4FD6A

Crystal structure of native arylalkylamine n-acetyltransferase 2 from the yellow fever mosquito, aedes aegypti
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
218
structure length
218
Chain Sequence
b'KLNNIRFETISSKYYDDVIEHLRQTFFADEPLNKAVNLTRPGQGHPLLEQHSLSTLKDNVSIMAISNDGDIAGVALNGILYGNTDIEKSREKLNEIQDESFKKIFKLLYEQNLKINLFKQFDVDKIFEIRILSVDSRFRGKGLAKKLIEKSEELALDRGFQVMKTDATGAFSQRVVSSLGFITKCEINYTDYLDENGEQIFVVDPPHEKLKIMCKVIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords arylalkylamine N-Acetyltransferase 2
publication title Evolution of insect arylalkylamine N-acetyltransferases: structural evidence from the yellow fever mosquito, Aedes aegypti.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Transferase
total genus 73
structure length 218
sequence length 218
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4fd6A00
2FS5A 4ONUA 4X5KA 5FVJA 2HV2A 2Z11A 1Y7RA 5J8CA 2CNSA 5KTAA 4QVTA 3R9FA 5CNPA 3TE4A 5F46A 1S7KA 2X7BA 2FE7A 2A4NA 1BOBA 3E0KA 2Q4YA 3R96A 3FXTA 2OH1A 2PDOA 3MGDA 4JLYA 1Y9WA 3GKRA 1NE9A 2HQYA 4LX9A 1N71A 3W91A 5JQ4A 2B5GA 1ON0A 1J4JA 1VHSA 5IX3A 4OADA 2D4PA 3OWCA 1M44A 1IYKA 4KOSA 3TO9A 4ORFA 3SXOA 3EXNA 3TT2A 3W6SA 1BO4A 5C82A 3D8PA 1S7NA 1XEBA 4OLLA 4KVME 1WWZA 2ZXVA 4Y49C 3RYOA 4KLVA 1IYLA 1I21A 4MI4A 2CY2A 1CJWA 2ARHA 4QUSA 2O28A 3S6FA 2Q44A 1P4NA 4R3LA 3IGRA 4HNWB 3PZJA 3GY9A 3EC4A 4R57A 2B4DB 3TOBA 2J8RA 4GS4A 4FD7A 4KVXA 2JDDA 3FNCA 4CRYB 1XF8A 3LODA 2BL1A 2ZW5A 2G0BA 2PC1A 2ZPAA 4AVAA 3QB8A 2CNMA 2JDCA 1U6MA 4JXQA 5GCNA 2Z0ZA 1B6BA 2F5IA 2JLMA 4OAEA 4YFJA 5F47A 4UWJA 3DR8A 2BEIA 2EVNA 2R1IA 1YLEA 4FD4A 4UWIA 3BJ8A 4EVYA 3DDDA 2Q4VA 5ISVA 4L89A 2BSWA 3UY5A 2R8VA 2AE6A 4XPDB 4E0AA 3CXSA 1S3ZA 2K5TA 2B5GB 4AG9A 2ZW6A 5EBVA 1M4GA 2FIWA 2VQYA 4KLWA 4IUSA 4UA3A 3FRMA 2GIVA 4NEXA 4K30A 1YVKA 4MBUA 3N7ZA 3TFYA 1TIQA 4R3KA 2IL4A 2OU2A 4CS0B 1B87A 4FD5A 2Q0YA 3D3SA 1UFHA 4B5PA 1Z9UA 3H4QA 1P0HA 1MK4A 5C88A 2PSWA 5IB0A 1I1DA 4FD6A 3R9GA 1YGHA 4NXYA 1YVOA 1Z4RA 3DNSA 3JVNA 1NSLA 2VZYA 4R87A 1QSRA 5F49A 4JJXA 3FYNA 4XPKA 1MJAA 1K4JA 4JXRA 2GE3A 4XPLA 1YK3A 4B5OA 4XNHB 2FXFA 2G3TA 1KUXA 4H6UA 2B3UA 1OZPA 1YX0A 5EC4A 2C27A 3R9EA 4MY3A 1VKCA 4JWPA 2R98A 4U5YA 1PU9A 4HNXB 3TTHA 4AVCA 2NMTA 3G3SA 1FY7A 4KOWA 2RC4A 3GYAA 4DNCA 1L0CA 1I12A 2AJ6A 4PSWA 3QAHA 4NCZA 3EO4A 4KOXA 3KKWA 4II9A 2VEZA 3JUWA 5DWNA 1S7FA 2P6FA 2REFA 2ZW7A 4MJ8A 4M3SA 1Q2DA 3VWDA 2GANA 3ZJ0A 2J8NA 5HH1A 4LUAA 4R9MA 3EY5A 1RO5A 3CXQA 3I3GA 4HNYB 1WK4A 2VI7A 4CAXA 3LD2A 4E2AA 1IB1E 2ZW4A 1PUAA 2PQ8A 4KUAA 3S6GA 4BMHA 1S60A 5IV0A 4B5PB 1KZFA 2BUEA 2Y0MA 2VXKA 3P2HA 2OZUA 1YREA 4QC6A 4CAWA 2P6GA 4H89A 5KTDA 2B3VA 3FBUA 1YR0A 4XPDC 1XIXA 4YGOA 1R57A 2KCWA 2EUIA 4NSQA 2HUZA 4KORA 4RI1A 4KOUA 1M4IA 3PGPA 4AG7A 4MHDA 4QB9A 4U9ZA 4KVOE 2OB0A 5E96A 2B4DA 2FSRA 4IF5A 3FB3A 4F6AA 3TO7A 1CM0A 3V8IA 1NMTA 3VWEA 5F48A 1QSMA 1M1DA 2VZZA 4AVBA 5DWMA 2FL4A 4E8OA 2Z10A 1Y9KA 2OZGA 2D4OA 5H84A 1QSNA 3NE7A 3DR6A 3T9YA 2J8MA 3SXNA 2G3AA 3TOAA 4PV6A 5HMNA 2QMLA 4KUBA 2R7HA 1MJBA 1RXTA 3T90A 3P2FA 5J8FA 4JD6A 4XNHC 4ZBGA 2JEVA 4HKFA 3C26A 2VBQA 1S7LA 2P0WA 1MJ9A 4MY0A 2Q7BA 1XE4A 3TO6A 2B4BA 4NF1A 2OZHA 3K9UA 4UBRA 4J3GA 3SHPA 1Z4EA 5KTCA 2I00A 1LRZA 1Q2CA 3D2PA 3R95A 3ZZIA 3CXPA 4F0YA 2I79A 4RS2A 4KOYA 5I0CA 5JPHA 2REEA 4H6ZA 4Y49B 2ATRA 2PRBA 4YRHA 2H5MA 3S6KA 2PR1A 1QSTA 4PK2A 1Q2YA 2WPWA 3BLNA 3DSBA 2FCKA 1GHEA 4AB7A 1KUYA 2FT0A 1SQHA 3PP9A 2PR8A 3G8WA 2FIAA 2DXQA 3IWGA 1XMTA 2P6EA 1IICA 2QECA 4KOVA 4CAVA 2CNTA 3BJ7A 4QBJA 3EFAA 3F0AA 2WPXA 1M4DA 3FIXA 3F8KA 1V0CA 1IIDA 2QIRA 4M85A 5H86A 3S6HA 3W6XA 2Q04A 4KOTA 3B8GA 1QSOA 3TCVA 4U9YA 4I49A 4PSXA 4L8AA 1S5KA 3D2MA 2B58A 3WR7A 3F5BA 4CRZB 3R1KA 4KZTA 4PK3A 3I9SA 1KUVA
chains in the Genus database with same CATH superfamily
