4FD6A

Crystal structure of native arylalkylamine n-acetyltransferase 2 from the yellow fever mosquito, aedes aegypti
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
218
structure length
218
Chain Sequence
KLNNIRFETISSKYYDDVIEHLRQTFFADEPLNKAVNLTRPGQGHPLLEQHSLSTLKDNVSIMAISNDGDIAGVALNGILYGNTDIEKSREKLNEIQDESFKKIFKLLYEQNLKINLFKQFDVDKIFEIRILSVDSRFRGKGLAKKLIEKSEELALDRGFQVMKTDATGAFSQRVVSSLGFITKCEINYTDYLDENGEQIFVVDPPHEKLKIMCKVIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords arylalkylamine N-Acetyltransferase 2
publication title Evolution of insect arylalkylamine N-acetyltransferases: structural evidence from the yellow fever mosquito, Aedes aegypti.
pubmed doi rcsb
source organism Aedes aegypti
total genus 73
structure length 218
sequence length 218
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4fd6A00
5CNPA 1MJAA 4JWPA 2FXFA 1S60A 4Y49C 1XE4A 3BLNA 2PR8A 3R95A 5C82A 5J8FA 1GHEA 4B5PA 3T9YA 1B6BA 4NXYA 2VQYA 1XIXA 2QECA 2FCKA 3BJ8A 4CAVA 5HH1A 5KTCA 1WK4A 2OB0A 2OZGA 2EVNA 4UA3A 2NMTA 5ISVA 5KTDA 3CXSA 4BMHA 3R9GA 1QSMA 2OH1A 1QSTA 1ON0A 3TFYA 4H6UA 3QB8A 4HNWB 1YR0A 4FD4A 4KOTA 4NEXA 3DSBA 2Q44A 2B4DA 2FIWA 4YFJA 2PRBA 3I3GA 1M1DA 4FD6A 1YLEA 4CRZB 2Z11A 2VI7A 3GKRA 2JLMA 1KUVA 3FIXA 2G0BA 2OZHA 3D2MA 2VZZA 4H6ZA 4II9A 3FB3A 1P0HA 4NCZA 3EO4A 2HV2A 4LX9A 5IB0A 4HNYB 1VKCA 3SHPA 4KVXA 1J4JA 3VWEA 4XPDB 4Y49B 2Q7BA 3EC4A 3S6GA 1QSNA 2Q4VA 1YVOA 3JVNA 2PC1A 4NSQA 5HMNA 2ARHA 3I9SA 5F49A 1Q2CA 2BUEA 4X5KA 4DNCA 5EBVA 4PSWA 4PSXA 1N71A 1MJ9A 2AJ6A 5H84A 2RC4A 4AG7A 3DDDA 3PGPA 3G8WA 4MJ8A 3TO7A 3GYAA 4FD5A 1U6MA 1YGHA 3VWDA 1IYLA 3D8PA 3R9FA 4HNXB 3RYOA 4UWIA 2HQYA 3P2FA 4AVCA 5IX3A 2GANA 3CXQA 4NF1A 4KZTA 2B4BA 3FXTA 4XPKA 2QIRA 2R1IA 4AVAA 2BSWA 1S3ZA 4F0YA 2FT0A 4J3GA 2J8MA 1Z4EA 2G3TA 1Q2DA 3TOBA 4R57A 3S6HA 2P6EA 1TIQA 4JXQA 2HUZA 3FRMA 4L8AA 3TE4A 2BL1A 1S7KA 1RO5A 1IB1E 5JPHA 4F6AA 3FNCA 1I21A 4U9ZA 4M3SA 3DNSA 3IGRA 3W6SA 1R57A 5H86A 2K5TA 3JUWA 2J8RA 2F5IA 4XNHC 5F47A 2R7HA 3R96A 4KOVA 1BO4A 1QSOA 1P4NA 4MY3A 4HKFA 4ONUA 4MI4A 1NE9A 4OADA 2FS5A 2O28A 2VZYA 1KUYA 5I0CA 4KOWA 3GY9A 1CJWA 4I49A 2ATRA 4KVOE 4KOSA 4OLLA 3LODA 1M44A 1B87A 4QVTA 4U5YA 3EFAA 2CNTA 2C27A 4RI1A 2Q4YA 4KUAA 3B8GA 1WWZA 1PU9A 3F5BA 1KZFA 2AE6A 3TTHA 2Q04A 2ZW4A 4JD6A 1S7LA 4M85A 1MK4A 1M4GA 1UFHA 2G3AA 1S7FA 2FSRA 1MJBA 1IYKA 4KLWA 5J8CA 2ZW6A 4L89A 5F48A 1CM0A 3TO9A 1Z9UA 4ORFA 2Z10A 1BOBA 2WPXA 1VHSA 3D2PA 4CAXA 1LRZA 2R98A 4R9MA 4QBJA 2J8NA 4KORA 4AVBA 2PDOA 3ZJ0A 1NMTA 3F0AA 4K30A 4LUAA 2EUIA 4IF5A 3F8KA 3WR7A 2PR1A 1YVKA 3PZJA 4MY0A 4PK3A 2ZXVA 1FY7A 4XPLA 4QC6A 5C88A 2VEZA 4QB9A 4H89A 2ZW7A 4ZBGA 3R1KA 3IWGA 3ZZIA 4PK2A 4YGOA 2GIVA 2QMLA 3NE7A 3EY5A 4IUSA 1Z4RA 1M4IA 4XPDC 1L0CA 4KLVA 5FVJA 1YX0A 2PSWA 2Y0MA 1IICA 1KUXA 3SXOA 2B5GB 2VXKA 3W6XA 4R87A 4YRHA 4E8OA 3C26A 4JLYA 4OAEA 3LD2A 5GCNA 2A4NA 1S7NA 2REFA 2CY2A 4B5OA 2JDDA 1RXTA 3QAHA 1SQHA 1OZPA 4R3LA 2B58A 2REEA 2I79A 4EVYA 1M4DA 3S6KA 1IIDA 4FD7A 1Y7RA 2D4PA 1XMTA 2FIAA 1PUAA 2CNMA 2KCWA 3TCVA 4JXRA 3KKWA 2ZW5A 2PQ8A 1XEBA 2P6GA 4KOUA 5KTAA 3CXPA 5IV0A 5DWMA 2P6FA 3DR8A 4AG9A 2X7BA 2FE7A 3EXNA 1Y9KA 2B3VA 4PV6A 4GS4A 4KUBA 4B5PB 3D3SA 1QSRA 4E0AA 1YREA 4MBUA 3V8IA 3TT2A 2VBQA 3FBUA 2CNSA 5EC4A 3R9EA 2R8VA 1I1DA 2WPWA 4KOXA 3E0KA 2GE3A 3UY5A 5JQ4A 1YK3A 2Z0ZA 2DXQA 4AB7A 1I12A 2JEVA 4JJXA 2OU2A 1XF8A 2JDCA 3K9UA 5F46A 3MGDA 2H5MA 3S6FA 4CRYB 3SXNA 3G3SA 3FYNA 2B4DB 4KOYA 5E96A 3TO6A 4CAWA 4UBRA 4KVME 4XNHB 3TOAA 4MHDA 1V0CA 2FL4A 2IL4A 1Y9WA 3N7ZA 5DWNA 2B5GA 1Q2YA 3DR6A 3H4QA 3P2HA 2D4OA 3W91A 1NSLA 1S5KA 4E2AA 4U9YA 2ZPAA 4RS2A 2BEIA 4QUSA 3T90A 2OZUA 3BJ7A 4R3KA 2Q0YA 3PP9A 2I00A 1K4JA 2B3UA 4UWJA 4CS0B 3OWCA 2P0WA
chains in the Genus database with same CATH superfamily
