4FD6A

Crystal structure of native arylalkylamine n-acetyltransferase 2 from the yellow fever mosquito, aedes aegypti
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
218
structure length
218
Chain Sequence
KLNNIRFETISSKYYDDVIEHLRQTFFADEPLNKAVNLTRPGQGHPLLEQHSLSTLKDNVSIMAISNDGDIAGVALNGILYGNTDIEKSREKLNEIQDESFKKIFKLLYEQNLKINLFKQFDVDKIFEIRILSVDSRFRGKGLAKKLIEKSEELALDRGFQVMKTDATGAFSQRVVSSLGFITKCEINYTDYLDENGEQIFVVDPPHEKLKIMCKVIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords arylalkylamine N-Acetyltransferase 2
publication title Evolution of insect arylalkylamine N-acetyltransferases: structural evidence from the yellow fever mosquito, Aedes aegypti.
pubmed doi rcsb
source organism Aedes aegypti
molecule tags Transferase
total genus 73
structure length 218
sequence length 218
ec nomenclature ec 2.3.1.87: Aralkylamine N-acetyltransferase.
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4fd6A00
4J3GA 2CNTA 3PGPA 4PK2A 2OB0A 3QB8A 4X5KA 4UBRA 4AVBA 4KOTA 4KOVA 4R9MA 3H4QA 5IX3A 2P0WA 3PP9A 2VQYA 4PSWA 3FB3A 4KOSA 3TTHA 2D4PA 4AB7A 2B4DA 1YVKA 4UA3A 1MJBA 1VKCA 1XMTA 5IV0A 2J8NA 1IYLA 3TO6A 3TT2A 1LRZA 4KUBA 2D4OA 1M1DA 2FSRA 1Y7RA 3EY5A 5H84A 2BUEA 2J8RA 4QC6A 1P0HA 4OAEA 5J8FA 3I3GA 1Z4RA 2X7BA 3T9YA 1RO5A 4KORA 4H89A 3G8WA 5JQ4A 2JDDA 4JWPA 1P4NA 3EC4A 4IF5A 4U5YA 5KTCA 2ATRA 2PC1A 1Q2DA 3DSBA 1PU9A 4MBUA 2R98A 4YFJA 4QVTA 2F5IA 5HH1A 3R9FA 3C26A 4MHDA 1Q2CA 1KUXA 1QSTA 2IL4A 3T90A 2BSWA 2ZW5A 3DR8A 4XPLA 4RS2A 3FBUA 2OH1A 3EO4A 4ONUA 1XF8A 4DNCA 2PRBA 2G0BA 1ON0A 4KUAA 3D3SA 1S7KA 2K5TA 1UFHA 3VWEA 5DWMA 2GIVA 4CAWA 4H6UA 4KOWA 1MJ9A 4B5OA 2B5GB 2CNMA 4II9A 3SXOA 4CAXA 3TO7A 3CXPA 4I49A 4FD5A 3TFYA 2PR1A 3GY9A 2R8VA 2Y0MA 4B5PB 2OU2A 1YR0A 1YGHA 1IIDA 2P6GA 3FNCA 4L8AA 4MJ8A 2DXQA 4UWIA 5CNPA 2FE7A 3P2FA 4Y49B 4GS4A 4CS0B 3JVNA 2Q7BA 2KCWA 4KLVA 5E96A 3GYAA 4U9ZA 2GANA 2RC4A 2PSWA 4LUAA 4L89A 2REFA 4R57A 5GCNA 5EC4A 4R3KA 2VXKA 3K9UA 3F0AA 3NE7A 4RI1A 4YGOA 1RXTA 3IWGA 4PK3A 1Y9KA 1WK4A 3BLNA 3GKRA 4JLYA 1SQHA 1BOBA 2OZHA 4XPDC 2VZYA 3R96A 1BO4A 2FCKA 3E0KA 3OWCA 2ZW4A 2P6EA 4JXQA 2H5MA 1M4DA 1YX0A 4KOYA 2PR8A 5IB0A 3UY5A 2EVNA 4KZTA 4ZBGA 2C27A 4BMHA 4FD6A 3LD2A 3TO9A 4HNYB 3G3SA 1MK4A 4Y49C 5F48A 1OZPA 1M44A 3B8GA 1YLEA 3VWDA 3S6GA 1YVOA 2VI7A 3F5BA 4NEXA 3R95A 3MGDA 3R9EA 2ZW6A 2B4BA 2I00A 1B6BA 4AG7A 2JLMA 3EXNA 4KVME 2Q04A 2P6FA 2FIAA 4F6AA 3PZJA 2WPXA 2B3VA 2I79A 3FYNA 4CAVA 4K30A 1R57A 1L0CA 2QECA 3FXTA 1Z9UA 2ZXVA 4U9YA 1KZFA 3ZZIA 1IICA 4UWJA 1IB1E 2B3UA 4KLWA 4NCZA 2OZGA 2G3TA 2QIRA 1I12A 4NXYA 2HQYA 3JUWA 4HNXB 3ZJ0A 2WPWA 4LX9A 1Z4EA 2Z10A 4XNHB 4PV6A 4R87A 2B5GA 3TOBA 1J4JA 4KVXA 3WR7A 2ARHA 4QBJA 1S3ZA 1B87A 4IUSA 2FIWA 3SHPA 1Q2YA 2Q4YA 1M4GA 4B5PA 2FL4A 2Z0ZA 2FS5A 1IYKA 4NSQA 4FD4A 4AVAA 4QUSA 4NF1A 3R9GA 5J8CA 4JD6A 4OLLA 2J8MA 2HUZA 3W6XA 4EVYA 1V0CA 2JDCA 2B4DB 4ORFA 4JXRA 1XIXA 3P2HA 1YK3A 4M85A 2Q44A 1QSNA 4E0AA 5JPHA 3W6SA 4XNHC 3V8IA 2Q4VA 4JJXA 4M3SA 2CY2A 5FVJA 2OZUA 3IGRA 3FIXA 4YRHA 5ISVA 1CM0A 2AJ6A 3F8KA 1VHSA 3S6HA 3N7ZA 3I9SA 2FT0A 4E8OA 3CXSA 3LODA 1S7LA 2ZW7A 5HMNA 2NMTA 4HKFA 2R1IA 3TCVA 4AG9A 1I21A 1I1DA 1N71A 5H86A 5C88A 3DDDA 4PSXA 2G3AA 5F47A 4KVOE 2HV2A 2BL1A 1MJAA 2VBQA 1K4JA 2O28A 1GHEA 2Z11A 2JEVA 4FD7A 1PUAA 4KOUA 2PQ8A 5DWNA 3BJ8A 1S5KA 5F46A 3BJ7A 1NMTA 4OADA 4QB9A 2FXFA 1XEBA 3D2PA 1S60A 2VZZA 3TE4A 1M4IA 1TIQA 4E2AA 1U6MA 5KTAA 4MY3A 3S6KA 1NE9A 1QSRA 1KUVA 1XE4A 2Q0YA 3DR6A 3FRMA 1QSOA 4AVCA 3S6FA 1S7FA 1S7NA 5EBVA 4MI4A 3D2MA 4F0YA 4MY0A 4HNWB 3CXQA 2PDOA 2AE6A 2VEZA 4H6ZA 4CRZB 2EUIA 2B58A 3SXNA 2CNSA 1KUYA 4KOXA 1NSLA 1Y9WA 1CJWA 5KTDA 2GE3A 3TOAA 3DNSA 4XPKA 2REEA 2R7HA 4XPDB 3RYOA 2QMLA 3QAHA 2ZPAA 1FY7A 5I0CA 5C82A 3R1KA 3KKWA 5F49A 2A4NA 1YREA 3D8PA 3W91A 3EFAA 1QSMA 4CRYB 4R3LA 1WWZA 2BEIA
chains in the Genus database with same CATH superfamily
