDQA 5CD3A 1NWPA 4NENA 4QRRE 4Z7UB 4AQEB 3EOTL 2UV3A 3RWDB 4U0RC 1UKSA 4X4ZA 2VE6B 2BOCB 3KPOB 4NGHH 5D7EA 2G4GA 1EZLA 3NH8A 3QZOA 1IAIL 2ADJA 3Q2NA 3OXRB 4FQJL 3UAJD 3VYOA 4RFNB 4OY9A 3A67H 3MRNA 5HGHB 2XTJC 4BWTA 4ELKA 3D9AL 5DUPL 3S7GA 5IOKA 4AB7A 4NGMA 3HN8A 1KXTB 4MNQA 2WXKA 4PRDA 2DMBA 3CSFA 3C5JB 1EXHA 2VMJA 1LP9B 2X1QA 4WI2A 2FGWL 2Z9TA 4G8FA 1LO0L 1ZGLP 4UFWA 4U5YA 3MR9A 4CC4A 1FZMB 3FQWA 2VZUA 4L9LC 2QL1A 2IGFL 4OV6F 2XZQH 2HVKB 2L04A 4M6MH 4KKBD 3CJJA 3S4SB 4ZFGL 2GSGB 2G3XA 4BEIA 4HSAC 4LNRB 1AC0A 1L0YA 3UC0L 1Y7RA 4IOFD 3K2MC 2ZG1A 2IEPA 4XN8A 3T90A 1KBPA 1MY7A 1ND0A 3TP4A 4WEUD 3BPCB 4NBYB 5D6CB 5E51A 5IHWA 4HEMA 3TO2A 5JW4R 4W68A 1ZXKA 1XTMA 1YPZE 4XPKA 3TXAA 4GSDL 4RX4A 4N5UA 1PIGA 3FT3A 2ZNXA 2DEYX 4JZJC 5LYLA 1Q9KA 3PL6D 4UOW1 2NUTB 4TKWA 1CLYH 3VXUA 3IM1A 3VWKB 2Y36L 3QEQD 4LSTH 3CN1A 3OKKA 4NZTL 3TBWB 2FD6L 4MA7H 2WQWA 4NRZB 5HHQB 3FRPA 4JYWA 1T7YA 4A32A 2OYKA 1BZ8A 1K5WA 4ZY0A 1E5AA 3QYCA 4B60A 4QWWC 2F5BL 3DO3A 3UJJL 3BH8A 3CFCH 3VWKD 2VM3A 4NGNA 5F9WB 3TWYA 5KJRL 5FGCB 5E2WH 4DQOH 3ATFA 1XF8A 2FIRT 2X2HA 4UIKL 1Z6JT 5G21A 5CBEB 2G2RA 2FLBT 4ZX4A 1UC6A 4UOW0 4LEOB 3U30B 2A9NH 4LRIA 1D6VH 2XBTA 2FHCA 3NMEA 1MREH 4NQQA 1WCQA 4KX7A 4M8QA 3Q1EA 3ARGB 2J6EA 5I5RA 3NUKA 2A74C 4GS4A 1FFPB 1MCEA 2BY2A 2WIMA 1PNCA 4A2ZA 1N6QH 3EYFA 1XMTA 3QARA 1P2CA 4BIKA 3KKWA 4L8SB 3W1ZA 3SI2A 3D2TA 1JPFB 1KJVB 3QS3A 3W9DB 4ODUB 3ZGIA 4YSAA 1QQ9A 4TVSa 4AENA 6PCYA 1KYAA 1HS6A 4I0PA 5PCYA 3FO1B 1GYWA 1D7FA 4YZFE 3MDJA 2PPDA 4GW4A 3MROA 1TJHH 4TUKH 2NNXA 1FNEA 2QKSA 2WP3O 4XBPB 4DIXA 1CK0L 1NCHA 3GSRA 4RMSA 2AK4E 5SV4A 4X3RA 1JXGA 2DWDA 4OVUA 3GGWA 4XB3A 5GZNC 3I3GA 3D85A 4MZ2A 5FYKL 1IGIH 3EYQC 4H4NA 4MJJA 4OBSA 4IEFB 4YXHL 5E96A 4PV6A 