4IK2A 3PBEA 2FS5A 1ZO0A 4ONUA 4X5KA 5FVJA 2HV2A 5HVGA 2Z11A 5HVHA 1Y7RA 5J8CA 1PCAA 2CNSA 4QVTA 5KTAA 3S9LA 3R9FA 4ONWA 5CNPA 2WZNA 5CBMA 1CX8A 3TE4A 3D67A 2V8GA 1AMPA 2JEWA 4B12A 5F46A 4MFQA 1S7KA 1VHEA 2F8HA 2X7BA 2FE7A 3NH8A 2A4NA 1BOBA 1GYTA 2G9DA 1X12A 2Q4YA 3E0KA 4JYWA 3R96A 3WC7A 1YSJA 3FXTA 4CGPA 4C68A 2OH1A 2PDOA 3MGDA 2CTBA 4JLYA 3DLJA 4A39A 4NGRA 3FX6A 2ZOGA 1Y9WA 3N5FA 3GKRA 1NE9A 1YW6A 1QMUA 3IEHA 2HQYA 2PIZA 1HDQA 4DUKA 4LX9A 4CYQA 1JQGA 1N71A 4Q36A 3W91A 5JQ4A 3IU1A 2B5GA 2Z3MA 4M6GA 3HUVA 4UIBA 1ON0A 1J4JA 4UCPA 2C6GA 1VHSA 2PE3A 5IX3A 1Z8LA 4OADA 1ELLP 2D4PA 3OWCA 4OKOA 1M44A 2ZEGA 3MRUA 5HVFA 1IYKA 3PB6X 4KOSA 3TO9A 3KHZA 4ORFA 3SJFA 3SXOA 3EXNA 3TT2A 3W6SA 1BO4A 2ZEEA 5C82A 5JGFA 3TC8A 4NGPA 3JRUA 3D8PA 4R7MA 1TKJA 4PPZA 1S7NA 2Z3PA 1XEBA 4OLLA 5G20A 4KVME 4B6ZA 5K8NA 1WWZA 1ZG8A 2ZXVA 4Y49C 3K2KA 2AFXA 4KLVA 3RYOA 1IYLA 3CDXA 1I21A 4MI4A 4R76A 3V7ZA 3FECA 4MMOA 2CY2A 4P4JA 1CJWA 1XFOA 4OIDA 1IOFA 2ARHA 2GLJA 4QUSA 4NGTA 4UFVA 2O28A 3S6FA 2Q44A 1P4NA 3SI0A 4R3LA 3IGRA 3ISZA 4HNWB 3D7FA 3PZJA 4O23A 4C7IA 3GY9A 2GFQA 4ZYQA 3PEIA 3EC4A 2IJZA 4NGQA 4R57A 4RUHA 2EK9A 2B4DB 5THWA 3TOBA 2J8RA 4GS4A 1TXRA 2BOAA 4DYOA 2PJBA 4FD7A 4KVXA 2JDDA 3FNCA 4A31A 4CRYB 1XF8A 4IAVA 3LODA 5D8NA 2BL1A 2ZW5A 2G0BA 2PC1A 4K3NA 2ZPAA 1CBXA 4AVAA 4JZ0A 3QB8A 4MFLA 2CNMA 3WT4A 1YMEA 1Z5RA 2JDCA 1U6MA 1LAMA 4JXQA 2PCUA 4EMEA 4FWUA 5GCNA 4CGMA 2Z0ZA 3BI0A 4B13A 4P10A 2WYRA 1B6BA 3KZWA 4C2YA 5K8OA 1IOIA 2F5IA 4R8FA 2Q51A 2JLMA 4AXVA 5JH9A 4OAEA 4YFJA 5F47A 2RFHA 2WSAA 4C2XA 2POKA 3KQXA 3DR8A 4UWJA 3D66A 3B3SA 1HEEA 4ZY0A 4YU9A 4Q38A 3QNVA 2DPSA 2BEIA 3FEEA 1LAPA 2EVNA 1JWQA 1VGYA 2AFWA 3KHXA 2R1IA 2F7VA 1DTDA 1YLEA 3T8WA 3KASA 4FD4A 5LYFA 4UWIA 1Z8WA 5LRKA 3BJ8A 5IB9A 4EVYA 2VL1A 5D29A 3DDDA 2Q4VA 2C6PA 3PB4X 4L89A 5AG6A 2BSWA 3UY5A 5ISVA 4MHZA 2R8VA 3PB9X 2PIYA 2ZENA 2AE6A 3JTKA 4XPDB 3VARA 4E0AA 3CXSA 2O53A 4UCMA 1S3ZA 2K5TA 3V38A 2B5GB 3NE8A 4AG9A 2ZW6A 2PRQA 4F0XA 5EBVA 1M4GA 8CPAA 3FVLA 4OC4A 4A2ZA 1TKFA 4NGMA 2FIWA 4PXDA 2YNEA 1TF8A 2VQYA 4KLWA 4IUSA 1CPSA 4UA3A 1YW4A 3KQZA 4MCPA 3RBUA 3FRMA 2GIVA 4NEXA 4X2TA 5HXDA 4A30A 4FBEA 4K30A 1YVKA 4UFXA 2V8HA 4MBUA 3N7ZA 3TFYA 1TIQA 4R3KA 1ZLIA 3NA6A 2IL4A 1UWYA 2OU2A 4CS0B 1XRYA 3KL9A 2YGWA 2Z3OA 4CYPA 1ELMP 1B87A 4FD5A 2Q0YA 4P44A 3CPXA 3D3SA 5EMIA 3B7IA 1UFHA 4B5PA 1Z9UA 2PJ6A 3H4QA 4TWEA 1P0HA 1MK4A 4E2AA 2PSWA 1AYEA 5C88A 5IB0A 1I1DA 4FD6A 4Z65A 2Z3NA 3R9GA 1YGHA 3D7HA 1TKHA 1IU8A 2PJ5A 3B2YA 3S9MA 3NFZA 3CPAA 3BI1A 4NXYA 4MCRA 1YVOA 1Z4RA 3DNSA 3JVNA 1NSLA 4PXEA 2VZYA 2AFOA 2YNCC 4R87A 1QSRA 3TX8A 4CAEA 3KI9A 2XEIA 4UF4A 5F49A 4JJXA 3FYNA 2QYVA 4XPKA 1MJAA 3SJGA 4CYNA 5AG4A 4ZGYB 1K4JA 4JXRA 2GE3A 1YLOA 4NGSA 2Q43A 1AUGA 1TF9A 2YNDA 3B3TA 2ODFA 4XPLA 1YK3A 4CYOA 1Z2LA 4B5OA 4XNHB 2FXFA 1FT7A 1BLLE 4A32A 2G3TA 2FVGA 1KUXA 2I3CA 1Z8XA 2XEFA 4H6UA 2B3UA 1OZPA 4YWYA 1YX0A 2PJ1A 2C27A 3CT9A 4Q7AA 5EC4A 4KSFA 4HPSA 2CXAA 5LRJA 5BWAB 3D4UA 3R9EA 4BD9A 2J9AA 4H2KA 3SI2A 3LACA 1VKCA 3IU2A 4G1PA 2R98A 4JWPA 4MY3A 4F8ZA 4KSIA 3D68A 1CPXA 4OC0A 2EBJA 4U5YA 4OC5A 1PU9A 4HNXB 1R3NA 4UEZA 2PJ4A 3TTHA 4AVCA 4ZX9A 2CTCA 2ZOFA 5LYIA 3H5ZA 4MFPA 5I4MA 2NMTA 3G3SA 1FY7A 4KOWA 4CGOA 2RC4A 3GYAA 3SI1A 4DNCA 1L0CA 1DE4C 1I12A 1Z8TA 3SJEA 4W9YA 5LYLA 2Z3KA 1IY7A 2AJ6A 4PSWA 3QAYA 3QAHA 1Y7EA 3IWEA 4NCZA 3EO4A 2PJCA 5CPAA 4P4FA 4MCQA 3RZAA 5DS0A 4UEEA 4KOXA 3KKWA 4II9A 2VEZA 4UFWA 3B3WA 3JUWA 5DWNA 1S7FA 2P6FA 2REFA 1KWMA 2ZW7A 4UCNA 5K8MA 4WWVA 3FH4A 4MJ8A 4M3SA 3PFEA 4ZX8A 5F09A 1Q2DA 3PBBA 2GANA 3VWDA 4OP4A 3ZJ0A 4IHMA 3S9NA 2J8NA 5HH1A 4BINA 1NSAA 4LUAA 3VATA 3WABA 5J1QA 4R9MA 3EY5A 4MFZA 1RO5A 2ZELA 3B35A 3CXQA 3I3GA 1WK4A 2VI7A 4HNYB 3LD2A 3GLJA 2C6CA 1IB1E 2AFUA 2ZW4A 2ZEHA 1PUAA 3H8GA 4EWTA 4B14A 2PQ8A 2OOTA 4KUAA 3S6GA 4BMHA 1S60A 5IV0A 3IWWA 1XMBA 1IGBA 4B5PB 2XEJA 1A2ZA 2C1CA 1KZFA 2BUEA 2QJ8A 2Y0MA 3LWUA 2VXKA 3P2HA 2OZUA 1BPNA 1YREA 4QC6A 4CAWA 2P6GA 3PB8X 4H89A 5KTDA 2B3VA 3FBUA 4P6YA 4X8IA 1YR0A 1R43A 4XPDC 1XOVA 3PB7X 1XIXA 4YGOA 4B11A 4C2ZA 1R57A 1Y0YA 2NSMA 3B3CA 2KCWA 2EUIA 2O4HA 1EE3P 4NSQA 3IJ3A 1OBRA 3NH5A 2HUZA 2IMOA 4KORA 4RI1A 4KOUA 1M4IA 2PJ9A 2V8VA 1BAVA 3CZXA 3PGPA 4AG7A 4GXHA 2HB6A 3DGVA 4MHDA 4QB9A 4U9ZA 2EWBA 5LRGA 1F57A 1QQ9A 4KVOE 2OB0A 5E96A 2B4DA 2FSRA 4IF5A 4F9UA 1ZG9A 3I1UA 3FB3A 4F6AA 3TO7A 3KR5A 4ZY1A 2XEGA 1CM0A 2PJ7A 2PJ0A 4NJRA 2ANPA 3V8IA 