4J3GA 2POKA 2ABZA 2CNTA 3PGPA 4PK2A 4PXEA 4X2TA 2OB0A 3QB8A 4A32A 4X5KA 4UBRA 2GU2A 3WC7A 2DPSA 1NSAA 1CPXA 1JWQA 4AVBA 4KOTA 3PBBA 4KOVA 4A37A 2YNEA 3D68A 2QVPA 2ZENA 4CGLA 2EK8A 5HVFA 5THWA 4R9MA 3TC8A 3H4QA 2F7VA 4F9UA 5IX3A 8CPAA 4PPZA 2P0WA 4P10A 5K8PA 3PP9A 2VQYA 4PSWA 3FB3A 3D67A 2FVGA 3PBEA 4UIAA 4MHNA 4KOSA 3TTHA 2D4PA 1CG2A 2B4DA 4AB7A 1YVKA 4UA3A 1MJBA 1VKCA 1XMTA 1Y0RA 5IV0A 2J8NA 1IU8A 4A31A 1IYLA 1Z8LA 4OP4A 3JTKA 3TO6A 3TT2A 1XMBA 1BPMA 4A30A 2PJ2A 2AFSA 4OMEA 3FX6A 3B3SA 1VHEA 5G22A 1XOVA 2PIYA 1LRZA 4CAFA 4KUBA 2D4OA 3SI0A 2PVWA 1M1DA 4OC0A 2FSRA 3LACA 4ZGYB 1Y7RA 3GIUA 3EY5A 2ZEPA 5H84A 3ISZA 2BUEA 2J8RA 4QC6A 2DEAA 1P0HA 3B3VA 4OAEA 5J8FA 3I3GA 5AG4A 1Z4RA 2X7BA 3T9YA 1RO5A 5K8NA 4KORA 1ELLP 2C1CA 2F8HA 4H89A 4ONWA 4P4JA 3G8WA 4TNUA 5F09A 2CTCA 5LRJA 2IMOA 3FEDA 4ZI6A 5JQ4A 4B13A 2JDDA 3V38A 4JWPA 4P4DA 1P4NA 4NGMA 3EC4A 4IF5A 4U5YA 5KTCA 4IK2A 1VHOA 1YLOA 4F9VA 2ATRA 2PC1A 1HDUA 2AFZA 1Q2DA 4DUKA 3DSBA 1PU9A 4MBUA 2R98A 2PJ5A 2PCUA 4YFJA 4LQGA 3KQXA 3T8WA 4QVTA 3HLPA 2F5IA 5G21A 5HH1A 1YMEA 2C6GA 3R9FA 4B14A 2PJ9A 3C26A 4MHDA 1Q2CA 1ZLHA 1KUXA 1QSTA 2HB6A 3L2NA 5AGEA 4ZY1A 2IL4A 3QAYA 2PJCA 1UWYA 3T90A 2BSWA 2ZW5A 2OR4A 3DR8A 3PB8X 5BWAB 1F57A 1HEEA 4RS2A 4XPLA 3FBUA 2OH1A 3EO4A 4ONUA 1M4LA 1XF8A 4H2KA 4CAEA 2PRBA 4DNCA 5LRKA 7CPAA 2G0BA 1ON0A 4FWUA 4KUAA 3D3SA 1S7KA 2K5TA 2AFOA 1UFHA 4UFXA 5DWMA 3VWEA 5HVGA 4Q7AA 4MMOA 2GIVA 1VGYA 2GLFA 5LRGA 4H6UA 1LAMA 4KOWA 3SJGA 4CAWA 1MJ9A 3NFZA 4B5OA 3DGVA 2B5GB 2CNMA 6CPAA 4II9A 5CBMA 3KZWA 4Q38A 4OC2A 4WWVA 3SXOA 3TO7A 4CAXA 4CYNA 2XEJA 4ZY0A 3PB6X 3B3CA 2PJ6A 4PXBA 3KQZA 5EMIA 3CXPA 4A38A 4I49A 4FD5A 4P44A 4OC3A 4C2YA 1IOIA 3TFYA 2PR1A 2ZELA 3GY9A 3NA6A 2R8VA 2Y0MA 1QMUA 1Z8WA 2BOAA 4P4BA 1JQGA 2OU2A 4ZY2A 4B5PB 1XBUA 2PRQA 1YR0A 4UFWA 4KSIA 2BCOA 3B3TA 5ELYA 4UF4A 1YGHA 1IIDA 2P6GA 4B12A 1YSJA 3FNCA 3MN8A 4L8AA 4MJ8A 2GLJA 2JBKA 4NGPA 2DXQA 4UWIA 5CNPA 2C6PA 2FE7A 3P2FA 4Y49B 3IU2A 3SJEA 4GS4A 4C7IA 4Z65A 2Z3NA 4P4IA 4CS0B 3JVNA 2AFWA 2Q7BA 2KCWA 3K2KA 2Q51A 3B35A 4W9YA 4KLVA 4FAIA 2XEGA 5E96A 1QQ9A 3GYAA 4U9ZA 2GANA 2RC4A 2IQ6A 2PSWA 1LOKA 2O53A 2WZNA 4LUAA 1AUGA 2CIJA 4UCPA 5G20A 4L89A 2REFA 3NH8A 4MCRA 1FT7A 1DTDA 2Q43A 4R57A 4A33A 2ZEDA 5GCNA 5EC4A 1TXRA 1ZLIA 4R3KA 4UFVA 2VXKA 3K9UA 3BXMA 4OC5A 3F0AA 3CDXA 3NE7A 4RI1A 4OKOA 1ZG7A 1BAVA 4EFDA 4YGOA 1LCPA 1RXTA 3KL9A 3PRTA 3IWGA 1CP7A 3RO0A 4OC4A 4PK3A 1Y9KA 1WK4A 1F2PA 1LAPA 2CXAA 3BLNA 3GKRA 4JLYA 1SQHA 1R43A 1BOBA 3NE8A 2OZHA 4CYPA 5A28A 4A95A 4MFZA 4MXUA 4XPDC 4Q36A 4BBHA 1F2OA 2VZYA 2DF5A 3R96A 1BO4A 2FCKA 3E0KA 3OWCA 4JYWA 5JM6A 3D66A 2AFUA 3IO1A 4EWTA 2ZW4A 2P6EA 1GYTA 4WJBA 4JXQA 2H5MA 4A94A 5CPAA 4UCNA 1M4DA 1IY7A 4MFLA 3KGQA 4K3NA 1YX0A 5D29A 4KOYA 4DYOA 2PR8A 5IB0A 3UY5A 2EVNA 4KZTA 4NGQA 4ZBGA 4A2ZA 2Z3PA 2WYRA 2C27A 1ZO0A 4FD6A 3LD2A 3TO9A 4BMHA 2ZEFA 3B3WA 4HNYB 3G3SA 4P45A 4CGPA 1ZG8A 1MK4A 4Y49C 1AYEA 5F48A 1OZPA 2PJ0A 3IFEA 1M44A 3B8GA 5AG7A 2IJZA 2YNCC 1YLEA 3VWDA 3S6GA 4ZX8A 3KASA 1TKFA 4ZX9A 1YVOA 4NJRA 4O23A 2V8HA 2VI7A 3F5BA 3K9TA 4G1PA 2EWBA 4NEXA 4C68A 3R95A 3MGDA 2ANPA 3R9EA 2ZW6A 2B4BA 2ZEOA 3D4UA 1ZG9A 5HXDA 1CPSA 2I00A 1B6BA 4MCQA 2ZEHA 4NGRA 2JLMA 4X3RA 3V7ZA 3EXNA 4AG7A 4UCMA 2CF4A 4YU9A 1Z2LA 4KVME 5A27A 4NJQA 1Y7EA 2Q04A 2J9AA 2FIAA 2P6FA 4F6AA 2PJ7A 1H8LA 3PZJA 4IHMA 2PE3A 2NSMA 4MHYA 3RBUA 3VATA 4CPAA 2WPXA 3SJXA 1PCAA 1R3NA 5G1ZA 2B3VA 2I79A 2ZEMA 3FYNA 4A39A 3IEHA 3QNVA 4CAVA 2Z3LA 4K30A 1CX8A 1L0CA 1R57A 2QECA 1Z9UA 2ZXVA 3FXTA 1KZFA 3H5ZA 3GB0A 1IICA 3PB9X 4P6YA 4U9YA 4UWJA 1IB1E 1PYTB 4F0XA 2B3UA 2Q7SA 4KLWA 4NCZA 2OZGA 2G3TA 3IIBA 2QIRA 4OC1A 4FUUA 1I12A 4NXYA 2HQYA 3I1UA 4UEEA 4MRIA 3JUWA 4HNXB 3ZJ0A 1BLLE 2WPWA 4UIBA 2GFQA 2BO9A 2Z3OA 3NH4A 1KWMA 3A9LA 2QJ8A 4MHPA 2XEFA 4LX9A 1Z4EA 4R6TA 2Z10A 3IWEA 4CGMA 4XNHB 4PV6A 3CPAA 4R87A 1XRYA 3IJ3A 1X10A 1ARLA 3ISXA 2B5GA 2WUUA 3TOBA 1J4JA 2YGWA 4KVXA 3WR7A 2ZOGA 3D7DA 1A2ZA 2PIZA 4X8IA 3LWUA 2ARHA 2PJBA 4QBJA 1S3ZA 1LFWA 1B87A 3FJUA 2ZEEA 4IUSA 2FIWA 3IC1A 3SHPA 1X12A 4CYOA 1Q2YA 5I4MA 2Q4YA 1M4GA 4B5PA 5DS0A 2FL4A 2ODFA 1Z5RA 4KS9A 3H8FA 2Z0ZA 3WABA 3GLJA 2FS5A 3CZXA 2RFHA 1IYKA 4NSQA 4PQAA 4PXDA 2I3CA 3BHXA 4PXCA 4FD4A 3VARA 4RUHA 1RTQA 1TF9A 2G9DA 1IGBA 2PVVA 3RAMA 4NGSA 4AVAA 4QUSA 5AG6A 1FNOA 4FBEA 4NF1A 4NGNA 2YNCA 3FF3A 3R9GA 4IAVA 5J8CA 