2O26U 3OWEA 1OP5H 1AO7E 4YHIB 3DYPA 3ZR5A 3QISA 1O9ZA 4RFOL 5HI4C 3K72A 3L4WA 4FQQB 3U2JA 2XVGA 2HKAA 1LLAA 1NOFA 4YL4A 2Y2TA 5DO2C 1ULVA 4JPKH 2NCEA 1T83C 3NEOA 3FU5A 4YLQT 4AX3A 3BEVB 2WUBH 3B2DC 2PJ2A 3ZRFC 4ZMLA 1QWNA 1T7WA 3LKQB 3PWPB 4Z76B 1RUKL 2K8QA 5HHOD 5FO2A 4NDMA 5L2KD 1WZ1H 2WO4A 1QNZH 3ZDXF 2V8HA 5ANMA 1ZHBA 5ITBH 1XFOA 1U8KB 5AQ0A 5JPMC 3FOMA 2EDXA 5I15L 4LP4A 1KFAH 3REVB 3CD4A 2H32B 1HHGB 3B3WA 1AGCB 1G7JA 1ODUA 3BZ4A 4CU7A 3FMGL 4U0QB 2NUPB 3H7LA 4JQIH 1XRYA 2HG5B 3DX0A 5GGUB 1F02I 1CXHA 5DQJA 4FF9A 3ULVF 2FB4H 2NXZB 3U4AA 1Z3GH 3E80A 5JHBA 4I13B 3BUIA 3FO9A 4CU8A 1Z5LB 1N2RA 3RAJH 5E94B 3MXVH 2E7LC 3SGEI 5TQ0L 1YAZA 3QW9A 5A2KH 2X4NB 2NXZD 3FH5A 3SDCB 4OJEH 3QUXC 2Z3OA 1MDAA 3CHRA 2CCLA 4GOSA 3WS3A 4UT6A 1X5YA 2YAPA 2W95A 4AC4A 4XPAL 5K8MA 2BOBA 3DDFA 3GXTA 4RZCB 5IB4B 4KV5E 1IBYA 2BDNL 2R2BB 4WO0A 4DYOA 2M8XA 1Q9LB 4ANUA 3VI3A 1YNKL 5EZLA 2PJ6A 2NY4C 2X6CA 1VCBC 5LCVL 1IC5L 1JK8B 4IU2A 2X4RB 4AQ8C 1SM3H 2OL3L 4F8ZA 3ULUH 1U58A 4JM4H 3CZUB 4U1LB 3QPXL 5JIMA 1F11B 2IXQA 3GHPA 3TFBA 2EIKB 3QAZC 2E74C 2I5YL 3FCBA 4ACTA 5EUOE 2HLAB 2YGNA 3S8FB 2G3NA 2Q5BA 2PVVA 2YXMA 2P5EA 4QBJA 4IU3A 3VG0L 4X6CF 5ISZA 3UXFA 2DEAA 4XPHL 1DJZA 1D6EB 3L3DA 4GQ9L 4RMVA 4FG6C 3GSXB 1MQ8A 2BVOA 1DQJA 4HOXA 4NF1A 1CTNA 1I8AA 2X0VA 5AUMA 1DLFL 1UGNA 2YS4A 5B7FA 1RHHB 1BPMA 1A6TA 2BY3A 4Z7UF 4J6IA 5C71A 4LSQL 1IFHH 2VLKA 2D7TL 1HL9A 1ZANH 3NH7L 3QUZC 4D9QD 1RJCA 4ZSOE 2AQ3A 4KO7A 2DDQH 4JCMA 4MXQC 2JLMA 4PXEA 2X7LB 1UWEH 2Z8SA 1R3KB 1KCVL 4KO6A 1RVFL 4PG9A 5FXCH 9PCYA 2VO8A 4OI7A 4JFFA 4UUJB 5B3NA 5E08L 2VIRA 3T0DA 1EEZB 2VLLB 2ZWSA 3II2A 1UURA 4QOKE 1R3IH 4FXKB 4S1RL 3CC5B 3AU0A 3IDMB 1FNSH 3SQBB 3VARA 3S97C 3WEAA 1C5DA 1V7MH 3CPLB 4KJQC 5DZOA 