2WUUA 4P4DA 3IFEA 1NMTA 1CP7A 3IC1A 1XBUA 3VWEA 4MCSA 4MFJA 2Q7SA 5F48A 3FEDA 1QSMA 2PVWA 2Q4ZA 1M1DA 2VZZA 4OC2A 4OIWA 4C7HA 4AVBA 4BBHA 3FF3A 4OC3A 5DWMA 2FL4A 4E8OA 2Z10A 1ZLHA 1Y9KA 2OZGA 2V77A 4ZY2A 2D4OA 4MHPA 5H84A 1QSNA 3WC6A 1ARLA 3NE7A 3DR6A 2ZEPA 3T9YA 3BXMA 2EK8A 2BO9A 2J8MA 4NGNA 4A37A 3SXNA 2G3AA 5LYDA 4LQ6A 3TOAA 4PV6A 3D7DA 2QMLA 5HMNA 1RTQA 4KUBA 4R6TA 1LFWA 1MJBA 2R7HA 1RXTA 4A94A 3T90A 3P2FA 5G21A 5J8FA 4JD6A 2GLFA 4CPAA 4MXUA 4MHYA 4X3RA 4XNHC 4ZBGA 4NJQA 3FMCA 5A27A 4MRIA 2JEVA 4B10A 2V8DA 4HKFA 3C26A 2VBQA 4P4IA 1S7LA 2DPTA 2IQ6A 3KR4A 1PYTB 2P0WA 2GU2A 3HLPA 4MFKA 3A9LA 2PVVA 4P4EA 4P45A 3RO0A 1MJ9A 3IIBA 4MY0A 7CPAA 2Q7BA 4FUUA 1XE4A 4UIAA 3TO6A 4LQGA 2B4BA 4NF1A 3PFOA 2OZHA 3K9UA 3NH4A 1LOKA 4OMEA 4UBRA 2ZEDA 1XJOA 4J3GA 4OC1A 3SHPA 1Z4EA 1LCPA 4P4BA 4KS9A 2ABZA 5KTCA 2I00A 1LRZA 1Q2CA 3D2PA 3R95A 3ZZIA 3CXPA 1YQEA 2QVPA 3K9TA 1F2OA 5G1ZA 4F0YA 1Y0RA 2I79A 3L2NA 4KOYA 4RS2A 5AG7A 5I0CA 3LMSA 2ZEOA 2REEA 4H6ZA 5JPHA 4A33A 4Y49B 2ZEMA 4A38A 2ATRA 2Z3LA 2PRBA 4YRHA 2EO8A 2H5MA 2DF5A 1F2PA 3S6KA 1VIXA 5AG5A 2PR1A 4TNUA 1QSTA 4PXBA 2PJ8A 6CPAA 4PK2A 1HDUA 5G22A 5JM6A 2GREA 1Q2YA 2WPWA 1M4LA 4PXCA 4CAFA 3BLNA 3DSBA 5A28A 2DEAA 2FCKA 1GHEA 4AB7A 1KUYA 2FT0A 1SQHA 2AFMA 3WC5A 4FAIA 5AGEA 4A95A 2YNCA 3SJXA 3GIUA 3PP9A 4DJLA 2PR8A 3H8FA 3G8WA 2AFZA 4NFRA 4M6HA 2FIAA 3MN8A 2DXQA 3IWGA 1CG2A 1FNOA 4MHNA 2PJAA 4ZI6A 1XMTA 2P6EA 1IICA 3BHXA 4PQAA 3FJUA 2QECA 1H8LA 2PJ2A 4KOVA 3GB0A 2CIJA 4CGLA 4CAVA 2CNTA 4WJBA 1ARMA 1CP6A 4CGNA 3BJ7A 3IO1A 4QBJA 3EFAA 3GUXA 3F0AA 1VHOA 2WPXA 3PRTA 4RN7A 1BPMA 1M4DA 1X10A 3FIXA 3F8KA 5K8PA 1V0CA 1Q7LA 1IIDA 2QIRA 2BCOA 4M85A 4GM5A 5H86A 3H8EA 3S6HA 2ZEFA 2OR4A 2RB7A 1LANA 3W6XA 2Q04A 2PJ3A 4KOTA 3B8GA 4EFDA 4F9VA 1QSOA 3TCVA 3KGQA 4U9YA 4I49A 4CAXA 4PSXA 4L8AA 2NYQA 1S5KA 3D2MA 2AFSA 3B3VA 2B58A 1ZG7A 4M6IA 3RNZA 3WR7A 3F5BA 2CF4A 3VH9A 4CRZB 3R1KA 4KSAA 4UEFA 2HC9A 4KZTA 2JBJA 3ISXA 5ELYA 4PK3A 3D7GA 3I9SA 3RAMA 1KUVA 2JBKA
chains in the Genus database with same CATH topology
2FS5A 1ZO0A 4ONUA 4X5KA 5FVJA 2HV2A 2Z11A 1Y7RA 5J8CA 2CNSA 5KTAA 4QVTA 3R9FA 5CNPA 3TE4A 4B12A 5F46A 4MFQA 1S7KA 2X7BA 2FE7A 2A4NA 1BOBA 3E0KA 2Q4YA 3R96A 3FXTA 4CGPA 4C68A 2OH1A 2PDOA 3MGDA 4JLYA 1Y9WA 3GKRA 1NE9A 2HQYA 4LX9A 4CYQA 1N71A 4Q36A 3W91A 5JQ4A 3IU1A 2B5GA 2Z3MA 1ON0A 1J4JA 4UCPA 1VHSA 5IX3A 4OADA 2D4PA 3OWCA 1M44A 1IYKA 4KOSA 3TO9A 4ORFA 3SXOA 3EXNA 3TT2A 3W6SA 1BO4A 5C82A 3D8PA 1S7NA 2Z3PA 1XEBA 4OLLA 5G20A 4KVME 1WWZA 2ZXVA 4Y49C 3RYOA 4KLVA 1IYLA 1I21A 4MI4A 2CY2A 1CJWA 2ARHA 4QUSA 4UFVA 2O28A 3S6FA 2Q44A 1P4NA 4R3LA 3IGRA 4HNWB 3PZJA 4C7IA 3GY9A 3EC4A 4R57A 2B4DB 3TOBA 2J8RA 4GS4A 4FD7A 4KVXA 2JDDA 3FNCA 4A31A 4CRYB 1XF8A 3LODA 2BL1A 2ZW5A 2G0BA 2PC1A 2ZPAA 4AVAA 4MFLA 3QB8A 2CNMA 2JDCA 1U6MA 4JXQA 5GCNA 4CGMA 2Z0ZA 4B13A 4C2YA 1B6BA 2F5IA 2JLMA 4OAEA 4YFJA 5F47A 2WSAA 4C2XA 4UWJA 3DR8A 4Q38A 2DPSA 2BEIA 2EVNA 2R1IA 1YLEA 4FD4A 4UWIA 3BJ8A 4EVYA 3DDDA 2Q4VA 5ISVA 4L89A 5AG6A 2BSWA 3UY5A 2R8VA 2AE6A 3JTKA 4XPDB 4E0AA 3CXSA 4UCMA 1S3ZA 2K5TA 4F0XA 2B5GB 4AG9A 2ZW6A 5EBVA 1M4GA 4A2ZA 2FIWA 2YNEA 2VQYA 4KLWA 4IUSA 4UA3A 3FRMA 2GIVA 4NEXA 4A30A 4K30A 1YVKA 4UFXA 4MBUA 3N7ZA 3TFYA 1TIQA 4R3KA 2IL4A 2OU2A 4CS0B 2YGWA 2Z3OA 4CYPA 1B87A 4FD5A 2Q0YA 3D3SA 1UFHA 4B5PA 1Z9UA 3H4QA 1P0HA 1MK4A 5C88A 2PSWA 5IB0A 1I1DA 4FD6A 2Z3NA 3R9GA 1YGHA 4NXYA 1YVOA 1Z4RA 3DNSA 3JVNA 1NSLA 2VZYA 2YNCC 4R87A 4CAEA 1QSRA 5F49A 4JJXA 3FYNA 4XPKA 1MJAA 4CYNA 5AG4A 4ZGYB 1K4JA 4JXRA 2GE3A 2YNDA 4XPLA 1YK3A 4CYOA 4B5OA 4XNHB 2FXFA 4A32A 2G3TA 1KUXA 4H6UA 2B3UA 1OZPA 1YX0A 5EC4A 2C27A 4KSFA 2CXAA 5BWAB 3R9EA 4MY3A 1VKCA 3IU2A 4JWPA 2R98A 4U5YA 1PU9A 4HNXB 3TTHA 4AVCA 3H5ZA 4MFPA 2NMTA 3G3SA 1FY7A 4KOWA 4CGOA 2RC4A 3GYAA 4DNCA 1L0CA 1I12A 2Z3KA 2AJ6A 4PSWA 3QAHA 3IWEA 4NCZA 3EO4A 4KOXA 3KKWA 4II9A 2VEZA 4UFWA 3JUWA 5DWNA 1S7FA 2P6FA 2REFA 2ZW7A 4UCNA 4MJ8A 4M3SA 1Q2DA 3VWDA 2GANA 3ZJ0A 2J8NA 5HH1A 4LUAA 4R9MA 3EY5A 4MFZA 1RO5A 3CXQA 3I3GA 4HNYB 1WK4A 2VI7A 4CAXA 3LD2A 4E2AA 1IB1E 2ZW4A 1PUAA 4B14A 2PQ8A 4KUAA 3S6GA 