4FD6A

Crystal structure of native arylalkylamine n-acetyltransferase 2 from the yellow fever mosquito, aedes aegypti
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
218
structure length
218
Chain Sequence
KLNNIRFETISSKYYDDVIEHLRQTFFADEPLNKAVNLTRPGQGHPLLEQHSLSTLKDNVSIMAISNDGDIAGVALNGILYGNTDIEKSREKLNEIQDESFKKIFKLLYEQNLKINLFKQFDVDKIFEIRILSVDSRFRGKGLAKKLIEKSEELALDRGFQVMKTDATGAFSQRVVSSLGFITKCEINYTDYLDENGEQIFVVDPPHEKLKIMCKVIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of insect arylalkylamine N-acetyltransferases: structural evidence from the yellow fever mosquito, Aedes aegypti.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Transferase
molecule keywords arylalkylamine N-Acetyltransferase 2
total genus 73
structure length 218
sequence length 218
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4fd6A00
3MGDA 2ZXVA 2BEIA 2REFA 2FXFA 2QIRA 1IB1E 3DNSA 3R9GA 5ISVA 2D4PA 4J3GA 3UY5A 2X7BA 3LODA 2K5TA 2G3TA 5IV0A 4KVOE 2WPWA 5KTCA 2PR8A 3SXOA 3D2PA 2B4DA 3E0KA 4IF5A 1XE4A 1QSRA 4PSWA 1RXTA 2OZUA 1YLEA 4NXYA 4GS4A 4R57A 5GCNA 3N7ZA 4KLWA 4B5PA 2BL1A 4YRHA 2I00A 4IUSA 3BJ7A 4NF1A 4KORA 1S60A 3FB3A 3T9YA 5HMNA 2FS5A 2JDCA 2HUZA 4FD4A 4MI4A 4LUAA 1Z4EA 1KUYA 2NMTA 2Q4VA 1GHEA 2OH1A 2Z0ZA 5KTDA 5F48A 1VKCA 4KLVA 3ZJ0A 5JQ4A 2EUIA 3FXTA 1NE9A 1I12A 4XPDB 4HKFA 4K30A 4E0AA 2REEA 4QB9A 4QC6A 2Q7BA 1QSTA 1MJBA 1YGHA 4UWIA 2DXQA 3EXNA 2CNTA 4QVTA 3TO7A 2C27A 3P2FA 1QSNA 3TTHA 4KOWA 2Q4YA 5EC4A 1KZFA 4AVCA 1Z4RA 1PUAA 4HNXB 3D8PA 1Y7RA 3W91A 2PC1A 5H86A 3IGRA 1QSMA 5JPHA 2CY2A 3S6FA 3VWDA 4RS2A 3TO6A 2RC4A 2PDOA 4F0YA 3DSBA 1S7LA 3PGPA 2VZZA 4MBUA 5FVJA 4UBRA 1R57A 4B5OA 4PK2A 3H4QA 4H89A 1LRZA 1L0CA 2BUEA 4Y49C 4E2AA 1P0HA 5C82A 1Q2DA 3F0AA 4LX9A 2B58A 3F5BA 4AB7A 3G3SA 4X5KA 2EVNA 2ATRA 3CXSA 1XMTA 2FSRA 4KOYA 3D3SA 2Z10A 3TT2A 2G3AA 4CAVA 2Z11A 3FYNA 4ZBGA 3T90A 2FCKA 2J8NA 1IIDA 2ZW5A 3TE4A 4JJXA 2ZW6A 3CXQA 2B3VA 4JLYA 4M85A 5I0CA 4BMHA 4NEXA 2ZW7A 2VEZA 1P4NA 4R87A 4AVAA 3GKRA 4KOTA 1M44A 4R9MA 2Y0MA 2OB0A 2GIVA 4L8AA 4ORFA 4CRYB 4HNYB 2R8VA 2P6EA 3PZJA 2ZW4A 2VZYA 4JXRA 4CAXA 2HQYA 1WK4A 3DDDA 3C26A 1Q2CA 5EBVA 3S6KA 2QMLA 2B4DB 1I1DA 4AVBA 3P2HA 1CJWA 4L89A 3CXPA 3KKWA 4MHDA 3S6GA 4KZTA 2FIAA 4CRZB 3RYOA 2R1IA 4KOUA 3TFYA 2ZPAA 2FIWA 1KUVA 4OADA 1Y9KA 4PSXA 5H84A 1YR0A 1K4JA 3F8KA 1WWZA 1Z9UA 2QECA 4H6UA 3TOAA 2WPXA 4NCZA 3FIXA 4PK3A 2JDDA 4CAWA 1M4DA 4AG9A 3R95A 3I3GA 5F49A 4MJ8A 4H6ZA 3S6HA 5F46A 1IICA 4XPKA 1N71A 2P6FA 1MJAA 1XF8A 3W6SA 1SQHA 3QB8A 4R3KA 4XNHC 1NSLA 4FD7A 4JXQA 5J8CA 3SXNA 3LD2A 3D2MA 3K9UA 4XPDC 3GY9A 3FRMA 4EVYA 2JLMA 1QSOA 4PV6A 4KUAA 1UFHA 3R9EA 3R1KA 2ARHA 4JD6A 4QUSA 4U5YA 3SHPA 1BO4A 2AJ6A 5HH1A 3V8IA 1U6MA 1ON0A 2J8MA 3WR7A 4ONUA 5IX3A 1IYKA 3NE7A 4OAEA 4M3SA 3JUWA 1B6BA 3BLNA 3DR8A 4FD6A 1S3ZA 4E8OA 4AG7A 4OLLA 2R98A 1PU9A 2O28A 2Q44A 3PP9A 2JEVA 3ZZIA 3VWEA 2AE6A 1M4IA 4KVXA 1XEBA 1YVOA 2J8RA 4II9A 1OZPA 3EO4A 4B5PB 1S7KA 5IB0A 2PRBA 4QBJA 2PR1A 3TCVA 5DWMA 4HNWB 4FD5A 2Q0YA 2OZHA 4DNCA 2B5GA 4R3LA 3QAHA 3G8WA 2CNMA 4KUBA 1YREA 2HV2A 2R7HA 2P6GA 3B8GA 4YGOA 2VI7A 2GE3A 2VQYA 1YX0A 2G0BA 4KOSA 1YK3A 1I21A 2KCWA 2FE7A 1FY7A 1XIXA 4XPLA 1S7NA 4RI1A 2VBQA 2D4OA 4JWPA 2BSWA 1KUXA 2PSWA 3EC4A 5F47A 3TOBA 3R96A 1M1DA 5C88A 2B4BA 4KOVA 5E96A 1TIQA 3W6XA 4CS0B 1IYLA 4NSQA 1MJ9A 1VHSA 3I9SA 5DWNA 2OZGA 3GYAA 2Q04A 5KTAA 2B3UA 3EFAA 3R9FA 4Y49B 1Q2YA 1NMTA 4U9ZA 2A4NA 2F5IA 1Y9WA 4UWJA 1YVKA 2OU2A 5J8FA 2PQ8A 4UA3A 4U9YA 3JVNA 1J4JA 2P0WA 3FNCA 4XNHB 3FBUA 2FL4A 2VXKA 2GANA 3DR6A 4MY0A 2H5MA 3OWCA 1S5KA 1RO5A 2B5GB 2I79A 1S7FA 4YFJA 4KOXA 2CNSA 4I49A 1BOBA 4MY3A 4F6AA 4KVME 1CM0A 1V0CA 1B87A 3IWGA 1MK4A 2FT0A 1M4GA 5CNPA 3TO9A 3EY5A 3BJ8A 2IL4A
chains in the Genus database with same CATH superfamily