1Y07A 1TKJA 15C8L 1GOHA 1S7XA 1ODAA 5DJ2A 1T1XA 3LD8B 1GXEA 2F5IA 1QLEB 2ZAHA 3MGDA 2Y7NA 2YA2A 5HYJA 1BQ5A 4Q9QL 2Q4YA 4R9MA 5HDOA 2ICWA 2HFEA 3MLUH 1GS8A 2FIKB 1ZGLM 3SI1A 1W0VA 3FH7A 4Y1TA 1T0OA 1TTCA 2CTCA 1LAMA 3ESVF 3G5YB 1Q90A 1FYHB 1HZKA 4WEMB 4UQ2B 1XF2B 5H35B 1F42A 4FXLA 4IBWA 1YJDH 3V7ZA 4BM7A 4P04A 5ENWA 5F7YC 4C4KT 1R46A 4A68A 1AS6A 3JVGC 4R0LC 2AGJH 3I02B 2OSYA 5T1MA 4GXHA 3RKDC 4AW4A 1LYQA 5ADOH 3KL9A 3BN9C 4CAVA 4PJGF 1BD2E 2XVKA 4PJ8C 5HHXH 2BEIA 1I21A 2O53A 3V2AR 1OM3H 4AGMA 2V9UA 1JK9A 4FLQA 1RP8A 2RJMA 3CSYA 3KPPA 2NYYD 1KFGA 4QUOA 4YIQB 3F7YB 5GS1A 1ZE3C 3IJYA 4PN6A 1HHHB 1RIHH 4XR8C 2YZ1A 4TM9A 4OIIL 1VIWA 3C2AH 1ONQA 2H8PB 4G7YH 2VLJE 2FX9H 3FSVA 2NQCA 2UY6A 3DX8B 4CW1B 4P9ML 3DV4A 4R6UA 3QQDA 1A2YA 2FEDD 4AT6B 1JXKA 1ZVSA 1A7OL 4KUZL 5B38G 2A6IB 4RESB 5I1LA 4AYFB 4E0RA 3O2WH 2NSQA 2FAUA 3LRMA 1OT1A 1KEML 2B3IA 4HJ1A 3KPSE 2GSIA 4PWHA 3VFOA 4Z7QE 5KSBA 1ARLA 1WCBA 3KCWA 1X10A 2YD2A 2DMGA 4PB0H 5B22A 3RVXC 5D7IA 3SGJA 1DSFL 4BK5C 2YUZA 1TZHB 4Y5VC 2G9HB 2MTPA 4ANXA 1T0NA 2R7EA 1DQML 4PYGA 1OAYL 4PRPA 3FIXA 3GSNB 2BRRH 4JHAH 1DLHB 1QW8A 4MA8L 5HHVL 3LYRA 2ZWLT 4UM9D 1C08B 4L9DA 2CKNA 4MD5A 1A21A 3FOLA 1BV8A 3LS4H 4GO8A 4JFHE 2JCWA 1J9SA 4N2OA 1FFNA 2CR3A 2ODFA 3KL5A 4FQLH 4HDIA 1E2ZA 5J1QA 4H8WL 4XMTA 4JKWA 3HC0A 3B9VA 3CHQA 2IQ6A 3QT2A 2R2CA 1KPUB 3OMNB 3ZQXA 5C09E 2F7IA 4XCYB 5DS8B 3CN3A 5IBLC 1H3XA 2VL5A 2IF7A 3MV8B 3ISYA 5E7FA 4IRSA 5GSRA 4RH4A 5BW7C 1T03H 4YHKH 3KPRE 4Z1PA 2VC2H 2Z93B 3O6LH 1UGKA 3QCUL 4ZFZA 5FLVA 4PJAB 1CFTA 3MV8D 4OCNC 2W9DL 2ZOWA 4OAWB 2AEPL 2FO4B 4F9LC 4UDUB 2AK1H 3TBCA 1KENL 2XFXB 1BF2A 4LL4A 3QXAA 1HCZA 2FZ3B 5DEGA 2WB7A 3VRLE 3FUHA 2VLRB 1RI8A 4YSDA 5SX5K 1MHPH 3U4BL 1E5ZA 2QLYA 1OE1A 2ISDA 