1Z8TA 2AFXA 5CNPA 1MJAA 4JWPA 2FXFA 1S60A 4C2XA 4ZY1A 4Y49C 1X10A 1XE4A 4R76A 4OMEA 3BLNA 2PR8A 3GIUA 3PBBA 2XEJA 3R95A 4B10A 4ZGYB 3I1UA 2Q7SA 2CTCA 1LOKA 5C82A 4MFLA 2AFWA 5J8FA 1ZLHA 4UF4A 3JTKA 1ZLIA 4UEEA 1CG2A 1GHEA 2PJBA 4FUUA 4B5PA 3T9YA 1H8LA 1B6BA 4NXYA 4CYNA 2VQYA 1XIXA 2QECA 2FCKA 3BJ8A 4CAVA 5HH1A 2Z3LA 5JM6A 5KTCA 1WK4A 2OB0A 2Z3PA 2OZGA 2EVNA 2ANPA 2WSAA 4UA3A 2NMTA 4X8IA 5D29A 4R6TA 5ISVA 5KTDA 2CF4A 2PJ9A 4CGOA 4NGRA 3CXSA 4BMHA 1TKFA 3NA6A 3R9GA 3KI9A 2AFSA 1QSMA 4P44A 1FNOA 2PJ6A 2OH1A 1QSTA 2PIZA 2PVVA 3WC6A 1ON0A 5AG7A 4ZY2A 3TFYA 3IEHA 4H6UA 3QB8A 4HNWB 3KL9A 1PYTB 1TKJA 1Y0RA 2O53A 5K8NA 1YR0A 5F09A 4FD4A 4KOTA 4MFZA 1X12A 4EFDA 4JYWA 4NEXA 2I3CA 3DSBA 3SI2A 2Q44A 4CAEA 3L2NA 2C1CA 2B4DA 1Z2LA 2FIWA 2WYRA 3D7GA 2CTBA 2ZEFA 2PRBA 3PB9X 3RZAA 4YFJA 4A31A 4W9YA 3I3GA 1M1DA 4FD6A 3VH9A 1YLEA 5LRJA 3FEEA 4CRZB 2Z11A 2VI7A 2Z3OA 3GKRA 2JLMA 4FBEA 2JBKA 4M6GA 4OC3A 5K8PA 2NYQA 4Q38A 1KUVA 3FIXA 2G0BA 4P10A 3D68A 2OZHA 3MN8A 3D2MA 2VZZA 2WUUA 3PB8X 4H6ZA 4II9A 3BXMA 5D8NA 4MCRA 1Z8XA 4P4JA 3FB3A 1BPMA 1P0HA 4NCZA 5K8MA 3PFEA 3FEDA 3PFOA 3EO4A 2HV2A 4LX9A 3D7FA 5IB0A 5A27A 2PJ1A 4HNYB 1VKCA 2ZELA 4KVXA 3SHPA 2GLJA 3D66A 3PB7X 4MCQA 2XEGA 3GB0A 1J4JA 2QVPA 4UFXA 3VWEA 4CYOA 1CP7A 4XPDB 2AFOA 4Y49B 3EC4A 2Q7BA 1BPNA 4OKOA 2PJ3A 2YNCC 3S6GA 2Z3KA 1QSNA 2Q4VA 1YVOA 5BWAB 3JVNA 2PC1A 4NSQA 4OC4A 4F9UA 1AUGA 5HMNA 2ARHA 3I9SA 5F49A 1Q2CA 2BUEA 5LYIA 4X5KA 4DNCA 5EBVA 4PSWA 1TXRA 4PSXA 4ZYQA 4LQGA 1LAMA 1N71A 2PJ4A 1MJ9A 3IWWA 2C6PA 2AFUA 2AJ6A 1PCAA 2RC4A 1IOIA 2YNDA 5H84A 4AG7A 3DDDA 4CGLA 1GYTA 3PGPA 1BAVA 1CP6A 3G8WA 2DPSA 4A30A 3B3TA 4ZY0A 4P4DA 3IFEA 4MJ8A 3TO7A 3GYAA 4NGSA 3V7ZA 2Q43A 4FD5A 3BHXA 2F8HA 1U6MA 2PIYA 5AG6A 1YGHA 3VWDA 2VL1A 3CT9A 1IYLA 2EO8A 3D8PA 4B6ZA 1Y7EA 2XEFA 4K3NA 4HNXB 3R9FA 3NH4A 2HQYA 4MRIA 4UWIA 3RYOA 4IK2A 3WC7A 3P2FA 4AVCA 1YW6A 3LWUA 1YMEA 5IX3A 2GANA 3NFZA 2ZEMA 2YNCA 3PB4X 4NJQA 3CXQA 4NF1A 4KZTA 4UIAA 2B4BA 4EVYA 4KSAA 4R7MA 3FXTA 4NGTA 4XPKA 4Z65A 2ZOGA 2PJ2A 1KWMA 2QIRA 2R1IA 4AVAA 2BSWA 1S3ZA 4F0YA 2FT0A 4J3GA 2J8MA 1Z4EA 4PPZA 2G3TA 3IU1A 1Q2DA 3TOBA 4A32A 1IGBA 4R57A 2P6EA 4YU9A 3S6HA 1TIQA 2C6CA 4P45A 3S9MA 4JXQA 4F9VA 1VGYA 2HUZA 3WC5A 3FRMA 4L8AA 3TE4A 2BL1A 3QAYA 4P4EA 1S7KA 4GXHA 5THWA 4Q36A 2HC9A 3KZWA 4IAVA 4ZX8A 1RO5A 5A28A 3MRUA 2ZEEA 1IB1E 5G20A 5JPHA 3PEIA 4X2TA 4A95A 1LFWA 3B7IA 4F6AA 2JBJA 3FNCA 1IOFA 1I21A 4M3SA 4U9ZA 5G22A 5JGFA 1CPSA 3DNSA 4OIDA 3IGRA 1CBXA 3D67A 3W6SA 3FVLA 2Z3NA 2ZEPA 1R57A 4OC0A 3K2KA 1ARMA 2OR4A 5H86A 4OP4A 1HDUA 2K5TA 3JUWA 3RNZA 2J8RA 2F5IA 4X3RA 4C68A 4XNHC 4BINA 5F47A 2R7HA 3FMCA 3R96A 5IB9A 4KOVA 1BO4A 1QSOA 4GM5A 4FAIA 1ZG7A 3WT4A 1Z8LA 1R3NA 1P4NA 4MY3A 4UCMA 4NGMA 2GFQA 3IJ3A 4HKFA 4A38A 2XEIA 4FWUA 4BD9A 4ONUA 2GREA 7CPAA 3ISZA 4F8ZA 2GU2A 2AFZA 5AGEA 3PB6X 3B3SA 4MI4A 1NE9A 1LANA 1TF9A 1XOVA 4OADA 3NH8A 1EE3P 4RN7A 5HVFA 4RUHA 5HVGA 3CDXA 2EK8A 2FS5A 3DGVA 3KGQA 2DEAA 2Z3MA 2O28A 2VZYA 1KUYA 5I0CA 4KSIA 2IQ6A 4KOWA 3TC8A 4CAFA 1DTDA 8CPAA 3GY9A 4A33A 1CJWA 4I49A 2ATRA 2PJCA 3CPXA 4JZ0A 4KOSA 4KVOE 1YQEA 3LODA 4OLLA 4NGNA 4MHPA 1M44A 2BOAA 1B87A 1XBUA 1ELLP 5J1QA 4UEFA 4QVTA 5LRKA 4U5YA 1R43A 4TNUA 3EFAA 1ZO0A 1M4LA 2C27A 2CNTA 2FVGA 3PBEA 4RI1A 2EWBA 3B3VA 2PVWA 2RB7A 2Q4YA 4KUAA 1Q7LA 3B8GA 3BI0A 1WWZA 3FJUA 1PU9A 4UCPA 3F5BA 1KZFA 2QJ8A 2PJ8A 3VARA 2AE6A 1RTQA 4PXEA 2O4HA 2Q04A 3TTHA 4CYQA 5JH9A 2ZW4A 3B3WA 4JD6A 1S7LA 4M85A 4OC2A 1MK4A 2ABZA 1M4GA 1UFHA 2QYVA 4ZX9A 3CPAA 1JWQA 2G3AA 1S7FA 2FSRA 1MJBA 4BBHA 1CPXA 1IYKA 4KLWA 1CX8A 4KSFA 3KR4A 5J8CA 2ZW6A 4DUKA 3B3CA 3D4UA 2RFHA 1YW4A 4L89A 5F48A 1CM0A 1TKHA 3KQXA 3JRUA 5G1ZA 4MFKA 1XJOA 3SI0A 3TO9A 1Z9UA 4LQ6A 4ORFA 2Z10A 3NH5A 4A2ZA 3KHXA 1BOBA 5CBMA 2WPXA 4MMOA 3RAMA 1VHSA 3B2YA 3D2PA 3FF3A 5CPAA 4CAXA 1LRZA 2R98A 1YLOA 4R9MA 4CYPA 4QBJA 2J8NA 4AXVA 4KORA 3WABA 2NSMA 3FH4A 2PDOA 3ZJ0A 4AVBA 4OC5A 1NMTA 3F0AA 1XFOA 3KHZA 4NGQA 3SJFA 4K30A 4LUAA 2EUIA 3GLJA 4A94A 4IF5A 4PXBA 3H8EA 3T8WA 1NSAA 1YSJA 3F8KA 4UCNA 3WR7A 2PR1A 2PRQA 2V8HA 2WZNA 1YVKA 3PZJA 4MY0A 4PK3A 1XRYA 4NFRA 2ZXVA 1FY7A 4MFQA 1HEEA 4B12A 4XPLA 4QC6A 6CPAA 5DS0A 5C88A 1Z5RA 2CIJA 2VEZA 4QB9A 4A39A 4P4BA 2Q4ZA 4H89A 4MXUA 2C6GA 1QQ9A 2ZW7A 5HXDA 4ZBGA 3IC1A 3R1KA 3IO1A 1AMPA 3IWGA 4R8FA 4PXDA 1ELMP 3ZZIA 1XMBA 1VIXA 3QNVA 4PXCA 4MCPA 2PJAA 4PK2A 2GIVA 2QMLA 4YGOA 3NE7A 4ONWA 3EY5A 3H8FA 3IU2A 4IUSA 