4MHPA 3MGDA 4OC4A 4OKOA 2ZXVA 2BEIA 2REFA 2FXFA 2QIRA 1IB1E 3DNSA 3R9GA 2EBJA 5ISVA 2RFHA 2D4PA 2AFOA 1IY7A 4J3GA 4NJQA 4C2YA 3UY5A 4O23A 3TX8A 4Q36A 1PYTB 2X7BA 3LODA 4LQGA 4X2TA 4MMOA 1LOKA 2K5TA 5G20A 2G3TA 4A31A 2WYRA 5IV0A 4OP4A 4KVOE 2WPWA 1LAMA 5KTCA 2PR8A 3SXOA 4CGOA 3BI1A 1CP7A 4B6ZA 3D2PA 2B4DA 1CBXA 3E0KA 3JTKA 4IF5A 1YSJA 5D8NA 1XE4A 1QSRA 4PSWA 3KGQA 4BD9A 1RXTA 1JWQA 2OZUA 3V38A 1YLEA 2VL1A 5LYLA 4NXYA 4GS4A 3CDXA 4R57A 3SJEA 1YW4A 3K2KA 3N7ZA 4HPSA 5GCNA 3NFZA 4KLWA 3PFOA 2ZEFA 4B5PA 1X10A 2BL1A 4YRHA 2ZEEA 2G9DA 2I00A 4IUSA 3BJ7A 4NF1A 4ZY1A 2O4HA 4ZYQA 4KORA 4ZGYB 1S60A 2CTCA 3FB3A 3GLJA 3T9YA 2JBJA 5THWA 1IGBA 2ZEPA 3FEEA 1ZLIA 2PE3A 2YGWA 3FVLA 5AG6A 2ZEGA 3CZXA 4M6HA 2PJ0A 5HMNA 2EWBA 2FS5A 2JDCA 1UWYA 2HUZA 3KQXA 4FD4A 3H8FA 4MI4A 4UEZA 4LUAA 1Z4EA 1CX8A 4B10A 1YMEA 5K8PA 1KUYA 2IJZA 2Z3LA 2PRQA 2NMTA 1XOVA 5DS0A 2Q4VA 1GHEA 4NJRA 2OH1A 2Z0ZA 5KTDA 5F48A 5K8OA 1VKCA 4KLVA 3ZJ0A 5JQ4A 2EUIA 3FXTA 1NE9A 4UIAA 1I12A 3JRUA 4XPDB 2ZOFA 4HKFA 1NSAA 4FUUA 4K30A 4E0AA 5AGEA 3B3SA 2AFWA 5D29A 3IO1A 4B12A 2REEA 3RNZA 4BINA 1ELLP 3IFEA 4QB9A 1XJOA 4QC6A 2Q7BA 2C6PA 1QSTA 1X12A 4A33A 1IOFA 1MJBA 5K8NA 1JQGA 2Q4ZA 2IMOA 2WZNA 4MFKA 4CGPA 1TKJA 4OC0A 1YGHA 4UWIA 2DXQA 3EXNA 2CNTA 2Z3NA 4QVTA 1Y7EA 3TO7A 1TF8A 3SJGA 5HVGA 4F8ZA 2C27A 2PJ2A 3LACA 3P2FA 1QSNA 3TTHA 3BHXA 3IJ3A 2V77A 4KOWA 3H8EA 2Q4YA 3HLPA 5LYIA 2GREA 2JBKA 4EFDA 5EC4A 2YNCC 4FWUA 1KZFA 4AVCA 4DUKA 1Z4RA 2GLJA 3RO0A 4CGNA 1PUAA 4HNXB 5I0CA 1BPNA 3D8PA 1Y7RA 3W91A 5LRJA 2PVVA 1XFOA 2AFXA 2PC1A 3MRUA 4IHMA 1YLOA 4B11A 5H86A 3IGRA 1QSMA 4R6TA 2GFQA 3CPAA 3D66A 4KSFA 3B3CA 3VARA 5JPHA 2CY2A 2ZEDA 4YU9A 3S6FA 3VWDA 5LYFA 2PJBA 4RS2A 4MRIA 4FAIA 3TO6A 2RC4A 2PDOA 4F0YA 2EO8A 3DSBA 3VH9A 4C7HA 3K9TA 1S7LA 2PCUA 3PGPA 2VZZA 3BI0A 2JEWA 4MBUA 4JYWA 3D68A 1XMBA 1HDQA 5FVJA 4UBRA 1R57A 2XEGA 4MCSA 4B5OA 4PK2A 5ELYA 3A9LA 3H4QA 4H89A 1CP6A 2PJ4A 1LRZA 1L0CA 2BUEA 2HB6A 4Y49C 4H2KA 4UEEA 3IC1A 1P0HA 4GXHA 5C82A 5G22A 1Q2DA 2PJ9A 3F0AA 1BAVA 3FX6A 3KZWA 3KHXA 4LX9A 2B58A 3F5BA 4AB7A 3G3SA 2V8HA 1ZG8A 4X5KA 3NH4A 4FBEA 3PB7X 1Z8XA 2EVNA 4TWEA 5LRGA 2ATRA 4TNUA 3CXSA 4MHYA 1XMTA 2FSRA 4G1PA 2BO9A 4DYOA 4K3NA 4IK2A 1RTQA 3D3SA 4KOYA 1BPMA 2Z10A 3TT2A 5HXDA 5AG4A 3WC7A 2PIYA 4MCQA 1CPSA 2G3AA 1Z8TA 4CAVA 4A94A 3IEHA 2Q43A 4WWVA 2Z11A 3FYNA 4ZBGA 3T90A 4NGSA 2CF4A 2Z3KA 4R8FA 2POKA 2FCKA 3CT9A 4Q7AA 3FH4A 2J8NA 2XEFA 2YNDA 1IIDA 3FJUA 2ZW5A 3I1UA 3KQZA 1VHOA 4W9YA 3TE4A 4JJXA 2ZW6A 3CXQA 4MHNA 2B3VA 4UF4A 1DE4C 4JLYA 4UCNA 4F9VA 4M85A 2F8HA 2Z3MA 1VHEA 2XEJA 3IU2A 3IWEA 4P4IA 4BMHA 4C2XA 4NEXA 4Z65A 2ZW7A 2VEZA 1P4NA 4P45A 4R87A 4KS9A 4AVAA 3GKRA 4KOTA 4UFVA 1M44A 4R9MA 2Y0MA 2FVGA 4MXUA 4CYOA 4BBHA 1YQEA 2OB0A 2GIVA 3MN8A 1Y0YA 4L8AA 4MCPA 4ORFA 4CRYB 4PPZA 4ZI6A 4HNYB 2R8VA 2P6EA 3PZJA 5A27A 4C7IA 2ZW4A 4C68A 4CGLA 3SJXA 2VZYA 4JXRA 4OIWA 3SJFA 4F0XA 3SI2A 2V8GA 4MFLA 4CAXA 2HQYA 1WK4A 3DDDA 4OMEA 3B3VA 4P4DA 5G1ZA 3C26A 1Q2CA 5EBVA 3S6KA 3H5ZA 4MCRA 1PCAA 2QMLA 5JGFA 3CPXA 1AMPA 2B4DB 3RZAA 1I1DA 2DF5A 3VATA 3BXMA 2CIJA 4UFWA 4KSAA 2V8VA 1ELMP 4YWYA 4AVBA 3P2HA 1CJWA 4L89A 3CXPA 3NA6A 4EMEA 5J8FA 3KKWA 4MHDA 3S6GA 3NH8A 4KZTA 2FIAA 1OBRA 3D4UA 4CRZB 3RYOA 2R1IA 4X8IA 4A2ZA 4E2AA 4KOUA 3TFYA 4PXEA 2ZPAA 4RN7A 2FIWA 3D67A 3IWWA 1LAPA 1KUVA 3KI9A 4OADA 3RAMA 1Y9KA 1F2OA 4R7MA 1KWMA 1QQ9A 4PSXA 5H84A 3H8GA 4OC2A 1TXRA 1YR0A 3D7DA 1K4JA 2WSAA 3DGVA 3SI0A 2YNEA 3PFEA 3F8KA 2OR4A 1F2PA 5AG7A 1WWZA 2Z3PA 1Z9UA 2QECA 3PB8X 4H6UA 2EK8A 3TOAA 1ARLA 2WPXA 4UIBA 5A28A 4PXDA 5LRKA 4NCZA 3FIXA 2OOTA 1BLLE 3IIBA 3TC8A 4PK3A 3S9NA 2GU2A 2JDDA 4CAWA 1M4DA 2Q7SA 4AG9A 4A37A 1FNOA 3D7FA 3WC5A 2IQ6A 3R95A 3PRTA 1Z8LA 3I3GA 2ANPA 1Y0RA 5F49A 2ZENA 2AFMA 4MJ8A 4H6ZA 3S6HA 5F46A 1IICA 4XPKA 1N71A 5J1QA 2P6FA 1MJAA 2PJ8A 1QMUA 1XF8A 3PB4X 3W6SA 3PB9X 1SQHA 3QB8A 4R3KA 1R43A 4XNHC 1NSLA 2C6GA 4FD7A 4JXQA 5J8CA 3SXNA 3B3WA 3LD2A 3D2MA 3K9UA 4A30A 4XPDC 5I4MA 3GY9A 3V7ZA 5HVHA 3FRMA 2BOAA 4EVYA 1CG2A 3SI1A 1CPXA 2PJCA 2JLMA 1IU8A 1QSOA 2RB7A 4KUAA 1UFHA 4P10A 4PV6A 4NGTA 4P4EA 3R1KA 4R76A 3R9EA 1IOIA 2ARHA 4JD6A 2PVWA 4QUSA 4U5YA 1BO4A 3SHPA 2AJ6A 2WUUA 1YW6A 4PQAA 1Z2LA 2CXAA 1TKHA 5HH1A 4CAEA 4NFRA 4UEFA 4B14A 1VGYA 2F7VA 3V8IA 3IU1A 1U6MA 1ON0A 2J8MA 3WR7A 4ONUA 5IX3A 1EE3P 1FT7A 4F9UA 3B2YA 2NSMA 1IYKA 1LCPA 3NE7A 4OAEA 3LMSA 4IAVA 3PBEA 3HUVA 3ISZA 4M3SA 2C6CA 3JUWA 2AFSA 1B6BA 