4JD6A 3DLJA 4OLLA 4B11A 1AMPA 4EMEA 2J8MA 2HUZA 3W6XA 4EVYA 1V0CA 3FECA 2JDCA 3S9NA 3S9MA 4MFKA 2B4DB 4GXHA 3S9LA 1TF8A 5LYIA 2RB7A 3FEEA 4JXRA 4MFJA 3LMSA 4ORFA 4AXVA 2Z3KA 1XIXA 1Q7LA 3P2HA 2C6CA 3PB4X 2JEWA 2JBJA 3RZAA 3FMCA 2PJ1A 4OIDA 1YK3A 4JZ0A 4M85A 2Q44A 1QSNA 2CTBA 4E0AA 3SI1A 5JPHA 5K8OA 4M6GA 3FH4A 3W6SA 3MRUA 3WC6A 1Y0YA 2V8DA 4P4EA 1ELMP 3KHXA 4XNHC 3D7HA 2Q4VA 4JJXA 1BPNA 3V8IA 2CY2A 4M3SA 5FVJA 2OZUA 3IGRA 3FIXA 4YRHA 5ISVA 1CM0A 1XFOA 3GUXA 3D7GA 3BI1A 4C7HA 5JH9A 2AJ6A 2YNDA 3F8KA 4KSFA 1LANA 1VHSA 2AFXA 4M6HA 2OOTA 4CGOA 4GM5A 3S6HA 3N7ZA 2O4HA 3I9SA 2FT0A 4E8OA 3CXSA 4M6IA 4ZYQA 2NYQA 3FVLA 3LODA 4BINA 4C2ZA 2VL1A 1S7LA 2ZW7A 5IB9A 5HMNA 2NMTA 4NFRA 4HKFA 2R1IA 4B6ZA 3TCVA 1CBXA 4AG9A 1I21A 1VIXA 4R76A 1I1DA 1N71A 5H86A 5C88A 3DDDA 4PSXA 3PFOA 2AFMA 1YW6A 2G3AA 5F47A 4KVOE 2HV2A 3H8EA 1XJOA 2BL1A 5J1QA 1MJAA 2VBQA 1K4JA 2O28A 1GHEA 3CT9A 2Z11A 2QYVA 4P4FA 5JGFA 5D8NA 5LYDA 2JEVA 4FD7A 1OBRA 1PUAA 2ZEGA 4HPSA 4KOUA 2PQ8A 5DWNA 3BJ8A 1S5KA 5F46A 2PJAA 1NMTA 3BJ7A 4OADA 2EK9A 4QB9A 2FXFA 1XEBA 4DJLA 3D2PA 3PFEA 4RN7A 1S60A 2VZZA 3TE4A 2V8VA 1M4IA 1TIQA 1EE3P 4C2XA 1DE4C 4E2AA 5K8MA 1U6MA 4R7MA 5KTAA 3B7IA 1CP6A 4MY3A 1ARMA 3S6KA 3WC5A 1NE9A 2Q4ZA 1QSRA 3IU1A 1KUVA 4LQ6A 1XE4A 3JRUA 2Q0YA 3DR6A 3HUVA 3KI9A 4MCPA 3FRMA 3KR5A 1QSOA 2EO8A 2GREA 2V8GA 4AVCA 3CPXA 3S6FA 2EBJA 1S7FA 4R8FA 3WT4A 3RNZA 5HVHA 3NH5A 1S7NA 5EBVA 1IOFA 4MI4A 3D2MA 2PJ3A 2PJ4A 4KSAA 4MY0A 4YWYA 4F0YA 2XEIA 2DPTA 3ZZIA 5AG5A 3CXQA 4HNWB 2PDOA 2AE6A 2VEZA 2ZOFA 4H6ZA 4UEFA 4CRZB 2EUIA 2B58A 2PJ8A 3D7FA 3KHZA 3SXNA 2CNSA 1KUYA 3PEIA 3TX8A 4KOXA 1NSLA 1Y9WA 1CJWA 5LYLA 2HC9A 5KTDA 3B2YA 2Z3MA 2GE3A 4MHZA 4NGTA 3TOAA 1TKJA 1Z8XA 3DNSA 3SI2A 4XPKA 2REEA 2R7HA 4XPDB 3RYOA 2QMLA 4OIWA 3QAHA 4MCSA 2ZPAA 4MFPA 1TKHA 1FY7A 5I0CA 3PB7X 5C82A 3R1KA 4B10A 4BD9A 3SJFA 4CYQA 3KKWA 5F49A 2A4NA 2WSAA 3BI0A 1Z8TA 1YREA 3D8PA 1YQEA 3KR4A 4MFQA 3N5FA 4UEZA 3W91A 4TWEA 3EFAA 3IWWA 2V77A 5LYFA 1QSMA 4F8ZA 1HDQA 3VH9A 4CGNA 4CRYB 4R3LA 1YW4A 1WWZA 2BEIA 3H8GA
chains in the Genus database with same CATH topology
4J3GA 2CNTA 3PGPA 4PK2A 2OB0A 3QB8A 4A32A 4X5KA 4UBRA 2DPSA 4AVBA 4KOTA 4KOVA 2YNEA 4CGLA 4R9MA 3H4QA 5IX3A 2P0WA 3PP9A 2VQYA 4PSWA 3FB3A 4KOSA 3TTHA 2D4PA 4AB7A 2B4DA 1YVKA 4UA3A 1MJBA 1VKCA 1XMTA 5IV0A 2J8NA 4A31A 1IYLA 3JTKA 3TO6A 3TT2A 4A30A 5G22A 1LRZA 4CAFA 4KUBA 2D4OA 1M1DA 2FSRA 4ZGYB 1Y7RA 3EY5A 5H84A 2BUEA 2J8RA 4QC6A 1P0HA 4OAEA 5J8FA 3I3GA 5AG4A 1Z4RA 2X7BA 3T9YA 1RO5A 4KORA 4H89A 3G8WA 5JQ4A 4B13A 2JDDA 4JWPA 1P4NA 3EC4A 4IF5A 4U5YA 5KTCA 2ATRA 2PC1A 1Q2DA 3DSBA 1PU9A 4MBUA 2R98A 4YFJA 4QVTA 2F5IA 5G21A 5HH1A 3R9FA 4B14A 3C26A 4MHDA 1Q2CA 1KUXA 1QSTA 5AGEA 2IL4A 3T90A 2BSWA 2ZW5A 3DR8A 5BWAB 4XPLA 4RS2A 3FBUA 2OH1A 3EO4A 4ONUA 1XF8A 4CAEA 2PRBA 4DNCA 2G0BA 1ON0A 4KUAA 3D3SA 1S7KA 2K5TA 1UFHA 4UFXA 3VWEA 5DWMA 2GIVA 4CAWA 4H6UA 4KOWA 1MJ9A 4B5OA 2B5GB 2CNMA 4II9A 3SXOA 4Q38A 3TO7A 4CAXA 4CYNA 3CXPA 4I49A 4FD5A 4C2YA 3TFYA 2PR1A 3GY9A 2R8VA 2Y0MA 4B5PB 2OU2A 1YR0A 4UFWA 1YGHA 1IIDA 2P6GA 4B12A 3FNCA 4L8AA 4MJ8A 2DXQA 4UWIA 5CNPA 2FE7A 3P2FA 4Y49B 3IU2A 4GS4A 4C7IA 2Z3NA 4CS0B 3JVNA 2Q7BA 2KCWA 4KLVA 5E96A 3GYAA 4U9ZA 2GANA 2RC4A 2PSWA 4LUAA 4UCPA 5G20A 4L89A 2REFA 4A33A 4R57A 5GCNA 5EC4A 4R3KA 4UFVA 2VXKA 3K9UA 3F0AA 3NE7A 4RI1A 4YGOA 1RXTA 3IWGA 4PK3A 1Y9KA 1WK4A 2CXAA 3BLNA 3GKRA 4JLYA 1SQHA 1BOBA 2OZHA 4CYPA 5A28A 4A95A 4MFZA 4XPDC 4Q36A 4BBHA 2VZYA 3R96A 1BO4A 2FCKA 3E0KA 3OWCA 2ZW4A 2P6EA 4JXQA 2H5MA 4UCNA 1M4DA 4MFLA 1YX0A 4KOYA 2PR8A 5IB0A 3UY5A 2EVNA 4KZTA 4ZBGA 4A2ZA 2Z3PA 2C27A 1ZO0A 4FD6A 3LD2A 3TO9A 4BMHA 4HNYB 3G3SA 4CGPA 1MK4A 4Y49C 5F48A 1OZPA 1M44A 3B8GA 5AG7A 2YNCC 1YLEA 3VWDA 3S6GA 1YVOA 2VI7A 3F5BA 4NEXA 4C68A 3R95A 3MGDA 3R9EA 2ZW6A 2B4BA 2I00A 1B6BA 4AG7A 2JLMA 3EXNA 4UCMA 4KVME 5A27A 2Q04A 2P6FA 2FIAA 4F6AA 3PZJA 2WPXA 5G1ZA 2B3VA 2I79A 3FYNA 4CAVA 2Z3LA 4K30A 1R57A 1L0CA 2QECA 3FXTA 1Z9UA 2ZXVA 3H5ZA 1KZFA 4U9YA 3ZZIA 1IICA 4F0XA 4UWJA 1IB1E 2B3UA 4KLWA 4NCZA 2OZGA 2G3TA 2QIRA 1I12A 4NXYA 2HQYA 3JUWA 4HNXB 3ZJ0A 2WPWA 2Z3OA 