1IIKA 4KKAC 3IMVA 5CJXC 4ZG1A 5L88L 2VLRD 2J8UF 5JDJA 4WW1A 5HP5A 5BUAA 2E27H 1NGPL 4GAJH 3PGDB 3L45A 4JKLA 5L7XL 1HOEA 3BT0A 2NTFA 4AVCA 4FP8L 2P24B 5JW3H 1A9BB 4TV3A 2GG1A 3LVEA 1MWAA 4NRXB 1HL4A 5BVJA 3KD4A 3DROB 3FNKA 4L3FA 4IGBB 3IU3A 1LMIA 3MRFB 1L6PA 4X5WB 5J5EA 2CHDA 3OGOE 1QLRB 3QFDB 4C2ZA 3UH8A 4MHDA 1ZJAA 4ONHB 4HIPA 4IGBD 3BSZH 4ZI6A 2CIJA 1DVQA 2EVIA 5LUMA 4WWVA 1BBJB 2NMSA 4YSRA 3P0VH 5E2VH 4PJHB 2YO3A 4P59H 4TUJA 3SDXF 5EORL 3UTSE 2QHRH 1YRKA 2BO0A 4DWHA 1ETZA 1UXMA 2VR6A 2P80D 3ARFB 4P5TC 3PB6X 2OMYA 3HS8A 4WJ5B 5DRXB 1FYTE 2BVUA 3N9GL 1E50A 4WRLA 2YD8A 3MFFB 4ZT1A 3E8UL 5MEOA 3SE4C 3ARFD 5JIDA 3HZYB 4JPWL 3DVNB 3D87B 1CF8L 5B7EA 3CDZB 3C6LB 1P5UA 1CXFA 1SXSA 1XBRA 3PB9X 5JR1L 5LGHH 4WFFE 3ECQA 4Y5YC 5B1BB 3GJFB 3TBBA 4NJRA 1A64A 1HZHL 5EZOH 4RIRB 3FCGA 1DVFB 1NC4B 5IJVB 3HNVH 5BS0D 2XIDA 1DSWA 3DLQR 3KR5A 3PZJA 3C6LD 3CVHH 5DCCA 5A7EA 1VFAA 2VDNL 1ZTXL 5DMKA 2OTUA 1DVFD 4M56A 3TO4A 1M53A 3N42F 3V38A 5LBSL 3IMBA 3PYCA 3OKMB 1TR7A 5C9KA 1KCRL 3W91A 3QEGH 3MJ8B 1FUNA 3CVIH 3FMCA 3SE3A 4JD6A 3R18A 4XVOA 4XPDC 5FDWB 3ZL2A 1P0HA 4KPHH 2WSAA 2KH2B 5D6DA 4JE4B 1QRNB 3RG1C 4QVTA 4PLKD 4E41A 4B5ZA 3BQUC 5TDPB 2D03L 4WHDA 5DYFA 4WEEA 4EN3A 5MEQA 3BE1L 1DJWA 4H20L 1B2YA 5DQDL 4G1PA 1QRND 3EO1B 3NIFB 2FQGA 4M7LL 2ADIB 2I9LA 5D2LE 3MOAH 3K6SA 3DTDA 3DO7A 1YGHA 5B38A 1J9RA 1Z5RA 3INUL 5DJYA 5I17A 1PQZB 4UYQA 3U36A 1NFKA 2XA3A 4ZPTA 3R1KA 1Y0RA 4WFGD 3VGAB 1QUNB 3A21A 4HKBA 4CADA 3QPKA 1JHLH 1NSNL 3MBWA 4HKFA 3UJTL 5HYSG 3V5HB 2QVIA 1F90H 4M6NL 2X4UB 5E2TH 1E28B 2OL3B 4C56A 1JTTA 2FX7L 3DGGB 3O2DH 5GHWL 2HWZH 2VDPL 5LYDA 3L16A 4B7IA 4S1SH 2M83A 1XGPA 1HNYA 2LOEA 5MI0C 4X83A 3RRQA 5TH2A 2Q4VA 2B4CH 4XPTL 2Z0BA 3MOQA 2CMRL 2OZNA 3AWEA 