3BLNA 3DR8A 4FD6A 1S3ZA 4UFXA 2QVPA 3DLJA 4E8OA 5JH9A 4AG7A 4OLLA 2R98A 4C2ZA 1PU9A 2O28A 2Q44A 3PP9A 2JEVA 1XRYA 3T8WA 3ZZIA 2C1CA 3VWEA 2AE6A 1M4IA 4CAFA 4KVXA 1XEBA 1YVOA 2J8RA 4II9A 3KR4A 1OZPA 1AYEA 3EO4A 2V8DA 4MFJA 1S7KA 2ZEMA 1A2ZA 1F57A 4MHZA 4B5PB 5IB0A 2PRBA 4QBJA 3FECA 2DPTA 2ABZA 2PR1A 3TCVA 1HEEA 4CPAA 5DWMA 4HNWB 2GLFA 4FD5A 4NGQA 5AG5A 2Q0YA 5EMIA 2AFZA 2NYQA 2OZHA 4DNCA 2B5GA 2QJ8A 4R3LA 4A38A 2PJ1A 1H8LA 3QAHA 3G8WA 3B3TA 2CNMA 4KUBA 3S9LA 1YREA 3N5FA 2ZEOA 1LFWA 2HV2A 2PJ5A 1LANA 3L2NA 4NGNA 4ZY0A 3PEIA 2EK9A 2XEIA 2DPSA 2QYVA 2R7HA 4B13A 2P6GA 4CYPA 5JM6A 4LQ6A 4RUHA 5IB9A 4OIDA 3B8GA 4YGOA 3KHZA 4OC3A 4PXBA 2VI7A 4P6YA 2GE3A 2VQYA 1YX0A 2ODFA 2G0BA 3D7GA 3D7HA 4KOSA 3RBUA 1ARMA 4KSIA 1YK3A 1I21A 2PJ7A 2KCWA 1DTDA 2FE7A 4MFZA 3S9MA 5BWAB 1XBUA 2AFUA 1FY7A 4OC1A 1XIXA 4OC5A 3GB0A 4XPLA 4A95A 5K8MA 4NGRA 2ZEHA 1S7NA 4RI1A 2VBQA 5G21A 2D4OA 4JWPA 1Z5RA 2PJ3A 2BSWA 2ZELA 2DEAA 4UCPA 2PJ6A 3FEDA 1TF9A 1KUXA 2J9AA 2PSWA 3EC4A 5CPAA 1HDUA 3NE8A 5LYDA 4CGMA 5F47A 4UCMA 3TOBA 6CPAA 1ZLHA 3ISXA 2O53A 2ZOGA 1M1DA 3R96A 2B4BA 4KOVA 5E96A 4AXVA 5C88A 1TIQA 4X3RA 3W6XA 3WT4A 1Q7LA 4CS0B 1M4LA 4P4BA 4NGMA 3B7IA 2I3CA 3B35A 3LWUA 1IYLA 4NSQA 5CBMA 3GIUA 1MJ9A 1VHSA 3I9SA 3PBBA 3QAYA 3QNVA 5DWNA 2OZGA 3GYAA 4NGPA 4EWTA 2Q04A 1AUGA 5KTAA 2B3UA 3EFAA 3R9FA 1ZG9A 4Y49B 1Q2YA 4M6IA 3GUXA 1NMTA 4PXCA 2YNCA 4U9ZA 1Z8WA 2A4NA 2F5IA 4P44A 1R3NA 1Y9WA 3NH5A 4A39A 2HC9A 2Z3OA 2Q51A 4UWJA 1YVKA 2OU2A 4P4FA 2PQ8A 4UA3A 3KASA 4U9YA 4ZX9A 3JVNA 4DJLA 8CPAA 4ZX8A 7CPAA 1J4JA 2P0WA 3FNCA 4XNHB 3FBUA 2FL4A 2VXKA 2GANA 1VIXA 3DR6A 4MY0A 3FF3A 4ZY2A 2H5MA 3WC6A 5HVFA 3OWCA 1S5KA 1RO5A 1TKFA 1ZG7A 2B5GB 2I79A 4M6GA 1S7FA 4YFJA 4KOXA 4MFPA 2CNSA 4A32A 4I49A 4WJBA 1BOBA 4MY3A 4F6AA 4KVME 1CM0A 1V0CA 5F09A 1ZO0A 1B87A 2PJAA 2PIZA 2CTBA 4GM5A 3PB6X 4MFQA 3IWGA 4P4JA 4Q38A 3KL9A 1MK4A 4CYQA 2FT0A 4JZ0A 4CYNA 2BCOA 1M4GA 5CNPA 3TO9A 3EY5A 4ONWA 3KR5A 3BJ8A 1GYTA 3WABA 2IL4A 3FMCA
chains in the Genus database with same CATH topology
3MGDA 2ZXVA 2BEIA 2REFA 2FXFA 2QIRA 1IB1E 3DNSA 3R9GA 5ISVA 2D4PA 4J3GA 4C2YA 3UY5A 4Q36A 2X7BA 3LODA 2K5TA 5G20A 2G3TA 4A31A 5IV0A 4KVOE 2WPWA 5KTCA 2PR8A 3SXOA 4CGOA 3D2PA 2B4DA 3E0KA 3JTKA 4IF5A 1XE4A 1QSRA 4PSWA 1RXTA 2OZUA 1YLEA 4NXYA 4GS4A 4R57A 5GCNA 3N7ZA 4KLWA 4B5PA 2BL1A 4YRHA 2I00A 4IUSA 3BJ7A 4NF1A 4KORA 4ZGYB 1S60A 3FB3A 3T9YA 5AG6A 2YGWA 5HMNA 2FS5A 2JDCA 2HUZA 4FD4A 4MI4A 4LUAA 1Z4EA 4B10A 1KUYA 2Z3LA 2NMTA 2Q4VA 1GHEA 2OH1A 2Z0ZA 5KTDA 5F48A 1VKCA 4KLVA 3ZJ0A 5JQ4A 2EUIA 3FXTA 1NE9A 1I12A 4XPDB 4HKFA 4K30A 4E0AA 5AGEA 4B12A 2REEA 4QB9A 4QC6A 2Q7BA 1QSTA 4A33A 1MJBA 4MFKA 4CGPA 1YGHA 4UWIA 2DXQA 3EXNA 2CNTA 2Z3NA 4QVTA 3TO7A 2C27A 3P2FA 1QSNA 3TTHA 4KOWA 2Q4YA 5EC4A 2YNCC 1KZFA 4AVCA 1Z4RA 4CGNA 1PUAA 4HNXB 3D8PA 1Y7RA 3W91A 4B11A 2PC1A 5H86A 3IGRA 1QSMA 4KSFA 5JPHA 2CY2A 3S6FA 3VWDA 4RS2A 3TO6A 2RC4A 2PDOA 4F0YA 3DSBA 4C7HA 1S7LA 3PGPA 2VZZA 4MBUA 5FVJA 4UBRA 1R57A 4B5OA 4PK2A 3A9LA 3H4QA 4H89A 1LRZA 1L0CA 2BUEA 4Y49C 4E2AA 1P0HA 5C82A 5G22A 1Q2DA 3F0AA 4LX9A 2B58A 3F5BA 4AB7A 3G3SA 4X5KA 2EVNA 2ATRA 3CXSA 1XMTA 2FSRA 4KOYA 3D3SA 2Z10A 3TT2A 5AG4A 2G3AA 4CAVA 2Z11A 3FYNA 4ZBGA 3T90A 2Z3KA 2FCKA 2J8NA 2YNDA 1IIDA 2ZW5A 3TE4A 4JJXA 2ZW6A 3CXQA 2B3VA 4JLYA 4UCNA 4M85A 2Z3MA 3IWEA 5I0CA 3IU2A 4BMHA 4C2XA 4NEXA 2ZW7A 2VEZA 1P4NA 4R87A 4AVAA 4KS9A 3GKRA 4KOTA 4UFVA 1M44A 4R9MA 2Y0MA 4CYOA 4BBHA 2OB0A 2GIVA 4L8AA 4ORFA 4CRYB 4HNYB 2R8VA 2P6EA 3PZJA 5A27A 4C7IA 2ZW4A 4C68A 4CGLA 2VZYA 4JXRA 4F0XA 4MFLA 4CAXA 2HQYA 1WK4A 3DDDA 5G1ZA 3C26A 1Q2CA 5EBVA 3S6KA 3H5ZA 2QMLA 2B4DB 1I1DA 4UFWA 4KSAA 4AVBA 3P2HA 1CJWA 4L89A 3CXPA 3KKWA 4MHDA 3S6GA 4KZTA 2FIAA 4CRZB 3RYOA 2R1IA 4A2ZA 4KOUA 3TFYA 2ZPAA 2FIWA 1KUVA 4OADA 1Y9KA 4PSXA 5H84A 1YR0A 1K4JA 2WSAA 2YNEA 3F8KA 5AG7A 1WWZA 2Z3PA 1Z9UA 2QECA 4H6UA 3TOAA 2WPXA 5A28A 4NCZA 3FIXA 4PK3A 2JDDA 4CAWA 1M4DA 4AG9A 3R95A 3I3GA 5F49A 4MJ8A 4H6ZA 3S6HA 5F46A 1IICA 4XPKA 1N71A 2P6FA 1MJAA 1XF8A 3W6SA 1SQHA 3QB8A 4R3KA 4XNHC 1NSLA 4FD7A 4JXQA 5J8CA 3SXNA 4A30A 3LD2A 3D2MA 