3A9LA 4LX9A 1Z4EA 2Z10A 3IWEA 4CGMA 4XNHB 4PV6A 4R87A 2B5GA 2WUUA 3TOBA 1J4JA 2YGWA 4KVXA 3WR7A 2ARHA 4QBJA 1S3ZA 1B87A 4IUSA 2FIWA 3SHPA 4CYOA 1Q2YA 2Q4YA 1M4GA 4B5PA 2FL4A 4KS9A 2Z0ZA 2FS5A 1IYKA 4NSQA 4FD4A 4AVAA 4QUSA 5AG6A 4NF1A 2YNCA 3R9GA 5J8CA 4JD6A 4OLLA 4B11A 2J8MA 2HUZA 3W6XA 4EVYA 1V0CA 2JDCA 4MFKA 2B4DB 4ORFA 4JXRA 4MFJA 2Z3KA 1XIXA 3P2HA 1YK3A 4M85A 2Q44A 1QSNA 4E0AA 5JPHA 3W6SA 4XNHC 3V8IA 2Q4VA 4JJXA 2CY2A 4M3SA 5FVJA 2OZUA 3IGRA 3FIXA 4YRHA 5ISVA 1CM0A 4C7HA 2AJ6A 2YNDA 3F8KA 4KSFA 1VHSA 3S6HA 3N7ZA 3I9SA 2FT0A 4E8OA 3CXSA 3LODA 4C2ZA 1S7LA 2ZW7A 5HMNA 2NMTA 4HKFA 2R1IA 3TCVA 4AG9A 1I21A 1I1DA 1N71A 5H86A 5C88A 3DDDA 4PSXA 2G3AA 5F47A 4KVOE 2HV2A 2BL1A 1MJAA 2VBQA 1K4JA 2O28A 1GHEA 2Z11A 2JEVA 4FD7A 1PUAA 4KOUA 2PQ8A 5DWNA 3BJ8A 1S5KA 5F46A 3BJ7A 1NMTA 4OADA 4QB9A 2FXFA 1XEBA 3D2PA 1S60A 2VZZA 3TE4A 1M4IA 1TIQA 4C2XA 4E2AA 1U6MA 5KTAA 4MY3A 3S6KA 1NE9A 1QSRA 3IU1A 1KUVA 1XE4A 2Q0YA 3DR6A 3FRMA 1QSOA 4AVCA 3S6FA 1S7FA 1S7NA 5EBVA 4MI4A 3D2MA 4F0YA 4KSAA 4MY0A 2DPTA 5AG5A 4HNWB 3CXQA 2PDOA 2AE6A 2VEZA 4H6ZA 4CRZB 2EUIA 2B58A 3SXNA 2CNSA 1KUYA 4KOXA 1NSLA 1Y9WA 1CJWA 5KTDA 2Z3MA 2GE3A 3TOAA 3DNSA 4XPKA 2REEA 2R7HA 4XPDB 3RYOA 2QMLA 3QAHA 2ZPAA 4MFPA 1FY7A 5I0CA 5C82A 3R1KA 4B10A 4CYQA 3KKWA 5F49A 2A4NA 2WSAA 4CGOA 1YREA 3D8PA 4MFQA 3W91A 3EFAA 1QSMA 4CGNA 4CRYB 4R3LA 1WWZA 2BEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J3G A;  2CNT A;  3PGP A;  4PK2 A;  2OB0 A;  3QB8 A;  4X5K A;  4UBR A;  4AVB A;  4KOT A;  4KOV A;  4R9M A;  3H4Q A;  5IX3 A;  2P0W A;  3PP9 A;  2VQY A;  4PSW A;  3FB3 A;  4KOS A;  3TTH A;  2D4P A;  4AB7 A;  2B4D A;  1YVK A;  4UA3 A;  1MJB A;  1VKC A;  1XMT A;  5IV0 A;  2J8N A;  1IYL A;  3TO6 A;  3TT2 A;  1LRZ A;  4KUB A;  2D4O A;  1M1D A;  2FSR A;  1Y7R A;  3EY5 A;  5H84 A;  2BUE A;  2J8R A;  4QC6 A;  1P0H A;  4OAE A;  5J8F A;  3I3G A;  1Z4R A;  2X7B A;  3T9Y A;  1RO5 A;  4KOR A;  4H89 A;  3G8W A;  5JQ4 A;  2JDD A;  4JWP A;  1P4N A;  3EC4 A;  4IF5 A;  4U5Y A;  5KTC A;  2ATR A;  2PC1 A;  1Q2D A;  3DSB A;  1PU9 A;  4MBU A;  2R98 A;  4YFJ A;  4QVT A;  2F5I A;  5HH1 A;  3R9F A;  3C26 A;  4MHD A;  1Q2C A;  1KUX A;  1QST A;  2IL4 A;  3T90 A;  2BSW A;  2ZW5 A;  3DR8 A;  4XPL A;  4RS2 A;  3FBU A;  2OH1 A;  3EO4 A;  4ONU A;  1XF8 A;  4DNC A;  2PRB A;  2G0B A;  1ON0 A;  4KUA A;  3D3S A;  1S7K A;  2K5T A;  1UFH A;  3VWE A;  5DWM A;  2GIV A;  4CAW A;  4H6U A;  4KOW A;  1MJ9 A;  4B5O A;  2B5G B;  2CNM A;  4II9 A;  3SXO A;  4CAX A;  3TO7 A;  3CXP A;  4I49 A;  4FD5 A;  3TFY A;  2PR1 A;  3GY9 A;  2R8V A;  2Y0M A;  4B5P B;  2OU2 A;  1YR0 A;  1YGH A;  1IID A;  2P6G A;  3FNC A;  4L8A A;  4MJ8 A;  2DXQ A;  4UWI A;  5CNP A;  2FE7 A;  3P2F A;  4Y49 B;  4GS4 A;  4CS0 B;  3JVN A;  2Q7B A;  2KCW A;  4KLV A;  5E96 A;  3GYA A;  4U9Z A;  2GAN A;  2RC4 A;  2PSW A;  4LUA A;  4L89 A;  2REF A;  4R57 A;  5GCN A;  5EC4 A;  4R3K A;  2VXK A;  3K9U A;  3F0A A;  3NE7 A;  4RI1 A;  4YGO A;  1RXT A;  3IWG A;  4PK3 A;  1Y9K A;  1WK4 A;  3BLN A;  3GKR A;  4JLY A;  1SQH A;  1BOB A;  2OZH A;  4XPD C;  2VZY A;  3R96 A;  1BO4 A;  2FCK A;  3E0K A;  3OWC A;  2ZW4 A;  2P6E A;  4JXQ A;  2H5M A;  1M4D A;  1YX0 A;  4KOY A;  2PR8 A;  5IB0 A;  3UY5 A;  2EVN A;  4KZT A;  4ZBG A;  2C27 A;  4BMH A;  4FD6 A;  3LD2 A;  3TO9 A;  4HNY B;  3G3S A;  1MK4 A;  4Y49 C;  5F48 A;  1OZP A;  1M44 A;  3B8G A;  1YLE A;  3VWD A;  3S6G A;  1YVO A;  2VI7 A;  3F5B A;  4NEX A;  3R95 A;  3MGD A;  3R9E A;  2ZW6 A;  2B4B A;  2I00 A;  1B6B A;  4AG7 A;  2JLM A;  3EXN A;  4KVM E;  2Q04 A;  2P6F A;  2FIA A;  4F6A A;  3PZJ A;  2WPX A;  2B3V A;  2I79 A;  3FYN A;  4CAV A;  4K30 A;  1R57 A;  1L0C A;  2QEC A;  3FXT A;  1Z9U A;  2ZXV A;  4U9Y A;  1KZF A;  3ZZI A;  1IIC A;  4UWJ A;  1IB1 E;  2B3U A;  4KLW A;  4NCZ A;  2OZG A;  2G3T A;  2QIR A;  1I12 A;  4NXY A;  2HQY A;  3JUW A;  4HNX B;  3ZJ0 A;  2WPW A;  4LX9 A;  1Z4E A;  2Z10 A;  4XNH B;  4PV6 A;  4R87 A;  2B5G A;  3TOB A;  1J4J A;  4KVX A;  3WR7 A;  2ARH A;  4QBJ A;  1S3Z A;  1B87 A;  4IUS A;  2FIW A;  3SHP A;  1Q2Y A;  2Q4Y A;  