3OKLB 3NZ8A 4MJ6B 3VQ1C 2PYEB 4FG2A 5KAQG 1ZLHA 2XX1A 3C26A 3ARDA 3KYOB 3OPUA 5CF3A 1LK3L 5JPNA 2N1TE 2XTJE 3RB7A 4APQA 5EDXA 5EBLA 1NWOA 4UMSA 1N5AA 1FBIH 4U7KA 2VQ1A 4AITA 2XG5B 5FUOL 3DPDA 3HMXA 2WLIA 1SDYA 3ASNB 2YOAA 1YNLL 4OFYA 1NBZB 2DD8H 2R0ZL 3QDMB 5J06A 1DQKA 4PQXA 1UCBL 1SFDA 3TN0B 5CZXC 1XD1A 3I9IA 3QDMD 3KEHA 4C4KO 1FF5A 4PTUB 3BJ8A 2V8MA 2JF1A 4P23D 1CGSL 4ZW3A 3PGFL 5CP7B 3KW8A 4D8PB 1MJUL 3G6JB 1LE5A 4AGQA 3WKMH 2I07B 2DIEA 4FI7A 5A2AA 2P48B 4A2EA 5C86A 3BUTA 1XIWD 1PTZA 3RVUD 1MZYA 3BI0A 4XPFH 4JAMB 2HTKD 4R7DA 2COQA 3PJNA 3EJQA 3S36X 1RFDH 1CFQB 1NAMB 1UQSB 5C92A 2JCCA 1IAKB 1WF5A 1KC5H 3QJQB 1UH2A 3B1TA 1Z0NA 3QO0B 3TT3H 4Z7NB 4O9HL 3V0FA 3ZTJH 3HLAB 3SYPA 3QRBA 2P8LA 2AMUA 1IKNC 4BFFA 3IRZA 2X4PA 2CUMA 4BHUA 5I1DA 2R59A 1OP4A 1Y18B 2FGZA 2WXLA 4OGZA 5G55A 3IJHB 3S96B 1V27A 3ZSTA 5JQIB 1PDKB 4PV8A 4X4XA 5TD4A 5JDSB 4UINH 2HKFL 5JOEA 5FEBA 3S98A 3OMAB 1A4JB 4CGTA 1T21A 2AFUA 4MNHA 4HWBA 3DNKA 1KJ2B 2ATPA 4AQEA 1YEWA 4M5YL 4F9UA 3B56A 4C59B 4KMQA 4DGIL 4XBEL 2ZNWA 3KPOA 1U92B 2Z7UA 4HOZA 2O6EA 3ELQA 4M5ZL 4P5KA 3L17A 3VXPB 1A7BA 1BFVL 3DGVA 1N7ML 2EK9A 3GNMH 5E6UB 1H6EA 4OJFL 3R8BB 3Q1SH 4HXAH 4LU5L 1QSTA 3T8XA 2J9AA 4Y4HB 3WJJC 5JHDD 4HZAA 2ED6A 2VDKL 2X6AA 4PJ7B 3C8KB 2H41A 3EFDL 2PW1B 1W16A 4R4FL 1A6AA 3I2CH 3MXWL 2CUAA 4IBZA 1IX2A 4HUWA 2BSRB 4Y4HD 4PG2C 4OM1H 2PO6C 3GSVB 4OQTA 3FF7A 1DUZA 3Q6GL 4KTEH 4BZYA 3NFPA 1NGXB 3FUNA 4Y2OA 3FO0L 2BO9A 4WVRA 4MWFB 1G6RB 4NQXB 4KQ0A 1GZHC 3RZCC 2HVKA 1E8XA 3CVDA 1ZCRA 2VQ4A 4KKQA 4PBWD 1RUPH 5HYIA 1BMWA 3FFCB 1VADA 2G3MA 3MLXH 3NIGF 2A9CA 3BZFB 3O6MH 5TGBB 4F7CA 2VSKB 5MERA 3D66A 2NY0C 3GBML 3F3HA 1RZ7H 2ZOKA 4WUUA 3EJZD 1WYJA 3HE7B 3FFCD 3IJSA 3QUYB 5F7DA 3JWNG 3VE0A 4G3YL 