3K9UA 4XPDC 3GY9A 3FRMA 4EVYA 2JLMA 1QSOA 4PV6A 4KUAA 1UFHA 3R9EA 3R1KA 2ARHA 4JD6A 4QUSA 4U5YA 3SHPA 1BO4A 2AJ6A 2WUUA 5HH1A 2CXAA 4CAEA 4B14A 3V8IA 3IU1A 1U6MA 1ON0A 2J8MA 3WR7A 4ONUA 5IX3A 1IYKA 3NE7A 4OAEA 4M3SA 3JUWA 1B6BA 3BLNA 3DR8A 4FD6A 1S3ZA 4UFXA 4E8OA 4AG7A 4OLLA 2R98A 4C2ZA 1PU9A 2O28A 2Q44A 3PP9A 2JEVA 3ZZIA 3VWEA 2AE6A 1M4IA 4CAFA 4KVXA 1XEBA 1YVOA 2J8RA 4II9A 1OZPA 3EO4A 4MFJA 4B5PB 1S7KA 5IB0A 2PRBA 4QBJA 2DPTA 2PR1A 3TCVA 5DWMA 4HNWB 5AG5A 4FD5A 2Q0YA 2OZHA 4DNCA 2B5GA 4R3LA 3QAHA 3G8WA 2CNMA 4KUBA 1YREA 2HV2A 2DPSA 2R7HA 4B13A 2P6GA 4CYPA 3B8GA 4YGOA 2VI7A 2GE3A 2VQYA 1YX0A 2G0BA 4KOSA 1YK3A 1I21A 2KCWA 2FE7A 4MFZA 5BWAB 1FY7A 1XIXA 4XPLA 4A95A 1S7NA 4RI1A 2VBQA 5G21A 2D4OA 4JWPA 2BSWA 4UCPA 1KUXA 2PSWA 3EC4A 4CGMA 5F47A 4UCMA 3TOBA 3R96A 1M1DA 5C88A 2B4BA 4KOVA 5E96A 1TIQA 3W6XA 4CS0B 1IYLA 4NSQA 1MJ9A 1VHSA 3I9SA 5DWNA 2OZGA 3GYAA 2Q04A 5KTAA 2B3UA 3EFAA 3R9FA 4Y49B 1Q2YA 1NMTA 4U9ZA 2YNCA 2A4NA 2F5IA 1Y9WA 2Z3OA 4UWJA 1YVKA 2OU2A 5J8FA 2PQ8A 4UA3A 4U9YA 3JVNA 1J4JA 2P0WA 3FNCA 4XNHB 3FBUA 2FL4A 2VXKA 2GANA 3DR6A 4MY0A 2H5MA 3OWCA 1S5KA 1RO5A 2B5GB 2I79A 1S7FA 4YFJA 4KOXA 4MFPA 2CNSA 4A32A 4I49A 1BOBA 4MY3A 4F6AA 4KVME 1CM0A 1V0CA 1ZO0A 1B87A 4MFQA 3IWGA 4Q38A 1MK4A 4CYQA 2FT0A 4CYNA 1M4GA 5CNPA 3TO9A 3EY5A 3BJ8A 2IL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGD A;  2ZXV A;  2BEI A;  2REF A;  2FXF A;  2QIR A;  1IB1 E;  3DNS A;  3R9G A;  5ISV A;  2D4P A;  4J3G A;  3UY5 A;  2X7B A;  3LOD A;  2K5T A;  2G3T A;  5IV0 A;  4KVO E;  2WPW A;  5KTC A;  2PR8 A;  3SXO A;  3D2P A;  2B4D A;  3E0K A;  4IF5 A;  1XE4 A;  1QSR A;  4PSW A;  1RXT A;  2OZU A;  1YLE A;  4NXY A;  4GS4 A;  4R57 A;  5GCN A;  3N7Z A;  4KLW A;  4B5P A;  2BL1 A;  4YRH A;  2I00 A;  4IUS A;  3BJ7 A;  4NF1 A;  4KOR A;  1S60 A;  3FB3 A;  3T9Y A;  5HMN A;  2FS5 A;  2JDC A;  2HUZ A;  4FD4 A;  4MI4 A;  4LUA A;  1Z4E A;  1KUY A;  2NMT A;  2Q4V A;  1GHE A;  2OH1 A;  2Z0Z A;  5KTD A;  5F48 A;  1VKC A;  4KLV A;  3ZJ0 A;  5JQ4 A;  2EUI A;  3FXT A;  1NE9 A;  1I12 A;  4XPD B;  4HKF A;  4K30 A;  4E0A A;  2REE A;  4QB9 A;  4QC6 A;  2Q7B A;  1QST A;  1MJB A;  1YGH A;  4UWI A;  2DXQ A;  3EXN A;  2CNT A;  4QVT A;  3TO7 A;  2C27 A;  3P2F A;  1QSN A;  3TTH A;  4KOW A;  2Q4Y A;  5EC4 A;  1KZF A;  4AVC A;  1Z4R A;  1PUA A;  4HNX B;  3D8P A;  1Y7R A;  3W91 A;  2PC1 A;  5H86 A;  3IGR A;  1QSM A;  5JPH A;  2CY2 A;  3S6F A;  3VWD A;  4RS2 A;  3TO6 A;  2RC4 A;  2PDO A;  4F0Y A;  3DSB A;  1S7L A;  3PGP A;  2VZZ A;  4MBU A;  5FVJ A;  4UBR A;  1R57 A;  4B5O A;  4PK2 A;  3H4Q A;  4H89 A;  1LRZ A;  1L0C A;  2BUE A;  4Y49 C;  4E2A A;  1P0H A;  5C82 A;  1Q2D A;  3F0A A;  4LX9 A;  2B58 A;  3F5B A;  4AB7 A;  3G3S A;  4X5K A;  2EVN A;  2ATR A;  3CXS A;  1XMT A;  2FSR A;  4KOY A;  3D3S A;  2Z10 A;  3TT2 A;  2G3A A;  4CAV A;  2Z11 A;  3FYN A;  4ZBG A;  3T90 A;  2FCK A;  2J8N A;  1IID A;  2ZW5 A;  3TE4 A;  4JJX A;  2ZW6 A;  3CXQ A;  2B3V A;  4JLY A;  4M85 A;  5I0C A;  4BMH A;  4NEX A;  2ZW7 A;  2VEZ A;  1P4N A;  4R87 A;  4AVA A;  3GKR A;  4KOT A;  1M44 A;  4R9M A;  2Y0M A;  2OB0 A;  2GIV A;  4L8A A;  4ORF A;  4CRY B;  4HNY B;  2R8V A;  2P6E A;  3PZJ A;  2ZW4 A;  2VZY A;  4JXR A;  4CAX A;  2HQY A;  1WK4 A;  3DDD A;  3C26 A;  1Q2C A;  5EBV A;  3S6K A;  2QML A;  2B4D B;  1I1D A;  4AVB A;  3P2H A;  1CJW A;  4L89 A;  3CXP A;  3KKW A;  4MHD A;  3S6G A;  4KZT A;  2FIA A;  4CRZ B;  3RYO A;  2R1I A;  4KOU A;  3TFY A;  2ZPA A;  2FIW A;  1KUV A;  4OAD A;  1Y9K A;  4PSX A;  5H84 A;  1YR0 A;  1K4J A;  3F8K A;  1WWZ A;  1Z9U A;  2QEC A;  4H6U A;  3TOA A;  2WPX A;  4NCZ A;  3FIX A;  4PK3 A;  2JDD A;  4CAW A;  1M4D A;  4AG9 A;  3R95 A;  3I3G A;  5F49 A;  4MJ8 A;  4H6Z A;  3S6H A;  5F46 A;  1IIC A;  4XPK A;  1N71 A;  2P6F A;  1MJA A;  1XF8 A;  3W6S A;  1SQH A;  3QB8 A;  4R3K A;  4XNH C;  1NSL A;  4FD7 A;  4JXQ A;  5J8C A;  3SXN A;  3LD2 A;  3D2M A;  3K9U A;  4XPD C;  3GY9 A;  3FRM A;  4EVY A;  2JLM A;  1QSO A;  4PV6 A;  4KUA A;  1UFH A;  3R9E A;  3R1K A;  2ARH A;  4JD6 A;  4QUS A;  4U5Y A;  