1M4G A;  4B5P A;  2FL4 A;  2Z0Z A;  2FS5 A;  1IYK A;  4NSQ A;  4FD4 A;  4AVA A;  4QUS A;  4NF1 A;  3R9G A;  5J8C A;  4JD6 A;  4OLL A;  2J8M A;  2HUZ A;  3W6X A;  4EVY A;  1V0C A;  2JDC A;  2B4D B;  4ORF A;  4JXR A;  1XIX A;  3P2H A;  1YK3 A;  4M85 A;  2Q44 A;  1QSN A;  4E0A A;  5JPH A;  3W6S A;  4XNH C;  3V8I A;  2Q4V A;  4JJX A;  4M3S A;  2CY2 A;  5FVJ A;  2OZU A;  3IGR A;  3FIX A;  4YRH A;  5ISV A;  1CM0 A;  2AJ6 A;  3F8K A;  1VHS A;  3S6H A;  3N7Z A;  3I9S A;  2FT0 A;  4E8O A;  3CXS A;  3LOD A;  1S7L A;  2ZW7 A;  5HMN A;  2NMT A;  4HKF A;  2R1I A;  3TCV A;  4AG9 A;  1I21 A;  1I1D A;  1N71 A;  5H86 A;  5C88 A;  3DDD A;  4PSX A;  2G3A A;  5F47 A;  4KVO E;  2HV2 A;  2BL1 A;  1MJA A;  2VBQ A;  1K4J A;  2O28 A;  1GHE A;  2Z11 A;  2JEV A;  4FD7 A;  1PUA A;  4KOU A;  2PQ8 A;  5DWN A;  3BJ8 A;  1S5K A;  5F46 A;  3BJ7 A;  1NMT A;  4OAD A;  4QB9 A;  2FXF A;  1XEB A;  3D2P A;  1S60 A;  2VZZ A;  3TE4 A;  1M4I A;  1TIQ A;  4E2A A;  1U6M A;  5KTA A;  4MY3 A;  3S6K A;  1NE9 A;  1QSR A;  1KUV A;  1XE4 A;  2Q0Y A;  3DR6 A;  3FRM A;  1QSO A;  4AVC A;  3S6F A;  1S7F A;  1S7N A;  5EBV A;  4MI4 A;  3D2M A;  4F0Y A;  4MY0 A;  4HNW B;  3CXQ A;  2PDO A;  2AE6 A;  2VEZ A;  4H6Z A;  4CRZ B;  2EUI A;  2B58 A;  3SXN A;  2CNS A;  1KUY A;  4KOX A;  1NSL A;  1Y9W A;  1CJW A;  5KTD A;  2GE3 A;  3TOA A;  3DNS A;  4XPK A;  2REE A;  2R7H A;  4XPD B;  3RYO A;  2QML A;  3QAH A;  2ZPA A;  1FY7 A;  5I0C A;  5C82 A;  3R1K A;  3KKW A;  5F49 A;  2A4N A;  1YRE A;  3D8P A;  3W91 A;  3EFA A;  1QSM A;  4CRY B;  4R3L A;  1WWZ A;  2BEI A; 
#chains in the Genus database with same CATH topology
 4J3G A;  2POK A;  2ABZ A;  2CNT A;  3PGP A;  4PK2 A;  4PXE A;  4X2T A;  2OB0 A;  3QB8 A;  4A32 A;  4X5K A;  4UBR A;  2GU2 A;  3WC7 A;  2DPS A;  1NSA A;  1CPX A;  1JWQ A;  4AVB A;  4KOT A;  3PBB A;  4KOV A;  4A37 A;  2YNE A;  3D68 A;  2QVP A;  2ZEN A;  4CGL A;  2EK8 A;  5HVF A;  5THW A;  4R9M A;  3TC8 A;  3H4Q A;  2F7V A;  4F9U A;  5IX3 A;  8CPA A;  4PPZ A;  2P0W A;  4P10 A;  5K8P A;  3PP9 A;  2VQY A;  4PSW A;  3FB3 A;  3D67 A;  2FVG A;  3PBE A;  4UIA A;  4MHN A;  4KOS A;  3TTH A;  2D4P A;  1CG2 A;  2B4D A;  4AB7 A;  1YVK A;  4UA3 A;  1MJB A;  1VKC A;  1XMT A;  1Y0R A;  5IV0 A;  2J8N A;  1IU8 A;  4A31 A;  1IYL A;  1Z8L A;  4OP4 A;  3JTK A;  3TO6 A;  3TT2 A;  1XMB A;  1BPM A;  4A30 A;  2PJ2 A;  2AFS A;  4OME A;  3FX6 A;  3B3S A;  1VHE A;  5G22 A;  1XOV A;  2PIY A;  1LRZ A;  4CAF A;  4KUB A;  2D4O A;  3SI0 A;  2PVW A;  1M1D A;  4OC0 A;  2FSR A;  3LAC A;  4ZGY B;  1Y7R A;  3GIU A;  3EY5 A;  2ZEP A;  5H84 A;  3ISZ A;  2BUE A;  2J8R A;  4QC6 A;  2DEA A;  1P0H A;  3B3V A;  4OAE A;  5J8F A;  3I3G A;  5AG4 A;  1Z4R A;  2X7B A;  3T9Y A;  1RO5 A;  5K8N A;  4KOR A;  1ELL P;  2C1C A;  2F8H A;  4H89 A;  4ONW A;  4P4J A;  3G8W A;  4TNU A;  5F09 A;  2CTC A;  5LRJ A;  2IMO A;  3FED A;  4ZI6 A;  5JQ4 A;  4B13 A;  2JDD A;  3V38 A;  4JWP A;  4P4D A;  1P4N A;  4NGM A;  3EC4 A;  4IF5 A;  4U5Y A;  5KTC A;  4IK2 A;  1VHO A;  1YLO A;  4F9V A;  2ATR A;  2PC1 A;  1HDU A;  2AFZ A;  1Q2D A;  4DUK A;  3DSB A;  1PU9 A;  4MBU A;  2R98 A;  2PJ5 A;  2PCU A;  4YFJ A;  4LQG A;  3KQX A;  3T8W A;  4QVT A;  3HLP A;  2F5I A;  5G21 A;  5HH1 A;  1YME A;  2C6G A;  3R9F A;  4B14 A;  2PJ9 A;  3C26 A;  4MHD A;  1Q2C A;  1ZLH A;  1KUX A;  1QST A;  2HB6 A;  3L2N A;  5AGE A;  4ZY1 A;  2IL4 A;  3QAY A;  2PJC A;  1UWY A;  3T90 A;  2BSW A;  2ZW5 A;  2OR4 A;  3DR8 A;  3PB8 X;  5BWA B;  1F57 A;  1HEE A;  4RS2 A;  4XPL A;  3FBU A;  2OH1 A;  3EO4 A;  4ONU A;  1M4L A;  1XF8 A;  4H2K A;  4CAE A;  2PRB A;  4DNC A;  5LRK A;  7CPA A;  2G0B A;  1ON0 A;  4FWU A;  4KUA A;  3D3S A;  1S7K A;  2K5T A;  2AFO A;  1UFH A;  4UFX A;  5DWM A;  3VWE A;  5HVG A;  4Q7A A;  4MMO A;  2GIV A;  1VGY A;  2GLF A;  5LRG A;  4H6U A;  1LAM A;  4KOW A;  3SJG A;  4CAW A;  1MJ9 A;  3NFZ A;  4B5O A;  3DGV A;  2B5G B;  2CNM A;  6CPA A;  4II9 A;  5CBM A;  3KZW A;  4Q38 A;  4OC2 A;  4WWV A;  3SXO A;  3TO7 A;  4CAX A;  4CYN A;  2XEJ A;  4ZY0 A;  3PB6 X;  3B3C A;  2PJ6 A;  4PXB