4BMHA 1S60A 5IV0A 4B5PB 1KZFA 2BUEA 2Y0MA 2VXKA 3P2HA 2OZUA 1YREA 4QC6A 4CAWA 2P6GA 4H89A 5KTDA 2B3VA 3FBUA 1YR0A 4XPDC 1XIXA 4YGOA 4B11A 4C2ZA 1R57A 2KCWA 2EUIA 4NSQA 2HUZA 4KORA 4RI1A 4KOUA 1M4IA 3PGPA 4AG7A 4MHDA 4QB9A 4U9ZA 4KVOE 2OB0A 5E96A 2B4DA 2FSRA 4IF5A 3FB3A 4F6AA 3TO7A 1CM0A 3V8IA 2WUUA 1NMTA 3VWEA 4MFJA 5F48A 1QSMA 1M1DA 2VZZA 4C7HA 4AVBA 4BBHA 5DWMA 2FL4A 4E8OA 2Z10A 1Y9KA 2OZGA 2D4OA 5H84A 1QSNA 3NE7A 3DR6A 3T9YA 2J8MA 3SXNA 2G3AA 3TOAA 4PV6A 5HMNA 2QMLA 4KUBA 2R7HA 1MJBA 1RXTA 3T90A 3P2FA 5G21A 5J8FA 4JD6A 4XNHC 4ZBGA 5A27A 2JEVA 4B10A 4HKFA 3C26A 2VBQA 1S7LA 2DPTA 2P0WA 4MFKA 3A9LA 1MJ9A 4MY0A 2Q7BA 1XE4A 3TO6A 2B4BA 4NF1A 2OZHA 3K9UA 4UBRA 4J3GA 3SHPA 1Z4EA 4KS9A 5KTCA 2I00A 1LRZA 1Q2CA 3D2PA 3R95A 3ZZIA 3CXPA 4F0YA 5G1ZA 2I79A 4RS2A 5AG7A 4KOYA 5I0CA 5JPHA 2REEA 4H6ZA 4A33A 4Y49B 2ATRA 2Z3LA 2PRBA 4YRHA 2H5MA 3S6KA 5AG5A 2PR1A 1QSTA 4PK2A 5G22A 1Q2YA 2WPWA 4CAFA 3BLNA 3DSBA 5A28A 2FCKA 1GHEA 4AB7A 1KUYA 2FT0A 1SQHA 5AGEA 4A95A 2YNCA 3PP9A 2PR8A 3G8WA 2FIAA 2DXQA 3IWGA 1XMTA 2P6EA 1IICA 2QECA 4KOVA 4CGLA 4CAVA 2CNTA 4CGNA 3BJ7A 4QBJA 3EFAA 3F0AA 2WPXA 1M4DA 3FIXA 3F8KA 1V0CA 1IIDA 2QIRA 4M85A 5H86A 3S6HA 3W6XA 2Q04A 4KOTA 3B8GA 1QSOA 3TCVA 4U9YA 4I49A 4PSXA 4L8AA 1S5KA 3D2MA 2B58A 3WR7A 3F5BA 4CRZB 3R1KA 4KSAA 4KZTA 4PK3A 3I9SA 1KUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FS5 A;  4ONU A;  4X5K A;  5FVJ A;  2HV2 A;  2Z11 A;  1Y7R A;  5J8C A;  2CNS A;  5KTA A;  4QVT A;  3R9F A;  5CNP A;  3TE4 A;  5F46 A;  1S7K A;  2X7B A;  2FE7 A;  2A4N A;  1BOB A;  3E0K A;  2Q4Y A;  3R96 A;  3FXT A;  2OH1 A;  2PDO A;  3MGD A;  4JLY A;  1Y9W A;  3GKR A;  1NE9 A;  2HQY A;  4LX9 A;  1N71 A;  3W91 A;  5JQ4 A;  2B5G A;  1ON0 A;  1J4J A;  1VHS A;  5IX3 A;  4OAD A;  2D4P A;  3OWC A;  1M44 A;  1IYK A;  4KOS A;  3TO9 A;  4ORF A;  3SXO A;  3EXN A;  3TT2 A;  3W6S A;  1BO4 A;  5C82 A;  3D8P A;  1S7N A;  1XEB A;  4OLL A;  4KVM E;  1WWZ A;  2ZXV A;  4Y49 C;  3RYO A;  4KLV A;  1IYL A;  1I21 A;  4MI4 A;  2CY2 A;  1CJW A;  2ARH A;  4QUS A;  2O28 A;  3S6F A;  2Q44 A;  1P4N A;  4R3L A;  3IGR A;  4HNW B;  3PZJ A;  3GY9 A;  3EC4 A;  4R57 A;  2B4D B;  3TOB A;  2J8R A;  4GS4 A;  4FD7 A;  4KVX A;  2JDD A;  3FNC A;  4CRY B;  1XF8 A;  3LOD A;  2BL1 A;  2ZW5 A;  2G0B A;  2PC1 A;  2ZPA A;  4AVA A;  3QB8 A;  2CNM A;  2JDC A;  1U6M A;  4JXQ A;  5GCN A;  2Z0Z A;  1B6B A;  2F5I A;  2JLM A;  4OAE A;  4YFJ A;  5F47 A;  4UWJ A;  3DR8 A;  2BEI A;  2EVN A;  2R1I A;  1YLE A;  4FD4 A;  4UWI A;  3BJ8 A;  4EVY A;  3DDD A;  2Q4V A;  5ISV A;  4L89 A;  2BSW A;  3UY5 A;  2R8V A;  2AE6 A;  4XPD B;  4E0A A;  3CXS A;  1S3Z A;  2K5T A;  2B5G B;  4AG9 A;  2ZW6 A;  5EBV A;  1M4G A;  2FIW A;  2VQY A;  4KLW A;  4IUS A;  4UA3 A;  3FRM A;  2GIV A;  4NEX A;  4K30 A;  1YVK A;  4MBU A;  3N7Z A;  3TFY A;  1TIQ A;  4R3K A;  2IL4 A;  2OU2 A;  4CS0 B;  1B87 A;  4FD5 A;  2Q0Y A;  3D3S A;  1UFH A;  4B5P A;  1Z9U A;  3H4Q A;  1P0H A;  1MK4 A;  5C88 A;  2PSW A;  5IB0 A;  1I1D A;  4FD6 A;  3R9G A;  1YGH A;  4NXY A;  1YVO A;  1Z4R A;  3DNS A;  3JVN A;  1NSL A;  2VZY A;  4R87 A;  1QSR A;  5F49 A;  4JJX A;  3FYN A;  4XPK A;  1MJA A;  1K4J A;  4JXR A;  2GE3 A;  4XPL A;  1YK3 A;  4B5O A;  4XNH B;  2FXF A;  2G3T A;  1KUX A;  4H6U A;  2B3U A;  1OZP A;  1YX0 A;  5EC4 A;  2C27 A;  3R9E A;  4MY3 A;  1VKC A;  4JWP A;  2R98 A;  4U5Y A;  1PU9 A;  4HNX B;  3TTH A;  4AVC A;  2NMT A;  3G3S A;  1FY7 A;  4KOW A;  2RC4 A;  3GYA A;  4DNC A;  1L0C A;  1I12 A;  2AJ6 A;  4PSW A;  3QAH A;  4NCZ A;  3EO4 A;  4KOX A;  3KKW A;  4II9 A;  2VEZ A;  3JUW A;  5DWN A;  1S7F A;  2P6F A;  2REF A;  2ZW7 A;  4MJ8 A;  4M3S A;  1Q2D A;  3VWD A;  2GAN A;  3ZJ0 A;  2J8N A;  5HH1 A;  4LUA A;  4R9M A;  3EY5 A;  1RO5 A;  3CXQ A;  3I3G A;  4HNY B;  1WK4 A;  2VI7 A;  4CAX A;  3LD2 A;  4E2A A;  1IB1 E;  2ZW4 A;  1PUA A;  2PQ8 A;  4KUA A;  3S6G A;  4BMH A;  1S60 A;  5IV0 A;  4B5P B;  1KZF A;  2BUE A;  2Y0M A;  2VXK A;  3P2H A;  2OZU A;  1YRE A;  4QC6 A;  4CAW A;  2P6G A;  4H89 A;  5KTD A;  2B3V A;  3FBU A;  1YR0 A;  4XPD C;  