5F6IB 4X6CE 2PR8A 3M8OH 4Q0XH 3V4PL 5HYSA 3N5FA 1NCBL 4GNKB 2VDRH 3EDEA 4HNXB 3UGEA 1JPEA 5IFHL 3VSVA 3HE7D 3QUYD 5E99H 5CCHE 2FJGB 1U8PB 4PRNB 3MNWB 1H0DB 2I9TA 2FIAA 2KI6A 4ONGL 5FO9A 3R4DA 4X6DF 1VSCA 1YMHA 4Z8FL 1NCCH 1SYSB 4R3KA 3U0TA 4ELME 3GZKA 4CYQA 2MQGA 4JGMA 3WKQA 4JKPL 1SDDA 4ZFOB 3GPSA 2MPVA 1KXVC 1MQKL 3QS2A 3BH4A 1IV8A 2W60A 4MNGA 3G5XB 4PLJC 3PIQA 3ECWA 5CBEA 2HKHH 5I19H 4ZAKA 1SMAA 1AI1H 4DF9A 4LEOA 1GTFA 1RV6X 5B39B 1JSYA 3OJDA 3BWAA 5TPWL 4AK1A 3ARGA 1KUVA 3NIFF 5CEZL 1BLIA 1SY6H 5DZNA 4I3RH 1UZ8B 5B4MD 3M45A 4KJPD 2EIJB 1T3FA 3I6LD 3ROOB 5F6HI 2JXMB 3MNZA 5IUSA 2Y07H 5MENE 1E8WA 2Y7SA 1DTDA 3DRTB 3FO1A 1A02N 1OW0A 3FQ4A 4HLZH 1QWHA 1TJIL 2CR0A 1X9UA 2A2QT 2D9CA 4QRQA 4XCCL 1UJ3C 4JFEE 5T33L 2IJ0C 4HAFA 2AMGA 2VDOB 1HJBC 5JQ6H 2HVBA 3S5LA 4FCHA 2YEZA 1Z2KA 2QKIA 3SBWA 5EF1A 4NN5C 3PWNA 4IEFA 5AVTB 4KZEL 1SJVA 1J8HB 1UD6A 4JDEA 4PJGE 4NJ9L 2DL9A 5KYXA 2L0DA 4G8AC 4FQQA 1EGJH 1NJ9B 2E7DA 1YY9C 5ACLA 2IV8A 2VR4A 4XH2B 5INCB 4D2NA 1J8HD 2VABA 5TE7L 5JHLH 5EOCH 1WT5C 3GSWB 2E4FA 1BBDH 2IOOA 3HPLB 3PWPA 4OLYH 5IQ7L 3HA0A 2PYFB 2CK2A 5DS0A 4Y9EA 2WMPA 1OXYA 1AD9A 2XKNA 2ZXAA 5J6HB 1BGXH 2OJZL 1HHGA 4ZXBA 4U6YB 2XQYA 1VHSA 3QUKB 1BVKA 4LLDA 2OZ4A 3FQUA 2DBJA 5DC4B 2HG5A 4PY8I 3BVXA 1EPFA 2CUIA 5CBAA 4L05A 5IM7B 3FK3A 3JBG7 1QSVA 4P46B 1KLUB 2A73A 1NBVH 1M05B 2CJUH 5D7LA 3R7RA 3ERXA 2VAAB 4B7LA 3MJ9A 4P46D 3SDCA 4LOUD 3N41F 5SV3A 3MRHA 3SDAC 1WFMA 2L7QA 2O61B 3NDYE 4FFVC 4ZUUA 2CO4A 3BLKA 2WHVA 4FQXA 1N0LB 2PJCA 3QB8A 1ACYH 3B7YA 2E7BA 2X40A 1QKZL 1GAFL 3TEUA 3H7BA 5IB4A 4RZCA 3EYSL 4WZ9A 3UZVB 3SPGA 1J86A 3UBGA 4HVBA 4F91B 4FLOA 3QUML 2E4TA 3F6IA 4HUVB 2IDSA 2HT2C 2RCSH 1OSPL 1M9WA 4GXFA 5KZCB 2VDPB 2DJ4A 4PXBA 4G6KH 4G6MH 