1Z4RA 5ELYA 4H2KA 1M4IA 4XPDC 1L0CA 2YGWA 4KLVA 5FVJA 1YX0A 3H8GA 4ZI6A 3N5FA 3LACA 3D7HA 4DJLA 1ZG9A 3S9NA 2ZEGA 4MFPA 2PSWA 4C2ZA 1TF8A 2Y0MA 1IICA 1KUXA 1VHOA 1IY7A 4O23A 3SXOA 2B5GB 2VXKA 3W6XA 4R87A 5HVHA 4YRHA 4E8OA 3C26A 4JLYA 2BO9A 3BI1A 4OAEA 4UFWA 1HDQA 3LD2A 4CGNA 5GCNA 2A4NA 2ZEOA 1S7NA 2REFA 4A37A 2CY2A 5LYLA 4M6IA 4B5OA 3VATA 2JDDA 1RXTA 3QAHA 3FECA 1SQHA 1F2PA 1FT7A 4MFJA 1OZPA 4R3LA 3SJXA 2IJZA 2B58A 3D7DA 2REEA 4PQAA 4CPAA 2I79A 4G1PA 3HUVA 1M4DA 3LMSA 4UEZA 2V8DA 3NE8A 4UIBA 1IIDA 3ISXA 3S6KA 4CGPA 5K8OA 4FD7A 1LCPA 4KS9A 1Y7RA 2D4PA 1XMTA 2FIAA 1PUAA 2CNMA 2KCWA 3TCVA 3B35A 4JXRA 1F57A 2GLFA 3GUXA 4MHZA 3HLPA 4MCSA 3KKWA 4MHYA 2ZW5A 2PQ8A 5AG4A 1Y0YA 4M6HA 4C7HA 1XEBA 4C2YA 3DLJA 2F7VA 2P6GA 4KOUA 5KTAA 3CXPA 5IV0A 5DWMA 2AFMA 2P6FA 3DR8A 4OC1A 4AG9A 2X7BA 2FE7A 2EBJA 3EXNA 1Y9KA 2B3VA 4PV6A 3KASA 4GS4A 4KUBA 1ARLA 4YWYA 3PRTA 4P6YA 4B5PB 1VHEA 3D3SA 1QSRA 5G21A 2OOTA 4E0AA 1YREA 2J9AA 4MBUA 4HPSA 3V8IA 5AG5A 1QMUA 3TT2A 2VBQA 3FBUA 2HB6A 2CNSA 2IMOA 4P4IA 5EC4A 1AYEA 3R9EA 2R8VA 2V8VA 1I1DA 4CGMA 2Q51A 2WPWA 4KOXA 3E0KA 4IHMA 2GE3A 3UY5A 4C7IA 3A9LA 4UFVA 3KR5A 5JQ4A 1UWYA 4TWEA 1YK3A 3IIBA 2Z0ZA 2DXQA 5LYDA 3TX8A 3CZXA 4AB7A 1I12A 2JEVA 4JJXA 2OU2A 1XF8A 2JDCA 2JEWA 3FX6A 3SJGA 1BLLE 1F2OA 3K9TA 3K9UA 5F46A 3MGDA 2H5MA 5LRGA 3RO0A 3S6FA 4P4FA 3SJEA 4CRYB 2V77A 1LAPA 4WJBA 1ZG8A 2PJ0A 3SXNA 3G3SA 2POKA 3FYNA 3RBUA 2B4DB 4KOYA 5E96A 3TO6A 3V38A 4CAWA 3KQZA 4UBRA 4KVME 4WWVA 4XNHB 4EMEA 2V8GA 2ZENA 3TOAA 1Z8WA 1V0CA 2FL4A 1IU8A 2IL4A 4MHDA 1Y9WA 2G9DA 2PCUA 3N7ZA 3SI1A 1JQGA 2ZEHA 5LYFA 2CXAA 2PJ7A 5DWNA 2B5GA 1Q2YA 3DR6A 2PJ5A 3H4QA 3H5ZA 3P2HA 2D4OA 3W91A 1A2ZA 2ZEDA 1S5KA 1NSLA 4E2AA 4U9YA 2ZPAA 1DE4C 4RS2A 2BEIA 4NGPA 4MHNA 4DYOA 5I4MA 4QUSA 4Q7AA 3T90A 2OZUA 3BJ7A 4EWTA 2ODFA 4R3KA 4B13A 2EK9A 2PE3A 2Q0YA 3IWEA 2DF5A 3S9LA 4F0XA 3PP9A 2YNEA 2ZOFA 2BCOA 2I00A 1K4JA 2DPTA 1OBRA 2B3UA 4OIWA 5EMIA 4B14A 4NJRA 4UWJA 4CS0B 3OWCA 2P0WA 4B11A
chains in the Genus database with same CATH topology
5CNPA 1MJAA 4JWPA 2FXFA 1S60A 4C2XA 4Y49C 1XE4A 3BLNA 2PR8A 3R95A 4B10A 4ZGYB 5C82A 4MFLA 5J8FA 3JTKA 1GHEA 4B5PA 3T9YA 1B6BA 4NXYA 4CYNA 2VQYA 1XIXA 2QECA 2FCKA 3BJ8A 4CAVA 5HH1A 2Z3LA 5KTCA 1WK4A 2OB0A 2Z3PA 2OZGA 2EVNA 2WSAA 4UA3A 2NMTA 5ISVA 5KTDA 4CGOA 3CXSA 4BMHA 3R9GA 1QSMA 2OH1A 1QSTA 1ON0A 5AG7A 3TFYA 4H6UA 3QB8A 4HNWB 1YR0A 4FD4A 4KOTA 4MFZA 4NEXA 3DSBA 2Q44A 4CAEA 2B4DA 2FIWA 4YFJA 2PRBA 4A31A 3I3GA 1M1DA 4FD6A 1YLEA 4CRZB 2Z11A 2VI7A 2Z3OA 3GKRA 2JLMA 4Q38A 1KUVA 3FIXA 2G0BA 2OZHA 3D2MA 2VZZA 2WUUA 4H6ZA 4II9A 3FB3A 1P0HA 4NCZA 3EO4A 2HV2A 4LX9A 5IB0A 5A27A 4HNYB 1VKCA 3SHPA 4KVXA 1J4JA 4UFXA 3VWEA 4CYOA 4XPDB 4Y49B 2Q7BA 3EC4A 2YNCC 3S6GA 2Z3KA 1QSNA 2Q4VA 1YVOA 5BWAB 3JVNA 2PC1A 4NSQA 5HMNA 2ARHA 3I9SA 5F49A 1Q2CA 2BUEA 4X5KA 4DNCA 5EBVA 4PSWA 4PSXA 1N71A 1MJ9A 2AJ6A 5H84A 2RC4A 2YNDA 4CGLA 4AG7A 3DDDA 3PGPA 3G8WA 2DPSA 4A30A 4MJ8A 3TO7A 3GYAA 4FD5A 1U6MA 5AG6A 1YGHA 3VWDA 1IYLA 3D8PA 3R9FA 4HNXB 3RYOA 4UWIA 2HQYA 3P2FA 4AVCA 5IX3A 2GANA 2YNCA 3CXQA 4NF1A 4KZTA 2B4BA 4KSAA 3FXTA 4XPKA 2QIRA 2R1IA 4AVAA 2BSWA 1S3ZA 4F0YA 2FT0A 4J3GA 2J8MA 1Z4EA 2G3TA 3IU1A 1Q2DA 3TOBA 4A32A 4R57A 3S6HA 2P6EA 1TIQA 4JXQA 2HUZA 3FRMA 4L8AA 3TE4A 2BL1A 1S7KA 4Q36A 1RO5A 5A28A 5G20A 1IB1E 5JPHA 4A95A 4F6AA 3FNCA 1I21A 4U9ZA 4M3SA 5G22A 3DNSA 3IGRA 3W6SA 2Z3NA 1R57A 5H86A 2K5TA 3JUWA 2J8RA 2F5IA 4C68A 4XNHC 5F47A 2R7HA 3R96A 4KOVA 1BO4A 1QSOA 1P4NA 4MY3A 4UCMA 4HKFA 4ONUA 5AGEA 4MI4A 1NE9A 4OADA 2FS5A 2Z3MA 2O28A 2VZYA 1KUYA 5I0CA 4KOWA 4CAFA 3GY9A 4A33A 1CJWA 4I49A 2ATRA 4KVOE 4KOSA 4OLLA 3LODA 1M44A 1B87A 4QVTA 4U5YA 3EFAA 1ZO0A 2CNTA 2C27A 4RI1A 2Q4YA 4KUAA 3B8GA 1WWZA 1PU9A 4UCPA 3F5BA 1KZFA 2AE6A 3TTHA 4CYQA 2Q04A 2ZW4A 4JD6A 1S7LA 4M85A 1MK4A 1M4GA 1UFHA 2G3AA 1S7FA 2FSRA 1MJBA 4BBHA 1IYKA 4KLWA 4KSFA 5J8CA 2ZW6A 4L89A 5F48A 1CM0A 5G1ZA 4MFKA 3TO9A 4A2ZA 1Z9UA 4ORFA 2Z10A 1BOBA 2WPXA 1VHSA 3D2PA 4CAXA 1LRZA 2R98A 4R9MA 4CYPA 4QBJA 2J8NA 4KORA 4AVBA 2PDOA 3ZJ0A 1NMTA 3F0AA 4K30A 4LUAA 2EUIA 4IF5A 4UCNA 3F8KA 3WR7A 2PR1A 