1XIX A;  4YGO A;  1R57 A;  2KCW A;  2EUI A;  4NSQ A;  2HUZ A;  4KOR A;  4RI1 A;  4KOU A;  1M4I A;  3PGP A;  4AG7 A;  4MHD A;  4QB9 A;  4U9Z A;  4KVO E;  2OB0 A;  5E96 A;  2B4D A;  2FSR A;  4IF5 A;  3FB3 A;  4F6A A;  3TO7 A;  1CM0 A;  3V8I A;  1NMT A;  3VWE A;  5F48 A;  1QSM A;  1M1D A;  2VZZ A;  4AVB A;  5DWM A;  2FL4 A;  4E8O A;  2Z10 A;  1Y9K A;  2OZG A;  2D4O A;  5H84 A;  1QSN A;  3NE7 A;  3DR6 A;  3T9Y A;  2J8M A;  3SXN A;  2G3A A;  3TOA A;  4PV6 A;  5HMN A;  2QML A;  4KUB A;  2R7H A;  1MJB A;  1RXT A;  3T90 A;  3P2F A;  5J8F A;  4JD6 A;  4XNH C;  4ZBG A;  2JEV A;  4HKF A;  3C26 A;  2VBQ A;  1S7L A;  2P0W A;  1MJ9 A;  4MY0 A;  2Q7B A;  1XE4 A;  3TO6 A;  2B4B A;  4NF1 A;  2OZH A;  3K9U A;  4UBR A;  4J3G A;  3SHP A;  1Z4E A;  5KTC A;  2I00 A;  1LRZ A;  1Q2C A;  3D2P A;  3R95 A;  3ZZI A;  3CXP A;  4F0Y A;  2I79 A;  4RS2 A;  4KOY A;  5I0C A;  5JPH A;  2REE A;  4H6Z A;  4Y49 B;  2ATR A;  2PRB A;  4YRH A;  2H5M A;  3S6K A;  2PR1 A;  1QST A;  4PK2 A;  1Q2Y A;  2WPW A;  3BLN A;  3DSB A;  2FCK A;  1GHE A;  4AB7 A;  1KUY A;  2FT0 A;  1SQH A;  3PP9 A;  2PR8 A;  3G8W A;  2FIA A;  2DXQ A;  3IWG A;  1XMT A;  2P6E A;  1IIC A;  2QEC A;  4KOV A;  4CAV A;  2CNT A;  3BJ7 A;  4QBJ A;  3EFA A;  3F0A A;  2WPX A;  1M4D A;  3FIX A;  3F8K A;  1V0C A;  1IID A;  2QIR A;  4M85 A;  5H86 A;  3S6H A;  3W6X A;  2Q04 A;  4KOT A;  3B8G A;  1QSO A;  3TCV A;  4U9Y A;  4I49 A;  4PSX A;  4L8A A;  1S5K A;  3D2M A;  2B58 A;  3WR7 A;  3F5B A;  4CRZ B;  3R1K A;  4KZT A;  4PK3 A;  3I9S A;  1KUV A; 
#chains in the Genus database with same CATH topology
 4IK2 A;  3PBE A;  2FS5 A;  1ZO0 A;  4ONU A;  4X5K A;  5FVJ A;  2HV2 A;  5HVG A;  2Z11 A;  5HVH A;  1Y7R A;  5J8C A;  1PCA A;  2CNS A;  4QVT A;  5KTA A;  3S9L A;  3R9F A;  4ONW A;  5CNP A;  2WZN A;  5CBM A;  1CX8 A;  3TE4 A;  3D67 A;  2V8G A;  1AMP A;  2JEW A;  4B12 A;  5F46 A;  4MFQ A;  1S7K A;  1VHE A;  2F8H A;  2X7B A;  2FE7 A;  3NH8 A;  2A4N A;  1BOB A;  1GYT A;  2G9D A;  1X12 A;  2Q4Y A;  3E0K A;  4JYW A;  3R96 A;  3WC7 A;  1YSJ A;  3FXT A;  4CGP A;  4C68 A;  2OH1 A;  2PDO A;  3MGD A;  2CTB A;  4JLY A;  3DLJ A;  4A39 A;  4NGR A;  3FX6 A;  2ZOG A;  1Y9W A;  3N5F A;  3GKR A;  1NE9 A;  1YW6 A;  1QMU A;  3IEH A;  2HQY A;  2PIZ A;  1HDQ A;  4DUK A;  4LX9 A;  4CYQ A;  1JQG A;  1N71 A;  4Q36 A;  3W91 A;  5JQ4 A;  3IU1 A;  2B5G A;  2Z3M A;  4M6G A;  3HUV A;  4UIB A;  1ON0 A;  1J4J A;  4UCP A;  2C6G A;  1VHS A;  2PE3 A;  5IX3 A;  1Z8L A;  4OAD A;  1ELL P;  2D4P A;  3OWC A;  4OKO A;  1M44 A;  2ZEG A;  3MRU A;  5HVF A;  1IYK A;  3PB6 X;  4KOS A;  3TO9 A;  3KHZ A;  4ORF A;  3SJF A;  3SXO A;  3EXN A;  3TT2 A;  3W6S A;  1BO4 A;  2ZEE A;  5C82 A;  5JGF A;  3TC8 A;  4NGP A;  3JRU A;  3D8P A;  4R7M A;  1TKJ A;  4PPZ A;  1S7N A;  2Z3P A;  1XEB A;  4OLL A;  5G20 A;  4KVM E;  4B6Z A;  5K8N A;  1WWZ A;  1ZG8 A;  2ZXV A;  4Y49 C;  3K2K A;  2AFX A;  4KLV A;  3RYO A;  1IYL A;  3CDX A;  1I21 A;  4MI4 A;  4R76 A;  3V7Z A;  3FEC A;  4MMO A;  2CY2 A;  4P4J A;  1CJW A;  1XFO A;  4OID A;  1IOF A;  2ARH A;  2GLJ A;  4QUS A;  4NGT A;  4UFV A;  2O28 A;  3S6F A;  2Q44 A;  1P4N A;  3SI0 A;  4R3L A;  3IGR A;  3ISZ A;  4HNW B;  3D7F A;  3PZJ A;  4O23 A;  4C7I A;  3GY9 A;  2GFQ A;  4ZYQ A;  3PEI A;  3EC4 A;  2IJZ A;  4NGQ A;  4R57 A;  4RUH A;  2EK9 A;  2B4D B;  5THW A;  3TOB A;  2J8R A;  4GS4 A;  1TXR A;  2BOA A;  4DYO A;  2PJB A;  4FD7 A;  4KVX A;  2JDD A;  3FNC A;  4A31 A;  4CRY B;  1XF8 A;  4IAV A;  3LOD A;  5D8N A;  2BL1 A;  2ZW5 A;  2G0B A;  2PC1 A;  4K3N A;  2ZPA A;  1CBX A;  4AVA A;  4JZ0 A;  3QB8 A;  4MFL A;  2CNM A;  3WT4 A;  1YME A;  1Z5R A;  2JDC A;  1U6M A;  1LAM A;  4JXQ A;  2PCU A;  4EME A;  4FWU A;  5GCN A;  4CGM A;  2Z0Z A;  3BI0 A;  4B13 A;  4P10 A;  2WYR A;  1B6B A;  3KZW A;  4C2Y A;  5K8O A;  1IOI A;  2F5I A;  4R8F A;  2Q51 A;  2JLM A;  4AXV A;  5JH9 A;  4OAE A;  4YFJ A;  5F47 A;  2RFH A;  2WSA A;  4C2X A;  2POK A;  3KQX A;  3DR8 A;  4UWJ A;  3D66 A;  3B3S A;  1HEE A;  4ZY0 A;  4YU9 A;  4Q38 A;  3QNV A;  2DPS A;  2BEI A;  3FEE