3SHP A;  1BO4 A;  2AJ6 A;  5HH1 A;  3V8I A;  1U6M A;  1ON0 A;  2J8M A;  3WR7 A;  4ONU A;  5IX3 A;  1IYK A;  3NE7 A;  4OAE A;  4M3S A;  3JUW A;  1B6B A;  3BLN A;  3DR8 A;  4FD6 A;  1S3Z A;  4E8O A;  4AG7 A;  4OLL A;  2R98 A;  1PU9 A;  2O28 A;  2Q44 A;  3PP9 A;  2JEV A;  3ZZI A;  3VWE A;  2AE6 A;  1M4I A;  4KVX A;  1XEB A;  1YVO A;  2J8R A;  4II9 A;  1OZP A;  3EO4 A;  4B5P B;  1S7K A;  5IB0 A;  2PRB A;  4QBJ A;  2PR1 A;  3TCV A;  5DWM A;  4HNW B;  4FD5 A;  2Q0Y A;  2OZH A;  4DNC A;  2B5G A;  4R3L A;  3QAH A;  3G8W A;  2CNM A;  4KUB A;  1YRE A;  2HV2 A;  2R7H A;  2P6G A;  3B8G A;  4YGO A;  2VI7 A;  2GE3 A;  2VQY A;  1YX0 A;  2G0B A;  4KOS A;  1YK3 A;  1I21 A;  2KCW A;  2FE7 A;  1FY7 A;  1XIX A;  4XPL A;  1S7N A;  4RI1 A;  2VBQ A;  2D4O A;  4JWP A;  2BSW A;  1KUX A;  2PSW A;  3EC4 A;  5F47 A;  3TOB A;  3R96 A;  1M1D A;  5C88 A;  2B4B A;  4KOV A;  5E96 A;  1TIQ A;  3W6X A;  4CS0 B;  1IYL A;  4NSQ A;  1MJ9 A;  1VHS A;  3I9S A;  5DWN A;  2OZG A;  3GYA A;  2Q04 A;  5KTA A;  2B3U A;  3EFA A;  3R9F A;  4Y49 B;  1Q2Y A;  1NMT A;  4U9Z A;  2A4N A;  2F5I A;  1Y9W A;  4UWJ A;  1YVK A;  2OU2 A;  5J8F A;  2PQ8 A;  4UA3 A;  4U9Y A;  3JVN A;  1J4J A;  2P0W A;  3FNC A;  4XNH B;  3FBU A;  2FL4 A;  2VXK A;  2GAN A;  3DR6 A;  4MY0 A;  2H5M A;  3OWC A;  1S5K A;  1RO5 A;  2B5G B;  2I79 A;  1S7F A;  4YFJ A;  4KOX A;  2CNS A;  4I49 A;  1BOB A;  4MY3 A;  4F6A A;  4KVM E;  1CM0 A;  1V0C A;  1B87 A;  3IWG A;  1MK4 A;  2FT0 A;  1M4G A;  5CNP A;  3TO9 A;  3EY5 A;  3BJ8 A;  2IL4 A; 
#chains in the Genus database with same CATH topology
 4MHP A;  3MGD A;  4OC4 A;  4OKO A;  2ZXV A;  2BEI A;  2REF A;  2FXF A;  2QIR A;  1IB1 E;  3DNS A;  3R9G A;  2EBJ A;  5ISV A;  2RFH A;  2D4P A;  2AFO A;  1IY7 A;  4J3G A;  4NJQ A;  4C2Y A;  3UY5 A;  4O23 A;  3TX8 A;  4Q36 A;  1PYT B;  2X7B A;  3LOD A;  4LQG A;  4X2T A;  4MMO A;  1LOK A;  2K5T A;  5G20 A;  2G3T A;  4A31 A;  2WYR A;  5IV0 A;  4OP4 A;  4KVO E;  2WPW A;  1LAM A;  5KTC A;  2PR8 A;  3SXO A;  4CGO A;  3BI1 A;  1CP7 A;  4B6Z A;  3D2P A;  2B4D A;  1CBX A;  3E0K A;  3JTK A;  4IF5 A;  1YSJ A;  5D8N A;  1XE4 A;  1QSR A;  4PSW A;  3KGQ A;  4BD9 A;  1RXT A;  1JWQ A;  2OZU A;  3V38 A;  1YLE A;  2VL1 A;  5LYL A;  4NXY A;  4GS4 A;  3CDX A;  4R57 A;  3SJE A;  1YW4 A;  3K2K A;  3N7Z A;  4HPS A;  5GCN A;  3NFZ A;  4KLW A;  3PFO A;  2ZEF A;  4B5P A;  1X10 A;  2BL1 A;  4YRH A;  2ZEE A;  2G9D A;  2I00 A;  4IUS A;  3BJ7 A;  4NF1 A;  4ZY1 A;  2O4H A;  4ZYQ A;  4KOR A;  4ZGY B;  1S60 A;  2CTC A;  3FB3 A;  3GLJ A;  3T9Y A;  2JBJ A;  5THW A;  1IGB A;  2ZEP A;  3FEE A;  1ZLI A;  2PE3 A;  2YGW A;  3FVL A;  5AG6 A;  2ZEG A;  3CZX A;  4M6H A;  2PJ0 A;  5HMN A;  2EWB A;  2FS5 A;  2JDC A;  1UWY A;  2HUZ A;  3KQX A;  4FD4 A;  3H8F A;  4MI4 A;  4UEZ A;  4LUA A;  1Z4E A;  1CX8 A;  4B10 A;  1YME A;  5K8P A;  1KUY A;  2IJZ A;  2Z3L A;  2PRQ A;  2NMT A;  1XOV A;  5DS0 A;  2Q4V A;  1GHE A;  4NJR A;  2OH1 A;  2Z0Z A;  5KTD A;  5F48 A;  5K8O A;  1VKC A;  4KLV A;  3ZJ0 A;  5JQ4 A;  2EUI A;  3FXT A;  1NE9 A;  4UIA A;  1I12 A;  3JRU A;  4XPD B;  2ZOF A;  4HKF A;  1NSA A;  4FUU A;  4K30 A;  4E0A A;  5AGE A;  3B3S A;  2AFW A;  5D29 A;  3IO1 A;  4B12 A;  2REE A;  3RNZ A;  4BIN A;  1ELL P;  3IFE A;  4QB9 A;  1XJO A;  4QC6 A;  2Q7B A;  2C6P A;  1QST A;  1X12 A;  4A33 A;  1IOF A;  1MJB A;  5K8N A;  1JQG A;  2Q4Z A;  2IMO A;  2WZN A;  4MFK A;  4CGP A;  1TKJ A;  4OC0 A;  1YGH A;  4UWI A;  2DXQ A;  3EXN A;  2CNT A;  2Z3N A;  4QVT A;  1Y7E A;  3TO7 A;  1TF8 A;  3SJG A;  5HVG A;  4F8Z A;  2C27 A;  2PJ2 A;  3LAC A;  3P2F A;  1QSN A;  3TTH A;  3BHX A;  3IJ3 A;  2V77 A;  4KOW A;  3H8E A;  2Q4Y A;  3HLP A;  5LYI A;  2GRE A;  2JBK A;  4EFD A;  5EC4 A;  2YNC C;  4FWU A;  1KZF A;  4AVC A;  4DUK A;  1Z4R A;  2GLJ A;  3RO0 A;  4CGN A;  1PUA A;  4HNX B;  5I0C A;  1BPN A;  3D8P A;  1Y7R A;  3W91 A;  5LRJ A;  2PVV A;  1XFO A;  2AFX A;  2PC1 A;  3MRU A;  4IHM A;  1YLO A;  4B11 A;  5H86 A;  3IGR A;  1QSM A;  4R6T A;  2GFQ A;  3CPA A;  3D66 A;  4KSF A;  3B3C A;  3VAR A;  