1YVKA 3PZJA 4MY0A 4PK3A 2ZXVA 1FY7A 4MFQA 4B12A 4XPLA 4QC6A 5C88A 2VEZA 4QB9A 4H89A 2ZW7A 4ZBGA 3R1KA 3IWGA 3ZZIA 4PK2A 4YGOA 2GIVA 2QMLA 3NE7A 3EY5A 4IUSA 3IU2A 1Z4RA 1M4IA 4XPDC 1L0CA 2YGWA 4KLVA 5FVJA 1YX0A 4MFPA 2PSWA 4C2ZA 2Y0MA 1IICA 1KUXA 3SXOA 2B5GB 2VXKA 3W6XA 4R87A 4YRHA 4E8OA 3C26A 4JLYA 4CGNA 4OAEA 4UFWA 3LD2A 5GCNA 2A4NA 1S7NA 2REFA 2CY2A 4B5OA 2JDDA 1RXTA 3QAHA 1SQHA 4MFJA 1OZPA 4R3LA 2B58A 2REEA 2I79A 4EVYA 1M4DA 3S6KA 4CGPA 1IIDA 4FD7A 4KS9A 1Y7RA 2D4PA 1XMTA 2FIAA 1PUAA 2CNMA 2KCWA 3TCVA 4JXRA 3KKWA 2ZW5A 2PQ8A 5AG4A 4C7HA 1XEBA 4C2YA 2P6GA 4KOUA 5KTAA 3CXPA 5IV0A 5DWMA 2P6FA 3DR8A 4AG9A 2X7BA 2FE7A 3EXNA 1Y9KA 2B3VA 4PV6A 4GS4A 4KUBA 4B5PB 3D3SA 1QSRA 5G21A 4E0AA 1YREA 4MBUA 3V8IA 5AG5A 3TT2A 2VBQA 3FBUA 2CNSA 5EC4A 3R9EA 2R8VA 1I1DA 4CGMA 2WPWA 4KOXA 3E0KA 2GE3A 3UY5A 4C7IA 3A9LA 4UFVA 5JQ4A 1YK3A 2Z0ZA 2DXQA 4AB7A 1I12A 2JEVA 4JJXA 2OU2A 1XF8A 2JDCA 3K9UA 5F46A 3MGDA 2H5MA 3S6FA 4CRYB 3SXNA 3G3SA 3FYNA 2B4DB 4KOYA 5E96A 3TO6A 4CAWA 4UBRA 4KVME 4XNHB 3TOAA 4MHDA 1V0CA 2FL4A 2IL4A 1Y9WA 3N7ZA 2CXAA 5DWNA 2B5GA 1Q2YA 3DR6A 3H4QA 3H5ZA 3P2HA 2D4OA 3W91A 1NSLA 1S5KA 4E2AA 4U9YA 2ZPAA 4RS2A 2BEIA 4QUSA 3T90A 2OZUA 3BJ7A 4R3KA 4B13A 2Q0YA 3IWEA 4F0XA 3PP9A 2YNEA 2I00A 1K4JA 2DPTA 2B3UA 4B14A 4UWJA 4CS0B 3OWCA 2P0WA 4B11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CNP A;  1MJA A;  4JWP A;  2FXF A;  1S60 A;  4Y49 C;  1XE4 A;  3BLN A;  2PR8 A;  3R95 A;  5C82 A;  5J8F A;  1GHE A;  4B5P A;  3T9Y A;  1B6B A;  4NXY A;  2VQY A;  1XIX A;  2QEC A;  2FCK A;  3BJ8 A;  4CAV A;  5HH1 A;  5KTC A;  1WK4 A;  2OB0 A;  2OZG A;  2EVN A;  4UA3 A;  2NMT A;  5ISV A;  5KTD A;  3CXS A;  4BMH A;  3R9G A;  1QSM A;  2OH1 A;  1QST A;  1ON0 A;  3TFY A;  4H6U A;  3QB8 A;  4HNW B;  1YR0 A;  4FD4 A;  4KOT A;  4NEX A;  3DSB A;  2Q44 A;  2B4D A;  2FIW A;  4YFJ A;  2PRB A;  3I3G A;  1M1D A;  4FD6 A;  1YLE A;  4CRZ B;  2Z11 A;  2VI7 A;  3GKR A;  2JLM A;  1KUV A;  3FIX A;  2G0B A;  2OZH A;  3D2M A;  2VZZ A;  4H6Z A;  4II9 A;  3FB3 A;  1P0H A;  4NCZ A;  3EO4 A;  2HV2 A;  4LX9 A;  5IB0 A;  4HNY B;  1VKC A;  3SHP A;  4KVX A;  1J4J A;  3VWE A;  4XPD B;  4Y49 B;  2Q7B A;  3EC4 A;  3S6G A;  1QSN A;  2Q4V A;  1YVO A;  3JVN A;  2PC1 A;  4NSQ A;  5HMN A;  2ARH A;  3I9S A;  5F49 A;  1Q2C A;  2BUE A;  4X5K A;  4DNC A;  5EBV A;  4PSW A;  4PSX A;  1N71 A;  1MJ9 A;  2AJ6 A;  5H84 A;  2RC4 A;  4AG7 A;  3DDD A;  3PGP A;  3G8W A;  4MJ8 A;  3TO7 A;  3GYA A;  4FD5 A;  1U6M A;  1YGH A;  3VWD A;  1IYL A;  3D8P A;  3R9F A;  4HNX B;  3RYO A;  4UWI A;  2HQY A;  3P2F A;  4AVC A;  5IX3 A;  2GAN A;  3CXQ A;  4NF1 A;  4KZT A;  2B4B A;  3FXT A;  4XPK A;  2QIR A;  2R1I A;  4AVA A;  2BSW A;  1S3Z A;  4F0Y A;  2FT0 A;  4J3G A;  2J8M A;  1Z4E A;  2G3T A;  1Q2D A;  3TOB A;  4R57 A;  3S6H A;  2P6E A;  1TIQ A;  4JXQ A;  2HUZ A;  3FRM A;  4L8A A;  3TE4 A;  2BL1 A;  1S7K A;  1RO5 A;  1IB1 E;  5JPH A;  4F6A A;  3FNC A;  1I21 A;  4U9Z A;  4M3S A;  3DNS A;  3IGR A;  3W6S A;  1R57 A;  5H86 A;  2K5T A;  3JUW A;  2J8R A;  2F5I A;  4XNH C;  5F47 A;  2R7H A;  3R96 A;  4KOV A;  1BO4 A;  1QSO A;  1P4N A;  4MY3 A;  4HKF A;  4ONU A;  4MI4 A;  1NE9 A;  4OAD A;  2FS5 A;  2O28 A;  2VZY A;  1KUY A;  5I0C A;  4KOW A;  3GY9 A;  1CJW A;  4I49 A;  2ATR A;  4KVO E;  4KOS A;  4OLL A;  3LOD A;  1M44 A;  1B87 A;  4QVT A;  4U5Y A;  3EFA A;  2CNT A;  2C27 A;  4RI1 A;  2Q4Y A;  4KUA A;  3B8G A;  1WWZ A;  1PU9 A;  3F5B A;  1KZF A;  2AE6 A;  3TTH A;  2Q04 A;  2ZW4 A;  4JD6 A;  1S7L A;  4M85 A;  1MK4 A;  1M4G A;  1UFH A;  2G3A A;  1S7F A;  2FSR A;  1MJB A;  1IYK A;  4KLW A;  5J8C A;  2ZW6 A;  4L89 A;  5F48 A;  1CM0 A;  3TO9 A;  1Z9U A;  4ORF A;  2Z10 A;  1BOB A;  2WPX A;  1VHS A;  3D2P A;  4CAX A;  1LRZ A;  2R98 A;  4R9M A;  4QBJ A;  2J8N A;  4KOR A;  4AVB A;  2PDO A;  3ZJ0 A;  1NMT A;  3F0A A;  4K30 A;  4LUA A;  2EUI A;  4IF5 A;  3F8K A;  3WR7 A;  2PR1 A;  1YVK A;  3PZJ A;  4MY0 A;  4PK3 A;  2ZXV A;  1FY7 A;  4XPL A;  4QC6 A;  5C88 A;  2VEZ A;  4QB9 A;  4H89 A;  2ZW7 A;  4ZBG A;  3R1K A;  3IWG A;  