A;  1LAP A;  2EVN A;  1JWQ A;  1VGY A;  2AFW A;  3KHX A;  2R1I A;  2F7V A;  1DTD A;  1YLE A;  3T8W A;  3KAS A;  4FD4 A;  5LYF A;  4UWI A;  1Z8W A;  5LRK A;  3BJ8 A;  5IB9 A;  4EVY A;  2VL1 A;  5D29 A;  3DDD A;  2Q4V A;  2C6P A;  3PB4 X;  4L89 A;  5AG6 A;  2BSW A;  3UY5 A;  5ISV A;  4MHZ A;  2R8V A;  3PB9 X;  2PIY A;  2ZEN A;  2AE6 A;  3JTK A;  4XPD B;  3VAR A;  4E0A A;  3CXS A;  2O53 A;  4UCM A;  1S3Z A;  2K5T A;  3V38 A;  2B5G B;  3NE8 A;  4AG9 A;  2ZW6 A;  2PRQ A;  4F0X A;  5EBV A;  1M4G A;  8CPA A;  3FVL A;  4OC4 A;  4A2Z A;  1TKF A;  4NGM A;  2FIW A;  4PXD A;  2YNE A;  1TF8 A;  2VQY A;  4KLW A;  4IUS A;  1CPS A;  4UA3 A;  1YW4 A;  3KQZ A;  4MCP A;  3RBU A;  3FRM A;  2GIV A;  4NEX A;  4X2T A;  5HXD A;  4A30 A;  4FBE A;  4K30 A;  1YVK A;  4UFX A;  2V8H A;  4MBU A;  3N7Z A;  3TFY A;  1TIQ A;  4R3K A;  1ZLI A;  3NA6 A;  2IL4 A;  1UWY A;  2OU2 A;  4CS0 B;  1XRY A;  3KL9 A;  2YGW A;  2Z3O A;  4CYP A;  1ELM P;  1B87 A;  4FD5 A;  2Q0Y A;  4P44 A;  3CPX A;  3D3S A;  5EMI A;  3B7I A;  1UFH A;  4B5P A;  1Z9U A;  2PJ6 A;  3H4Q A;  4TWE A;  1P0H A;  1MK4 A;  4E2A A;  2PSW A;  1AYE A;  5C88 A;  5IB0 A;  1I1D A;  4FD6 A;  4Z65 A;  2Z3N A;  3R9G A;  1YGH A;  3D7H A;  1TKH A;  1IU8 A;  2PJ5 A;  3B2Y A;  3S9M A;  3NFZ A;  3CPA A;  3BI1 A;  4NXY A;  4MCR A;  1YVO A;  1Z4R A;  3DNS A;  3JVN A;  1NSL A;  4PXE A;  2VZY A;  2AFO A;  2YNC C;  4R87 A;  1QSR A;  3TX8 A;  4CAE A;  3KI9 A;  2XEI A;  4UF4 A;  5F49 A;  4JJX A;  3FYN A;  2QYV A;  4XPK A;  1MJA A;  3SJG A;  4CYN A;  5AG4 A;  4ZGY B;  1K4J A;  4JXR A;  2GE3 A;  1YLO A;  4NGS A;  2Q43 A;  1AUG A;  1TF9 A;  2YND A;  3B3T A;  2ODF A;  4XPL A;  1YK3 A;  4CYO A;  1Z2L A;  4B5O A;  4XNH B;  2FXF A;  1FT7 A;  1BLL E;  4A32 A;  2G3T A;  2FVG A;  1KUX A;  2I3C A;  1Z8X A;  2XEF A;  4H6U A;  2B3U A;  1OZP A;  4YWY A;  1YX0 A;  2PJ1 A;  2C27 A;  3CT9 A;  4Q7A A;  5EC4 A;  4KSF A;  4HPS A;  2CXA A;  5LRJ A;  5BWA B;  3D4U A;  3R9E A;  4BD9 A;  2J9A A;  4H2K A;  3SI2 A;  3LAC A;  1VKC A;  3IU2 A;  4G1P A;  2R98 A;  4JWP A;  4MY3 A;  4F8Z A;  4KSI A;  3D68 A;  1CPX A;  4OC0 A;  2EBJ A;  4U5Y A;  4OC5 A;  1PU9 A;  4HNX B;  1R3N A;  4UEZ A;  2PJ4 A;  3TTH A;  4AVC A;  4ZX9 A;  2CTC A;  2ZOF A;  5LYI A;  3H5Z A;  4MFP A;  5I4M A;  2NMT A;  3G3S A;  1FY7 A;  4KOW A;  4CGO A;  2RC4 A;  3GYA A;  3SI1 A;  4DNC A;  1L0C A;  1DE4 C;  1I12 A;  1Z8T A;  3SJE A;  4W9Y A;  5LYL A;  2Z3K A;  1IY7 A;  2AJ6 A;  4PSW A;  3QAY A;  3QAH A;  1Y7E A;  3IWE A;  4NCZ A;  3EO4 A;  2PJC A;  5CPA A;  4P4F A;  4MCQ A;  3RZA A;  5DS0 A;  4UEE A;  4KOX A;  3KKW A;  4II9 A;  2VEZ A;  4UFW A;  3B3W A;  3JUW A;  5DWN A;  1S7F A;  2P6F A;  2REF A;  1KWM A;  2ZW7 A;  4UCN A;  5K8M A;  4WWV A;  3FH4 A;  4MJ8 A;  4M3S A;  3PFE A;  4ZX8 A;  5F09 A;  1Q2D A;  3PBB A;  2GAN A;  3VWD A;  4OP4 A;  3ZJ0 A;  4IHM A;  3S9N A;  2J8N A;  5HH1 A;  4BIN A;  1NSA A;  4LUA A;  3VAT A;  3WAB A;  5J1Q A;  4R9M A;  3EY5 A;  4MFZ A;  1RO5 A;  2ZEL A;  3B35 A;  3CXQ A;  3I3G A;  1WK4 A;  2VI7 A;  4HNY B;  3LD2 A;  3GLJ A;  2C6C A;  1IB1 E;  2AFU A;  2ZW4 A;  2ZEH A;  1PUA A;  3H8G A;  4EWT A;  4B14 A;  2PQ8 A;  2OOT A;  4KUA A;  3S6G A;  4BMH A;  1S60 A;  5IV0 A;  3IWW A;  1XMB A;  1IGB A;  4B5P B;  2XEJ A;  1A2Z A;  2C1C A;  1KZF A;  2BUE A;  2QJ8 A;  2Y0M A;  3LWU A;  2VXK A;  3P2H A;  2OZU A;  1BPN A;  1YRE A;  4QC6 A;  4CAW A;  2P6G A;  3PB8 X;  4H89 A;  5KTD A;  2B3V A;  3FBU A;  4P6Y A;  4X8I A;  1YR0 A;  1R43 A;  4XPD C;  1XOV A;  3PB7 X;  1XIX A;  4YGO A;  4B11 A;  4C2Z A;  1R57 A;  1Y0Y A;  2NSM A;  3B3C A;  2KCW A;  2EUI A;  2O4H A;  1EE3 P;  4NSQ A;  3IJ3 A;  1OBR A;  3NH5 A;  2HUZ A;  2IMO A;  4KOR A;  4RI1 A;  4KOU A;  1M4I A;  2PJ9 A;  2V8V A;  1BAV A;  3CZX A;  3PGP A;  4AG7 A;  4GXH A;  2HB6 A;  3DGV A;  4MHD A;  4QB9 A;  4U9Z A;  2EWB A;  5LRG A;  1F57 A;  1QQ9 A;  4KVO E;  2OB0 A;  5E96 A;  2B4D A;  2FSR A;  4IF5 A;  4F9U A;  1ZG9 A;  3I1U A;  3FB3 A;  4F6A A;  3TO7 A;  3KR5 A;  4ZY1 A;  2XEG A;  1CM0 A;  2PJ7 A;  2PJ0 A;  4NJR