5JPH A;  2CY2 A;  2ZED A;  4YU9 A;  3S6F A;  3VWD A;  5LYF A;  2PJB A;  4RS2 A;  4MRI A;  4FAI A;  3TO6 A;  2RC4 A;  2PDO A;  4F0Y A;  2EO8 A;  3DSB A;  3VH9 A;  4C7H A;  3K9T A;  1S7L A;  2PCU A;  3PGP A;  2VZZ A;  3BI0 A;  2JEW A;  4MBU A;  4JYW A;  3D68 A;  1XMB A;  1HDQ A;  5FVJ A;  4UBR A;  1R57 A;  2XEG A;  4MCS A;  4B5O A;  4PK2 A;  5ELY A;  3A9L A;  3H4Q A;  4H89 A;  1CP6 A;  2PJ4 A;  1LRZ A;  1L0C A;  2BUE A;  2HB6 A;  4Y49 C;  4H2K A;  4UEE A;  3IC1 A;  1P0H A;  4GXH A;  5C82 A;  5G22 A;  1Q2D A;  2PJ9 A;  3F0A A;  1BAV A;  3FX6 A;  3KZW A;  3KHX A;  4LX9 A;  2B58 A;  3F5B A;  4AB7 A;  3G3S A;  2V8H A;  1ZG8 A;  4X5K A;  3NH4 A;  4FBE A;  3PB7 X;  1Z8X A;  2EVN A;  4TWE A;  5LRG A;  2ATR A;  4TNU A;  3CXS A;  4MHY A;  1XMT A;  2FSR A;  4G1P A;  2BO9 A;  4DYO A;  4K3N A;  4IK2 A;  1RTQ A;  3D3S A;  4KOY A;  1BPM A;  2Z10 A;  3TT2 A;  5HXD A;  5AG4 A;  3WC7 A;  2PIY A;  4MCQ A;  1CPS A;  2G3A A;  1Z8T A;  4CAV A;  4A94 A;  3IEH A;  2Q43 A;  4WWV A;  2Z11 A;  3FYN A;  4ZBG A;  3T90 A;  4NGS A;  2CF4 A;  2Z3K A;  4R8F A;  2POK A;  2FCK A;  3CT9 A;  4Q7A A;  3FH4 A;  2J8N A;  2XEF A;  2YND A;  1IID A;  3FJU A;  2ZW5 A;  3I1U A;  3KQZ A;  1VHO A;  4W9Y A;  3TE4 A;  4JJX A;  2ZW6 A;  3CXQ A;  4MHN A;  2B3V A;  4UF4 A;  1DE4 C;  4JLY A;  4UCN A;  4F9V A;  4M85 A;  2F8H A;  2Z3M A;  1VHE A;  2XEJ A;  3IU2 A;  3IWE A;  4P4I A;  4BMH A;  4C2X A;  4NEX A;  4Z65 A;  2ZW7 A;  2VEZ A;  1P4N A;  4P45 A;  4R87 A;  4KS9 A;  4AVA A;  3GKR A;  4KOT A;  4UFV A;  1M44 A;  4R9M A;  2Y0M A;  2FVG A;  4MXU A;  4CYO A;  4BBH A;  1YQE A;  2OB0 A;  2GIV A;  3MN8 A;  1Y0Y A;  4L8A A;  4MCP A;  4ORF A;  4CRY B;  4PPZ A;  4ZI6 A;  4HNY B;  2R8V A;  2P6E A;  3PZJ A;  5A27 A;  4C7I A;  2ZW4 A;  4C68 A;  4CGL A;  3SJX A;  2VZY A;  4JXR A;  4OIW A;  3SJF A;  4F0X A;  3SI2 A;  2V8G A;  4MFL A;  4CAX A;  2HQY A;  1WK4 A;  3DDD A;  4OME A;  3B3V A;  4P4D A;  5G1Z A;  3C26 A;  1Q2C A;  5EBV A;  3S6K A;  3H5Z A;  4MCR A;  1PCA A;  2QML A;  5JGF A;  3CPX A;  1AMP A;  2B4D B;  3RZA A;  1I1D A;  2DF5 A;  3VAT A;  3BXM A;  2CIJ A;  4UFW A;  4KSA A;  2V8V A;  1ELM P;  4YWY A;  4AVB A;  3P2H A;  1CJW A;  4L89 A;  3CXP A;  3NA6 A;  4EME A;  5J8F A;  3KKW A;  4MHD A;  3S6G A;  3NH8 A;  4KZT A;  2FIA A;  1OBR A;  3D4U A;  4CRZ B;  3RYO A;  2R1I A;  4X8I A;  4A2Z A;  4E2A A;  4KOU A;  3TFY A;  4PXE A;  2ZPA A;  4RN7 A;  2FIW A;  3D67 A;  3IWW A;  1LAP A;  1KUV A;  3KI9 A;  4OAD A;  3RAM A;  1Y9K A;  1F2O A;  4R7M A;  1KWM A;  1QQ9 A;  4PSX A;  5H84 A;  3H8G A;  4OC2 A;  1TXR A;  1YR0 A;  3D7D A;  1K4J A;  2WSA A;  3DGV A;  3SI0 A;  2YNE A;  3PFE A;  3F8K A;  2OR4 A;  1F2P A;  5AG7 A;  1WWZ A;  2Z3P A;  1Z9U A;  2QEC A;  3PB8 X;  4H6U A;  2EK8 A;  3TOA A;  1ARL A;  2WPX A;  4UIB A;  5A28 A;  4PXD A;  5LRK A;  4NCZ A;  3FIX A;  2OOT A;  1BLL E;  3IIB A;  3TC8 A;  4PK3 A;  3S9N A;  2GU2 A;  2JDD A;  4CAW A;  1M4D A;  2Q7S A;  4AG9 A;  4A37 A;  1FNO A;  3D7F A;  3WC5 A;  2IQ6 A;  3R95 A;  3PRT A;  1Z8L A;  3I3G A;  2ANP A;  1Y0R A;  5F49 A;  2ZEN A;  2AFM A;  4MJ8 A;  4H6Z A;  3S6H A;  5F46 A;  1IIC A;  4XPK A;  1N71 A;  5J1Q A;  2P6F A;  1MJA A;  2PJ8 A;  1QMU A;  1XF8 A;  3PB4 X;  3W6S A;  3PB9 X;  1SQH A;  3QB8 A;  4R3K A;  1R43 A;  4XNH C;  1NSL A;  2C6G A;  4FD7 A;  4JXQ A;  5J8C A;  3SXN A;  3B3W A;  3LD2 A;  3D2M A;  3K9U A;  4A30 A;  4XPD C;  5I4M A;  3GY9 A;  3V7Z A;  5HVH A;  3FRM A;  2BOA A;  4EVY A;  1CG2 A;  3SI1 A;  1CPX A;  2PJC A;  2JLM A;  1IU8 A;  1QSO A;  2RB7 A;  4KUA A;  1UFH A;  4P10 A;  4PV6 A;  4NGT A;  4P4E A;  3R1K A;  4R76 A;  3R9E A;  1IOI A;  2ARH A;  4JD6 A;  2PVW A;  4QUS A;  4U5Y A;  1BO4 A;  3SHP A;  2AJ6 A;  2WUU A;  1YW6 A;  4PQA A;  1Z2L A;  2CXA A;  1TKH A;  5HH1 A;  4CAE A;  4NFR A;  4UEF A;  4B14 A;  1VGY A;  2F7V A;  3V8I A;  3IU1 A;  1U6M A;  1ON0 A;  2J8M A;  3WR7 A;  4ONU A;  5IX3 A;  1EE3 P;  1FT7 A;  4F9U A;  3B2Y A;  2NSM A;  1IYK A;  1LCP A;  3NE7 A;  4OAE A;  3LMS A;  4IAV A;  3PBE A;  3HUV A;  3ISZ A;  4M3S A;  