3ZZI A;  4PK2 A;  4YGO A;  2GIV A;  2QML A;  3NE7 A;  3EY5 A;  4IUS A;  1Z4R A;  1M4I A;  4XPD C;  1L0C A;  4KLV A;  5FVJ A;  1YX0 A;  2PSW A;  2Y0M A;  1IIC A;  1KUX A;  3SXO A;  2B5G B;  2VXK A;  3W6X A;  4R87 A;  4YRH A;  4E8O A;  3C26 A;  4JLY A;  4OAE A;  3LD2 A;  5GCN A;  2A4N A;  1S7N A;  2REF A;  2CY2 A;  4B5O A;  2JDD A;  1RXT A;  3QAH A;  1SQH A;  1OZP A;  4R3L A;  2B58 A;  2REE A;  2I79 A;  4EVY A;  1M4D A;  3S6K A;  1IID A;  4FD7 A;  1Y7R A;  2D4P A;  1XMT A;  2FIA A;  1PUA A;  2CNM A;  2KCW A;  3TCV A;  4JXR A;  3KKW A;  2ZW5 A;  2PQ8 A;  1XEB A;  2P6G A;  4KOU A;  5KTA A;  3CXP A;  5IV0 A;  5DWM A;  2P6F A;  3DR8 A;  4AG9 A;  2X7B A;  2FE7 A;  3EXN A;  1Y9K A;  2B3V A;  4PV6 A;  4GS4 A;  4KUB A;  4B5P B;  3D3S A;  1QSR A;  4E0A A;  1YRE A;  4MBU A;  3V8I A;  3TT2 A;  2VBQ A;  3FBU A;  2CNS A;  5EC4 A;  3R9E A;  2R8V A;  1I1D A;  2WPW A;  4KOX A;  3E0K A;  2GE3 A;  3UY5 A;  5JQ4 A;  1YK3 A;  2Z0Z A;  2DXQ A;  4AB7 A;  1I12 A;  2JEV A;  4JJX A;  2OU2 A;  1XF8 A;  2JDC A;  3K9U A;  5F46 A;  3MGD A;  2H5M A;  3S6F A;  4CRY B;  3SXN A;  3G3S A;  3FYN A;  2B4D B;  4KOY A;  5E96 A;  3TO6 A;  4CAW A;  4UBR A;  4KVM E;  4XNH B;  3TOA A;  4MHD A;  1V0C A;  2FL4 A;  2IL4 A;  1Y9W A;  3N7Z A;  5DWN A;  2B5G A;  1Q2Y A;  3DR6 A;  3H4Q A;  3P2H A;  2D4O A;  3W91 A;  1NSL A;  1S5K A;  4E2A A;  4U9Y A;  2ZPA A;  4RS2 A;  2BEI A;  4QUS A;  3T90 A;  2OZU A;  3BJ7 A;  4R3K A;  2Q0Y A;  3PP9 A;  2I00 A;  1K4J A;  2B3U A;  4UWJ A;  4CS0 B;  3OWC A;  2P0W A; 
#chains in the Genus database with same CATH topology
 1Z8T A;  2AFX A;  5CNP A;  1MJA A;  4JWP A;  2FXF A;  1S60 A;  4C2X A;  4ZY1 A;  4Y49 C;  1X10 A;  1XE4 A;  4R76 A;  4OME A;  3BLN A;  2PR8 A;  3GIU A;  3PBB A;  2XEJ A;  3R95 A;  4B10 A;  4ZGY B;  3I1U A;  2Q7S A;  2CTC A;  1LOK A;  5C82 A;  4MFL A;  2AFW A;  5J8F A;  1ZLH A;  4UF4 A;  3JTK A;  1ZLI A;  4UEE A;  1CG2 A;  1GHE A;  2PJB A;  4FUU A;  4B5P A;  3T9Y A;  1H8L A;  1B6B A;  4NXY A;  4CYN A;  2VQY A;  1XIX A;  2QEC A;  2FCK A;  3BJ8 A;  4CAV A;  5HH1 A;  2Z3L A;  5JM6 A;  5KTC A;  1WK4 A;  2OB0 A;  2Z3P A;  2OZG A;  2EVN A;  2ANP A;  2WSA A;  4UA3 A;  2NMT A;  4X8I A;  5D29 A;  4R6T A;  5ISV A;  5KTD A;  2CF4 A;  2PJ9 A;  4CGO A;  4NGR A;  3CXS A;  4BMH A;  1TKF A;  3NA6 A;  3R9G A;  3KI9 A;  2AFS A;  1QSM A;  4P44 A;  1FNO A;  2PJ6 A;  2OH1 A;  1QST A;  2PIZ A;  2PVV A;  3WC6 A;  1ON0 A;  5AG7 A;  4ZY2 A;  3TFY A;  3IEH A;  4H6U A;  3QB8 A;  4HNW B;  3KL9 A;  1PYT B;  1TKJ A;  1Y0R A;  2O53 A;  5K8N A;  1YR0 A;  5F09 A;  4FD4 A;  4KOT A;  4MFZ A;  1X12 A;  4EFD A;  4JYW A;  4NEX A;  2I3C A;  3DSB A;  3SI2 A;  2Q44 A;  4CAE A;  3L2N A;  2C1C A;  2B4D A;  1Z2L A;  2FIW A;  2WYR A;  3D7G A;  2CTB A;  2ZEF A;  2PRB A;  3PB9 X;  3RZA A;  4YFJ A;  4A31 A;  4W9Y A;  3I3G A;  1M1D A;  4FD6 A;  3VH9 A;  1YLE A;  5LRJ A;  3FEE A;  4CRZ B;  2Z11 A;  2VI7 A;  2Z3O A;  3GKR A;  2JLM A;  4FBE A;  2JBK A;  4M6G A;  4OC3 A;  5K8P A;  2NYQ A;  4Q38 A;  1KUV A;  3FIX A;  2G0B A;  4P10 A;  3D68 A;  2OZH A;  3MN8 A;  3D2M A;  2VZZ A;  2WUU A;  3PB8 X;  4H6Z A;  4II9 A;  3BXM A;  5D8N A;  4MCR A;  1Z8X A;  4P4J A;  3FB3 A;  1BPM A;  1P0H A;  4NCZ A;  5K8M A;  3PFE A;  3FED A;  3PFO A;  3EO4 A;  2HV2 A;  4LX9 A;  3D7F A;  5IB0 A;  5A27 A;  2PJ1 A;  4HNY B;  1VKC A;  2ZEL A;  4KVX A;  3SHP A;  2GLJ A;  3D66 A;  3PB7 X;  4MCQ A;  2XEG A;  3GB0 A;  1J4J A;  2QVP A;  4UFX A;  3VWE A;  4CYO A;  1CP7 A;  4XPD B;  2AFO A;  4Y49 B;  3EC4 A;  2Q7B A;  1BPN A;  4OKO A;  2PJ3 A;  2YNC C;  3S6G A;  2Z3K A;  1QSN A;  2Q4V A;  1YVO A;  5BWA B;  3JVN A;  2PC1 A;  4NSQ A;  4OC4 A;  4F9U A;  1AUG A;  5HMN A;  2ARH A;  3I9S A;  5F49 A;  1Q2C A;  2BUE A;  5LYI A;  4X5K A;  4DNC A;  5EBV A;  4PSW A;  1TXR A;  4PSX A;  4ZYQ A;  4LQG A;  1LAM A;  1N71 A;  2PJ4 A;  1MJ9 A;  3IWW A;  2C6P A;  2AFU A;  2AJ6 A;  1PCA A;  2RC4 A;  1IOI A;  2YND A;  5H84 A;  4AG7 A;  3DDD A;  4CGL A;  1GYT A;  3PGP A;  1BAV A;  1CP6 A;  3G8W A;  2DPS A;  4A30 A;  3B3T A;  