A;  2ANP A;  3V8I A;  2WUU A;  4P4D A;  3IFE A;  1NMT A;  1CP7 A;  3IC1 A;  1XBU A;  3VWE A;  4MCS A;  4MFJ A;  2Q7S A;  5F48 A;  3FED A;  1QSM A;  2PVW A;  2Q4Z A;  1M1D A;  2VZZ A;  4OC2 A;  4OIW A;  4C7H A;  4AVB A;  4BBH A;  3FF3 A;  4OC3 A;  5DWM A;  2FL4 A;  4E8O A;  2Z10 A;  1ZLH A;  1Y9K A;  2OZG A;  2V77 A;  4ZY2 A;  2D4O A;  4MHP A;  5H84 A;  1QSN A;  3WC6 A;  1ARL A;  3NE7 A;  3DR6 A;  2ZEP A;  3T9Y A;  3BXM A;  2EK8 A;  2BO9 A;  2J8M A;  4NGN A;  4A37 A;  3SXN A;  2G3A A;  5LYD A;  4LQ6 A;  3TOA A;  4PV6 A;  3D7D A;  2QML A;  5HMN A;  1RTQ A;  4KUB A;  4R6T A;  1LFW A;  1MJB A;  2R7H A;  1RXT A;  4A94 A;  3T90 A;  3P2F A;  5G21 A;  5J8F A;  4JD6 A;  2GLF A;  4CPA A;  4MXU A;  4MHY A;  4X3R A;  4XNH C;  4ZBG A;  4NJQ A;  3FMC A;  5A27 A;  4MRI A;  2JEV A;  4B10 A;  2V8D A;  4HKF A;  3C26 A;  2VBQ A;  4P4I A;  1S7L A;  2DPT A;  2IQ6 A;  3KR4 A;  1PYT B;  2P0W A;  2GU2 A;  3HLP A;  4MFK A;  3A9L A;  2PVV A;  4P4E A;  4P45 A;  3RO0 A;  1MJ9 A;  3IIB A;  4MY0 A;  7CPA A;  2Q7B A;  4FUU A;  1XE4 A;  4UIA A;  3TO6 A;  4LQG A;  2B4B A;  4NF1 A;  3PFO A;  2OZH A;  3K9U A;  3NH4 A;  1LOK A;  4OME A;  4UBR A;  2ZED A;  1XJO A;  4J3G A;  4OC1 A;  3SHP A;  1Z4E A;  1LCP A;  4P4B A;  4KS9 A;  2ABZ A;  5KTC A;  2I00 A;  1LRZ A;  1Q2C A;  3D2P A;  3R95 A;  3ZZI A;  3CXP A;  1YQE A;  2QVP A;  3K9T A;  1F2O A;  5G1Z A;  4F0Y A;  1Y0R A;  2I79 A;  3L2N A;  4KOY A;  4RS2 A;  5AG7 A;  5I0C A;  3LMS A;  2ZEO A;  2REE A;  4H6Z A;  5JPH A;  4A33 A;  4Y49 B;  2ZEM A;  4A38 A;  2ATR A;  2Z3L A;  2PRB A;  4YRH A;  2EO8 A;  2H5M A;  2DF5 A;  1F2P A;  3S6K A;  1VIX A;  5AG5 A;  2PR1 A;  4TNU A;  1QST A;  4PXB A;  2PJ8 A;  6CPA A;  4PK2 A;  1HDU A;  5G22 A;  5JM6 A;  2GRE A;  1Q2Y A;  2WPW A;  1M4L A;  4PXC A;  4CAF A;  3BLN A;  3DSB A;  5A28 A;  2DEA A;  2FCK A;  1GHE A;  4AB7 A;  1KUY A;  2FT0 A;  1SQH A;  2AFM A;  3WC5 A;  4FAI A;  5AGE A;  4A95 A;  2YNC A;  3SJX A;  3GIU A;  3PP9 A;  4DJL A;  2PR8 A;  3H8F A;  3G8W A;  2AFZ A;  4NFR A;  4M6H A;  2FIA A;  3MN8 A;  2DXQ A;  3IWG A;  1CG2 A;  1FNO A;  4MHN A;  2PJA A;  4ZI6 A;  1XMT A;  2P6E A;  1IIC A;  3BHX A;  4PQA A;  3FJU A;  2QEC A;  1H8L A;  2PJ2 A;  4KOV A;  3GB0 A;  2CIJ A;  4CGL A;  4CAV A;  2CNT A;  4WJB A;  1ARM A;  1CP6 A;  4CGN A;  3BJ7 A;  3IO1 A;  4QBJ A;  3EFA A;  3GUX A;  3F0A A;  1VHO A;  2WPX A;  3PRT A;  4RN7 A;  1BPM A;  1M4D A;  1X10 A;  3FIX A;  3F8K A;  5K8P A;  1V0C A;  1Q7L A;  1IID A;  2QIR A;  2BCO A;  4M85 A;  4GM5 A;  5H86 A;  3H8E A;  3S6H A;  2ZEF A;  2OR4 A;  2RB7 A;  1LAN A;  3W6X A;  2Q04 A;  2PJ3 A;  4KOT A;  3B8G A;  4EFD A;  4F9V A;  1QSO A;  3TCV A;  3KGQ A;  4U9Y A;  4I49 A;  4CAX A;  4PSX A;  4L8A A;  2NYQ A;  1S5K A;  3D2M A;  2AFS A;  3B3V A;  2B58 A;  1ZG7 A;  4M6I A;  3RNZ A;  3WR7 A;  3F5B A;  2CF4 A;  3VH9 A;  4CRZ B;  3R1K A;  4KSA A;  4UEF A;  2HC9 A;  4KZT A;  2JBJ A;  3ISX A;  5ELY A;  4PK3 A;  3D7G A;  3I9S A;  3RAM A;  1KUV A;  2JBK A; 
#chains in the Genus database with same CATH homology
 2FS5 A;  1ZO0 A;  4ONU A;  4X5K A;  5FVJ A;  2HV2 A;  2Z11 A;  1Y7R A;  5J8C A;  2CNS A;  5KTA A;  4QVT A;  3R9F A;  5CNP A;  3TE4 A;  4B12 A;  5F46 A;  4MFQ A;  1S7K A;  2X7B A;  2FE7 A;  2A4N A;  1BOB A;  3E0K A;  2Q4Y A;  3R96 A;  3FXT A;  4CGP A;  4C68 A;  2OH1 A;  2PDO A;  3MGD A;  4JLY A;  1Y9W A;  3GKR A;  1NE9 A;  2HQY A;  4LX9 A;  4CYQ A;  1N71 A;  4Q36 A;  3W91 A;  5JQ4 A;  3IU1 A;  2B5G A;  2Z3M A;  1ON0 A;  1J4J A;  4UCP A;  1VHS A;  5IX3 A;  4OAD A;  2D4P A;  3OWC A;  1M44 A;  1IYK A;  4KOS A;  3TO9 A;  4ORF A;  3SXO A;  3EXN A;  3TT2 A;  3W6S A;  1BO4 A;  5C82 A;  3D8P A;  1S7N A;  2Z3P A;  1XEB A;  4OLL A;  5G20 A;  4KVM E;  1WWZ A;  2ZXV A;  4Y49 C;  3RYO A;  4KLV A;  1IYL A;  1I21 A;  4MI4 A;  2CY2 A;  1CJW A;  2ARH A;  4QUS A;  4UFV A;  2O28 A;  3S6F A;  2Q44 A;  1P4N A;  4R3L A;  3IGR A;  4HNW B;  3PZJ A;  4C7I A;  3GY9 A;  3EC4 A;  4R57 A;  2B4D B;  3TOB A;  2J8R A;  4GS4 A;  4FD7 A;  4KVX A;  2JDD A;  3FNC A;  4A31 A;  4CRY B;  