A;  3KQZ A;  5EMI A;  3CXP A;  4A38 A;  4I49 A;  4FD5 A;  4P44 A;  4OC3 A;  4C2Y A;  1IOI A;  3TFY A;  2PR1 A;  2ZEL A;  3GY9 A;  3NA6 A;  2R8V A;  2Y0M A;  1QMU A;  1Z8W A;  2BOA A;  4P4B A;  1JQG A;  2OU2 A;  4ZY2 A;  4B5P B;  1XBU A;  2PRQ A;  1YR0 A;  4UFW A;  4KSI A;  2BCO A;  3B3T A;  5ELY A;  4UF4 A;  1YGH A;  1IID A;  2P6G A;  4B12 A;  1YSJ A;  3FNC A;  3MN8 A;  4L8A A;  4MJ8 A;  2GLJ A;  2JBK A;  4NGP A;  2DXQ A;  4UWI A;  5CNP A;  2C6P A;  2FE7 A;  3P2F A;  4Y49 B;  3IU2 A;  3SJE A;  4GS4 A;  4C7I A;  4Z65 A;  2Z3N A;  4P4I A;  4CS0 B;  3JVN A;  2AFW A;  2Q7B A;  2KCW A;  3K2K A;  2Q51 A;  3B35 A;  4W9Y A;  4KLV A;  4FAI A;  2XEG A;  5E96 A;  1QQ9 A;  3GYA A;  4U9Z A;  2GAN A;  2RC4 A;  2IQ6 A;  2PSW A;  1LOK A;  2O53 A;  2WZN A;  4LUA A;  1AUG A;  2CIJ A;  4UCP A;  5G20 A;  4L89 A;  2REF A;  3NH8 A;  4MCR A;  1FT7 A;  1DTD A;  2Q43 A;  4R57 A;  4A33 A;  2ZED A;  5GCN A;  5EC4 A;  1TXR A;  1ZLI A;  4R3K A;  4UFV A;  2VXK A;  3K9U A;  3BXM A;  4OC5 A;  3F0A A;  3CDX A;  3NE7 A;  4RI1 A;  4OKO A;  1ZG7 A;  1BAV A;  4EFD A;  4YGO A;  1LCP A;  1RXT A;  3KL9 A;  3PRT A;  3IWG A;  1CP7 A;  3RO0 A;  4OC4 A;  4PK3 A;  1Y9K A;  1WK4 A;  1F2P A;  1LAP A;  2CXA A;  3BLN A;  3GKR A;  4JLY A;  1SQH A;  1R43 A;  1BOB A;  3NE8 A;  2OZH A;  4CYP A;  5A28 A;  4A95 A;  4MFZ A;  4MXU A;  4XPD C;  4Q36 A;  4BBH A;  1F2O A;  2VZY A;  2DF5 A;  3R96 A;  1BO4 A;  2FCK A;  3E0K A;  3OWC A;  4JYW A;  5JM6 A;  3D66 A;  2AFU A;  3IO1 A;  4EWT A;  2ZW4 A;  2P6E A;  1GYT A;  4WJB A;  4JXQ A;  2H5M A;  4A94 A;  5CPA A;  4UCN A;  1M4D A;  1IY7 A;  4MFL A;  3KGQ A;  4K3N A;  1YX0 A;  5D29 A;  4KOY A;  4DYO A;  2PR8 A;  5IB0 A;  3UY5 A;  2EVN A;  4KZT A;  4NGQ A;  4ZBG A;  4A2Z A;  2Z3P A;  2WYR A;  2C27 A;  1ZO0 A;  4FD6 A;  3LD2 A;  3TO9 A;  4BMH A;  2ZEF A;  3B3W A;  4HNY B;  3G3S A;  4P45 A;  4CGP A;  1ZG8 A;  1MK4 A;  4Y49 C;  1AYE A;  5F48 A;  1OZP A;  2PJ0 A;  3IFE A;  1M44 A;  3B8G A;  5AG7 A;  2IJZ A;  2YNC C;  1YLE A;  3VWD A;  3S6G A;  4ZX8 A;  3KAS A;  1TKF A;  4ZX9 A;  1YVO A;  4NJR A;  4O23 A;  2V8H A;  2VI7 A;  3F5B A;  3K9T A;  4G1P A;  2EWB A;  4NEX A;  4C68 A;  3R95 A;  3MGD A;  2ANP A;  3R9E A;  2ZW6 A;  2B4B A;  2ZEO A;  3D4U A;  1ZG9 A;  5HXD A;  1CPS A;  2I00 A;  1B6B A;  4MCQ A;  2ZEH A;  4NGR A;  2JLM A;  4X3R A;  3V7Z A;  3EXN A;  4AG7 A;  4UCM A;  2CF4 A;  4YU9 A;  1Z2L A;  4KVM E;  5A27 A;  4NJQ A;  1Y7E A;  2Q04 A;  2J9A A;  2FIA A;  2P6F A;  4F6A A;  2PJ7 A;  1H8L A;  3PZJ A;  4IHM A;  2PE3 A;  2NSM A;  4MHY A;  3RBU A;  3VAT A;  4CPA A;  2WPX A;  3SJX A;  1PCA A;  1R3N A;  5G1Z A;  2B3V A;  2I79 A;  2ZEM A;  3FYN A;  4A39 A;  3IEH A;  3QNV A;  4CAV A;  2Z3L A;  4K30 A;  1CX8 A;  1L0C A;  1R57 A;  2QEC A;  1Z9U A;  2ZXV A;  3FXT A;  1KZF A;  3H5Z A;  3GB0 A;  1IIC A;  3PB9 X;  4P6Y A;  4U9Y A;  4UWJ A;  1IB1 E;  1PYT B;  4F0X A;  2B3U A;  2Q7S A;  4KLW A;  4NCZ A;  2OZG A;  2G3T A;  3IIB A;  2QIR A;  4OC1 A;  4FUU A;  1I12 A;  4NXY A;  2HQY A;  3I1U A;  4UEE A;  4MRI A;  3JUW A;  4HNX B;  3ZJ0 A;  1BLL E;  2WPW A;  4UIB A;  2GFQ A;  2BO9 A;  2Z3O A;  3NH4 A;  1KWM A;  3A9L A;  2QJ8 A;  4MHP A;  2XEF A;  4LX9 A;  1Z4E A;  4R6T A;  2Z10 A;  3IWE A;  4CGM A;  4XNH B;  4PV6 A;  3CPA A;  4R87 A;  1XRY A;  3IJ3 A;  1X10 A;  1ARL A;  3ISX A;  2B5G A;  2WUU A;  3TOB A;  1J4J A;  2YGW A;  4KVX A;  3WR7 A;  2ZOG A;  3D7D A;  1A2Z A;  2PIZ A;  4X8I A;  3LWU A;  2ARH A;  2PJB A;  4QBJ A;  1S3Z A;  1LFW A;  1B87 A;  3FJU A;  2ZEE A;  4IUS A;  2FIW A;  3IC1 A;  3SHP A;  1X12 A;  4CYO A;  1Q2Y A;  5I4M A;  2Q4Y A;  1M4G A;  4B5P A;  5DS0 A;  2FL4 A;  2ODF A;  1Z5R A;  4KS9 A;  3H8F A;  2Z0Z A;  3WAB A;  3GLJ A;  2FS5 A;  3CZX A;  2RFH A;  1IYK A;  4NSQ A;  4PQA A;  4PXD A;  2I3C A;  3BHX A;  4PXC A;  4FD4 A;  3VAR A;  4RUH A;  1RTQ A;  1TF9 A;  2G9D A;  1IGB A;  2PVV A;  3RAM A;  4NGS A;  4AVA A;  4QUS A;  5AG6 A;  1FNO A;  4FBE A;  4NF1 A;  4NGN A;  2YNC A;  3FF3 A;  3R9G A;  4IAV A;  5J8C A;  4JD6 A;  3DLJ A;  4OLL A;  4B11 A;  1AMP A;  