4CC4C 2LAGB 4KROD 5EN2B 2R29L 1S5KA 4Z7NF 3LV3B 2O28A 3N50A 3SJVB 3WIFA 3GUTA 3NCJL 4FS0A 4LBAA 1MF2L 1ID5I 2X1PA 1HC1A 3UABA 3O11B 3OMIB 1G1KA 2NY2B 5EWIH 4ZDHB 4XWGH 3MV9A 3CXFA 4NXKA 5K39A 2NLJA 4AEHH 4G83A 1K5NA 2AXGA 2WKLA 3Q43A 4FFWD 3SJVD 5E4IA 4ZQTA 5JIQA 1PLCA 1QEWA 4NCDA 4Q4EA 3NE8A 2G0LA 3L9YA 2NY2D 3TTSA 5A2BA 1GHFH 4HGWB 4BFEA 3DX7A 4IBUA 1ZDQA 4LAQL 3NSDA 2P5ED 5IV2B 2FE7A 1PG7H 5THWA 3KXFA 3MGAA 2CNYA 3CZSA 4X0KB 2J8UE 1SYVA 4XNQA 1O6SB 3HG1A 2RAMA 1F58H 3MLWH 1SOKA 1DBKH 4WCYH 5IQMA 5DUML 2X7LA 2Y7LA 4NN6B 1AHWA 1BFOB 3GBDA 5C0BD 1GH7A 4UEFA 3AAZA 1SN0A 2R7HA 1BZ9B 5C0IA 4UUJA 3BP6A 4Z3JA 2XYBA 4X98A 5GSVB 2VLLA 3PWLA 2VLKD 4L3EB 5IT2H 3HBGA 1K6QH 1U91A 5FO8A 2ADGB 2V2XA 5GIRB 2H3XC 5K59E 1QBAA 4K3HA 1J0HA 1JZEA 4OZFB 1OP3K 3UZQA 4F37K 1CTMA 3LMSA 4FWUA 5CAYB 1U8OA 4L3ED 4FDWA 3O8XB 2DQTH 5DWUL 3BAKA 1P6WA 1A3LL 1ASOA 3CCHB 2APVA 5HDBE 4R96A 3RU8H 1KN4L 4JFFD 1H15B 3ZKNC 3CZGA 3F7VA 1N67A 1B0GB 1YEIH 3W9EB 4JM0A 1OWRM 2OPCA 2FIKA 1IVLA 3O8XD 2V5SA 4K2UH 4RMQA 2BM3A 2G5UA 3QQ9C 4FNLL 4JY6B 1C8PA 2VQYA 4KXCA 3I3DA 4YQXH 1B0RB 1XF2A 3HRZA 4JFZL 3NCCB 4ENZA 1NE9A 4TTDC 4YFJA 4X9FA 2EQDA 2PDOA 5IROA 1BQKA 1KCUH 1YEKL 4M29A 3P2FA 5LO7A 4FGMA 5F46A 4PWFA 1SFHA 1TSRA 3MTRA 5FA3A 3JV5A 1ELLP 3NEXA 3O3EB 2D7NA 1MN4A 3N91A 5GRZA 3V4VL 5DFVC 4ESKA 3V6OA 1H19A 3DXAB 3WN5A 2O93L 1OGAA 1XGQB 2H45A 2PPFA 5E4EC 3HG2A 4NGSA 4CRPA 3V0HA 3F7YA 1HU8A 3E2HC 2GC4C 1HHHA 1RJZB 3QIBB 3GXIA 5EOCJ 4DGUA 3B7IA 2JSFA 4R8WL 3RPKA 4CVZB 2UWEB 1CR9L 2L8AA 1AXTL 3QH3A 3Q7JA 5IJDC 3UTZA 4M8UA 2R2HB 4M1GH 2D3VA 4MFHA 3DX8A 4CW1A 3QIBD 5HPMB 4U2YA 1GCFA 1VAHA 4MCYB 2W59A 3G6AB 1LOKA 4XXWC 5DT1H 3VI4A 3L1OH 1HH6A 4PB9H 3A5VA 5JW4N 1GCYA 1BOGA 5DYOA 2YD1A 