1XF8 A;  3LOD A;  2BL1 A;  2ZW5 A;  2G0B A;  2PC1 A;  2ZPA A;  4AVA A;  4MFL A;  3QB8 A;  2CNM A;  2JDC A;  1U6M A;  4JXQ A;  5GCN A;  4CGM A;  2Z0Z A;  4B13 A;  4C2Y A;  1B6B A;  2F5I A;  2JLM A;  4OAE A;  4YFJ A;  5F47 A;  2WSA A;  4C2X A;  4UWJ A;  3DR8 A;  4Q38 A;  2DPS A;  2BEI A;  2EVN A;  2R1I A;  1YLE A;  4FD4 A;  4UWI A;  3BJ8 A;  4EVY A;  3DDD A;  2Q4V A;  5ISV A;  4L89 A;  5AG6 A;  2BSW A;  3UY5 A;  2R8V A;  2AE6 A;  3JTK A;  4XPD B;  4E0A A;  3CXS A;  4UCM A;  1S3Z A;  2K5T A;  4F0X A;  2B5G B;  4AG9 A;  2ZW6 A;  5EBV A;  1M4G A;  4A2Z A;  2FIW A;  2YNE A;  2VQY A;  4KLW A;  4IUS A;  4UA3 A;  3FRM A;  2GIV A;  4NEX A;  4A30 A;  4K30 A;  1YVK A;  4UFX A;  4MBU A;  3N7Z A;  3TFY A;  1TIQ A;  4R3K A;  2IL4 A;  2OU2 A;  4CS0 B;  2YGW A;  2Z3O A;  4CYP A;  1B87 A;  4FD5 A;  2Q0Y A;  3D3S A;  1UFH A;  4B5P A;  1Z9U A;  3H4Q A;  1P0H A;  1MK4 A;  5C88 A;  2PSW A;  5IB0 A;  1I1D A;  4FD6 A;  2Z3N A;  3R9G A;  1YGH A;  4NXY A;  1YVO A;  1Z4R A;  3DNS A;  3JVN A;  1NSL A;  2VZY A;  2YNC C;  4R87 A;  4CAE A;  1QSR A;  5F49 A;  4JJX A;  3FYN A;  4XPK A;  1MJA A;  4CYN A;  5AG4 A;  4ZGY B;  1K4J A;  4JXR A;  2GE3 A;  2YND A;  4XPL A;  1YK3 A;  4CYO A;  4B5O A;  4XNH B;  2FXF A;  4A32 A;  2G3T A;  1KUX A;  4H6U A;  2B3U A;  1OZP A;  1YX0 A;  5EC4 A;  2C27 A;  4KSF A;  2CXA A;  5BWA B;  3R9E A;  4MY3 A;  1VKC A;  3IU2 A;  4JWP A;  2R98 A;  4U5Y A;  1PU9 A;  4HNX B;  3TTH A;  4AVC A;  3H5Z A;  4MFP A;  2NMT A;  3G3S A;  1FY7 A;  4KOW A;  4CGO A;  2RC4 A;  3GYA A;  4DNC A;  1L0C A;  1I12 A;  2Z3K A;  2AJ6 A;  4PSW A;  3QAH A;  3IWE A;  4NCZ A;  3EO4 A;  4KOX A;  3KKW A;  4II9 A;  2VEZ A;  4UFW A;  3JUW A;  5DWN A;  1S7F A;  2P6F A;  2REF A;  2ZW7 A;  4UCN A;  4MJ8 A;  4M3S A;  1Q2D A;  3VWD A;  2GAN A;  3ZJ0 A;  2J8N A;  5HH1 A;  4LUA A;  4R9M A;  3EY5 A;  4MFZ A;  1RO5 A;  3CXQ A;  3I3G A;  4HNY B;  1WK4 A;  2VI7 A;  4CAX A;  3LD2 A;  4E2A A;  1IB1 E;  2ZW4 A;  1PUA A;  4B14 A;  2PQ8 A;  4KUA A;  3S6G A;  4BMH A;  1S60 A;  5IV0 A;  4B5P B;  1KZF A;  2BUE A;  2Y0M A;  2VXK A;  3P2H A;  2OZU A;  1YRE A;  4QC6 A;  4CAW A;  2P6G A;  4H89 A;  5KTD A;  2B3V A;  3FBU A;  1YR0 A;  4XPD C;  1XIX A;  4YGO A;  4B11 A;  4C2Z A;  1R57 A;  2KCW A;  2EUI A;  4NSQ A;  2HUZ A;  4KOR A;  4RI1 A;  4KOU A;  1M4I A;  3PGP A;  4AG7 A;  4MHD A;  4QB9 A;  4U9Z A;  4KVO E;  2OB0 A;  5E96 A;  2B4D A;  2FSR A;  4IF5 A;  3FB3 A;  4F6A A;  3TO7 A;  1CM0 A;  3V8I A;  2WUU A;  1NMT A;  3VWE A;  4MFJ A;  5F48 A;  1QSM A;  1M1D A;  2VZZ A;  4C7H A;  4AVB A;  4BBH A;  5DWM A;  2FL4 A;  4E8O A;  2Z10 A;  1Y9K A;  2OZG A;  2D4O A;  5H84 A;  1QSN A;  3NE7 A;  3DR6 A;  3T9Y A;  2J8M A;  3SXN A;  2G3A A;  3TOA A;  4PV6 A;  5HMN A;  2QML A;  4KUB A;  2R7H A;  1MJB A;  1RXT A;  3T90 A;  3P2F A;  5G21 A;  5J8F A;  4JD6 A;  4XNH C;  4ZBG A;  5A27 A;  2JEV A;  4B10 A;  4HKF A;  3C26 A;  2VBQ A;  1S7L A;  2DPT A;  2P0W A;  4MFK A;  3A9L A;  1MJ9 A;  4MY0 A;  2Q7B A;  1XE4 A;  3TO6 A;  2B4B A;  4NF1 A;  2OZH A;  3K9U A;  4UBR A;  4J3G A;  3SHP A;  1Z4E A;  4KS9 A;  5KTC A;  2I00 A;  1LRZ A;  1Q2C A;  3D2P A;  3R95 A;  3ZZI A;  3CXP A;  4F0Y A;  5G1Z A;  2I79 A;  4RS2 A;  5AG7 A;  4KOY A;  5I0C A;  5JPH A;  2REE A;  4H6Z A;  4A33 A;  4Y49 B;  2ATR A;  2Z3L A;  2PRB A;  4YRH A;  2H5M A;  3S6K A;  5AG5 A;  2PR1 A;  1QST A;  4PK2 A;  5G22 A;  1Q2Y A;  2WPW A;  4CAF A;  3BLN A;  3DSB A;  5A28 A;  2FCK A;  1GHE A;  4AB7 A;  1KUY A;  2FT0 A;  1SQH A;  5AGE A;  4A95 A;  2YNC A;  3PP9 A;  2PR8 A;  3G8W A;  2FIA A;  2DXQ A;  3IWG A;  1XMT A;  2P6E A;  1IIC A;  2QEC A;  4KOV A;  4CGL A;  4CAV A;  2CNT A;  4CGN A;  3BJ7 A;  4QBJ A;  3EFA A;  3F0A A;  2WPX A;  1M4D A;  3FIX A;  3F8K A;  1V0C A;  1IID A;  2QIR A;  4M85 A;  5H86 A;  3S6H A;  3W6X A;  2Q04 A;  4KOT A;  3B8G A;  1QSO A;  3TCV A;  4U9Y A;  4I49 A;  4PSX A;  4L8A A;  1S5K A;  3D2M A;  2B58 A;  3WR7 A;  3F5B A;  4CRZ B;  3R1K A;  4KSA A;  4KZT A;  4PK3 A;  3I9S A;  1KUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...