4EME A;  2J8M A;  2HUZ A;  3W6X A;  4EVY A;  1V0C A;  3FEC A;  2JDC A;  3S9N A;  3S9M A;  4MFK A;  2B4D B;  4GXH A;  3S9L A;  1TF8 A;  5LYI A;  2RB7 A;  3FEE A;  4JXR A;  4MFJ A;  3LMS A;  4ORF A;  4AXV A;  2Z3K A;  1XIX A;  1Q7L A;  3P2H A;  2C6C A;  3PB4 X;  2JEW A;  2JBJ A;  3RZA A;  3FMC A;  2PJ1 A;  4OID A;  1YK3 A;  4JZ0 A;  4M85 A;  2Q44 A;  1QSN A;  2CTB A;  4E0A A;  3SI1 A;  5JPH A;  5K8O A;  4M6G A;  3FH4 A;  3W6S A;  3MRU A;  3WC6 A;  1Y0Y A;  2V8D A;  4P4E A;  1ELM P;  3KHX A;  4XNH C;  3D7H A;  2Q4V A;  4JJX A;  1BPN A;  3V8I A;  2CY2 A;  4M3S A;  5FVJ A;  2OZU A;  3IGR A;  3FIX A;  4YRH A;  5ISV A;  1CM0 A;  1XFO A;  3GUX A;  3D7G A;  3BI1 A;  4C7H A;  5JH9 A;  2AJ6 A;  2YND A;  3F8K A;  4KSF A;  1LAN A;  1VHS A;  2AFX A;  4M6H A;  2OOT A;  4CGO A;  4GM5 A;  3S6H A;  3N7Z A;  2O4H A;  3I9S A;  2FT0 A;  4E8O A;  3CXS A;  4M6I A;  4ZYQ A;  2NYQ A;  3FVL A;  3LOD A;  4BIN A;  4C2Z A;  2VL1 A;  1S7L A;  2ZW7 A;  5IB9 A;  5HMN A;  2NMT A;  4NFR A;  4HKF A;  2R1I A;  4B6Z A;  3TCV A;  1CBX A;  4AG9 A;  1I21 A;  1VIX A;  4R76 A;  1I1D A;  1N71 A;  5H86 A;  5C88 A;  3DDD A;  4PSX A;  3PFO A;  2AFM A;  1YW6 A;  2G3A A;  5F47 A;  4KVO E;  2HV2 A;  3H8E A;  1XJO A;  2BL1 A;  5J1Q A;  1MJA A;  2VBQ A;  1K4J A;  2O28 A;  1GHE A;  3CT9 A;  2Z11 A;  2QYV A;  4P4F A;  5JGF A;  5D8N A;  5LYD A;  2JEV A;  4FD7 A;  1OBR A;  1PUA A;  2ZEG A;  4HPS A;  4KOU A;  2PQ8 A;  5DWN A;  3BJ8 A;  1S5K A;  5F46 A;  2PJA A;  1NMT A;  3BJ7 A;  4OAD A;  2EK9 A;  4QB9 A;  2FXF A;  1XEB A;  4DJL A;  3D2P A;  3PFE A;  4RN7 A;  1S60 A;  2VZZ A;  3TE4 A;  2V8V A;  1M4I A;  1TIQ A;  1EE3 P;  4C2X A;  1DE4 C;  4E2A A;  5K8M A;  1U6M A;  4R7M A;  5KTA A;  3B7I A;  1CP6 A;  4MY3 A;  1ARM A;  3S6K A;  3WC5 A;  1NE9 A;  2Q4Z A;  1QSR A;  3IU1 A;  1KUV A;  4LQ6 A;  1XE4 A;  3JRU A;  2Q0Y A;  3DR6 A;  3HUV A;  3KI9 A;  4MCP A;  3FRM A;  3KR5 A;  1QSO A;  2EO8 A;  2GRE A;  2V8G A;  4AVC A;  3CPX A;  3S6F A;  2EBJ A;  1S7F A;  4R8F A;  3WT4 A;  3RNZ A;  5HVH A;  3NH5 A;  1S7N A;  5EBV A;  1IOF A;  4MI4 A;  3D2M A;  2PJ3 A;  2PJ4 A;  4KSA A;  4MY0 A;  4YWY A;  4F0Y A;  2XEI A;  2DPT A;  3ZZI A;  5AG5 A;  3CXQ A;  4HNW B;  2PDO A;  2AE6 A;  2VEZ A;  2ZOF A;  4H6Z A;  4UEF A;  4CRZ B;  2EUI A;  2B58 A;  2PJ8 A;  3D7F A;  3KHZ A;  3SXN A;  2CNS A;  1KUY A;  3PEI A;  3TX8 A;  4KOX A;  1NSL A;  1Y9W A;  1CJW A;  5LYL A;  2HC9 A;  5KTD A;  3B2Y A;  2Z3M A;  2GE3 A;  4MHZ A;  4NGT A;  3TOA A;  1TKJ A;  1Z8X A;  3DNS A;  3SI2 A;  4XPK A;  2REE A;  2R7H A;  4XPD B;  3RYO A;  2QML A;  4OIW A;  3QAH A;  4MCS A;  2ZPA A;  4MFP A;  1TKH A;  1FY7 A;  5I0C A;  3PB7 X;  5C82 A;  3R1K A;  4B10 A;  4BD9 A;  3SJF A;  4CYQ A;  3KKW A;  5F49 A;  2A4N A;  2WSA A;  3BI0 A;  1Z8T A;  1YRE A;  3D8P A;  1YQE A;  3KR4 A;  4MFQ A;  3N5F A;  4UEZ A;  3W91 A;  4TWE A;  3EFA A;  3IWW A;  2V77 A;  5LYF A;  1QSM A;  4F8Z A;  1HDQ A;  3VH9 A;  4CGN A;  4CRY B;  4R3L A;  1YW4 A;  1WWZ A;  2BEI A;  3H8G A; 
#chains in the Genus database with same CATH homology
 4J3G A;  2CNT A;  3PGP A;  4PK2 A;  2OB0 A;  3QB8 A;  4A32 A;  4X5K A;  4UBR A;  2DPS A;  4AVB A;  4KOT A;  4KOV A;  2YNE A;  4CGL A;  4R9M A;  3H4Q A;  5IX3 A;  2P0W A;  3PP9 A;  2VQY A;  4PSW A;  3FB3 A;  4KOS A;  3TTH A;  2D4P A;  4AB7 A;  2B4D A;  1YVK A;  4UA3 A;  1MJB A;  1VKC A;  1XMT A;  5IV0 A;  2J8N A;  4A31 A;  1IYL A;  3JTK A;  3TO6 A;  3TT2 A;  4A30 A;  5G22 A;  1LRZ A;  4CAF A;  4KUB A;  2D4O A;  1M1D A;  2FSR A;  4ZGY B;  1Y7R A;  3EY5 A;  5H84 A;  2BUE A;  2J8R A;  4QC6 A;  1P0H A;  4OAE A;  5J8F A;  3I3G A;  5AG4 A;  1Z4R A;  2X7B A;  3T9Y A;  1RO5 A;  4KOR A;  4H89 A;  3G8W A;  5JQ4 A;  4B13 A;  2JDD A;  4JWP A;  1P4N A;  3EC4 A;  4IF5 A;  4U5Y A;  5KTC A;  2ATR A;  2PC1 A;  1Q2D A;  3DSB A;  1PU9 A;  4MBU A;  2R98 A;  4YFJ A;  4QVT A;  2F5I A;  5G21 A;  5HH1 A;  3R9F A;  4B14 A;  3C26 A;  4MHD A;  1Q2C A;  1KUX A;  1QST A;  5AGE A;  2IL4 A;  3T90 A;  2BSW A;  2ZW5 A;  3DR8 A;  5BWA B;  4XPL A;  4RS2 A;  3FBU A;  2OH1 A;  