2C6C A;  3JUW A;  2AFS A;  1B6B A;  3BLN A;  3DR8 A;  4FD6 A;  1S3Z A;  4UFX A;  2QVP A;  3DLJ A;  4E8O A;  5JH9 A;  4AG7 A;  4OLL A;  2R98 A;  4C2Z A;  1PU9 A;  2O28 A;  2Q44 A;  3PP9 A;  2JEV A;  1XRY A;  3T8W A;  3ZZI A;  2C1C A;  3VWE A;  2AE6 A;  1M4I A;  4CAF A;  4KVX A;  1XEB A;  1YVO A;  2J8R A;  4II9 A;  3KR4 A;  1OZP A;  1AYE A;  3EO4 A;  2V8D A;  4MFJ A;  1S7K A;  2ZEM A;  1A2Z A;  1F57 A;  4MHZ A;  4B5P B;  5IB0 A;  2PRB A;  4QBJ A;  3FEC A;  2DPT A;  2ABZ A;  2PR1 A;  3TCV A;  1HEE A;  4CPA A;  5DWM A;  4HNW B;  2GLF A;  4FD5 A;  4NGQ A;  5AG5 A;  2Q0Y A;  5EMI A;  2AFZ A;  2NYQ A;  2OZH A;  4DNC A;  2B5G A;  2QJ8 A;  4R3L A;  4A38 A;  2PJ1 A;  1H8L A;  3QAH A;  3G8W A;  3B3T A;  2CNM A;  4KUB A;  3S9L A;  1YRE A;  3N5F A;  2ZEO A;  1LFW A;  2HV2 A;  2PJ5 A;  1LAN A;  3L2N A;  4NGN A;  4ZY0 A;  3PEI A;  2EK9 A;  2XEI A;  2DPS A;  2QYV A;  2R7H A;  4B13 A;  2P6G A;  4CYP A;  5JM6 A;  4LQ6 A;  4RUH A;  5IB9 A;  4OID A;  3B8G A;  4YGO A;  3KHZ A;  4OC3 A;  4PXB A;  2VI7 A;  4P6Y A;  2GE3 A;  2VQY A;  1YX0 A;  2ODF A;  2G0B A;  3D7G A;  3D7H A;  4KOS A;  3RBU A;  1ARM A;  4KSI A;  1YK3 A;  1I21 A;  2PJ7 A;  2KCW A;  1DTD A;  2FE7 A;  4MFZ A;  3S9M A;  5BWA B;  1XBU A;  2AFU A;  1FY7 A;  4OC1 A;  1XIX A;  4OC5 A;  3GB0 A;  4XPL A;  4A95 A;  5K8M A;  4NGR A;  2ZEH A;  1S7N A;  4RI1 A;  2VBQ A;  5G21 A;  2D4O A;  4JWP A;  1Z5R A;  2PJ3 A;  2BSW A;  2ZEL A;  2DEA A;  4UCP A;  2PJ6 A;  3FED A;  1TF9 A;  1KUX A;  2J9A A;  2PSW A;  3EC4 A;  5CPA A;  1HDU A;  3NE8 A;  5LYD A;  4CGM A;  5F47 A;  4UCM A;  3TOB A;  6CPA A;  1ZLH A;  3ISX A;  2O53 A;  2ZOG A;  1M1D A;  3R96 A;  2B4B A;  4KOV A;  5E96 A;  4AXV A;  5C88 A;  1TIQ A;  4X3R A;  3W6X A;  3WT4 A;  1Q7L A;  4CS0 B;  1M4L A;  4P4B A;  4NGM A;  3B7I A;  2I3C A;  3B35 A;  3LWU A;  1IYL A;  4NSQ A;  5CBM A;  3GIU A;  1MJ9 A;  1VHS A;  3I9S A;  3PBB A;  3QAY A;  3QNV A;  5DWN A;  2OZG A;  3GYA A;  4NGP A;  4EWT A;  2Q04 A;  1AUG A;  5KTA A;  2B3U A;  3EFA A;  3R9F A;  1ZG9 A;  4Y49 B;  1Q2Y A;  4M6I A;  3GUX A;  1NMT A;  4PXC A;  2YNC A;  4U9Z A;  1Z8W A;  2A4N A;  2F5I A;  4P44 A;  1R3N A;  1Y9W A;  3NH5 A;  4A39 A;  2HC9 A;  2Z3O A;  2Q51 A;  4UWJ A;  1YVK A;  2OU2 A;  4P4F A;  2PQ8 A;  4UA3 A;  3KAS A;  4U9Y A;  4ZX9 A;  3JVN A;  4DJL A;  8CPA A;  4ZX8 A;  7CPA A;  1J4J A;  2P0W A;  3FNC A;  4XNH B;  3FBU A;  2FL4 A;  2VXK A;  2GAN A;  1VIX A;  3DR6 A;  4MY0 A;  3FF3 A;  4ZY2 A;  2H5M A;  3WC6 A;  5HVF A;  3OWC A;  1S5K A;  1RO5 A;  1TKF A;  1ZG7 A;  2B5G B;  2I79 A;  4M6G A;  1S7F A;  4YFJ A;  4KOX A;  4MFP A;  2CNS A;  4A32 A;  4I49 A;  4WJB A;  1BOB A;  4MY3 A;  4F6A A;  4KVM E;  1CM0 A;  1V0C A;  5F09 A;  1ZO0 A;  1B87 A;  2PJA A;  2PIZ A;  2CTB A;  4GM5 A;  3PB6 X;  4MFQ A;  3IWG A;  4P4J A;  4Q38 A;  3KL9 A;  1MK4 A;  4CYQ A;  2FT0 A;  4JZ0 A;  4CYN A;  2BCO A;  1M4G A;  5CNP A;  3TO9 A;  3EY5 A;  4ONW A;  3KR5 A;  3BJ8 A;  1GYT A;  3WAB A;  2IL4 A;  3FMC A; 
#chains in the Genus database with same CATH homology
 3MGD A;  2ZXV A;  2BEI A;  2REF A;  2FXF A;  2QIR A;  1IB1 E;  3DNS A;  3R9G A;  5ISV A;  2D4P A;  4J3G A;  4C2Y A;  3UY5 A;  4Q36 A;  2X7B A;  3LOD A;  2K5T A;  5G20 A;  2G3T A;  4A31 A;  5IV0 A;  4KVO E;  2WPW A;  5KTC A;  2PR8 A;  3SXO A;  4CGO A;  3D2P A;  2B4D A;  3E0K A;  3JTK A;  4IF5 A;  1XE4 A;  1QSR A;  4PSW A;  1RXT A;  2OZU A;  1YLE A;  4NXY A;  4GS4 A;  4R57 A;  5GCN A;  3N7Z A;  4KLW A;  4B5P A;  2BL1 A;  4YRH A;  2I00 A;  4IUS A;  3BJ7 A;  4NF1 A;  4KOR A;  4ZGY B;  1S60 A;  3FB3 A;  3T9Y A;  5AG6 A;  2YGW A;  5HMN A;  2FS5 A;  2JDC A;  2HUZ A;  4FD4 A;  4MI4 A;  4LUA A;  1Z4E A;  4B10 A;  1KUY A;  2Z3L A;  2NMT A;  2Q4V A;  1GHE A;  2OH1 A;  2Z0Z A;  5KTD A;  5F48 A;  1VKC A;  4KLV A;  3ZJ0 A;  5JQ4 A;  2EUI A;  3FXT A;  1NE9 A;  1I12 A;  4XPD B;  4HKF A;  4K30 A;  4E0A A;  5AGE A;  4B12 A;  2REE A;  4QB9 A;  4QC6 A;  2Q7B A;  1QST A;  4A33 A;  1MJB A;  4MFK A;  4CGP A;  1YGH A;  4UWI A;  2DXQ A;  3EXN A;  2CNT A;  2Z3N A;  4QVT A;  3TO7 