4ZY0 A;  4P4D A;  3IFE A;  4MJ8 A;  3TO7 A;  3GYA A;  4NGS A;  3V7Z A;  2Q43 A;  4FD5 A;  3BHX A;  2F8H A;  1U6M A;  2PIY A;  5AG6 A;  1YGH A;  3VWD A;  2VL1 A;  3CT9 A;  1IYL A;  2EO8 A;  3D8P A;  4B6Z A;  1Y7E A;  2XEF A;  4K3N A;  4HNX B;  3R9F A;  3NH4 A;  2HQY A;  4MRI A;  4UWI A;  3RYO A;  4IK2 A;  3WC7 A;  3P2F A;  4AVC A;  1YW6 A;  3LWU A;  1YME A;  5IX3 A;  2GAN A;  3NFZ A;  2ZEM A;  2YNC A;  3PB4 X;  4NJQ A;  3CXQ A;  4NF1 A;  4KZT A;  4UIA A;  2B4B A;  4EVY A;  4KSA A;  4R7M A;  3FXT A;  4NGT A;  4XPK A;  4Z65 A;  2ZOG A;  2PJ2 A;  1KWM A;  2QIR A;  2R1I A;  4AVA A;  2BSW A;  1S3Z A;  4F0Y A;  2FT0 A;  4J3G A;  2J8M A;  1Z4E A;  4PPZ A;  2G3T A;  3IU1 A;  1Q2D A;  3TOB A;  4A32 A;  1IGB A;  4R57 A;  2P6E A;  4YU9 A;  3S6H A;  1TIQ A;  2C6C A;  4P45 A;  3S9M A;  4JXQ A;  4F9V A;  1VGY A;  2HUZ A;  3WC5 A;  3FRM A;  4L8A A;  3TE4 A;  2BL1 A;  3QAY A;  4P4E A;  1S7K A;  4GXH A;  5THW A;  4Q36 A;  2HC9 A;  3KZW A;  4IAV A;  4ZX8 A;  1RO5 A;  5A28 A;  3MRU A;  2ZEE A;  1IB1 E;  5G20 A;  5JPH A;  3PEI A;  4X2T A;  4A95 A;  1LFW A;  3B7I A;  4F6A A;  2JBJ A;  3FNC A;  1IOF A;  1I21 A;  4M3S A;  4U9Z A;  5G22 A;  5JGF A;  1CPS A;  3DNS A;  4OID A;  3IGR A;  1CBX A;  3D67 A;  3W6S A;  3FVL A;  2Z3N A;  2ZEP A;  1R57 A;  4OC0 A;  3K2K A;  1ARM A;  2OR4 A;  5H86 A;  4OP4 A;  1HDU A;  2K5T A;  3JUW A;  3RNZ A;  2J8R A;  2F5I A;  4X3R A;  4C68 A;  4XNH C;  4BIN A;  5F47 A;  2R7H A;  3FMC A;  3R96 A;  5IB9 A;  4KOV A;  1BO4 A;  1QSO A;  4GM5 A;  4FAI A;  1ZG7 A;  3WT4 A;  1Z8L A;  1R3N A;  1P4N A;  4MY3 A;  4UCM A;  4NGM A;  2GFQ A;  3IJ3 A;  4HKF A;  4A38 A;  2XEI A;  4FWU A;  4BD9 A;  4ONU A;  2GRE A;  7CPA A;  3ISZ A;  4F8Z A;  2GU2 A;  2AFZ A;  5AGE A;  3PB6 X;  3B3S A;  4MI4 A;  1NE9 A;  1LAN A;  1TF9 A;  1XOV A;  4OAD A;  3NH8 A;  1EE3 P;  4RN7 A;  5HVF A;  4RUH A;  5HVG A;  3CDX A;  2EK8 A;  2FS5 A;  3DGV A;  3KGQ A;  2DEA A;  2Z3M A;  2O28 A;  2VZY A;  1KUY A;  5I0C A;  4KSI A;  2IQ6 A;  4KOW A;  3TC8 A;  4CAF A;  1DTD A;  8CPA A;  3GY9 A;  4A33 A;  1CJW A;  4I49 A;  2ATR A;  2PJC A;  3CPX A;  4JZ0 A;  4KOS A;  4KVO E;  1YQE A;  3LOD A;  4OLL A;  4NGN A;  4MHP A;  1M44 A;  2BOA A;  1B87 A;  1XBU A;  1ELL P;  5J1Q A;  4UEF A;  4QVT A;  5LRK A;  4U5Y A;  1R43 A;  4TNU A;  3EFA A;  1ZO0 A;  1M4L A;  2C27 A;  2CNT A;  2FVG A;  3PBE A;  4RI1 A;  2EWB A;  3B3V A;  2PVW A;  2RB7 A;  2Q4Y A;  4KUA A;  1Q7L A;  3B8G A;  3BI0 A;  1WWZ A;  3FJU A;  1PU9 A;  4UCP A;  3F5B A;  1KZF A;  2QJ8 A;  2PJ8 A;  3VAR A;  2AE6 A;  1RTQ A;  4PXE A;  2O4H A;  2Q04 A;  3TTH A;  4CYQ A;  5JH9 A;  2ZW4 A;  3B3W A;  4JD6 A;  1S7L A;  4M85 A;  4OC2 A;  1MK4 A;  2ABZ A;  1M4G A;  1UFH A;  2QYV A;  4ZX9 A;  3CPA A;  1JWQ A;  2G3A A;  1S7F A;  2FSR A;  1MJB A;  4BBH A;  1CPX A;  1IYK A;  4KLW A;  1CX8 A;  4KSF A;  3KR4 A;  5J8C A;  2ZW6 A;  4DUK A;  3B3C A;  3D4U A;  2RFH A;  1YW4 A;  4L89 A;  5F48 A;  1CM0 A;  1TKH A;  3KQX A;  3JRU A;  5G1Z A;  4MFK A;  1XJO A;  3SI0 A;  3TO9 A;  1Z9U A;  4LQ6 A;  4ORF A;  2Z10 A;  3NH5 A;  4A2Z A;  3KHX A;  1BOB A;  5CBM A;  2WPX A;  4MMO A;  3RAM A;  1VHS A;  3B2Y A;  3D2P A;  3FF3 A;  5CPA A;  4CAX A;  1LRZ A;  2R98 A;  1YLO A;  4R9M A;  4CYP A;  4QBJ A;  2J8N A;  4AXV A;  4KOR A;  3WAB A;  2NSM A;  3FH4 A;  2PDO A;  3ZJ0 A;  4AVB A;  4OC5 A;  1NMT A;  3F0A A;  1XFO A;  3KHZ A;  4NGQ A;  3SJF A;  4K30 A;  4LUA A;  2EUI A;  3GLJ A;  4A94 A;  4IF5 A;  4PXB A;  3H8E A;  3T8W A;  1NSA A;  1YSJ A;  3F8K A;  4UCN A;  3WR7 A;  2PR1 A;  2PRQ A;  2V8H A;  2WZN A;  1YVK A;  3PZJ A;  4MY0 A;  4PK3 A;  1XRY A;  4NFR A;  2ZXV A;  1FY7 A;  4MFQ A;  1HEE A;  4B12 A;  4XPL A;  4QC6 A;  6CPA A;  5DS0 A;  5C88 A;  1Z5R A;  2CIJ A;  2VEZ A;  4QB9 A;  4A39 A;  4P4B A;  2Q4Z A;  4H89 A;  4MXU A;  2C6G A;  1QQ9 A;  2ZW7 A;  5HXD A;  4ZBG A;  3IC1 A;  3R1K A;  3IO1 A;  1AMP A;  3IWG A;  4R8F A;  4PXD A;  1ELM P;  3ZZI A;  1XMB A;  1VIX A;  3QNV A;  4PXC A;  4MCP A;  2PJA A;  4PK2 A;  2GIV A;  2QML A;  4YGO A;  3NE7 A;  4ONW A;  3EY5 