3EO4 A;  4ONU A;  1XF8 A;  4CAE A;  2PRB A;  4DNC A;  2G0B A;  1ON0 A;  4KUA A;  3D3S A;  1S7K A;  2K5T A;  1UFH A;  4UFX A;  3VWE A;  5DWM A;  2GIV A;  4CAW A;  4H6U A;  4KOW A;  1MJ9 A;  4B5O A;  2B5G B;  2CNM A;  4II9 A;  3SXO A;  4Q38 A;  3TO7 A;  4CAX A;  4CYN A;  3CXP A;  4I49 A;  4FD5 A;  4C2Y A;  3TFY A;  2PR1 A;  3GY9 A;  2R8V A;  2Y0M A;  4B5P B;  2OU2 A;  1YR0 A;  4UFW A;  1YGH A;  1IID A;  2P6G A;  4B12 A;  3FNC A;  4L8A A;  4MJ8 A;  2DXQ A;  4UWI A;  5CNP A;  2FE7 A;  3P2F A;  4Y49 B;  3IU2 A;  4GS4 A;  4C7I A;  2Z3N A;  4CS0 B;  3JVN A;  2Q7B A;  2KCW A;  4KLV A;  5E96 A;  3GYA A;  4U9Z A;  2GAN A;  2RC4 A;  2PSW A;  4LUA A;  4UCP A;  5G20 A;  4L89 A;  2REF A;  4A33 A;  4R57 A;  5GCN A;  5EC4 A;  4R3K A;  4UFV A;  2VXK A;  3K9U A;  3F0A A;  3NE7 A;  4RI1 A;  4YGO A;  1RXT A;  3IWG A;  4PK3 A;  1Y9K A;  1WK4 A;  2CXA A;  3BLN A;  3GKR A;  4JLY A;  1SQH A;  1BOB A;  2OZH A;  4CYP A;  5A28 A;  4A95 A;  4MFZ A;  4XPD C;  4Q36 A;  4BBH A;  2VZY A;  3R96 A;  1BO4 A;  2FCK A;  3E0K A;  3OWC A;  2ZW4 A;  2P6E A;  4JXQ A;  2H5M A;  4UCN A;  1M4D A;  4MFL A;  1YX0 A;  4KOY A;  2PR8 A;  5IB0 A;  3UY5 A;  2EVN A;  4KZT A;  4ZBG A;  4A2Z A;  2Z3P A;  2C27 A;  1ZO0 A;  4FD6 A;  3LD2 A;  3TO9 A;  4BMH A;  4HNY B;  3G3S A;  4CGP A;  1MK4 A;  4Y49 C;  5F48 A;  1OZP A;  1M44 A;  3B8G A;  5AG7 A;  2YNC C;  1YLE A;  3VWD A;  3S6G A;  1YVO A;  2VI7 A;  3F5B A;  4NEX A;  4C68 A;  3R95 A;  3MGD A;  3R9E A;  2ZW6 A;  2B4B A;  2I00 A;  1B6B A;  4AG7 A;  2JLM A;  3EXN A;  4UCM A;  4KVM E;  5A27 A;  2Q04 A;  2P6F A;  2FIA A;  4F6A A;  3PZJ A;  2WPX A;  5G1Z A;  2B3V A;  2I79 A;  3FYN A;  4CAV A;  2Z3L A;  4K30 A;  1R57 A;  1L0C A;  2QEC A;  3FXT A;  1Z9U A;  2ZXV A;  3H5Z A;  1KZF A;  4U9Y A;  3ZZI A;  1IIC A;  4F0X A;  4UWJ A;  1IB1 E;  2B3U A;  4KLW A;  4NCZ A;  2OZG A;  2G3T A;  2QIR A;  1I12 A;  4NXY A;  2HQY A;  3JUW A;  4HNX B;  3ZJ0 A;  2WPW A;  2Z3O A;  3A9L A;  4LX9 A;  1Z4E A;  2Z10 A;  3IWE A;  4CGM A;  4XNH B;  4PV6 A;  4R87 A;  2B5G A;  2WUU A;  3TOB A;  1J4J A;  2YGW A;  4KVX A;  3WR7 A;  2ARH A;  4QBJ A;  1S3Z A;  1B87 A;  4IUS A;  2FIW A;  3SHP A;  4CYO A;  1Q2Y A;  2Q4Y A;  1M4G A;  4B5P A;  2FL4 A;  4KS9 A;  2Z0Z A;  2FS5 A;  1IYK A;  4NSQ A;  4FD4 A;  4AVA A;  4QUS A;  5AG6 A;  4NF1 A;  2YNC A;  3R9G A;  5J8C A;  4JD6 A;  4OLL A;  4B11 A;  2J8M A;  2HUZ A;  3W6X A;  4EVY A;  1V0C A;  2JDC A;  4MFK A;  2B4D B;  4ORF A;  4JXR A;  4MFJ A;  2Z3K A;  1XIX A;  3P2H A;  1YK3 A;  4M85 A;  2Q44 A;  1QSN A;  4E0A A;  5JPH A;  3W6S A;  4XNH C;  3V8I A;  2Q4V A;  4JJX A;  2CY2 A;  4M3S A;  5FVJ A;  2OZU A;  3IGR A;  3FIX A;  4YRH A;  5ISV A;  1CM0 A;  4C7H A;  2AJ6 A;  2YND A;  3F8K A;  4KSF A;  1VHS A;  3S6H A;  3N7Z A;  3I9S A;  2FT0 A;  4E8O A;  3CXS A;  3LOD A;  4C2Z A;  1S7L A;  2ZW7 A;  5HMN A;  2NMT A;  4HKF A;  2R1I A;  3TCV A;  4AG9 A;  1I21 A;  1I1D A;  1N71 A;  5H86 A;  5C88 A;  3DDD A;  4PSX A;  2G3A A;  5F47 A;  4KVO E;  2HV2 A;  2BL1 A;  1MJA A;  2VBQ A;  1K4J A;  2O28 A;  1GHE A;  2Z11 A;  2JEV A;  4FD7 A;  1PUA A;  4KOU A;  2PQ8 A;  5DWN A;  3BJ8 A;  1S5K A;  5F46 A;  3BJ7 A;  1NMT A;  4OAD A;  4QB9 A;  2FXF A;  1XEB A;  3D2P A;  1S60 A;  2VZZ A;  3TE4 A;  1M4I A;  1TIQ A;  4C2X A;  4E2A A;  1U6M A;  5KTA A;  4MY3 A;  3S6K A;  1NE9 A;  1QSR A;  3IU1 A;  1KUV A;  1XE4 A;  2Q0Y A;  3DR6 A;  3FRM A;  1QSO A;  4AVC A;  3S6F A;  1S7F A;  1S7N A;  5EBV A;  4MI4 A;  3D2M A;  4F0Y A;  4KSA A;  4MY0 A;  2DPT A;  5AG5 A;  4HNW B;  3CXQ A;  2PDO A;  2AE6 A;  2VEZ A;  4H6Z A;  4CRZ B;  2EUI A;  2B58 A;  3SXN A;  2CNS A;  1KUY A;  4KOX A;  1NSL A;  1Y9W A;  1CJW A;  5KTD A;  2Z3M A;  2GE3 A;  3TOA A;  3DNS A;  4XPK A;  2REE A;  2R7H A;  4XPD B;  3RYO A;  2QML A;  3QAH A;  2ZPA A;  4MFP A;  1FY7 A;  5I0C A;  5C82 A;  3R1K A;  4B10 A;  4CYQ A;  3KKW A;  5F49 A;  2A4N A;  2WSA A;  4CGO A;  1YRE A;  3D8P A;  4MFQ A;  3W91 A;  3EFA A;  1QSM A;  4CGN A;  4CRY B;  4R3L A;  1WWZ A;  2BEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...