2VDKB 4GYBA 1SLVA 3VRJA 3ABMB 3CN0A 1C7SA 1Q0YL 1I3GL 2EO1A 1IGML 4PUBL 2CBQA 4BUQA 2XWBB 1WBZA 3II3A 1Y7EA 2KDGA 4ZTOH 2QVFB 4QY8B 4AYID 4C68A 1U9KA 3ZTEA 4B96A 5DR5H 2PKDA 3MLTA 1WFJA 3CH1B 4NQDB 4LSRH 3A3YB 4GUCA 1T20B 1C08A 1U3JA 3KPNA 2NX5B 1TETH 1EHKB 2E9JA 2BNUA 1WUZA 3S34H 3GI8L 1MXDA 4NQDD 2JK5B 3SQRA 1DYZA 3M1OA 5ITFB 3T09A 4XCFH 3SN6N 3OMZA 4G9DA 5C0AB 3GYAA 4LLYA 2IH3A 2WQUA 4PRHB 2X6VA 4BFOA 4LX9A 4R4ND 4EMZA 1UD3A 2H3NB 2BIQA 2J8OA 1CF1A 3DLJA 4LOVA 2Z3NA 3QAYA 5T5NG 3WD5H 4M62L 1H3UA 4X7SH 5D2NA 4K8RD 1XB8A 3FKUS 1MJ7L 3S8WA 3ABLB 3HJ0A 4TNWK 3GMMB 3NJNA 4UILH 4TSCL 1WEJL 4IRJA 1R3HB 3DJ9A 5JNYB 1OK8A 3GBEA 3VMPA 5EC1B 3NFSH 2WYTA 1CQYA 2FO4A 4YWGH 4MAUH 2WAQA 2GITB 2DQJL 1FDLH 5I8KH 1Y9KA 3L7FA 3A24A 1W6WA 1YEDB 2PP8A 4OIBA 1RMFH 2ZD0A 3AREA 4DP8X 2B3VA 1UM6H 3VFVB 2YKLH 5I1CL 4LDEB 3F7KA 3HFML 5ETUB 4XC1H 1VJSA 1WP6A 1OSYA 4Q6IB 5ES4B 1R3JB 1CI5A 2P24A 2BK8A 2NXYC 1A9BA 1LO4L 1CB4A 5DLLA 5IF0B 1W72L 3QCVH 3V5DA 4NO2B 2X6MA 2HB6A 3F12B 4H2CA 4OB5L 5FAAA 1QO3B 4OF5A 3TEXA 1ET7A 3W2DL 4F8PA 5ICZA 3H9HB 3AC0A 2W38A 4G6AC 2CKBL 3JWDC 5FUZL 2VB5A 5KVGL 1QPPA 3RQ3A 2R1WB 2O5ZL 2ZG3A 4OM0H 4BKTC 3FX6A 1JHKH 4U33A 3P9MB 3ZL4L 2EUWA 3FPYA 2AEOA 4PS4H 4UNVA 4B5PA 5IBTH 1F56A 4TUOB 4ZW6A 1CL7I 3GI9L 2HLFC 2OCCB 4N8VG 3MRCB 3OQ3B 4Y49C 4NQTA 2HTLD 4MYPA 4AWJC 1U8CA 3JV6B 1MIML 3H2QA 5E9NA 4G8EA 3HZYA 3BPLC 2QEJA 1L0QA 1OPGL 3QG6B 4TN9A 4FLSA 4MXWH 1PD6A 2WO2B 1QHQA 4JVPA 4EIBA 5HI5D 5ID1B 4YHNB 4J39A 3QDJB 2LLNA 1CO1A 3D39E 1NMTA 4ES9A 1GIGH 2ESVB 4S1QL 3AQZA 4L4VB 3SOTA 4DKTA 4ZUTA 3A0OA 2A9ML 2KL6A 1MFAL 3ZHDA 5F71A 4AIZA 4IUSA 3OAUL 1OPOA 4ISVB 5IMMA 1G7PB 1HXMA 5D5MA 2J73A 4WWNA 4L4VD 3P11H 2ATRA 3DX4A 3MJ8A 5DJAB 4YXLH 2GHWB