A;  3H8F A;  3IU2 A;  4IUS A;  1Z4R A;  5ELY A;  4H2K A;  1M4I A;  4XPD C;  1L0C A;  2YGW A;  4KLV A;  5FVJ A;  1YX0 A;  3H8G A;  4ZI6 A;  3N5F A;  3LAC A;  3D7H A;  4DJL A;  1ZG9 A;  3S9N A;  2ZEG A;  4MFP A;  2PSW A;  4C2Z A;  1TF8 A;  2Y0M A;  1IIC A;  1KUX A;  1VHO A;  1IY7 A;  4O23 A;  3SXO A;  2B5G B;  2VXK A;  3W6X A;  4R87 A;  5HVH A;  4YRH A;  4E8O A;  3C26 A;  4JLY A;  2BO9 A;  3BI1 A;  4OAE A;  4UFW A;  1HDQ A;  3LD2 A;  4CGN A;  5GCN A;  2A4N A;  2ZEO A;  1S7N A;  2REF A;  4A37 A;  2CY2 A;  5LYL A;  4M6I A;  4B5O A;  3VAT A;  2JDD A;  1RXT A;  3QAH A;  3FEC A;  1SQH A;  1F2P A;  1FT7 A;  4MFJ A;  1OZP A;  4R3L A;  3SJX A;  2IJZ A;  2B58 A;  3D7D A;  2REE A;  4PQA A;  4CPA A;  2I79 A;  4G1P A;  3HUV A;  1M4D A;  3LMS A;  4UEZ A;  2V8D A;  3NE8 A;  4UIB A;  1IID A;  3ISX A;  3S6K A;  4CGP A;  5K8O A;  4FD7 A;  1LCP A;  4KS9 A;  1Y7R A;  2D4P A;  1XMT A;  2FIA A;  1PUA A;  2CNM A;  2KCW A;  3TCV A;  3B35 A;  4JXR A;  1F57 A;  2GLF A;  3GUX A;  4MHZ A;  3HLP A;  4MCS A;  3KKW A;  4MHY A;  2ZW5 A;  2PQ8 A;  5AG4 A;  1Y0Y A;  4M6H A;  4C7H A;  1XEB A;  4C2Y A;  3DLJ A;  2F7V A;  2P6G A;  4KOU A;  5KTA A;  3CXP A;  5IV0 A;  5DWM A;  2AFM A;  2P6F A;  3DR8 A;  4OC1 A;  4AG9 A;  2X7B A;  2FE7 A;  2EBJ A;  3EXN A;  1Y9K A;  2B3V A;  4PV6 A;  3KAS A;  4GS4 A;  4KUB A;  1ARL A;  4YWY A;  3PRT A;  4P6Y A;  4B5P B;  1VHE A;  3D3S A;  1QSR A;  5G21 A;  2OOT A;  4E0A A;  1YRE A;  2J9A A;  4MBU A;  4HPS A;  3V8I A;  5AG5 A;  1QMU A;  3TT2 A;  2VBQ A;  3FBU A;  2HB6 A;  2CNS A;  2IMO A;  4P4I A;  5EC4 A;  1AYE A;  3R9E A;  2R8V A;  2V8V A;  1I1D A;  4CGM A;  2Q51 A;  2WPW A;  4KOX A;  3E0K A;  4IHM A;  2GE3 A;  3UY5 A;  4C7I A;  3A9L A;  4UFV A;  3KR5 A;  5JQ4 A;  1UWY A;  4TWE A;  1YK3 A;  3IIB A;  2Z0Z A;  2DXQ A;  5LYD A;  3TX8 A;  3CZX A;  4AB7 A;  1I12 A;  2JEV A;  4JJX A;  2OU2 A;  1XF8 A;  2JDC A;  2JEW A;  3FX6 A;  3SJG A;  1BLL E;  1F2O A;  3K9T A;  3K9U A;  5F46 A;  3MGD A;  2H5M A;  5LRG A;  3RO0 A;  3S6F A;  4P4F A;  3SJE A;  4CRY B;  2V77 A;  1LAP A;  4WJB A;  1ZG8 A;  2PJ0 A;  3SXN A;  3G3S A;  2POK A;  3FYN A;  3RBU A;  2B4D B;  4KOY A;  5E96 A;  3TO6 A;  3V38 A;  4CAW A;  3KQZ A;  4UBR A;  4KVM E;  4WWV A;  4XNH B;  4EME A;  2V8G A;  2ZEN A;  3TOA A;  1Z8W A;  1V0C A;  2FL4 A;  1IU8 A;  2IL4 A;  4MHD A;  1Y9W A;  2G9D A;  2PCU A;  3N7Z A;  3SI1 A;  1JQG A;  2ZEH A;  5LYF A;  2CXA A;  2PJ7 A;  5DWN A;  2B5G A;  1Q2Y A;  3DR6 A;  2PJ5 A;  3H4Q A;  3H5Z A;  3P2H A;  2D4O A;  3W91 A;  1A2Z A;  2ZED A;  1S5K A;  1NSL A;  4E2A A;  4U9Y A;  2ZPA A;  1DE4 C;  4RS2 A;  2BEI A;  4NGP A;  4MHN A;  4DYO A;  5I4M A;  4QUS A;  4Q7A A;  3T90 A;  2OZU A;  3BJ7 A;  4EWT A;  2ODF A;  4R3K A;  4B13 A;  2EK9 A;  2PE3 A;  2Q0Y A;  3IWE A;  2DF5 A;  3S9L A;  4F0X A;  3PP9 A;  2YNE A;  2ZOF A;  2BCO A;  2I00 A;  1K4J A;  2DPT A;  1OBR A;  2B3U A;  4OIW A;  5EMI A;  4B14 A;  4NJR A;  4UWJ A;  4CS0 B;  3OWC A;  2P0W A;  4B11 A; 
#chains in the Genus database with same CATH homology
 5CNP A;  1MJA A;  4JWP A;  2FXF A;  1S60 A;  4C2X A;  4Y49 C;  1XE4 A;  3BLN A;  2PR8 A;  3R95 A;  4B10 A;  4ZGY B;  5C82 A;  4MFL A;  5J8F A;  3JTK A;  1GHE A;  4B5P A;  3T9Y A;  1B6B A;  4NXY A;  4CYN A;  2VQY A;  1XIX A;  2QEC A;  2FCK A;  3BJ8 A;  4CAV A;  5HH1 A;  2Z3L A;  5KTC A;  1WK4 A;  2OB0 A;  2Z3P A;  2OZG A;  2EVN A;  2WSA A;  4UA3 A;  2NMT A;  5ISV A;  5KTD A;  4CGO A;  3CXS A;  4BMH A;  3R9G A;  1QSM A;  2OH1 A;  1QST A;  1ON0 A;  5AG7 A;  3TFY A;  4H6U A;  3QB8 A;  4HNW B;  1YR0 A;  4FD4 A;  4KOT A;  4MFZ A;  4NEX A;  3DSB A;  2Q44 A;  4CAE A;  2B4D A;  2FIW A;  4YFJ A;  2PRB A;  4A31 A;  3I3G A;  1M1D A;  4FD6 A;  1YLE A;  4CRZ B;  2Z11 A;  2VI7 A;  2Z3O A;  3GKR A;  2JLM A;  4Q38 A;  1KUV A;  3FIX A;  2G0B A;  2OZH A;  3D2M A;  2VZZ A;  2WUU A;  4H6Z A;  4II9 A;  3FB3 A;  1P0H A;  4NCZ A;  3EO4 A;  2HV2 A;  4LX9 A;  5IB0 A;  5A27 A;  4HNY B;  1VKC A;  3SHP A;  4KVX A;  1J4J A;  4UFX A;  3VWE A;  4CYO A;  4XPD B;  4Y49 B;  2Q7B A;  3EC4 