A;  2C27 A;  3P2F A;  1QSN A;  3TTH A;  4KOW A;  2Q4Y A;  5EC4 A;  2YNC C;  1KZF A;  4AVC A;  1Z4R A;  4CGN A;  1PUA A;  4HNX B;  3D8P A;  1Y7R A;  3W91 A;  4B11 A;  2PC1 A;  5H86 A;  3IGR A;  1QSM A;  4KSF A;  5JPH A;  2CY2 A;  3S6F A;  3VWD A;  4RS2 A;  3TO6 A;  2RC4 A;  2PDO A;  4F0Y A;  3DSB A;  4C7H A;  1S7L A;  3PGP A;  2VZZ A;  4MBU A;  5FVJ A;  4UBR A;  1R57 A;  4B5O A;  4PK2 A;  3A9L A;  3H4Q A;  4H89 A;  1LRZ A;  1L0C A;  2BUE A;  4Y49 C;  4E2A A;  1P0H A;  5C82 A;  5G22 A;  1Q2D A;  3F0A A;  4LX9 A;  2B58 A;  3F5B A;  4AB7 A;  3G3S A;  4X5K A;  2EVN A;  2ATR A;  3CXS A;  1XMT A;  2FSR A;  4KOY A;  3D3S A;  2Z10 A;  3TT2 A;  5AG4 A;  2G3A A;  4CAV A;  2Z11 A;  3FYN A;  4ZBG A;  3T90 A;  2Z3K A;  2FCK A;  2J8N A;  2YND A;  1IID A;  2ZW5 A;  3TE4 A;  4JJX A;  2ZW6 A;  3CXQ A;  2B3V A;  4JLY A;  4UCN A;  4M85 A;  2Z3M A;  3IWE A;  5I0C A;  3IU2 A;  4BMH A;  4C2X A;  4NEX A;  2ZW7 A;  2VEZ A;  1P4N A;  4R87 A;  4AVA A;  4KS9 A;  3GKR A;  4KOT A;  4UFV A;  1M44 A;  4R9M A;  2Y0M A;  4CYO A;  4BBH A;  2OB0 A;  2GIV A;  4L8A A;  4ORF A;  4CRY B;  4HNY B;  2R8V A;  2P6E A;  3PZJ A;  5A27 A;  4C7I A;  2ZW4 A;  4C68 A;  4CGL A;  2VZY A;  4JXR A;  4F0X A;  4MFL A;  4CAX A;  2HQY A;  1WK4 A;  3DDD A;  5G1Z A;  3C26 A;  1Q2C A;  5EBV A;  3S6K A;  3H5Z A;  2QML A;  2B4D B;  1I1D A;  4UFW A;  4KSA A;  4AVB A;  3P2H A;  1CJW A;  4L89 A;  3CXP A;  3KKW A;  4MHD A;  3S6G A;  4KZT A;  2FIA A;  4CRZ B;  3RYO A;  2R1I A;  4A2Z A;  4KOU A;  3TFY A;  2ZPA A;  2FIW A;  1KUV A;  4OAD A;  1Y9K A;  4PSX A;  5H84 A;  1YR0 A;  1K4J A;  2WSA A;  2YNE A;  3F8K A;  5AG7 A;  1WWZ A;  2Z3P A;  1Z9U A;  2QEC A;  4H6U A;  3TOA A;  2WPX A;  5A28 A;  4NCZ A;  3FIX A;  4PK3 A;  2JDD A;  4CAW A;  1M4D A;  4AG9 A;  3R95 A;  3I3G A;  5F49 A;  4MJ8 A;  4H6Z A;  3S6H A;  5F46 A;  1IIC A;  4XPK A;  1N71 A;  2P6F A;  1MJA A;  1XF8 A;  3W6S A;  1SQH A;  3QB8 A;  4R3K A;  4XNH C;  1NSL A;  4FD7 A;  4JXQ A;  5J8C A;  3SXN A;  4A30 A;  3LD2 A;  3D2M A;  3K9U A;  4XPD C;  3GY9 A;  3FRM A;  4EVY A;  2JLM A;  1QSO A;  4PV6 A;  4KUA A;  1UFH A;  3R9E A;  3R1K A;  2ARH A;  4JD6 A;  4QUS A;  4U5Y A;  3SHP A;  1BO4 A;  2AJ6 A;  2WUU A;  5HH1 A;  2CXA A;  4CAE A;  4B14 A;  3V8I A;  3IU1 A;  1U6M A;  1ON0 A;  2J8M A;  3WR7 A;  4ONU A;  5IX3 A;  1IYK A;  3NE7 A;  4OAE A;  4M3S A;  3JUW A;  1B6B A;  3BLN A;  3DR8 A;  4FD6 A;  1S3Z A;  4UFX A;  4E8O A;  4AG7 A;  4OLL A;  2R98 A;  4C2Z A;  1PU9 A;  2O28 A;  2Q44 A;  3PP9 A;  2JEV A;  3ZZI A;  3VWE A;  2AE6 A;  1M4I A;  4CAF A;  4KVX A;  1XEB A;  1YVO A;  2J8R A;  4II9 A;  1OZP A;  3EO4 A;  4MFJ A;  4B5P B;  1S7K A;  5IB0 A;  2PRB A;  4QBJ A;  2DPT A;  2PR1 A;  3TCV A;  5DWM A;  4HNW B;  5AG5 A;  4FD5 A;  2Q0Y A;  2OZH A;  4DNC A;  2B5G A;  4R3L A;  3QAH A;  3G8W A;  2CNM A;  4KUB A;  1YRE A;  2HV2 A;  2DPS A;  2R7H A;  4B13 A;  2P6G A;  4CYP A;  3B8G A;  4YGO A;  2VI7 A;  2GE3 A;  2VQY A;  1YX0 A;  2G0B A;  4KOS A;  1YK3 A;  1I21 A;  2KCW A;  2FE7 A;  4MFZ A;  5BWA B;  1FY7 A;  1XIX A;  4XPL A;  4A95 A;  1S7N A;  4RI1 A;  2VBQ A;  5G21 A;  2D4O A;  4JWP A;  2BSW A;  4UCP A;  1KUX A;  2PSW A;  3EC4 A;  4CGM A;  5F47 A;  4UCM A;  3TOB A;  3R96 A;  1M1D A;  5C88 A;  2B4B A;  4KOV A;  5E96 A;  1TIQ A;  3W6X A;  4CS0 B;  1IYL A;  4NSQ A;  1MJ9 A;  1VHS A;  3I9S A;  5DWN A;  2OZG A;  3GYA A;  2Q04 A;  5KTA A;  2B3U A;  3EFA A;  3R9F A;  4Y49 B;  1Q2Y A;  1NMT A;  4U9Z A;  2YNC A;  2A4N A;  2F5I A;  1Y9W A;  2Z3O A;  4UWJ A;  1YVK A;  2OU2 A;  5J8F A;  2PQ8 A;  4UA3 A;  4U9Y A;  3JVN A;  1J4J A;  2P0W A;  3FNC A;  4XNH B;  3FBU A;  2FL4 A;  2VXK A;  2GAN A;  3DR6 A;  4MY0 A;  2H5M A;  3OWC A;  1S5K A;  1RO5 A;  2B5G B;  2I79 A;  1S7F A;  4YFJ A;  4KOX A;  4MFP A;  2CNS A;  4A32 A;  4I49 A;  1BOB A;  4MY3 A;  4F6A A;  4KVM E;  1CM0 A;  1V0C A;  1ZO0 A;  1B87 A;  4MFQ A;  3IWG A;  4Q38 A;  1MK4 A;  4CYQ A;  2FT0 A;  4CYN A;  1M4G A;  5CNP A;  3TO9 A;  3EY5 A;  3BJ8 A;  2IL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...