A;  2YNC C;  3S6G A;  2Z3K A;  1QSN A;  2Q4V A;  1YVO A;  5BWA B;  3JVN A;  2PC1 A;  4NSQ A;  5HMN A;  2ARH A;  3I9S A;  5F49 A;  1Q2C A;  2BUE A;  4X5K A;  4DNC A;  5EBV A;  4PSW A;  4PSX A;  1N71 A;  1MJ9 A;  2AJ6 A;  5H84 A;  2RC4 A;  2YND A;  4CGL A;  4AG7 A;  3DDD A;  3PGP A;  3G8W A;  2DPS A;  4A30 A;  4MJ8 A;  3TO7 A;  3GYA A;  4FD5 A;  1U6M A;  5AG6 A;  1YGH A;  3VWD A;  1IYL A;  3D8P A;  3R9F A;  4HNX B;  3RYO A;  4UWI A;  2HQY A;  3P2F A;  4AVC A;  5IX3 A;  2GAN A;  2YNC A;  3CXQ A;  4NF1 A;  4KZT A;  2B4B A;  4KSA A;  3FXT A;  4XPK A;  2QIR A;  2R1I A;  4AVA A;  2BSW A;  1S3Z A;  4F0Y A;  2FT0 A;  4J3G A;  2J8M A;  1Z4E A;  2G3T A;  3IU1 A;  1Q2D A;  3TOB A;  4A32 A;  4R57 A;  3S6H A;  2P6E A;  1TIQ A;  4JXQ A;  2HUZ A;  3FRM A;  4L8A A;  3TE4 A;  2BL1 A;  1S7K A;  4Q36 A;  1RO5 A;  5A28 A;  5G20 A;  1IB1 E;  5JPH A;  4A95 A;  4F6A A;  3FNC A;  1I21 A;  4U9Z A;  4M3S A;  5G22 A;  3DNS A;  3IGR A;  3W6S A;  2Z3N A;  1R57 A;  5H86 A;  2K5T A;  3JUW A;  2J8R A;  2F5I A;  4C68 A;  4XNH C;  5F47 A;  2R7H A;  3R96 A;  4KOV A;  1BO4 A;  1QSO A;  1P4N A;  4MY3 A;  4UCM A;  4HKF A;  4ONU A;  5AGE A;  4MI4 A;  1NE9 A;  4OAD A;  2FS5 A;  2Z3M A;  2O28 A;  2VZY A;  1KUY A;  5I0C A;  4KOW A;  4CAF A;  3GY9 A;  4A33 A;  1CJW A;  4I49 A;  2ATR A;  4KVO E;  4KOS A;  4OLL A;  3LOD A;  1M44 A;  1B87 A;  4QVT A;  4U5Y A;  3EFA A;  1ZO0 A;  2CNT A;  2C27 A;  4RI1 A;  2Q4Y A;  4KUA A;  3B8G A;  1WWZ A;  1PU9 A;  4UCP A;  3F5B A;  1KZF A;  2AE6 A;  3TTH A;  4CYQ A;  2Q04 A;  2ZW4 A;  4JD6 A;  1S7L A;  4M85 A;  1MK4 A;  1M4G A;  1UFH A;  2G3A A;  1S7F A;  2FSR A;  1MJB A;  4BBH A;  1IYK A;  4KLW A;  4KSF A;  5J8C A;  2ZW6 A;  4L89 A;  5F48 A;  1CM0 A;  5G1Z A;  4MFK A;  3TO9 A;  4A2Z A;  1Z9U A;  4ORF A;  2Z10 A;  1BOB A;  2WPX A;  1VHS A;  3D2P A;  4CAX A;  1LRZ A;  2R98 A;  4R9M A;  4CYP A;  4QBJ A;  2J8N A;  4KOR A;  4AVB A;  2PDO A;  3ZJ0 A;  1NMT A;  3F0A A;  4K30 A;  4LUA A;  2EUI A;  4IF5 A;  4UCN A;  3F8K A;  3WR7 A;  2PR1 A;  1YVK A;  3PZJ A;  4MY0 A;  4PK3 A;  2ZXV A;  1FY7 A;  4MFQ A;  4B12 A;  4XPL A;  4QC6 A;  5C88 A;  2VEZ A;  4QB9 A;  4H89 A;  2ZW7 A;  4ZBG A;  3R1K A;  3IWG A;  3ZZI A;  4PK2 A;  4YGO A;  2GIV A;  2QML A;  3NE7 A;  3EY5 A;  4IUS A;  3IU2 A;  1Z4R A;  1M4I A;  4XPD C;  1L0C A;  2YGW A;  4KLV A;  5FVJ A;  1YX0 A;  4MFP A;  2PSW A;  4C2Z A;  2Y0M A;  1IIC A;  1KUX A;  3SXO A;  2B5G B;  2VXK A;  3W6X A;  4R87 A;  4YRH A;  4E8O A;  3C26 A;  4JLY A;  4CGN A;  4OAE A;  4UFW A;  3LD2 A;  5GCN A;  2A4N A;  1S7N A;  2REF A;  2CY2 A;  4B5O A;  2JDD A;  1RXT A;  3QAH A;  1SQH A;  4MFJ A;  1OZP A;  4R3L A;  2B58 A;  2REE A;  2I79 A;  4EVY A;  1M4D A;  3S6K A;  4CGP A;  1IID A;  4FD7 A;  4KS9 A;  1Y7R A;  2D4P A;  1XMT A;  2FIA A;  1PUA A;  2CNM A;  2KCW A;  3TCV A;  4JXR A;  3KKW A;  2ZW5 A;  2PQ8 A;  5AG4 A;  4C7H A;  1XEB A;  4C2Y A;  2P6G A;  4KOU A;  5KTA A;  3CXP A;  5IV0 A;  5DWM A;  2P6F A;  3DR8 A;  4AG9 A;  2X7B A;  2FE7 A;  3EXN A;  1Y9K A;  2B3V A;  4PV6 A;  4GS4 A;  4KUB A;  4B5P B;  3D3S A;  1QSR A;  5G21 A;  4E0A A;  1YRE A;  4MBU A;  3V8I A;  5AG5 A;  3TT2 A;  2VBQ A;  3FBU A;  2CNS A;  5EC4 A;  3R9E A;  2R8V A;  1I1D A;  4CGM A;  2WPW A;  4KOX A;  3E0K A;  2GE3 A;  3UY5 A;  4C7I A;  3A9L A;  4UFV A;  5JQ4 A;  1YK3 A;  2Z0Z A;  2DXQ A;  4AB7 A;  1I12 A;  2JEV A;  4JJX A;  2OU2 A;  1XF8 A;  2JDC A;  3K9U A;  5F46 A;  3MGD A;  2H5M A;  3S6F A;  4CRY B;  3SXN A;  3G3S A;  3FYN A;  2B4D B;  4KOY A;  5E96 A;  3TO6 A;  4CAW A;  4UBR A;  4KVM E;  4XNH B;  3TOA A;  4MHD A;  1V0C A;  2FL4 A;  2IL4 A;  1Y9W A;  3N7Z A;  2CXA A;  5DWN A;  2B5G A;  1Q2Y A;  3DR6 A;  3H4Q A;  3H5Z A;  3P2H A;  2D4O A;  3W91 A;  1NSL A;  1S5K A;  4E2A A;  4U9Y A;  2ZPA A;  4RS2 A;  2BEI A;  4QUS A;  3T90 A;  2OZU A;  3BJ7 A;  4R3K A;  4B13 A;  2Q0Y A;  3IWE A;  4F0X A;  3PP9 A;  2YNE A;  2I00 A;  1K4J A;  2DPT A;  2B3U A;  4B14 A;  4UWJ A;  4CS0 B;  3OWC A;  2P0W A;  4B11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...